Está en la página 1de 14

Instituto Nacional de Salud

Publica
Escuela de Salud Publica de México

I
N
S
P

QC. Miguel Ángel Ortiz Gil.


 Trastorno del sistema
nervioso que afecta al
control muscular.
 Es una enfermedad
crónica que conduce con
el tiempo a una
incapacidad progresiva.
 Se caracteriza por temblor
en los brazos y en las
piernas, rigidez muscular
y trastornos del equilibrio.
 Mutaciones en la proteína Parkina son uno
de los factores hereditarios predominantes
en los pacientes que padecen Parkinson
juvenil autosómico recesivo.

 La proteína Parkina es un miembro de la


familia de la E3 ubiquitin ligasas que se
define por la presencia de 3 dominios: el
anillo 1(RING1), el anillo 2 (RING2) y un
dominio de conexión entre ambos (IBR:in
bteween ring).
 El plegamiento correcto de este dominio es
dependiente del zinc.

 La mutación del residuo 351 que pasa de ser


una treonina a una prolina causa una alteración
global del plegamiento de este dominio.

 El estudio de la mutación indican que este


dominio facilita la organización de los anillos
adyacentes 1 y 2 y facilita la interacción con
otras proteínas como sinfilina1, Sept5 y SIM2 y
su posterior ubiquitinación.
 MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGV
PADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQR
PWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVD
LSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIY
NSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQ
GPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCG
AHPTSDKETPVALHLIATNSRNITCITCTDVRSPVLVF
QCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSL
PCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECV
LQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGL
GCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVD
ERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGG
CMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHW
FDV
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGV
PADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQR
PWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVD
LSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIY
NSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQ
GPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCG
AHPTSDKETPVALHLIATNSRNITCITCTDVRSPVLVF
QCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSL
PCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECV
LQMGGVLCPRPGCGAGLLPEPDQRKVPCEGGNGL
GCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVD
ERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGG
CMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHW
FDV
 La treonina es un
aminoácido polar, no
cargado a pH neutro.

 Su símbolo es T en
código de una letra y
Thr en código de tres
letras.
 Es un aminoácido cíclico no
polar.

 Su símbolo es P en código de
una letra y Pro en código de
tres letras.

 En las proteínas, la prolina


produce curvaturas e
interrumpe estructuras
secundarias alfa-hélices y
láminas-beta.
 La ubiquitinación es el proceso de
marcaje de una molécula con
ubiquitina.
 La ubiquitina es una proteína ubicua
altamente conservada de 76
aminoácidos con una glicina en el
extremo carboxilo terminal por donde
se une al nitrógeno epsilon de una lisina
del sustrato.
 La molécula de ubiquitina que ya está
unida al sustrato se le van incorporando
nuevas moléculas de ubiquitina que se
unen por sus residuos de lisina.
 Existe diversidad estructural en la
formación de estas cadenas de
poliubiquitina. La variedad en el número
de ubiquitinas y su topología determina
el destino del sustrato.
 El proceso de ubiquitinación es esencial
en numerosos procesos como el
acortamiento y degradación de
proteínas por medio del proteasoma.
 Existen una gran variedad de enzimas
que participan en el proceso de
ubiquitinación y desubiquitinación.
 Estructura tridimensional.

 Fuente: http://www.sbg.bio.ic.ac.uk/servers/phyre/qphyre_output/93dea8d3441f9515/summary.html
 Estructura tridimensional.

 Fuente:
http://www.sbg.bio.ic.ac.uk/phyre/qphyre_output/dffe565a03531b0a/summary.html
 http://
www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=protein&id=3063388#feature_

 http://www.medmol.es/noticia.cfm?id=66

 http://
www.arsxxi.com/pfw_files/cma/ArticulosR/NeurologiaSuplementos/2006/119

 http://www.ncbi.nlm.nih.gov/pubmed/17360614?dopt=Abstract

 http://www.sbg.bio.ic.ac.uk/servers/phyre/qphyre_output/93dea8d3441f

 http://www.sbg.bio.ic.ac.uk/phyre/qphyre_output/dffe565a03531b0a/sum