Biotecnología de Proteínas

Nombre: Crhistian Mark Montenegro Valderrama

Código:0201523035
Ciclo: IX
Determinación de función de
proteínas
Proteína: 3,7-dimethylxanthine N-methyltransferase
Gen: DXMT1
Organismo: Coffea arabica (Arabian coffee)
 MetaCyc
https://biocyc.org/META/NEW-IMAGE?type=PATHWAY&object=PWY-
5037&detail-level=3
Biosíntesis de Cafeína I
 UNIPROT
https://www.uniprot.org/uniprot/Q8H0D2
UniProtKB - Q8H0D2
(DXMT1_COFAR)
 Actividad catalítica:
S-adenosyl-L-methionine + theobromine = caffeine + H+ + S-adenosyl-L-homocysteine1 Publication
Secuencia FASTA
>sp|Q8H0D2|DXMT1_COFAR 3,7-dimethylxanthine N-
methyltransferase OS=Coffea arabica OX=13443 GN=DXMT1 PE=1 SV=1
MELQEVLHMNGGEGDTSYAKNSFYNLFLIRVKPILEQCIQELLRANLPNINKCIKV
ADLGCASGPNTLLTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLFQNDFNSVFKS
LPSFYRKLEKENGCKIGSCLIGAMPGSFYGRLFPEESMHFLHSCYCLHWLSQVPS
GLVTELGISANKGCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLT
WICKEDEFENPNSIDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKCIVEEE
GSFEILYLETFKVPYDAGFSIDDDYQGRSHSPVSCDEHARAAHVASVVRSIFEPIV
ASHFGEAILPDLSHRIAKNAAKVLRSGKGFYDSVIISLAKKPEKADM
Determinación de parámetros
bioquímicos en Expasy
https://web.expasy.org/protparam/
Resultados en ProtParam
• Número de aminoácidos: 384
• Peso molecular: 43248.43
• Punto Isoeléctrico teórico: 5.33
 Ala (A) 21 5.5% Phe (F) 21 5.5% Asp + Glu : 54
Arg (R) 15 3.9% Pro (P) 18 4.7% Arg + Lys: 40
Asn (N) 18 4.7% Ser (S) 35 9.1%
Asp (D) 20 5.2% Thr (T) 11 2.9%
Cys (C) 11 2.9% Trp (W) 2 0.5%
Gln (Q) 11 2.9% Tyr (Y) 12 3.1%
Glu (E) 34 8.9% Val (V) 21 5.5%
Gly (G) 22 5.7% Pyl (O) 0 0.0%
His (H) 11 2.9% Sec (U) 0 0.0%
Ile (I) 30 7.8%
Leu (L) 39 10.2% (B) 0 0.0%
Lys (K) 25 6.5% (Z) 0 0.0%
Met (M) 7 1.8% (X) 0 0.0%
 PRABI
https://npsa-prabi.ibcp.fr
 Porcentaje de aminoácidos
L: 10.2% N: 4.7%
S: 9.1% R: 3.9%
E: 8.9% Y: 3.1%
I: 7.8% T: 2.9%
K: 6.5% Q: 2.9%
G: 5.7% H: 2.9%
V: 5.5% C: 2.9%
F: 5.5% M: 1.8%
A: 5.5% W: 0.5%
D: 5.2%
P: 4.7%
 Estructuras secundarias
Alpha helix (Hh) : 169 is 44.01%
310Helix (Gg) : 0 is 0.00%
Pi helix (Ii) : 0 is 0.00%
Beta bridge (Bb) : 0 is 0.00%
Extended strand (Ee) : 51 is 13.28%
Beta turn (Tt) : 0 is 0.00%
Bend region (Ss) : 0 is 0.00%
Random coil (Cc) : 164 is 42.71%
Ambiguous states (?) : 0 is 0.00%
Other states : 0 is 0.00%
 Clasificación de proteínas
De acuerdo a la siguiente clase:
Todo alfa: %H>45 and %E< 5
Todo Beta: %H<5 and %E>45
Alfa Beta: %H>30 and %E>20
Mixto: resto

Clasificación: mixto
 PROSITE
https://prosite.expasy.org/
Tipos de sitios de acción de proteína
PS00005 PKC_PHOSPHO_SITE Protein kinase C phosphorylation site :
In vivo, la proteína quinasa C muestra una preferencia por la fosforilación de los residuos de serina o treonina que se encuentran cerca de un residuo básico C-terminal. La
presencia de residuos básicos adicionales en el extremo N o C del aminoácido objetivo aumenta la Vmax y la Km de la reacción de fosforilación.

PS00006 CK2_PHOSPHO_SITE Casein kinase II phosphorylation site :

La caseína quinasa II (CK-2) es una proteína serina / treonina quinasa cuya actividad es independiente de los nucleótidos cíclicos y el calcio. CK-2 fosforila muchas proteínas
diferentes. La especificidad del sustrato de esta enzima se puede resumir de la siguiente manera:
(1) En condiciones comparables, se favorece a Ser sobre Thr.
(2) Un residuo ácido (ya sea Asp o Glu) debe estar presente tres residuos del terminal C del sitio aceptor de fosfato.
(3) Los residuos ácidos adicionales en las posiciones +1, +2, +4 y +5 aumentan la velocidad de fosforilación. La mayoría de los sustratos fisiológicos tienen al menos un residuo
ácido en estas posiciones.
(4) Se prefiere Asp a Glu como proveedor de determinantes ácidos.
(5) Un residuo básico en el extremo N-terminal del sitio del aceptor disminuye la tasa de fosforilación, mientras que un residuo ácido lo incrementará.

PS00008 MYRISTYL N-myristoylation site :

Un número apreciable de proteínas eucarióticas se acilan mediante la adición covalente de miristato (un ácido graso saturado C14) a su residuo N-terminal a través de un enlace
amida. La especificidad de secuencia de la enzima responsable de esta modificación, miristoil CoA: proteína N-miristoil transferasa (NMT), se deriva de la secuencia de proteínas
N-miristoiladas conocidas y de estudios que utilizan péptidos sintéticos. Parece ser el siguiente:

El residuo N-terminal debe ser glicina.

En la posición 2, se permiten los residuos no cargados. No se permiten residuos cargados, prolina y residuos hidrófobos grandes.
En las posiciones 3 y 4, la mayoría, si no todos, los residuos están permitidos.
En la posición 5, se permiten pequeños residuos no cargados (Ala, Ser, Thr, Cys, Asn y Gly). Se favorece la serina.
En la posición 6, la prolina no está permitida....
 NCBI BLAST
https://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE=Proteins
• Superfamilia: Metiltransferasa_7
• Blast 100%
• RecName: Full=3,7-dimethylxanthine N-methyltransferase;
Short=CaDXMT1; AltName: Full=Caffeine synthase 7; Short=CtCS7
 ENZYME
Búsqueda de dímeros de proteínas
Nombre Sistemático
• Nombre Sitemático: S-adenosyl-L-methionine:3,7-dimethylxanthine
N1-methyltransferase
• La paraxantina es el mejor sustrato para esta enzima, pero se
considera que la vía de la paraxantina es una vía menor para la
biosíntesis de la cafeína.
Subunidades diméricas
• Las enzimas xantosina metiltransferasa, 7-metilxantina
metiltransferasa y 3,7-dimetilxantina metiltransferasa forman cada
una un homo-dímero en el citosol.
• Además, cada enzima también forma un heterodímero con cada una
de las otras dos enzimas en el citosol.
BIBLIOGRAFÍA
(1) Ashihara04: Ashihara H, Suzuki T (2004). "Distribution and biosynthesis of caffeine in plants." Front Biosci 9;1864-76. PMID: 14977593
(2) Kato96: Kato, Misako, Kanehara, Tomomi, Shimizu, Hisayo, Suzuki, Takeo, Gillies, Fiona, Ashihara, Hiroshi (1996). "Caffeine biosynthesis in young leaves of Camellia sinensis: In
vitro studies on N-methyl transferase activity involved in the conversion of xanthosine to caffeine." Physiologia Plantarum 98:629-36.
(3) Misako04: Misako K, Kouichi M (2004). "Caffeine synthase and related methyltransferases in plants." Front Biosci 9;1833-42. PMID: 14977590
(4) Mizuno03: Mizuno K, Kato M, Irino F, Yoneyama N, Fujimura T, Ashihara H (2003). "The first committed step reaction of caffeine biosynthesis: 7-methylxanthosine synthase is
closely homologous to caffeine synthases in coffee (Coffea arabica L.)." FEBS Lett 547(1-3);56-60. PMID: 12860386
(5) Mizuno03a: Mizuno K, Okuda A, Kato M, Yoneyama N, Tanaka H, Ashihara H, Fujimura T (2003). "Isolation of a new dual-functional caffeine synthase gene encoding an enzyme
for the conversion of 7-methylxanthine to caffeine from coffee (Coffea arabica L.)." FEBS Lett 534(1-3);75-81. PMID: 12527364
(6) Ogawa01: Ogawa M, Herai Y, Koizumi N, Kusano T, Sano H (2001). "7-Methylxanthine methyltransferase of coffee plants. Gene isolation and enzymatic properties." J Biol Chem
276(11);8213-8. PMID: 11108716
(7) Uefuji03: Uefuji H, Ogita S, Yamaguchi Y, Koizumi N, Sano H (2003). "Molecular cloning and functional characterization of three distinct N-methyltransferases involved in the
caffeine biosynthetic pathway in coffee plants." Plant Physiol 132(1);372-80. PMID: 12746542
Other References Related to Enzymes, Genes, Subpathways, and Substrates of this Pathway
(8) Cannon02: Cannon LM, Butler FN, Wan W, Zhou ZS (2002). "A stereospecific colorimetric assay for (S,S)-adenosylmethionine quantification based on thiopurine
methyltransferase-catalyzed thiol methylation." Anal Biochem 308(2);358-63. PMID: 12419350
(9) Kato00: Kato M, Mizuno K, Crozier A, Fujimura T, Ashihara H (2000). "Caffeine synthase gene from tea leaves." Nature 406(6799);956-7. PMID: 10984041
(10) Kato99: Kato M, Mizuno K, Fujimura T, Iwama M, Irie M, Crozier A, Ashihara H (1999). "Purification and characterization of caffeine synthase from tea leaves." Plant Physiol
120(2);579-86. PMID: 10364410
(11) Latendresse13: Latendresse M. (2013). "Computing Gibbs Free Energy of Compounds and Reactions in MetaCyc."
(12) Negishi88: Negishi, Osamu, Ozawa, Tetsuo, Imagawa, Hiroshi (1988). "N-methyl nucleosidase from tea leaves." Agric. Biol. Chem. 52(1):169-175.