Documentos de Académico
Documentos de Profesional
Documentos de Cultura
Cinta colectora
GSSF 2000 x 47,7
Shougang Hierro II
2-492-20980
Copyright, también para componentes. Todos los derechos reservados incluyendo los de la traducción. Este
documento no puede ser proceso, reproducido ni difundido de alguna manera, sea totalmente o en partes sin
nuestro consentimiento escrito, tampoco bajo el empleo de sistemas electrónicos.
1.3 Definiciones - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -1 - 3
2 Datos técnicos - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -2 - 1
3.1 Principios - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -3 - 1
3.3 Personal - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -3 - 2
4.4 Accionamiento - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 4 - 6
7 Conservación - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 7 - 1
7.3 Reparaciones - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 7 - 14
7.3.1 Sustitución del tambor tensor con ganchos C. - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 7 - 14
7.3.2 Sustitución del tambor tensor sin ganchos C - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 7 - 16
7.3.3 Sustitución del tambor de accionamiento - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 7 - 22
11/2013 Rev 0
8 Lubricación - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 8 - 1
9 ANEXO - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 9 - 1
9.1 Dibujos
9.2 Accionamiento
PALABRA DE SEÑALIZACIÓN
Tipo del peligro y su fuente
Distinguido Cliente:
ThyssenKrupp Resource Technologies ha elaborado este manual de montaje y operación
para que sea leído y observado en todos sus puntos por todos aquellos encargados del
transporte, del montaje, de la puesta en operación, del mantenimiento así como del
desechamiento de materiales adicionales para la producción. Sólo cuando las personas
encargadas de la máquina conozcan este manual de montaje y operación se pueden evi-
tar errores al operar la máquina/instalación garantizando de este modo un funcionamiento
libre de averías.
Junto a ello son válidas las condiciones de garantía y responsabilidad de las condiciones
generales comerciales de ThyssenKrupp Resource Technologies.
Para esta documentación nos reservamos todos los derechos, también para el caso de
otorgamiento de patentes o registros de modelos de utilidad. Esta no puede ser reprodu-
cida ni permitido su acceso a terceros o ser empleado inapropiadamente de otro modo
sin nuestra conformidad previa por escrito.
ATENCIÓN
Empleo de repuestos no-originales
Una reserva de las piezas de repuesto y desgaste más importantes es una condición para
un funcionamiento y disponibilidad de servicio permanentes de la máquina / instalación.
Para el pedido de repuestos sírvase por favor de la lista de repuestos. Más información
sobre las piezas de repuesto se puede obtener de los dibujos de dichas piezas que son
parte de esta documentación.
Sólo asumimos una garantía para los repuestos originales suministrados por nuestra par-
te.
Por favor, observe que para las piezas propias y de terceros frecuentemente existen es-
pecificaciones especiales de fabricación y suministro.
11/2013 Rev 0
11/2013 Rev 0
Datos básicos
Datos de prestaciones
Ilustración 1
11/2013 Rev 0
Modelo:
Electrónica de evaluación:
Modelo:
11/2013 Rev 0
11/2013 Rev 0
Ilustración 2
11/2013 Rev 0
3.1 Principios
• Estas disposiciones de seguridad deben ser leídas y aplicadas por todas aquellas
personas encargadas con el transporte, la instalación, la puesta en marcha, el
servicio, la conservación así como la eliminación de productos de servicio y
auxiliares. El gestionador del personal debe hacerse confirmar mediante la firma de
la toma de conocimientos de las normas de seguridad.
• ¡En caso de cambios que aparezcan en la máquina/ planta que sean relevantes para
la seguridad o su funcionamiento, ésta debe ser inmediatamente puesta fuera de
funcionamiento y se debe dar aviso al departamento respectivo!
3.3 Personal
• El personal no puede llevar cabellos largos sueltos, ropa holgada o joyas incluyendo
anillos. Existe peligro de lesiones p.ej. por ser atrapado o arrastrado.
• Los trabajos en la máquina / instalación sólo pueden ser ejecutados por personal
fiable. ¡Observar la edad mínima admisible legalmente!
Dependiendo del material a ser procesado en cada caso se generan emisiones de ruidos
que recién pueden ser medidos durante el servicio. El gestionador debe asegurar que
inmediatamente tras la puesta en marcha se mida el nivel de presión acústica en todas
las posiciones de mando (p.ej. para mantenimiento y control, puesto de control).
NOTA
Directiva 2003/10/CE del Parlamento Europeo y del Consejo del 6.2.2003 (17º
Directiva individual en el sentido del artículo 16 párrafo 1 de la Directiva 89/391/
CEE).
Si los riesgos relacionados con una nocividad por ruido no se pueden evitar
tomando otras medidas, se debe poner a disposición de los empleados una
protección del oído apropiada e individualmente adaptada, la cual los empleados
están obligados a utilizar.
• Las unidades y grupos constructivos que durante el servicio se calientan con más
intensidad en función de las solicitaciones eléctricas y/o mecánicas tiene que ser
vigiladas por el personal responsable. Esto vale p.ej. para compresores, engranajes,
cojinetes, motores, grupos de aceite / hidráulicos.
PELIGRO
Peligro de lesiones por operación de la máquina / instalación con
modificaciones, reformas o repuestos no autorizados
ATENCIÓN
Daños en la instalación por empleo de la máquina / instalación no conforme
a la finalidad prevista
Véase Ilustración 3
11/2013 Rev 0
Ilustración 3
El mineral triturado por el triturador llega a través de la corredera de agujas (219) a través
del resbaladero de transferencia (20) a la cinta de evacuación. La zapata de alimentación
(14) sirve para guiar y apaciguar al material.
La cinta transportadora (8) del transportador se desplaza sobre ruedas portadoras (9-13),
que están sujetas mediante soportes al bastidor de la cinta. La cinta transportadora es
reenviada en el tambor de accionamiento (5) y el tambor tensor (7).
Para provocar el cierre por fricción, la cinta transportadora se tensa mediante la unidad
tensora (6) por husillos tensores y cilindros hidráulicos.
Dos rascadores de cabezal previo (18) separan material adherido en el área del tambor
de accionamiento del lado exterior de la correa transportadora.
Un rascador de arado (17) se encuentra delante del tambor tensor y separa material
adherido del lado interior de la correa transportadora.
Los listones del guiado de material (15) dispuestos sobre la correa transportadora, cuidan
de que ningún material caiga lateralmente de la correa transportadora.
11/2013 Rev 0
Ilustración 3
Véase Ilustración 4
El engranaje de ruedas dentadas cónicas (1) está equipado con una sistema
antirretroceso (4). El sistema antirretroceso (4) incorporado evita que la cubierta de la
cinta transportadora retroceda durante el tiempo de parada.
11/2013 Rev 0
Ilustración 4
11/2013 Rev 0
Proteger del calor Proteger de la humedad ¡Precaución! ¡Vidrio! Este lado arriba
PELIGRO
Peligro de lesiones por transporte inadecuado de la máquina / instalación
ATENCIÓN
Peligro de daños en la instalación por transporte inadecuado de la máquina
/ instalación
Después que se haya realizado el suministro a la zona de trabajo, se deben revisar todas
11/2013 Rev 0
las partes para determinar si estas han sufrido algún daño durante el transporte.
ADVERTENCIA
Peligro de lesiones por componentes asegurados de forma inapropiada
durante el montaje
5.2.2 Elevar
NOTA
Antes de la elevación de cargas pesadas aplicar una calda de pesaje para
comprobación de la carga.
• En caso de dudas con relación a los siguientes puntos consultar el jefe de montaje
responsable:
– método de fijación correcto,
– el espesor seleccionado del elemento de sujeción,
– el tipo del elementos de sujeción.
• Tras fijar el elemento de sujeción apretar este a mano lo más fuerte posible. Si el
elemento de sujeción tiene que ser apretado con una grúa, observar que ninguna
parte del cuerpo quede entre la carga y el elemento de sujeción y observar una
postura correcta de manos y dedos.
11/2013 Rev 0
Después que el peso de la carga haya sido asumido completamente por el elemento
de elevación y la carga se haya elevado un poco:
• Comprobar el freno de la carga.
• Comprobar nuevamente si la carga está asegurada en todos los puntos.
• Transportar la carga en lo posible sobre áreas libres.
• Dar señales de advertencia ante personas en la zona de peligro.
Asentar la carga:
• Asentar la carga lentamente sobre una base adecuadamente estable. Nivelar una
vez más la base antes de asentar.
• Quitar el elemento de elevación de la carga y comprobar la presencia de daños en
ambos.
11/2013 Rev 0
Ángulo de carga Capacidad de carga carga máx. admisible por tramo con
% relación a 1000 kg
– vibración
– corrosión
Colocar las grapas de cables metálicos de tal manera, que la parte inferior de la grapa (6)
sea presionado contra el extremo largo (5) del cable y el yugo de la grapa (2) contra el
extremo muerto (4) del cable. Aplicar siempre un guardacabos (1). La cantidad correcta
de grapas y la distancia (3) entre ellas está indicada en la siguiente tabla.
Apretar las tuercas de sujeción con los pares de apriete indicados.
Una vez puesto en servicio el cable y se encuentra bajo tensión, apretar nuevamente las
tuercas de sujeción. Comprobar regularmente las tuercas de sujeción y en caso necesario
apretarlas. De esta manera se compensa la dilatación del cable y la reducción del radio
del mismo ligado a ello.
Diámetro del cable Diámetro del yugo de Distancia entre grapas Cantidad mínima
grapado necesaria de grapas
Empleo:
Las cadenas de sujeción están constituidas de aleación de acero y son más robustas así
como más flexibles que cables de sujeción, sin embargo con relación a cargas de impacto
no son tan resistentes como los cables. El espesor de una cadena se determina con
relación al diámetro (1) de un eslabón de cadena.
• Proteger las cadenas de sujeción contra esquinas y bordes filosos que puedan
deformar los eslabones de la cadena. Emplear tablas apropiadas flexibles o
instalaciones metálicas de protección de esquinas.
11/2013 Rev 0
5.2.6 Gancho
La capacidad de carga admisible que se reduce a través del ángulo de la carga, continúa
reduciéndose por el empleo de cáncamos roscados.
Un cáncamo roscado con talón, que p. ej. se emplea en un ángulo de 45°, sólo puede ser
cargado con hasta el 10 % de la carga admisible para el servicio de elevación vertical.
Diámetro del Servicio de Tracción con 60° al Tracción con 45° al Tracción a 90° o
vástago elevación vertical nivel del talón nivel del talón tracción lateral
suelta
3/4 19,3 3000 1361 400 181 250 113 300 136
1-1/4 31,8 9000 4082 1300 590 800 363 900 408
1-1/2 38,1 13000 5897 1800 816 1200 544 1300 590
2-1/2 63,5 37000 16783 6000 2722 3500 1724 4300 1950
11/2013 Rev 0
5.2.8 Grilletes
PELIGRO
Peligro por empleo de medios de sujeción erróneos
• Si se emplean los grilletes con otros ángulos de carga que 90°, la capacidad de
carga admisible está reducida; véase tabla:
Diámetro Grillete individual Dos grilletes 60° Dos grilletes 45° Dos grilletes 30°
vertical
1/4 6,4 1/3 0,3 3/4 0,7 1/2 0,5 1/3 0,3
1-1/8 28,6 6-1/2 5,9 11-1/2 10,5 9-1/2 8,5 6-1/2 5,9
• Asegurar que la base tenga una superficie estable y nivelada y que pueda soportar
el peso total de la carga. Emplear únicamente madera dura con sección (aprox.)
cuadrada como base.
• Proteger superficies mecanizadas mediante acolchado de la base, p. ej. con
arpilleras, cartón prensado o correas.
• Emplear cuñas para evitar un rolado o movimiento de las cargas (p. ej. mangos,
piezas forjadas redondas y anillos). Al emplear cuñas etc. cuidar las manos para que
estas no sean aplastadas en un movimiento de la carga.
• Al emplear varios soportes como bases, utilizar sólo soportes de la misma altura.
• Ubicar los soportes debajo de las cargas, de manera que estén alineados de forma
estable y nivelada. No emplear soportes que estén redondeadas por los bornes,
sean frágiles o estén dañados.
11/2013 Rev 0
ATENCIÓN
Peligro de daños en la instalación por almacenaje / montaje inadecuado de
la máquina / instalación
• En caso que la máquina / instalación tenga que ser almacenada, esta debe
permanecer en el estado de suministro. El fabricante no se responsabiliza por
daños causados por un montaje repetido inapropiado de la máquina/instalación.
ATENCIÓN
Peligro de daños en la instalación por almacenaje inadecuado de la
máquina / instalación
Todas las superficies no pintadas deben ser protegidas con una capa de anticorrosivo.
El área de almacenamiento debe estar limpio, sin polvo y libre de cualquier contaminante.
Proteja las piezas de plástico o de goma de la radiación solar directa. Los equipos deben
ser almacenados a una temperatura de + 5 °C como mínimo y a + 45 °C como máximo.
Proteja el equipo de contaminación con grasa o aceite. Normalmente se suministran las
piezas de goma como las cintas de los transportadores de cinta cóncava y de las cintas
de filtro y de los filtros de cinta al vacío, en bobinas. Deposite las bobinas en posición
vertical y no en posición horizontal. No deposite las bobinas directamente en el suelo.
Almacene las bobinas verticalmente y en suelo firme, protegiéndolas contra la humedad
por medio de paletas. No está permitido apilar las bobinas.
El almacenaje debe llevarse acabo rigurosamente en una base como maderos, paletas o
algo similar, preferentemente en una superficie de base plana, drenada y con grava. Evite
el contacto con las aguas superficiales y el suelo. Almacene todas las piezas de tal modo
que no se acumule agua sobre ellas.
Las marcas puestas en cada pieza deben ser legibles sin tener la necesidad de moverlas.
En caso que se acumule agua sobre las marcas en la superficie de la pieza, marque
nuevamente la pieza en un lugar adecuado.
11/2013 Rev 0
Proteja las piezas que no deben ser expuestas a la radiación solar directa, así como
también aquellas que no deben ser expuestas a la lluvia debido a la superficie
mecanizada, la junta de goma o de plástico instalada, los orificios de ventilación o algo
similar.
El almacenaje debe llevarse acabo rigurosamente en una base como maderos, paletas o
algo similar, preferentemente en una superficie de base plana, drenada y con grava. Evite
el contacto con las aguas superficiales y el suelo.
Ejemplos:
– Tornillos/ tuercas para el montaje de la corona dentada
– Tornillos de anclaje
– Todo tipo de máquinas e instrumentos de medida
– Tubos para componentes hidráulicos, lubricación de la corona dentada
– Interruptores, Centro de control del motor (MCC = motor control center)
– Transmisor, control de la frecuencia
– Distribuidor para unidades hidráulicas y para unidades de lubricación
– Bolsas de filtro para colectores de polvo con las correspondientes válvulas
magnéticas
11/2013 Rev 0
Los motores que aún no estén montados en la máquina deben permanecer en las cajas
originales.
El área de almacén no debe estar expuesta a vibraciones.
Rodamientos:
– Rodamientos de bolas y rodillos (rodamientos relubricables). Engrase los
rodamientos por completo antes de almacenarlos por un largo tiempo. Una vez al
mes gire los ejes principales y añada grasa para rodamientos. Gire manualmente el
eje, antes de la puesta en servicio.
– Bolas (rodamiento, no relubricables). No hay que tomar medidas adicionales para
este tipo de rodamiento.
Todos los drenajes deben estar operativos y/o se deben quitar los tornillos de drenaje.
Los motores deben ser almacenados de tal modo que los orificios de drenaje se
encuentren en la parte más baja posible. Todas las válvulas de respiración y los canales
de descarga automáticos con tornillos de seguridad-T deben estar operativos de tal modo
que la respiración se realice de otro modo y no a través de los asientos del rodamiento.
Todas las partes externas y los motores con peligro de corrosión deben ser protegidos
mediante una capa anticorrosiva.
11/2013 Rev 0
5.3.3.2 Engranajes
En caso que se almacenen motores reductores como por ejemplo SEW, el lubricante de
este engranaje debe ser mezclado con un anticorrosivo VCI (volatile corrosion inhibitors).
Algunos engranajes son suministrados con un nivel alto de aceite para un almacenaje de
largo plazo.
El tiempo máximo de almacenaje es de 3 años, además de una inspección regular según
la documentación adjunta del fabricante.
ATENCIÓN
Daños en engranajes por almacenamiento inadecuado de la máquina
Accionamientos DC:
– Los motores de accionamiento han sido diseñados de manera cerrada. Asegúrese
de que las cubiertas estén cerradas de manera estanca.
Cuide de una temperatura entre + 5 °C y + 45 °C.
– Carcasa de accionamiento y estación de mando -- La carcasa y la estación de
mando deben ser mantenidas secas con material secante. Asegúrese que ambas
estén cerradas. En caso de haber recortado algunos orificios, ciérrelos con un medio
de obturación para obturar canales o bien una cinta adhesiva industrial.
Cuide de una temperatura entre + 5 °C y + 45 °C.
Válvulas de control:
Las condiciones de almacenaje normales son válidas para todos los productos. "Normal"
significa que los equipos se encuentren almacenados en condiciones sin exceso de calor
o frío (temperatura de almacenaje de + 5 °C a + 45 °C) en ambientes secos y protegidos
contra el polvo. No apile otros productos encima de ellos.
Correas y empaquetaduras:
11/2013 Rev 0
Los aditivos VCI se usan para el acero, hierro, cromo, hierro fundido y aluminio. Además
existen aditivos VCI especiales para el cobre y sus aleaciones. El proceso de VCI no se
puede usar para la conservación de zinc, estaño, cadmio, magnesio, plomo y sus
correspondientes aleaciones.
Si las condiciones del lugar de emplazamiento requieren una desviación respecto al plano
de emplazamiento, deberá consultarse a ThyssenKrupp Resource Technologies.
11/2013 Rev 0
ADVERTENCIA
Peligro por el empleo de personal no capacitado así como medios de
trabajo no adecuados a la seguridad
• En caso de tener que realizar trabajos de montaje por encima de la altura del
cuerpo, use plataformas o medios de ascenso previstos para el caso u otros
medios que cumplan con las exigencias de seguridad respectivas. ¡Nunca use
partes de la máquina como medios de ayuda para subir! En caso de tener que
realizar trabajos de mantenimiento a una altura considerable utilice medios de
seguridad contra caídas.
ADVERTENCIA
11/2013 Rev 0
• Trabajos en los sistemas o equipos eléctricos sólo deben ser realizados por
personal especializado en la materia o personal instruido bajo la dirección y
supervisión de un especialista de acuerdo a las reglas de la electrotécnica.
NOTA
¡El fabricante no asume ninguna responsabilidad por daños que resulten de un
montaje incorrecto de la máquina!
NOTA
La secuencia de enumeración de estos grupos constructivos corresponde a la
secuencia de montaje.
ADVERTENCIA
Peligro de lesiones por transporte y montaje inadecuados
ADVERTENCIA
Peligro de lesiones por trabajos de montaje a gran altura
• En caso de tener que realizar trabajos de montaje por encima de la altura del
cuerpo, use plataformas o medios de ascenso previstos para el caso u otros
medios que cumplan con las exigencias de seguridad respectivas.
ADVERTENCIA
Peligro de lesiones por trabajos en instalaciones eléctricas
Los trabajos en las instalaciones y medios de servicio eléctricos sólo pueden ser
realizados por un profesional electricista o personal instruido bajo la dirección y
supervisión de un profesional electricista de acuerdo a las reglas de la
electrotécnica.
NOTA
¡El fabricante no asume ninguna responsabilidad por daños que resulten de un
montaje incorrecto de la máquina!
Para llevar a cabo de manera correcta dichos trabajos es muy importante una
buena selección de las herramientas y equipos necesarios así como el personal
de montaje.
Se recomienda que el especialista en montajes de ThyssenKrupp Resource
Technologies controle los trabajos de principio a fin.
Una precondición para la garantía es que el montaje final y la comprobación del
montaje se realice por un especialista en montaje de ThyssenKrupp Resource
Technologies.
ATENCIÓN
Daños en la instalación por marcha oblicua incontrolada de la cinta
transportadora
11/2013 Rev 0
Ilustración 5
Este apartado describe los tipos de soporte de rodillos sobre los cuales marcha la correa
transportadora.
Véase Ilustración 6
Los rodillos portantes están constituidos de tres rodillos de longitud similar así como de
la estación de rodillos.
Todos los rodillos disponen de una tubería especial en los que han sido prensados y
soldados los extremos de cojinetes embutidos , lo que posibilita una marcha suave e
impide un desequilibrado.
Los rodamientos están obturados por el lado interior a través de una arandela obturadora,
para que no pueda fugar grasa del rodamiento al interior del rodillo.
Ilustración 6
Véase Ilustración 7
Rodillos de choque son rodillos portantes con aros de goma adicionales para acolchado
de los rodillos.
11/2013 Rev 0
Los rodillos de choque están dispuestos sobre elementos elásticos de elastómero, lo que
reduce el impulso de choque de la caída de material.
Los rodillos están unidos entre sí con un perfil de acero, para evitar un vuelco de la
estación de rodillos.
Véase Ilustración 8
Ilustración 8
Véase Ilustración 9
Ilustración 9
En los puntos de contacto con la cinta transportadora se han dispuesto listones de guía
(1) con juntas de goma (2) regulables. Las juntas de goma impiden la caída de material.
• Atornillar los listones de guía (1) en los apoyos laterales (3) del bastidor de la cinta.
• Ajustar la altura de los listones de goma (2).
Ilustración 10
11/2013 Rev 0
Ilustración 11
11/2013 Rev 0
Véase Ilustración 12
• Montar y ajustar el rascador previo al cabezal (2) en el tambor de accionamiento (1).
• Lea la documentación del fabricante en ANEXO 9.5 "Rascador B6C".
Ilustración 12
11/2013 Rev 0
Ilustración 13
11/2013 Rev 0
Véase Ilustración 14
• Instalar un termómetro de resistencia en cada una de ambas carcasas de cojinetes
del tambor tensor en las perforaciones (1).
• Instalar un termómetro de resistencia en cada una de ambas carcasas de cojinetes
del tambor de accionamiento en las perforaciones (2).
11/2013 Rev 0
Ilustración 14
ATENCIÓN
Daños en la instalación por cinta transportadora montada erróneamente
ATENCIÓN
Daños en la instalación por tensado erróneo de la cinta transportadora
Para tensar la correa transportadora sirven dos cilindros hidráulicos (3). Estos se sujetan
en placas de soporte (2) y presionan sobre ambas carcasas de cojinetes (4) en el tambor
tensor. Las placas de soporte (2) se encajan y atornillan arriba y abajo en las ranuras de
dos carriles (1).
Para la presurización de los cilindros hidráulicos se suministra una bomba de mano (8) y
tubos flexibles.
El tensado se realiza en varios pasos, porque la carrera de los cilindros hidráulicos (3)
solo es reducida. Entre los pasos se deben desplazar los cilindros hidráulicos.
Antes del tensado se desenroscan las tuercas (7) de los husillos tensores (5) hasta que
los husillos tensores puedan desplazarse dentro de las placas de soporte (6).
A continuación de montan las placas de soporte (2) con los cilindros hidráulicos (3) a
ambos lados del tambor de tensado en los posible cerca de las carcasas de cojinetes (4).
11/2013 Rev 0
Con la bomba de mano (8) se extraen los cilindros hidráulicos (3) y de ese modo se
empuja el tambor tensor.
Ahora se montan desplazadas las placas de soporte (6) de los husillos tensores (5) y se
aprietan las tuercas (7) de los husillos tensores para mantener el tambor tensor en esta
posición.
A continuación se sueltan nuevamente las tuercas (7) de los husillos tensores (5) y se
desenroscan para que el husillo tensor seas desplazable para el segundo procedimiento
de tensado.
Estos pasos, descritos hasta aquí, se ejecutan sucesivamente hasta tanto la correa
transportadora esté suficientemente tensada.
Finalmente se aprietan y afirman con contratuercas las tuercas (7) de los husillos
tensores (5) pata fijar el tambor tensor en esta posición.
Ilustración 15
11/2013 Rev 0
11/2013 Rev 0
Para la primera puesta en operación, observar también las indicaciones para los
componentes que aparecen en el ANEXO 9.
PELIGRO
Peligro de lesiones por aislamientos dañados de los cables de conexión y
faltas de cubiertas de las cajas de bornes
ADVERTENCIA
Peligro de lesiones por grandes oscilaciones pendulares
PRECAUCIÓN
Peligro de lesiones por servicio de grupos de accionamiento sin
revestimiento de protección
En caso de que no se haya encontrado ninguna deficiencia durante los controles, la cinta
de evacuación de la trituradora puede ser puesta en prueba de funcionamiento.
ATENCIÓN
Daños en la instalación por accionamiento de instalaciones de seguridad
para interrupciones normales de servicio
11/2013 Rev 0
ATENCIÓN
Daños en la instalación debido a tensión excesiva de la cinta
Durante la prueba de funcionamiento todas las partes de la planta deben ser operadas
por lo menos 4 h en marcha sin carga.
PELIGRO
Peligro de lesiones por eliminación de bloqueos durante el servicio
• Estos trabajos sólo deben ser realizados cuando la cinta de evacuación esté
parada y asegurada contra reencendido.
ADVERTENCIA
Peligro por vallado insuficiente de la instalación
ATENCIÓN
Daños en la instalación por arranque con material de transporte cargado
NOTA
11/2013 Rev 0
ATENCIÓN
Daños en la instalación por sobrecarga de material ante desconexión de
emergencia
ATENCIÓN
Daños en la instalación por desconexión incontrolada de componentes de
la instalación.
11/2013 Rev 0
ADVERTENCIA
Peligro de lesiones por trabajos de limpieza, inspección, mantenimiento y
reparación durante el servicio
• En caso de tener que realizar trabajos de montaje por encima de la altura del cuerpo,
use plataformas o medios de ascenso previstos para el caso u otros medios que
cumplan con las exigencias de seguridad respectivas. ¡Nunca use partes de la
máquina como medios de ayuda para subir! En caso de tener que realizar trabajos
de mantenimiento a una altura considerable utilice medios de seguridad contra
caídas.
• ¡Mantenga libre de suciedad, nieve y hielo todos las manijas, escalones, barandas,
estrados, plataformas y escaleras!
• ¡Usar sólo fusibles originales con la intensidad de corriente requerida! ¡En caso de
averías que afecten la alimentación de energía eléctrica, apagar inmediatamente la
máquina/ instalación!
• Trabajos en los sistemas o equipos eléctricos sólo deben ser realizados por personal
especializado en la materia o personal instruido bajo la dirección y supervisión de un
especialista de acuerdo a las reglas de la electrotécnica.
• En caso que sea necesario trabajar en partes que están conduciendo electricidad,
asegure que una segunda persona se encuentre presente, para que en caso de
11/2013 Rev 0
• ¡Despresurice las secciones del sistema y tubería a presión antes de empezar con
los trabajos de reparación de acuerdo a las descripciones del grupo constructivo!
PRECAUCIÓN
Peligro de lesiones por trabajos sin equipamiento personal de protección
Limpiar los lugares difícilmente accesibles con medios de ayuda como por ejemplo
escobillas especiales.
ADVERTENCIA
Peligro de lesiones por trabajos de mantenimiento no ejecutados dentro de
los plazos
ATENCIÓN
Daños en la instalación por mantenimiento inapropiado
• ¡Controle por lo menos una vez por turno que la máquina/ instalación no
presente daños que salten a la vista! ¡Informe inmediatamente al departamento
respectivo, sobre cambios que se presenten (inclusive los que afecten al
comportamiento de la máquina durante la operación)!
• ¡En caso de anomalías de funcionamiento pare y asegure la máquina/
instalación inmediatamente!
¡Haga reparar dichas averías inmediatamente!
11/2013 Rev 0
• Controlar la pintura por lo menos cada 6 meses en cuanto a daños por corrosión.
Mejore profesionalmente todas las partes dañadas.
• Deje que personal especializado controle por turnos el funcionamiento de todos los
dispositivos de la técnica de mando de operaciones/ bloqueos eléctricos.
NOTA
Aproveche los periodos de inactividad debido a reparaciones necesarias, para
realizar también trabajos de mantenimiento requeridos.
NOTA
Para la lubricación de la máquina/ instalación véase Capítulo 8.
Para el mantenimiento y reparación de los componentes véase el ANEXO 9.
ADVERTENCIA
Peligro de lesiones por fijaciones inapropiadas
PRECAUCIÓN
Peligro de lesiones por trabajos en transportadores de cinta en marcha
Los trabajos de mantenimiento deben ser organizados de tal modo que tiempos de
parada también en otras partes de la instalación puedan ser aprovechados para la
realización de dichos trabajos.
11/2013 Rev 0
Ilustración 16
Los intervalos de mantenimiento, según los cuales se deben realizar dichos trabajos,
representan las propuestas y recomendaciones de ThyssenKrupp Resource
Technologies.
La frecuencia de los trabajos de mantenimiento es sin embargo dependiente de las
condiciones de operación concretas in situ, como:
– Duración de la operación,
– Estado de funcionamiento,
– Desgaste.
Por eso observe las condiciones de operación. Con el paso del tiempo, se puede
comprobar la necesidad de cambiar/ adaptar los intervalos de mantenimiento.
11/2013 Rev 0
Rodillos portadores
Controlarlos en cuanto a aglomeraciones 1
Controlarlos en cuanto a un desplazamiento 1 1
tranquilo
Tambores
Controlarlos en cuanto a aglomeraciones 1
Rascador de la cinta
Verificar el funcionamiento 1
Comprobar regletas 1
Zapata de alimentación
Verificar el funcionamiento 1
Controlar la empaquetadura de goma 1
Tornillos de fijación
Controlar el apriete 50 h 12
Rodamientos
Limpiar, renovar la grasa 6000 24
Unidad de accionamiento
Revisar si existen pérdidas por derrame 1
Comprobar el nivel de aceite/ en caso dado 1
repostar
Verificar apriete de los tornillos 50 h 12
Cambio de aceite 500 h 17500 60
7.2.2 Accionamiento
7.2.3 Rodamientos
Los rodamientos del tambor de accionamiento y del tambor tensor deben ser controlados
en periodos de tiempo regulares en cuanto a un funcionamiento estable.
Relubricación
Antes de la relubricación se deben limpiar los engrasadores. Para el caso de cajas de
rodamientos sin engrasadores, la relubricación se debe realizar durante una parada de la
máquina. Es esto se debe sacar la grasa usada y cambiarla por nueva grasa.
11/2013 Rev 0
Ilustración 17
Ilustración 18
ADVERTENCIA
Peligro de lesiones por trabajos de limpieza, inspección, mantenimiento y
reparación durante el servicio
NOTA
Observar el Capítulo 7.1.3 "Indicaciones para la reparación".
11/2013 Rev 0
Ilustración 19
Ilustración 20
11/2013 Rev 0
11/2013 Rev 0
Ilustración 21
Ilustración 22
Ilustración 23
Ilustración 24
• Levantar el tambor tensor (4) con el polipasto de cadena (8) debajo de la plataforma
de la tolva de evacuación. (Véase también Capítulo 5.2 "Dispositivos de elevación y
medios de sujeción".)
Ilustración 26
Ilustración 27
Para montar el tambor tensor, deberá procederse de la misma forma, pero en el orden
11/2013 Rev 0
inverso.
11/2013 Rev 0
Desmontaje
• Disminuir la tensión de la correa transportadora (1) mediante husillos tensores (2).
• Levantar las guías de material (4) y la zapata de alimentación (5).
• Desmontar los rascadores previos al cabezal (6).
Cortar la correa transportadora y sacarla con un torno de cable. En esto se recomienda
unir la nueva correa transportadora con la que tiene que ser desmontada e introducir la
nueva.
ATENCIÓN
Daños en la instalación por reparación inapropiado
Montaje
Después la cinta de evacuación debe ser puesta nuevamente en servicio, realizando para
ello los trabajos arriba mencionados pero en secuencia inversa.
Para tensar la cadena de transporte véase Capítulo 5.9 "Montar y tensar la correa
transportadora".
11/2013 Rev 0
ADVERTENCIA
Peligro de lesiones por bordes filosos de los rodillos portantes
desgastados.
Montaje
11/2013 Rev 0
Ilustración 31
11/2013 Rev 0
• Aflojar los listones de sujeción (1) del rascador de arado (2) y reajustar o cambiar las
placas de plástico (3).
• Ajustar el rascador de arado a la altura necesaria mediante los tornillos de ajuste.
Ilustración 32
11/2013 Rev 0
• Aflojar los listones de sujeción (3) de la zapata de alimentación (1) o bien de la guía
de material (2) y reajustar o cambiar los listones de caucho (4).
Ilustración 33
11/2013 Rev 0
Ilustración 34
11/2013 Rev 0
Ilustración 35
11/2013 Rev 0
Ilustración 36
11/2013 Rev 0
Ilustración 37
11/2013 Rev 0
Desmontaje
• Marcar en el eje la posición del casquillo de sujeción y desasegurar la tuerca del
manguito doblando la chapa de seguridad (Fig. 1).
• Pero si el rodamiento está montado sobre un eje liso, la herramienta debe estar
empalmada en el anillo interior del rodamiento (Fig. 3).
11/2013 Rev 0
Montaje
Los asientos del rodamiento deben ser ligeramente lubricados antes del montaje para
evitar daños durante el mismo.
• Medir el juego del rodamiento según fig. 5 con un calibre explorador entre el anillo
exterior y el rodillo descargado.
11/2013 Rev 0
ATENCIÓN
Daños en la instalación debido a errores de montaje
Valores de orientación para la reducción del juego radial y el desplazamiento axial al montar el
rodamiento oscilante de rodillos
mm mm mm mm mm
120 140 0,065 0,090 1,10 1,40 2,75 3,50 0,055 0,080 0,110
140 160 0,075 0,100 1,20 1,60 3,00 4,00 0,055 0,090 0,130
160 180 0,080 0,110 1,30 1,70 3,25 4,25 0,060 0,100 0,150
180 200 0,090 0,130 1,40 2,00 3,50 5,00 0,070 0,100 0,160
200 225 0,100 0,140 1,60 2,20 4,00 5,50 0,080 0,120 0,180
225 250 0,110 0,150 1,70 2,40 4,25 6,00 0,090 0,130 0,200
250 280 0,120 0,170 1,90 2,70 4,75 6,75 0,100 0,140 0,220
280 315 0,130 0,190 2,00 3,00 5,00 7,50 0,110 0,150 0,240
315 355 0,150 0,210 2,40 3,30 6,00 8,25 0,120 0,170 0,260
355 400 0,170 0,230 2,60 3,60 6,50 9,00 0,130 0,190 0,290
400 450 0,200 0,260 3,10 4,00 7,75 10,00 0,130 0,200 0,310
450 500 0,210 0,280 3,30 4,40 8,25 11,00 0,160 0,230 0,350
Tornillo de cabeza hexagonal (rosca hasta la DIN EN ISO 4017 8.8 / 10.9 / 12.9
cabeza)
Tornillo de cabeza cilíndrica con hexágono DIN EN ISO 4762 8.8 / 10.9 / 12.9
interior
Tornillo de cabeza cilíndrica con hexágono DIN 7984 8.8 / 10.9 / 12.9
interior y cabeza chata
• Siempre usar conjuntamente sólo las siguientes calidades de tornillos con las
siguientes calidades de tuercas:
M6 11 15 18
M8 26 36 43
M10 51 71 86
NOTA
Estos momentos de apriete siempre deben ser usados, cuando en la respectiva
sección no se nombra ningún momento de apriete específico.
Tuerca hexagonal HV 10 sí HV
según la norma alemana DIN
6915
Arandela - sí HV
según la norma alemana DIN
6916
• Siempre usar conjuntamente sólo las siguientes calidades de tornillos con las
siguientes calidades de tuercas:
Procedimientos de par
M 12 50 100 120
11/2013 Rev 0
1
) Tuercas tratadas con bisulfuro de molibdeno u otra sustancia lubricante equivalente
Control de la unión GV después del montaje, luego por lo menos una vez al año según:
Ángulo de Acción
continuación de giro
30° hasta 60° pretensión es suficiente, controlar dos tornillos vecinos en la misma conexión
> 60° cambiar tornillo, controlar dos tornillos vecinos en la misma conexión
11/2013 Rev 0
11/2013 Rev 0
ADVERTENCIA
Peligro de lesiones por trabajos de limpieza, inspección, mantenimiento y
reparación durante el servicio
Una lubricación adecuada con los mejores lubricantes para los respectivos usos
previstos, es absolutamente necesario para la conservación de la seguridad de
funcionamiento y una duración adecuada. No es posible caracterizar absolutamente al
lubricante con los valores de orientación indicados en la tabla de lubricantes. La
responsabilidad de elección correcta del lubricante teniendo en consideración las
condiciones locales y las condiciones de aplicación de este tipo de instalación industrial
así como el último avance en la tecnología de lubricantes, queda finalmente en manos del
suministrador de lubricantes.
Los lubricantes deben ser puestos a disposición por el usuario/ propietario.
Nosotros no asumimos responsabilidad alguna por deficiencias o daños causados por
una mala elección del lubricante.
Para resumir, recomendamos utilizar sólo lubricantes de buena calidad, los cuales han
sido elegidos por empresas reconocidas en la materia teniendo en consideración
nuestros valores de orientación.
NOTA
Cada una de las empresas de aceite mineral que aparece en la tabla de
lubricantes mantiene un servicio de lubricación cuyos ingenieros están a
disposición de nuestros clientes para responder cualquier pregunta relacionada
a la lubricación y encontrar la lubricación adecuada para cada aplicación.
11/2013 Rev 0
11/2013 Rev 0
En Capítulo 8.4 "Tabla de lubricantes (índice 8)" se distinguen los siguientes grupos de
aceites:
Aceites minerales = CLP
Poliglicoles = CLP PG (aceites sintéticos)
Poli-a-olefina = CLP HC (aceites sintéticos)
Aceites hidráulicos = HLP
Aceites hidráulicos = HVLP (comportamiento de viscosidad-temperatura mejorado)
11/2013 Rev 0
Realice los cambios de aceite en los intervalos prescritos por el fabricante del
engranaje. Adicionalmente controle continuamente el nivel de aceite y rellene la
cantidad que falte.
ATENCIÓN
11/2013 Rev 0
Observar que las tuberías de lubricación estén limpias interiormente a fondo antes de la
primera puesta en operación y rellenadas con el lubricante prescrito.
PELIGRO
Peligro de lesiones por trabajos de limpieza, inspección, mantenimiento y
reparación durante el servicio
Códig Fuchs
Uso Clase Aral BP ESSO Mobil Shell Texaco Klüber
o Europa
Acoplamientos
Energol
hidráulicos y ISO VG 32 Vitam Nuto Renolin Rando LAMORA
A1 HLP-HM DTE 24 Tellus 32
grupos HLP GF 32 H 32 B 10 HD 32 HLP 32
32
hidráulicos
Energol
ISO VG Vitam Nuto Renolin Rando Oil LAMORA
A2 HLP-HM DTE 25 Tellus 46
46 HLP GF 46 H 46 B 15 HD 46 HLP 46
46
Instalaciones
hidráulicas
Energol
ISO VG Vitam Nuto Renolion Rando Oil LAMORA
A3 HLP-HM DTE 26 Tellus 68
68 HLP GF 68 H 68 B 20 HD C-68 HLP 68
68
Enersyn
ISO VG Renolin Mobilgear Klübersynth
Degol EP-XF 220 Omala Pinnacle
D2 220 CLP Unisyn SHC XMP GEM
PAS 220 (ya no se HD 220 EP 220
HC CLP 220 220 4-220 N
fabrica)
Aceite para
ISO VG Renolin Mobilgear Klübersynth
engranajes Degol Enersyn Omala Pinnacle
D3 320 CLP Unisyn SHC XMP GEM
sintético PAS 320 EP-XF 320 HD 320 EP 320
HC CLP 320 320 4-320 N
11/2013 Rev 0
ISO VG
Degol Renolin Tivela Synlube Klübersynth
E1 150 CLP
GS 150 PG 150 S 150 CLP 150 GH 6-150
PG
ISO VG Enersyn
Degol Glycolub Renolin Glycoyle Tivela Synlube Klübersynth
E2 220 CLP SG-XP
GS 220 e 220 PG 220 HE 220 S 220 CLP 220 GH 6-220
PG 220
Aceite para
engranajes
ISO VG Enersyn
sintético Degol Renolin Glycoyle Tivela Synlube Klübersynth
E3 320 CLP SG-XP
No mezclable GS 320 PG 320 HE 320 S 320 CLP 320 GH 6-320
PG 320
con aceite
mineral.
ISO VG Enersyn
Degol Glycolub Renolin Glycoyle Tivela Synlube Klübersynth
E4 460 CLP SG-XP
GS 460 e 460 PG 460 HE 460 S 460 CLP 460 GH 6-460
PG 460
ISO VG Enersyn
Degol Renolin Glycoyle Tivela Klübersynth
E5 680 CLP SG-XP
GS 680 PG 680 HE 680 S 680 GH 6-680
PG 680
Bloqueos de ISO VG Degol Energol Teresso DTE Oil Tellus Oil Rando
F1 —
retorno 46 CL CL 46 CS 46 46 Medium C 46 Oil 46
- Vanellus-
ESSOLU TITAN Ursa Klüberoil
Ruedas de Motor oil Kowal T Delvac Rimula
H1 BE-XD-3- Universal Super LA GEM
desplazamiento SAE 30 Motoroil -Energol Super X 30
HDX HD SAE 30 Ursatex 1-100 N
HDS
Fuchs
Código Uso Clase Aral BP ESSO Mobil Shell Texaco Klüber
Europa
Equipo de
Grasa CENTOP
lubricación con NLGI Aralub Energrease Mobilux Simnia
K1 fluida LEX
grasa soporte 000 GFP 000 HT 000 EP EP 023 Grease 000
000 GLP 500
superior del eje
Grasa
Soportes del eje fluida MICROL
NLGI Aralub Energrease Renolit Mobilplex Alvania Marfak
K2 acoplamientos para UBE
00 FDP 00 HT-EP 00 SO-D8024 44 GL 00 00
dentados engranaje GB 00
s
Acoplamientos
Grasa
dentados y MICROL
NLGI 0 Energrease Beacon Alvania Multifak
K3 equipos de UBE
KPO K-20 LS 0 EP 0 EP R- EP 0
lubricación con GB 0
OEP1
grasa
Equipos de MICROL
NLGI 1 Energrease Beacon Renolit Mobilux Alvania
K4 lubricación con UBE
KP1K-20 LS-EP 1 EP 1 FEP 2 EP 1 Grasa EP 1
grasa GL 261
Equipos de
lubricación con
grasa y Alvania CENTOP
NLGI 2 Aralub Energrease Beacon Renolit Mobilux Multifak
K5 rodamientos Grasa EP LEX
KP2K-20 H-LP 2 LS-EP 2 EP 2 FEP 2 EP 2 EP 2
antifricción (LF) 2 2 EP
(solicitación
elevada)
Rodamientos
antifricción NLGI 3 Aralub Energrease Renolit Alvania Glissando CENTOP
K6 Beacon 3 Mobilux 3
(solicitación K3K-20 HL 3 LS 3 FWA 220 Grasa RL 3 FT 3 LEX 3
normal)
Código Uso Clase Aral BP ESSO Fuchs Mobil Shell Texaco Klüber
Rodamientos
antifricción
Mobiltemp
L1 (elevada NLGI 2
SHC 100
solicitación
11/2013 Rev 0
térmica)
Rodamientos
antifricción
Mobilith Albida
L2 (elevada NLGI 2
SHC 220 PPS 2
solicitación
térmica)
Rodamientos
antifricción
Mobiltemp
L3 (elevada NLGI 1.5
SHC 32
solicitación
térmica)
GRAFLOSCON Klüberplex
M1 Imprimación a mano Ceplattyn 300
A - G1 ULTRA AG 11-462
GRAFLOSCON Klüberfluid
M2 Proceso de rodaje Rodaje de Ceplattyn - RN
B - SG-00 ULTRA B-F 2 ULTRA
GRAFLOSCON Klüberfluid
M5 Lubricante de operación de + 15 °C a 120 °C Ceplattyn KG 10 HMF - 2500
C - SG-2000 Ultra C-F 3 ULTRA
Aceites
CASTROL
Código Uso Clase CASTROL
BIO TOP
ISO VG
N1 Tribol 943 AW 32 Tribol BioTop 1448 / 32
32 HLP
Grupo hidráulico
Regulación de eje y protección contra
sobrecarga. ISO VG
N2 Tribol 943 AW 46 Tribol BioTop 1448 / 46
46 HLP
Engranaje intermedio por correas
trapezoidales
ISO VG
N3 Tribol 943 AW 68 Tribol BioTop 1448 / 68
68 HLP
ISO VG
N4 Tribol 1100/100
100 CLP
Unidad de aceite
ISO VG
N5 Sistema de lubricación por circulación de Tribol 1100/150 Tribol BioTop 1418 / 150
150 CLP
aceite
ISO VG
N6 Tribol 1100/220 Tribol BioTop 1418 / 220
220 CLP
Grasas
CASTROL
Código Uso Clase CASTROL
BIO TOP
Tribol 3020/1000-000
P1 NLGI 000
GP 000K-40
Equipo de lubricación con grasa
soporte superior del eje
Tribol 3020/1000-00
P2 NLGI 00
GP 00K-40
NLGI 2 Molub-Alloy
P3 Rodamientos antifricción Tribol 3020/1000-2
KP2K-20 Bio Top 9488-1
Fuchs
Código Uso Clase Aral BP ESSO Mobil Shell Texaco
Europa
Summit
Acoplamientos Hyspin
Q2 ISO VG 32 HySyn SHC 524
hidráulicos (Voith) AWH-M 32
FG 32
Instalaciones Tellus
R1 ISO VG 32
hidráulicas Arctic 32
ATENCIÓN
Daños en la instalación por indicaciones erróneas de cantidades y/o clases
de aceite
1. Cambio de
Comprobar
aceite tras
diariamente
Engranaje de 500 h;
el nivel de aprox.
1 ruedas cóni- 1 D3 siguientes tras
aceite con el 270 litros
cas 8000 - 12000 h,
engranaje
como máximo
parado
cada 4 años
Rodamiento
cada 6000 h o aprox. cada
2 del tambor de 2 K5
cada 2 años uno 7,7 kg
accionamiento
Rodamiento
cada 6000 h o aprox. cada
3 del tambor 2 K5
cada 2 años uno 3,2 kg
tensor
Rodillos porta-
4 Lubricación permanente
dores
11/2013 Rev 0
11/2013 Rev 0
9.1 Dibujos
9.2 Accionamiento
11/2013 Rev 0
Edition 08/2012
19358814 / EN
Contents
1 General Information.......................................................................................... 5
1.1 How to use the operating instructions...................................................... 5
1.2 Structure of the safety notes.................................................................... 5
1.3 Rights to claim under warranty.................................................................5
1.4 Exclusion of liability.................................................................................. 6
1.5 Copyright.................................................................................................. 6
2 Safety Notes...................................................................................................... 7
2.1 Preliminary remark................................................................................... 7
2.2 General information..................................................................................7
2.3 Target group.............................................................................................7
2.4 Designated use........................................................................................ 8
2.5 Other applicable documentation...............................................................8
2.6 Safety symbols on the gear unit............................................................... 8
2.7 Symbols on the packaging..................................................................... 12
2.8 Transport................................................................................................ 12
2.9 Storage and transport conditions........................................................... 14
3 Basic Gear Unit Structure.............................................................................. 16
3.1 Nameplate.............................................................................................. 16
3.2 Type designations.................................................................................. 17
3.3 Mounting positions................................................................................. 18
3.4 Mounting surfaces.................................................................................. 19
3.5 Shaft positions........................................................................................19
3.6 Mounting positions and standard mounting surfaces............................. 19
3.7 Directions of rotation dependencies....................................................... 20
3.8 Housing.................................................................................................. 21
3.9 Gearing and shafts................................................................................. 21
3.10 Input and output shafts...........................................................................22
3.11 Sealing systems..................................................................................... 23
3.12 Coating and surface protection systems................................................ 24
3.13 Lubrication types.................................................................................... 25
3.14 Accessories............................................................................................ 25
4 Design of options and accessories...............................................................27
4.1 Backstop /BS..........................................................................................27
4.2 Temperature sensor /PT100.................................................................. 27
5 Assembly/Installation..................................................................................... 28
5.1 Required tools/resources....................................................................... 28
5.2 Tolerances..............................................................................................28
5.3 Important notes...................................................................................... 29
5.4 Installation requirements........................................................................ 30
5.5 Installing the gear unit............................................................................ 31
5.6 Filling the gear unit with oil..................................................................... 32
5.7 Gear unit with solid shaft........................................................................ 32
5.8 Temperature sensor /PT100.................................................................. 33
6 Startup..............................................................................................................35
6.1 Important notes on startup..................................................................... 35
6.2 Backstop /BS..........................................................................................35
6.3 Gear unit shutdown/conservation...........................................................36
3
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Contents
7 Inspection/Maintenance................................................................................. 38
7.1 Preliminary work for inspection and maintenance..................................38
7.2 Inspection and maintenance intervals.................................................... 39
7.3 Lubricant change intervals..................................................................... 39
7.4 Checking the oil level............................................................................. 40
7.5 Check the oil consistency.......................................................................40
7.6 Changing the oil..................................................................................... 41
7.7 Refilling grease.......................................................................................42
7.8 Split housing...........................................................................................43
8 Lubricants........................................................................................................44
8.1 Information on lubricant selection...........................................................44
8.2 Lubricant table........................................................................................44
8.3 Lubricant fill quantities............................................................................46
8.4 Sealing greases / rolling bearing greases.............................................. 46
9 Malfunctions/Troubleshooting.......................................................................47
9.1 Troubleshooting information...................................................................47
9.2 Customer service................................................................................... 47
9.3 Possible gear unit malfunctions..............................................................48
9.4 Disposal..................................................................................................49
10 Index.................................................................................................................50
4
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
General Information
How to use the operating instructions 1
1 General Information
1.1 How to use the operating instructions
The operating instructions are an integral part of the product and contain important
information for operation and service. The operating instructions are written for all
employees who assemble, install, startup, and service this product..
The operating instructions must be accessible and legible. Make sure that persons
responsible for the system and its operation, as well as persons who work independently
on the unit, have read through the operating instructions carefully and understood them.
Consult SEW-EURODRIVE if you have any questions or if you require further information.
5
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
General Information
1 Exclusion of liability
1.5 Copyright
© 2012 – SEW-EURODRIVE. All rights reserved.
Unauthorized duplication, modification, distribution or any other use of the whole or any
part of this documentation is strictly prohibited.
6
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Safety Notes
Preliminary remark 2
2 Safety Notes
The following basic safety notes must be read carefully to prevent injury to persons and
damage to property. The operator must ensure that the basic safety notes are read and
adhered to. Make sure that persons responsible for the plant and its operation, as well
as persons who work independently on the unit, have read through the operating
instructions carefully and understood them. If you are unclear about any of the informa-
tion in this documentation or if you require further information, please contact SEW-
EURODRIVE.
7
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Safety Notes
2 Designated use
Any electronic work may only be performed by adequately qualified electricians. Qualified
electricians in this context are persons who are familiar with the electronic installation,
startup, troubleshooting and maintenance for this product. Further, they are qualified as
follows:
• Training in electrical engineering, e.g. as an electrician or mechatronics technician
(final examinations must have been passed).
• They are familiar with these operating instructions.
Any work in further areas of transportation, storage, operation and waste disposal may
only be carried out by persons who are trained appropriately.
All qualified personnel must wear appropriate protective clothing.
CAUTION
Safety symbols or signs can become dirty or illegible over time.
Risk of injury due to illegible symbols.
• Always make sure that safety, warning, and operating notes are legible.
• Replace damaged safety symbols and signs.
8
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Safety Notes
Designated use 2
The safety symbols on the gear unit must be observed. They have the following meaning:
Safety symbols Meaning
Oil
Indicates the oil filling location. Also serves as proper venting during the oil
change.
Indicates the positions for relubrication and makes it easier to find the locations to
be lubricated. Helps avoid bearing damage
For pivoted mounting positions, this symbol on the information sign indicates the
mounting position of the gear unit for checking the oil.
Helps avoid errors caused by lack of understanding. Read the information in the
operating instructions.
Caution: Removing the dipstick during operation may result in damage to the gear
unit.
S TOP
9
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Safety Notes
2 Designated use
After startup, you may remove the following labels from the gear unit.
Meaning
The brake is not set at the factory.
F ES
El fre n o n o vie n e a ju s ta d o
Le fre in n 'e s t p a s ré g lé d 'u s in e d e fá b ric a .
Risque de dommages matériels ! ¡Posibles daños materiales!
• Avant la mise en service, régler le frein • Antes de la puesta en marcha,
conformément aux instructions de la ajustar el freno según las
notice d'exploitation. instrucciones de funcionamiento.
X NL PL
De re m is n ie t a f fa b rie k Ha m u le c n ie je s t u s ta wio n y
in g e s te ld . fa b ryc zn ie .
Mogelijke materiële schade!
• Rem voor de inbedrijfstelling conform •
technische handleiding instellen.
18855199
F ES
L’a c c o u p le m e n t e s t livré s a n s El a c o p la m ie n to s e s u m in is tra
g ra is s e . s in g ra s a .
Risque de dommages matériels ! ¡Posibles daños materiales!
• Avant la mise en service, remplir • Llenar el acoplamiento con grasa
l’accouplement de graisse. antes de la puesta en marcha.
NL PL
Ko p p e lin g wo rd t zo n d e r S p rzę g ło d o s ta rc za n e je s t
ve t g e le ve rd . b e z s m a ru .
Mogelijke materiële schade! Możliwe szkody materialne!
• Koppeling vóór de inbedrijfstelling • Przed uruchomieniem należy
met vet vullen. wypełnićsprzęgło smarem.
18977405
10
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Safety Notes
Designated use 2
Meaning
The coupling is supplied without oil.
F ES
L’a c c o u p le m e n t e s t livré s a n s El a c o p la m ie n to s e s u m in is tra
h u ile . s in a c e ite .
Risque de dommages matériels ! ¡Posibles daños materiales!
• Avant la mise en service, remplir • Llenar el acoplamiento con aceite antes
l
Oi l’accouplement d’huile. de la puesta en marcha.
NL PL
Ko p p e lin g wo rd t zo n d e r S p rzę g ło d o s ta rc za n e je s t
o lie g e le ve rd . b e z o le ju .
Mogelijke materiële schade! Możliwe szkody materialne!
• Koppeling vóór de inbedrijfstelling • Przed uruchomieniem należy
met olie vullen. wypełnićsprzęgło olejem.
18977413
F Ré d u c te u r p ro té g é c o n tre la ES Re d u c to r e s tá p ro te g id o c o n VCI
c o rro s io n a ve c VCI. Ne p a s o u vrir c o n tra la c o rro s ió n . ¡No a b rir!
Risque de dommages matériels ! ¡Posibles daños materiales!
• Avant la mise en service, réaliser les • Antes de la puesta en marcha, efectuar
travaux préliminaires indiqués dans la los trabajos preparatorios según las
notice d'exploitation. instrucciones de funcionamiento.
• Pas de flammes ouvertes ! • No debe haber fuego abierto.
NL Ta n d wie lka s t is m e t VCI te g e n PL
VCI c o rro s ie b e s c h e rm d . Nie t o p e n e n !
Mogelijke materiële schade!
• Vóór de inbedrijfstelling voor-
bereidingen conform technische
handleiding uitvoeren.
18977421 • Geen open vuur!
F Le ré d u c te u r n e c o n tie n t p a s ES
El re d u c to r s e s u m in is tra
d 'h u ile à la livra is o n . s in a c e ite .
Dommages matériels possibles ! ¡Posibles daños materiales!
• Avant la mise en service, effectuer le • Antes de la puesta en marcha,
remplissage d'huile conformément à la efectuar el llenado de aceite según
Oi
l notice d'exploitation.
las instrucciones de funcionamiento.
NL PL
Ta n d wie lka s t wo rd t zo n d e r
o lie g e le ve rd .
Mogelijke materië schade!
• Vóór de inbedrijfstelling olie conform
technische handleiding bijvullen.
18977383
11
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Safety Notes
2 Symbols on the packaging
1811486091
2.8 Transport
2.8.1 General information
WARNING
Suspended loads can fall.
Severe or fatal injuries.
• Do not stand under the suspended load.
• Secure the danger zone.
• Use suitable, sufficiently rated and undamaged handling equipment.
• Consider the gear unit dimensions, the center of gravity and the weight that has to
be moved when selecting lifting equipment or crane (see dimension drawing).
CAUTION
Risk of slipping of unsecured mount-on components, e.g. keys.
Potential risk of crushing due to falling parts.
• Secure the mount-on components.
CAUTION
Risk of slipping due to lubricant leaking from damaged seals.
Minor injuries
• Check the gear unit and mount-on components for leaking lubricant.
NOTICE
Improper transport may result in damage to the gear unit.
Possible damage to property.
• Note the following:
12
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Safety Notes
Symbols on the packaging 2
• Inspect the shipment for any damage that may have occurred in transit as soon as
you receive the delivery. Inform the shipping company immediately about any damage.
It may be necessary to suspend startup.
• The weight of the gear unit (without oil) is indicated on the nameplate or on the
dimension sheet. Observe the loads and specifications given on the nameplate.
• If possible, transport the gear unit without oil fill. If this is not possible, note that the
weight indicated on the nameplate refers only to the gear unit without oil fill, and
replace the breather with a screw plug.
• Transport the gear unit in such a way that the lifting gear is tensioned only vertically.
• The gear unit must be transported in a manner that prevents damage to the gear unit,
and mount-on components. For example, impacts against exposed shaft ends can
damage the gear unit.
• Use only the prescribed suspension points to transport the gear unit [1] (see order
documents). The load suspensions of the motor or mount-on components are provided
for stabilization purposes only.
The following figure illustrates how to transport the gear unit.
[1] [1]
13
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Safety Notes
2 Storage and transport conditions
2.9.3 Packaging
Standard packaging
The gear unit is delivered on a pallet without cover.
Application: Land transport
Long-term packaging
The gear unit is delivered in a wooden box that is also appropriate for sea transport.
Application: Sea transport and/or for long-term storage
NOTICE
Improper storage may result in damages to the gear unit.
Possible damage to property.
• During storage up to startup, the gear unit must be stored in a shock-free manner
to prevent damage to the rolling bearing races.
• The output shaft must be rotated at least one full rotation every six months so that
the position of the roller elements in the bearings of the input and output shafts
changes.
14
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Safety Notes
Storage and transport conditions 2
INFORMATION
As standard, the gear units are delivered without oil; different protection systems are
required depending on the storage period and storage conditions as shown in the
table below.
Corrosion protection +
Storage location Storage duration
packaging
Standard corrosion protection Under roof, enclosed at constant temperature and atmospheric
humidity (5 °C < â < 60 °C, relative humidity < 50%). Max. 6 months with intact surface
+
No sudden temperature fluctuations. Controlled ventilation with corrosion protection
standard packaging filter (free from dust and dirt). No aggressive vapors, no shocks.
Under roof, enclosed at constant temperature and atmospheric
Long-term corrosion protection humidity (5 °C < â < 60 °C, relative humidity < 50%).
Max. 3 years with regular inspection
+ No sudden temperature fluctuations. Controlled ventilation of the and checking for intactness.
standard packaging storage location with filter (free from dust and dirt). No
aggressive vapors, no shocks.
Long-term corrosion protection
Max. 3 years with regular inspection
+ With roof, protected against rain and shocks.
and checking for intactness.
long-term packaging
INFORMATION
If stored in tropical zones, provide for sufficient protection against insect damage.
Contact SEW-EURODRIVE for differing requirements.
15
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
3 Nameplate
Made in Germany
18014398928127499
Type Type designation
Nr. 1 Manufacturing number
PK1 [kW] Operating power on the input shaft (HSS)
MK2 [Nm] Gear unit output torque
n1 [rpm] Input speed (HSS)
n2 [rpm] Output speed (LSS)
norm. Normal operating point
min. Operating point at minimum speed
max Operating point at maximum speed
i Exact gear unit reduction ratio
FS Service factor
FR1 [N] Actual overhung load acting on the input shaft
FR2 [N] Actual overhung load acting on the output shaft
FA1 [N] Actual axial load acting on the input shaft
FA2 [N] Actual axial load acting on the output shaft
Mass [kg] Weight of the gear unit
Qty of greasing points Number of regreasing points
Fans Number of installed fans
Oil grade and viscosity class / oil volume
Year Year of manufacture
IM Mounting position and mounting surface
16
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
Type designations 3
Application:
B = Bucket elevator drive
17
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
3 Mounting positions
With the alternative mounting positions, there might be limitations regarding certain
options. Contact SEW-EURODRIVE in this case.
3.3.1 X.K..
M1
M6 M2
M5
M4
M3
6790939531
18
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
Mounting surfaces 3
F1
1348021771
3.5.1 X.K..
The shaft positions 0 to 4 shown in the following figure apply to solid and hollow output
shafts. The order-specific shafts are shaded gray. The missing shafts are not illustrated,
but marked with a number.
19
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
3 Directions of rotation dependencies
The following figure provides an overview of mounting positions and standard mounting
surfaces.
M1
0
4
F1
M6
3
M2 F6
0
3 4
F3
3
0
0 M5
M4 4
0
F3
4
M3
4
3 3
F6
0 3
F2
1630370827
20
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
Housing 3
3.7.1 X.K..
Shaft position 03
Size
Pos. of end gear 4
X4K
1840433419
3.8 Housing
The gear unit housing is made from robust gray-cast iron.
441826955
21
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
3 Input and output shafts
X.K..
LS S
HS S
18014398833520651
9007200756231819
22
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
Sealing systems 3
• Features:
Single oil seal with radial labyrinth seal
• Ambient conditions:
Very high dust load with abrasive particles
[1]
• Features:
Single oil seal with radial labyrinth seal
• Ambient conditions:
Very high dust load with abrasive particles
[1]
23
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
3 Coating and surface protection systems
INFORMATION
Make sure that the gear unit shaft is rotating during the regreasing process.
Grease nipple on The lubrication points are located on the top side of the gear unit. Flat greasing nipples
the top side of the according to DIN 3404 A G1/8 are used. Regreasing should be carried out at regular
gear unit (option) intervals. Observe section "Maintenance intervals".
Note the following points:
• The option applies to both drive and output shaft(s).
Example
24
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
Lubrication types 3
OS/2
SEW design
Medium environmental impact
1) Standard color
INFORMATION
Sheet metal parts (e.g. protection covers, fan guard) are painted in RAL 1003.
3.14 Accessories
The following section describes the accessories for the several types of lubrication.
INFORMATION
The position of accessories might vary depending on the gear unit type and size.
25
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Basic Gear Unit Structure
3 Lubrication types
[1]
[2]
[3]
[4]
2671413899
[1] Oil dipstick (optional) [3] Oil level glass
[2] Gear unit breather [4] Oil drain
Breather The purpose of gear unit breather is to prevent that non-permitted pressure occurs from
heating during operation. The gear units are normally equipped with a high-quality
breather filter with a filter mesh of 2 µm.
Oil drain
26
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Design of options and accessories
Backstop /BS 4
[1]
[1]
CCW CW
199930635
The direction of rotation is determined with a view to the output shaft (LSS).
• CW = Clockwise
• CCW = Counterclockwise
The permitted direction of rotation [1] is indicated on the housing.
INFORMATION
If the drive has a through-going output shaft, the direction of rotation of the backstop
should be given as viewed towards shaft position 3.
When operated below the lift-off speed, wear can occur in the backstop.
Consult SEW-EURODRIVE for defining the maintenance intervals for:
• Input speed rates n1 < 950 rpm
• or any of the following gear unit designs
Size Input speed n1 [rpm]
X4K260 iN ≥ 200 950...1150
X4K260 iN ≥ 200 1150...1400
27
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Assembly/Installation
5 Required tools/resources
5 Assembly/Installation
5.1 Required tools/resources
Not included in the scope of delivery:
• Set of wrenches
• Torque wrench
• Mounting device
• Compensation elements (shims, spacing rings)
• Fasteners for input and output elements
• Lubricant (e.g. NOCO® fluid from SEW-EURODRIVE)
• For hollow shaft gear units → aids for assembly/disassembly onto the machine shaft
• Securing components for the gear unit base
5.2 Tolerances
The following tolerances apply.
28
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Assembly/Installation
Important notes 5
WARNING
An operator's machine that is not appropriately secured can fall during gear unit
installation or removal.
Severe or fatal injuries.
• Safeguard the customer machine against unintentional movement when installing
or removing the gear unit.
• Before releasing shaft connections, make sure there are no active torsional
moments present (tensions within the system).
WARNING
Danger of burns due to hot gear unit and hot gear unit oil.
Serious injury.
• Let the gear unit cool down before you start working on it.
• Carefully remove the oil level plug and the oil drain plug.
CAUTION
Danger due to unsecured mount-on components, e.g. keys.
Possible injury to persons due to falling parts.
• Install appropriate protective devices.
• Secure the mount-on components.
CAUTION
Risk of slipping due to lubricant leaking from damaged seals.
Minor injuries
• Check the gear unit and mount-on components for leaking lubricant.
CAUTION
Risk of injury due to protruding parts.
Minor injuries
• Gear units and mount-on components must not protrude into footways.
NOTICE
Improper installation and mounting may result in damage to the gear unit.
Possible damage to property.
• Note the following:
• Make sure that the customer components are designed for the load.
• The mounting position may only be changed after consultation with SEW-
EURODRIVE. The warranty will become void without prior consultation.
• The most important technical data is provided on the nameplate. Additional data
relevant for operation is available in drawings, on the order confirmation or any order-
specific documentation.
29
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Assembly/Installation
5 Installation requirements
• Do not modify the gear unit or the mount-on components without prior consultation
of SEW-EURODRIVE.
• Protect rotating drive parts, such as couplings, gears, or belt drives using suitable
devices that protect from contact.
• Install/mount the gear unit only in the specified mounting position on a level, vibration-
damping, and torsionally rigid support structure. Do not twist housing legs and
mounting flanges against each other.
• Make sure that the oil level and oil drain plugs, as well as the breather plugs are freely
accessible.
• Use plastic inserts if there is a risk of electrochemical corrosion between the gear unit
and the driven machine (connection between different metals such as cast iron and
high-grade steel). Also install the bolts with plastic washers. Always ground the gear
unit housing.
• It is important that only authorized personnel is allowed to assemble gear head units
with motors and adapters. Consult SEW-EURODRIVE.
• Do not weld anywhere on the drive. Do not use the drive as a ground point for welding
work. Welding may destroy gearing parts and bearings.
• Units installed outdoors must be protected from the sun. Suitable protective devices
are required, such as covers or roofs. Avoid any heat accumulation. The operator
must ensure that foreign objects do not impair the function of the gear unit (e.g. falling
objects or coverings).
• Protect the gear unit from direct cold air currents. Condensation may cause water to
accumulate in the oil.
• Gear units are supplied with a coating suitable for use in damp areas or in the open
air. Repair any damage to the paint work (e.g. on the breather).
• Do not modify the existing piping.
• The gear unit is delivered without oil fill.
• Observe the safety notes in the individual chapters.
30
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Assembly/Installation
Installing the gear unit 5
INFORMATION
The bolts must not be lubricated during assembly.
INFORMATION
The bolts must not be lubricated during assembly.
5.5.3 Foundation
To ensure quick and successful mounting, the type of foundation should be correctly
selected and the mounting carefully planned in advance. Foundation drawings with all
necessary construction and dimension details should be available.
To avoid harmful vibrations and oscillations, adequate rigidity must be ensured when
mounting the gear unit on a steel construction. The foundation must be dimensioned
according to weight and torque of the gear unit by taking account of the forces acting on
the gear unit.
Tighten retaining screws or nuts to the specified torque. Use the screws and tightening
torques specified in chapter "Gear unit mounting".
NOTICE
An improper foundation may result in damage to the gear unit.
Possible damage to property.
• The foundation must be level and flat; the gear unit may not be deformed when
the retaining screws are tightened. Unevenness must be leveled out appro-
• Observe the weight specified on the nameplate.
31
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Assembly/Installation
5 Filling the gear unit with oil
WARNING
Shafts can break if shaft axes are not aligned exactly.
Severe or fatal injuries.
• Refer to the separate operation instructions regarding the requirements of the
couplings.
The service life of the shafts, bearings and couplings depends on the precision of the
alignment of the shaft axes with each other.
Always try to achieve zero misalignment. When doing so, you should also consult the
special operating instructions regarding the requirements of the couplings, for example.
WARNING
Risk of crushing if the drive starts up unintentionally.
Severe or fatal injuries.
• De-energize the motor before you start working on the unit.
• Secure the motor against unintended power-up.
NOTICE
Improper oil filling may cause damage to the gear unit.
Possible damage to property.
• Note the following:
• Fill in the oil only when the gear unit is in the intended mounting position.
• Make sure the oil has ambient temperature when filling the gear unit.
• For gear units with external supply pipes, e.g. oil-air cooler, establish the connections
prior to the filling process.
• Fill the gear unit with the oil grade and oil quantity specified on the nameplate. The
oil quantity specified on the nameplate is an approximate quantity. The mark on the
oil level glass or oil dipstick is the decisive indicator for the correct oil level. For detailed
information, refer to "Changing the oil" (page 41).
NOTICE
Bearing, hosing or shaft may be damaged due to improper assembly.
Possible damage to property.
• Only use a mounting device for installing input and output elements. Use the
center bore and the thread on the shaft end for positioning.
• Never force belt pulleys, couplings, pinions, etc. onto the shaft end by hitting them
with a hammer. This may damage the bearing, the housing and the shaft.
• If belt pulleys are used, make sure the belt is tensioned correctly in accordance
with the manufacturer's instructions.
32
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Assembly/Installation
Temperature sensor /PT100 5
The following figure shows a mounting device for installing couplings or hubs on gear
unit or motor shaft ends. It may be possible to dispense with the thrust bearing on the
mounting device.
[1]
[2] [4] FX1 FX1 [4]
[3]
X1 X1
A B
356867979 651876363
[1] Shaft end A Incorrect
[2] Thrust bearing B Correct
[3] Coupling hub
[4] Hub
Avoid impermissibly high overhung loads: Install gear or chain sprockets according to
illustration B.
INFORMATION
Mounting is easier if you first apply lubricant to the output element and/or heat it up
briefly (to 80 ... 100 ˚C).
A 24 PG9, PG11
35
Ø8
34
G1/2
359154443
Dimension A = 150 mm
33
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Assembly/Installation
5 Temperature sensor /PT100
3
2 1
359158539
[1] [2] Resistor element connection
34
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Startup
Important notes on startup 6
6 Startup
6.1 Important notes on startup
NOTICE
Improper startup may result in damage to the gear unit.
Possible damage to property.
• Note the following:
• Before startup, check that the oil level is correct. Refer to the unit's nameplate for
lubricant fill quantities.
• Prior to startup, make sure the monitoring devices (pressure switch, temperature
switch etc.) are fully operational.
• The most important technical data is provided on the nameplate. Additional data
relevant for operation is available in drawings, on the order confirmation or any order-
specific documentation.
• Ensure that all retaining screws are tight after the gear unit has been installed.
• Make sure that the orientation has not changed after tightening the mounting elements.
• Ensure that rotating shafts as well as couplings are equipped with suitable protective
covers.
• It is essential that there is no open fire or risk of sparks when working on the gear unit.
• Protect the gear unit from falling objects.
• For gear units with long-term protection: Replace the screw plug at the location
indicated on the gear unit with a breather plug (position → see order documents).
• Remove transport fixtures prior to startup.
• Adhere to the safety notes in the individual chapters.
• From size X..220, avoid no-load operation independent of the driven machine. The
reason is that operation with a load below the minimum load might damage the rolling
bearing of the gear unit.
The direction of rotation is specified as viewed onto the output shaft (LSS):
• Clockwise (CW)
• Counterclockwise (CCW)
35
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Startup
6 Gear unit shutdown/conservation
[1]
CCW CW
199930635
INFORMATION
Gear units with water cooling system: disrupt the cooling water supply and drain the
water from the cooling circuit. Gear units with oil supply system: Please contact
SEW-EURODRIVE.
Additional conservation measures are required if the gear unit is to be shut-down for a
longer period. Depending on the location, the ambient conditions, and the lubrication
state, even a few weeks of downtime might require conservation measures.
36
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Startup
Gear unit shutdown/conservation 6
INFORMATION
For gear units with contactless sealing systems, consult SEW-EURODRIVE.
For gear units without contactless sealing systems, you may also use the oil type
indicated on the nameplate to perform the conservation. In this case, the gear unit
must be completely filled with clean oil. Replace the breather filter with a screw plug
and fill in the oil from the highest point of the gear unit. In order to provide for suffi-
cient conservation, all the gearing and bearing components must be completely
covered in oil.
Prior to startup, re-install the breather filter. Observe the information on the name-
plate regarding the oil grade and quantity.
INFORMATION
Consult the respective supplier regarding the compatibility with the oil that is used
and the length of corrosion protection for your particular gear unit model.
Observe the information in chapter "Storage and Transport Conditions" in the corres-
ponding operating instructions. This chapter provides information on the possible
storage periods in conjunction with adequate packaging – depending on the storage
location.
Prior to re-startup, observe chapter "Startup" in the corresponding operating
instructions.
37
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Inspection/Maintenance
7 Preliminary work for inspection and maintenance
7 Inspection/Maintenance
7.1 Preliminary work for inspection and maintenance
Observe the following notes before you start with inspection/maintenance work.
WARNING
Risk of crushing if the drive starts up unintentionally.
Severe or fatal injuries.
• De-energize the motor before you start working on the unit.
• Secure the motor against unintended power-up.
WARNING
A customer machine that is not appropriately secured can fall during gear unit install-
ation or removal.
Severe or fatal injuries.
• Safeguard the customer machine against unintentional movement when installing
or removing the gear unit.
• Before releasing shaft connections, be sure that there are no active torsional
moments present (tensions within the system).
WARNING
Danger of burns due to hot gear unit and hot gear unit oil.
Severe injuries.
• Let the gear unit cool down before you start working on it.
• Carefully remove the oil level plug and the oil drain plug.
NOTICE
Filling in the wrong oil may result in significantly different lubricant characteristics.
Possible damage to property.
• Do not mix different synthetic lubricants and do not mix synthetic with mineral
lubricants.
NOTICE
Improper maintenance may result in damage to the gear unit.
Possible damage to property.
• Note the following:
• Strict adherence to the inspection and maintenance intervals is absolutely necessary
to ensure safe working conditions.
• When using primary gearmotors, also observe the maintenance notes for motors and
primary gear units in the accompanying operating instructions.
• Observe chapter "Tightening torques" (page 31).
• Use only original spare parts according to the delivered spare and wear parts lists.
• If you remove the inspection cover, you must apply new sealing compound to the
sealing surface. Otherwise, the sealing properties of the gear unit might be impaired.
Consult SEW-EURODRIVE.
• Prevent foreign particles from entering into the gear unit during maintenance and
inspection work.
• Never clean the gear unit with a high-pressure cleaning system. Water might enter
the gear unit and the seals might be damaged.
38
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Inspection/Maintenance
Inspection and maintenance intervals 7
• Perform safety and function tests following all maintenance and repair work.
• Replace any brittle seals.
• For third-party parts, such as cooling systems, observe the separate inspection and
maintenance intervals of the manufacturer's documentation.
• Observe the safety notes in the individual chapters.
39
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Inspection/Maintenance
7 Checking the oil level
30000
[h]
25000
20000
[1] [A]
CLP HC
15000
10000 [A]
CLP
5000
0
70 80 90 100 110 [°C] 120
[2]
INFORMATION
In order to optimize the lubricant change intervals, SEW-EURODRIVE recommends
that the gear unit oil be analyzed regularly.
40
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Inspection/Maintenance
Changing the oil 7
WARNING
Danger of burns due to hot gear unit and hot gear unit oil.
Serious injury.
• Carefully remove the oil level plug and the oil drain plug.
NOTICE
Improper oil change may result in damage to the gear unit.
Possible damage to property.
• Note the following:
• Perform the oil change quickly after you have switched off the gear unit to prevent
solids from settling. You should drain the oil while it is still warm. Avoid oil temperat-
ures of significantly more than 50 °C.
• Always fill the gear unit with the same oil grade as before. Mixing oils of different
grades and/or manufacturers is not permitted. Especially synthetic oils may not be
mixed with mineral oils or other synthetic oils. When switching from mineral oil and/
or when switching from synthetic oil of one basis to synthetic oil of another basis,
thoroughly flush the gear unit with the new oil grade.
• Refer to the lubricant table to determine which oil of the various lubricant manufacturers
can be used.
• Information such as the oil grade, oil viscosity and required oil quantity is given on
the nameplate of the gear unit. The oil quantity specified on the nameplate is an
approximate quantity. The mark on the oil level glass or oil dipstick is the decisive
indicator for the correct oil level.
• When changing the oil, flush the gear unit interior thoroughly with oil to remove oil
sludge, oil residue, and abrasion. Use the same oil grade for this purpose as for
operating the gear unit. Fill in fresh oil only after all residues have been removed.
• For the position of the oil level plug, oil drain plug and breather plug, refer to the order
documents.
• Dispose of the used oil in accordance with applicable regulations.
• An oil level above the max marking could indicate that foreign liquids (e.g. water) have
entered. An oil level below the min marking could indicate a leakage. Find and
eliminate the cause before you fill in new oil.
• Empty accessories (e.g. filters) and piping if required.
• Empty the oil-bearing system of gear units with circulation lubrication and oil supply
systems according to the manufacturer's maintenance instructions.
• Elements for controlling the oil level, oil drain, and oil fill openings are indicated by
safety symbols.
41
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Inspection/Maintenance
7 Refilling grease
7.6.2 Procedure
Procedure for gear units without oil expansion tank and shaft end pump.
[2]
[1]
4605382667
42
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Inspection/Maintenance
Split housing 7
Used grease, including contaminants and sand, is in this way pressed out of the sealing
gap.
INFORMATION
Immediately remove the old grease that leaked out.
43
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Lubricants
8 Information on lubricant selection
8 Lubricants
8.1 Information on lubricant selection
NOTICE
Selecting improper lubricants may damage the gear unit.
Possible damage to property.
• Note the following:
• The oil viscosity and type (mineral/synthetic) to be used are determined by SEW-
EURODRIVE specifically for each order. This information is noted in the order
confirmation and on the gear unit's nameplate.
You must contact SEW-EURODRIVE in case of a deviation from this specification.
This lubricant recommendation in no way represents a guarantee as to the quality of
the lubricant delivered by the respective supplier. Each lubricant manufacturer is
responsible for the quality of its product.
• Before startup, ensure that the gear unit is filled with the correct oil grade and quantity.
Refer to the nameplate of the gear unit and the lubricant table in the following chapter
for information.
• Do not mix different synthetic lubricants and do not mix synthetic with mineral
lubricants.
• Check the compatibility of the greases and oils used.
44
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
bp
6)
IS O,NLGI ® ARAL FUCHS
Q8
Oil Mo b il LUBRICATION Trib o l Op tim o l TO T A L
DIN (IS O) S h e ll TEXACO
°C -50 0 +50 +100
Standard
Mobilgear XMP 320 S h e ll Om a la BP En e rg o l Klü b e ro il Ara l De g o l Me ro p a Alp h a S P 320 Op tig e a r Renolin CLP 320 Plus Go ya NT 320 Ca rte r EP
-10 +40 CLP CC VG 320 Mobilgear 600XP 320 F 320 GR-XP -320 GEM 1-320 N BG 320 320 Trib o l 1100/320 BM 320 Renolin High Gear 320 320
+20
3) Mobilgear XMP 150 BP En e rg o l Klü b e ro il Ara l De g o l Me ro p a Alp h a S P 150 Op tig e a r Renolin CLP 150 Plus
-20 CLP CC VG 150 Go ya NT 150
Mobilgear 600XP 150 GR-XP -150 GEM 1-150 N BG 150 150 Trib o l 1100/150 BM 150 Renolin High Gear 150
-15 +30 Mobilgear XMP 220 S h e ll Om a la BP En e rg o l Klü b e ro il Ara l De g o l Me ro p a Alp h a S P 220 Op tig e a r Renolin CLP 220 Plus Ca rte r EP
CLP CC VG 220 Mobilgear 600XP 220 BG 220 Trib o l 1100/220 Go ya NT 3220
F 220 GR-XP -220 GEM 1-220 N 220 BM 220 Renolin High Gear 320 220
+45 Mobilgear XMP 460 S h e ll Om a la BP En e rg o l Klü b e ro il Ara l De g o l Me ro p a Alp h a S P 460 Op tig e a r Renolin CLP 460 Plus Ca rte r EP
-5 CLP CC VG 460 Go ya NT 460
Mobilgear 600XP 460 F 460 GR-XP -460 GEM 1-460 N BG 460 460 Trib o l 1100/460 BM 460 Renolin High Gear 460 460
Mobilgear XMP 680 S h e ll Om a la BP En e rg o l Klü b e ro il Me ro p a Alp h a S P 680 Op tig e a r Renolin CLP 680 Plus Ca rte r EP
0 +50 Go ya NT 680
CLP CC VG 680 Mobilgear 600XP 680 F 680 GR-XP -680 GEM 1-680 N 680 Trib o l 1100/680 BM 680 Renolin High Gear 680 680
Standard Mobilgear SHC Alp h a s yn Renolin CLP 320 Plus
S h e ll Om a la BP En e rs yn Klü b e rs yn th P in n a c le Op tig e a r Ca rte r S H
-25 +40 CLP HC VG 320 XMP 320 EP 320 Renolin High Gear El Gre c o 320
HD 320 EP -XF-320 GEM 4-320 N EP 320 S yn th e tic X 320 320
Mobil SHC 632 Synth 320
3) S h e ll Om a la BP En e rs yn Klü b e rs yn th Op tig e a r Re o lin Un is yn
4) -40 +10 CLP HC VG 68 Mo b il S HC 626
HD 68 EP -XF-68 GEM 4-68 N S yn th e tic X 68 CLP 68
Mobilgear SHC
-35 +20 S h e ll Om a la BP En e rs yn Klü b e rs yn th P in n a c le Alp h a s yn Op tig e a r Re o lin Un is yn Ca rte r S H
4) CLP HC VG 150 XMP 150 El Gre c o 150
HD 150 EP -XF-150 GEM 4-150 N EP 150 EP 150 S yn th e tic X 150 CLP 150 150
Mobil SHC 629
Mobilgear SHC Op tig e a r Renolin CLP 320 Plus
-30 +30 S h e ll Om a la BP En e rs yn Klü b e rs yn th P in n a c le Alp h a s yn Ca rte r S H
CLP HC VG 220 XMP 220 S yn th e tic X 220 Renolin High Gear El Gre c o 220
HD 220 EP -XF-220 GEM 4-220 N EP 220 EP 220 220
Mobil SHC 630 Synth 220
Mobilgear SHC Renolin CLP 320 Plus
S h e ll Om a la BP En e rs yn Klü b e rs yn th P in n a c le Alp h a s yn Op tig e a r Ca rte r S H
-20 +50 VG 460 XMP 460 Renolin High Gear El Gre c o 460
CLP HC HD 460 EP -XF-460 GEM 4-460 N EP 460 EP 460 S yn th e tic X 460 460
Mobil SHC 634 Synth 460
Mobilgear SHC Op tig e a r
S h e ll Om a la BP En e rs yn Klü b e rs yn th P in n a c le Re o lin Un is yn Ca rte r S H
-10 +60 CLP HC VG 680 XMP 680 El Gre c o 680
HD 680 EP -XF-680 GEM 4-680 N EP 680 S yn th e tic X 680 CLP 680 680
Mobil SHC 636
-10 +30
3) S h e ll Ca s s id a Klü b e rö l Op tile b Ge ra lyn
VG 68
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Flu id GL 68 4UH1-68 N HY 68 S F 460
CLP HC
NS F H1 3) S h e ll Ca s s id a Klü b e rö l Op tile b
-20 +20 VG 220
Flu id GL 220 4UH1-220 N GT 220
3) S h e ll Ca s s id a Klü b e rö l Op tile b
4) -40 -10 VG 460
Flu id GL 460 4UH1-460N GT 460
Information on lubricant selection
Lubricants
45
8
Lubricants
8 Lubricant fill quantities
X.K..
Size Oil quantity [l]
X4K260 270
INFORMATION
• The greases may only be replaced within the same group. It is not permitted to
mix different groups.
• If a customer wants to use a grease that is not listed in the table, the customer
has to make sure that it is suitable for the intended application.
46
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Malfunctions/Troubleshooting
Troubleshooting information 9
9 Malfunctions/Troubleshooting
9.1 Troubleshooting information
Read the following notes before you proceed.
WARNING
Risk of crushing if the drive starts up unintentionally.
Severe or fatal injuries.
• De-energize the motor before you start working on the unit.
• Secure the motor against unintended power-up.
WARNING
Danger of burns due to hot gear unit and hot gear unit oil.
Serious injury.
• Let the gear unit cool down before you start working on it.
• Carefully remove the oil level plug and the oil drain plug.
NOTICE
Improper handling of the gear unit and the motor may lead to damage.
Possible damage to property.
• Only qualified personnel is permitted to separate drive and motor and to carry out
repair work on SEW drives.
• Consult the SEW-EURODRIVE customer service.
47
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Malfunctions/Troubleshooting
9 Possible gear unit malfunctions
48
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Malfunctions/Troubleshooting
Disposal 9
9.4 Disposal
Dispose gear units in accordance with the regulations in force regarding respective
materials:
• Steel scrap
– Housing parts
– Gears
– Shafts
– Rolling bearing
• Collect waste oil and dispose of it according to the regulations in force.
49
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Index
10
10 Index
A N
Accessories.............................................................25 Nameplate...............................................................16
Aligning the shaft axis............................................. 32 Notes
B Designation in the documentation........................ 5
Backstop O
Design................................................................ 27 Oil drain...................................................................26
Startup................................................................35 Oil level check.........................................................40
Breather.................................................................. 26 Output shaft............................................................ 22
C P
CCW....................................................................... 27 Packaging............................................................... 14
Changing the oil...................................................... 41 Preliminary work..................................................... 30
Check the oil consistency....................................... 40 PT100..................................................................... 27
Copyright...................................................................6 R
Customer service.................................................... 47 Refilling grease....................................................... 42
CW.......................................................................... 27 Rolling bearing greases.......................................... 46
D S
Directions of rotation dependencies........................20 Safety notes.............................................................. 7
Disposal.................................................................. 49 Designation in the documentation........................ 5
E Structure of the embedded safety notes.............. 5
Embedded safety notes............................................ 5 Structure of the section-related safety notes........5
External conservation............................................. 14 Safety symbols on the gear unit................................8
F Sealing grease........................................................ 46
Foundation.............................................................. 31 Sealing systems......................................................23
Section-related safety notes..................................... 5
G
Shaft position.......................................................... 19
Gear unit mounting................................................. 31
Shutting down gear units........................................ 36
Gearing and shafts..................................................21
Signal words in the safety notes............................... 5
Greasing points.......................................................24
Splash lubrication....................................................25
H Split housing........................................................... 43
Housing...................................................................21 Stickers on the gear unit........................................... 8
I Storage conditions.................................................. 14
Input shaft............................................................... 22 Surface protection...................................................24
Inspection intervals................................................. 39 T
Installing the gear unit.............................................31 Temperature sensor
Internal conservation...............................................14 Assembly............................................................33
L Dimensions........................................................ 33
Lubricant change intervals...................................... 39 Electrical connection.......................................... 34
Lubricants............................................................... 44 Structure.............................................................27
Lubricating greases.................................................46 Technical data.................................................... 34
Lubrication types.....................................................25 Tightening torques.................................................. 31
Tolerances.............................................................. 28
M
Transport.................................................................12
Maintenance intervals............................................. 39
Transport conditions............................................... 14
Malfunctions............................................................47
Type designation of the gear unit............................17
Mounting position....................................................18
Mounting position and standard mounting surface. 19 V
Mounting surface.................................................... 19 Visual oil level check...............................................26
50
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Index
10
W
Warning notes on the gear unit.................................8
Waste oil................................................................. 49
51
Installation and Operating Instructions – Helical and Bevel-Helical Gear Units X.. Series
Technical specification to the order
Date: 16.10.2013
valve
ISO code /viscosity : CLP HC 320
Lubricant volume [l] : 270,000
corrosion prot. lubr. [l] : 0,220
Lubricant type : Synth.Oil
Scope of delivery lubricant : Without oil filling
Temperature switch/sensor : PT100 in separate thermowell
Gear unit venting : Special
Special gear unit venting : staubdichtes
Entlüftungsventil /
dust-proof breather valve
Sealing system HSS : Taconite / Regreasable
Pos. greasing nipple inp. shaf : Extended to mounting surf. F2
HSS oil seal material : FKM
Sealing system LSS : Taconite / Regreasable
Pos. greasing nipple outp. sha : Extended to mounting surface F1 or F2
LSS oil seal material : FKM
Oil seal grease : synthetic
Backstop : Included
Backstop type : Standard
Extended storage : Yes
Additional description (ETO) : - Axial-Lüfter
- Lüfterhaube RAL1003/OS2
- verstärkte Fettleitung
zur Nachschmierung /
- Axial-fan
- Cover RAL1003/OS2
- forced grease pipe
Dokumentation language / qty : German / 1
Documentation no. A : 19358806
Dokumentation language / qty : Spanish / 1
Documentation no. B : 19358903
DFFRUGLQJWR6WDQGDUG(&
$7(;IRUILQLVKERUHGSLORW
ERUHGDQGXQERUHGFRXSOLQJV
7\SH$'5$'5.DQG$95
7\SH $=5DQG$=5VKRUW
7\SH$5$=5
7\SH$=95
7\SH$5ZLWKWDSHUFODPSLQJVOHHYH
7KH32/<1250LVDWRUVLRQDOO\HODVWLFMDZFRXSOLQJ,WLVDEOHWRFRPSHQVDWHRIIVHWRI
VKDIWVHJFDXVHGE\PDQXIDFWXULQJLQDFFXUDFLHVWKHUPDOH[SDQVLRQHWF
7DEOHRI&RQWHQWV
7HFKQLFDO'DWD
+LQWV
&RXSOLQJ6HOHFWLRQ
*HQHUDO+LQWV
6DIHW\DQG$GYLFH+LQWV
*HQHUDO+LQWVWR'DQJHU
3URSHU8VH
6WRUDJH
$VVHPEO\
&RPSRQHQWVRIWKH&RXSOLQJV
$VVHPEO\RIWKH&RXSOLQJ*HQHUDO
$VVHPEO\RIWKH7\SH$5
$VVHPEO\RIWKH7\SH$'5$'5.DQG$95
$VVHPEO\RIWKH7\SH$=5$=5VKRUWDQG$=95
$VVHPEO\RIWKH7\SH$5$=5
$VVHPEO\RIWKH7DSHU&ODPSLQJ6OHHYH
+LQW5HJDUGLQJWKH)LQLVK%RUH
'LVSODFHPHQWV$OLJQPHQWRIWKH&RXSOLQJV
6SDUHV,QYHQWRU\&XVWRPHU6HUYLFH$GGUHVVHV
(QFORVXUH$
+LQWVDQG,QVWUXFWLRQV5HJDUGLQJWKH8VHLQ +D]DUGRXV$UHDV
0DUNLQJRI&RXSOLQJIRUWKH+D]DUGRXV$UHD
6WDUWLQJ
%UHDNGRZQV&DXVHVDQG(OLPLQDWLRQ
(&&HUWLILFDWHRI&RQIRUPLW\$FFRUGLQJWRWKH(&6WDQGDUGV(&
'DWHG0DUFK
7HFKQLFDO'DWD
6L]H
WR
6L]H
WR
SLFWXUH32/<1250W\SH$5
7DEOHGLPHQVLRQVDQGWRUTXHVW\SH$5
32/<1250 $5FDVWLURQ(1*-/
(ODVWRPHUULQJ 'LPHQVLRQV>PP@
6L]H
SDUW )LQLVK 7KUHDGIRU :HLJKW
*HQHUDO >NJ@
WRUTXH>1P@ ERUH VHWVFUHZV
7.1 7.PD[ GPD[ /$5 O V ' + ' G+ 1 * W
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
VWDQGDUGPDWHULDO3HUEXQDQ1%56KRUH$IRUVL]HWRXVHRI'=LQGLYLGXDOHODVWRPHUV
ERUHV+ZLWKNH\ZD\',1SDJH>-6@DQGWKUHDGIRUVHWVFUHZRQWKHNH\ZD\
WLJKWHQLQJWRUTXHRIVHWVFUHZVVHHWDEOH
ZHLJKWVDSSO\IRUPD[ERUHGLDPHWHUVZLWKIHDWKHUNH\DFFRUGLQJWR',1VKHHW
7DEOHVHWVFUHZV',1(1,62
6L]H
'LPHQVLRQ*>PP@ 0 0 0 0 0 0 0 0 0
7LJKWHQLQJWRUTXH7$>1P@
7DEOHGLPHQVLRQVW\SH$'5DQG$'5.
32/<1250 $'5DQG$'5.W\SH$95FRUUHVSRQGLQJWRFRPSRQHQWV'DQG'UHIOHFWHG
FDVWLURQ(1*-/FRPSRQHQW''NIODQJHKXEQRGXODULURQ(1*-6
'LPHQVLRQV>PP@
0D[ILQLVK 7KUHDGIRU
*HQHUDO
6L]H ERUH VHWVFUHZV
/$'5
G G OO V V ' + ' ' G+ 1 0 : * W W
/$'5.
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
7DEOHWRUTXHVDQGZHLJKWVW\SH$'5DQG$'5.
6L]H
(ODVWRPHUULQJ SDUW 7.1
WRUTXH>1P@ 7.PD[
:HLJKW $'5
>NJ@ $'5.
7DEOHDUUDQJHPHQWRIWKHFDSVFUHZV',1(1,62
6L]H
6FUHZVL]H0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
6FUHZOHQJWKO
4XDQWLW\]
'LPHQVLRQ'
7LJKWHQLQJWRUTXH
7$>1P@
ERUHV+ZLWKNH\ZD\',1SDJH>-6@DQGWKUHDGIRUVHWVFUHZRQWKHNH\ZD\
WLJKWHQLQJWRUTXHRIVHWVFUHZVVHHWDEOH
VWDQGDUGPDWHULDO3HUEXQDQ1%56KRUH$IRUVL]HWRXVHRI'=LQGLYLGXDOHODVWRPHUV
ZHLJKWVDSSO\IRUPD[ERUHGLDPHWHUVZLWKIHDWKHUNH\DFFRUGLQJWR',1VKHHW
SHUIODQJHKXE
7HFKQLFDO'DWD
SLFWXUH
32/<1250W\SH$=5
7DEOHGLPHQVLRQVDQGWRUTXHVW\SH$=5
32/<1250$=5FDVWLURQ(1*-/FRPSRQHQW1VWHHO6-*
'URSRXW (ODVWRPHUUULQJ 'LPHQVLRQV>PP@
FHQWHU SDUW )LQLVK 7KUHDGIRU :HLJKW
6L]H *HQHUDO
OHQJWK/ WRUTXH>1P@ ERUH VHWVFUHZV >NJ@
>PP@ 7.1 7.PD[ GPD[ /$=5 O O V O '+ ') G+ 0 * W
0
0
0
0
0
0
0
0
0
0
0
0
7DEOHDUUDQJHPHQWRIWKHFDSVFUHZV',1(1,62
6L]H
6FUHZVL]H0 0 0 0 0 0 0 0 0 0 0 0 0
6FUHZOHQJWKO
'LPHQVLRQ'
4XDQWLW\]
7LJKWHQLQJWRUTXH7$>1P@
VWDQGDUGPDWHULDO3HUEXQDQ1%56KRUH$
ERUHV+ZLWKNH\ZD\',1SDJH>-6@DQGWKUHDGIRUVHWVFUHZRQWKHNH\ZD\
WLJKWHQLQJWRUTXHRIVHWVFUHZVVHHWDEOH
ZHLJKWVDSSO\IRUPD[ERUHGLDPHWHUVZLWKIHDWKHUNH\DFFRUGLQJWR',1VKHHW
HDFKIODQJHFRQQHFWLRQ
7HFKQLFDO'DWD
SLFWXUH32/<1250 W\SH$=5VKRUW SLFWXUH32/<1250 W\SH$5$=5
7DEOHGLPHQVLRQVW\SH$=5VKRUWDQG$5$=5
32/<1250$=5VKRUWDQG$5$=5FDVWLURQ(1*-/FRPSRQHQW1VWHHO6-*
'LPHQVLRQV>PP@
*HQHUDO 7KUHDGIRU
6L]H
VHWVFUHZV
/$=5VKRUW /$5$=5 O O O V O / '+ '') G+ 1 0
* W
0
0
0
0
0
0
0
0
0
0
0
0
7DEOHWRUTXHVDQGILQLVKERUHVW\SH$=5VKRUWDQG$5$=5
6L]H
(ODVWRPHUULQJ SDUW 7.1
WRUTXH>1P@ 7.PD[
0D[ILQLVKERUH G
>PP@ G
:HLJKW $=5VKRUW
>NJ@ $5$=5
7DEOHDUUDQJHPHQWRIWKHFDSVFUHZV',1(1,62
6L]H
6FUHZVL]H0 0 0 0 0 0 0 0 0 0 0 0 0
6FUHZOHQJWKO
'LPHQVLRQ'
4XDQWLW\]
7LJKWHQLQJWRUTXH
7$>1P@
WLJKWHQLQJWRUTXHRIVHWVFUHZVVHHWDEOH
VWDQGDUGPDWHULDO3HUEXQDQ1%56KRUH$
ERUHV+ZLWKNH\ZD\',1SDJH>-6@DQGWKUHDGIRUVHWVFUHZRQWKHNH\ZD\
ZHLJKWVDSSO\IRUPD[ERUHGLDPHWHUVZLWKIHDWKHUNH\DFFRUGLQJWR',1VKHHW
HDFKIODQJHFRQQHFWLRQ
7HFKQLFDO'DWD
SLFWXUH32/<1250 W\SH$=95
7DEOHGLPHQVLRQVW\SH$=95
32/<1250$=95FDVWLURQ(1*-/FRPSRQHQW1DQG1YVWHHO6-*
'LPHQVLRQV>PP@
*HQHUDO 7KUHDGVIRU :HLJKW
6L]H
VHWVFUHZV >NJ@
/$=95 O O V O O / '+ ') G+ 0
* W
0
0
0
0
0
0
0
0
7DEOHWRUTXHVDQGILQLVKERUHVW\SH$=95
6L]H
(ODVWRPHUULQJ SDUW 7.1
WRUTXH>1P@ 7.PD[
)LQLVKERUH >PP@ GPD[
7DEOHDUUDQJHPHQWRIWKHFDSVFUHZV',1(1,62
6L]H
6FUHZVL]H0 0 0 0 0 0 0 0 0
6FUHZOHQJWKO
'LPHQVLRQ'
4XDQWLW\]
7LJKWHQLQJWRUTXH7$>1P@
WLJKWHQLQJWRUTXHRIVHWVFUHZVVHHWDEOH
ZHLJKWVDSSO\IRUPD[ERUHGLDPHWHUVZLWKIHDWKHUNH\DFFRUGLQJWR',1VKHHW
VWDQGDUGPDWHULDO3HUEXQDQ1%56KRUH$
ERUHV+ZLWKNH\ZD\',1SDJH>-6@DQGWKUHDGIRUVHWVFUHZRQWKHNH\ZD\
HDFKIODQJHFRQQHFWLRQ
7HFKQLFDO'DWD
SLFWXUH32/<1250W\SHZLWKWDSHUFODPSLQJVOHHYH
7DEOHGLPHQVLRQVW\SHZLWKWDSHUFODPSLQJVOHHYH
32/<1250 ZLWKWDSHUFODPSLQJVOHHYHKXE7%DQG7%FDVWLURQ(1*-/
(ODVWRPHUULQJ 'LPHQVLRQV>PP@
VSHHG 7DSHU
SDUW )LQLVKERUH
*HQHUDO :HLJKW
6L]H QPD[ FODPSLQJ
WRUTXH>1P@ GG >NJ@
>PLQ@ OO V / ' '+ 1 VOHHYH
7.1 7.PD[ PLQ PD[
VWDQGDUGPDWHULDO3HUEXQDQ1%56KRUH$
ERUHV+ZLWKNH\ZD\',1SDJH>-6@DQGWKUHDGIRUVHWVFUHZRQWKHNH\ZD\
ZHLJKWVDSSO\IRUPD[ERUHGLDPHWHUVZLWKIHDWKHUNH\DFFRUGLQJWR',1VKHHW
32/<1250FRXSOLQJVZLWKVXFKFRPSRQHQWVWKDWDUHLQDSRVLWLRQWRSURGXFHKHDW
VSDUNVDQGVWDWLFFKDUJHHJLQFRPELQDWLRQZLWKEUDNHGUXPVGLVNVRYHUORDGV\VWHPV
OLNHWRUTXHOLPLWHUVIDQVHWFDUHQRWSHUPLWWHGIRUWKHXVHLQKD]DUGRXVORFDWLRQV
$VHSDUDWHWHVWKDVWREHSHUIRUPHG
+LQWV
&RXSOLQJ6HOHFWLRQ
&$87,21
)RUDFRQWLQXRXVDQGWURXEOHIUHHRSHUDWLRQRIWKHFRXSOLQJLWPXVWEHGHVLJQHGDFFRUGLQJWR
WKHVHOHFWLRQLQVWUXFWLRQVDFFRUGLQJWR',1SDUWIRUWKHSDUWLFXODUDSSOLFDWLRQ
VHH32/<1250 FDWDORJXH
,IWKHRSHUDWLQJFRQGLWLRQVSHUIRUPDQFHVSHHGFKDQJHVDWHQJLQHDQGPDFKLQHFKDQJH
WKHFRXSOLQJVHOHFWLRQPXVWEHFKHFNHGDJDLQ
3OHDVHQRWHWKDWWKHWHFKQLFDOGHWDLOVUHJDUGLQJWKHWRUTXHUHIHUWRWKHHODVWRPHUSDUWRQO\
7KHWUDQVPLWWDEOHWRUTXHRIWKHVKDIWKXEFRQQHFWLRQKDVWREHYHULILHGE\WKHFXVWRPHUDQG
LVVXEMHFWWRKLVUHVSRQVLELOLW\
*HQHUDO+LQWV
3OHDVHUHDGWKURXJKWKHVHPRXQWLQJLQVWUXFWLRQVFDUHIXOO\EHIRUH\RXVHWWKHFRXSOLQJLQWRRSHUDWLRQ
3OHDVHSD\VSHFLDODWWHQWLRQWRWKHVDIHW\LQVWUXFWLRQV
7KH32/<1250FRXSOLQJLVVXLWDEOHDQGDSSURYHGIRUWKHXVHLQKD]DUGRXVDUHDV:KHQXVLQJ
WKHFRXSOLQJLQKD]DUGRXVDUHDVSOHDVHREVHUYHWKHVSHFLDOKLQWVDQGLQVWUXFWLRQVUHJDUGLQJVDIHW\LQ
HQFORVXUH$
7KHPRXQWLQJLQVWUXFWLRQVDUHSDUWRI\RXUSURGXFW3OHDVHNHHSWKHPFDUHIXOO\DQGFORVHWRWKHFRXSOLQJ
7KHFRS\ULJKWIRUWKHVHPRXQWLQJLQVWUXFWLRQVUHPDLQVZLWK.75.XSSOXQJVWHFKQLN*PE+
6DIHW\DQG$GYLFH+LQWV
&$87,21 'DPDJHVRQWKHPDFKLQHSRVVLEOH
$77(17,21 3RLQWLQJWRLPSRUWDQWLWHPV
35(&$87,21 +LQWVFRQFHUQLQJH[SORVLRQSURWHFWLRQ
+LQWV
*HQHUDO+LQWVRI'DQJHU
'$1*(5
6723 :LWKDVVHPEO\RSHUDWLRQDQGPDLQWHQDQFHRIWKHFRXSOLQJLWKDVWREHPDGHVXUHWKDWWKH
HQWLUHGULYHWUDLQLVSURWHFWHGDJDLQVWXQLQWHQWLRQDOHQJDJHPHQW<RXFDQEHVHULRXVO\KXUW
E\URWDWLQJSDUWV3OHDVHPDNHDEVROXWHO\VXUHWRUHDGWKURXJKDQGREVHUYHWKHIROORZLQJ
VDIHW\LQVWUXFWLRQV
$OORSHUDWLRQVRQDQGZLWKWKHFRXSOLQJKDYHWREHSHUIRUPHGWDNLQJLQWRDFFRXQWVDIHW\ILUVW
3OHDVHPDNHVXUHWRGLVHQJDJHWKHSRZHUSDFNEHIRUH\RXSHUIRUP\RXUZRUN
3URWHFWWKHSRZHUSDFNDJDLQVWXQLQWHQWLRQDOHQJDJHPHQWHJE\SURYLGLQJKLQWVDWWKHSODFHRIHQJDJHPHQW
RUUHPRYLQJWKHIXVHIRUFXUUHQWVXSSO\
'RQRWWRXFKWKHRSHUDWLRQDUHDRIWKHFRXSOLQJDVORQJDVLWLVLQRSHUDWLRQ
3OHDVHSURWHFWWKHFRXSOLQJDJDLQVWXQLQWHQWLRQDOWRXFK3OHDVHSURYLGHIRUWKHQHFHVVDU\SURWHFWLRQGHYLFHV
DQGFDSV
3URSHU8VH
<RXPD\RQO\DVVHPEOHRSHUDWHDQGPDLQWDLQWKHFRXSOLQJLI\RX
KDYHFDUHIXOO\UHDGWKURXJKWKHPRXQWLQJLQVWUXFWLRQVDQGXQGHUVWRRGWKHP
KDGWHFKQLFDOWUDLQLQJ
DUHDXWKRUL]HGWRGRVRE\\RXUFRPSDQ\
7KHFRXSOLQJPD\RQO\EHXVHGLQDFFRUGDQFHZLWKWKHWHFKQLFDOGDWDVHHWDEOHWRLQFKDSWHU
8QDXWKRUL]HGPRGLILFDWLRQVRQWKHFRXSOLQJGHVLJQDUHQRWDGPLVVLEOH:HGRQRWWDNHDQ\ZDUUDQW\IRUUHVXOWLQJ
GDPDJHV7RIXUWKHUGHYHORSWKHSURGXFWZHUHVHUYHWKHULJKWIRUWHFKQLFDOPRGLILFDWLRQV
7KH32/<1250GHVFULEHGLQKHUHFRUUHVSRQGVWRWKHWHFKQLFDOVWDWXVDWWKHWLPHRISULQWLQJRIWKHVHPRXQWLQJ
LQVWUXFWLRQV
6WRUDJH
7KHFRXSOLQJKXEVDUHVXSSOLHGLQSUHVHUYHGFRQGLWLRQDQGFDQEHVWRUHGDWDGU\DQGURRIHGSODFHIRU
PRQWKV
7KHIHDWXUHVRIWKHHODVWRPHUULQJV'=LQGLYLGXDOHODVWRPHUVUHPDLQXQFKDQJHGIRUXSWR\HDUVLQFDVHRI
IDYRXUDEOHVWRFNFRQGLWLRQV
&$87,21
7KHVWRUDJHURRPVPD\QRWLQFOXGHDQ\R]RQHJHQHUDWLQJGHYLFHVOLNHHJIOXRUHVFHQW
OLJKWVRXUFHVPHUFXU\YDSRXUODPSVRUHOHFWULFDOKLJKYROWDJHDSSOLDQFHV
+XPLGVWRUDJHURRPVDUHQRWVXLWDEOH
3OHDVHPDNHVXUHWKDWWKHUHLVQRFRQGHQVDWLRQ7KHEHVWUHODWLYHDLUKXPLGLW\LVXQGHU
$VVHPEO\
%DVLFDOO\WKHFRXSOLQJLVVXSSOLHGLQLQGLYLGXDOSDUWV%HIRUHDVVHPEO\WKHFRXSOLQJKDVWREHFRQWUROOHGIRU
FRPSOHWHQHVV
&RPSRQHQWVRIWKH&RXSOLQJV
&RPSRQHQWVRI32/<1250W\SH$5
6L]HWR 6L]HWR
SLFWXUH32/<1250 W\SH$5
6L]HWR 6L]HWR
SLFWXUH32/<1250 W\SH$'5SDUW
$VVHPEO\
&RPSRQHQWVRIWKH&RXSOLQJV
&RPSRQHQWVRI32/<1250W\SH$'5.SDUW
6L]HWR 6L]HWR
SLFWXUH32/<1250 W\SH$'5.SDUW
&RPSRQHQWVRI32/<1250W\SH$=5DQG$=5VKRUW
SLFWXUH32/<1250W\SH$=5DQG$=5VKRUW
$VVHPEO\
&RPSRQHQWVRIWKH&RXSOLQJV
&RPSRQHQWVRI32/<1250W\SH$5$=5
SLFWXUH32/<1250 W\SH$5$=5
&RPSRQHQWVRI32/<1250W\SH$=95
SLFWXUH32/<1250W\SH$=95
$VVHPEO\
&RPSRQHQWVRIWKH&RXSOLQJV
&RPSRQHQWVRI32/<1250W\SHZLWKWDSHUFODPSLQJVOHHYH
SLFWXUH32/<1250 W\SHZLWKWDSHUFODPSLQJVOHHYH
&RXSOLQJGHVLJQ
7% &DPVLGHGVFUHZLQJ
7% &ROODUVLGHGVFUHZLQJ
9DULRXVFRPELQDWLRQVRIWKHGHVLJQV7%DQG
7%DUHSRVVLEOH
SLFWXUHW\SHZLWKWDSHUFODPSLQJVOHHYH
KXEGHVLJQ7%DQG7%
$VVHPEO\
$VVHPEO\RIWKH&RXSOLQJ*HQHUDO
$77(17,21
:HUHFRPPHQGWRFKHFNERUHVVKDIWNH\ZD\DQGIHDWKHUNH\IRUGLPHQVLRQDODFFXUDF\
EHIRUHDVVHPEO\
35(&$87,21
3OHDVHSD\DWWHQWLRQWRWKHGDQJHURILJQLWLRQLQKD]DUGRXVDUHDV
'$1*(5
6723 7RXFKLQJWKHKHDWHGKXEVFDXVHVEXUQV
:HZRXOGUHFRPPHQGWRZHDUVDIHW\JORYHV
&$87,21
'XULQJWKHDVVHPEO\SOHDVHPDNHVXUHWKDWWKHVGLPHQVLRQVHHWDEOHWRRIWKH
UHVSHFWLYHW\SHLVREVHUYHGVRWKDWWKHKXEVGRQRWFRQWDFWHDFKRWKHUGXULQJRSHUDWLRQ
'LVUHJDUGLQJWKLVKLQWPD\FDXVHGDPDJHRQWKHFRXSOLQJ
$VVHPEO\RIWKH7\SH$5
$VVHPEOHWKHKXEVRQWRWKHVKDIWRIGULYLQJDQG
GULYHQVLGHVHHSLFWXUH
SLFWXUHDVVHPEO\RIWKHKXE
,QVHUWWKHHODVWRPHUULQJRU'=LQGLYLGXDO
HODVWRPHUVUHVSHFWLYHO\LQWRWKHFDPVHFWLRQRIWKH
GULYHRUGULYHQVLGHGKXEVHHSLFWXUH
SLFWXUHDVVHPEO\RIWKHHODVWRPHUULQJ
0RYHWKHSRZHUSDFNVLQD[LDOGLUHFWLRQXQWLOWKH
GLPHQVLRQVLVDFKLHYHGVHHSLFWXUH
,IWKHSRZHUSDFNVDUHDOUHDG\ILUPO\DVVHPEOHG
D[LDOPRYHPHQWRIWKHKXEVRQWKHVKDIWVDOORZVIRU
DGMXVWLQJWKHGLPHQVLRQVVHHSLFWXUH
)DVWHQWKHKXEVE\WLJKWHQLQJWKHVHWVFUHZV
',1(1,62ZLWKFXSSRLQWWLJKWHQLQJWRUTXH
VHHWDEOH
SLFWXUHFRXSOLQJDVVHPEO\
$VVHPEO\
$VVHPEO\RIWKH7\SH$'5$'5.DQG$95
3OHDVHSOXJWKHIODQJHKXEDQGWKHFDPULQJWRJHWKHU
VHHSLFWXUH
$WILUVWKDQGVFUHZWKHSDUWV
SLFWXUHDVVHPEO\RIWKHIODQJHKXEZLWKFDPULQJ
$VVHPEOHWKHKXEDQGIODQJHKXEZLWKFDPULQJRQWR
WKHVKDIWRIGULYLQJDQGGULYHQVLGHVHHSLFWXUH
7LJKWHQWKHVFUHZVZLWKDVXLWDEOHWRUTXHNH\WRWKH
WLJKWHQLQJWRUTXHV7$VKRZQLQWDEOH
SLFWXUHDVVHPEO\RIWKHKXEDQGIODQJHKXEZLWKFDPULQJ
,QVHUWWKHHODVWRPHUULQJRU'=LQGLYLGXDOHODVWRPHUV
UHVSHFWLYHO\LQWRWKHFDPVHFWLRQRIWKHGULYHRU
GULYHQVLGHGKXERUFDPULQJVHHSLFWXUH
SLFWXUHDVVHPEO\RIWKHHODVWRPHUULQJ
&$87,21
)RUWKHHDVLHUDVVHPEO\RIWKHHODVWRPHU
ULQJLIWKHDJJUHJDWHVKDYHDOUHDG\EHHQ
DVVHPEOHGZHZRXOGUHFRPPHQGWR
VHSDUDWHWKHHODVWRPHUULQJXSWRVL]HDW
RQHSRVLWLRQEHWZHHQWKHGDPSHUVVHH
SLFWXUH
)URPVL]HRQZHZRXOGUHFRPPHQGWR
VHSDUDWHWKHHODVWRPHUULQJEHWZHHQHYHU\
SLFWXUHDVVHPEO\KHOS SLFWXUHDVVHPEO\KHOS
VHFRQGGDPSHUIRUDQHDVLHUDVVHPEO\VHH RIWKHHODVWRPHUULQJ RIWKHHODVWRPHUULQJ
SLFWXUH XSWRVL]H IURPVL]HRQ
0RYHWKHSRZHUSDFNVLQD[LDOGLUHFWLRQXQWLOWKH
GLPHQVLRQVLVDFKLHYHGVHHSLFWXUH
,IWKHSRZHUSDFNVDUHDOUHDG\ILUPO\DVVHPEOHG
D[LDOPRYHPHQWRIWKHKXEVRQWKHVKDIWVDOORZVIRU
DGMXVWLQJWKHGLPHQVLRQVVHHSLFWXUH
)DVWHQWKHKXEVRUIODQJHKXEVE\WLJKWHQLQJWKH
VHWVFUHZV',1(1,62ZLWKFXSSRLQW
WLJKWHQLQJWRUTXHVHHWDEOH
SLFWXUHFRXSOLQJDVVHPEO\
&$87,21
+DYLQJVHWWKHFRXSOLQJLQWRRSHUDWLRQWKHWLJKWHQLQJWRUTXHRIWKHVFUHZVDQGZHDURI
HODVWRPHUULQJKDYHWREHLQVSHFWHGLQXVXDOPDLQWHQDQFHLQWHUYDOV
$VVHPEO\
$VVHPEO\RIWKH7\SH$=5$=5VKRUWDQG$=95
$VVHPEOHWKHFRXSOLQJIODQJHRQWRWKHVKDIWRI
GULYLQJRUGULYHQVLGHVHHSLFWXUH
7KHLQVLGHRIWKHFRXSOLQJIODQJHPXVWEHIOXVKZLWK
WKHIDFHVRIWKHVKDIWV
0RYHWKHSRZHUSDFNVLQD[LDOGLUHFWLRQXQWLOWKH
GLPHQVLRQ/LVDFKLHYHG
)DVWHQWKHFRXSOLQJIODQJHVE\WLJKWHQLQJWKH
VHWVFUHZV',1(1,62ZLWKFXSSRLQW
WLJKWHQLQJWRUTXHVHHWDEOH
SLFWXUHDVVHPEO\RIWKHFRXSOLQJIODQJHV
3OHDVHSOXJWKHGULYLQJIODQJHVDQGWKHHODVWRPHU
ULQJWRJHWKHUVHHSLFWXUH
SLFWXUHDVVHPEO\RIWKHGULYLQJIODQJHZLWKHODVWRPHUULQJ
3XWWKHDVVHPEOHGSDUWVEHWZHHQWKHFRXSOLQJ
IODQJHVVHHSLFWXUH
$WILUVWKDQGVFUHZWKHSDUWV
7LJKWHQWKHVFUHZVZLWKDVXLWDEOHWRUTXHNH\WRWKH
WLJKWHQLQJWRUTXHV7$VKRZQLQWDEOHDQG
3OHDVHFKHFNWKHVRUWKH/GLPHQVLRQVHHWDEOH
DQG
,IWKHSRZHUSDFNVDUHDOUHDG\ILUPO\DVVHPEOHG
D[LDOPRYHPHQWRIWKHFRXSOLQJIODQJHVRQWKH
VKDIWVDOORZVIRUDGMXVWLQJWKHGLPHQVLRQVRU/
VHHSLFWXUH
SLFWXUHFRXSOLQJDVVHPEO\
&$87,21
+DYLQJVHWWKHFRXSOLQJLQWRRSHUDWLRQWKHWLJKWHQLQJWRUTXHRIWKHVFUHZVDQGZHDURI
HODVWRPHUULQJKDYHWREHLQVSHFWHGLQXVXDOPDLQWHQDQFHLQWHUYDOV
$VVHPEO\
$VVHPEO\RIWKH7\SH$5$=5
$VVHPEOHWKHFRXSOLQJIODQJHRQWRWKHVKDIWRI
GULYLQJRUGULYHQVLGHVHHSLFWXUH
7KHLQVLGHRIWKHFRXSOLQJIODQJHPXVWEHIOXVKZLWK
WKHIDFHVRIWKHVKDIWV
SLFWXUHDVVHPEO\RIWKHIODQJHKXE
3OHDVHSOXJWKHKXEWKHHODVWRPHUULQJDQGWKH
GULYLQJIODQJHWRJHWKHUVHHSLFWXUH
SLFWXUHDVVHPEO\RIWKHKXEHODVWRPHUULQJDQGGULYLQJIODQJH
$VVHPEOHWKHSDUWVSXWWRJHWKHURQWRWKHRWKHUVKDIW
HQGVHHSLFWXUH
6HFXUHWKHKXEDQGWKHFRXSOLQJIODQJHE\IDVWHQLQJ
WKHVHWVFUHZV',1(1,62ZLWKFXSSRLQW
WLJKWHQLQJWRUTXHVHHWDEOH
SLFWXUHDVVHPEO\RIWKHFRPSRQHQWV
3RVLWLRQWKHPDFKLQHLQDZD\WKDWWKHGULYLQJIODQJH
DQGWKHFRXSOLQJIODQJHFDQEHVFUHZHGWRJHWKHU
)LUVWVFUHZWKHSDUWVPDQXDOO\DQGWLJKWHQWKH
VFUHZVZLWKDVXLWDEOHWRUTXHNH\DFFRUGLQJWRWKH
WLJKWHQLQJWRUTXHV7$LQGLFDWHGLQWDEOH
3OHDVHFKHFNWKHVGLPHQVLRQVHHSLFWXUH
SLFWXUHFRXSOLQJDVVHPEO\
&$87,21
+DYLQJVHWWKHFRXSOLQJLQWRRSHUDWLRQWKHWLJKWHQLQJWRUTXHRIWKHVFUHZVDQGZHDURI
HODVWRPHUULQJKDYHWREHLQVSHFWHGLQXVXDOPDLQWHQDQFHLQWHUYDOV
$VVHPEO\
$VVHPEO\RIWKH7DSHU&ODPSLQJ6OHHYH
$VVHPEO\RIWKHWDSHUFODPSLQJVOHHYH
)LWWKHFRXSOLQJHOHPHQWDQGWKHWDSHUFODPSLQJVOHHYHLQWRHDFKRWKHUPDNHVXUHWKDWWKHERUHVFRYHUHDFK
RWKHUDQGWLJKWHQWKHVHWVFUHZVVOLJKWO\3XWWKHFRXSOLQJHOHPHQWZLWKWKHWDSHUFODPSLQJVOHHYHRQWRWKHVKDIW
DQGWLJKWHQWKHVHWVFUHZVWRWKHWLJKWHQLQJWRUTXHVKRZQLQWDEOH
'XULQJWKHSURFHVVRIVFUHZLQJWKHKXELVSXVKHGRQWRWKHWDSHUVOHHYHVRWKDWWKHEXVKLVSUHVVHGRQWRWKH
VOHHYH7KHWDSHUFODPSLQJVOHHYHKDVWREHGULYHQIXUWKHULQWRWKHWDSHUERUHZLWKOLJKWEORZVRIDKDPPHUE\
PHDQVRIDVXLWDEOHVOHHYH$IWHUZDUGVWKHVHWVFUHZVKDYHWREHUHWLJKWHQHGWRWKHWLJKWHQLQJWRUTXHVKRZQLQ
WDEOH7KLVSURFHVVKDVWREHSHUIRUPHGDWOHDVWRQHWLPH
$IWHUWKHGULYHKDVEHHQRSHUDWHGXQGHUORDGRYHUDVKRUWSHULRGLQWLPHLWVKRXOGEHUHYLHZHGZKHWKHUWKH
VHWVFUHZVPD\KDYHXQVFUHZHG
$QD[LDOIDVWHQLQJRIWKHWDSHUORFNKXEFRXSOLQJKXEZLWKWDSHUFODPSLQJVOHHYHFDQRQO\EHUHDOL]HGE\D
SURSHUDVVHPEO\
&$87,21
:KHQXVLQJWKHJUXEVFUHZVIRUIL[LQJWKHWDSHUFODPSLQJVOHHYHVLQH[SORVLYHDUHDVSOHDVH
DGGLWLRQDOO\VHFXUHWKHPDJDLQVWVHOIORRVHQLQJHJZ/RFWLWHPHGLXPVWUHQJWK7DSHU
FODPSLQJVOHHYHVZLWKRXWXVLQJDIHDWKHUNH\DUHQRWSHUPLWWHGLQH[SORVLYHDUHDV
SLFWXUH32/<1250W\SHZLWKWDSHUFODPSLQJVOHHYH
'LVDVVHPEO\RIWKHWDSHUFODPSLQJVOHHYH
7KHWDSHUFODPSLQJVOHHYHLVGHWDFKHGLIWKHVHWVFUHZVDUHUHPRYHG$IWHUZDUGVRQHRIWKHVHWVFUHZVLVVFUHZHG
LQWRWKHWKUHDGRIWKHEXVKDVDSXOORIIVFUHZDQGWLJKWHQHG
7KHGHWDFKHGFRXSOLQJKXEFDQEHUHPRYHGPDQXDOO\IURPWKHVKDIWWRJHWKHUZLWKWKHWDSHUFODPSLQJVOHHYH
7DEOH
7DSHU 6FUHZGLPHQVLRQVV
FODPSLQJ * / 6: 7$ 4XDQWLW\
VOHHYH >LQFK@ >LQFK@ >PP@ >1P@
SLFWXUH:LWKZRUWKVHWVFUHZ%6:
$VVHPEO\
+LQW5HJDUGLQJWKH)LQLVK%RUH
.75VXSSOLHVWKHFRXSOLQJSDUWVDQGVSDUHSDUWVLQDQXQERUHGRUSLORWERUHGGHVLJQRQO\RQUHTXHVWRIWKH
FXVWRPHU6XFKSDUWVDUHPDUNHGDGGLWLRQDOO\ZLWKWKHV\PERO
&$87,21
7KHFXVWRPHULVUHVSRQVLEOHIRUDOOPDFKLQLQJSURFHVVHVSHUIRUPHGVXEVHTXHQWO\RQDOO
XQERUHGRUSLORWERUHGDVZHOODVILQLVKPDFKLQHGFRXSOLQJSDUWVDQGVSDUHSDUWVE\WKH
FXVWRPHU.75GRHVQRWWDNHDQ\ZDUUDQW\IRUDQ\LPSURSHUUHPDFKLQLQJSURFHVVHV
35(&$87,21
$Q\PHFKDQLFDOUHZRUNWRFRXSOLQJVWKDWDUHXVHGLQKD]DUGRXVDUHDVUHTXLUHDQH[SOLFLW
UHOHDVHE\.75
7KHRUGHUHUPXVWVHQGDGUDZLQJWR.75DFFWRZKLFKWKHPDQXIDFWXUHPXVWEHPDGH.75
FKHFNVWKLVGUDZLQJDQGUHWXUQVLWWRWKHRUGHUHUZLWKDSSURYDO
'LVSODFHPHQWV$OLJQPHQWRIWKH&RXSOLQJV
7KH32/<1250 FRPSHQVDWHVIRUGLVSODFHPHQWVSURGXFHGE\WKHVKDIWVWREHFRPELQHGDVVKRZQLQWDEOH
([FHVVLYHPLVDOLJQPHQWPD\EHFDXVHGE\LQDFFXUDWHDOLJQPHQWSURGXFWLRQWROHUDQFHVWKHUPDOH[SDQVLRQVKDIW
GHIOHFWLRQWZLVWLQJRIPDFKLQHIUDPHVHWF
&$87,21
,QRUGHUWRHQVXUHDORQJOLIHWLPHRIWKHFRXSOLQJDQGWRDYRLGGDQJHUVUHJDUGLQJWKHXVHLQ
KD]DUGRXVDUHDVWKHVKDIWHQGVPXVWEHDFFXUDWHO\DOLJQHG
3OHDVHDEVROXWHO\REVHUYHWKHGLVSODFHPHQWILJXUHVLQGLFDWHGVHHWDEOH,IWKHILJXUHV
DUHH[FHHGHGWKHFRXSOLQJLVGDPDJHG
7KHPRUHDFFXUDWHO\WKHFRXSOLQJLVDOLJQHGWKHKLJKHULVLWVGXUDELOLW\
,QFDVHRIDXVHLQKD]DUGRXVDUHDVIRUWKHH[SORVLRQJURXS,,&PDUNLQJ,,*'F,,&7;
RQO\WKHKDOIGLVSODFHPHQWILJXUHVVHHWDEOHDUHSHUPLVVLEOH
3OHDVHQRWH
7KHGLVSODFHPHQWYDOXHVPHQWLRQHGLQWDEOHDUHPD[LPXPYDOXHVZKLFKPD\QRWRFFXUDWWKHVDPHWLPH,I
WKHUDGLDODQGWKHDQJXODUGLVSODFHPHQWRFFXUDWWKHVDPHWLPHWKHVXPRIWKHGLVSODFHPHQWVPD\QRWH[FHHG
.URU .:
3OHDVHFKHFNZLWKDGLDOJDXJHUXOHURUIHHOHUZKHWKHUWKHSHUPLVVLEOHGLVSODFHPHQWILJXUHVRIWDEOHFDQEH
REVHUYHG
'LVSODFHPHQWV$OLJQPHQWRIWKH&RXSOLQJV
&RQWLQXDWLRQ
([DPSOHIRUWKHPLVDOLJQPHQW
FRPELQDWLRQVJLYHQLQSLFWXUH
([DPSOH
.5
.:
([DPSOH
.5
.:
7DEOHGLVSODFHPHQWILJXUHV
6L]H
0D[D[LDOGLVSODFHPHQW
.D>PP@
0D[UDGLDOGLVSODFHPHQWZLWK
Q PLQ .U>PP@
0D[UDGLDOGLVSODFPHQWZLWK
Q PLQ .U>PP@
0D[DQJXODUGLVSODFHPHQW
ZLWKQ PLQ .Z>PP@
0D[DQJXODUGLVSODFHPHQW
ZLWKQ PLQ .Z>PP@
6SDUHV,QYHQWRU\&XVWRPHU6HUYLFH$GGUHVVHV
$EDVLFUHTXLUHPHQWWRJXDUDQWHHWKHRSHUDWLRQDOUHDGLQHVVRIWKHFRXSOLQJLVDVWRFNRIWKHPRVWLPSRUWDQWVSDUH
SDUWVRQVLWH
&RQWDFWDGGUHVVHVRIWKH.75SDUWQHUVIRUVSDUHSDUWVDQGRUGHUVFDQEHREWDLQHGIURPWKH.75KRPHSDJH
XQGHUZZZNWUFRP
(QFORVXUH$
+LQWVDQG,QVWUXFWLRQV5HJDUGLQJWKH8VHLQ +D]DUGRXV$UHDV
7\SH$5 KXEHODVWRPHUULQJKXERU
KXE'=LQGLYLGXDOHODVWRPHUVKXE
7\SH$'5 KXEHODVWRPHUULQJIODQJHKXEFDPULQJRU
KXE'=LQGLYLGXDOHODVWRPHUVIODQJHKXEFDPULQJ
7\SH$'5. KXEHODVWRPHUULQJIODQJHKXE.FDPULQJRU
KXE'=LQGLYLGXDOHODVWRPHUVIODQJHKXE.FDPULQJ
7\SH$=5DQG$=5VKRUW FRXSOLQJIODQJHGULYLQJIODQJHHODVWRPHUULQJGULYLQJIODQJHFRXSOLQJIODQJH
7\SH$5$=5 KXEHODVWRPHUULQJGULYLQJIODQJHFRXSOLQJIODQJH
7\SH$=95 FRXSOLQJIODQJHGULYLQJIODQJHHODVWRPHUULQJGULYLQJIODQJH$=95
FRXSOLQJIODQJH$=95
7\SHZLWKWDSHUFODPSLQJVOHHYH KXEWDSHUFODPSLQJVOHHYHHODVWRPHUULQJWDSHUFODPSLQJVOHHYHKXE
8VHRIWDSHUFODPSLQJVOHHYHRQO\LQFRQQHFWLRQZLWKDIHDWKHUNH\
8VHLQ +D]DUGRXV$UHDV$FFRUGLQJWRWKH5HJXODWLRQV
&RQGLWLRQVRIRSHUDWLRQLQ KD]DUGRXVORFDWLRQV
32/<1250 FRXSOLQJVDUHVXLWDEOHIRUWKHXVHDFFRUGLQJWR(&VWDQGDUG(&
7HPSHUDWXUHFODVV
7HPSHUDWXUHFODVV $PELHQWRURSHUDWLQJWHPSHUDWXUH7D 0D[VXUIDFHWHPSHUDWXUH
77777 &WR& &
7 &WR& &
([SODQDWLRQ
7KHPD[LPXPVXUIDFHWHPSHUDWXUHVUHVXOWIURPHDFKWKHPD[LPXPSHUPLVVLEOHDPELHQWRURSHUDWLQJWHPSHUDWXUH7DSOXVWKH
PD[LPXPWHPSHUDWXUHLQFUHDVH 7RI.ZKLFKKDVWREHWDNHQLQWRDFFRXQW
7KHDPELHQWRURSHUDWLQJWHPSHUDWXUH7DLVOLPLWHGWR&GXHWRWKHSHUPLVVLEOHSHUPDQHQWRSHUDWLQJWHPSHUDWXUHRI
WKHHODVWRPHUVXVHG
7KHPD[LPXPVXUIDFHWHPSHUDWXUHRI&DSSOLHVIRUWKHXVHLQORFDWLRQVZKLFKDUHSRWHQWLDOO\VXEMHFWWRGXVW
H[SORVLRQWRR
0LQLQJ
'HYLFHFODVV,RIFDWHJRU\0FRXSOLQJLVQRWDSSURYHGIRUGHYLFHFDWHJRU\0
3HUPLVVLEOHDPELHQWWHPSHUDWXUH&WR&
(QFORVXUH$
+LQWVDQG,QVWUXFWLRQV5HJDUGLQJWKH8VHLQ +D]DUGRXV$UHDV
&RQWURO,QWHUYDOVIRU&RXSOLQJVLQ +D]DUGRXV$UHDV
([SORVLRQJURXS &RQWUROLQWHUYDOV
)RUFRXSOLQJVZKLFKDUHFODVVLILHGLQFDWHJRU\*RU'WKHRSHUDWLQJDQGDVVHPEO\
LQVWUXFWLRQVWKDWDUHXVXDOIRUVWDQGDUGRSHUDWLRQDSSO\'XULQJWKHVWDQGDUGRSHUDWLRQ
* ZKLFKKDVWREHVXEMHFWWRWKHDQDO\VLVRIGDQJHURILJQLWLRQWKHFRXSOLQJVDUHIUHHIURPDQ\
' LJQLWLRQVRXUFH0HUHO\WKHWHPSHUDWXUHLQFUHDVHSURGXFHGE\SURSHUKHDWLQJDQG
GHSHQGLQJRQWKHFRXSOLQJW\SHKDVWREHFRQVLGHUHG
IRU32/<1250 7 .
$FKHFNLQJRIWKHFLUFXPIHUHQWLDOEDFNODVKDQGDYLVXDOFKHFNRIWKHHODVWRPHUULQJ
'=LQGLYLGXDOHODVWRPHUVPXVWEHHIIHFWHGDIWHURSHUDWLQJKRXUVIRUWKHILUVWWLPHDIWHU
PRQWKVDWWKHODWHVW([FHSWIRUFHQWHUHGVWLIIFRQQHFWLQJIODQJHVHJEHOOKRXVLQJV
,I\RXQRWHDQXQFRQVLGHUDEOHRUQRZHDUDWWKHHODVWRPHUULQJ'=LQGLYLGXDOHODVWRPHUV
DIWHUWKLVILUVWLQVSHFWLRQWKHIXUWKHULQVSHFWLRQVFDQEHHIIHFWHGLQFDVHRIWKHVDPH
,,*F,,% RSHUDWLQJSDUDPHWHUVUHVSHFWLYHO\DIWHURSHUDWLQJKRXUVRUDIWHUPRQWKVDWWKH
777 ODWHVW
,I\RXQRWHDFRQVLGHUDEOHZHDUGXULQJWKHILUVWLQVSHFWLRQVRWKDWDFKDQJHRIWKH
HODVWRPHUULQJ'=LQGLYLGXDOHODVWRPHUVZRXOGEHUHFRPPHQGHGSOHDVHILQGRXWWKHFDXVH
DFFRUGLQJWRWKHWDEOHÄ%UHDNGRZQV³DVIDUDVSRVVLEOH
7KHPDLQWHQDQFHLQWHUYDOVPXVWEHDGMXVWHGDFFRUGLQJWRWKHFKDQJHGRSHUDWLQJ
SDUDPHWHUV
$FKHFNLQJRIWKHFLUFXPIHUHQWLDOEDFNODVKDQGDYLVXDOFKHFNRIWKHHODVWRPHUULQJ
'=LQGLYLGXDOHODVWRPHUVPXVWEHHIIHFWHGDIWHURSHUDWLQJKRXUVIRUWKHILUVWWLPHDIWHU
PRQWKVDWWKHODWHVW([FHSWIRUFHQWHUHGVWLIIFRQQHFWLQJIODQJHVHJEHOOKRXVLQJV
,I\RXQRWHDQXQFRQVLGHUDEOHRUQRZHDUDWWKHHODVWRPHUULQJ'=LQGLYLGXDOHODVWRPHUV
DIWHUWKLVILUVWLQVSHFWLRQWKHIXUWKHULQVSHFWLRQVFDQEHHIIHFWHGLQFDVHRIWKHVDPH
,,*F,,& RSHUDWLQJSDUDPHWHUVUHVSHFWLYHO\DIWHURSHUDWLQJKRXUVRUDIWHUPRQWKVDWWKH
777 ODWHVW
,I\RXQRWHDFRQVLGHUDEOHZHDUGXULQJWKHILUVWLQVSHFWLRQVRWKDWDFKDQJHRIWKH
HODVWRPHUULQJ'=LQGLYLGXDOHODVWRPHUVZRXOGEHUHFRPPHQGHGSOHDVHILQGRXWWKHFDXVH
DFFRUGLQJWRWKHWDEOHÄ%UHDNGRZQV³DVIDUDVSRVVLEOH
7KHPDLQWHQDQFHLQWHUYDOVPXVWEHDGMXVWHGDFFRUGLQJWRWKHFKDQJHGRSHUDWLQJ
SDUDPHWHUV
,QVSHFWLRQRIWZLVWLQJEDFNODVK
+HUHWKHEDFNODVKEHWZHHQWKHFRXSOLQJFDPV
DQGWKHHODVWRPHUWHHWKPXVWEHFKHFNHGE\D
UHYHUVHEDFNODVK
7KHIULFWLRQZHDUPD\EHRIWKHRULJLQDO
WRRWKWKLFNQHVVRIWKHHODVWRPHUEHIRUH
HODVWRPHUULQJV'=LQGLYLGXDOHODVWRPHUVPXVW
EHFKDQJHG
:KHQUHDFKLQJWKHOLPLWRIZHDUDQGWHDU VPD[
WKHHODVWRPHUULQJV'=LQGLYLGXDOHODVWRPHUV
PXVWEHH[FKDQJHGLPPHGLDWHO\LUUHVSHFWLYHRI
WKHLQVSHFWLRQLQWHUYDOV
SLFWXUH32/<1250W\SH$5
(QFORVXUH$
+LQWVDQG,QVWUXFWLRQV5HJDUGLQJWKH8VHLQ +D]DUGRXV$UHDV
$SSUR[LPDWH9DOXHVRI:HDU
7KHDFKLHYHPHQWRIWKHH[FKDQJHOLPLWVGHSHQGVRQWKHFRQGLWLRQVRIWKHXVHDQGWKHH[LVWLQJRSHUDWLQJ
SDUDPHWHUV
,QFDVHRIDWRUVLRQDOEDFNODVKRI VPD[DQH[FKDQJHRIWKHHODVWRPHUULQJV'=LQGLYLGXDOHODVWRPHUVPXVWEH
HIIHFWHG)ULFWLRQ RIWKHRULJLQDOWRRWKWKLFNQHVVRIWKHHODVWRPHUH[FKDQJHLVQHFHVVDU\
&$87,21
,QRUGHUWRHQVXUHDORQJOLIHWLPHRIWKHFRXSOLQJDQGWRDYRLGGDQJHUVUHJDUGLQJWKHXVHLQ
KD]DUGRXVDUHDVWKHVKDIWHQGVPXVWEHDFFXUDWHO\DOLJQHG
3OHDVHDEVROXWHO\REVHUYHWKHGLVSODFHPHQWILJXUHVLQGLFDWHGVHHWDEOH,IWKHILJXUHV
DUHH[FHHGHGWKHFRXSOLQJLVGDPDJHG
SLFWXUHFKHFNLQJRIWKHOLPLWRIZHDU SLFWXUHZHDURIHODVWRPHUULQJ
7DEOH
/LPLWVRIZHDU /LPLWVRIZHDU
32/< (ODVWRPHU 7RUVLRQDO 32/< (ODVWRPHU 7RUVLRQDO
1250 WRRWK )ULFWLRQ EDFNODVK 1250 WRRWK )ULFWLRQ EDFNODVK
VL]H WKLFNQHVV ;PD[>PP@ VPD[ VL]H WKLFNQHVV ;PD[>PP@ VPD[
>PP@ >PP@ >PP@ >PP@
3HUPLVVLEOH&RXSOLQJ0DWHULDOVLQWKH +D]DUGRXV$UHD
,QWKH([SORVLRQ*URXSV,,$,,%DQG,,&WKHIROORZLQJPDWHULDOVPD\EHFRPELQHG
(1*-/ ROGGHVLJQDWLRQ**
(1*-6 ROGGHVLJQDWLRQ***
6HPLILQLVKHGSURGXFWVIURPDOXPLQLXPZLWKDPDJQHVLXPSDUWRIXSWRDQGD\LHOGSRLQWRI
5S 1PPDUHSHUPLWWHGIRUWKHXVHLQKD]DUGRXVDUHDV
$OXPLQLXPGLHFDVWLVJHQHUDOO\H[FOXGHGIRUKD]DUGRXVDUHDV
(QFORVXUH$
+LQWVDQG,QVWUXFWLRQV5HJDUGLQJWKH8VHLQ +D]DUGRXV$UHDV
0DUNLQJRI&RXSOLQJIRUWKH+D]DUGRXV$UHD
&RXSOLQJVIRUWKHXVHLQKD]DUGRXVDUHDVDUHPDUNHGRQDWOHDVWRQHFRPSRQHQWFRPSOHWHO\DQGRQWKH
UHPDLQLQJFRPSRQHQWVDWWKHRXWVLGHGLDPHWHURIWKHKXERURQWKHIURQWVLGHZLWKDQ ODEHOIRUWKHUHVSHFWLYHO\
SHUPLWWHGFRQGLWLRQVRIXVH7KHHODVWRPHUULQJRU'=LQGLYLGXDOHODVWRPHUVUHVSHFWLYHO\LVQRWPDUNHG
6KRUWODEHOOLQJ
,,*'F,,&7;,0F;
7KHODEHOOLQJZLWK([SORVLRQ*URXSOO&LQFOXGHVWKH([SORVLRQ*URXSVOO$DQGOO%
&$87,21
$Q\PHFKDQLFDOUHZRUNWRFRXSOLQJVWKDWDUHXVHGLQKD]DUGRXVDUHDVUHTXLUHDQH[SOLFLW
UHOHDVHE\.75
7KHRUGHUHUPXVWVHQGDGUDZLQJWR.75DFFWRZKLFKWKHPDQXIDFWXUHPXVWEHPDGH.75
FKHFNVWKLVGUDZLQJDQGUHWXUQVLWWRWKHRUGHUHUZLWKDSSURYDO
6WDUWLQJ
%HIRUHSXWWLQJWKHFRXSOLQJLQWRRSHUDWLRQFKHFNWKHWLJKWQHVVRIWKHJUXEVFUHZVLQWKHKXEVWKHDOLJQPHQWDQG
WKHGLVWDQFHGLPHQVLRQVDQGFRUUHFWLIQHFHVVDU\DQGDOVRFKHFNDOOVFUHZFRQQHFWLRQVUHJDUGLQJWKHVWLSXODWHG
WLJKWHQLQJWRUTXHVGHSHQGHQWRQWKHW\SHRIFRXSOLQJ
,IXVHGLQKD]DUGRXVDUHDVWKHJUXEVFUHZVWRIL[WKHKXEDVZHOODVDOOVFUHZFRQQHFWLRQVPXVWEH
DGGLWLRQDOO\VHFXUHGDJDLQVWVHOIORRVHQLQJHJJOXHZLWK/RFWLWHPHGLXPVWUHQJWK
/DVWEXWQRWOHDVWWKHFRXSOLQJSURWHFWLRQDJDLQVWXQLQWHQGHGFRQWDFWPXVWEHIL[HG
7KHFRYHUPXVWEHHOHFWULFDOO\FRQGXFWLYHDQGEHLQFOXGHGLQWKHHTXLSRWHQWLDOERQGLQJ%HOOKRXVLQJVPDJQHVLXP
SDUWEHORZPDGHIURPDOXPLQLXPDQGGDPSLQJULQJV1%5FDQEHXVHGDVFRQQHFWLQJHOHPHQWEHWZHHQ
SXPSDQGHOHFWURPRWRU7KHFRYHUPD\RQO\EHWDNHQRIIDIWHUKDYLQJVWRSSHGWKHXQLW
'XULQJRSHUDWLRQSOHDVHSD\DWWHQWLRQWR
VWUDQJHUXQQLQJQRLVHV
RFFXUULQJYLEUDWLRQV
,IWKHFRXSOLQJVDUHXVHGLQGXVWH[SORVLYHDUHDVDQGLQPLQLQJWKHXVHUPXVWPDNHVXUHWKDWWKHUHLVQR
DFFXPXODWLRQRIGXVWLQDFULWLFDOTXDQWLW\EHWZHHQWKHFRYHUDQGWKHFRXSOLQJ7KHFRXSOLQJPXVWQRRSHUDWHLQDQ
DFFXPXODWLRQRIGXVW
)RUFRYHUVZLWKXQORFNHGRSHQLQJVRQWKHXSSHUVLGHQROLJKWPHWDOVPD\EHXVHGLIWKHFRXSOLQJVDUHXVHGDV
DSSOLDQFHVRIDSSOLDQFHJURXSOOLISRVVLEOHIURPVWDLQOHVVVWHHO
,IWKHFRXSOLQJVDUHXVHGLQPLQLQJDSSOLDQFHJURXSO0WKHFRYHUPXVWQRWEHPDGHIURPOLJKWPHWDO,Q
DGGLWLRQLWPXVWEHUHVLVWDQWWRKLJKHUPHFKDQLFDOORDGVWKDQLILWLVXVHGDVDSSOLDQFHRIDSSOLDQFHJURXSOO
(QFORVXUH$
+LQWVDQG,QVWUXFWLRQV5HJDUGLQJWKH8VHLQ +D]DUGRXV$UHDV
6WDUWLQJ
7KHPLQLPXPGLVWDQFHRIWKHSURWHFWLRQGHYLFHWRWKHURWDWLQJSDUWVPXVWEHDWOHDVWPP
,IWKHSURWHFWLRQGHYLFHLVXVHGDVFRYHUUHJXODURSHQLQJVFRPSO\LQJZLWKWKHH[SORVLRQSURWHFWLRQGHPDQGVFDQ
EHPDGHWKDWPXVWQRWH[FHHGWKHIROORZLQJGLPHQVLRQV
)RUPRIWKHRSHQLQJV
6WUDLJKWRUEHQGHGVORWGLVWDQFH
&LUFXODURSHQLQJV 5HFWDQJXODURSHQLQJV
RIWKHVLGHOLPLW
GLDPHWHULQPP VLGHOHQJWKLQPP
LQPP
7RSVXUIDFHRIWKHFRYHULQJ 3URKLELWHG
6LGHSDUWVRIWKHFRYHULQJ
&$87,21
,I\RXQRWHDQ\LUUHJXODULWLHVDWWKHFRXSOLQJGXULQJRSHUDWLRQWKHGULYHXQLWPXVWEHWXUQHG
RIILPPHGLDWHO\7KHFDXVHRIWKHEUHDNGRZQPXVWEHIRXQGRXWZLWKWKHWDEOH
Ä%UHDNGRZQV³DQGLISRVVLEOHEHHOLPLQDWHGDFFRUGLQJWRWKHSURSRVDOV7KHSRVVLEOH
EUHDNGRZQVPHQWLRQHGFDQEHKLQWVRQO\7RILQGRXWWKHFDXVHDOORSHUDWLQJIDFWRUVDQG
PDFKLQHFRPSRQHQWVPXVWEHFRQVLGHUHG
&RXSOLQJOD\HU
,IFRDWHGSULPLQJSDLQWLQJHWFFRXSOLQJVDUHXVHGLQKD]DUGRXVDUHDVWKHUHTXLUHPHQWVWR
FRQGXFWDELOLW\DQGOD\HUWKLFNQHVVPXVWEHFRQVLGHUHG,QFDVHRISDLQWLQJVXSWRPQR
HOHFWURVWDWLFORDGFDQEHH[SHFWHG0XOWLSOHFRDWLQJVWKDWDUHWKLFNHUWKDQPDUHSURKLELWHGIRU
H[SORVLRQJURXSOO&
%UHDNGRZQV&DXVHVDQG(OLPLQDWLRQ
7KHEHORZPHQWLRQHGHUURUVFDQOHDGWRDQLQFRUUHFWXVHRIWKH32/<1250FRXSOLQJ,QDGGLWLRQWRWKH
VWLSXODWLRQVLQWKHVHRSHUDWLQJDQGPRXQWLQJLQVWUXFWLRQVSOHDVHPDNHVXUHWRDYRLGWKHVHHUURUV
7KHHUURUVOLVWHGFDQRQO\EHFOXHVWRVHDUFKIRUWKHHUURUV:KHQVHDUFKLQJIRUWKHHUURUWKHDGMDFHQW
FRPSRQHQWVPXVWEHJHQHUDOO\LQFOXGHG
'XHWRLQFRUUHFWXVHWKHFRXSOLQJFDQEHFRPHDVRXUFHRILJQLWLRQ
(&6WDQGDUG(&UHTXLUHVDVSHFLDOFDUHIURPWKHPDQXIDFWXUHUDQGWKHXVHU
*HQHUDOHUURUVLQFRUUHFWXVH
,PSRUWDQWGDWDIRUWKHFRXSOLQJVHOHFWLRQZDVQRWIRUZDUGHG
7KHFDOFXODWLRQRIWKHVKDIWKXEFRQQHFWLRQZDVQRWFRQVLGHUHG
&RXSOLQJSDUWVZLWKGDPDJHRFFXUUHGGXULQJWUDQVSRUWDUHDVVHPEOHG
,IWKHKHDWHGKXEVDUHDVVHPEOHGWKHSHUPLVVLEOHWHPSHUDWXUHLVH[FHHGHG
7KHILWVRIWKHSDUWVWREHDVVHPEOHGDUHQRWFRRUGLQDWHGZLWKHDFKRWKHU
7LJKWHQLQJWRUTXHVDUHEHORZH[FHHGHG
&RPSRQHQWVDUHH[FKDQJHGE\PLVWDNHSXWWRJHWKHULQFRUUHFWO\
$ZURQJRUQRHODVWRPHUULQJ'=LQGLYLGXDOHODVWRPHUVLVLQVHUWHGLQWRWKHFRXSOLQJ
1RRULJLQDO.75SDUWVSXUFKDVHGSDUWVDUHXVHG
2OGDOUHDG\ZRUQRUVXSHUSRVHGHODVWRPHUULQJV'=LQGLYLGXDOHODVWRPHUVDUHXVHG
7KHFRXSOLQJXVHGWKHFRXSOLQJSURWHFWLRQXVHGLVQRWVXLWDEOHIRUWKHRSHUDWLRQLQKD]DUGRXVDUHDVDQGGRHV
QRWFRUUHVSRQGWR(&6WDQGDUG(&UHVSHFWLYHO\
0DLQWHQDQFHLQWHUYDOVDUHQRWREVHUYHG
(QFORVXUH$
+LQWVDQG,QVWUXFWLRQV5HJDUGLQJWKH8VHLQ +D]DUGRXV$UHDV
%UHDNGRZQV&DXVHVDQG(OLPLQDWLRQ
'DQJHUKLQWVIRU
%UHDNGRZQV &DXVHV (OLPLQDWLRQ
KD]DUGRXVDUHDV
SXWWKHXQLWRXWRIRSHUDWLRQ
HOLPLQDWHWKHUHDVRQIRUWKH
PLVDOLJQPHQWHJORRVHIRXQGDWLRQ
EROWVEUHDNRIWKHHQJLQHIL[LQJKHDW
PLVDOLJQPHQW H[SDQVLRQRIXQLWFRPSRQHQWVFKDQJH
RIWKHDVVHPEO\GLPHQVLRQVRIWKH
FRXSOLQJ
FKHFNLQJRIZHDUVHHXQGHUSRLQW
&RQWURO
SXWWKHXQLWRXWRIRSHUDWLRQ
FKDQJHRIWKH
GLVDVVHPEOHWKHFRXSOLQJDQGUHPRYH
UXQQLQJQRLVHV
ZHDURIHODVWRPHU UHVWVRIWKHHODVWRPHUULQJ
DQGRURFFXUULQJ
ULQJVKRUWWHUP GDQJHURILJQLWLRQGXH FKHFNFRXSOLQJSDUWVDQGH[FKDQJH
YLEUDWLRQV
WRUTXHWUDQVPLVVLRQ WRVSDUNLQJ GDPDJHGFRXSOLQJSDUWV
GXHWRPHWDOFRQWDFW LQVHUWHODVWRPHUULQJDVVHPEOH
FRXSOLQJSDUWV
FKHFNDOLJQPHQWFRUUHFWLIQHFHVVDU\
SXWWKHXQLWRXWRIRSHUDWLRQ
FKHFNDOLJQPHQWRIFRXSOLQJ
ORRVHVFUHZVIRU
GDQJHURILJQLWLRQGXH WLJKWHQWKHVFUHZVWRVHFXUHWKHKXEV
D[LDOVHFXUHPHQW
WRVSDUNLQJ DQGVHFXUHDJDLQVWVHOIORRVHQLQJ
RIKXEV
FKHFNLQJRIZHDUVHHXQGHUSRLQW
&RQWURO
ZHDURIHODVWRPHU
SXWWKHXQLWRXWRIRSHUDWLRQ
ULQJWRUTXH GDQJHURILJQLWLRQGXH
FKDQJHFRPSOHWHFRXSOLQJ
WUDQVPLVVLRQGXHWR WRVSDUNLQJ
FKHFNDOLJQPHQW
PHWDOFRQWDFW
SXWWKHXQLWRXWRIRSHUDWLRQ
EUHDNRIWKHFDPV
GDQJHURILJQLWLRQGXH FKDQJHFRPSOHWHFRXSOLQJ
GXHWRKLJKVKRFN
WRVSDUNLQJ FKHFNDOLJQPHQW
HQHUJ\RYHUORDG
ILQGRXWWKHUHDVRQRIRYHUORDG
EUHDNRIFDP SXWWKHXQLWRXWRIRSHUDWLRQ
RSHUDWLQJ
FKHFNWKHRSHUDWLQJSDUDPHWHUVDQG
SDUDPHWHUVGRQRW
GDQJHURILJQLWLRQGXH VHOHFWDODUJHUFRXSOLQJFRQVLGHU
FRUUHVSRQGWRWKH
WRVSDUNLQJ LQVWDOODWLRQVSDFH
SHUIRUPDQFHRIWKH
DVVHPEOHQHZFRXSOLQJVL]H
FRXSOLQJ
FKHFNDOLJQPHQW
SXWWKHXQLWRXWRIRSHUDWLRQ
PLVWDNHLQVHUYLFH GDQJHURILJQLWLRQGXH FKDQJHFRPSOHWHFRXSOLQJ
RIWKHXQLW WRVSDUNLQJ FKHFNDOLJQPHQW
LQVWUXFWDQGWUDLQWKHVHUYLFHVWDII
(QFORVXUH$
+LQWVDQG,QVWUXFWLRQV5HJDUGLQJWKH8VHLQ +D]DUGRXV$UHDV
%UHDNGRZQV&DXVHVDQG(OLPLQDWLRQ
'DQJHUKLQWVIRU
%UHDNGRZQV &DXVHV (OLPLQDWLRQ
KD]DUGRXVDUHDV
SXWWKHXQLWRXWRIRSHUDWLRQ
HOLPLQDWHWKHUHDVRQIRUWKH
PLVDOLJQPHQWHJORRVHIRXQGDWLRQ
EROWVEUHDNRIWKHHQJLQHIL[LQJKHDW
PLVDOLJQPHQW H[SDQVLRQRIXQLWFRPSRQHQWVFKDQJH
RIWKHDVVHPEO\GLPHQVLRQVRIWKH
FRXSOLQJ
FKHFNLQJRIZHDUVHHXQGHUSRLQW
&RQWURO
SXWWKHXQLWRXWRIRSHUDWLRQ
HJFRQWDFWZLWK GLVDVVHPEOHWKHFRXSOLQJDQGUHPRYH
DJJUHVVLYHOLTXLGV UHVWVRIWKHHODVWRPHUULQJ
RLOVR]RQH FKHFNFRXSOLQJSDUWVDQGH[FKDQJH
GDQJHURILJQLWLRQ
LQIOXHQFHWRRKLJK GDPDJHGFRXSOLQJSDUWV
GXHWRVSDUNLQJLQ
SUHPDWXUHZHDURI DPELHQW LQVHUWHODVWRPHUULQJDVVHPEOH
FDVHRIPHWDOOLFFRQWDFW
HODVWRPHUULQJ WHPSHUDWXUHVHWF FRXSOLQJSDUWV
RIWKHFDPV
HIIHFWLQJDSK\VLFDO FKHFNDOLJQPHQWFRUUHFWLIQHFHVVDU\
FKDQJHRIWKH PDNHVXUHWKDWIXUWKHUSK\VLFDO
HODVWRPHUULQJ FKDQJHVRIWKHHODVWRPHUULQJDUH
H[FOXGHG
SXWWKHXQLWRXWRIRSHUDWLRQ
GLVDVVHPEOHWKHFRXSOLQJDQGUHPRYH
DPELHQWFRQWDFW UHVWVRIWKHHODVWRPHUULQJ
WHPSHUDWXUHVZKLFK GDQJHURILJQLWLRQ FKHFNFRXSOLQJSDUWVDQGH[FKDQJH
DUHWRRKLJKIRUWKH GXHWRVSDUNLQJLQFDVH GDPDJHGFRXSOLQJSDUWV
HODVWRPHUULQJPD[ RIPHWDOOLFFRQWDFWRI LQVHUWHODVWRPHUULQJDVVHPEOH
SHUPLVVLEOH WKHFDPV FRXSOLQJSDUWV
&& FKHFNDOLJQPHQWFRUUHFWLIQHFHVVDU\
FKHFNDQGUHJXODWHDPELHQWFRQWDFW
WHPSHUDWXUH
SXWWKHXQLWRXWRIRSHUDWLRQ
GLVDVVHPEOHWKHFRXSOLQJDQGUHPRYH
SUHPDWXUHZHDURI UHVWVRIWKHHODVWRPHUULQJ
GDQJHURILJQLWLRQ
HODVWRPHUULQJ FKHFNFRXSOLQJSDUWVDQGH[FKDQJH
GXHWRVSDUNLQJLQFDVH
+DUGHQLQJ GULYHYLEUDWLRQV GDPDJHGFRXSOLQJSDUWV
RIPHWDOOLFFRQWDFWRI
HPEULWWOHPHQWRI LQVHUWHODVWRPHUULQJDVVHPEOH
WKHFDPV
WKHHODVWRPHUFDP FRXSOLQJSDUWV
FKHFNDOLJQPHQWFRUUHFWLIQHFHVVDU\
ILQGRXWWKHUHDVRQIRUWKHYLEUDWLRQV
$77(17,21
.75GRHVQRWDVVXPHDQ\OLDELOLWLHVRUJXDUDQWHHVUHJDUGLQJWKHXVHRIVSDUHSDUWVDQG
DFFHVVRULHVZKLFKDUHQRWSURYLGHGE\.75DQGIRUWKHGDPDJHVUHVXOWLQJKHUHIURP
Technical specification to the order
Date: 16.10.2013
Contents
1 Important Notes................................................................................................... 3
2 Flange coupling .................................................................................................. 4
2.1 Dimensions of the machine shaft ................................................................ 4
2.2 Mounting the flange coupling half with conical interference fit onto the
machine shaft.............................................................................................. 4
2.3 Mounting the flange connection .................................................................. 7
2.4 Removing the coupling from the shaft ........................................................ 9
2 Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit
Important Notes
1
1 Important Notes
Flange coupling with conical interference fit
INFORMATION
This addendum describes amendments to the "Helical and Bevel-Helical Gear Units,
X.. Series" operating instructions.
Observe the following addition in chapter "Flange coupling"
This document does not replace the detailed operating instructions.
Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit 3
Flange coupling
2 Dimensions of the machine shaft
2 Flange coupling
2.1 Dimensions of the machine shaft
INFORMATION
Make sure the dimensions of the machine shaft correspond to SEW specifications.
Observe the information given in the dimension sheets.
2.2 Mounting the flange coupling half with conical interference fit onto the
machine shaft
1. Thoroughly clean and degrease the machine shaft [1], the bushing [2], and the bore
of the flange coupling half [3]. The 4 disassembly bores [4] of the flange coupling half
[3] must also be free from dirt.
• NOTICE Improper assembly can damage the flange coupling half [3].
Possible damage to property.
– Make sure that the machine shaft [1], bushing [2], and bore [4] are completely
free from grease to ensure proper functioning of the interference fit. Do not use
assembly paste during assembly.
[4]
[3]
[2]
[1]
3494600587
[2]
[1]
3494852107
4 Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit
Flange coupling
Mounting the flange coupling half with conical interference fit onto the
2
3. Before mounting the flange coupling half [3] to the machine shaft [1], make sure that
the bushing [2] is perfectly aligned to the machine shaft [1]:
• The 4 grooves [5] of the bushing must be under the disassembly bores after the
mounting of the flange coupling half [3]. The groove [6] must point upwards.
[6] [5]
[3] [4]
[2]
[1]
3494854539
4. Heat the flange coupling half [3] to a joining temperature of 230 °C, as long as no
special joining temperature is specified for the order.
• CAUTION The required assembly clearance is achieved only by heating the
flange coupling half [3].
Important: Danger of burns during the entire assembly process!
– Make sure that hot parts cannot be touched unintentionally.
• NOTICE Radiant heat from the flange coupling half [3] can damage adjacent
elements.
Possible damage to property.
– Protect adjacent elements (e.g. oil seals) with suitable heat shields.
[3]
3508896139
5. Quickly push the flange coupling half [3] onto the bushing [2] until it reaches the
shoulder of the bushing. Make sure everything is aligned correctly as described in
point 3.
• INFORMATION Prepare mounting tools and the process carefully, so that the
coupling can be fitted to the shaft quickly. During the cooling process, the coupling
must be secured on the shaft.
Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit 5
Flange coupling
2 Mounting the flange coupling half with conical interference fit onto the
• INFORMATION Once the coupling has cooled down, fill the disassembly bores
[4] with clean mineral oil of viscosity class ISO-VG 150 and close them using the
supplied screw plugs.
[3] [4]
[2]
[1]
[2]
[3] [1]
[1]
[3]
9406007435
6. Mount the lock washer [8] to the machine shaft [1] with 3 screws [9].
[9]
[8]
[10]
9406013835
6 Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit
Flange coupling
Mounting the flange connection
2
NOTICE
Improper assembly may damage the coupling.
Possible damage to property.
• Note that the flange coupling cannot compensate shaft misalignments.
1. Clean the flange surfaces [1] of the flange coupling halves [2].
[2]
[1]
9406084875
2. Align the bore patterns of the two flange coupling halves [2] and join the flange cou-
pling.
[2]
992700555
Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit 7
Flange coupling
2 Mounting the flange connection
3. Mount the bolts [3] and tighten them in diametrically opposite sequence with the tight-
ening torques in the following table.
• INFORMATION Do not lubricate the bolts [3] during assembly.
16 1 9
8 5
15 10
4 3
14 11
6 7
13 2 12
1 2
16
15 3
[3] 14 4
13 5
12 6
11 7
10 9 8
992703755
8 Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit
Flange coupling
Removing the coupling from the shaft
2
CAUTION
Risk of jamming and crushing due to improper removal of heavy components.
Risk of injury.
• Disassemble the flange coupling properly.
• Observe the following disassembly instructions.
To remove the flange coupling [1], the interference fit must first be widened hydraulically.
The remaining holding force must then be overcome with an extractor [2]. The following
figure shows an exemplary design of a hydraulic extractor.
[1]
[2]
1071755147
For disassembling the coupling, one oil pump is required per disassembly bore.
The data required for the extractor is listed in the following table.
Oil pressure required for Number of disassembly Connection thread of the Required axial force of the
Size disassembly bores/number of required pressure oil bores in the extractor
[bar] oil pumps flange coupling [kN]
X260 1600 4 G 1/4" 550
Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit 9
Flange coupling
2 Removing the coupling from the shaft
2.4.2 Procedure
INFORMATION
Remove the lock washer before disassembling the machine shaft,
1. Loosen the bolts [1] and separate the flange coupling. Remove the screw plugs [2]
of the disassembly bores.
• INFORMATION Prepare disassembly tools and the process carefully, so that the
coupling can be removed from the shaft quickly.
[2]
[1]
1105822859
2. Connect the first oil pump [3] to the disassembly bore closest to the flange [4] and
apply pressure until oil comes out of the second disassembly bore [5]. Depending on
the size, this bore can also be located on the flange surface of the coupling.
• INFORMATION It is essential that you observe the safety notes of the manufac-
turers of the hydraulic devices during the disassembly process.
[3]
[4]
[4]
[5]
1000632331
10 Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit
Flange coupling
Removing the coupling from the shaft
2
3. Connect the next oil pump [6] to this bore [5] and press in oil until it comes out at the
next disassembly bore [7].
[7]
[6]
[5]
1002542475
4. Repeat this process until all disassembly bores are connected to an oil pump and
pressure is applied. At the last disassembly bore [7], the pressure must be increased
until at both front faces of the coupling [8] oil comes out in the shape of a ring.
• INFORMATION The coupling can also be disassembled with only one oil pump.
In this case, the individual disassembly bores must be blocked after pressure has
been applied. Provide for a consistent pressure throughout the disassembly pro-
cedure.
• INFORMATION Before removing the coupling, keep the oil pressure constant for
30 minutes to create an evenly distributed oil film inside the interference fit. The
pressure must be kept constant during this time and the remaining disassembly
process at all bores.
[7]
[8]
1002549387
Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit 11
Flange coupling
2 Removing the coupling from the shaft
5. Install the extractor [3]. Remove the coupling from the shaft. Since the oil pressure
breaks down after the last disassembly bore has been reached, the required force
for removing the coupling is significantly higher at the end.
[3]
[4]
1000624651
6. Check the condition of the shaft and the coupling bore after the disassembly process.
Damaged parts must be replaced.
12 Addendum to the Assembly and Operating Instructions – Flange coupling with conical interference fit
SEW-EURODRIVE---Driving the world
You can call up all information concerning your purchase order easily and directly via our customer portal: 18611751.
Here you trace
the status of your purchase order very accurately and also call up technical data and documentation very easily.
Página en blanco
11/2013 Rev 0
11/2013 Rev 0
Hydraulic Cylinders
Repair Parts Sheets for this product are A DANGER is only used when your action or lack
available from the Enerpac web site at of action may cause serious injury or even death.
www.enerpac.com, or from your nearest
WARNING: Wear proper personal
Authorized Enerpac Service Center or Enerpac
protective gear when operating
Sales office. hydraulic equipment.
1.0 IMPORTANT RECEIVING WARNING: Stay clear of loads
INSTRUCTIONS supported by hydraulics. A cylinder,
Visually inspect all components for shipping when used as a load lifting device,
damage. Shipping damage is not covered by should never be used as a load holding device.
warranty. If shipping damage is found, notify After the load has been raised or lowered, it
carrier at once. The carrier is responsible for all must always be blocked mechanically.
repair and replacement costs resulting from WARNING: USE ONLY RIGID
damage in shipment. PIECES TO HOLD LOADS.
SAFETY FIRST Carefully select steel or wood blocks
that are capable of supporting the load. Never
2.0 SAFETY ISSUES use a hydraulic cylinder as a shim or spacer in
Read all instructions, warnings any lifting or pressing application.
and cautions carefully. Follow DANGER: To avoid personal
all safety precautions to avoid injury keep hands and feet
personal injury or property damage during away from cylinder and
system operation. Enerpac cannot be workpiece during operation.
responsible for damage or injury resulting from
unsafe product use, lack of maintenance or WARNING: Do not exceed equipment
incorrect product and/or system operation. ratings. Never attempt to lift a load
Contact Enerpac when in doubt as to the safety weighing more than the capacity of
precautions and operations. If you have never the cylinder. Overloading causes equipment
been trained on high-pressure hydraulic safety, failure and possible personal injury. The
consult your distribution or service center for a cylinders are designed for a max. pressure of
free Enerpac Hydraulic safety course. 700 bar [10,000 psi]. Do not connect a jack or
cylinder to a pump with a higher pressure rating.
Failure to comply with the following cautions
and warnings could cause equipment damage DANGER: Never set the relief valve
and personal injury. to a higher pressure than the
maximum rated pressure of the
A CAUTION is used to indicate correct pump. Higher settings may result in equipment
operating or maintenance procedures and damage and/or personal injury. Do not remove
practices to prevent damage to, or destruction relief valve.
of equipment or other property.
WARNING: The system operating
A WARNING indicates a potential danger that pressure must not exceed the
requires correct procedures or practices to pressure rating of the lowest rated
avoid personal injury. component in the system. Install pressure
gauges in the system to monitor operating Distribute the load evenly across the
pressure. It is your window to what is entire saddle surface. Always use a
happening in the system. saddle to protect the plunger.
CAUTION: Avoid damaging
hydraulic hose. Avoid sharp bends IMPORTANT: Hydraulic equipment
and kinks when routing hydraulic must only be serviced by a qualified
hoses. Using a bent or kinked hose will cause hydraulic technician. For repair
severe back-pressure. Sharp bends and kinks service, contact the Authorized
will internally damage the hose leading to ENERPAC Service Center in your area. To
premature hose failure. protect your warranty, use only ENERPAC oil.
air
3
Hoja de Instrucciones
Cilindros Hidraúlicos
L1608 Rev C 10/06
Las hojas de despiece para este producto estan
disponibles en la página web de Enerpac en la
dirección www.enerpac.com,o en su centro de
Asistencia Técnica ó punto de venta Enerpac
mas cercano.
16
PELIGRO: Nunca fije la válvula de componentes pueden fallar calamitosamente,
seguridad a una presión más alta lo que causaría lesiones personales graves.
que el máximo valor nominal de ADVERTENCIA: Asegurese que el
presión de la bomba. Los ajustes más altos equipo sea antes de levantar la
pueden resultar en daños al equipo y/o carga. El cilindro debe colocarse
lesiones personales. No remover la válvula de sobre una superficie plana capaz de
seguridad. soportar la carga. De ser necesario, utilice una
ADVERTENCIA: La presión de base de cilindro para mayor estabilidad. No
operación del sistema no debe suelde ni modifique el cilindro en modo alguno
sobrepasar el valor nominal de para fijarle una base u otro medio de soporte.
presión del componente con el valor nominal Evite las situaciones en las cuales las
más bajo en el sistema. Instale manómetros de cargas no estén directamente
presión en el sistema para vigilar la presión de centradas sobre el émbolo del
operación. Es su ventana a lo que está cilindro. Las cargas descentradas producen un
sucediendo en el sistema. esfuerzo considerable sobre los cilindros y los
PRECAUCIÓN: Evite dañar la émbolos. Adeás, la carga podria resbalar o
manguera hidráulica. Evite pliegues caerse, creando situaciones potencialmente
y curvas agudos al guiar las peligrosas.
mangueras hidráulicas. Usar una manguera
Distribuya la carga uniformemente
con pliegues o curvas puede causar severa
sobre la superficie total del asiento
contrapresión. Los pliegues y curvas agudos
del cilindro. Siempre utilice un
causarán daños internos la manguera, lo que
asiento para proteger el émbolo
ocasionará que ésta falle prematuramente.
cuando no se usen accesorios roscados.
No deje caer objetos pesados sobre IMPORTANTE: Únicamente técnicos
la manguera. Un impacto directo calificados en sistemas hidráulicos
puede causar daños internos a las habrán de prestarle servicio al
hebras de alambre de la manguera. Aplicar equipo hidráulico. Comuníquese con
presión a una manguera dañada puede el Centro de Servicio ENERPAC autorizado en
ocasionar que se quiebre. su zona para prestarle servicio de
IMPORTANTE: No levante el equipo reparaciones. Use únicamente aceite
hidráulico por las mangueras o ENERPAC a fin de proteger su garantía.
acopladores giratorios. Use el mango ADVERTENCIA: Reemplace
de transporte u otros medios para transportarla inmediatamente las piezas gastadas
con seguridad. o dañadas por piezas ENERPAC
PRECAUCIÓN: Mantenga el genuinas. Las piezas de clasificación estándar
equipo hidráulico alejado de las se romperán, lo que causará lesiones
llamas y el calor. El calor en personales y daños a la propiedad. Las piezas
exceso ablandará las juntas y sellos, lo que ENERPAC están diseñadas para encajar
resultará en fugas de líquidos. Asimismo, el debidamente y resistir altas cargas.
calor debilita los materiales de la manguera y
juntas. Para lograr un rendimiento óptimo, no
exponga el equipo a temperaturas de 65 °C 3.0 INSTALACION
[150 °F] o mayores. Proteja las mangueras y
cilindros de salpicaduras de soldadura. 1. Conecte los componentes hidráulicos.
Utilice una bomba con una válvula de alivio
PELIGRO: No manipule o válvula de 3 vías y una manguera para los
mangueras bajo presión. El aceite cilindros de acción única (1). Utilice una
que escape bajo presión puede bomba con una válvula de 4 vías y dos
penetrar la piel y causar lesiones graves. Si se mangueras para los cilindros de doble
inyecta aceite bajo la piel, consulte a un acción (2).
médico inmediatamente.
IMPORTANTE: Los cilindros de doble
ADVERTENCIA: Use cilindros acción deberán tener ambos acopladores
hidráulicos únicamente en conectados.
sistemas acoplados. Nunca use un Apriete todos los acopladores con la mano.
cilindro si los acopladores no están Las conexiones flojas bloquearán el flujo del
conectados. Si el cilindro se sobrecarga, los
17
un 50% como mínimo.
4.0 FUNCIONAMIENTO
Accione la bomba hidráulica para extender y
retraer el cilindro. Algunos cilindros de acción
única tienen retorno por acción de resorte,
otros tienen retorno por acción de la carga. La
velocidad de retracción se ve afectada por la
longitud de la manguera y otras restricciones
en la línea. Los cilindros de doble acción son
impulsados en ambos sentidos por la bomba.
El casquillo de tope del cilindro está diseñado
para aceptar toda la carga. Sin embargo, para
aceite entre la bomba y el cilindro. reducir el desgaste del cilindro emplee, siempre
que sea posible, menos del total de la carrera.
2. Purgue el aire del cilindro como se muestra
a continuación. Cilindros de acción única: 5.0 MANTENIMIENTO
Coloque el cilindro de modo que su émbolo
funcione hacia abajo y el cilindro esté 1. Utilice con estos cilindros aceite hidráulico
colocado en posición más baja que la Enerpac exclusivamente. El empleo de
bomba. Extienda y retraiga el cilindro por cualquier otro aceite hidráulico puede
completo 2 ó 3 veces. invalidar la garantía.
Cilindros de doble acción: Coloque el 2. Utilice tapas guardapolvo cuando los
cilindro sobre su costado con los cilindros estén desconectados de la
acopladores hacia arriba. Extienda y manguera. Mantenga limpio el cilindro en su
retraiga el cilindro por completo 2 ó 3 veces. totalidad para prolongar la vida útil del
mismo.
3. NO PERMITIR QUE EL VASTAGO 3. Almacene los cilindros en posición vertical
GIRE CUANDO SE ESTEN INSTALANDO para evitar la distorsión de los sellos.
LOS ADAPTADORES. EL RESORTE PUEDE
DANARSE CUANDO SE GIRE EL VASTAGO
HACIENDO QUE ESTE NO RETORNE. 6.0 LOCALIZACION DE AVERIAS
aire
aire
18
PROBLEMA CAUSA POSIBLE
19
Página en blanco
11/2013 Rev 0
DESCRIPTION
Enerpac supplies three different types of hydraulic hoses: thermoplastic,
heavy duty rubber, or nylon. The thermoplastic hose has four layers,
including two high strength steel wire braids. The rubber hose is
reinforced with two layers of braided steel webbing. The nylon hose has
an exterior plastic coating.
WARNING
Do not use Enerpac hoses in systems exceeding 10,000 psi [700 bar].
HOSE COMPARISON
Hose 700 Series Thermoplastic 800 Series Nylon 900 Series Rubber
Design Factor 4 to 1 2 to 1 2 to 1
Less flexible Less flexible, but more Most flexible at low temperatures, but
Flexibility
tolerant to tight bends tight bends can lead to damage
Durability of Outer
Abrasion-resistant Abrasion-resistant Easily abused
Covering
Tolerance to High
Very tolerant Tolerant Less tolerant
Pressure Cycling
SAFETY INFORMATION
To avoid personal injury during system operation, read and follow all
CAUTIONS, WARNINGS, and INSTRUCTIONS included with or attached
to each product. ENERPAC CANNOT BE RESPONSIBLE FOR DAMAGE
RESULTING FROM UNSAFE USE OF PRODUCT, LACK OF
MAINTENANCE, OR INCORRECT PRODUCT OR SYSTEM
APPLICATION. Contact Enerpac when in doubt about applications and
safety precautions.
WARNING
Be certain that ALL system components, including couplers, fittings, pipes,
and tubing, are rated for the maximum operating pressure of the system. The
system operating pressure must not exceed the pressure rating of the lowest
rated component in the system or system failure may occur, resulting in serious
personal injury or equipment damage.
WARNING
Always wear proper personal protective gear, when operating hydraulic
equipment.
WARNING
Make sure that all system components are protected from
external sources of damage, such as excessive heat, flame, weld
spatter, moving machine parts, sharp edges, and corrosive
chemicals. Do not expose hoses to temperatures of 150°F [65°C]
or higher.
WARNING
NEVER make or break hydraulic connections while the
system is under pressure.
WARNING
Wear proper personal protective gear when operating
hydraulic equipment.
WARNING
Do not handle hoses under pressure. Replace damaged
hoses immediately. Hydraulic fluid escaping through a small
hole can penetrate the skin, causing serious injury. If oil is
injected under the skin, see a doctor immediately.
CAUTION
Do not use hydraulic hose to carry hydraulic components
such as pumps or cylinders.
CAUTION
Use only the manufacturer's recommended fluid. Do not mix fluids in a
system. Use only fluids that are compatible with system components, or seals and
hoses will be damaged. Synthetic and fireproof fluids require special seals and
hoses. Contact the nearest authorized service center or the manufacturer for
recommendation.
(2)
INSTALLATION
Hydraulic Hoses
1. Before operating, visually inspect the system.
2. Check to be sure there are no cracks, kinks, cuts, or other damage
which might cause the hose to leak. Rubber guards protect crimped
areas at each end of the hose.
3. Make sure all hose ends, couplers, or union ends are R=4½ in.
clean and threads are in good condition. R=11,4 cm
4. Hose should not be twisted or bent too sharply. The
bend radius should always be at least 4.5 inches
(11,4 cm). Always use as few bends as possible.
5. Do not drop heavy objects on hose. A sharp impact
may cause internal damage to hose wire strands.
Applying pressure to a damaged hose may cause it
to rupture.
6. Make sure all hose connections between pump and
cylinder are tight and leak free. Do not over-tighten connections or
use tools to tighten connections. Excessive torque may cause
premature thread failure and may cause high pressure fittings to split
at pressure lower than rated capacity. When using quick disconnect
fittings, make sure the fittings are correctly and completely fastened
together.
CAUTION
Use care to ensure that pieces of tape do not enter the hydraulic system.
Pieces of tape in the fluid impairs fluid flow, causing system malfunctions.
(3)
MAINTENANCE
This section refers to components commonly found in a hydraulic system.
General
1. Keep the components clean at all times. Many hydraulic service
problems are caused by dirt and/or metallic particles in the hydraulic
system. To avoid these problems, the use of proper maintenance
including rust prevention and cleanliness will help extend the life of
your hydraulic system.
2. Use only an approved clean hydraulic fluid and change fluid as
recommended by the manufacturer. Change fluids more often if unit is
used under extreme conditions.
3. Change or clean the filter in the system periodically if one is used.
Hydraulic Hoses
1. Hydraulic hoses should be left in carton until needed.
2. Store hoses at a temperature between 50º to 75ºF [10º to 24ºC ] and
at a humidity between 20 and 70 percent.
3. Never store hoses in a hot, damp room, in direct sunlight or near heat
sources.
4. Do not stack hoses. The weight of the pile will tend to flatten the hose
on the bottom. Hanging in a rack is preferred.
5. Do not carry or drag hydraulic assemblies by pulling or pushing on
couplings or hoses.
(4)
Hoja de instrucciones
®
DESCRIPCION
Enerpac suministra tres tipos diferentes de mangueras hidráulicas: de
plástico térmico, de caucho para servicio severo y de nilón. La manguera
de plástico térmico tiene cuatro capas, dos de las cuales tienen trenzado
de acero de alta resistencia. La manguera de caucho está reforzada con
dos capas de trenzado de acero. La manguera de nilón tiene un
revestimiento exterior de plástico.
ADVERTENCIA
No utilice las mangueras Enerpac en sistemas cuya presión exceda los 700
bar [10,000 psi].
Inerte a la mayoría de los flui- Inerte a la mayoría de los flui- Menos tolerante a diferentes
Tolerancia a fluidos
dos dos tipos de fluido
Durabilidad de reves-
Resistente a abrasiones Resistente a abrasiones Fácil de dañar
timiento exterior
Tolerancia a ciclos
Muy tolerante Tolerante Menos tolerante
de alta presión
INFORMACION SOBRE SEGURIDAD
Para evitar lesiones personales mientras el sistema está funcionando, lea
y observe toda la información encontrada en los AVISOS,
ADVERTENCIAS e INSTRUCCIONES que acompañan el producto.
ENERPAC NO SE HACE RESPONSABLE DE LOS DAÑOS O LESIONES
CAUSADOS POR EL USO INSEGURO DEL PRODUCTO, LA FALTA DE
MANTENIMIENTO, O LA APLICACION INCORRECTA DEL PRODUCTO Y
SISTEMA. Ante cualquier duda sobre las aplicaciones y medidas de
seguridad, póngase en contacto con Enerpac.
ADVERTENCIA
Asegúrese que TODOS los componentes del sistema, incluso los
acopladores, adaptadores y tubos tengan la capacidad necesaria para trabajar
con la presión máxima de trabajo del sistema. La presión de funcionamiento del
sistema no debe sobrepasar el régimen de presión del componente de presión
más baja en el sistema. De lo contrario, se puede causar la falla del sistema, lo
cual puede resultar en lesiones personales graves y daños al equipo.
ADVERTENCIA
Siempre use el equipo protector personal apropiado cuando maneje el
equipo hidráulico.
ADVERTENCIA
Asegúrese que todos los componentes del sistema estén
protegidos de fuentes dañinas externas, tales como calor
excesivo, llamas, salpicaduras de soldadura, piezas mecánicas
móviles, bordes afilados y productos químicos corrosivos. NO
exponga las mangueras a temperaturas mayores o iguales que
65°C [150°F].
ADVERTENCIA
NUNCA conecte ni desconecte componentes hidráulicos
mientras el sistema se encuentre presurizado.
ADVERTENCIA
Siempre use el equipo protector personal apropiado cuan-
do maneje el equipo hidráulico.
ADVERTENCIA
No manipule las mangueras presurizadas. Reemplace las
mangueras dañadas de inmediato. El fluido hidráulico que se
escapa a presión a través de un agujero pequeño tiene fuerza
suficiente para penetrar la piel, causando lesiones graves. Si se
inyecta fluido en la piel, consulte a un médico de inmediato.
ATENCION
No utilice la manguera hidráulica para levantar
componentes hidráulicos, tales como las bombas y cilindros.
ATENCION
Utilice únicamente los fluidos recomendados por el fabricante. No mezcle
fluidos diferentes en un mismo sistema. Utilice únicamente fluidos compatibles
con los componentes del sistema, de lo contrario se dañarán los sellos y
mangueras. Los fluidos sintéticos y a prueba de incendios requieren el uso de
sellos y mangueras especiales. Comuníquese con el centro de servicio autorizado
más cercano o con el fabricante para las recomendaciones del caso.
(14)
INSTALACION
Mangueras hidráulicas
1. Antes de usar el sistema, inspeccione visualmente todos sus
componentes.
2. Asegúrese que la manguera no tenga roturas, dobladuras, cortes ni
otros daños que pudieran causar fugas. Unos protectores de caucho
protegen las zonas engarzadas de cada extremo de la manguera.
3. Asegúrese que los extremos de la manguera, R=4½ in.
acopladores y juntas estén limpios y que sus roscas R=11,4 cm
estén en buenas condiciones.
4. La manguera no debe estar torcida ni doblada hasta
quebrarla. El radio de curvatura debe medir un
mínimo de 11,4 cm (4.5 inches). Utilice la cantidad
mínima de dobladuras posible.
5. No deje caer objetos pesados sobre la manguera.
Un fuerte impacto puede causar daños internos a
los alambres de la manguera. Si se aplica presión a
una manguera dañada se podría causar su rotura.
6. Asegúrese que todas las conexiones entre la bomba y el cilindro
estén bien apretadas y libres de fugas. No apriete las conexiones en
exceso ni utilice herramientas para apretarlas. El apriete excesivo de
las conexiones causa la falla prematura de las roscas y puede hacer
que los adaptadores de alta presión se rompan a una presión menor
que su capacidad nominal. Si se usan adaptadores de desconexión
rápida, asegúrese que éstos se encuentren instalados de modo
correcto y completo.
Adaptadores y tubería
Observe las recomendaciones siguientes cuando se utilicen adaptadores
en un sistema hidráulico.
1. Tenga cuidado de evitar trasroscar los adaptadores roscados.
2. Asegúrese de sellar las conexiones con un elemento sellador de
tubos de buena calidad.
3. La cinta adhesiva o pasta selladora debe aplicarse únicamente a las
roscas. No aplique cinta adhesiva a la primera rosca para evitar que
partículas de la misma ingresen al sistema.
ATENCION
Evite que partículas de cinta adhesiva ingresen al sistema hidráulico. Los
pedazos de cinta adhesiva perjudican el caudal del fluido y causan averías en el
sistema.
4. Las cargas por vibración y cargas de choque del sistema son las
causas principales de la falla de adaptadores/tuberías. Utilice
soportes de tubería disponibles en el mercado para prolongar la vida
útil del sistema. La zona más crítica en la cual se debe colocar un
soporte de tubería es a unos 10-18 cm de cada adaptador.
5. Los tubos no son rígidos. Los tramos largos necesitan soporte. Las
secciones sin soportes instalados pueden causar la falla prematura
de los adaptadores. Las válvulas y manómetros siempre deben
instalarse con un montaje firme. Nunca permita que el tubo sea el
único medio de soporte.
(15)
MANTENIMIENTO
Esta sección describe componentes hallados comúnmente en un sistema hidráulico.
Generalidades
1. Mantenga los componentes limpios en todo momento. Muchos de los
problemas en los sistemas hidráulicos son causados por la presencia
de tierra y/o partículas en el sistema hidráulico. Para evitar estos
problemas, utilice procedimientos de mantenimiento apropiados,
incluyendo mantenimiento preventivo y procedimientos de prevención
de herrumbre y de limpieza, para prolongar la vida útil del sistema
hidráulico.
2. Utilice únicamente fluido hidráulico limpio de tipo aprobado y cambie
el fluido con la frecuencia recomendada por el fabricante. Cambie los
fluidos con mayor frecuencia si se trabaja en condiciones extremas.
3. Si el sistema utiliza un filtro, cámbielo o límpielo periódicamente.
Mangueras hidráulicas
1. Deje las mangueras hidráulicas en su caja hasta el momento de
usarlas.
2. Guarde las mangueras a una temperatura de 10° a 24°C [50° a 75°F],
con una humedad relativa de 20 a 70%.
3. Nunca guarde las mangueras en un lugar caliente y húmedo, ni las
exponga a la luz solar directa o a fuentes de calor.
4. No apile las mangueras. El peso de la pila tiende a aplastar la
manguera en el fondo de la misma. Es preferible colgarlas en un
estante.
5. No transporte ni arrastre los conjuntos hidráulicos tirando ni
empujando los acoplamientos y las mangueras.
Adaptadores y acopladores
1. Todas las roscas de los acopladores, sean macho o hembra, deben
mantenerse limpias y lubricarse periódicamente. Cubra los
acopladores con tapas guardapolvo cuando no estén conectados al
sistema. No quite las tapas o tapones hasta que el componente esté
listo para usarse.
2. Mantenga las tapas guardapolvo colocadas en los acopladores
cuando no estén en uso. Asegúrese que todos los acopladores no
utilizados estén sellados con tapas guardapolvo/protectores de rosca.
3. Asegúrese que todas las conexiones de manguera estén libres de
partículas extrañas y suciedad.
(16)
Instruction Sheet
Visually inspect all components for shipping damage. or wood blocks that are capable of
®
Shipping damage is not covered by warranty. If supporting the load. Never use a hydraulic cylinder
shipping damage is found, notify carrier at once. The as a shim or spacer in any lifting or pressing
carrier is responsible for all repair and replacement application.
costs resulting from damage in shipment. DANGER: To avoid personal injury
keep hands and feet away from cylinder
SAFETY FIRST and workpiece during operation.
2.0 SAFETY ISSUES WARNING: Do not exceed equipment
Read all instructions, ratings. Never attempt to lift a load
warnings and cautions weighing more than the capacity of the
carefully. Follow all safety cylinder. Overloading causes equipment
precautions to avoid personal injury or property failure and possible personal injury. The cylinders are
damage during system operation. Enerpac cannot be designed for a max. pressure of 700 bar [10,000 psi].
responsible for damage or injury resulting from unsafe Do not connect a jack or cylinder to a pump with a
product use, lack of maintenance or incorrect product higher pressure rating.
and/or system operation. Contact Enerpac when in DANGER: Never set the relief valve to a
doubt as to the safety precautions and operations. If higher pressure than the maximum rated
you have never been trained on high-pressure pressure of the pump. Higher settings
hydraulic safety, consult your distribution or service may result in equipment damage and/or
center for a free Enerpac Hydraulic safety course. personal injury. Do not remove relief valve.
Failure to comply with the following cautions and WARNING: The system operating
warnings could cause equipment damage and pressure must not exceed the pressure
personal injury. rating of the lowest rated component in
A CAUTION is used to indicate correct operating or the system. Install pressure gauges in the
maintenance procedures and practices to prevent system to monitor operating pressure. It is your
damage to, or destruction of equipment or other window to what is happening in the system.
property. CAUTION: Avoid damaging hydraulic
A WARNING indicates a potential danger that hose. Avoid sharp bends and kinks when
requires correct procedures or practices to avoid routing hydraulic hoses. Using a bent or
personal injury. kinked hose will cause severe back-
pressure. Sharp bends and kinks will internally
A DANGER is only used when your action or lack of damage the hose leading to premature hose failure.
action may cause serious injury or even death.
Do not drop heavy objects on hose. A
WARNING: Wear proper personal sharp impact may cause internal damage
protective gear when operating hydraulic ®
SPECIFICATIONS – Use this instruction sheet for the following hand pump models.
Hand Pump Specifications
Model Type Maximum Pressure Oil Volume per Stroke Usable Oil Capacity
(Speed) Rating psi [bar] in 3 [cm 3] in3 [cm3]
EHF-65 1 6,500 [440] .16 [2.62] 22 [360]
P-18 1 2,850 [200] .16 [2.62] 22 [360]
P-25 1 2,500 [170] .58 [9.51] 231 [3786]
P-39, 1003 1 10,000 [700] .16 [2.62] 43 [705]
P-50 1 5,000 [340] .29 [4.75] 231 [3786]
P-51 1 3,000 [210] .25 [4.09] 50 [820]
P-141, 1001 1 10,000 [700] .055 [.90] 20 [328]
P-391, 1004 1 10,000 [700] .151 [2.47] 55 [900]
2
3.0 DESCRIPTION 3.2 Models P-18/P-39, 1003/P-80, 1006/
P-84/P-801, P-77
3.1 Models P-141, 1001; P-142, 1002; Figure 2 and the corresponding table below show the
P-202; P-391, 1004; P-392, 1005; P-802; main components of these hand pump models.
P-842 Model P-84 is equipped with a 4-way, 3-position
Figure 1 and the corresponding table show the main valve for use with double-acting cylinders. To convert
components of hand pump models P-141, P-142, P- models P-18 or P-39 to foot operation, order Kit PC-10.
202, P-391, P-392, P-802, and P-842. The dual-
purpose vent/fill cap acts as a pressure relief valve in
case of accidental reservoir pressurization. To A
provide an access port at the rear of the reservoir for
remote valves, use a return-to-tank kit. See the Table B
1 for kit model numbers. A
A
D B
A
B
B
E B
C
P842
Figure 2
B
D WARNING: These pumps are operated
with a non-vented reservoir. If the
reservoir is subjected to high pressure,
Figure 1 the casing may rupture, causing
personal injury and/or equipment damage.
NEVER attempt to return more oil to the reservoir
than it is capable of holding.
Table 1
Fig. 1 P-141, 1001 P-142, 1002 P-202 P-391, 1004 P-392, 1005 P-802 P-842
A Release Valve Release Valve Release Valve Release Valve Release Valve Release Valve 4-Way Valve
B 1 /4 NPTF 1 /4 NPTF 1 /4 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF
Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port
C Vent/Fill Vent/Fill Vent/Fill Vent/Fill Vent/Fill Vent/Fill Vent/Fill
Cap Cap Cap Cap Cap Cap Cap
D Mounting Mounting — — — Mounting Mounting
Slots Slots Slots
E — — — — — Return-to-Tank —
Port
Return-to PC-20 PC-20 PC-25 PC-25 PC-25 — —
-Tank Kit
Table 2
Fig. 2 P-18 P-39, 1003 P-77 P-80, 1006 P-84 P-801
A Release Valve Release Valve Release Valve Release Valve Release Valve Release Valve
B 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF
Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port
C Fill Plug Fill Plug Fill Plug Fill Plug Fill Plug Fill Plug
D — — — 1/4 NPTF — 1/4 NPTF
Return-to-Tank Port Return-to-Tank Port
3
3.3 Models P-462 and P-464 Table 4 and 5
Figure 3 and the table below show the main features Fig. 4 & 5 P-25 P-50 P-51
of hand pump models P-462, for use with single- A Release Valve Release Valve Release Valve
acting cylinders, and P-464, for use with double- B 1/4 NPTF 1/4 NPTF 1/4 NPTF
Outlet Port Outlet Port Outlet Port
acting cylinders.
C Vent/Fill Cap Vent/Fill Cap Vent/Fill Cap
4.0 INSTALLATION
C
4.1 Connecting the Pump
D 1. Thread hose into pump outlet. Use 1 1/2 wraps of
Teflon tape (or suitable thread sealant) on hose
B
fitting, leaving the first complete thread free of tape
to ensure that tape does not shed into hydraulic
system, causing damage. Trim loose ends.
A 2. Install a pressure gauge in-line from the pump for
added safety and better control.
3. Connect the hose(s) to your cylinder or tool.
P-462/464F3
C OPERATING POSITION
EHF-65. . . . . . . . . either P-202 . . . . . . . . . either
A P-18 . . . . . . . . . . . either P-391, 1004 . . . . . either
P-25 . . . . horizontal only P-77 . . . . . . . . . . either
P-39, 1003 . . . . . . either P-392, 1005 . . . . . either
B P-50 . . . . horizontal only P-392AL . . . . . . . . either
P-51 . . . . horizontal only P-462. . . horizontal only
P-80, 1006 . . . . . . either P-464 . . . horizontal only
P-84 . . . . . . . . . . . either P-801 . . . . . . . . . either
P-51F5
4
NOTE: When operating the pump in the vertical CAUTION: Close release valve finger
position, the hose end must be pointed down, or the tight ONLY. Using tools on release valve
pump will pick up air and will not build pressure properly. can damage it and cause the pump to
malfunction.
5.0 OPERATION
2. Operate pump handle to deliver hydraulic power
to system. Pressure will be maintained until
5.1 Before Using the Pump release valve is opened.
1. Check all system fittings and connections to be 3. Open release valve (turn counter-clockwise) to
sure they are tight and leak free. release pressure, allowing oil to flow back to the
2. Check oil level in reservoir before operating reservoir.
pump. See "Adding Oil to the Pump" on page 7.
5.4 Single-Acting Applications with 3-Way,
2 Position Manual Valve
CAUTION: NEVER add extensions to
pump handle. Extensions cause 1. Shift valve handle to position 1 as shown in Figure 7.
unstable pump operation. 2. Operate pump handle to deliver hydraulic power
to the system. Pressure will be maintained until
WARNING: In certain situations the the valve is shifted.
pump handle can "kick back". Always
3. To allow oil to return to the reservoir, shift valve
keep your body to the side of the pump,
handle to position 2.
away from the line of force of the handle.
NOTE: To reduce handle effort at high pressure, take 2 2
short strokes. Maximum leverage is obtained in the
last 5° of stroke.
A B
A B
Figure 6 Figure 8a
5
5.6 Relief Valve Adjustment
A B A B A B
All pumps contain a factory set relief valve to prevent
over-pressurization of the system. Lower pressure
settings can be obtained. Contact your Authorized
I
Enerpac Service Center.
A N B
6.0 AIR REMOVAL
Removing air from the hydraulic system will help the
Figure 8b cylinder to advance and retract smoothly (see figure 9).
1. Position lever on 4-way valve to select function as 6.1 Pump With Single-Acting Cylinder (A)
follows: 1. Vent pump reservoir (for vented pumps only) and
(A) Flow to Port "A"; port "B" returns flow to the close release valve.
reservoir 2. Position pump at higher elevation than cylinder.
(N) Neutral; ports "A" and "B" are blocked 3. Position cylinder with the plunger end down (up if
(B) Flow to port "B"; port "A" returns flow to the using pull cylinder). See Figure 9 below.
reservoir 4. Operate pump to fully extend the cylinder (retract
if using pull cylinder).
5. Open release valve to retract cylinder (extend if a
pull cylinder). This will force the trapped air to
move up to the pump reservoir.
6. Repeat the above steps as necessary.
N
7. Add oil if necessary. See page 7.
8. Return vent/fill cap to operating position.
B
A 6.2 Pump With Double-Acting Cylinder (B)
A
1. Vent pump reservoir (for vented pumps only).
B 2. Position pump at higher elevation than cylinder.
3. Put cylinder in horizontal position with ports up.
See Figure 9.
Figure 8c 4. Fully advance and retract the cylinder 2 to 3 times.
5. Repeat the above steps as necessary.
2. Operate pump to perform work. 6. Add oil if necessary. See page 7.
3. Change valve positions as needed. 7. Return vent/fill cap to operating position.
air
air
A B
Figure 9
6
7.1 Adding Oil to the Pump
B, C
Check oil level regularly.
A
WARNING: Always add oil with
cylinders fully retracted (extended if
pull cylinders) or the system will contain
more oil than the reservoir can hold.
1. Remove vent/fill cap from reservoir.
2. Fill reservoir only to level mark shown on pump.
3. Remove air from system if necessary. See page 6.
Recheck oil level after removing air.
4. Return vent/fill cap to proper position. Figure 10
NOTE: Non-vented hand pumps require air in the
reservoir to function properly. If the reservoir is 7.4 Changing the Oil
completely filled, a vacuum will form preventing 1. Drain all oil and refill with clean Enerpac oil every
oil from flowing out of the pump. 12 months. If pump is used in dirty environments,
change the oil more often.
7.2 Keeping Oil Lines Clean
2. Remove vent/fill cap or plug from reservoir.
When coupler halves are disconnected, always screw 3. Tilt pump to drain out old oil.
on dust caps. Use every precaution to guard unit
against entrance of dirt because foreign matter may 4. Fill reservoir only to level mark shown on pump.
cause pump, cylinder, or valve failure. 5. Replace the vent/fill cap or plug.
6. Dispose of used oil properly.
7.3 Lubricating the Pump
To extend pump life and improve performance,
8.0 TROUBLESHOOTING GUIDE
lubricate the beam pin (A), cross pin (B), and piston
head (C) regularly, using roller bearing grease. See The following information is intended as an aid in
Figure 10. determining if a problem exists. For repair service,
contact the Authorized Enerpac Service Center in
your area.
TROUBLESHOOTING
Problem Possible Cause Solution
Cylinder does not 1. Oil level in pump reservoir is 1. Add oil according to the Maintenance instructions on
advance, advances low. page 6.
slowly, or advances in 2. Release valve open. 2. Close the release valve.
spurts.
3. Loose hydraulic coupler. 3. Check that all couplers are fully tightened.
4. Load is too heavy. 4. Do not attempt to lift more than rated tonnage.
5. Air trapped in system. 5. Remove air according to the instructions on page 6.
6. Cylinder plunger binding. 6. Check for damage to cylinder. Have cylinder serviced by
a qualified hydraulic technician.
Cylinder advances, but 1. Leaking connection. 1. Check that all connections are tight and leak free.
does not hold pressure. 2. Leaking seals. 2. Locate leak(s) and have equipment serviced by a
3. Internal leakage in pump. qualified hydraulic technician.
3. Have pump serviced by a qualified hydraulic technician.
Cylinder does not retract, 1. Release valve closed. 1. Open release valve.
retracts part way, or 2. Pump reservoir is over-filled. 2. Drain oil level to full mark. See page 7 instructions for
retracts more slowly than adding oil.
3. Loose hydraulic coupler.
normal.
4. Air trapped in system. 3. Check that all couplers are fully tightened.
5. Hose I.D. too narrow. 4. Remove air according to the instructions on page 6.
6. Cylinder retraction spring 5. Use larger diameter hydraulic hose.
broken or other cylinder 6. Have cylinder serviced by a qualified hydraulic
damage. technician.
7
Hoja de Instrucciones
®
Seleccione cuidadosamente bloques de
Lea todas las instrucciones, acero o de madera capaces de soportar la
advertencias y precauciones. carga. Nunca use un cilindro hidráulico como calza o
Acate todas las precauciones de separador en aplicaciones de levantamiento o presión.
seguridad para evitar lesiones personales o daños a la
propiedad durante la operación del sistema. PELIGRO: Para evitar lesiones
ENERPAC no puede ser responsable de daños o personales, mantenga las manos y
lesiones que resulten de no usar el producto de forma los pies alejados del cilindro y pieza
segura, falta de mantenimiento o aplicación de trabajo durante la operación.
incorrecta del producto y/u operación del sistema. ADVERTENCIA: No sobrepase el valor
Comuníquese con ENERPAC si tuviese dudas sobre nominal del equipo. Nunca intente
las precauciones de seguridad o sobre las levantar una carga que pese más de la
aplicaciones. Si nunca ha sido capacitado en capacidad del cilindro. Las sobrecargas
seguridad hidráulica de alta presión, consulte a su ocasionan fallas del equipo y posibles lesiones
distribuidor o centro de servicio para obtener un curso personales. Los cilindros están diseñados para
de seguridad gratis denominado ENERPAC Hydraulic. resistir una presión máxima de 700 bar. No conecte
El no cumplir con las siguientes precauciones y un gato o cilindro a una bomba cuyo valor nominal de
advertencias podría causar daños al equipo y presión es mayor que el indicado.
lesiones personales. PELIGRO: Nunca fije la válvula de
Una PRECAUCIÓN se utiliza para indicar seguridad a una presión más alta que el
procedimientos y prácticas de operación o máximo valor nominal de presión de la
mantenimiento correctos para evitar daños o la bomba. Los ajustes más altos pueden
destrucción de equipo u otra propiedad. resultar en daños al equipo y/o lesiones personales.
No remover la válvula de seguridad.
Una ADVERTENCIA indica un potencial peligro que
requiere de procedimientos o prácticas correctos ADVERTENCIA: La presión de operación
para evitar lesiones personales. del sistema no debe sobrepasar el valor
nominal de presión del componente con el
Un PELIGRO se utiliza sólo cuando su acción o falta valor nominal más bajo en el sistema.
de acción podría causar lesiones graves o incluso la Instale manómetros de presión en el sistema para
muerte. vigilar la presión de operación. Es su ventana a lo que
ADVERTENCIA: Use el equipo de está sucediendo en el sistema.
protección personal adecuado cuando PRECAUCIÓN: Evite dañar la manguera
opere equipo hidráulico. hidráulica. Evite pliegues y curvas
agudos al guiar las mangueras
ADVERTENCIA: Manténgase alejado de hidráulicas. Usar una manguera con
las cargas soportadas por sistemas pliegues o curvas puede causar severa
hidráulicos. Cuando un cilindro se utiliza contrapresión. Los pliegues y curvas agudos
como dispositivo para levantar carga, causarán daños internos la manguera, lo que
nunca debería usarse como dispositivo para ocasionará que ésta falle prematuramente.
30
No deje caer objetos pesados sobre la superficie plana capaz de soportar la carga. De ser
manguera. Un impacto directo puede necesario, utilice una base de cilindro para mayor
causar daños internos a las hebras de estabilidad. No suelde ni modifique el cilindro en modo
®
alambre de la manguera. Aplicar presión a una alguno para fijarle una base u otro medio de soporte.
manguera dañada puede ocasionar que se quiebre.
Evite las situaciones en las cuales las
IMPORTANTE: No levante el equipo cargas no estén directamente centradas
hidráulico por las mangueras o sobre el émbolo del cilindro. Las cargas
acopladores giratorios. Use el mango de descentradas producen un esfuerzo
transporte u otros medios para considerable sobre los cilindros y los émbolos.
transportarla con seguridad. Adeás, la carga podria resbalar o caerse, creando
situaciones potencialmente peligrosas.
PRECAUCIÓN: Mantenga el equipo
hidráulico alejado de las llamas y el Distribuya la carga uniformemente sobre
calor. El calor en exceso ablandará las la superficie total del asiento del cilindro.
juntas y sellos, lo que resultará en Siempre utilice un asiento para proteger el
fugas de líquidos. Asimismo, el calor debilita los émbolo cuando no se usen accesorios
materiales de la manguera y juntas. Para lograr un roscados.
rendimiento óptimo, no exponga el equipo a
IMPORTANTE: Únicamente técnicos
temperaturas de 65 °C [150 °F] o mayores. Proteja las
calificados en sistemas hidráulicos habrán
mangueras y cilindros de salpicaduras de soldadura.
de prestarle servicio al equipo hidráulico.
PELIGRO: No manipule mangueras bajo Comuníquese con el Centro de Servicio
presión. El aceite que escape bajo ENERPAC autorizado en su zona para prestarle
presión puede penetrar la piel y causar servicio de reparaciones. Use únicamente aceite
lesiones graves. Si se inyecta aceite bajo ENERPAC a fin de proteger su garantía.
la piel, consulte a un médico inmediatamente.
ADVERTENCIA: Reemplace
ADVERTENCIA: Use cilindros inmediatamente las piezas gastadas o
hidráulicos únicamente en sistemas dañadas por piezas ENERPAC genuinas.
acoplados. Nunca use un cilindro si los Las piezas de clasificación estándar se
acopladores no están conectados. Si el romperán, lo que causará lesiones personales y daños
cilindro se sobrecarga, los componentes a la propiedad. Las piezas ENERPAC están diseñadas
pueden fallar calamitosamente, lo que causaría para encajar debidamente y resistir altas cargas.
lesiones personales graves.
ATENCION: Siempre acarree la bomba
ADVERTENCIA: Asegurese que el tomándola del asa. Si la acarrea de la manguera
equipo sea antes de levantar la carga. puede dañar la manguera y/o la bomba.
El cilindro debe colocarse sobre una
®
ESPECIFICACIONES – Use esta hoja de instrucciones para los siguientes modelos de bombas manuales.
Especificaciones
Modelo Tipo Presión máxima Volumen de aceite por Capacidad de aceite
(velocidad) psi [bar] embolada pulg3 [cm 3] pulg3 [cm3]
EHF-65 1 6,500 [440] .16 [2.62] 22 [360]
P-18 1 2,850 [200] .16 [2.62] 22 [360]
P-25 1 2,500 [170] .58 [9.51] 231 [3786]
P-39, 1003 1 10,000 [700] .16 [2.62] 43 [705]
P-50 1 5,000 [340] .29 [4.75] 231 [3786]
P-51 1 3,000 [210] .25 [4.09] 50 [820]
P-141, 1001 1 10,000 [700] .055 [.90] 20 [328]
P-391, 1004 1 10,000 [700] .151 [2.47] 55 [900]
Etapa 1 Etapa 2 Etapa 1 Etapa 2
P-80, 1006 2 350 [25] 10,000 [700] .99 [16.23] .15 [2.46] 140 [2295]
P-84 2 350 [25] 10,000 [700] .99 [16.23] .15 [2.46] 140 [2295]
P-142, 1002 2 200 [14] 10,000 [700] .221 [3.62] .055 [.90] 20 [328]
P-142AL 2 200 [14] 10,000 [700] .221 [3.62] .055 [.90] 9.0 [148]
P-202 2 200 [14] 10,000 [700] .221 [3.62] .055 [.90] 55 [900]
P-77 2 200 [14] 10,000 [700] .63 [16.0] .094 [2.41] 47 [769]
P-392, 1005 2 200 [14] 10,000 [700] .687 [11.26] .151 [2.47] 55 [900]
P-392AL 2 200 [14] 10,000 [700] .687 [11.26] .151 [2.47] 55 [900]
P-462 2 200 [14] 10,000 [700] 7.69 [126.00] .29 [4.75] 462 [7572]
P-464 2 200 [14] 10,000 [700] 7.69 [126.00] .29 [4.75] 462 [7572]
P-801 2 350 [25] 10,000 [700] .99 [16.23] .15 [2.46] 250 [4095]
P-802 2 400 [28] 10,000 [700] 2.40 [39.34] .15 [2.46] 155 [2540]
P-842 2 400 [28] 10,000 [700] 2.40 [39.34] .15 [2.46] 155 [2540]
31
3.0 DESCRIPCION 3.2 Modelos P-18/P-39, 1003/P-80, 1006/
P-84/P-801, P77
3.1 Modelos P-141, 1001/P-142, 1002/P- La Figura 2 y la tabla correspondiente a continuación
202/P-391, 1004/P-392, 1005/P-802/P-842 muestran los componentes principales de estos
La Figura 1 y la tabla correspondiente a continuación modelos de bombas manuales. Los modelos P-84
muestran los componentes principales de los están equipados con una válvula de 4 vías y 3
modelos de bombas manuales P-141, P-142, P 202, posiciones para uso con cilindros de doble efecto.
P-391, P-392, P-802, y P-842. La tapa de doble Para convertir los modelos P-18 ó P-39 a
propósito de ventilación/llenado actúa como una accionamiento por pedal, pida el conjunto PC-10.
válvula de alivio de presión en el caso de ocurrir una
presurización accidental del depósito. Para proveer A
una conexión de acceso en la parte trasera del
depósito para las válvulas remotas, use un conjunto B
de retorno al tanque. Vea la tabla a continuación para A
los números de modelos de los conjuntos.
A D B
A
B
B
E B
C
P842
Figura 2
C
Tabla 1
Fig. 1 P-141, 1001 P-142, 1002 P-202 P-391, 1004 P-392, 1005 P-802 P-842
A Válvula de alivio Válvula de alivio Válvula de alivio Válvula de alivio Válvula de alivio Válvula de alivio Válvula de 4 vías
B Conexión de Conexión de Conexión de Conexión de Conexión de Conexión de Conexión de
salida 1/4 NPTF salida 1/4 NPTF salida 1/4 NPTF salida 3/8 NPTF salida 3/8 NPTF salida 3/8 NPTF salida 3/8 NPTF
C Tapa de Tapa de Tapa de Tapa de Tapa de Tapa de Tapa de
ventilación/ ventilación/ ventilación/ ventilación/ ventilación/ ventilación/ ventilación/
llenado llenado llenado llenado llenado llenado llenado
D Ranuras Ranuras — — — Ranuras Ranuras
de montaje de montaje de montaje de montaje
E — — — — — Retorno al depósito —
Conjunto PC-20 PC-20 PC-25 PC-25 PC-25 — —
de retorno
al tanque
Tabla 2
Fig. 2 P-18 P-39, 1003 P-77 P-80, 1006 P-84 P-801
A Válvula de alivio Válvula de alivio Válvula de alivio Válvula de alivio Válvula de 4 vías Válvula de alivio
y 3 posiciones
B Conexión de salida Conexión de salida Conexión de salida Conexión de salida Conexión de salida Conexión de salida
3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF
C Tapón de Tapón de Tapón de Tapón de Tapón de Tapón de
D — — — etorno al depósito — etorno al depósito
1/4 NPTF 1/4 NPTF
32
3.3 Modelos P-462 y P-464 Tabla 4 y 5
Fig.4/5 P-25 P-50 P-51
La Figura 3 y la tabla a continuación muestran las
A Válvula de alivi Válvula de alivi Válvula de alivi
características principales de los modelos de
B Conexión de Conexión de Conexión de
bombas manuales P-462 para uso con cilindros de salida1/4 NPTF salida1/4 NPTF 1salida/4 NPTF
simple efecto y P-464 para uso con cilindros de
C Tapón de Tapón de Tapón de
doble efecto. ventilación/llenado ventilación/llenado ventilación/
llenado
C
4.0 INSTALACION
D
4.1 Conexión de la bomba
B 1. Enrosque la manguera en la salida de la bomba.
Ponga 1 1/2 vueltas de cinta de teflón (o sellador
de roscas adecuado) en los racores de la
A
manguera, dejando el primer hilo de rosca sin
encintar para asegurar que no se desprendan
pedazos de cinta y entren al sistema hidráulico y
P-462/464F3
OPCIONES DE VENTILACION
B
P-51F5
33
4.3 Posición de la bomba NOTA: Para mejor rendimiento, accione la palanca
de la bomba a velocidad moderada durante la
Vea la tabla a continuación para determinar la posición primera etapa de caudal alto. La velocidad rápida de
correcta de funcionamiento de su bomba, horizontal o la palanca en la primera etapa impedirá que la bomba
vertical. La P-80, P-801, y la P-84 no podrán cebarse alimente el volumen total de aceite.
cuando estén trabajando verticalmente.
POSICION DE FUNCIONAMIENTO
5.3 Aplicaciones de simple efecto con
válvula de alivio
EHF-65 . . . . . cualquiera de los dos P-202 . . . . . . cualquiera de los dos
P-18 . . . . . . . cualquiera de los dos P-391, 1004 . cualquiera de los dos 1. Cierre la válvula de alivio girándola en sentido
P-25. . . . . . . . horizontal solamente P-77 . . . . . . . cualquiera de los dos
P-39, 1003 . . cualquiera de los dos P-392, 1005. . cualquiera de los dos horario, como se muestra en la Figura 6.
P-50. . . . . . . . horizontal solamente P-392AL . . . . cualquiera de los dos
P-51. . . . . . . . horizontal solamente P-462 . . . . . . horizontal solamente
P-80, 1006 . . cualquiera de los dos P-464 . . . . . . horizontal solamente
P-84 . . . . . . . cualquiera de los dos P-801 . . . . . cualquiera de los dos
P-141, 1001 . cualquiera de los dos P-802 . . . . . . cualquiera de los dos
P-142, 1002 . cualquiera de los dos P-842 . . . . . . cualquiera de los dos
P-142AL . . . . cualquiera de los dos
34
5.5 Aplicaciones de doble efecto con 6.0 PURGA DEL AIRE
válvula manual de 4 vías y 3 posiciones
La purga del aire del sistema hidráulico permitirá que
Las bombas con válvulas de control de 4 vías están el cilindro se extienda y se retraiga suavemente. Vea
diseñadas para accionar cilindros de doble efecto. la Figura 9.
Vea la Figura 8 en la página 13 para las posiciones de
la válvula. 6.1 Bomba con cilindro de simple efecto (A)
N
1. Abra el respiradero del depósito de la bomba
(para bombas con ventilación solamente) y cierre
A B la válvula de alivio.
2. Coloque la bomba más elevada que el cilindro.
A B
3. Coloque el cilindro con el extremo del émbolo
hacia abajo (arriba en caso de cilindro de
tracción). Vea la Figura 9.
4. Haga funcionar la bomba para extender
totalmente el cilindro (retraer en caso de cilindro
de tracción).
Figura 8a
5. Abra la válvula de alivio para retraer el cilindro
A B A B A B (extender en caso de cilindro de tracción). Esto
empujará el aire retenido hacia el depósito de la
bomba.
I 6. Repita los pasos anteriores según sea necesario.
7. Añada aceite si es necesario. Vea la página 35.
A N B
8. Vuelva a poner la tapa de ventilación/llenado en
Figura 8b posición de funcionamiento.
11. Coloque la palanca en la válvula de 4 vías para 6.2 Bomba con cilindro de doble efecto (B)
seleccionar la función de la siguiente manera:
1. Abra el respiradero del depósito de la bomba
(A) Paso al orificio "A"; el orificio "B" devuelve el (para bombas con ventilación solamente).
aceite al depósito
2. Coloque la bomba más elevada que el cilindro.
(N) Neutro; los orificios "A" y "B" están
3. Ponga el cilindro en posición horizontal con las
bloqueados
conexiones hacia arriba. Vea la Figura 9.
(B) Paso al orificio "B"; el orificio "A" devuelve el
4. Extienda y retraiga totalmente el cilindro 2 a 3 veces.
aceite al depósito
5. Repita los pasos anteriores según sea necesario.
6. Añada aceite si es necesario. Vea la página 35.
7. Vuelva a poner la tapa de ventilación/llenado en
posición de funcionamiento.
N
A
B 7.0 MANTENIMIENTO
A
Use únicamente aceite hidráulico Enerpac con estas
B
bombas para prolongar la duración de la bomba y
proteger su garantía. Los juegos de sellos Viton y
Figura 8c EPR están disponibles para algunas bombas
manuales. Para más información acerca de estos
2. Haga funcionar la bomba para realizar el trabajo. productos y sus aplicaciones, póngase en
3. Cambie las posiciones de la válvula según sea comunicación con el representante de Enerpac.
necesario.
ADVERTENCIA: Haga funcionar el cilindro 7.1 Adición de aceite a la bomba
de doble efecto solamente cuando las dos
Revise el nivel de aceite regularmente.
mangueras están conectadas a la bomba.
Si se deja un acoplador desconectado, se ADVERTENCIA: Siempre añada aceite
acumulará alta presión detrás del acoplador lo que con los cilindros totalmente retraídos
podría causar lesiones corporales y/o daño al equipo. (extendidos en el caso de cilindros de
tracción) de lo contrario el sistema
5.6 Ajuste de la válvula de alivio sobrepasará la capacidad de aceite del depósito.
1. Quite la tapa de ventilación/llenado del depósito.
Todas las bombas tienen una válvula de alivio ajustada
en la fábrica para impedir la sobrepresurización del 2. Llene el depósito solamente hasta la marca de
sistema. Se pueden obtener ajustes de presión más nivel indicada en la bomba.
bajos. Póngase en contacto con el centro de servicio
autorizado Enerpac.
35
3. Purgue el aire del sistema si es necesario. Vea la B, C
página 51. Vuelva a revisar el nivel de aceite
A
después de purgar el aire.
4. Vuelva a poner la tapa de ventilación/llenado en la
posición apropiada.
NOTA: Las bombas manuales sin ventilación
requieren aire en el depósito para funcionar
correctamente. Si el depósito está totalmente lleno,
se formará un vacío que impedirá la salida de aceite
de la bomba.
Figura 10
7.2 Limpieza de las líneas de aceite 7.4 Cambio del aceite
Cuando se desconecte las mitades del acoplador, 1. Cada 12 meses, vacíe todo el aceite y vuelva a
siempre coloque tapas guardapolvo. Tome todas las llenar con aceite Enerpac. Si la bomba funciona
precauciones debidas para proteger la bomba contra en ambientes sucios, cambie el aceite más
la entrada de suciedad. La materia extraña puede frecuentemente.
causar la falla de la bomba, el cilindro o la válvula..
2. Quite la tapa de ventilación/llenado del depósito.
7.3 Lubricación de la bomba 3. Incline la bomba para vaciar el aceite viejo.
4. Llene el depósito solamente hasta la marca de
Para prolongar la duración de la bomba y mejorar su
nivel indicada en la bomba.
rendimiento, lubrique el pasador de soporte (A),
pasador transversal (B) y la cabeza del pistón (C) 5. Vuelva a poner el tapón o tapa de
regularmente con grasa para cojinetes de rodillos. ventilación/llenado.
Vea la Figura 10 a continuación. 6. Deseche el aceite viejo como es debido.
Aire
Aire
A B
Figure 9
1. Fugas en las conexiones. 1. Revise que todas las conexiones estén apretadas y sin fugas.
El cilindro se extiende, pero
2. Fugas en los sellos. 2. Ubique la(s) fuga(s) y haga reparar el equipo por un técnico
no retiene la presión
3. Fuga interna en la bomba. experto en sistemas hidráulicos.
3. Haga reparar la bomba por un técnico experto en sistemas
hidráulicos.
1. Válvula de alivio cerrada.
El cilindro no se retrae, lo 1. Abra la válvula de alivio.
2. El depósito de la bomba está lleno en
hace parcialmente o más 2. Vacíe el aceite hasta la marca "full" (lleno). Vea las instrucciones
exceso.
lentamente que lo normal. en la página 35.
3. El acoplador hidráulico está suelto
4. Aire retenido en el sistema. 3. Revise que todos los acopladores estén totalmente apretados.
5. D.I. de la manguera demasiado 4. Purgue el aire de acuerdo a las instrucciones en la página 35.
estrecho. 5. Use una manguera hidráulica de mayor diámetro.
6. El resorte de retracción del cilindro está 6. Haga reparar el cilindro por un técnico experto en sistemas
roto o existe otro daño en el cilindro. hidráulicos.
36
Instruction Sheet
Visually inspect all components for shipping damage. or wood blocks that are capable of
®
Shipping damage is not covered by warranty. If supporting the load. Never use a hydraulic cylinder
shipping damage is found, notify carrier at once. The as a shim or spacer in any lifting or pressing
carrier is responsible for all repair and replacement application.
costs resulting from damage in shipment. DANGER: To avoid personal injury
keep hands and feet away from cylinder
SAFETY FIRST and workpiece during operation.
2.0 SAFETY ISSUES WARNING: Do not exceed equipment
Read all instructions, ratings. Never attempt to lift a load
warnings and cautions weighing more than the capacity of the
carefully. Follow all safety cylinder. Overloading causes equipment
precautions to avoid personal injury or property failure and possible personal injury. The cylinders are
damage during system operation. Enerpac cannot be designed for a max. pressure of 700 bar [10,000 psi].
responsible for damage or injury resulting from unsafe Do not connect a jack or cylinder to a pump with a
product use, lack of maintenance or incorrect product higher pressure rating.
and/or system operation. Contact Enerpac when in DANGER: Never set the relief valve to a
doubt as to the safety precautions and operations. If higher pressure than the maximum rated
you have never been trained on high-pressure pressure of the pump. Higher settings
hydraulic safety, consult your distribution or service may result in equipment damage and/or
center for a free Enerpac Hydraulic safety course. personal injury. Do not remove relief valve.
Failure to comply with the following cautions and WARNING: The system operating
warnings could cause equipment damage and pressure must not exceed the pressure
personal injury. rating of the lowest rated component in
A CAUTION is used to indicate correct operating or the system. Install pressure gauges in the
maintenance procedures and practices to prevent system to monitor operating pressure. It is your
damage to, or destruction of equipment or other window to what is happening in the system.
property. CAUTION: Avoid damaging hydraulic
A WARNING indicates a potential danger that hose. Avoid sharp bends and kinks when
requires correct procedures or practices to avoid routing hydraulic hoses. Using a bent or
personal injury. kinked hose will cause severe back-
pressure. Sharp bends and kinks will internally
A DANGER is only used when your action or lack of damage the hose leading to premature hose failure.
action may cause serious injury or even death.
Do not drop heavy objects on hose. A
WARNING: Wear proper personal sharp impact may cause internal damage
protective gear when operating hydraulic ®
SPECIFICATIONS – Use this instruction sheet for the following hand pump models.
Hand Pump Specifications
Model Type Maximum Pressure Oil Volume per Stroke Usable Oil Capacity
(Speed) Rating psi [bar] in 3 [cm 3] in3 [cm3]
EHF-65 1 6,500 [440] .16 [2.62] 22 [360]
P-18 1 2,850 [200] .16 [2.62] 22 [360]
P-25 1 2,500 [170] .58 [9.51] 231 [3786]
P-39, 1003 1 10,000 [700] .16 [2.62] 43 [705]
P-50 1 5,000 [340] .29 [4.75] 231 [3786]
P-51 1 3,000 [210] .25 [4.09] 50 [820]
P-141, 1001 1 10,000 [700] .055 [.90] 20 [328]
P-391, 1004 1 10,000 [700] .151 [2.47] 55 [900]
2
3.0 DESCRIPTION 3.2 Models P-18/P-39, 1003/P-80, 1006/
P-84/P-801, P-77
3.1 Models P-141, 1001; P-142, 1002; Figure 2 and the corresponding table below show the
P-202; P-391, 1004; P-392, 1005; P-802; main components of these hand pump models.
P-842 Model P-84 is equipped with a 4-way, 3-position
Figure 1 and the corresponding table show the main valve for use with double-acting cylinders. To convert
components of hand pump models P-141, P-142, P- models P-18 or P-39 to foot operation, order Kit PC-10.
202, P-391, P-392, P-802, and P-842. The dual-
purpose vent/fill cap acts as a pressure relief valve in
case of accidental reservoir pressurization. To A
provide an access port at the rear of the reservoir for
remote valves, use a return-to-tank kit. See the Table B
1 for kit model numbers. A
A
D B
A
B
B
E B
C
P842
Figure 2
B
D WARNING: These pumps are operated
with a non-vented reservoir. If the
reservoir is subjected to high pressure,
Figure 1 the casing may rupture, causing
personal injury and/or equipment damage.
NEVER attempt to return more oil to the reservoir
than it is capable of holding.
Table 1
Fig. 1 P-141, 1001 P-142, 1002 P-202 P-391, 1004 P-392, 1005 P-802 P-842
A Release Valve Release Valve Release Valve Release Valve Release Valve Release Valve 4-Way Valve
B 1 /4 NPTF 1 /4 NPTF 1 /4 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF
Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port
C Vent/Fill Vent/Fill Vent/Fill Vent/Fill Vent/Fill Vent/Fill Vent/Fill
Cap Cap Cap Cap Cap Cap Cap
D Mounting Mounting — — — Mounting Mounting
Slots Slots Slots
E — — — — — Return-to-Tank —
Port
Return-to PC-20 PC-20 PC-25 PC-25 PC-25 — —
-Tank Kit
Table 2
Fig. 2 P-18 P-39, 1003 P-77 P-80, 1006 P-84 P-801
A Release Valve Release Valve Release Valve Release Valve Release Valve Release Valve
B 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF
Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port Outlet Port
C Fill Plug Fill Plug Fill Plug Fill Plug Fill Plug Fill Plug
D — — — 1/4 NPTF — 1/4 NPTF
Return-to-Tank Port Return-to-Tank Port
3
3.3 Models P-462 and P-464 Table 4 and 5
Figure 3 and the table below show the main features Fig. 4 & 5 P-25 P-50 P-51
of hand pump models P-462, for use with single- A Release Valve Release Valve Release Valve
acting cylinders, and P-464, for use with double- B 1/4 NPTF 1/4 NPTF 1/4 NPTF
Outlet Port Outlet Port Outlet Port
acting cylinders.
C Vent/Fill Cap Vent/Fill Cap Vent/Fill Cap
4.0 INSTALLATION
C
4.1 Connecting the Pump
D 1. Thread hose into pump outlet. Use 1 1/2 wraps of
Teflon tape (or suitable thread sealant) on hose
B
fitting, leaving the first complete thread free of tape
to ensure that tape does not shed into hydraulic
system, causing damage. Trim loose ends.
A 2. Install a pressure gauge in-line from the pump for
added safety and better control.
3. Connect the hose(s) to your cylinder or tool.
P-462/464F3
C OPERATING POSITION
EHF-65. . . . . . . . . either P-202 . . . . . . . . . either
A P-18 . . . . . . . . . . . either P-391, 1004 . . . . . either
P-25 . . . . horizontal only P-77 . . . . . . . . . . either
P-39, 1003 . . . . . . either P-392, 1005 . . . . . either
B P-50 . . . . horizontal only P-392AL . . . . . . . . either
P-51 . . . . horizontal only P-462. . . horizontal only
P-80, 1006 . . . . . . either P-464 . . . horizontal only
P-84 . . . . . . . . . . . either P-801 . . . . . . . . . either
P-51F5
4
NOTE: When operating the pump in the vertical CAUTION: Close release valve finger
position, the hose end must be pointed down, or the tight ONLY. Using tools on release valve
pump will pick up air and will not build pressure properly. can damage it and cause the pump to
malfunction.
5.0 OPERATION
2. Operate pump handle to deliver hydraulic power
to system. Pressure will be maintained until
5.1 Before Using the Pump release valve is opened.
1. Check all system fittings and connections to be 3. Open release valve (turn counter-clockwise) to
sure they are tight and leak free. release pressure, allowing oil to flow back to the
2. Check oil level in reservoir before operating reservoir.
pump. See "Adding Oil to the Pump" on page 7.
5.4 Single-Acting Applications with 3-Way,
2 Position Manual Valve
CAUTION: NEVER add extensions to
pump handle. Extensions cause 1. Shift valve handle to position 1 as shown in Figure 7.
unstable pump operation. 2. Operate pump handle to deliver hydraulic power
to the system. Pressure will be maintained until
WARNING: In certain situations the the valve is shifted.
pump handle can "kick back". Always
3. To allow oil to return to the reservoir, shift valve
keep your body to the side of the pump,
handle to position 2.
away from the line of force of the handle.
NOTE: To reduce handle effort at high pressure, take 2 2
short strokes. Maximum leverage is obtained in the
last 5° of stroke.
A B
A B
Figure 6 Figure 8a
5
5.6 Relief Valve Adjustment
A B A B A B
All pumps contain a factory set relief valve to prevent
over-pressurization of the system. Lower pressure
settings can be obtained. Contact your Authorized
I
Enerpac Service Center.
A N B
6.0 AIR REMOVAL
Removing air from the hydraulic system will help the
Figure 8b cylinder to advance and retract smoothly (see figure 9).
1. Position lever on 4-way valve to select function as 6.1 Pump With Single-Acting Cylinder (A)
follows: 1. Vent pump reservoir (for vented pumps only) and
(A) Flow to Port "A"; port "B" returns flow to the close release valve.
reservoir 2. Position pump at higher elevation than cylinder.
(N) Neutral; ports "A" and "B" are blocked 3. Position cylinder with the plunger end down (up if
(B) Flow to port "B"; port "A" returns flow to the using pull cylinder). See Figure 9 below.
reservoir 4. Operate pump to fully extend the cylinder (retract
if using pull cylinder).
5. Open release valve to retract cylinder (extend if a
pull cylinder). This will force the trapped air to
move up to the pump reservoir.
6. Repeat the above steps as necessary.
N
7. Add oil if necessary. See page 7.
8. Return vent/fill cap to operating position.
B
A 6.2 Pump With Double-Acting Cylinder (B)
A
1. Vent pump reservoir (for vented pumps only).
B 2. Position pump at higher elevation than cylinder.
3. Put cylinder in horizontal position with ports up.
See Figure 9.
Figure 8c 4. Fully advance and retract the cylinder 2 to 3 times.
5. Repeat the above steps as necessary.
2. Operate pump to perform work. 6. Add oil if necessary. See page 7.
3. Change valve positions as needed. 7. Return vent/fill cap to operating position.
air
air
A B
Figure 9
6
7.1 Adding Oil to the Pump
B, C
Check oil level regularly.
A
WARNING: Always add oil with
cylinders fully retracted (extended if
pull cylinders) or the system will contain
more oil than the reservoir can hold.
1. Remove vent/fill cap from reservoir.
2. Fill reservoir only to level mark shown on pump.
3. Remove air from system if necessary. See page 6.
Recheck oil level after removing air.
4. Return vent/fill cap to proper position. Figure 10
NOTE: Non-vented hand pumps require air in the
reservoir to function properly. If the reservoir is 7.4 Changing the Oil
completely filled, a vacuum will form preventing 1. Drain all oil and refill with clean Enerpac oil every
oil from flowing out of the pump. 12 months. If pump is used in dirty environments,
change the oil more often.
7.2 Keeping Oil Lines Clean
2. Remove vent/fill cap or plug from reservoir.
When coupler halves are disconnected, always screw 3. Tilt pump to drain out old oil.
on dust caps. Use every precaution to guard unit
against entrance of dirt because foreign matter may 4. Fill reservoir only to level mark shown on pump.
cause pump, cylinder, or valve failure. 5. Replace the vent/fill cap or plug.
6. Dispose of used oil properly.
7.3 Lubricating the Pump
To extend pump life and improve performance,
8.0 TROUBLESHOOTING GUIDE
lubricate the beam pin (A), cross pin (B), and piston
head (C) regularly, using roller bearing grease. See The following information is intended as an aid in
Figure 10. determining if a problem exists. For repair service,
contact the Authorized Enerpac Service Center in
your area.
TROUBLESHOOTING
Problem Possible Cause Solution
Cylinder does not 1. Oil level in pump reservoir is 1. Add oil according to the Maintenance instructions on
advance, advances low. page 6.
slowly, or advances in 2. Release valve open. 2. Close the release valve.
spurts.
3. Loose hydraulic coupler. 3. Check that all couplers are fully tightened.
4. Load is too heavy. 4. Do not attempt to lift more than rated tonnage.
5. Air trapped in system. 5. Remove air according to the instructions on page 6.
6. Cylinder plunger binding. 6. Check for damage to cylinder. Have cylinder serviced by
a qualified hydraulic technician.
Cylinder advances, but 1. Leaking connection. 1. Check that all connections are tight and leak free.
does not hold pressure. 2. Leaking seals. 2. Locate leak(s) and have equipment serviced by a
3. Internal leakage in pump. qualified hydraulic technician.
3. Have pump serviced by a qualified hydraulic technician.
Cylinder does not retract, 1. Release valve closed. 1. Open release valve.
retracts part way, or 2. Pump reservoir is over-filled. 2. Drain oil level to full mark. See page 7 instructions for
retracts more slowly than adding oil.
3. Loose hydraulic coupler.
normal.
4. Air trapped in system. 3. Check that all couplers are fully tightened.
5. Hose I.D. too narrow. 4. Remove air according to the instructions on page 6.
6. Cylinder retraction spring 5. Use larger diameter hydraulic hose.
broken or other cylinder 6. Have cylinder serviced by a qualified hydraulic
damage. technician.
7
Hoja de Instrucciones
®
Seleccione cuidadosamente bloques de
Lea todas las instrucciones, acero o de madera capaces de soportar la
advertencias y precauciones. carga. Nunca use un cilindro hidráulico como calza o
Acate todas las precauciones de separador en aplicaciones de levantamiento o presión.
seguridad para evitar lesiones personales o daños a la
propiedad durante la operación del sistema. PELIGRO: Para evitar lesiones
ENERPAC no puede ser responsable de daños o personales, mantenga las manos y
lesiones que resulten de no usar el producto de forma los pies alejados del cilindro y pieza
segura, falta de mantenimiento o aplicación de trabajo durante la operación.
incorrecta del producto y/u operación del sistema. ADVERTENCIA: No sobrepase el valor
Comuníquese con ENERPAC si tuviese dudas sobre nominal del equipo. Nunca intente
las precauciones de seguridad o sobre las levantar una carga que pese más de la
aplicaciones. Si nunca ha sido capacitado en capacidad del cilindro. Las sobrecargas
seguridad hidráulica de alta presión, consulte a su ocasionan fallas del equipo y posibles lesiones
distribuidor o centro de servicio para obtener un curso personales. Los cilindros están diseñados para
de seguridad gratis denominado ENERPAC Hydraulic. resistir una presión máxima de 700 bar. No conecte
El no cumplir con las siguientes precauciones y un gato o cilindro a una bomba cuyo valor nominal de
advertencias podría causar daños al equipo y presión es mayor que el indicado.
lesiones personales. PELIGRO: Nunca fije la válvula de
Una PRECAUCIÓN se utiliza para indicar seguridad a una presión más alta que el
procedimientos y prácticas de operación o máximo valor nominal de presión de la
mantenimiento correctos para evitar daños o la bomba. Los ajustes más altos pueden
destrucción de equipo u otra propiedad. resultar en daños al equipo y/o lesiones personales.
No remover la válvula de seguridad.
Una ADVERTENCIA indica un potencial peligro que
requiere de procedimientos o prácticas correctos ADVERTENCIA: La presión de operación
para evitar lesiones personales. del sistema no debe sobrepasar el valor
nominal de presión del componente con el
Un PELIGRO se utiliza sólo cuando su acción o falta valor nominal más bajo en el sistema.
de acción podría causar lesiones graves o incluso la Instale manómetros de presión en el sistema para
muerte. vigilar la presión de operación. Es su ventana a lo que
ADVERTENCIA: Use el equipo de está sucediendo en el sistema.
protección personal adecuado cuando PRECAUCIÓN: Evite dañar la manguera
opere equipo hidráulico. hidráulica. Evite pliegues y curvas
agudos al guiar las mangueras
ADVERTENCIA: Manténgase alejado de hidráulicas. Usar una manguera con
las cargas soportadas por sistemas pliegues o curvas puede causar severa
hidráulicos. Cuando un cilindro se utiliza contrapresión. Los pliegues y curvas agudos
como dispositivo para levantar carga, causarán daños internos la manguera, lo que
nunca debería usarse como dispositivo para ocasionará que ésta falle prematuramente.
30
No deje caer objetos pesados sobre la superficie plana capaz de soportar la carga. De ser
manguera. Un impacto directo puede necesario, utilice una base de cilindro para mayor
causar daños internos a las hebras de estabilidad. No suelde ni modifique el cilindro en modo
®
alambre de la manguera. Aplicar presión a una alguno para fijarle una base u otro medio de soporte.
manguera dañada puede ocasionar que se quiebre.
Evite las situaciones en las cuales las
IMPORTANTE: No levante el equipo cargas no estén directamente centradas
hidráulico por las mangueras o sobre el émbolo del cilindro. Las cargas
acopladores giratorios. Use el mango de descentradas producen un esfuerzo
transporte u otros medios para considerable sobre los cilindros y los émbolos.
transportarla con seguridad. Adeás, la carga podria resbalar o caerse, creando
situaciones potencialmente peligrosas.
PRECAUCIÓN: Mantenga el equipo
hidráulico alejado de las llamas y el Distribuya la carga uniformemente sobre
calor. El calor en exceso ablandará las la superficie total del asiento del cilindro.
juntas y sellos, lo que resultará en Siempre utilice un asiento para proteger el
fugas de líquidos. Asimismo, el calor debilita los émbolo cuando no se usen accesorios
materiales de la manguera y juntas. Para lograr un roscados.
rendimiento óptimo, no exponga el equipo a
IMPORTANTE: Únicamente técnicos
temperaturas de 65 °C [150 °F] o mayores. Proteja las
calificados en sistemas hidráulicos habrán
mangueras y cilindros de salpicaduras de soldadura.
de prestarle servicio al equipo hidráulico.
PELIGRO: No manipule mangueras bajo Comuníquese con el Centro de Servicio
presión. El aceite que escape bajo ENERPAC autorizado en su zona para prestarle
presión puede penetrar la piel y causar servicio de reparaciones. Use únicamente aceite
lesiones graves. Si se inyecta aceite bajo ENERPAC a fin de proteger su garantía.
la piel, consulte a un médico inmediatamente.
ADVERTENCIA: Reemplace
ADVERTENCIA: Use cilindros inmediatamente las piezas gastadas o
hidráulicos únicamente en sistemas dañadas por piezas ENERPAC genuinas.
acoplados. Nunca use un cilindro si los Las piezas de clasificación estándar se
acopladores no están conectados. Si el romperán, lo que causará lesiones personales y daños
cilindro se sobrecarga, los componentes a la propiedad. Las piezas ENERPAC están diseñadas
pueden fallar calamitosamente, lo que causaría para encajar debidamente y resistir altas cargas.
lesiones personales graves.
ATENCION: Siempre acarree la bomba
ADVERTENCIA: Asegurese que el tomándola del asa. Si la acarrea de la manguera
equipo sea antes de levantar la carga. puede dañar la manguera y/o la bomba.
El cilindro debe colocarse sobre una
®
ESPECIFICACIONES – Use esta hoja de instrucciones para los siguientes modelos de bombas manuales.
Especificaciones
Modelo Tipo Presión máxima Volumen de aceite por Capacidad de aceite
(velocidad) psi [bar] embolada pulg3 [cm 3] pulg3 [cm3]
EHF-65 1 6,500 [440] .16 [2.62] 22 [360]
P-18 1 2,850 [200] .16 [2.62] 22 [360]
P-25 1 2,500 [170] .58 [9.51] 231 [3786]
P-39, 1003 1 10,000 [700] .16 [2.62] 43 [705]
P-50 1 5,000 [340] .29 [4.75] 231 [3786]
P-51 1 3,000 [210] .25 [4.09] 50 [820]
P-141, 1001 1 10,000 [700] .055 [.90] 20 [328]
P-391, 1004 1 10,000 [700] .151 [2.47] 55 [900]
Etapa 1 Etapa 2 Etapa 1 Etapa 2
P-80, 1006 2 350 [25] 10,000 [700] .99 [16.23] .15 [2.46] 140 [2295]
P-84 2 350 [25] 10,000 [700] .99 [16.23] .15 [2.46] 140 [2295]
P-142, 1002 2 200 [14] 10,000 [700] .221 [3.62] .055 [.90] 20 [328]
P-142AL 2 200 [14] 10,000 [700] .221 [3.62] .055 [.90] 9.0 [148]
P-202 2 200 [14] 10,000 [700] .221 [3.62] .055 [.90] 55 [900]
P-77 2 200 [14] 10,000 [700] .63 [16.0] .094 [2.41] 47 [769]
P-392, 1005 2 200 [14] 10,000 [700] .687 [11.26] .151 [2.47] 55 [900]
P-392AL 2 200 [14] 10,000 [700] .687 [11.26] .151 [2.47] 55 [900]
P-462 2 200 [14] 10,000 [700] 7.69 [126.00] .29 [4.75] 462 [7572]
P-464 2 200 [14] 10,000 [700] 7.69 [126.00] .29 [4.75] 462 [7572]
P-801 2 350 [25] 10,000 [700] .99 [16.23] .15 [2.46] 250 [4095]
P-802 2 400 [28] 10,000 [700] 2.40 [39.34] .15 [2.46] 155 [2540]
P-842 2 400 [28] 10,000 [700] 2.40 [39.34] .15 [2.46] 155 [2540]
31
3.0 DESCRIPCION 3.2 Modelos P-18/P-39, 1003/P-80, 1006/
P-84/P-801, P77
3.1 Modelos P-141, 1001/P-142, 1002/P- La Figura 2 y la tabla correspondiente a continuación
202/P-391, 1004/P-392, 1005/P-802/P-842 muestran los componentes principales de estos
La Figura 1 y la tabla correspondiente a continuación modelos de bombas manuales. Los modelos P-84
muestran los componentes principales de los están equipados con una válvula de 4 vías y 3
modelos de bombas manuales P-141, P-142, P 202, posiciones para uso con cilindros de doble efecto.
P-391, P-392, P-802, y P-842. La tapa de doble Para convertir los modelos P-18 ó P-39 a
propósito de ventilación/llenado actúa como una accionamiento por pedal, pida el conjunto PC-10.
válvula de alivio de presión en el caso de ocurrir una
presurización accidental del depósito. Para proveer A
una conexión de acceso en la parte trasera del
depósito para las válvulas remotas, use un conjunto B
de retorno al tanque. Vea la tabla a continuación para A
los números de modelos de los conjuntos.
A D B
A
B
B
E B
C
P842
Figura 2
C
Tabla 1
Fig. 1 P-141, 1001 P-142, 1002 P-202 P-391, 1004 P-392, 1005 P-802 P-842
A Válvula de alivio Válvula de alivio Válvula de alivio Válvula de alivio Válvula de alivio Válvula de alivio Válvula de 4 vías
B Conexión de Conexión de Conexión de Conexión de Conexión de Conexión de Conexión de
salida 1/4 NPTF salida 1/4 NPTF salida 1/4 NPTF salida 3/8 NPTF salida 3/8 NPTF salida 3/8 NPTF salida 3/8 NPTF
C Tapa de Tapa de Tapa de Tapa de Tapa de Tapa de Tapa de
ventilación/ ventilación/ ventilación/ ventilación/ ventilación/ ventilación/ ventilación/
llenado llenado llenado llenado llenado llenado llenado
D Ranuras Ranuras — — — Ranuras Ranuras
de montaje de montaje de montaje de montaje
E — — — — — Retorno al depósito —
Conjunto PC-20 PC-20 PC-25 PC-25 PC-25 — —
de retorno
al tanque
Tabla 2
Fig. 2 P-18 P-39, 1003 P-77 P-80, 1006 P-84 P-801
A Válvula de alivio Válvula de alivio Válvula de alivio Válvula de alivio Válvula de 4 vías Válvula de alivio
y 3 posiciones
B Conexión de salida Conexión de salida Conexión de salida Conexión de salida Conexión de salida Conexión de salida
3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF 3/8 NPTF
C Tapón de Tapón de Tapón de Tapón de Tapón de Tapón de
D — — — etorno al depósito — etorno al depósito
1/4 NPTF 1/4 NPTF
32
3.3 Modelos P-462 y P-464 Tabla 4 y 5
Fig.4/5 P-25 P-50 P-51
La Figura 3 y la tabla a continuación muestran las
A Válvula de alivi Válvula de alivi Válvula de alivi
características principales de los modelos de
B Conexión de Conexión de Conexión de
bombas manuales P-462 para uso con cilindros de salida1/4 NPTF salida1/4 NPTF 1salida/4 NPTF
simple efecto y P-464 para uso con cilindros de
C Tapón de Tapón de Tapón de
doble efecto. ventilación/llenado ventilación/llenado ventilación/
llenado
C
4.0 INSTALACION
D
4.1 Conexión de la bomba
B 1. Enrosque la manguera en la salida de la bomba.
Ponga 1 1/2 vueltas de cinta de teflón (o sellador
de roscas adecuado) en los racores de la
A
manguera, dejando el primer hilo de rosca sin
encintar para asegurar que no se desprendan
pedazos de cinta y entren al sistema hidráulico y
P-462/464F3
OPCIONES DE VENTILACION
B
P-51F5
33
4.3 Posición de la bomba NOTA: Para mejor rendimiento, accione la palanca
de la bomba a velocidad moderada durante la
Vea la tabla a continuación para determinar la posición primera etapa de caudal alto. La velocidad rápida de
correcta de funcionamiento de su bomba, horizontal o la palanca en la primera etapa impedirá que la bomba
vertical. La P-80, P-801, y la P-84 no podrán cebarse alimente el volumen total de aceite.
cuando estén trabajando verticalmente.
POSICION DE FUNCIONAMIENTO
5.3 Aplicaciones de simple efecto con
válvula de alivio
EHF-65 . . . . . cualquiera de los dos P-202 . . . . . . cualquiera de los dos
P-18 . . . . . . . cualquiera de los dos P-391, 1004 . cualquiera de los dos 1. Cierre la válvula de alivio girándola en sentido
P-25. . . . . . . . horizontal solamente P-77 . . . . . . . cualquiera de los dos
P-39, 1003 . . cualquiera de los dos P-392, 1005. . cualquiera de los dos horario, como se muestra en la Figura 6.
P-50. . . . . . . . horizontal solamente P-392AL . . . . cualquiera de los dos
P-51. . . . . . . . horizontal solamente P-462 . . . . . . horizontal solamente
P-80, 1006 . . cualquiera de los dos P-464 . . . . . . horizontal solamente
P-84 . . . . . . . cualquiera de los dos P-801 . . . . . cualquiera de los dos
P-141, 1001 . cualquiera de los dos P-802 . . . . . . cualquiera de los dos
P-142, 1002 . cualquiera de los dos P-842 . . . . . . cualquiera de los dos
P-142AL . . . . cualquiera de los dos
34
5.5 Aplicaciones de doble efecto con 6.0 PURGA DEL AIRE
válvula manual de 4 vías y 3 posiciones
La purga del aire del sistema hidráulico permitirá que
Las bombas con válvulas de control de 4 vías están el cilindro se extienda y se retraiga suavemente. Vea
diseñadas para accionar cilindros de doble efecto. la Figura 9.
Vea la Figura 8 en la página 13 para las posiciones de
la válvula. 6.1 Bomba con cilindro de simple efecto (A)
N
1. Abra el respiradero del depósito de la bomba
(para bombas con ventilación solamente) y cierre
A B la válvula de alivio.
2. Coloque la bomba más elevada que el cilindro.
A B
3. Coloque el cilindro con el extremo del émbolo
hacia abajo (arriba en caso de cilindro de
tracción). Vea la Figura 9.
4. Haga funcionar la bomba para extender
totalmente el cilindro (retraer en caso de cilindro
de tracción).
Figura 8a
5. Abra la válvula de alivio para retraer el cilindro
A B A B A B (extender en caso de cilindro de tracción). Esto
empujará el aire retenido hacia el depósito de la
bomba.
I 6. Repita los pasos anteriores según sea necesario.
7. Añada aceite si es necesario. Vea la página 35.
A N B
8. Vuelva a poner la tapa de ventilación/llenado en
Figura 8b posición de funcionamiento.
11. Coloque la palanca en la válvula de 4 vías para 6.2 Bomba con cilindro de doble efecto (B)
seleccionar la función de la siguiente manera:
1. Abra el respiradero del depósito de la bomba
(A) Paso al orificio "A"; el orificio "B" devuelve el (para bombas con ventilación solamente).
aceite al depósito
2. Coloque la bomba más elevada que el cilindro.
(N) Neutro; los orificios "A" y "B" están
3. Ponga el cilindro en posición horizontal con las
bloqueados
conexiones hacia arriba. Vea la Figura 9.
(B) Paso al orificio "B"; el orificio "A" devuelve el
4. Extienda y retraiga totalmente el cilindro 2 a 3 veces.
aceite al depósito
5. Repita los pasos anteriores según sea necesario.
6. Añada aceite si es necesario. Vea la página 35.
7. Vuelva a poner la tapa de ventilación/llenado en
posición de funcionamiento.
N
A
B 7.0 MANTENIMIENTO
A
Use únicamente aceite hidráulico Enerpac con estas
B
bombas para prolongar la duración de la bomba y
proteger su garantía. Los juegos de sellos Viton y
Figura 8c EPR están disponibles para algunas bombas
manuales. Para más información acerca de estos
2. Haga funcionar la bomba para realizar el trabajo. productos y sus aplicaciones, póngase en
3. Cambie las posiciones de la válvula según sea comunicación con el representante de Enerpac.
necesario.
ADVERTENCIA: Haga funcionar el cilindro 7.1 Adición de aceite a la bomba
de doble efecto solamente cuando las dos
Revise el nivel de aceite regularmente.
mangueras están conectadas a la bomba.
Si se deja un acoplador desconectado, se ADVERTENCIA: Siempre añada aceite
acumulará alta presión detrás del acoplador lo que con los cilindros totalmente retraídos
podría causar lesiones corporales y/o daño al equipo. (extendidos en el caso de cilindros de
tracción) de lo contrario el sistema
5.6 Ajuste de la válvula de alivio sobrepasará la capacidad de aceite del depósito.
1. Quite la tapa de ventilación/llenado del depósito.
Todas las bombas tienen una válvula de alivio ajustada
en la fábrica para impedir la sobrepresurización del 2. Llene el depósito solamente hasta la marca de
sistema. Se pueden obtener ajustes de presión más nivel indicada en la bomba.
bajos. Póngase en contacto con el centro de servicio
autorizado Enerpac.
35
3. Purgue el aire del sistema si es necesario. Vea la B, C
página 51. Vuelva a revisar el nivel de aceite
A
después de purgar el aire.
4. Vuelva a poner la tapa de ventilación/llenado en la
posición apropiada.
NOTA: Las bombas manuales sin ventilación
requieren aire en el depósito para funcionar
correctamente. Si el depósito está totalmente lleno,
se formará un vacío que impedirá la salida de aceite
de la bomba.
Figura 10
7.2 Limpieza de las líneas de aceite 7.4 Cambio del aceite
Cuando se desconecte las mitades del acoplador, 1. Cada 12 meses, vacíe todo el aceite y vuelva a
siempre coloque tapas guardapolvo. Tome todas las llenar con aceite Enerpac. Si la bomba funciona
precauciones debidas para proteger la bomba contra en ambientes sucios, cambie el aceite más
la entrada de suciedad. La materia extraña puede frecuentemente.
causar la falla de la bomba, el cilindro o la válvula..
2. Quite la tapa de ventilación/llenado del depósito.
7.3 Lubricación de la bomba 3. Incline la bomba para vaciar el aceite viejo.
4. Llene el depósito solamente hasta la marca de
Para prolongar la duración de la bomba y mejorar su
nivel indicada en la bomba.
rendimiento, lubrique el pasador de soporte (A),
pasador transversal (B) y la cabeza del pistón (C) 5. Vuelva a poner el tapón o tapa de
regularmente con grasa para cojinetes de rodillos. ventilación/llenado.
Vea la Figura 10 a continuación. 6. Deseche el aceite viejo como es debido.
Aire
Aire
A B
Figure 9
1. Fugas en las conexiones. 1. Revise que todas las conexiones estén apretadas y sin fugas.
El cilindro se extiende, pero
2. Fugas en los sellos. 2. Ubique la(s) fuga(s) y haga reparar el equipo por un técnico
no retiene la presión
3. Fuga interna en la bomba. experto en sistemas hidráulicos.
3. Haga reparar la bomba por un técnico experto en sistemas
hidráulicos.
1. Válvula de alivio cerrada.
El cilindro no se retrae, lo 1. Abra la válvula de alivio.
2. El depósito de la bomba está lleno en
hace parcialmente o más 2. Vacíe el aceite hasta la marca "full" (lleno). Vea las instrucciones
exceso.
lentamente que lo normal. en la página 35.
3. El acoplador hidráulico está suelto
4. Aire retenido en el sistema. 3. Revise que todos los acopladores estén totalmente apretados.
5. D.I. de la manguera demasiado 4. Purgue el aire de acuerdo a las instrucciones en la página 35.
estrecho. 5. Use una manguera hidráulica de mayor diámetro.
6. El resorte de retracción del cilindro está 6. Haga reparar el cilindro por un técnico experto en sistemas
roto o existe otro daño en el cilindro. hidráulicos.
36
Instruction Sheet
Gauges
L505 Rev C 10/01
Cylinders should be placed on a flat adjusted for production runs, your hydraulic
surface that can support the load. gauge should be disconnected from the
Where applicable, use a cylinder base for hydraulic system. This can be done by
2
complete removal from the system or by connections and fittings, use the proper
installation of a shut-off valve between the open-end wrenches. Do not use crescent
gauge and the high-pressure line. or pipe wrenches, as they may damage the
Should the hydraulic gauge be left in operation high-pressure fittings.
continuously, the calibration of the gauge may 5.0 OPERATION
be greatly affected, requiring recalibration or
complete replacement. Shut-off valves are The gauge should be operated at pressures
recommended as added protection for any which do not normally exceed 75% of full
hydraulic gauge that may be subjected to high scale.
cycle rates or pressure fluctuations. Using the gauge to read less than 10% of the
full scale can result in an erroneous reading.
Pump IMPORTANT: The gauge should be checked
outlet port for accuracy on a periodic basis, especially
when the pressure measurement is critical and
(1) Hose or a gauge failure or inaccuracy will create a
coupler
hazard to personnel or property.
75%
(2)
(3)
A B
(1) Gauge
10%
(2) Shut-off Valve
(3) Gauge Adaptor
4.0 INSTALLATION
6.0 REPAIR AND SERVICE INFORMATION
NOTE: When making hydraulic connections,
use high quality sealing compound only on the Enerpac gauges are precalibrated by the
threads of the male NPT fittings. If you use factory to within ±1% and ±11/2% of the full
Teflon tape, do not tape the first thread. Use scale. For recalibration, please refer to your
tape sparingly. Loose Teflon tape in your pump local phone or business directory. For warranty
or cylinder can cause malfunctions and and/or repair service, send your gauge to the
damage. Wrap tape so that it tightens upon nearest Enerpac Service Center.
assembly (clockwise with the threads facing
you). Install your hydraulic gauge where it is 6.1 Glycerin Gauge Maintenance
easily readable but well protected against For maintenance, please contact your nearest
damage from external sources. authorized Enerpac Service Center. The
1. Remove the hydraulic oil outlet plug(s) from procedure for filling the glycerin gauge is
your pump. covered in Enerpac's Instruction Sheet, L2561.
2. Apply sealant (or Teflon tape) to male NPT
threads. Make connections as pictured
above. When tightening hydraulic
3
Hoja de Instrucciones
Manómetros
L505 Rev C 10/01
1.0 IMPORTANTES INSTRUCCIONES DE
RECEPCIÓN
Inspeccione visualmente todos los
componentes para verificar si hay daños de
envío. Debido a que la garantía no ampara
daños por envío, si los hubiese, infórmeselo
inmediatamente a la empresa de transportes,
puesto que ésta es responsable de todos los
gastos de reparaciones o reemplazo que
resulten por daños de envío.
SEGURIDAD PRIMERO ADVERTENCIA: Manténgase
2.0 ASPECTOS DE SEGURIDAD alejado de las cargas soportadas
por sistemas hidráulicos. Cuando
Lea todas las instrucciones,
un cilindro se utiliza como dispositivo para
advertencias y precauciones.
levantar carga, nunca debería usarse como
Acate todas las precauciones
dispositivo para sostener carga. Después de
de seguridad para evitar lesiones personales o
que la carga haya sido levantada o
daños a la propiedad durante la operación del
descendida, debe bloquearse siempre en
sistema. ENERPAC no puede ser responsable
forma mecánica.
de daños o lesiones que resulten de no usar el
producto de forma segura, falta de ADVERTENCIA: USE SÓLO PIEZAS
mantenimiento o aplicación incorrecta del RÍGIDAS PARA SOSTENER
®
CARGAS. Seleccione
Comuníquese con ENERPAC si tuviese dudas cuidadosamente bloques de acero o de
sobre las precauciones de seguridad o sobre madera capaces de soportar la carga. Nunca
las aplicaciones. Si nunca ha sido capacitado use un cilindro hidráulico como calza o
en seguridad hidráulica de alta presión, separador en aplicaciones de levantamiento o
consulte a su distribuidor o centro de servicio presión.
para obtener un curso de seguridad gratis PELIGRO: Para evitar lesiones
denominado ENERPAC Hydraulic. personales, mantenga las
El no cumplir con las siguientes precauciones manos y los pies alejados del
y advertencias podría causar daños al equipo cilindro y pieza de trabajo durante la
y lesiones personales. operación.
Una PRECAUCIÓN se utiliza para indicar ADVERTENCIA: No sobrepase el
procedimientos y prácticas de operación o valor nominal del equipo. Nunca
mantenimiento correctos para evitar daños o intente levantar una carga que pese
la destrucción de equipo u otra propiedad. más de la capacidad del cilindro. Las
sobrecargas ocasionan fallas del equipo y
Una ADVERTENCIA indica un potencial
posibles lesiones personales.
peligro que requiere de procedimientos o
prácticas correctos para evitar lesiones Nunca fije la válvula de seguridad a
personales. una presión más alta que el máximo
valor nominal de presión de la
Un PELIGRO se utiliza sólo cuando su acción
bomba. Los ajustes más altos pueden resultar
o falta de acción podría causar lesiones graves
en daños al equipo y/o lesiones personales.
o incluso la muerte.
ADVERTENCIA: La presión de
ADVERTENCIA: Use el equipo de
operación del sistema no debe
protección personal adecuado
sobrepasar el valor nominal de
cuando opere equipo hidráulico.
presión del componente con el valor nominal
más bajo en el sistema. Instale manómetros
16
de presión en el sistema para vigilar la presión Evite las situaciones en las cuales las
de operación. Es su ventana a lo que está cargas no estén directamente
sucediendo en el sistema. centradas sobre el émbolo del
PRECAUCIÓN: Evite dañar la cilindro. Las cargas descentradas producen un
manguera hidráulica. Evite pliegues esfuerzo considerable sobre los cilindros y los
y curvas agudos al guiar las émbolos. Adeás, la carga podria resbalar o
mangueras hidráulicas. Usar una manguera caerse, creando situaciones potencialmente
con pliegues o curvas puede causar severa peligrosas.
contrapresión. Los pliegues y curvas agudos Distribuya la carga uniformemente
causarán daños internos la manguera, lo que sobre la superficie total del asiento
ocasionará que ésta falle prematuramente. del cilindro. Siempre utilice un
No deje caer objetos pesados sobre asiento para proteger el émbolo
la manguera. Un impacto directo cuando no se usen accesorios roscados.
®
corte como protectores para todos los contra daños causados por fuentes externas.
manómetros hidráulicos sujetos a ritmos
1. Quite el tapón (los tapones) de la(s) salida(s)
acelerados de trabajo o fluctuaciones grandes
de aceite hidráulico de la bomba.
de presión.
2. Aplique pasta selladora (o cinta de Teflon) a
las roscas NPT macho. Haga las
conexiones de la manera arriba ilustrada. Al
apretar las conexiones y adaptadores
hidráulicos, utilice llaves de tuercas del
(1) tamaño adecuado. No utilice llaves
ajustables ni llaves de tubería, ya que éstas
Lumbrera pueden dañar los adaptadores para presión
de salida alta.
de bomba
5.0 FUNCIONAMIENTO
Manguera o El manómetro debe usarse a presiones que
(2) acoplador normalmente no excedan el 75% del valor de
deflexión completa de la aguja.
4.0 INSTALACION
NOTA: Al hacer las conexiones hidráulicas,
aplique pasta selladora de alta calidad
solamente a las roscas de los conectores NPT
macho. Si se usa cinta de Teflon, no coloque la
cinta sobre la primera rosca. Utilice poca
cantidad de cinta. Los pedazos sueltos de
cinta de Teflon que ingresen a la bomba o el
cilindro pueden causar averías y daños.
Envuelva la cinta de modo que la misma se
apriete durante el armado. (En sentido horario
cuando se miran las roscas de frente.) Instale
el manómetro hidráulico de modo que pueda
leerse fácilmente y que esté bien protegido
18
Los manómetros Enerpac se calibran en la
75% fábrica con un margen de tolerancia de ±1% y
±11/2% del valor de deflexión completa de su
aguja. Para recalibrarlos, consulte la guía
telefónica o comercial de la localidad. Para
trabajos bajo garantía y/o reparaciones, envíe
el manómetro al Centro de servicio Enerpac
más cercano.
19
9.8 Dispositivos de seguridad
11/2013 Rev 0
Información general
Mediante el detector de rotura de correa, del tipo BLS, permiten detectarse los siguientes
daños de la correa en la fase de inicio:
Los pedazos de la correa sueltos pueden quedar atrapados en una estación de rodillos de soporte
y, en el peor de los casos, desgarrar longitudinalmente la correa o la capa de revestimiento. Lo
mismo puede ocurrir también con hilos de acero rotos o sueltos de una correa con armazón.
Función
Si, de lo contrario, deben detectarse también pedazos de goma y alambres rotos que sobresalgan
hacia arriba y, por lo tanto, puedan quedar atrapados en un rodillo de soporte debajo de la correa
inferior, debe instalarse un sistema de detección de rotura de correa debajo de la correa inferior.
Montaje (válido para un interruptor)
Imagen 2 Imagen 3
Datos técnicos
BLS011 BLS001
Interruptor de proximidad Interruptor magnético
- pnp - contacto de cierre - contacto Reed - contacto de
cierre
Tipo de protección IP 67 IP 67
Rango de temperatura -25°C … +70°C -25°C … +80°C
Carcasa latón, M12*1 latón, M12*1
Tensión de servicio 10 …30V CC
Corriente de conmutación máx 400mA máx 1 A
Número de pedido 92.047392.011 92.047392.001
Pull-rope emergency stop switch
Type NTS
OPERATING INSTRUCTIONS
Imprint CE mark and conformity
Table of contents
1 Safety............................................................................................................................... 7
1.1 Intended use ................................................................................................................................................ 7
1.2 Layout of safety instructions ........................................................................................................................ 8
1.3 Safety instructions ..................................................................................................................................... 10
1.3.1 Exclusion of liability and warranty.............................................................................................................. 10
1.3.2 Safety instructions for avoiding personal injury ......................................................................................... 11
1.3.3 Safety instructions for avoiding property damage...................................................................................... 12
1.4 Personal safety equipment ........................................................................................................................ 14
3 Description..................................................................................................................... 17
3.1 Introduction ................................................................................................................................................ 17
3.2 Function ..................................................................................................................................................... 19
6 Maintenance .................................................................................................................. 43
6.1 Overview of maintenance .......................................................................................................................... 43
6.2 Tools required............................................................................................................................................ 43
6.3 Visual inspection........................................................................................................................................ 44
6.4 Cleaning the device from the outside ........................................................................................................ 46
6.4.1 Removing dirt from the outside.................................................................................................................. 46
6.4.2 Removing ice from the outside .................................................................................................................. 47
6.5 Functional test ........................................................................................................................................... 49
7 Repairs .......................................................................................................................... 53
7.1 Tools required............................................................................................................................................ 53
7.2 Replacing the cover ................................................................................................................................... 53
7.3 Replacing a sealing screw ......................................................................................................................... 55
7.4 replacing the screwed cable gland ............................................................................................................ 56
7.5 Replacing the signal lamp.......................................................................................................................... 58
8 Commissioning .............................................................................................................. 60
1 Safety
1.1 Intended use in-tended use cannot be negatively affected in any way,
even by an unforeseen external influence on the device.
Pull-rope emergency stop switches, type NTS are used
as emergency stop devices actuated on both sides in This documentation must be considered as part of the
stationary conveyor systems in control circuits in accor- product and must be kept and made available to the re-
dance with the safety requirements of DIN EN 620 and in s-pective owner/user throughout the life cycle of the pro-d-
agreement with DIN EN ISO 13850. According to the uct. The documentation must be passed on to each suc-
BGIA report 2/2008 "Functional safety of machine con- cessive owner of the product.
trols - application of DIN EN ISO 13849" issued by the Intended use includes in particular that you perform all
German Social Accident Insurance (Deutsche Gesetzli- activities with and on the device with the aid of these
che Unfallversicherung), the pull-rope emergency stop operating instructions.
switches can be used as emergency stop devices in Work on the device may be performed only by techni-
safety control circuits up to performance level PLe. cians who have been authorized by the person respon-
These operating instructions describe the intended use, sible for the safety of the system to perform the required
mechanical mounting/dismounting at the attachment activities.
points for the pull-rope emergency stop switch NTS, Qualified technicians are those who, on account of their
electrical connection and maintenance, repair, commis- training, experience or instruction as well as their knowl-
sioning and troubleshooting for the pull-rope emergency edge of relevant standards, laws, provisions, accident
stop switch NTS. These operating instructions do not prevention regulations, generally acknowledged rules on
contain any information regarding the use and handling safety and operating conditions, are able to perform the
of the pull-rope system or the control. required activities and can identify and prevent potential
Usage of the device other than as intended and unau- hazards. If the work requires specialized knowledge,
tho-rized changes to the device and its components may e. g. in electrical engineering, mechanics and pneumat-
re-sult in personal injury and property damage, for which ics, technicians must have the appropriate qualification.
the manufacturer assumes no liability. Make certain that Observe the locally stipulated instructions of the plant op-
erator.
Further information on the definition of technicians can 1.2 Layout of safety instructions
be found e. g. in DIN VDE 0105 Part 100, EN 50110-1. The classification of dangers is based on ISO 3864-2 and
Intended use will protect you and prevent damage to ANSI Z535.6. It uses the key words
the device and its components! “Danger”, “Warning”, and “Caution” with reference to
personal injuries,
“Beware” for property damage, and
“Note” to convey general information.
Dangers and instructions in this documentation have
been categorized and represented as follows:
! Danger!
! Warning!
Pictograms
! Caution! The following pictograms are used to clarify the source of
the danger. The pictograms may be used at any level of
indicates a potentially dangerous situation. Failure to danger.
avoid the dangerous situation may result in slight or mi-
nor injuries. Pictogram Type of danger
Dangers of all type, except the danger is
identified by the following pictogram.
! Beware!
indicates a situation which may result in property dam- Danger arising through usage in areas with
age. If the situation which may result in property dam- explosion hazard.
age is not avoided, the product or something in the area
around it may be damaged. Injuries caused by hazardous voltages and
currents.
Note!
“Note” indicates application tips and other espe- Injuries caused by crushing.
cially useful information.
Before working on the device, disconnect the release Unless otherwise indicated in these operating instruc-
line from the release lever to prevent inadvertent actu- tions, you must make and secure the screw connec-
ation of the release lever. tions during assembly exactly as they were originally
implemented in the device delivered by Vossloh Kiepe
GmbH. Always use new screw retaining elements when
assembling screw connections.
! Beware!
If the hood seal is damaged, dust and moisture may Contact sprays, greases and oils may damage the
penetrate the device and damage the device and its seals of the device.
components. Do not use contact sprays, greases and oils without the
Check the seal for damage before closing the hood. Re- consent of Vossloh Kiepe GmbH (for contact data see
place the hood if the seal is damaged. Imprint).
Penetration of dust and moisture if seals are Damage to components and lines due to in-
! damaged! ! correct electrical connections and installa-
Seals on screwed cable glands and sealing screws tion!
age; as a result, the tightness of the devices can no lon- Ensure that the line markers are not removed from the
ger be ensured when the screwed cable glands or seal- lines, or mark the lines so that the lines can be assigned
ing screws have been opened. during installation.
Replace screwed cable glands and sealing screws with Combine the lines meaningfully, using cable ties if re-
new screwed cable glands and sealing screws whenev- quired. Use the fastening clamps available in the device
er the device has been opened. to attach the lines.
Use only the screwed cable glands and sealing screws When installing the lines, observe any bending radii
recommended by the manufacturer. specified by the manufacturer.
2.3 Disposal
! Aging of materials! Our products were developed in consideration of the EU
Directive 2002/95/EC (RoHS) and do not contain any
Materials may age due to long storage so that material
known harmful substances.
properties are impaired (e. g. seals and synthetic mate-
rials may become brittle). The properties of lubricants The device components and materials can be separated
may change due to long storage. by removal and destruction of the device. The auxiliary
materials and lubricants used (< 0.1 mass percentage)
Check the device for damage before use or installation.
are protected from being washed out by the housing. The
Do not install the device if it has visible aging damage.
auxiliary materials and lubricants must not be disposed
of in the ground water, watercourses or the sewage sys-
! Penetration of dirt and moisture! tem.
Our products must be disposed of according to the appli-
When delivered, the cover is only screwed on finger- cable local or national and international regulations.
tight. For transportation and storage, the screwed cable
gland is lightly sealed by a protective plug. The device
is not protected against penetration of dirt and moisture
in accordance with the protection class specified in the
technical data (see Section 4.1, page 21).
3 Description
3.1 Introduction switches can be used as emergency stop devices in
safety control circuits up to performance level PLe.
Pull-rope emergency stop switches, type NTS are used
as emergency stop devices actuated on both sides in The pull-rope emergency stop switch NTS can be actuat-
stationary conveyor systems in control circuits in accor- ed in two directions via a pull-rope (20). The pull-rope is
dance with the safety requirements of DIN EN 620 and in stretched under tension along the length of the conveyor
agreement with DIN EN ISO 13850. According to the system and is guided by the pull-rope guides (21). The
BGIA report 2/2008 "Functional safety of machine con- pull-rope emergency stop switch NTS is mounted in the
trols - application of DIN EN ISO 13849" issued by the center between the two attachment points (22).
German Social Accident Insurance (Deutsche Gesetzli-
che Unfallversicherung), the pull-rope emergency stop
Attachment point (22) Reset lever (2) Release lever (1) Attachment point (22)
Fig. 3-2: Pull-rope emergency stop switch NTS: view of inte- Fig. 3-3: Pull-rope emergency stop switch NTS: illustration of
rior (reset lever to the rear) switch positions (reset lever to the front)
3.2 Function position "1" to switch position "0". Release lever (1) is dis-
connected and can now move freely, so preventing any
Pull-rope emergency stop switches, type NTS are elec-
subsequent switching processes (locking function). The
tro-mechanical switches designed to fulfill safety func-
switching element contacts (5) N/C contact (safety cir-
tions in accordance with DIN EN ISO 13849-1. The pull-
cuit) are open, the switching element contacts (6) N/O
rope emergency stop switches can be actuated in two di-
contacts (control circuit) are closed.
rections.
The pull-rope emergency stop switch, type NTS is an Switching element
emergency stop device that comes with at least two Switch position of
reset lever (2) N/C contact (5) N/O contact (6)
switching elements (5, 6) (see Fig. 3-2). At least one of
Safety circuit Control circuit
the switching elements (5) has a positive opening con-
tact. 1 (pull-rope emer- Closed Open
gency stop switch
The switching element (5) N/C contact is used for
active)
the safety circuit connection.
0 (pull-rope emer- Open Closed
The switching element (6) N/O contact is used for
gency stop switch
the control circuit connection or for the optional sig-
triggered)
nal lamp connection (12) (see Figure 4-1, page24).
Tab. 3-1: Overview: function of the switching element
Switching elements (5, 6) are actuated simultaneously
via the cam roller (16).
If you are using pull-rope emergency stop switches with
Emergency stop signal lamp (12), the signal lamp comes on (12).
In the home position (pull-rope emergency stop switch
active), reset lever (2) is in switch position "1" (see Fig. 3-
3). The switching element contacts (5) N/C contact (safe-
ty circuit) are closed, the switching element contacts (6)
N/O contact (control circuit) are open.
By actuating release lever (1), cam roller (16) jumps to
the shut-off position. Reset lever (2) jumps from switch
Manual reset
! Warning!
4 Technical data
4.1 General technical data
Designation Pull-rope emergency stop switch
Version Emergency stop switch with actuation in both directions
Area of application Control circuit, stop category 1 in accordance with DIN EN ISO 13850
Signal lamp Section 10.2: "Ordering replacement parts and accessories", page 67
Connection cable cross-section 1.0 mm2 to 2.5 mm2
Conductor infeed Threaded hole for 2 x M25 x 1.5, see also Section 4.6, page 29:
1 x screwed cable gland M25 x 1.5; sealing area Ø 11 mm to Ø 16 mm
2 x sealing screw M 25 x 1.5
The cable selected must be such that protection class IP 67 is guaranteed. The cable
must be round and must not be twisted.
Mechanical data
Housing material Bulk Molding Compound (BMC)
Actuation via pull rope; length: up to 50 m in both directions of actuation
Recommended distance between the guides for the pull rope: 2.5 m
Note!
Accessories from Vossloh Kiepe GmbH are recommended for the pull rope system.
Notwithstanding the above, the requirements specified in the relevant standards must
be complied with in respect of the pull-rope system.
Actuation force 30 N ± 10 N
Actuation stroke Approx. 25 mm in both directions of actuation or 15°, see also Section 4.6, page 29
Weight / mass 2.02 kg
Mounting 4 oblong holes for M8 screws
Recommended screws for fixing it to the substructure: Hexagonal screws M8 in accor-
dance with DIN EN 4017; suitable threadlock protection must be provided to prevent
loosening
Dimensions see Section 4.6: "Dimensions", page 29
Installation position Horizontal, deviation of up to approx 15° (see Section 4.7: "Installation location and
installation position", page 30)
Installation location Centrally located between the attachment points for the pull rope
Ambient conditions
Permissible ambient temperature - 25 °C … + 70 °C, see also Section 4.5, page 28
Permissible storage temperature - 25 °C … + 70 °C, see also Section 4.5, page 28
Protection class IP 67 in accordance with EN 60529
Safety data in accordance with DIN EN ISO 13849 and EN 61062
Safety functions Emergency stop
manual reset
Can be used up to DIN EN ISO 13849-1:2008 performance level PLe (in accordance with BGIA-Report 2/
2008 "Functional safety of machine controls - application of DIN EN ISO 13849")
Warning!
According to DIN EN ISO 138479-1, the likelihood of faults increases if pull-rope
emergency stop switches are series connected. This could reduce the area of PL
application.
B10d service life 24000 actuation cycles
12
X1 X2
12 14 1
Pull rope side
10 11
9
9
Type designation
4.6 Dimensions
134.3 128
15°
15°
187
160
29.8
25°
9 10
54 41
137
90
4.7 Installation location and installation Release lever (1) must be pointing at the conveyor
position belt.
If the device is positioned transversely, screwed
The following requirements with regard to the installation
cable gland (11) must point downwards. To do this it
location and the installation position must be met (see
may be necessary to replace the sealing screw (10)
Section 5.2.2: "Substructure, installation location and in-
and the screwed cable gland (11).
stallation position", page 32):
The pull-rope emergency stop switch must be
mounted so it is centered between the attachment
points on the pull rope.
1
10
11
10 11
5.2 Important preliminary mounting To fix the pull-rope emergency stop switch, four
instructions holes must be drilled as shown in the dimensional
drawing (see Section 4.6: "Dimensions", page 29).
Please observe the following instructions before mount-
Ensure that the screw type selected to fix the device
ing the pull-rope emergency stop switch.
to the substructure is suitable for the purpose (see
5.2.1 General requirements Section 4.1: "General technical data", page 21).
When mounting the device and when in operation, Observe the requirements for the installation loca-
the requirements set out in EN 1088, particularly tion and installation position (see Section 4.7:
section 5.7 "Design to minimize defeat possibilities", "Installation location and installation position", page
must be observed. 30).
The overall concept for the safety circuit in which the 5.2.3 Mounting conditions
pull-rope emergency stop switches are integrated
Carry out the entire mounting operation without interrup-
must be validated in accordance with DIN EN ISO
tion under the following conditions:
13849-2.
in dry, calm weather
The requirements set out in the technical data must
be met (see Chapter 4, page 21). in the absence of major dust pollution or dirt
If the mounting operation is interrupted, protect the inside
5.2.2 Substructure, installation location and instal- of the device against dirt and moisture. If dirt and mois-
lation position ture have penetrated the device, you must immediately
The following requirements with regard to the substruc- clean and dry the device (Section 5.4.4: "Finishing work",
ture and the installation position must be met: page 38, steps 2 and 3).
The substructure for installation of the pull-rope
emergency stop switch must be even and sound.
We recommend a protected installation location in
order to protect the pull-rope emergency stop switch
from falling bulk materials and against condensation,
melt or rain water.
3. If necessary, prepare the cables for electrical con- 5.4.2 Mechanical mounting
nection (see Chapter 4: "Technical data", page 21). 1. Place the new pull-rope emergency stop switch on
the substructure. Ensure that the installation position
is correct (see Section 4.7: "Installation location and
installation position", page 30).
2. Apply a suitable threadlock product to the screws.
3. Fix the pull-rope emergency stop switch to the sub-
structure using four suitable screws and washers
inserted through the oblong holes (13) (see Fig. 5-
2).
9 9
13 13
11
13
13
9
4 9
12
X1 X2
12 14 1
Pull rope side
Connecting the pull-rope emergency stop switch applicable, connect the connection cable for the sig-
nal lamp (12).
Danger of death if the safety circuit is not
! properly connected!
Tighten the screws for switching element connec-
tions (5, 6)and signal lamp (12) to the tightening
If the safety circuit is not properly connected, there is a torque specified in Section 4.2: "Electrical connec-
risk that the emergency stop function will not perform tion", page 24.
correctly. 7. Combine the lines using cable ties if required.
To connect the safety circuit, the positive opening Ensure that the connection cables cannot block the
switching elements (5) N/C contacts with connections mechanics in the device.
(:21,:22), (:41,:42) or (:61,:62) must be used (see
Section 4.2: "Electrical connection", page 24). Penetration of dust and moisture if seals are
! damaged!
Connect the pull-rope emergency stop switch as follows
Seals on screwed cable glands and sealing screws
(see Figure 5-3 und Section 4.2: "Electrical connection",
age; as a result, the tightness of the devices can no lon-
page 24):
ger be ensured when the screwed cable glands or seal-
Danger due to blockage of the mechanism in ing screws have been opened.
! the device! Replace screwed cable glands and sealing screws with
The lines fed into the device must not block the mecha- new screwed cable glands and sealing screws whenev-
nism. er the device has been opened.
Use the fastening clamps available in the device to at- Use only the screwed cable glands and sealing screws
tach the lines. Combine the lines meaningfully, using recommended by the manufacturer.
cable ties if required. 8. Tighten screwed cable gland nut (11) to the tighten-
5. Guide the cable through the fastening clamps (14) ing torque of 6.7 Nm (see Fig. 5-4). Make sure that
(see Fig. 5-3). the sealing ring for screwed cable gland (11) cleanly
encases the cable and is not squeezed out.
6. Connect the connection cables for the safety and
control circuit to switching elements (5, 6), and if
9. Check that switching elements (5, 6) are working 5.4.4 Finishing work
both in reset lever switch positions "1" and "0" (2) as
described in the following table (see Fig. 5-3):
! Ingress of dirt and moisture!
Switching element
Dirt and moisture may cause the device to malfunction
Switch posi- N/C contact (5) N/O contact (6) and corrosion.
tion of reset (:21,:22),(:41,:42), (:13,:14),(:33,:34),
lever (2) If dirt and moisture have penetrated the device, you
(:61,:62) (:53,:54) must clean and dry the device before you close the
Safety circuit Control circuit
hood.
1 (pull-rope Closed Open
emergency stop 1. Check whether any dust, dirt or moisture have soiled
switch active) the pull-rope emergency stop switch. Remove dust,
dirt or moisture as described in the following steps.
0 (pull-rope Open Closed
emergency stop 2. Dry the pull-rope emergency stop switch as follows:
switch trig- a. Remove any significant quantities of water by
gered) dismounting the pull-rope emergency stop
switch, emptying it out and remounting it.
b. Remove any residual moisture in the device with
a clean, absorbent and lint-free cloth.
! Beware!
3. Clean the pull-rope emergency stop switch from the 4. Check the seal on the cover (4) for damage.
inside by removing dust and dirt with a clean lint-free Replace cover (4) if the seal is damaged.
cloth or a brush. You can remove major soiling with 5. Close cover (4). When closing cover (4), ensure that
the careful use of pincers, for example. the cables are not squeezed or damaged. The
cables must not block the mechanics in the device.
Penetration of dust and moisture if seals are
! damaged! 6. Tighten the screws (9) evenly to a tightening
torque of 4 Nm (see Fig. 5-4).
If the hood seal is damaged, dust and moisture may
7. Carry out a visual inspection (see Section 6.3:
penetrate the device and damage the device and its
"Visual inspection", page 44).
components.
8. Commission the device (see Chapter 8: "Commis-
Check the seal for damage before closing the hood. Re-
sioning", page 60).
place the hood if the seal is damaged.
9 9
11
9
4 9
Always observe the safety measures and general in- Only an electrician may work on the device.
structions described in Chapter 1: "Safety", page 7. Before starting work, isolate the system from the power
supply. Secure the system from being switched on
Warning - danger due to transport, storage, again. Cover any adjacent, live parts so that they can-
! and disposal! not be touched.
Always observe the safety measures and general in-
structions described in Chapter 2: "Transport, storage 1. Before starting work, isolate the system from the
and disposal", page 15. power supply. Secure the system from being
swit-ched on again. Cover any adjacent, live parts so
To dismount the pull-rope emergency stop switch, pro- that they cannot be touched.
ceed as follows:
Warning - risk of injuries when the release
1. Preparatory work ! line is disconnected!
2. Loosening the electrical connections
The release line is under spring tension. Carefully dis-
3. Mechanical dismounting
connect the release line from the release lever so that
the release line cannot spring back uncontrollably. Ob-
serve the documentation for the release line system.
5.5.2 Loosening the electrical connections pull-rope emergency stop switch before the
1. Remove the screwed cable gland nut (11). connection cables are disconnected.
2. Remove the cable in the pull-rope emergency stop 3. Disconnect the connection cable between the safety
switch from fastening clamp (14) and remove the and control circuits and the switching elements (5, 6)
cable tie if applicable (see Fig. 5-5). and if applicable, disconnect the connection cable
for the signal lamp (12) as described in Section 4.2:
Note! "Electrical connection", page 24 (see Fig. 5-5).
To mount a new pull-rope emergency stop 4. Remove the cable from screwed cable gland (11).
switch or a repaired pull-rope emergency stop
switch, we recommend that the connections be
labeled with the connection designations for the
12
X1 X2
12 14 1
Pull-rope side
9 9
11
9
4 9
1
6 Maintenance
6.1 Overview of maintenance 6.2 Tools required
interval Component Measure Standard workshop equipment is adequate for working
1 on the pull-rope emergency stop switch. At the very least
Monthly Pull-rope emer- Visual inspection (see
you will require the following tools for maintenance:
gency stop switch Section 6.3, page 44)
Set of screwdrivers (slot / Phillips)
Cleaning the device
from the outside (see Open-end wrench for screw connection M25
Section 6.4, page 46) Suitable torque wrench (Section 4.2: "Electrical con-
Annual Pull-rope emer- Functional test (see nection", page 24 and Section 4.3: "Tightening
gency stop switch Section 6.5, page 49) torques", page 26)
Every 10 Pull-rope emer- Replace pull-rope
years gency stop switch emergency stop switch 2
(see Chapter 5: "Mount-
ing and dismounting",
page 31)
1. It may be necessary to reduce the interval depending on the
operating or local conditions (e.g. greater quantities of dirt,
weather conditions).
10 11
4
1
Risk of death from electrical shock! 3. Check the pull-rope emergency stop switch and its
components for distortions (e.g. caused by the use
Only an electrician may work on the device. of force) and damage (e.g. corrosion):
Before starting work, isolate the system from the power – If distorted, replace the pull-rope emergency
supply. Secure the system from being switched on stop switch (see Chapter 5: "Mounting and dis-
again. Cover any adjacent, live parts so that they can- mounting", page 31).
not be touched. – Replace the pull-rope emergency stop switch if
there is damage to release lever (1), reset lever
To carry out a visual inspection of the pull-rope emergen- (2) or housing (3) (see Chapter 5: "Mounting and
cy stop switch, proceed as follows: dismounting", page 31).
1. Before starting work, isolate the system from the – Replace the damaged component if the cover
power supply. Secure the system from being (4), sealing screw (10), the screwed cable gland
swit-ched on again. Cover any adjacent, live parts so (11) or the signal lamp (12) are damaged (see
that they cannot be touched. Chapter 7: "Repairs", page 53).
2. Check the pull-rope emergency stop switch for dirt
and ice. Release lever (1) and reset lever (2) must
not be blocked by dirt or ice (see Fig. 6-1). Clean the
pull-rope emergency stop switch if it is dirty or iced
up (see Section 6.4, page 46).
4. Check the pull-rope emergency stop switch to
NTS Operating Instructions
█████
█████ 6 Maintenance 45
█████
ensure it is properly fixed to the substructure. 5. Check whether the following components have been
If the pull-rope emergency stop switch is not prop- tightened to the specified tightening torque:
erly fixed, proceed as follows: Component Tightening torque
a. Fix the pull-rope emergency stop switch to the
Screw (9) 4 Nm
substructure (see Section 5.4.2: "Mechanical
mounting", page 35). Screw plug (10) 5 Nm
b. Carry out a function test (see Section 6.5: "Func- Screwed cable gland (11) 5 Nm
tional test", page 49). Screwed cable gland nut 6.7 Nm
(11)
2 1
4
10 3 11
6.4 Cleaning the device from the outside Warning - risk of injuries when the release
6.4.1 Removing dirt from the outside
! line is disconnected!
The release line is under spring tension. Carefully dis-
Danger of death if the safety instructions are connect the release line from the release lever so that
! not observed! the release line cannot spring back uncontrollably. Ob-
Always observe the safety measures and general in- serve the documentation for the release line system.
structions described in Chapter 1: "Safety", page 7.
2. Remove the pull-rope from release lever (1).
Observe the instructions in the documentation on
Risk of death from electrical shock!
the pull-rope system.
Only an electrician may work on the device.
Before starting work, isolate the system from the power
supply. Secure the system from being switched on
again. Cover any adjacent, live parts so that they can- 2 1
not be touched.
To clean the pull-rope emergency stop switch from out-
side, proceed as follows:
1. Before starting work, isolate the system from the
power supply. Secure the system from being
swit-ched on again. Cover any adjacent, live parts so
that they cannot be touched.
3. Remove any dirt (e.g. dust, soot, sand) that could Risk of death from electrical shock!
block the release lever mechanism (1) and reset
Only an electrician may work on the device.
lever (2). Observe the following cleaning instruc-
tions: Before starting work, isolate the system from the power
supply. Secure the system from being switched on
– Clean the pull-rope emergency stop switch by
again. Cover any adjacent, live parts so that they can-
hand using a hand brush or cloth.
not be touched.
– Do not use any cleaning agents that contain sol-
vents. To remove ice proceed as follows:
– Do not use any knives or sharp-edged tools. 1. Before starting work, isolate the system from the
4. Carry out a function test (see Section 6.5: "Func- power supply. Secure the system from being
tional test", page 49). swit-ched on again. Cover any adjacent, live parts so
5. Mount the pull-rope on release lever (1). When the that they cannot be touched.
pull-rope has been mounted, release lever (1) must Warning - risk of injuries when the release
be in a vertical position. Observe the instructions in ! line is disconnected!
the documentation on the pull-rope system.
The release line is under spring tension. Carefully dis-
connect the release line from the release lever so that
the release line cannot spring back uncontrollably. Ob-
serve the documentation for the release line system.
2. Remove the pull-rope from release lever (1). 3. To remove any ice that could block release lever (1)
Observe the instructions in the documentation on and reset lever (2), actuate release lever (1) and
the pull-rope system. reset lever (2) several times.
Do not use any cleaning agents that contain sol-
! Beware! vents or any knives or sharp-edged tools.
4. Carry out a function test (see Section 6.5: "Func-
The surfaces of the device and the seals must not be tional test", page 49).
damaged by the removal of ice. 5. Mount the pull-rope on release lever (1). When the
Do not use any cleaning agents which contain solvents. pull-rope has been mounted, release lever (1) must
Do not use any knives or sharp-edged tools. be in a vertical position. Observe the instructions in
the documentation on the pull-rope system.
2 1
3. Actuate release lever (1) in one direction of actua- 5. Actuate release lever (1) in the opposite direction of
tion. actuation.
Reset lever (2) jumps from switch position "1" to switch Reset lever (2) jumps from switch position "1" to switch
position "0". It must not be possible to move reset lever position "0". It must not be possible to move reset lever
(2) freely. Release lever (1) is now disconnected and can (2) freely. Release lever (1) is now disconnected and can
move freely. move freely(see Fig. 6-6).
4. Reset the pull-rope emergency stop switch by
switching reset lever (2) from switch position "0" to
switch position "1".
1 2
Release lever (1) is fixed in a vertical position.
Direction of
2 1 actuation
Fig. 6-5: Actuating the pull-rope emergency stop switch Fig. 6-6: Illustration of switch positions
6. Reset the pull-rope emergency stop switch by Electrical function test on the conveyor system
switching reset lever (2) from switch position "0" to
switch position "1". Danger!
!
If there are any steps that you cannot perform, the pull-
rope emergency stop switch mechanism may be blocked The following checks are conducted on a conveyor
or damaged (see Chapter 9: "Defects and faults", page which is switched on. The rules for working on live parts
63). If you cannot rectify the fault, replace the pull-rope and the regulations of the plant operator for working on
emergency stop switch (see Chapter 5: "Mounting and a conveyor which is switched on must be observed.
dismounting", page 31).
12
X1 X2
12 14 1
Pull-rope side
Switching element
Switch posi- N/C contact (5) N/O contact (6)
tion of reset (:21,:22),(:41,:42), (:13,:14),(:33,:34),
lever (2) (:61,:62) (:53,:54)
Safety circuit Control circuit
1 (pull-rope Closed Open
emergency stop
switch active)
0 (pull-rope Open Closed
emergency stop
switch trig-
gered)
7 Repairs
You can send faulty pull-rope emergency stop switches
Warning - danger due to transport, storage,
to the manufacturer, Vossloh Kiepe GmbH, for repair
(see the Imprint for the company's address).
! and disposal!
Always observe the safety measures and general in-
7.1 Tools required structions described in Chapter 2: "Transport, storage
and disposal", page 15.
Standard workshop equipment is adequate for working
on the pull-rope emergency stop switch. At the very least To replace cover (4), proceed as follows (see Fig. 7-1):
you will require the following tools for repairs:
Set of screwdrivers (slot / Phillips) Risk of death from electrical shock!
Open-end wrench for screw connection M25
Suitable torque wrench (Section 4.2: "Electrical con- Only an electrician may work on the device.
nection", page 24 and Section 4.3: "Tightening Before starting work, isolate the system from the power
torques", page 26) supply. Secure the system from being switched on
again. Cover any adjacent, live parts so that they can-
7.2 Replacing the cover not be touched.
2. Open the cover (4). To do this, loosen the two 3. Check the pull-rope emergency stop switch for dirt
screws (9). and moisture. Remove dirt and moisture as
described in Section 5.4.4: "Finishing work", page
Ingress of dirt and moisture! 38, steps 2 and 3.
!
Penetration of dust and moisture if seals are
Dirt and moisture may cause the device to malfunction
and corrosion.
! damaged!
If dirt and moisture have penetrated the device, you If the hood seal is damaged, dust and moisture may
must clean and dry the device before you close the penetrate the device and damage the device and its
hood. components.
Check the seal for damage before closing the hood. Re-
place the hood if the seal is damaged.
7.3 Replacing a sealing screw 2. If necessary, clean the pull-rope emergency stop
switch from outside (see Section 6.4, page 46).
Danger of death if the safety instructions are 3. Screw sealing screw (10) out of the housing (3).
! not observed!
Always observe the safety measures and general in-
structions described in Chapter 1: "Safety", page 7.
Penetration of dust and moisture if seals are Warning - danger due to transport, storage,
! damaged! ! and disposal!
Seals on screwed cable glands and sealing screws Always observe the safety measures and general in-
age; as a result, the tightness of the devices can no lon- structions described in Chapter 2: "Transport, storage
ger be ensured when the screwed cable glands or seal- and disposal", page 15.
ing screws have been opened.
To replace screwed cable gland (11), proceed as follows
Replace screwed cable glands and sealing screws with
(see Fig. 7-3):
new screwed cable glands and sealing screws whenev-
er the device has been opened.
Risk of death from electrical shock!
Use only the screwed cable glands and sealing screws
recommended by the manufacturer.
Only an electrician may work on the device.
4. Check the seal of the new sealing screw (10) for Before starting work, isolate the system from the power
damage. Replace the sealing screw (10) if the seal supply. Secure the system from being switched on
is damaged. again. Cover any adjacent, live parts so that they can-
5. Screw new sealing screw (10) into housing (3) and not be touched.
tighten the sealing screw (10) to a tightening 1. Before starting work, isolate the system from the
torque of 5 Nm. power supply. Secure the system from being
swit-ched on again. Cover any adjacent, live parts so
7.4 replacing the screwed cable gland that they cannot be touched.
Danger of death if the safety instructions are 2. If necessary, clean the pull-rope emergency stop
! not observed! switch from outside (see Section 6.4, page 46).
5. Check the seal for new screwed cable gland (11) for
damage. Replace screwed cable gland (11) if the
seal is damaged.
6. Screw new screwed cable gland (11) into housing
(3) and tighten screwed cable gland (11) to a tight-
ening torque of 5 Nm.
11
7. Mount the pull-rope emergency stop switch on the
conveyor system (see Section 5.4, page 34).
7.5 Replacing the signal lamp 2. Open the cover (4). To do this, loosen the two
screws (9).
Danger of death if the safety instructions are
! not observed! Ingress of dirt and moisture!
!
Always observe the safety measures and general in-
structions described in Chapter 1: "Safety", page 7. Dirt and moisture may cause the device to malfunction
and corrosion.
Warning - danger due to transport, storage, If dirt and moisture have penetrated the device, you
! and disposal! must clean and dry the device before you close the
Always observe the safety measures and general in- hood.
structions described in Chapter 2: "Transport, storage
3. Check the pull-rope emergency stop switch for dirt
and disposal", page 15.
and moisture. Remove dirt and moisture as
To replace signal lamp (12), proceed as follows (see described in Section 5.4.4: "Finishing work", page
Fig. 7-5): 38, steps 2 and 3.
4. Rotate signal lamp (12) to remove it from its socket.
Risk of death from electrical shock! 5. Insert a new signal light (12) and rotate it into the
socket.
Only an electrician may work on the device.
Penetration of dust and moisture if seals are
Before starting work, isolate the system from the power
supply. Secure the system from being switched on
! damaged!
again. Cover any adjacent, live parts so that they can- If the hood seal is damaged, dust and moisture may
not be touched. penetrate the device and damage the device and its
components.
1. Before starting work, isolate the system from the Check the seal for damage before closing the hood. Re-
power supply. Secure the system from being place the hood if the seal is damaged.
swit-ched on again. Cover any adjacent, live parts so
that they cannot be touched.
6. Check the seal on the cover (4) for damage. 7. Close cover (4). When closing cover (4), ensure that
Replace cover (4) if the seal is damaged. the cables are not squeezed or damaged. The
cables must not block the mechanics in the device.
8. Tighten the screws (9) evenly to a tightening
torque of 4 Nm.
9. Check that signal lamp (12) is working properly in
the conveyor system (see conveyor system docu-
mentation).
9 9
12
Fig. 7-4: Opening / closing the cover Fig. 7-5: Replacing the signal lamp
8 Commissioning
Mechanical and electrical function test in the con-
Danger of death if the safety instructions are
! not observed!
veyor system
2. Carry out a function test in accordance with
Always observe the safety measures and general in- Section 6.5: "Functional test", page 49.
structions described in Chapter 1: "Safety", page 7.
Function test on the conveyor system with pull-rope
Risk of death from electrical shock! system
When installing the pull-rope system, observe the follow-
Only an electrician may work on the device. ing instructions:
Before starting work, isolate the system from the power The safety input module is not included with delivery
supply. Secure the system from being switched on of the pull-rope emergency stop switch NTS. Acces-
again. Cover any adjacent, live parts so that they can- sories from Vossloh Kiepe GmbH are recommended
not be touched. for the pull rope system (see Section 10.2: "Ordering
replacement parts and accessories", page 67). Not-
1. Before starting work, isolate the system from the withstanding the above, the requirements specified
power supply. Secure the system from being in the relevant standards must be complied with in
swit-ched on again. Cover any adjacent, live parts so respect of the pull-rope system.
that they cannot be touched.
The pull-ropes (20) should be guided in a straight
line from attachment points (22) to the pull-rope
emergency stop switch.
Ensure that you have an unobstructed view of the
entire length of pull-ropes (20) from the pull-rope
emergency stop switch to attachment points (22).
Ensure that the pull-rope (20) cannot be moved 4. Fasten pull-rope (20) to the right and left of release
either by external influences or hindered by the way lever (1). Observe the instructions in the documenta-
it is installed and can be moved in all directions. tion on the pull-rope system.
Observe the instructions in the documentation on 5. Set the tension of pull-rope (20) on both sides of
the pull-rope system. release lever (1) in accordance with the instructions
in the documentation on the pull-rope system.
3. Check that the pull-rope emergency stop switch is
mounted in the center between the two attachment 6. Check whether the same forces are being exerted
points (22). If the pull-rope emergency stop switch is on both sides of release lever (1). To do this, switch
not mounted in the center, remount the pull-rope reset lever (2) to switch position "0" (see Fig. 8-2).
emergency stop switch (see Chapter 5: "Mounting Release lever (1) must be in a vertical position.
and dismounting", page 31).
Attachment point (22) Reset lever (2) Release lever (1) Attachment point (22)
Pull rope (20) Pull-rope guide (21)
Direction of actuation
Fig. 8-1: Function of the pull-rope emergency stop switches NTS
7. Simulate a tear or a break in the pull-rope (20). The – The actuation path must not exceed 300mm.
pull-rope emergency stop switch must be triggered. – The actuation force must not exceed 125 N.
8. In turn, actuate pull-rope (20) on either side of If the values are not adhered to, correct the setting
release lever (1), in the center between release lever for the pull-rope system (see documentation on the
(1) and the attachment point and in the center pull-rope system).
between the two pull-rope guides (21) respectively 9. Set the pull-rope emergency stop switch to the home
(see Fig. 8-1): position (pull-rope emergency stop switch active) by
switching reset lever (2) from switch position "0" to
switch position "1".
1 2
12
X1 X2
12 14 1
Pull rope side
Replacement parts
4 Cover for devices not supplied 93.067319.001
with signal lamps (incl. seal and
screws)
Cover for devices supplied with 93.067319.002
signal lamps (incl. seal and
screws)
10 11 11 Screwed cable gland M25 x 1.5; 113.52.02.20.01
sealing area Ø 11 mm to Ø
Fig. 10-1: Ordering replacement parts 16 mm
Índice de contenidos
1 Seguridad ........................................................................................................................ 7
1.1 Uso adecuado.............................................................................................................................................. 7
1.2 Concepción de las indicaciones de advertencia.......................................................................................... 8
1.3 Indicaciones de seguridad ......................................................................................................................... 10
1.3.1 Exclusión de la garantía y de responsabilidad .......................................................................................... 10
1.3.2 Indicaciones de seguridad para evitar daños personales.......................................................................... 11
1.3.3 Indicaciones de seguridad para evitar daños materiales........................................................................... 12
1.4 Equipo de protección personal .................................................................................................................. 14
3 Descripción .................................................................................................................... 17
3.1 Introducción ............................................................................................................................................... 17
3.2 Función ...................................................................................................................................................... 19
6 Mantenimiento ............................................................................................................... 44
6.1 Vista general de mantenimiento ................................................................................................................ 44
6.2 Herramientas necesarias........................................................................................................................... 44
6.3 Control visual ............................................................................................................................................. 45
6.4 Limpieza exterior del aparato .................................................................................................................... 47
6.4.1 Eliminación de la suciedad del exterior ..................................................................................................... 47
6.4.2 Eliminación de hielo del exterior ................................................................................................................ 48
6.5 Prueba de funcionamiento......................................................................................................................... 50
7 Reparación .................................................................................................................... 54
7.1 Herramientas necesarias........................................................................................................................... 54
7.2 Sustitución de la cubierta........................................................................................................................... 54
7.3 Sustitución del tapón roscado.................................................................................................................... 56
7.4 Sustitución del racor atornillado para cables ............................................................................................. 57
7.5 Sustitución de la lámpara señalizadora ..................................................................................................... 59
1 Seguridad
1.1 Uso adecuado La utilización inadecuada del aparato y las modificacio-
nes realizadas por cuenta propia tanto en el aparato
Los interruptores de seguridad por tracción de cable del
como en sus componentes pueden provocar daños per-
tipo NTS se utilizan conforme los requisitos de seguridad
sonales y materiales, por los que el fabricante no asume
de la DIN EN 620 y en cumplimiento de la DIN EN ISO
responsabilidad alguna. Asegúrese de que el uso ade-
13850 como dispositivos de parada de emergencia de
cuado del aparato no se ve perjudicado por causas aje-
accionamiento en ambos lados en instalaciones trans-
nas imprevistas.
portadoras fijas en circuitos de mando. En virtud del in-
forme BGIA (Instituto para la seguridad en el trabajo ale- La presente documentación se considera parte del pro-
mán) 2/2008 "Seguridad funcional de controles de ducto, por lo que se debe conservar durante la vida útil
máquinas – aplicación de la norma DIN EN ISO 13849" de éste y se debe poner a disposición del propietario/
del seguro alemán obligatorio de accidentes, los inte- usuario correspondiente. Si el producto cambia de pro-
rruptores de seguridad por tracción de cable pueden uti- pietario, la documentación debe transmitirse también al
lizarse como dispositivos de parada de emergencia en nuevo propietario.
circuitos de control de seguridad hasta un nivel de segu- En especial, se considera uso adecuado el cumplimiento
ridad PLe. de las indicaciones de este manual de instrucciones a
Estas instrucciones para el servicio describen la utiliza- la hora de realizar cualquier trabajo en y con el aparato.
ción correcta y apropiada, el montaje y desmontaje me- Los trabajos en el aparato sólo pueden ser realizados
cánico en los puntos de fijación del interruptor de seguri- por especialistas que hayan sido instruidos acerca del
dad por tracción de cable NTS, la conexión eléctrica, así procedimiento de ejecución de dichos trabajos por parte
como el mantenimiento, reparación, puesta en servicio y de los responsables en materia de seguridad de la insta-
la localización/subsanación de averías del interruptor de lación.
emergencia por tracción de cable NTS. Estas instruccio- Como especialista se entiende toda aquella persona que
nes para el servicio no contienen indicaciones para la uti- por su formación, experiencia o instrucción, así como por
lización y manejo del sistema de cordón de desgarre o sus conocimientos acerca de las normas, leyes, disposi-
del control. ciones, prescripciones de seguridad en el trabajo, regu-
! ¡Advertencia!
Pictogramas
! ¡Cuidado! Para aclarar las fuentes de peligro se utilizan los siguien-
tes pictogramas. Los pictogramas pueden aparecer en
designa una situación potencialmente peligrosa. Si no todos los niveles de peligro.
se evita la situación peligrosa, se pueden producir le-
siones leves. Pictograma Tipo de peligro
Peligros de todo tipo; además de con la
¡Atención! indicación ¡Peligro! se identifican mediante
! el siguiente pictograma.
designa una situación potencialmente perjudicial. Si no Peligros debido a la utilización en ambien-
se evita la situación perjudicial, el producto o algo de su tes con peligro de explosión.
entorno pueden resultar dañados.
Lesiones debidas a tensiones y corrientes
¡Nota! peligrosas.
"Nota" designa consejos de utilización y cual-
quier otra información especialmente útil. Lesiones por aplastamiento.
2.3 Eliminación
! ¡Envejecimiento de materiales! Además de componentes mecánicos, este aparato tam-
bién puede contener componentes electrónicos. Se per-
Un almacenamiento prolongado puede provocar el en-
mite la separación de los componentes del aparato, así
vejecimiento de algunos materiales de forma que resul-
como de los materiales empleados, mediante el despie-
ten dañadas sus propiedades (p. ej. las juntas y plásti-
ce del aparato.
cos pueden volverse quebradizos). Las propiedades de
los lubricantes pueden alterarse debido a un almacena- La eliminación de nuestros productos debe realizarse
miento prolongado. según las prescripciones locales, nacionales e interna-
cionales vigentes que correspondan.
Controle si el aparato presenta daños antes de su utili-
zación o su montaje. No monte un aparato si presenta
daños visibles de envejecimiento.
3 Descripción
3.1 Introducción rruptores de seguridad por tracción de cable pueden uti-
lizarse como dispositivos de parada de emergencia en
Los interruptores de seguridad por tracción de cable del
circuitos de control de seguridad hasta un nivel de segu-
tipo NTS se utilizan conforme los requisitos de seguridad
ridad PLe.
de la DIN EN 620 y en cumplimiento de la DIN EN ISO
13850 como dispositivos de parada de emergencia de El interruptor de seguridad por tracción de cable NTS
accionamiento en ambos lados en instalaciones trans- permite accionarse mediante un cordón de desgarre en
portadoras fijas en circuitos de mando. En virtud del in- dos direcciones (20). El cordón de desgarre se tensa a lo
forme BGIA (Instituto para la seguridad en el trabajo ale- largo de la instalación de transporte y se conduce por las
mán) 2/2008 "Seguridad funcional de controles de guías de cordones de desgarre (21). El interruptor de se-
máquinas – aplicación de la norma DIN EN ISO 13849" guridad por tracción de cable NTS se monta centrado en-
del seguro alemán obligatorio de accidentes, los inte- tre dos puntos de fijación (22).
Punto de fijación (22) Palanca de retroceso Palanca de desenclava- Punto de fijación (22)
(2) miento (1)
Fig. 3-2: Interruptor de seguridad por tracción de cable NTS: Fig. 3-3: Interruptor de seguridad por tracción de cable NTS:
Viste desde el interior (palanca de retroceso detrás) Indicación de las posiciones de conmutación (pa-
lanca de retroceso delante)
3.2 Función tos del elemento actuador (6) Contacto de trabajo (circui-
to de control) están abiertos.
Los interruptor de seguridad por tracción de cable del
tipo NTS son interruptores electromecánicos aptos para Accionando la palanca de desenclavamiento (1) el rodillo
desempeñar funciones de seguridad conforma a la de levas (16) salta a la posición de desconexión. La pa-
DIN EN ISO 13849-1. Los interruptores de seguridad por lanca de retroceso (2) salta de la posición de conmuta-
tracción de cable permiten accionarse en dos direccio- ción "1" a la posición "0". La palanca de desenclavamien-
nes. to (1) se desacopla y queda libre, de modo que no puede
producirse un nuevo proceso de conmutación (función
El interruptor de seguridad por tracción de cable del tipo
de enclavamiento). Los contactos del elemento actuador
NTS es un dispositivo de parada de emergencia, equipa-
(5) Contacto de reposo (circuito de seguridad) están
do como mínimo con dos elementos de conmutación (5,
abiertos, los contactos del elemento actuador (6) Con-
6) (v. fig. 3-2). Como mínimo uno de los elementos ac-
tacto de trabajo (circuito de control) están cerrados.
tuadores (5) es de apertura forzada.
El elemento actuador (5) Contacto de reposo se uti- Elemento actuador
liza para su conexión a un circuito de seguridad. Posición de con-
mutación de la Contacto de Contacto de tra-
El elemento actuador (6) Contacto de trabajo se uti- palanca de retro- reposo (5) bajo (6)
liza para la conexión del circuito de control o ceso (2) Circuito de segu- Circuito de con-
conexión de la lámpara de señalización opcional ridad trol
(12) (véase la figura 4-1, página 24).
1 (interruptor de cerrado abierto
Los elementos actuadores (5, 6) son accionados al mis- seguridad por trac-
mo tiempo a través del rodillo de levas (16). ción de cable activo)
Parada de emergencia 0 (interruptor de abierto cerrado
seguridad por trac-
En la posición básica (interruptor de seguridad por trac-
ción de cable accio-
ción de cable activo) la palanca de retroceso (2) se en- nado)
cuentra en la posición de conmutación "1" (v. fig. 3-3).
Tab. 3-1: Vista general: Función de los elementos
Los contactos del elemento actuador (5) Contacto de re-
actuadores
poso (circuito de seguridad) están cerrados, los contac-
Retroceso manual
! ¡Advertencia!
4 Datos técnicos
4.1 Datos técnicos generales
Denominación Interruptor de seguridad por tracción de cable
Modelo Interruptor de parada de emergencia con accionamiento por ambos lados
Campo de aplicación Circuito de control, categoría de parada 1 conforme a la norma DIN EN ISO 13850
¡Nota!
Se recomienda utilizar para el sistema de cordones de desgarre accesorios de la
empresa Vossloh Kiepe GmbH.
Además deberán observarse para los sistemas de cordón de desgarre los requisitos de
las normas aplicables.
Fuerza de accionamiento 30 N ± 10 N
Carrera de accionamiento aprox. 25mm en ambas direcciones de accionamiento ó 15°, véase también el
párrafo 4.6, página 29
Peso / Medidas 2,02 kg
Fijación 4 agujeros oblongos para tornillos M8
Tornillos recomendados para la fijación en la subestructura: tornillos hexagonales M8
según DIN EN 4017, debe disponerse también de la fijación para los tornillos adecuada
¡Advertencia!
Con la instalación en fila de interruptores de seguridad por tracción de cable es
posible que aumente la la probabilidad de aparición de errores según
DIN EN ISO 138479-1. Como consecuencia puede verse reducido el campo de
aplicación PL (nivel de rendimiento).
Vida útil B10d 24000 ciclos de carga
12
X1 X2
12 14 1
Lado cable Bowden
:53, :54
:21, :22 Contacto de reposo (5): Circuito Tornillo M3,5 1,0 Nm
:41, :42 de seguridad
:61, :62
X1, X2 Lámpara de señalización (12), en Tornillo M3 0,6 Nm
diferentes variantes (véase el
párrafo 10.2: "Pedido piezas de
repuesto y accesorios", página
69)
Identificación de tipo
4.6 Dimensiones
134,3 128
15°
15°
187
160
29,8
25°
9 10
54 41
137
90
10
11
10 11
5 Montaje y desmontaje
5.1 Volumen de suministro gún EN ISO 4017 y con la fijación adecuada para el
tornillo (véase el párrafo 4.1: "Datos técnicos generales",
página 21).
! ¡Penetración de suciedad y humedad!
Tampoco los cables para la conexión eléctrico ni el sis-
En el estado de envío la cubierta no está atornillada del tema de cordón de desgarre están incluidos en el volu-
todo. Los aparatos están sellados con dos tapones ros- men de suministro del interruptor de seguridad por trac-
cados para el transporte y el almacenamiento. Por tan- ción de cable (véase el párrafo 5.2.5: "Sistema de
to, el aparato no está protegido contra la penetración cordón de desgarre", página 33).
de suciedad y humedad conforme al tipo de protección
especificado en los datos técnicos (véase el
párrafo 4.1, página 21).
El aparato sólo puede ponerse en funcionamiento si to-
dos los orificios han sido cerrados con el racor atornilla-
do para cables y el tapón roscado. Utilice únicamente
los racores atornillados para cable y los tapones rosca-
dos suministrados, ya que de lo contrario no se garan-
tizará la estanqueidad del aparato.
5.2 Indicaciones para el montaje rial de escombros, así como del agua de condensa-
importantes previas ción, de descongelación o de lluvia.
Para fijar el interruptor de seguridad por tracción de
Tenga en cuenta las siguientes indicaciones antes de
cable son necesarios dos orificios conforme al
montar el interruptor de seguridad por tracción de cable.
dibujo acotado (véase el párrafo 4.6: "Dimensiones",
5.2.1 Requisitos generales página 29).
Durante el montaje y, en especial, durante su funcio- Disponga de los tornillos adecuados para la fijación
namiento, deben respetarse las requisitos conforme a la subestructura (véase el párrafo 4.1: "Datos téc-
a la norma DIN EN 1088, en particular el apartado nicos generales", página 21).
5.7 "Dispositivos divisorios para reducir las posibili- Tenga en cuenta los requisitos de la posición y lugar
dades de acceso". de montaje (véase el párrafo 4.7: "Posición y lugar
El concepto total del circuito de seguridad, en el que de montaje", página 30).
se integra el interruptor de seguridad por tracción de
5.2.3 Condiciones para el montaje
cable, debe validarse conforme a la norma DIN EN
ISO 13849-2. Lleve a cabo el montaje completo en las siguientes con-
diciones sin interrupción:
Deben cumplirse los requisitos de los datos técnicos
(véase el capítulo 4, página 21). con un tiempo climatológico seco y tranquilo
sin exceso o acumulación de polvo y suciedad
5.2.2 Subestructura, lugar y posición de montaje Si interrumpe el montaje, proteja el interior del aparato
Deberán cumplirse los siguientes requisitos en cuanto a contra el polvo y la humedad. En caso de que haya en-
la subestructura y a la posición de montaje : trado suciedad y humedad en el aparato, deberá limpiar
la subestructura para el montaje del interruptor de y secar necesariamente el aparato (Párrafo 5.4.4: Traba-
seguridad por tracción de cable debe ser plana y jos de finalización", página 39, pasos 2 y 3).
estable. Recomendamos elegir una posición de
montaje protegida, para proteger el interruptor de
seguridad por tracción de cable de la caída de mate-
12
X1 X2
12 14 1
Lado cable Bowden
6. Conecte el conductor de conexión para el circuito de 8. Apriete la tuerca del racor atornillado para cables
control y de seguridad a los elementos actuadores (11) con un par de apriete de 6,7 Nm (v. fig. 5-4).
(5, 6), así como (en caso necesario) el conductor de Asegúrese de que el anillo obturador del racor ator-
conexión para la lámpara de señalización (12). nillado para cables (11) envuelva correctamente el
Apriete los tornillos de las conexiones de los ele- cable y no quede aplastado.
mentos actuadores (5, 6) y de la lámpara de señali- 9. Compruebe el funcionamiento de los elementos
zación (12) con los pares de apriete especificados actuadores (5, 6) tanto en la posición de conmuta-
en Párrafo 4.2: Conexión eléctrica", página 24. ción "1" como en la posición de conmutación "0" de
7. En caso necesario, una los conductores de la palanca de retroceso (2) conforme a las indicacio-
conexión con presillas para cables. Asegúrese de nes de la siguiente tabla (v. fig. 5-3):
que los conductores de conexión no bloqueen el Elemento actuador
mecanismo en el aparato.
Posición de Contacto de Contacto de tra-
¡Penetración de suciedad y humedad en el conmutación reposo (5) bajo (6)
! caso de juntas dañadas! de la palanca (:21,:22),(:41,:42), (:13,:14),(:33,:34),
de retroceso (:61,:62) (:53,:54)
Las juntas de los racores atornillados para cables y ta- (2) Circuito de segu- Circuito de con-
pones roscados envejecen con el paso del tiempo, im-
ridad trol
pidiendo que se asegure la estanqueidad de los apara-
tos después de abrir los racores atornillados para 1 (interruptor de cerrado abierto
cables o tapones roscados. seguridad por
tracción de
Después de abrir los racores atornillados para cables y
cable activo)
tapones roscados, sustitúyalos por otros nuevos.
0 (interruptor de abierto cerrado
Utilice exclusivamente los racores atornillados para ca-
seguridad por
bles y tapones roscados recomendados por el fabrican-
tracción de
te. cable accio-
nado)
4. Compruebe la junta de la cubierta (4) frente a posi- 8. Lleve a cabo una puesta en servicio (véase el
bles daños. Sustituya la cubierta (4) si está dañada capítulo 8: "Puesta en servicio", página 62).
la junta.
5. Cierre la cubierta (4). Al cerrar la cubierta (4), preste 5.5 Desmontaje
atención de no aprisionar o dañar los cables. Los
cables no deben bloquear el mecanismo (mecánica) ¡Peligro de muerte en caso de no observar las
del aparato. ! indicaciones de seguridad!
6. Apriete los tornillos (9) alternadamente con un par Preste atención fundamentalmente a las medidas de
de apriete de 4 Nm (v. fig. 5-4). seguridad y a las indicaciones generales que se descri-
7. Lleve a cabo un control visual (véase el párrafo 6.3: ben en el capítulo 1: Seguridad", página 7.
"Control visual", página 45).
Advertencia de peligros durante el transpor-
! te, el almacenaje y la eliminación.
Preste atención fundamentalmente a las medidas de
9 9 seguridad y a las indicaciones generales que se descri-
ben en el capítulo 2: Transporte, almacenaje y elimina-
ción", página 15.
El desmontaje del interruptor de seguridad por tracción
11 de cable se realiza en los siguientes pasos:
1. Trabajos previos
2. Soltar las conexiones eléctricas
9 3. Desmontaje mecánico
4 9
5.5.2 Soltar las conexiones eléctricas una reparación, recomendamos marcar las co-
1. Suelte la tuerca del racor atornillado para cables nexiones con las denominaciones de conexión
(11). del interruptor de seguridad por tracción de ca-
2. Suelte los cable en el interruptor de seguridad por ble antes de soltar los cables de conexión.
tracción de cable de la abrazadera de fijación (14) y 3. Suelte el conductor de conexión para el circuito de
retire las presillas para cables (si existen) (v. fig. 5- control y de seguridad a los elementos actuadores
5). (5, 6), así como (en caso necesario) el conductor de
conexión para la lámpara de señalización (12)
¡Nota! según Párrafo 4.2: Conexión eléctrica", página 24
Para el montaje de un interruptor de seguridad (v. fig. 5-5).
por tracción de cable nuevo o montaje de un in- 4. Tire del cable para sacarlo del racor atornillado para
terruptor de seguridad por tracción de cable tras cables (11).
12
X1 X2
12 14 1
Lado cable Bowden
9 9
11
9
4 9
1
6 Mantenimiento
6.1 Vista general de mantenimiento 6.2 Herramientas necesarias
Intervalo Componente Medida Para realizar los trabajo en o con el interruptor de segu-
ridad por tracción de cable deberá contar con los medios
mensual- Interruptor de segu- Control visual (véase el
y herramientas habituales de un taller. Pero, necesitará
mente1 ridad por tracción párrafo 6.3, página 45)
de cable al menos las siguientes herramientas:
Limpieza exterior del
Juego de destornilladores (de ranura / de cruz)
aparato (véase el
párrafo 6.4, página 47) Llave de boca para atornilladura M25
anualmente Interruptor de segu- Prueba de funciona- Llave dinamométrica adecuada (párrafo 4.2, página
ridad por tracción miento (véase el 24 y párrafo 4.3, página 26)
de cable párrafo 6.5, página 50)
cada 10 años Interruptor de segu- Sustitución del interrup- 2
ridad por tracción tor de seguridad por
de cable tracción de cable
(véase el capítulo 5:
"Montaje y desmon-
taje", página 31)
1. Dependiendo de las condiciones de funcionamiento o las con-
diciones del entorno (p.ej. acumulación intensa de suciedad, 10 11
efectos de la climatología) puede ser necesario reducir los
intervalos para el mantenimiento.
4
1
10 3 11
6.4 Limpieza exterior del aparato ¡Advertencia sobre heridas al soltar el cordón
6.4.1 Eliminación de la suciedad del exterior
! de desgarre!
El cordón de desgarre se encuentra sometido a una
¡Peligro de muerte en caso de no observar las tensión por resorte. Suelte con cuidado el cordón de
! indicaciones de seguridad! desgarre de la palanca de desenclavamiento de mane-
Preste atención fundamentalmente a las medidas de ra que el cordón de desgarre no rebote sin control hacia
seguridad y a las indicaciones generales que se descri- atrás. Tenga en cuenta la documentación pertenecien-
ben en el capítulo 1: Seguridad", página 7. te al sistema de cordón de desgarre.
3. Accione la palanca de desenclavamiento (1) en una La palanca de desenclavamiento (1) se encuentra fija en
de las direcciones de accionamiento. posición vertical.
La palanca de retroceso (2) salta de la posición de con- 5. Accione la palanca de desenclavamiento (1) en la
mutación "1" a la posición "0". La palanca de retroceso otra dirección de accionamiento.
(2) no debe poder moverse libremente. La palanca de La palanca de retroceso (2) salta de la posición de con-
desenclavamiento (1) queda suelta y permite moverse li- mutación "1" a la posición "0". La palanca de retroceso
bremente. (2) no debe poder moverse libremente. La palanca de
4. Vuelva a colocar el interruptor de seguridad por trac-
ción de cable a la posición anterior. Para ello mueva
la palanca de retroceso (2) de la posición de conmu- 1 2
tación "0" a la posición de conmutación "1".
Dirección de
2 1 accionamiento
Fig. 6-5: Accionamiento del interruptor de seguridad por Fig. 6-6: Indicación de las posiciones de conmutación
tracción de cable
Instrucciones para el servicio NTS
52 6 Mantenimiento
desenclavamiento (1) queda suelta y permite moverse li- Prueba de funcionamiento eléctrica en la instalación
bremente (v. fig. 6-6). transportadora
6. Vuelva a colocar el interruptor de seguridad por trac-
ción de cable a la posición anterior. Para ello mueva ! ¡Peligro!
la palanca de retroceso (2) de la posición de conmu-
tación "0" a la posición de conmutación "1". Las siguientes comprobaciones se efectúan en una ins-
Si no puede ejecutar alguno de los pasos de trabajo, es talación transportadora conectada. Deberán respetar-
posible que se deba al bloqueo del mecanismo del inte- se en todo momento las normas para realizar trabajos
rruptor de seguridad por tracción de cable, o que éste bajo tensión eléctrica y las prescripciones del operador
esté dañado (véase el capítulo 9, página 65). Si no logra para los trabajos efectuados en una instalación trans-
subsanar el fallo, sustituya el interruptor de seguridad portadora conectada.
por tracción de cable (véase el capítulo 5, página 31).
12
X1 X2
12 14 1
Lado cable Bowden
Elemento actuador
Posición de Contacto de Contacto de tra-
conmutación reposo (5) bajo (6)
de la palanca (:21,:22),(:41,:42), (:13,:14),(:33,:34),
de retroceso (:61,:62) (:53,:54)
(2) Circuito de segu- Circuito de con-
ridad trol
1 (interruptor de cerrado abierto
seguridad por
tracción de
cable activo)
0 (interruptor de abierto cerrado
seguridad por
tracción de
cable accio-
nado)
7 Reparación
Los interruptores de seguridad por tracción de cable de-
Advertencia de peligros durante el transpor-
fectuosos pueden enviarse directamente al fabricante ! te, el almacenaje y la eliminación.
Vossloh Kiepe GmbH para su reparación (véase la nota
legal para conocer la dirección de la empresa). Preste atención fundamentalmente a las medidas de
seguridad y a las indicaciones generales que se descri-
7.1 Herramientas necesarias ben en el capítulo 2: Transporte, almacenaje y elimina-
ción", página 15.
Para realizar los trabajo en o con el interruptor de segu-
ridad por tracción de cable deberá contar con los medios La sustitución de la cubierta (4) se realiza en los siguien-
y herramientas habituales de un taller. Pero, necesitará tes pasos (v. fig. 7-1):
para la reparación al menos las siguientes herramientas:
Juego de destornilladores (de ranura / de cruz) ¡Peligro de muerte por electrocución!
Llave de boca para atornilladura M25
Llave dinamométrica adecuada (Párrafo 4.2: Los trabajos en el aparato sólo pueden ser realizados
Conexión eléctrica", página 24 y Párrafo 4.3: Pares por un electricista.
de apriete", página 26) Desconecte la tensión de la instalación antes de iniciar
los trabajos. Asegure la instalación contra una co-
7.2 Sustitución de la cubierta nexión involuntaria. Cubra las piezas conductoras de
tensión que estén próximas de forma que sean resis-
¡Peligro de muerte en caso de no observar las tentes al contacto.
! indicaciones de seguridad!
1. Desconecte la tensión de la instalación antes de ini-
Preste atención fundamentalmente a las medidas de ciar los trabajos. Asegure la instalación contra una
seguridad y a las indicaciones generales que se descri- conexión involuntaria. Cubra las piezas conductoras
ben en el capítulo 1: Seguridad", página 7. de tensión que estén próximas de forma que sean
resistentes al contacto.
2. Para abrir la cubierta (4) suelte los dos tornillos (9). 3. Compruebe que el interruptor de seguridad por trac-
ción de cable no presente suciedad o humedad.
¡Penetración de suciedad y humedad! Limpie la suciedad y elimine la humedad tal como
! se describe en Párrafo 5.4.4: Trabajos de finaliza-
La suciedad y la humedad pueden ocasionar fallos en ción", página 39, los pasos 2 y 3.
el funcionamiento y corrosión en el aparato.
¡Penetración de suciedad y humedad en el
En caso de que haya entrado suciedad y humedad en ! caso de juntas dañadas!
el aparato, deberá limpiar y secar el aparato antes de
cerrar la cubierta. Si está dañada la junta de la cubierta, puede penetrar
suciedad y humedad en el aparato, y dañar tanto el
aparato como sus componentes.
Antes cerrar la cubierta asegúrese de que no esté da-
ñada la junta. Sustituya la cubierta si está dañada la
junta.
4
4. Compruebe la junta de la cubierta (4) frente a posi-
bles daños. Sustituya la cubierta (4) si está dañada
la junta.
9 9
5. Cierre la cubierta (4). Al cerrar la cubierta (4), preste
atención de no aprisionar o dañar los cables. Los
cables no deben bloquear el mecanismo (mecánica)
del aparato.
6. Apriete los tornillos (9) alternadamente con un par
de apriete de 4 Nm.
7.3 Sustitución del tapón roscado 1. Desconecte la tensión de la instalación antes de ini-
ciar los trabajos. Asegure la instalación contra una
¡Peligro de muerte en caso de no observar las conexión involuntaria. Cubra las piezas conductoras
! indicaciones de seguridad! de tensión que estén próximas de forma que sean
Preste atención fundamentalmente a las medidas de resistentes al contacto.
seguridad y a las indicaciones generales que se descri- 2. En caso necesario, limpie el exterior del interruptor
ben en el capítulo 1: Seguridad", página 7. de seguridad por tracción de cable (véase el
párrafo 6.4, página 47).
Advertencia de peligros durante el transpor- 3. Desenrosque el tapón roscado (10) de la carcasa
! te, el almacenaje y la eliminación. (3).
Preste atención fundamentalmente a las medidas de
seguridad y a las indicaciones generales que se descri-
ben en el capítulo 2: Transporte, almacenaje y elimina-
ción", página 15.
3
Fig. 7-3: Sustitución del racor atornillado para cables
5. Compruebe la junta del racor atornillado para cables 7.5 Sustitución de la lámpara
nuevo (11) frente a posibles daños. Sustituya el señalizadora
racor atornillado para cables (11) si está dañada la
junta. ¡Peligro de muerte en caso de no observar las
6. Enrosque el racor atornillado para cables nuevo (11) ! indicaciones de seguridad!
en la carcasa (3) y apriételo (11) con un par de Preste atención fundamentalmente a las medidas de
apriete de 5 Nm. seguridad y a las indicaciones generales que se descri-
7. Monte el interruptor de seguridad por tracción de ben en el capítulo 1: Seguridad", página 7.
cable a la instalación transportadora (véase el
párrafo 5.4, página 34). Advertencia de peligros durante el transpor-
! te, el almacenaje y la eliminación.
Preste atención fundamentalmente a las medidas de
seguridad y a las indicaciones generales que se descri-
ben en el capítulo 2: Transporte, almacenaje y elimina-
ción", página 15.
6. Compruebe la junta de la cubierta (4) frente a posi- 7. Cierre la cubierta (4). Al cerrar la cubierta (4), preste
bles daños. Sustituya la cubierta (4) si está dañada atención de no aprisionar o dañar los cables. Los
la junta. cables no deben bloquear el mecanismo (mecánica)
del aparato.
8. Apriete los tornillos (9) alternadamente con un par
de apriete de 4 Nm.
9. Compruebe el funcionamiento de la lámpara señali-
zadora (12) en la instalación transportadora (véase
la documentación perteneciente a la instalación
transportadora).
9 9
12
8 Puesta en servicio
Prueba de funcionamiento eléctrica y mecánica en la
¡Peligro de muerte en caso de no observar las
! instalación transportadora
indicaciones de seguridad!
2. Lleve a cabo una prueba de funcionamiento
Preste atención fundamentalmente a las medidas de Párrafo 6.5: Prueba de funcionamiento", página 50.
seguridad y a las indicaciones generales que se descri-
ben en el capítulo 1: Seguridad", página 7. Prueba de funcionamiento de la instalación trans-
portadora con sistema de cordón de desgarre
¡Peligro de muerte por electrocución! Tenga en cuentas las siguientes indicaciones para la ins-
talación del sistema de cordón de desgarre:
Los trabajos en el aparato sólo pueden ser realizados El sistema de cordón de desgarre no se incluye en
por un electricista. el volumen de suministro del interruptor de seguri-
Desconecte la tensión de la instalación antes de iniciar dad por tracción de cable NTS. Se recomienda utili-
los trabajos. Asegure la instalación contra una co- zar para el sistema de cordones de desgarre acce-
nexión involuntaria. Cubra las piezas conductoras de sorios de la empresa Vossloh Kiepe GmbH (véase
tensión que estén próximas de forma que sean resis- el párrafo 10.2: "Pedido piezas de repuesto y acce-
tentes al contacto. sorios", página 69). Además deberán observarse
para los sistemas de cordón de desgarre los requisi-
1. Desconecte la tensión de la instalación antes de ini- tos de las normas aplicables.
ciar los trabajos. Asegure la instalación contra una
Los cordones de desgarre (20) deben guiarse en
conexión involuntaria. Cubra las piezas conductoras
línea recta desde los puntos de fijación (22) hacia el
de tensión que estén próximas de forma que sean
interruptor de seguridad por tracción de cable.
resistentes al contacto.
Asegúrese de que los cordones de desgarre (20)
desde el interruptor de seguridad por tracción de
cable hasta los puntos de fijación (22) quede visible en toda su longitud.
Dirección de accionamiento
Fig. 8-1: Funcionamiento del interruptor de seguridad por tracción de cable NTS
ción de conmutación "0" (v. fig. 8-2). La palanca de 8. Accione el cordón de desgarre (20) consecutiva-
desenclavamiento (1) debe estar en posición verti- mente en ambos lados de la palanca de desencla-
cal. vamiento (1) tanto en el centro entre la palanca de
7. Simule una rotura o corte del cordón de desgarre desenclavamiento (1) y el punto de fijación como en
(20). El interruptor de seguridad por tracción de el centro entre dos guías para cordón de desgarre
cable debería activarse. (21) (v. fig. 8-1):
– El trayecto de accionamiento no debe ser supe-
rior a 300 mm.
– La fuerza de accionamiento no debe ser supe-
1 2 rior a 125 mm.
Si no se mantienen estos valores, corrija el ajuste
del sistema de cordón de desgarre (véase la docu-
mentación perteneciente al sistema de cordón de
desgarre).
9. Vuelva a colocar el interruptor de seguridad por trac-
ción de cable a la posición básica. Para ello mueva
la palanca de retroceso (2) de la posición de conmu-
tación "0" a la posición de conmutación "1".
9 Errores y averías
12
X1 X2
12 14 1
Lado cable Bowden
Número de
Pos. Texto para el pedido
pedido
Piezas de repuesto
4 Cubierta para aparato sin lám- 93.067319.001
para de señalización (incl. junta y
tornillos)
10 11 Cubierta para aparato con lám- 93.067319.002
para de señalización (incl. junta y
Fig. 10-1: Pedido de piezas de recambio tornillos)
Número de
Pos. Texto para el pedido
pedido
11 Racor atornillado para cables M 113.52.02.20.01
25 x 1,5, grosor Ø 11 mm hasta Ø
16 mm
10 Acometida de línea M25 x 1,5 113.52.87.20.02
12 Lámpara de señalización (sin fig.)
LED, AC/DC 230 V / 1,3 W 338.04.01.02.01
LED, AC/DC 24V hasta 28 V / 338.04.01.02.02
0,8 W
Accesorio
– Sistema de cordón de desgarre bajo petición
Instrucciones para el servicio (Original) El aparato cumple los requisitos de las directivas euro-
N.º de documento: 94.065258.161 peas y nacionales vigentes.
La conformidad ha sido comprobada, los certificados y
Interruptor de marcha oblicua, tipo SLS documentación correspondientes han sido entregados al
Número de aparato: Varios fabricante.
Índice de contenidos
1 Para su seguridad personal............................................................................................. 5
1.1 Uso adecuado.............................................................................................................................................. 5
1.2 Concepción de las indicaciones de advertencia.......................................................................................... 6
3 Descripción .................................................................................................................... 10
5 Montaje y desmontaje.................................................................................................... 16
5.1 Volumen de suministro .............................................................................................................................. 16
5.2 Montaje ...................................................................................................................................................... 17
5.2.1 Montaje mecánico...................................................................................................................................... 17
5.2.2 Conexión eléctrica ..................................................................................................................................... 19
6 Mantenimiento................................................................................................................ 27
6.1 Vista general de mantenimiento................................................................................................................. 27
6.2 Herramientas necesarias ........................................................................................................................... 27
6.3 Control visual ............................................................................................................................................. 28
6.4 Limpieza exterior del aparato..................................................................................................................... 29
6.4.1 Eliminación de la suciedad del exterior...................................................................................................... 29
6.4.2 Eliminación de hielo del exterior ................................................................................................................ 30
6.5 Prueba de funcionamiento ......................................................................................................................... 31
7 Reparación ..................................................................................................................... 33
7.1 Sustitución de la palanca de rodillo............................................................................................................ 33
! ¡Advertencia!
Pictogramas
Para aclarar las fuentes de peligro se utilizan los
siguientes pictogramas. Los pictogramas pueden
aparecer en todos los niveles de peligro.
2.3 Eliminación
! ¡Envejecimiento de materiales! Además de componentes mecánicos, este aparato
también puede contener componentes electrónicos. Se
Un almacenamiento prolongado puede provocar el
permite la separación de los componentes del aparato,
envejecimiento de algunos materiales de forma que
así como de los materiales empleados, mediante el
resulten dañadas sus propiedades (p. ej. las juntas y
despiece del aparato.
plásticos pueden volverse quebradizos). Las
propiedades de los lubricantes pueden alterarse debido La eliminación de nuestros productos debe realizarse
a un almacenamiento prolongado. según las prescripciones locales, nacionales e
internacionales vigentes que correspondan.
Controle si el aparato presenta daños antes de su
utilización o su montaje. No monte un aparato si
presenta daños visibles de envejecimiento.
3 Descripción
Los interruptores de marcha oblicua se utilizan en
instalaciones de cinta transportadora en condiciones
especialmente desfavorables para la supervisión de
marcha oblicua en transportadores continuos.(véase el Palanca de rodillo
párrafo 1.1: "Uso adecuado", página 5). Los (3)
1 0 1
interruptores de marcha oblicua tienen la finalidad de
proteger las correas frente a daños o roturas en caso de
una marcha oblicua. Mediante su utilización, se permiten 2 2
desconectar con antelación aquellas instalaciones
alimentadoras para evitar la sobrecarga de materiales o
la aparición de averías de funcionamiento.
La palanca de rodillo (3) del interruptor de marcha
oblicua de acero fino tiene cojinetes de bolas, para poder
3
soportar mejor las fuerzas transversales y los golpes. El
gran diámetro de los rodillos (48 mm) permite la
utilización en caso de velocidades altas de la cinta.
Las palancas de rodillo (3) del interruptor de marcha
oblicua pueden inclinarse en ambas direcciones (v.
fig. 3-1). Al inclinarse la palanca de rodillo (3), se giran 0: Posición inicial
1: Punto de conmutación en caso de desviación de 5° a 15°
los discos de levas (11) (v. fig. 3-2). Los discos de levas
2: Punto de conmutación en caso de desviación de 15° a 35°
(11) accionan el interruptor (7). Los discos de levas (11) 3: Desviación máxima en 75°
son ajustables y permiten adaptar los puntos de
conmutación a las condiciones del emplazamiento.
Fig. 3-1: Interruptor de marcha oblicua – Puntos de
conmutación (ajustables)
El interruptor de marcha oblicua p. ej. puede ajustarse de Los interruptores de marcha oblicua se utilizan por
forma que, al alcanzar el primer punto de conmutación, parejas en la correa superior delante del tambor de
se dispare una preadvertencia (gama de ajuste: de 5° accionamiento, en la correa inferior delante del tambor
hasta 15°) y al alcanzar el segundo punto de de inversión y, adicionalmente, en aquellas zonas con
conmutación, se desconecte la instalación de cinta mayor distancia entre ejes o de entrega de materiales (v.
transportadora (gama de ajuste: al arrancar una leva de fig. 3-3).
15° hasta 35°). El tope mecánico de la palanca de rodillo
(3) se alcanza al producirse una desviación de 75°.
4 Datos técnicos
4.1 Datos técnicos generales
Normas cumplidas EN 60947-5-1
VDE 0110 – Grado de suciedad 2 (interior), 4 (exterior)
Apto para Dispositivos de control e instalaciones según EN 60204
Carcasa Moldeo por compuesto a granel (Bulk Moulding Compound (BMC))
Fijación Cuatro agujeros oblongos para tornillos M 8
Temperatura ambiente permitida - 25 °C … + 70 °C, véase también Párrafo 4.3, página 14
Temperatura admisible de - 25 °C … + 70 °C, véase también Párrafo 4.3, página 14
almacenaje
altura máx. por encima de NN 2.000 m (consulte con el fabricante en caso de una instalación en niveles superiores)
Tipo de protección IP 65, según la EN 60529
Sistema de conmutación Interruptor de resorte, máx. 4 inversores de contacto normalmente cerrado, véase
también Párrafo 4.3, página 14
Tipo de accionamiento Rodillo cilíndrico de acero vanadio, Ø 48 mm
Puntos de conmutación Ajustable: 5° hasta 15° y 15° hasta 35°
Preajuste: 2 x 10°
Desviación de la palanca de rodillo máx. 75°
Tensión de aislamiento nominal Ui Ui = 250 V
Corriente térmica convencional Ith 6A
Capacidad de rotura CA-15: Ue = CA 230 V, Ie = 1,5 A
CC 24 V, t = 2 ms hasta 3 ms, hasta 3 A
Nº de artículo del
aparato: Número base
y número de variante
4.4 Dimensiones
290
125,5
10 138,1
90
187
160
177
48, 6
9
54
113,8
5 Montaje y desmontaje
5.1 Volumen de suministro
! ¡Atención!
Los interruptores de marcha oblicua se suministran listos
para el funcionamiento. No están incluidos en el volumen
El aparato sólo puede ponerse en funcionamiento si
de suministro los tornillos para la fijación mecánica.
todos los orificios han sido cerrados con el racor
El volumen de suministro incluye un racor atornillado atornillado para cables (6) y el tapón roscado (25).
para cables (6) y dos tapones roscados (25) montados ¡Utilice únicamente el racor atornillado para cables (6)
(v. fig. 5-1). y los tapones roscados (25) suministrados, ya que de lo
contrario no se garantizará la estanqueidad del
aparato!
Los trabajos en el aparato sólo pueden ser realizados Monte el interruptor de marcha oblicua de manera que,
por un electricista. en caso de un desplazamiento, el borde de la correa
accione la palanca de rodillo (3) en la mitad inferior del
Desconecte la tensión de la instalación antes de iniciar
rodillo. De este modo se evita que la correa resbale
los trabajos. Asegure la instalación contra una
sobre la palanca de rodillo (3) (v. fig. 5-2).
conexión involuntaria. Cubra las piezas conductoras de
tensión que estén próximas de forma que sean Los interruptores de marcha oblicua se utilizan por
resistentes al contacto. parejas en la correa superior delante del tambor de
accionamiento, en la correa inferior delante del tambor
! ¡Advertencia! Distancia entre el borde de la correa y la palanca
de rodillo (3): 10 … 20 mm
Los aparatos sólo deben utilizarse en circuitos de
mando. Palanca de rodillo (3)
*
! ¡Atención! Correa superior o inferior de la
cinta transportadora
El aparato sólo puede ponerse en funcionamiento si
todos los orificios han sido cerrados con el racor
atornillado para cables (6) y el tapón roscado (25).
¡Utilice únicamente el racor atornillado para cables (6)
y los tapones roscados (25) suministrados, ya que de lo
* El borde de la correa debe accionar la palanca de rodillo (3)
contrario no se garantizará la estanqueidad del en la mitad inferior del rodillo.
aparato! Fig. 5-2: Montaje del interruptor de marcha oblicua por pares
en la cinta transportadora
Instrucciones para el servicio SLS
18 5 Montaje y desmontaje
de inversión y, adicionalmente, en aquellas zonas con interruptor de marcha oblicua con cuatro tornillos a
mayor distancia entre ejes o de entrega de materiales (v. través de los agujeros oblongos (10) (v. fig. 5-3).
fig. 5-2). A fin de evitar un rápido desgaste de la palanca de rodillo
1. Desconecte la tensión de la instalación antes de (3), debe montar la palanca de rodillo (3) de forma que
iniciar los trabajos. Asegure la instalación contra queden de 10 a 20 mm antes del borde de la correa
una conexión involuntaria. Cubra las piezas (véase la figura 5-2 y 5-4).
conductoras de tensión que estén próximas de 3. Acople la palanca de rodillo (3) en el árbol (14).
forma que sean resistentes al contacto.
2. Fije los interruptores de marcha oblicua en la
estructura de la cinta transportadora (véase el
párrafo 4.4: "Dimensiones", página 15). Fije el
Al inclinarse, la palanca de
rodillo (3) no debe golpear
en la cubierta (2).
Agujero
oblongo (10)
Árbol (14)
Agujero
oblongo
(10)
Tuerca (9)
Fig. 5-3: Montaje del interruptor de marcha oblicua en la Fig. 5-4: Montaje de la palanca de rodillo en el interruptor de
cinta transportadora marcha oblicua
SLS Instrucciones para el servicio
5 Montaje y desmontaje 19
! ¡Peligro!
1. Desconecte la tensión de la instalación antes de interruptor de marcha oblicua a las conexiones del
iniciar los trabajos. Asegure la instalación contra interruptor (7) (v. fig. 5-7).
una conexión involuntaria. Cubra las piezas Los interruptores de marcha oblicua están preajustados
conductoras de tensión que estén próximas de de fábrica al punto de conmutación de 10° en ambas
forma que sean resistentes al contacto. direcciones de accionamiento. Usted puede ajustar lo
2. Para abrir la cubierta (2) del interruptor de marcha puntos de conmutación del interruptor de marcha oblicua
oblicua, suelte los cuatro tornillos (5). según sus preferencias.
3. Suelte la tuerca del racor atornillado para cables (6) 5. Ajuste el punto de conmutación de la palanca de
y pase el cable de conexión (Ø 9 mm hasta Ø 17 rodillo (3) en el disco de levas (11), si desea otro
mm) (v. fig. 5-6). punto de conmutación (véase el párrafo 5.2.3:
"Ajuste de los puntos de conmutación", página 22).
4. Conecte el cable de conexión de acuerdo con el
esquema de conexiones en la cubierta (2) el
Carcasa (1)
6. Apriete la tuerca del racor atornillado para cables 9. Fije la cubierta (2) con los tornillos (5).
(6) con un par de apriete de 1,5 Nm. Apriete los tornillos (5) uniformemente con un par
de apriete de 1,5 Nm.
! ¡Atención! 10. Ponga en funcionamiento el interruptor de marcha
oblicua (véase el párrafo 5.2.4: "Puesta en servicio",
¡No utilice un aparato con la guarnición (22) dañada! página 24).
Retire cualquier el polvo que haya podido penetrar en
la carcasa (1).
7. Compruebe la guarnición (22) de la cubierta (2)
frente a posibles daños.
8. Cierre la cubierta (2) del interruptor de marcha
oblicua.
Cubierta (2)
5.2.3 Ajuste de los puntos de conmutación "Desconectar" del interruptor de macha oblicua según
Los interruptores de marcha oblicua están preajustados sus preferencias.
de fábrica al punto de conmutación de 10° en ambas
direcciones de accionamiento. Usted puede ajustar lo ¡Peligro de muerte por electrocución!
puntos de conmutación "Preadvertencia" y
Los trabajos en el aparato sólo pueden ser realizados
Palanca de rodillo por un electricista.
(3) Desconecte la tensión de la instalación antes de iniciar
1 0 1
los trabajos. Asegure la instalación contra una
conexión involuntaria. Cubra las piezas conductoras de
2 2 tensión que estén próximas de forma que sean
resistentes al contacto.
1. Desconecte la tensión de la instalación antes de
iniciar los trabajos. Asegure la instalación contra
una conexión involuntaria. Cubra las piezas
3
3
conductoras de tensión que estén próximas de
forma que sean resistentes al contacto.
2. Para abrir la cubierta (2) del interruptor de marcha
oblicua, suelte los cuatro tornillos (5) (v. fig. 5-8).
¡Nota!
0: Posición inicial
En ambos discos de levas (11) encontrará dos
1: Punto de conmutación en caso de desviación de 5° a 15°
2: Punto de conmutación en caso de desviación de 15° a 35°
tornillos (15) (véase la figura 5-10, página 23).
3: Desviación máxima en 75° Con uno de los tornillos (15), se fija el disco de
levas (11) en su ajuste básico. Con el segundo
tornillo (15), se atornilla el disco de levas (11).
Fig. 5-9: Ajuste de los puntos de conmutación
Para ajustar el disco de levas (11) el primer b. Afloje el tornillo (15) en el disco de levas (11)
tornillo (15) se afloja sólo hasta el punto en que sólo hasta el punto en que el disco de levas (11)
el disco de levas (11) pueda girarse. Por lo pueda girarse.
tanto, el tornillo (15) puede permanecer en el c. Ajuste el punto de conmutación 2 (desconectar),
aparato. Tras el ajuste, el disco de levas (11) se girando el disco de levas (11).
fija con el segundo tornillo (15). d. Apriete el segundo tornillo (15) de forma que el
De esta forma, especialmente en el caso de disco de levas (11) quede fijado en la nueva
pequeñas modificaciones en el ajuste, se evita posición ajustada.
que el disco de levas (11), al apretar el tornillo 5. Compruebe los puntos de conmutación ajustados
(15) vuelva a girarse a su posición original. (véase la figura 5-9, página 22)
3. Ajuste el punto de conmutación 1 (preadvertencia)
(véase la figura 5-9 y 5-10).
Gama de ajuste: 5° hasta 15°
Palanca de rodillo (3)
a. Afloje el tornillo (15) en el disco de levas (11)
sólo hasta el punto en que el disco de levas (11)
Disco de levas (11)
pueda girarse.
b. Ajuste el punto de conmutación 1
(preadvertencia), girando el disco de levas (11).
c. Apriete el segundo tornillo (15) de forma que el
disco de levas (11) quede fijado en la nueva
posición ajustada.
4. Ajuste el punto de conmutación 2 (desconectar). Tornillos (15)
Gama de ajuste: 15° hasta 35°
a. Saque del disco de levas (11) la leva (12), para
conseguir una gama de ajuste más amplia.
Fig. 5-10: Ajuste de los puntos de conmutación – Aflojar los
tornillos en el disco de levas
Instrucciones para el servicio SLS
24 5 Montaje y desmontaje
Interruptor (7) Leva (12) Tapones Racor atornillado para cables (6)
Cubierta (2) roscados (25)
Tornillos (5)
Guarnición
(22)
–
Compruebe que los tornillos (5) de la cubierta 5.3 Desmontaje
(2) se han apretado con un par de apriete de
1,5 Nm. ¡Peligro de muerte por electrocución!
– Compruebe que se ha apretado correctamente
el racor atornillado para cables (6). Los trabajos en el aparato sólo pueden ser realizados
– Compruebe que se ha apretado correctamente por un electricista.
el tapón roscado (25). Desconecte la tensión de la instalación antes de iniciar
2. Compruebe el interruptor de marcha oblicua en los trabajos. Asegure la instalación contra una
conjunto y sus componentes frente a posibles conexión involuntaria. Cubra las piezas conductoras de
daños. tensión que estén próximas de forma que sean
resistentes al contacto.
! ¡Peligro!
Carcasa (1)
! ¡Peligro! ! ¡Atención!
¡Sólo abra el interruptor de marcha oblicua cuando esté Las juntas de los racores atornillados para cables y
libre de tensión eléctrica! tapones roscados envejecen con el paso del tiempo,
impidiendo que se asegure la estanqueidad de los
1. Desconecte la tensión de la instalación antes de aparatos después de abrir los racores atornillados para
iniciar los trabajos. Asegure la instalación contra cables o tapones roscados.
una conexión involuntaria. Cubra las piezas
Después de abrir los racores atornillados para cables y
conductoras de tensión que estén próximas de
tapones roscados, sustitúyalos por otros nuevos.
forma que sean resistentes al contacto.
2. Abra la cubierta (2) aflojando los cuatro tornillos (5)
(véase la figura 5-12, página 24).
3. Suelte el racor atornillado para cables (6) (v. fig. 5-
13).
4. Suelte todas las conexiones eléctricas y tire del
cable por el racor atornillado para cables (6).
5. Suelte los cuatro tornillos con los que se fija el
interruptor de marcha oblicua por los agujeros
oblongos (10) a la instalación de cinta
transportadora (véase la figura 5-3, página 18) y
retire el interruptor de marcha oblicua.
6 Mantenimiento
6.1 Vista general de mantenimiento 6.2 Herramientas necesarias
Intervalo Componente Medida Para realizar los trabajo en o con el interruptor de
marcha oblicua deberá contar con los medios y
mensualment Interruptor de Control visual (véase el
herramientas habituales de un taller. Pero, necesitará al
ea marcha oblicua párrafo 6.3, página 28)
menos las siguientes herramientas:
Limpieza exterior del
Juego de destornilladores (de ranura / de cruz)
aparato (véase el
párrafo 6.4, página 29) Llave de boca para atornilladura M25
Anualmente Interruptor de Prueba de Llave dinamométrica adecuada
marcha oblicua funcionamiento (véase
el párrafo 6.5, página
31)
Palanca de rodillo (3)
cada 20 años Interruptor de Cambiar el interruptor
marcha oblicua de marcha oblicua
(véase el capítulo 5: Racor atornillado para
cables (6) Tapones roscados (25)
"Montaje y
desmontaje", página
16)
a. Dependiendo de las condiciones de funcionamiento o las
condiciones del entorno (p.ej. acumulación intensa de
suciedad, efectos de la climatología) puede ser necesario
reducir los intervalos para el mantenimiento.
En caso de que no se haya fijado correctamente el 6.4 Limpieza exterior del aparato
interruptor de marcha oblicua, proceda del siguiente
modo: 6.4.1 Eliminación de la suciedad del exterior
a. Fije el interruptor de marcha oblicua a la
subestructura (véase el párrafo 5.2.1: "Montaje ¡Peligro de muerte por electrocución!
mecánico", página 17).
Los trabajos en el aparato sólo pueden ser realizados
b. Lleve a cabo una prueba de funcionamiento
por un electricista.
(véase el párrafo 6.5: "Prueba de
funcionamiento", página 31). Desconecte la tensión de la instalación antes de iniciar
los trabajos. Asegure la instalación contra una
5. Compruebe si los siguientes componentes se
apretaron al par de apriete especificado: conexión involuntaria. Cubra las piezas conductoras de
tensión que estén próximas de forma que sean
Componente Par de apriete resistentes al contacto.
Tornillo (5) 4 Nm
La limpieza del exterior del interruptor de marcha oblicua
tapones roscados (25) 5 Nm se realiza en los siguientes pasos:
Racor atornillado para 5 Nm 1. Desconecte la tensión de la instalación antes de
cables (6) iniciar los trabajos. Asegure la instalación contra
Tuerca del racor 6,7 Nm una conexión involuntaria. Cubra las piezas
atornillado para cables (6) conductoras de tensión que estén próximas de
forma que sean resistentes al contacto.
2. Elimine las acumulaciones de suciedad (p. ej. polvo,
hollín, arena), que pudieran bloquear el mecanismo
de la palanca de rodillo (3). Tenga en cuenta lo
siguiente para la limpieza:
– Limpie el interruptor de marcha oblicua
manualmente con un cepillo de mano o un
trapo.
Instrucciones para el servicio SLS
30 6 Mantenimiento
–No utilice productos limpiadores con 2. Retire el hielo que pueda bloquear el mecanismo del
disolventes. interruptor de rodillo (3), accionando para ello varias
– No utilice cuchillas o herramientas punzantes. veces la palanca de rodillo (3).
3. Lleve a cabo una prueba de funcionamiento (véase No emplee productos limpiadores con disolventes ni
el párrafo 6.5: "Prueba de funcionamiento", página cuchillas o herramientas punzantes.
31). 3. Lleve a cabo una prueba de funcionamiento (véase
el párrafo 6.5: "Prueba de funcionamiento", página
6.4.2 Eliminación de hielo del exterior 31).
7 Reparación
7.1 Sustitución de la palanca de rodillo A fin de evitar un rápido desgaste de la palanca de rodillo
(3) nueva, debe montar la palanca de rodillo (3) de forma
que queden de 10 a 20 mm antes del borde de la correa
¡Peligro de muerte por electrocución!
(véase la figura 5-2, página 17).
Los trabajos en el aparato sólo pueden ser realizados 3. Acople la nueva palanca de rodillo (3) en el árbol
por un electricista. (14).
Desconecte la tensión de la instalación antes de iniciar
los trabajos. Asegure la instalación contra una ! ¡Atención!
conexión involuntaria. Cubra las piezas conductoras de
tensión que estén próximas de forma que sean Al apretar la tuerca (9) tener en cuenta que, al girar la
resistentes al contacto. palanca de rodillo (3) la distancia hasta la cubierta (2)
debe ser suficientemente grande como para que la
1. Desconecte la tensión de la instalación antes de palanca de rodillo (3) no golpee en la cubierta (2).
iniciar los trabajos. Asegure la instalación contra
una conexión involuntaria. Cubra las piezas
conductoras de tensión que estén próximas de
forma que sean resistentes al contacto.
2. Afloje la tuerca (9) con una llave de boca
(entrecaras 16) y extraiga la palanca de rodillo (3)
del árbol (14) (v. fig. 7-1).
Al inclinarse, la palanca de
rodillo (3) no debe golpear
en la cubierta (2).
Árbol (14)
Tuerca (9)
Palanca de
rodillo (3)
Identificación de tipo
Número de
Pos. Texto para el pedido
pedido
3 Palanca de mando con rodillo 93.055201.101
(palanca de rodillo)
6 racor atornillado para cables 113.51.00.20.10
25 Tapón roscado (tapón obturador) 113.43.87.20.01
OPERATING INSTRUCTIONS
Imprint CE mark and conformity
Operating Instructions (Translation of original dated The device meets the requirements of applicable Europe-
09.02.2010, Index 0) an and national regulations.
Document No.: 94.065258.191 Conformity has been demonstrated. The manufacturer
keeps the applicable declarations and materials on file.
Misalignment Switch, Type SLS
Device item number: Various
Protective note (as per DIN ISO 16016:2002-5)
Release date: Feb. 10, 2010
Change status: Index 0 The reproduction, distribution and utilization of this docu-
ment as well as the communication of its contents to oth-
ers without explicid authorization is prohibited. Offenders
will be held liable for the payment of damages. All rights
reserved in the event of the grant of a patent, utility model
or design.
Table of contents 3
Table of contents
1 For your own safety ..........................................................................................................5
1.1 Intended use .................................................................................................................................................5
1.2 Layout of warning messages ........................................................................................................................5
3 Description........................................................................................................................9
6 Maintenance................................................................................................................... 27
7 Repairs ........................................................................................................................... 28
7.1 Replacing roller levers................................................................................................................................ 28
Icons
! Warning! The following icons are used to more clearly define the
sources of danger. The icons can appear in reference to
indicates a possibly dangerous situation. Not avoiding any level of danger.
this dangerous situation could result in death or
extremely serious injury (crippling). Icon Type of danger
Dangers of all types, except those that are
! Caution! labeled with the following icon
indicates a possibly dangerous situation. Failure to Injuries caused by dangerous voltages and
avoid this dangerous situation can result in light or currents.
minor injuries.
Damage caused by electrostatic dis-
charges (ESD protection)
! Beware!
indicates a possibly harmful situation. If this harmful Tab. 1-1: Icons for general sources of danger
situation is not avoided, the product or something in its
vicinity could be damaged.
Note!
“Note” indicates advice on use and other espe-
cially helpful information.
2.3 Disposal
Disposal of our products must be performed in accor-
dance with the relevant applicable local, national, and in-
ternational requirements.
If the product contains consumable operating materials
such as oils, greases, and coolants in the form of liquids,
pastes, and gas, etc., suitable measures must be taken to
collect and dispose of these materials according to appli-
cable local, national, and international requirements. Pen-
etration of these consumable operating materials into the
ground, sewer system, and water sources as well as liber-
ation into the atmosphere must always be prevented.
3 Description
Misalignment switches are used in conveyor systems un-
der especially harsh conditions to monitor conveyor belts
with continuous conveyors for misalignment (see
section 1.1: „Intended use", page 5). Misalignment
Roller lever (3)
switches are used to protect belts from damage or de-
1 0 1
struction if the belt is misaligned. Conveying systems can
be turned off in time to prevent overflowing material or
malfunctions. 2 2
The roller lever (3) of the misalignment switch has a ball
bearing made of stainless steel to deal better with shear
forces and impacts. The larger roller diameter of 48 mm
allows for use at high belt speeds.
The roller levers (3) of misalignment switches can be de-
3
flected in both directions (see Fig. 3-1). The deflection of
the roller lever (3) turns the cam disk (11) (see Fig. 3-2).
The cam disk (11) activates the switches (7). The cam
disk (11) is adjustable, which makes it possible to adjust
the switching points to specific local details.
0: Basic setting
1: Switching point for deflection from 5° to 15°
2: Switching point for deflection from 15° to 35°
3: Maximum deflection at 75°
The misalignment switch can be adjusted so that a pre- Misalignment switches are mounted in pairs on the upper
warning is generated when the first switching point is belt before the drive drum on the lower belt, before the
reached (adjustment range: 5° to 15°) and the conveyor deflection drum, and also at critical points with greater
system is turned off when the second switching point is axial distances or at material transfer points (see Fig. 3-
reached (adjustment range by breaking out a cam 15° to 3).
35°). The mechanical stop of the roller lever (3) is
reached at a deflection of 75°.
* Belt edge must activate the roller lever (3) in the lower half of
the roller.
Fig. 3-2: Misalignment switch – shown without roller lever Fig. 3-3: Misalignment switches installed in pairs on the con-
veyor belt
SLS Operating Instructions
4 Technical data 11
4 Technical data
4.1 General technical data
Requirements fulfilled EN 60947-5-1
VDE 0110 – Contamination level 2 (inside), 4 (outside)
Suitable for Control units and systems in accordance with EN 60204
Housing Bulk Molding Compound (BMC)
Fastening Four oblong holes for M 8 screws
Permissible ambient temperature - 25 °C … + 70 °C, see also Section 4.3, page 13
Permissible storage temperature - 25 °C … + 70 °C, see also Section 4.3, page 13
Max. alt. above sea level 2000 m (for installation at higher altitudes, consult the manufacturer)
Protection type IP 65 as per EN 60529
Switching system Quick break switch, max. 4 positive break changers, see also Section 4.3, page 13
Drive type Cylindrical roller made of VA steel, Ø 48 mm
Switching points Adjustable: 5° to 15° and 15° to 35°
Default setting: 2 x 10°
Deflection of the roller lever Max. 75°
Rated insulation voltage Ui Ui = 250 V
Conventional thermal current Ith 6A
Switching capacity AC-15: Ue = AC 230 V, Ie = 1.5 A
DC 24 V, t = 2 ms to 3 ms, to 3 A
4.4 Dimensions
290
125.5
10 138.1
90
187
160
177
48, 6
9
54
113.8
Work on the device may be performed only by a quali- Install the misalignment switch so that when the belt is
fied electrical technician. misaligned the edge of the belt activates the roller lever
(3) in the lower half of the roller. This will prevent the
Prior to working, switch off the power supply to the sys-
belt from slipping over the roller lever (3) (see Fig. 5-2).
tem. Ensure that the system cannot be accidentally
switched on. Mask any neighboring components that Misalignment switches are mounted in pairs on the upper
may be live to prevent contact. belt before the drive drum on the lower belt, before the
deflection drum, and also at critical points with greater
! Beware! Distance between belt edge and
roller lever (3): 10 … 20 mm
The belt misalignment switches are to be used in
control circuits only. Roller lever (3)
*
! Caution! Upper or lower belt
of the conveyor
The device must only be operated if all openings are
sealed with the enclosed cable screw joint (6) and dum-
my plug (25)! Use only the cable screw joint (6) and
dummy plug (25) included with delivery. Otherwise the
seal of the device cannot be ensured! * Belt edge must activate the roller lever (3) in the lower half of
the roller.
Fig. 5-2: Installing the misalignment switches in pairs on the
conveyor belt
axial distances or at material transfer points (see Fig. 5- 2).
SLS Operating Instructions
5 Mounting and dismounting 17
1. Prior to working, switch off the power supply to the To prevent rapid wearing of the roller lever (3), you
system. Ensure that the conveyor system cannot be should install the roller lever (3) so that it is positioned
accidentally switched on. Mask any neighboring about 10 to 20 mm before the belt edge (see Figure 5-2
components that may be live to prevent contact. and 5-4).
2. Fasten the misalignment switch onto the conveyor 3. Attach the roller lever (3) to the shaft (14).
belt structure (see section 4.4: „Dimensions", page
14). Fasten the misalignment switches through the
oblong holes (10) with four screws (see Fig. 5-3).
Oblong hole
Shaft (14)
! Danger!
Shaft (14) If gaskets are damaged, dirt and water can penetrate
into the device and damage the device and its compo-
nents.
Nut (9) Check gaskets for damage before assembling. If the
gasket is damaged, exchange the device cover.
Fig. 5-5: Install the roller lever on the misalignment switch
1. Prior to working, switch off the power supply to the switches (7) as shown in the connection diagram
system. Ensure that the conveyor system cannot be (see Fig. 5-7).
accidentally switched on. Mask any neighboring Misalignment switches are pre-set to switching points of
components that may be live to prevent contact. 10° in both directions of activation. You can adjust the
2. Open the hood (2) of the misalignment switch. To do switching points of misalignment switches according to
this, loosen the four screws (5). your requirements.
3. Loosen the nut of the cable screw joint (6) and guide 5. Adjust the switching point of the roller lever (3) on
the connection cable (Ø 9 mm to Ø 17 mm) through the cam disk (11) if you want to have different
(see Fig. 5-6). switching points (see section 5.2.3: „Adjusting the
4. Connect the connection cable lines in the hood (2) of switching points", page 21).
the misalignment switch to the connections on the
Seal (22)
Housing (1)
6. Tighten the cable screw joint (6) to a tightening Tighten the screws (5) evenly to a tightening
torque of 1.5 Nm. torque of 1.5 Nm.
10. Place the misalignment switch in operation (see
! Caution! section 5.2.4: „Commissioning", page 23).
Hood (2)
3
Note!
In each of the two cam disks (11) are two
screws (15) (see Figure 5-10, page 22). One of
the screws (15) secures the cam disk (11) in its
basic setting. The other screw (15) is screwed
0: Basic setting
1: Switching point for deflection from 5° to 15° into the cam disk (11).
2: Switching point for deflection from 15° to 35° To adjust the cam disk (11) loosen the first
3: Maximum deflection at 75° screw (15) just far enough so that the cam disk
(11) can be turned. Then the screw (15) can re-
main in the device. After the setting is made,
Fig. 5-9: Adjusting the switching points
fasten the cam disk (11) in place with the sec- d. Tighten the second screw (15) so that the cam
ond screw (15). disk (11) is fastened in place in the new selected
Especially when small changes are being made position.
to the setting, this prevents the cam disk (11) 5. Check the switching points that have been set (see
from being turned back to its original position Figure 5-9, page 21).
when the screw (15) is tightened.
3. Adjust switching point 1 (pre-warning) (see Figure 5- ! Caution!
9 and 5-10).
Devices with a damaged seal (22) must not be used! If
Adjustment range: 5° to 15°
necessary, remove any dust that has penetrated into
a. Loosen the screw (15) in the cam disk (11) until the housing (1).
you can turn the cam disk (11).
b. Adjust switching point 1 (pre-warning) by turning
the cam disk (11). Roller lever (3)
c. Tighten the second screw (15) so that the cam
disk (11) is fastened in place in the new selected Cam disk (11)
position.
4. Adjust switching point 2 (shutoff).
Adjustment range: 15° to 35°
a. Break the cam (12) out of the cam disk (11) to
increase the size of the adjustment range.
b. Loosen the screw (15) in the cam disk (11) until
Screws (15)
you can turn the cam disk (11).
c. Adjust switching point 2 (shutoff) by turning the
cam disk (11).
Fig. 5-10: Adjusting the switching points – loosening screws in
the cam disks
SLS Operating Instructions
5 Mounting and dismounting 23
6. Check the seal (22) on the hood (2) for damage. 5.2.4 Commissioning
7. Close the hood (2) of the misalignment switch. 1. Before commissioning of the misalignment switch,
8. Fasten the hood (2) with the screws (5) (see make certain the seal is secure (see Fig. 5-12):
Figure 5-12, page 23). – Check to make certain that the screws (5) of the
Tighten the screws (5) evenly to a tightening hood (2) are tightened to a tightening torque of
torque of 1.5 Nm. 1.5 Nm.
9. Place the misalignment switch in operation (see – Check to make certain the cable screw joint (6)
section 5.2.4: „Commissioning", page 23). is tightened.
– Check to make certain the dummy plug (25) is
securely tightened.
Seal (22)
! Danger!
5.3 Dismounting
! Danger!
Danger of fatal electric shock
Open the misalignment switch only if the misalignment
Work on the device may be performed only by a quali- switch is deenergized!
fied electrical technician. 1. Prior to working, switch off the power supply to the
Prior to working, switch off the power supply to the sys- system. Ensure that the conveyor system cannot be
tem. Ensure that the system cannot be accidentally accidentally switched on. Mask any neighboring
switched on. Mask any neighboring components that components that may be live to prevent contact.
may be live to prevent contact. 2. Open the hood (2). To do this, loosen the four
screws (5) (see Figure 5-12, page 23).
3. Loosen the cable screw joint (6) (see Fig. 5-13).
Switch (7) Cam disk (11) 4. Loosen all electrical connections and pull the cables
Hood (2) out of the cable screw joint (6).
5. Loosen the four screws which are used to fasten the
misalignment switch onto the conveyor belt system
through the oblong holes (10) (see Figure 5-3, page
17) and remove the misalignment switch.
Housing (1)
! Caution!
6 Maintenance
Check the misalignment switches at regular intervals
(about every three months) to make certain they are in
good condition and are functioning with no problems.
! Danger!
Seal (22)
Housing (1)
7 Repairs
7.1 Replacing roller levers
! Caution!
Danger of fatal electric shock
Make certain when tightening the nut (9) that when the
Work on the device may be performed only by a quali- roller lever (3) is deflected, the distance from the hood
fied electrical technician. (2) is great enough so that the roller lever (3) cannot
strike the hood (2).
Prior to working, switch off the power supply to the sys-
tem. Ensure that the system cannot be accidentally 4. Turn the roller lever (3) to the desired position and
switched on. Mask any neighboring components that tighten the self-locking nut (9) with a fork wrench
may be live to prevent contact. size 16 to a tightening torque of 32 Nm.