Está en la página 1de 466

BIOQUIMICA

DEFINICIN: ciencia que estudia la base qumica de la vida, las reacciones y procesos que experimenta.
IMPORTANCIA: - DOCENCIA - INVESTIGACIN - ALIMENTACIN - MEDICINA( ONDONTOLOGICA,VETERINARIA ETC) - INDUSTRIA - GENETICA

INTRODUCCIN
Importancia en odontologia: - Identificar los componentes quimcos de la clula,tejidos. - Explicar los cambios bioqumicos y fisiolgicos en el organismo. - Explicar los componentes quimicos del diente y sus cambios - Explicar la bioqumica de la caries y enfermedades bucales - Explicar la composicin qumica de los materiales dentales y sus cambios al contacto con el aparato estomatogntico. - Motivar al estudiante a la investigacin.

IMPORTANCIA
- Explicar todos los procesos a nivel molecular relacionados con la vida ejm: - Potencial de membrana - Crecimiento y desarrollo - Divisin celular - Metabolismo celular - Contraccin muscular - Conduccin nerviosa - Hemostasia etc

Bioquimica y medicina
- Explicar fenmenos como los trastornos genticos: alcaptonuria,cistinuria,albinismo,fe nilcetonuria,fibrsis qustica. - Trastornos del metabolismo: diabetes miellitus,atero-esclerosis, cancer,hipovitaminosis discrasias sanguineas trastornos genticos,cromosmicos,degenerativos,etc. (errores congnitos del metabolismo)

BIOQUIMICA: divisin
1.-Bioquimica esttica: - estudia la composicin qumica de la materia viviente como los principales elementos para la vida: vitaminas, minerales:Na,Cl,K,Ca Mg,Cu,Zc,F,He,etc aminocidos cidos grasos carbohidratos

Bioquimica dinmica
- Estudia las transformaciones de los principales nutrientes u oligoelementos en la vida, ejemplo - Bioenergtica - metabolismo de carbohidratos. - metabolismo de lipidos - metabolismo de protenas - metabolismo de vitaminas y minerales

ENLACES BIOQUIMICOS

ENLACES BIOQUIMICOS

BIOELEMENTOS

BIOELEMENTOS

BIOMOLECULAS:
- DNA:herencia,sintesis(transcripcin. - RNA:sintesis proteca(traslacin) - Protenas:enzimas y estructuras - carbohidratos:fuente de energa y estructuras. - Lipidos:fuente de reserva energtica formacin de membranas hormonas,mediadores etc. - protenas:estructuras,enzimas hormonas.

Composicin qumica normal varn de 65 kg


Proteinas: 11 K 17.0% Grasas: 9 13.8% azucares: 1 1.5% Agua 40 61.6% Minerales 4 6.1%

Obtencin de molculas
Fraccionamiento sub-celular: extraccin,homogeneizacin, centrifugado. Extraccin:soluciones iso-osmticas,Ph 7.4 Homogeneizacin: rotacin controlada del agitador. Centrifugacin:subfraccionamiento del contenido de un homogenado por centrifuga cin,3 pasos de centrifugado

AGUA

Agua y Ph
Importancia biolgica: - Homeostasis lquido intracelular: 55 a 65% lquido extracelular: 25% - Regulacin del equilibrio hdrico depende del hipotalamo y hormona antidiurtica (evitar hipo o hipervolemia).

Agua y Ph
- el agua es un solvente biolgico ideal - Tiene forma de tetraedro con orbital 2sp3 - El agua es bipolar:polar y apolar. - Forman puentes de hidrogeno en azucares,lidos,protenas - Tienen 3 estados fisicos. gas,liqudo,slido.

AGUA

AGUA

Agua; propiedades
Propiedades Masa molar: 18 gr. Punto de fusin: O C. ( a 101.325 KPa o 1 Atm ) Punto de ebullicin: 100C. ( a 101.325 KPa o 1Atm ) (Descargar tablas de valores) Densidad a 3.98C = 1g/cm3 Densidad slido 0.8 g/ cm3. Molcula polar y diamagntica Calor especfico : 1 cal / g.C a 20C Calor de fusin : 79 cal / g. C a 20C Calor de evaporacin : 540 cal / g, C a 20C Tensin superficial : 73 dinas/ cn3 La mayoria de las propiedades dependen de los enlaces puente de hidrgeno : Punto de fusin, punto de ebullicin, densidad, calor especfico,calor de fusin, tensin superficial , de fcil interpretacin como as tambien la accin disolvente, fuerza de cohesin y de adhesin que plantearemos

pH
Sorensen en 1909 define el Ph como logaritmo negativo de la concentracin de hidrgenos: pH= -log (H+) Los cidos: son donadores de protnes Las bases: aceptores de protnes

GRUPOS FUNCIONALES
ALCANOS : R-CH4 ALQUENOS :CH2=CH2 ALQUINOS :CH=CH ALCADIENOS :CH2=C=CH2 ALDEHIDOS :R=CH2 CETONAS :R=c=R AMINAS :R-NH3 AMIDAS :R=NH2 AC CARBOXILICOS R:COOH ETER :R=O=R ESTER R-COO-R TIOESTER :R-S-R

5. Introduccin al estudio de los Hidratos de Carbono o Glcidos. Monosacridos y Derivados

Hidratos de carbono o Glcidos


- Polihidroxialdehidos o polihidroxicetonas (compuestos polihidroxicarbonlicos)

- Sus derivados por oxidacin, reduccin y sustituciones diversas


- Sus oligmeros y polmeros por unin de los anteriores mediante enlaces glicosdicos

Polihidroxialdehidos

Polihidroxicetonas

H
H C O H C OH CH2OH D-Gliceraldehido

C O H C OH HO C H H C OH H C OH CH2OH D-Glucosa

CH2OH
CH2OH C O CH2OH

C O HO C H H C OH H C OH CH2OH D-Fructosa

Glicerona (Dihidroxiacetona)

Derivados
Oxidacin
COOH H C OH HO C H H C OH H C OH CH2OH

Reduccin
CH2OH H C OH HO C H H C OH H C OH CH2OH Sorbitol

Sustitucin

O CH2O P OC O H C OH H C OH O CH2O P OOD-Ribulosa (1,5) bisfosfato O-

cido Glucnico

CH2OH H H OH OH H
HOCH2 H H OH OH H OH H OH O H H O

O H OH

a-Metilglucsido
O CH3

HOCH2 H H OH O H OH H

Oligmeros y Polmeros
Maltosa

CH2OH H HO H OH H O O H H OH H

H OH H

OH H H O O H

CH2OH O H OH H O H H OH n H

H OH H

OH H H OH O

Celulosa

CH2OH

CH2OH

Hidratos de carbono: funciones


1. Energtica

- Combustible de uso rpido e inmediato - Por fermentacin y por respiracin


2. Estructural - Paredes celulares: bacterias, hongos, plantas - Matriz de los tejidos mesodrmicos

3. Informativa
- Funciones de reconocimiento en superficie a travs de glicoconjugados

I. Osas

Clasificacin, 1
Compuestos polihidroxicarbonlicos y sus derivados, sin enlaces glicosdicos

II. sidos Presencia de enlaces glicosdicos 1. Hetersidos: enlace glicosdico entre una osa y un grupo qumico no glucdico

2. Holsidos: enlace glicosdico entre osas


a. Oligsidos: unos pocos residuos (< 20) b. Polisidos: muchos residuos

Clasificacin, 2
I. Monosacridos Compuestos polihidroxicarbonlicos y sus derivados (se corresponden con Osas) II. Glicsidos Un monosacrido unido a un grupo no glucdico (se corresponden con Hetersidos) III. Oligosacridos Unos pocos monosacridos unidos por enlaces glicosdicos (se corresponden con Oligsidos) IV. Polisacridos Muchos monosacridos unidos por enlaces glicosdicos (se corresponden con Polisidos)

D-Glucosa
El monosacrido ms abundante de la naturaleza - Libre: suero sanguneo y medio extracelular (5 mM) zumo de uva - Como monmero se presenta en una gran cantidad de oligosacridos y polisacridos La prctica totalidad de las clulas vivientes son capaces de obtener energa a partir de glucosa. Hay clulas que nicamente pueden consumir glucosa, y no molculas, p.e.: hemates y neuronas.

D-Glucosa
Composicin qumica: C6H12O6 Peso molecular: 180 Constitucin qumica: - Un grupo aldehido, -CHO - Cuatro alcoholes secundarios, -CHOH- Un alcohol primario, -CH2OH:
CH2OH (CHOH)4 CHO

Tiene, por tanto, cuatro carbonos asimtricos o quirales; lo cual da la posibilidad de 24 = 16 ismeros pticos

Configuracin absoluta: disposicin 3D en el gliceraldehido

CHO HO C H CH2OH L-Gliceraldehido

CHO H C OH CH2OH D-Gliceraldehido

Configuracin y proyeccin de Fischer


Los carbonos 2, 4 y 5 de la glucosa tienen la misma configuracin que el D-Gliceraldehido El carbono 3 tiene la configuracin del L-gliceraldehido 1 CHO 2 3 4

H C OH HO C H H C OH H C OH
6

CHO HO C H CH2OH L-Gliceraldehido

CHO H C OH CH2OH D-Gliceraldehido

CH2OH

D-Glucosa

D-Aldohexosas
CHO H C OH H C OH H C OH H C OH CH2OH D-Alosa
CHO H C OH H C OH HO C H H C OH CH2OH D-Gulosa

CHO HO C H H C OH H C OH H C OH CH2OH D-Altrosa


CHO HO C H H C OH HO C H H C OH CH2OH D-Idosa

CHO H C OH HO C H H C OH H C OH CH2OH D-Glucosa

CHO HO C H HO C H H C OH H C OH CH2OH D-Manosa

CHO H C OH HO C H HO C H H C OH CH2OH D-Galactosa

CHO HO C H HO C H HO C H H C OH CH2OH D-Talosa

Serie D: El ltimo carbono asimtrico tiene la misma configuracin que el D-gliceraldehido

CHO H C OH HO C H H C OH H C OH CH2OH D-Glucosa

CHO HO C H H C OH HO C H HO C OH CH2OH L-Glucosa

Enantimeros (imagen especular)

CHO H C OH HO C H H C OH H C OH CH2OH D-Glucosa

CHO HO C H HO C H H C OH H C OH CH2OH D-Manosa

CHO H C OH HO C H HO C H H C OH CH2OH D-Galactosa

Epmeros: difieren en un solo carbono asimtrico: - D-Manosa es el 2-epmero de la D-Glucosa - D-Galactosa es el 4-epmero de la D-Glucosa

Formas cclicas de la glucosa


1. La D-Glucosa no da todas las reacciones de los aldehidos 2. La D-Glucosa presenta el fenmeno de mutarrotacin: - Al disolver D-Glucosa slida, la rotacin del plano de polarizacin de la luz vara con el tiempo. 3. Se pueden obtener dos formas distintas de D-Glucosa: - Una tiene una rotacin de 112 : forma a - Otra tiene una rotacin de 18.7: forma b

Formas cclicas: Formacin de hemiacetal interno Forma a


H C OH H C OH HO C H H C OH H C

Carbono anomrico

Forma abierta
CHO H C OH HO C H H C OH H C OH CH2OH

Forma b
HO C H O H C OH O HO C H H C OH H C CH2OH

CH2OH

Nuevo centro de asimetra en la D-Glucosa al formarse el ciclo

CH2OH H C OH H C OH HO C H H C OH H C CH2OH
Proyeccin de Fischer

O H O OH H OH H H OH H OH
Proyeccin de Haworth

a-D-Glucopiranosa

HO C H H C OH O HO C H H C OH H C CH2OH
Proyeccin de Fischer

CH2OH O H OH H OH H H OH OH H

Proyeccin de Haworth

b-D-Glucopiranosa

Conformacin silla

Conformacin bote

ax eq eq ax eq eq ax ax eq ax O

Sustituyentes: - Axiales - Ecuatoriales

Otros monosacridos

- Segn sea la naturaleza de la funcin carbonilo, tendremos: 1. Aldosas, cuando es un aldehido -CHO 2. Cetosas, cuando es una cetona -CO- A lo cual se aade el nmero de tomos de carbono:

Aldotriosas, Aldotetrosas, Cetopentosas, Aldohexosas, etc.

Aldotriosas
CHO H C OH CH2OH D-Gliceraldehido

Cetotriosa
CH2OH C O CH2OH Glicerona (Dihidroxiacetona)

Aldotetrosas
CHO H C OH H C OH CH2OH D-Eritrosa CHO HO C H H C OH CH2OH D-Treosa

Cetotetrosas
CH2OH C O H C OH CH2OH D-Eritrulosa

Aldopentosas

CHO H C OH H C OH H C OH CH2OH D-Ribosa

CHO HO C H H C OH H C OH CH2OH D-Arabinosa

CHO H C OH HO C H H C OH CH2OH D-Xilosa

CHO HO C H HO C H H C OH CH2OH D-Lixosa

Formas cclicas de la D-Ribosa


CHO H C OH H C OH H C OH CH2OH

CH2OH O H H OH H

H OH OH

a-D-Ribofuranosa

CH2OH O D-Ribosa (forma abierta) H H OH H

OH H OH

b-D-Ribofuranosa

Aldohexosas
CH2OH O H OH H OH H OH H H OH OH H CH2OH O H OH H H OH H OH

D-Manosa (a-D-Manopiranosa)

D-Galactosa (a-D-Galactopiranosa)

Cetohexosas: D-Fructosa
CH2OH C O HO C H H C OH H C OH CH2OH D-Fructosa

CH2OH O H H OH H HO

CH2OH OH

a-D-Fructofuranosa

CH2OH O H H OH H HO

OH CH2OH

b-D-Fructofuranosa

CH2OH O H OH H O OH H H OH

COOH H C OH HO C H H C OH H C OH CH2OH

5-Glucoconolactona

cido Glucnico

COOH O H OH H OH H H OH H OH H OH

H O COOH OH H H OH H OH

cido D-Glucurnico

cido L-Idurnico

Derivados por reduccin


CH2OH H C OH HO C H H C OH H C OH CH2OH Sorbitol CH2OH HO C H HO C H H C OH H C OH CH2OH Manitol CH2OH HO C H CH2OH Glicerol

Desoxiderivados
CH2OH O H H OH H H H OH

O OH H CH3 H OH H OH H OH

Ramnosa (6-Desoxi-L-manosa)

O H CH3 H OH OH H H OH

b-D-2-Desoxirribosa
OH

Fucosa (6-Desoxi-L-galactosa)

Aminoderivados
CH2OH O H OH H OH H H H OH OH H H OH H H CH2OH O H OH

HN C CH3 O

HN C CH3 O

N-Acetilglucosamina (2-desoxi 2-acetamido D-glucosa)

N-acetilgalactosamina (2-desoxi 2-acetamido D-galactosa)

H HOOC OH O H

H O OH H NH C CH3 H

H C OH cido Silico (N-acetil neuramnico) H C OH CH2OH

7. Oligosacridos

CH2OH OH H OH H H OH O O H H H

H OH H

OH OH H O H

CH2OH

Lactosa: b-D-Galactopiranosil-1,4-D-glucopiranosa

O CH2 O P OO O H OH H OH H H OH
-

CH2OH O H OH H OH H H OH H O O P OO-

H OH

Glucosa-6-fosfato

Glucosa-1-fosfato

O CH2O P OOO H H OH H HO OH H OH CH2OH H

O CH2O P OOO HO OH H O CH2O P OO-

Fructosa-6-fosfato

Fructosa-1,6-bisfosfato

CH2OH H HO H OH H O H OH H O H

H OH O

OH H H HOCH2 OH OH

Trehalosa: a-D-Glucopiranosil-a-D-glucopiransido

CH2OH H HO H OH H O H OH H O H

CH2OH O H OH H H OH OH H

Maltosa: a-D-Glucopiranosil-(1,4)-D-glucopiranosa

CH2OH H HO H OH H O O H H OH H

H OH H

OH OH H O H

CH2OH

Celobiosa: b-D-Glucopiranosil-(1,4)-D-glucopiranosa

CH2OH H HO H OH H O H OH H O O CH2OH

H OH OH H H CH2OH

Sacarosa: a-D-Glucopiranosil-b-D-fructofuransido

Oligosacrido N-ligado (a residuo de asparragina, Asn, N)

NH O C H HC CH2 CO N HN C O R C NH

OH HN COCH3 HOCH2 O O

OH HN COCH3 HO CH2 O OH

Oligosacrido O-ligado (a residuo de serina, Ser, S)

NH O C HC CH2 O HN C O R CH NH

OH HN COCH3 HOCH2 O O

OH HN COCH3 HO CH2 O OH

8. Polisacridos

CH2OH H HO H OH H O H OH H O H

CH2OH O H OH H H OH H O H

CH2OH O H OH H H OH n H O H

CH2OH O H OH H H OH H OH

a-Glucanos: Amilosa

CH2OH H ....... O H OH H CH2OH H ..... O H OH H O H OH H O H H OH H O H OH CH2OH H O H

CH2OH O H OH H O H OH H OH CH2 H O H H OH H O H OH H O H H OH H CH2OH O H OH H ...... O H O

a-Glucanos: Amilopectina, Glucgeno

...... H

a-Glucanos: Dextrano
CH2 O H OH H OH

OH H

O CH2 H H OH OH H OH O H

O CH2 H H OH OH H OH O H

O CH2 H H OH OH H OH O H .....

CH2OH H HO H OH H O O H H OH H

H OH H

OH H H O O H

CH2OH O H OH H O H H OH n H

H OH H

OH H H OH O

CH2OH

CH2OH

b-Glucanos: Celulosa

b-Glucanos: Quitina

CH3 CO CH2OH H HO H OH H O O H H NH CO CH3 H OH H CH2OH H O O H NH CO CH3 n H NH H H H OH CH2OH O O H H H OH H H

CH3 CO NH H OH O CH2OH

CH2 CH2OH O O OH CH2 OH O HO CH2 CH2 O CH2OH O O OH CH2 OH O HOCH2 CH2 O CH2OH O O OH CH2 OH O HOCH2 O OH OH OH OH OH OH

Inulina

Glicosaminoglicanos:

cido Hialurnico
CH2OH O COOCH2OH O COOO H O H OH H H OH OH O H H H NH CO CH3 H H OH H H O H H OH H O OH O H H H NH CO CH3 H H H O

Glicosaminoglicanos:
- Condroitin-4-sulfato
-

O S

O O H O

CH2OH O H H H NH CO CH3 H O

COO
-

O O

O S

O O H O

CH2OH O H H H NH CO CH3 H H O H H OH

COO H O H OH H

O O

H OH

H OH

Glicosaminoglicanos:

- Condroitin-6-sulfato
-

O S O

O O CH2 O OH H H O H NH CO CH3 H

O S O

O O CH2 O H O H O H NH CO CH3 H

COOO H OH H H OH

COOO H O H OH H H OH

OH H

Glicosaminoglicanos:

- Dermatansulfato
-

O S O

O O CH2 O OH H H O H NH CO CH3 H

O S O

O O CH2 O H O H O H NH CO CH3 H

H O COOOH H H OH

H O H O COO OH H
-

OH H

H OH

Glicosaminoglicanos:

- Queratansulfato
-

O S O

O O CH2 O OH H H O H NH CO CH3 H

O S O

O O CH2 O OH H H O H NH CO CH3 H CH2OH O O H H OH H H OH H

CH2OH O O H OH H H OH

Glicosaminoglicanos:

- Heparan sulfato - Heparina


-

O S O

O O CH2 O OH H H O H NH O S O OH

O S O H

O O CH2 O H O H H NH O S O OH

COOO H OH H H O O S O O-

H O H O COO OH H
-

OH O H O H

O S O O-

Introduccin a la Bioenergtica

Cundo tiene lugar una reaccin qumica? (1)


- Las reacciones que tienen lugar espontneamente suelen ser exotrmicas, esto es, con desprendimiento de calor. - El calor que se desprende o absorbe en una reaccin a presin constante recibe el nombre de Entalpa (DH). Las reacciones en las que se desprende calor son exotrmicas y por convencin, la entalpa se supone negativa: DH < 0 - Sin embargo, hay reacciones endotrmicas que cursan espontneamente, DH > 0; por ejemplo, la disolucin de sulfato amnico en agua.

Cundo tiene lugar una reaccin qumica? (2)


- La disolucin de sulfato amnico en agua es un proceso por el cual se pasa de un sistema altamente ordenado, cual es el estado cristalino, a otro de mucho mayor desorden molecular. - La funcin termodinmica que mide el desorden de un sistema recibe el nombre de Entropa (DS). Puede observarse que muchas reacciones que cursan espontneamente lo hacen con incremento positivo de entropa: DS > 0.

- Sin embargo, hay procesos espontneos que cursan con disminucin de entropa, p.e.: la solidificacin del agua a 0C.

Cundo tiene lugar una reaccin qumica? (3)


- Ni la entropa ni la entalpa valen como criterio nico para definir la espontaneidad de una reaccin. - Existe otra funcin termodinmica de estado que agrupa a las dos en procesos a presin constante, la Energa Libre de Gibbs, que se define as:

DG = DH - TDS
- La energa libre de Gibbs es un criterio vlido para verificar la espontaneidad de una reaccin. Pueden cursar espontneamente aquellos procesos en los que se desprende energa libre (DG < 0); no pueden hacerlo, sin embargo, aquellos procesos en los que se absorbe energa libre (DG > 0)

Sea un sistema

La reaccin cursar de izquierda a derecha cuando las concentraciones de A y B sean tales que la energa libre del sistema sea negativa. La energa libre del sistema viene dada por: DG = DG0 + RT ln [B]

[A]

Donde DG0 es la Energa Libre Standard de la reaccin: la energa libre del sistema con los reactivos a concentracin unidad, en condiciones STP. Hay tablas que nos dan la DG0 para toda reaccin. A partir de las mismas podemos calcular si un proceso puede tener lugar espontneamente o no en unas determinadas condiciones.

Ejemplo: Calcular la energa libre del proceso de descomposicin del ster Glucosa-6-fosfato a Glucosa y fosfato inorgnico en las condiciones intracelulares, que son: Temperatura: 37 C, equivalentes a 310 K [Glucosa-6-fosfato], 1 mM [Glucosa], 0.01 mM [fosfato], 10 mM La Energa Libre Standard de la reaccin es de -3250 cal/mol

La reaccin es:
G6P + H2O G + Pi

La expresin que nos da la Energa Libre es: DG = DG0 + RT ln

[Glucosa] [Fosfato]
[Glucosa-6-fosfato]

(No se tiene en cuenta el agua porque su concentracin se considera constante) Sustituyendo, obtenemos: DG = -3250 + 1.98*310*2.303* log 10-5*10-3 10-2 Por lo tanto, en las condiciones intracelulares el proceso puede tener lugar espontneamente.

= -8900 cal/mol

Relacionado con el anterior, tendramos el siguiente problema: Cul sera la concentracin mnima necesaria de glucosa para que, siendo el resto de las condiciones iguales a las del ejemplo anterior, en la clula tuviera lugar la formacin de ster por reversin de la hidrlisis? Esta concentracin sera la que diera lugar a un valor de 0 para DG en el ejemplo anterior. As, llamando X a la conc. de glucosa,
-2 X*10 0 = -3250 + 1.98*310*2.303*log 10-3

Despejando log X obtenemos log X = 1.3 X = antilog (1.3) = 20 M

La expresin que nos da la energa libre de un proceso tiene otra importante derivacin. Para la reaccin

A
Esta expresin es:
DG = DG0

B
+ RT ln [B] [A]

En el equilibrio, DG = 0; por tanto, 0= [Beq] Pero = Keq [Aeq] DG0 [Beq] + RT ln [A ] eq

Por tanto, DG0 = -RT ln Keq

Esquema energtico del metabolismo

Estructuras complejas

Catabolismo

DG

Anabolismo

Estructuras simples

En general, podemos decir:


Reacciones catablicas: DG < 0

Reacciones anablicas: DG > 0


Supongamos una reaccin anablica mediante la cual se forma un enlace qumico entre A y B; esquemticamente,

A+B

A-B

(DG > 0)

La reaccin no puede tener lugar espontneamente. Cmo puede entonces tener lugar en el metabolismo?

Lo que ocurre en el metabolismo es que las reacciones endergnicas (DG > 0) se acoplan a reacciones exergnicas (DG < 0) de manera que : 1. La energa desprendida en una de las reacciones es absorbida por la otra. 2. La suma total de energas libres de una y otra reaccin da una DG < 0, por lo que el proceso en conjunto tiene lugar espontneamente.

As, la reaccin

A+B
Se acopla a

A-B

(DG1 > 0)

X-Y + H2O
Siendo

X + Y (DG2 < 0)

|DG2 | > |DG1|

Dando lugar a una reaccin global

A + B + X-Y + H2O

A-B + X + Y

(DG < 0)

El tipo de reaccin

X-Y + H2O

X + Y (DG2 < 0)

Que tiene lugar en los seres vivos para acoplarse a procesos endergnicos es, en la mayora de los casos, la hidrlisis de anhdridos de cido, y particularmente, la hidrlisis de polifosfatos :

O O-

O O-

O O-

O O-

R O P O P O- + H2O

R O P OH + HO P O-

El polifosfato mayoritario en las reacciones de acoplamiento energtico es el ATP, 5-Adenosina trifosfato: NH2

N O
-

O O
-

O O
-

N O N N

O P O P O P O CH2 O
-

OH

OH

De esta manera, los procesos catablicos productores de energa generan ATP, que se emplear en todas aquellas reacciones endergnicas en las que sea requerido. En general, el ATP se produce de dos maneras:

1. Por fosforilacin a nivel de substrato (procesos anaerbicos, fermentativos) Por ejemplo: La Glicolisis 2. Por fosforilacin oxidativa (procesos aerbicos, oxidativos) Por ejemplo: Ciclo de Krebs, - b oxidacin, etc.

Los dos enlaces anhdrido del polifosfato del ATP son el ejemplo de configuraciones de alta energa de hidrlisis:
O
-

O O-

O O-

O P O P O P O R O-

Existen otras configuraciones de alta energa, por ejemplo:


COO- O C O P OCH2 O-

O C CH2 O

CH3 NH

O O-

N C NH P O-

Fosfoenolpiruvato

Fosfocreatina

Otras configuraciones de alta energa de hidrlisis

O O-

O R C S CoA
Tiosteres de Coenzima A

H 2 N C O P O-

Carbamilfosfato

Consideremos ahora la reaccin de degradacin aerbica de la glucosa:

C6H12O6 + 6O2

6CO2 + 6H2O

DG0 = -684 kcal/mol

Segn lo hasta ahora expuesto, esta reaccin es fuertemente exergnica, por lo que debera cursar espontneamente.
Sin embargo, la glucosa en presencia de oxgeno es perfectamente estable y no entra espontneamente en combustin.

Ello es debido a que los reactivos han de superar una barrera energtica, la Energa de Activacin:

Energa

Ea

G + O2
DG0

CO2 + H2O

Coordenada de reaccin

Metabolismo de los carbohidratos


-Glucolisis anaerobica o camino de ebdenMeyer-hoff -Glucolisis aerobica: ciclo de Krebs -Ciclo de cori -Glucogenolss -Glucognesis -Ciclo de las pentosas

Glucolisis anaerobica

Glucolisis aerobica: ciclo de Krebs

FOSFORILACION OXIDATIVA
la "cadena respiratoria" tenamos un total de 4 ATPs, 10 NADHs y 2 FADHs.

Vea el siguiente grfico.

PROCESO METABOLICO
Gluclisis

ATPs
2

NADHs

FADHs

Metabolismo de piruvato a Acetil CoA (x2)

Ciclo de Krebs (x2)

TOTAL:

10

Metabolismo energtico: balance final de ATPs. Como ya habamos resumido anteriormente, hasta antes de ingresar a la "cadena respiratoria" tenamos un total de 4 ATPs, 10 NADHs y 2 FADHs. Si tomamos en cuenta que cada NADH equivale a 3 ATPs y cada FADH equivale a 2 ATPs, tendramos la siguiente sumatoria: 4 ATPs (de la gluclisis y formacin de Acetil CoA) + 30 ATPs (provenientes de los NADHs) + 4 ATPs (provenientes de los FADHs). Con un total de 38 ATPs como producto del metabolismo energtico de una molcula de glucosa.

GLUCOGENESIS

Glucogenolisis

DIABETES MELLITUS

9. Introduccin al estudio de los lpidos. cidos grasos y eicosanoides

Lpidos
- Caracterstica fundamental es la insolubilidad en agua y la solubilidad en solventes orgnicos - Qumicamente, los lpidos son: - Derivados por esterificacin y otras modificaciones de cidos orgnicos monocarboxlicos, llamados cidos grasos - Derivados por aposicin y posteriores modificaciones de unidades isoprenoides

Funciones de los lpidos

1. Energtica: combustible de alto valor calrico (10 kcal/g) y de uso diferido. Slo admiten degradacin aerbica (respiracin) 2. Estructural: Forman las membranas plasmticas de todo tipo de seres vivos

3. Informativa: seales qumicas como esteroides, prostaglandinas, retinoides, leucotrienos, calciferoles, etc.

Tejido o producto biolgico Extraccin con ClCH3 - C6H14


Fase orgnica

Saponificacin

Tratamiento con NaOH en caliente Extraccin acuosa

Fase acuosa

Fase orgnica: residuo insaponificable


Fase acuosa: componentes de lpidos saponificables

Reaccin de saponificacin

R CO O CH2 R CO O CH + 3NaOH R CO O CH2

CH2OH 3 R-COONa + HOCH CH2OH

Lpidos saponificables:
C C C n
CH2 O C C O C H O O O CH2 O C

R CO O R'
R: cido graso R: alcohol

H O C C

OH OH OH HOCH2 O OH

HN CH CH2 O

Lpidos insaponificables
C
n

CH2OH

Retinol

HO

Colesterol

Clasificacin
I. Lpidos saponificables (lpidos C2) 1. cidos grasos y eicosanoides 2. Lpidos neutros 3. Lpidos anfipticos a. Fosfolpidos b. Glicolpidos II. Lpidos insaponificables (lpidos C5) 1. Esteroides 2. Terpenos

El efecto hidrofbico

Enlaces de hidrgeno en cidos grasos


O O H H H H H H O O

O O

O O

O O

O O

cidos grasos saturados


C2 C4 C6 C8 C10 C12 C14 C16 C18 C20 C22 C24 Actico Butrico Caproico Caprlico Cprico Lurico Mirstico Palmtico Esterico Araqudico Behnico Lignocrico Etanoico Butanoico Hexanoico Octanoico Decanoico Dodecanoico Tetradecanoico Hexadecanoico Octadecanoico Eicosanoico Docoeicosanoico Tetraeicosanoico

Estructura de los cidos grasos saturados

cido palmtico, C16

CH3 (CH2)14 COOH

COOH

cidos grasos insaturados

C16:1 Palmitoleico 9-cis hexadecenoico C18:1 Oleico 9-cis octadecenoico

C18:2 Linoleico 9,12 todo cis octadecadienoico C18:3 Linolnico 9,12,15 todo cis octadecatrienoico C20:4 Araquidnico 5,8,11,14 todo cis eicosatetraenoico

Estructura de los cidos grasos insaturados


Araquidnico
COOH

COOH

Linolnico
COOH

Linoleico
COOH

Oleico

c.oleico

c.linoleico

c.linolnico

c.araquidnico

Enranciamiento de cidos insaturados


H C C R R' O2 O O HC CH Endoperxido R R' H O2 O HC CH R R' Epxido

CHO CH2 CHO Malonodialdehido


CHO

4-hidroxi 2-trans nonelal

Hidroxicidos grasos
H
9

OH COOH

HO H

c. cerebrnico (2-hidroxi lignocrico)

COOH c. ricinoleico (12-hidroxi oleico) H OH COOH c. hidroxinervnico

cidos grasos ramificados


CH3 COOH c. tuberculoesterico

COOH c. lactobaclico

COOH c. chaulmgrico

Prostaglandinas
O COOH c. prostanoico HO PGE O R1 R1 R1 R2 HO PGF HO R1 R2 R1 HO R1

R2 PGA PGB

R2 PGC

R2

O PGD

R2

COOH O Prostaglandina E

HO H OH COOH HO Prostaglandina F2a HO H OH

Prostaglandina E (PGE)

Prostaglandina F2a (PGF2a)

COOH

O O

PGG2

Endoperxidos de prostaglandina

OOH COOH

PGH2

O O

OH

Glucocorticoides Lpidos de membrana Salicilatos

Fosfolipasa A2

cido araquidnico (C20:4) Lipoxigenasa

Cicloxigenasa

PGG2
PGH2

5-HPETE

LTA4 PGI2 PGE2 + PGF2a TXA2 TXB2

LTC4

COOH OH TBXB2 HO O H OH COOH

Tromboxanos

O O H

TBXA2

OH

Leucotrieno C4

S CH2 HC CO NH CH2 COOH HN CO CH2 CH2 CH COOH NH2

11. Lpidos isoprenoides

Lpidos isoprenoides
Formados por aposicin de unidades isoprenoides:
CH3 C H 3C CH3 CH

Colesterol

HO

CHO

11-cis retinal

Unin cabeza-cola

Unin cola-cola

Lpidos isoprenoides: nomenclatura


C5 C10 C15 C20 C30 C40 Monoprenoides Diprenoides Triprenoides Tetraprenoides Hexaprenoides Octaprenoides Hemiterpenos Monoterpenos Sesquiterpenos Diterpenos Triterpenos Tetraterpenos

CH2OH

Isopentenol
H 2C

CH2 C CH2 CH2OH

CH2OH

Geraniol

CH2OH

Farnesol

Escualeno

Esteroides
Compuestos hexaprenoides estructurados en un sistema polialicclico, ciclopentano perhidrofenantreno - Esteroles o alcoholes esteroideos - Calciferoles o vitaminas D - cidos biliares - Esteroides hormonales, que incluyen: - Glucocorticoides - Mineralocorticoides - Gestgenos - Estrgenos - Andrgenos

21 22 18 19 2 3 1 4 5 10 11 9 6 12 13 14 20 23 17 16 15 27 24 26 25

8 7

HO

Numeracin

Colestanol
HO H
CH3 A B H H CH3

Serie allo

Coprostanol
HO H
CH3 CH3 H

Serie normal

A H

HO

Colesterol

OH

Colecalciferol
CH2
CH2

25-hidroxi colecalciferol

Colesterol 7-dehidrocolesterol Luz ultravioleta Colecalciferol 25-hidroxicolecalciferol 1,25 dihidroxi colecalciferol

OH

CH2
1,25-dihidroxicolecalciferol

HO

Estmulo transcripcional de sntesis de transportador intestinal de calcio

OH

COO-

c.clico
O

HO

OH

OH

CO NH CH2 CH2 S OO

c.tauroclico
HO H OH

OH

CO NH CH2 COO-

c.glicoclico
HO H OH

cido clico (visto por la cara polar)

CH2OH C O HO OH

Glucocorticoides
O

Cortisol

O HO

CH2OH CH C O

Mineralocorticoides Aldosterona

CH3 C O
Gestgenos

Progesterona

OH
Estrgenos

HO

17-b estradiol

OH

Andrgenos

Testosterona

Terpenos

Compuestos poliprenoides no esteroideos, que incluyen:


- Retinoides o vitaminas A - Tocoferoles o vitaminas E - Naftoquinonas o vitaminas K

b-caroteno

CH2OH

Retinol

11-cis retinal

CHO

CHO

todo-trans retinal

R CH NH OC HN N CH OC HN HC NH R HC R

HC

CO

CO

Unin retinal-opsina

Opsina 11-cis retinal Rodopsina (11-cis) hn Retinal isomerasa Rodopsina*

(cuanto de luz)

Impulso nervioso
todo-trans retinal

Opsina

El ciclo visual, 1

cGMP (canal inico abierto) Rodopsina*

Transducina

cGMP fosfodiesterasa 5-GMP (canal inico cerrado)

El ciclo visual, 2
Impulso nervioso

CH3 H 3C HO CH3
a-tocoferol

O
3

Peroxidacin en cadena de lpidos


O2

Radical libre lipdico, L*

Radical libre oxigenado, L-O-O*

Hidroperxido L-O-O-H Enranciamiento

Lpido intacto, L

O CH3
Naftoquinona

n O

O CH3
Menadiona

OH CH2

OH

Dicumarol
O OO O

COOHC COOCH2 HC NH3+ COO-

c. g-carboxiglutmico

O O P O16

O-

Dolicol fosfato

10. Lpidos neutros. Lpidos anfipticos

Convencin sn- para el glicerol

CH2OH HO C H CH2OH

sn-1

sn-2
sn-3

Monoacilgliceroles
CH2 O CO HOCH CH2OH
CH2OH CO O CH CH2OH

CH2OH HOCH CH2 O CO

CH2 O CO CO O CH CH2OH

CH2 O CO HOCH CH2 O CO

CH2OH CO O CH CH2 O CO

Diacilgliceroles

CH2 O CO CO O CH CH2 O CO

CH2 O CO CO O CH CH2 O CO

CH2 O CO CO O CH CH2 O CO

Triacilgliceroles

Ceras
CO O

CH3 (CH2)14 CO O

(CH2)15 CH3

Fosfatidil colina o Lecitina


CO O CH2 CO O CH O OCH3 CH3 CH2 O P O CH2 CH2 N+ CH3

cido fosfatdico

Colina

R CO O CH2 R' CO O CH O OCH3 CH3 CH2 O P O CH2 CH2 N+ CH3

Fosfatidil etanolamina o cefalina


R CO O CH2 R' CO O CH O OCH2 O P O CH2 CH2 NH3+

R CO O CH2 R' CO O CH O O-

Fosfatidil serina

CH2 O P O CH2 CH COONH3+

R CO O CH2 R' CO O CH O OHCOH CH2OH


R CO O CH2 R' CO O CH O OH COH O OHC O CO R'' CH2 O CO R''' CH2 O P O CH2 CH2 O P O CH2

CH2 O P O CH2

Fosfatidil glicerol

Difosfatidil glicerol o cardiolipina

R CO O CH2 R' CO O CH O OOH


-

Fosfatidil inositol
OH OH OH OH

CH2 O P O

OH O3P O
-

O PO3-

O3P O OH

R CO O CH2 R' CO O CH O OOH


-

O PO3

OH

CH2 O P O O3P O OH OH

IP3

Fosfatidil inositol bisfosfato

O CH2 CO O CH O OCH3 CH3 CH2 O P O CH2 CH2 N+ CH3

Plasmalgeno de colina

OH C H CO NH CH O OCH3 CH3 CH2 O P O CH2 CH2 N+ CH3

Esfingomielina

CH2OH O CH O CH2

Difitanil gliceril ter

CO O CH2 HO CH O OCH3 CH3 CH2 O P O CH2 CH2 N+ CH3

Lisolecitina

HO CH2 CO O CH O OCH2 O P O CH2 CH2 NH3+

Lisocefalina

O O S OO

Dodecil sulfato sdico (SDS)


CH3 N+ CH3 CH3

Cetil trimetilamonio (CTA)

H C OH H2N C H CH2OH
H C OH H2N C H CH2OH

Esfinganina

Esfingosina
H C OH CO HN C H CH2OH

Ceramida (N-acil esfingosina)

OH C H CO NH CH CH2 O OH HOCH2 O OH OH

Cerebrsido (b-galactosil ceramida)

Gal

4 Gal

Cer

Gala
4 Gal b
b

Glicolpidos
4 Glc b
b

GalNac
b

3 Gal

a
b

Cer

Globo

Gal

3 GalNac

4 Gal

4 Glc

Cer

Ganglio

Gal

3 GlcNac

b 3 Gal 4 Glc

b Cer

Lacto

Gal

4 GlcNac

3 Gal

4 Glc

Cer

Neolacto

Gal

3 GalNac

4 Gal 3 a NeuAc

4 Glc

Cer

Ganglisido GM1

Gal

3 GalNac

4 Gal 3 a NeuAc 8 a NeuAc

4 Glc

Cer

Ganglisido GD1

Ganglisido GD1

Monmero

Micela

Micela inversa

Monmero

Monocapa

Bicapa

Bicapa solvatada, fase cristal lquido

Bicapa solvatada, fase fluida

Fluidez de membrana en funcin de la temperatura


1

Bicapa
Fluidez de membrana (Unidades arbitrarias)

Bicapa + colesterol

0 0 1 2

Temperatura (unidades arbitrarias)

13. Aminocidos

Aminocidos
Grupo amino (protonado)

Grupo carboxilo (disociado)

COO H 3N
Cadena lateral

C H R
Carbono a

Aminocidos: estereoisomera

COOH H 2N C H R

CHO HO C H CH2OH

L-Alanina

L-Gliceraldehido

Aminocidos: estereoisomera

COO+

COOH C NH3+ CH3

H 3N C H CH3

L-Alanina

D-Alanina

COO
+

COOH 3N C H H C CH3 CH2 CH3

H3 N C H H C OH CH3

L-Treonina

L-Isoleucina

Aminocidos alifticos o neutros, 1


COO H 3N
+ -

COO H 3N
+

COOH 3N + C H CH H 3C CH3

C H H

C H CH3

Glicina Gly, G NE

Alanina Ala, A NE

Valina Val, V E

Aminocidos alifticos o neutros, 2


COOH 3N + C H CH2 CH H 3C CH3

Leucina Leu, L E

COOH 3N + C H CH H 3C CH2 CH3

Isoleucina Ile, I E

Aminocidos alifticos

Su caracterstica fundamental es la hidrofobicidad de la cadena lateral (con excepcin de G) Suelen ocupar el interior de las protenas globulares, donde contribuyen a la estructura global de la protena debido al efecto hidrofbico (micela proteica) Reactividad qumica muy escasa Glicina tiene un destacado papel estructural: suele ser invariante en series filogenticas

COO-

COOH 3N
+

COOH3 N+ C H CH2

H 3N +

C H CH2

C H CH2

Fenilalanina Phe, F E

OH

Tirosina Tyr, Y NE

NH

Triptfano Trp, W E

Aminocidos aromticos

Aminocidos aromticos
La presencia de sistemas aromticos hace que absorban luz UV en torno a 280 nm; la absorcin UV de las protenas se debe a su contenido en estos aminocidos F y W son hidrofbicos

COOH 3N
+

C H CH2OH

Serina Ser, S NE

COOH 3N + C H CH3 H C OH

Treonina Thr, T E

Hidroxiaminocidos

Hidroxiaminocidos
El grupo -OH de la serina es fundamental en el centro activo de muchas enzimas (serin proteinasas, p.e.) Forma enlaces glicosdicos con oligosacridos en ciertas glicoprotenas El grupo -OH tanto de S como de T es susceptible de fosforilacin: importante modificacin postraduccional que regula la actividad de muchas protenas

Tioaminocidos
COOH 3N + C SH H CH2

Cistena Cys, C NE

COOH 3N + C H CH2 CH2 S CH3


Metionina Met, M E

Tioaminocidos

Importante papel estructural de la cistena por la posibilidad de formar enlaces disulfuro con otro residuo de cistena La cistena participa en el centro activo de muchas enzimas La metionina es el aminocido iniciador de la sntesis de protenas (codon AUG)

Aminas secundarias (Iminocidos)

COO NH2
+

Prolina Pro, P NE

Aminocidos dicarboxlicos y amidas


COOH 3N + C H CH2 COOH 3N + COOC H CH2 CONH2

COOC H CH2 CH2 COOH 3N+

COOC H CH2 CH2 CONH2

H 3N +

c.Asprtico Asp, P NE

Asparragina Asn, N NE

c.Glutmico Glu, E NE

Glutamina Gln, Q NE

COOH 3N + C H CH2 CH2 CH2 CH2 NH3


+

COOH 3 N+ C H CH2 CH2 CH2 NH


+

COOH 3N + C H CH2 NH+ HN

Lisina Lys, K E
H2 N C

Arginina Arg, R E(?)

NH2

Histidina His, H E

Aminocidos dibsicos

Clasificacin de aminocidos segn polaridad


Aminocidos apolares o hidrofbicos: - A, V, L, I, F, W, M, P Aminocidos polares sin carga elctrica: - G, Y, S, T, C, N, Q Aminocidos polares con carga elctrica: - Aninicos (-): D, E - Catinicos (+): K, R, H

Aminocidos no proteicos: intermediarios metablicos


COO+

COO+

COO+

COO+

H3N C H CH2 CH2 CH2 NH3+

H3N C H CH2 CH2 CH2 NH

H3N C H CH2 CH2 SH

H3N C H CH2 CH2OH

O C NH2

Homocistena

Homoserina

Ornitina

Citrulina

Aminocidos no proteicos: DOPA

COO+

H 3N C H CH2

Catecolaminas

Hormonas tiroideas
HO OH

L-DOPA (dihidroxifenilalanina)

Melanina

-Aminocidos

COOCH2 CH2 NH3


+

COOCH2 CH2 CH2 NH3+


GABA g-Aminobutirato

b-Alanina

TRH (Hormona liberadora de tirotropina)

NH2 O O NH NH O N NH
Piroglutamil-histidil-prolinamida

CO N

CH2

ECA
DRVYHPFHL Angiotensina I HL

DRVYHPF
Angiotensina II

RPPGFSPFR KRPPGFSPFR

Bradiquinina Kalidina

Pptidos vasoactivos

Neurotransmisores peptdicos

YGGFL

(Leucin-encefalina)

YGGFM (Metionin-encefalina)

14. Estructura de protenas, 1

Niveles estructurales en las protenas

Estructura primaria: Secuencia de aminocidos


Estructura secundaria: Plegamiento bsico de la cadena debido a enlaces de hidrgeno entre grupos -CO- y -NHde la unin peptdica: hlices, lminas y giros Estructura terciaria: Estructura tridimensional de la protena

Estructura cuaternaria: Asociacin de distintas subunidades, siendo cada una un polipptido.

Estructura primaria
5-AAGGGTACCCAACATTTAGTT-3 3-TTCCCATGGGTTGTAAATCAA-5

DNA RNA
Protena

5-AAGGGUACCCAACAUUUAGUU-3

Lys.Gly.Ser.Gln.His.Leu.Val C

Estructura primaria de la insulina


S S S S S S

GIVEQCCASVCSLYQLENYCN

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Hoy da, la mayor parte de estructuras primarias de protenas se determina a partir de la secuencia de nucletidos en el genoma. Tcnicamente la secuenciacin de cidos nucleicos (en particular, la de DNA) es mucho ms sencilla y barata que la de protenas, estando al alcance de cualquier laboratorio.

Clculos a partir de estructura primaria


- Nmero, porcentaje y fraccin molar de aminocidos
- Frmula molecular y peso molecular

- pI (punto isoelctrico) terico


- Absorbancia molar terica

- Vida media terica


- ndices de inestabilidad e hidrofobicidad

a-Hlice
F = -57 Y= -47

Paso de rosca: 0.54 nm Traslacin por residuo: 0.15 nm Residuos por vuelta: 3.6 Enlaces H: n a n+3

Hlice 310
F = -49 Y = -26

Paso de rosca: 0.59 nm Traslacin por residuo: 0.19 Residuos por vuelta: 3

Mioglobina

Protena globular con alto contenido en a-hlice N

Fibringeno

Protena fibrosa con alto contenido en a-hlice

Colgeno

Estructuras suprasecundarias

- Hlice-vuelta-hlice - Siete hlices transmembrana y hlice anfiptica - Cremallera de leucina - Unidad bab - Meandro b - Dedo de Zn - Mano EF

Hlice-vuelta-hlice

Siete hlices transmembrana (bacteriorrodopsina)

a-hlice anfiptica

Lado hidrofbico

Lado polar

Cremallera de leucina

Motivo bab

15. Propiedades de las protenas

Protenas cidas: punto isoelctrico (pI) inferior a 7 Ricas en Asp y Glu; al pH celular presentan carga negativa neta. Protenas bsicas: punto isoelctrico (pI) superior a 7 Ricas en Arg y Lys; al pH celular presentan carga positiva neta.

En el medio biolgico, son, por lo general, ms abundantes las protenas cidas.

Muestra

Electroforesis
1. Se realiza sobre un soporte slido o semislido, para minimizar efectos de difusin 2. Se somete el conjunto a un campo elctrico constante, a un pH fijo; las protenas migran conforme a su carga elctrica

3. Terminada la carrera electrofortica, las protenas se tien con un colorante adecuado (p.e., Azul de Coomassie)

Muestra: tres componentes mezclados

Fundamento de la cromatografa
Se dispone una mezcla sobre una fase estacionaria

Fase estacionaria

Se hace fluir una fase mvil sobre la estacionaria

Dependiendo de la afinidad relativa por ambas fases, los componentes de la mezcla primitiva se separan

Fase mvil

Tipos de cromatografa
1. Intercambio inico - Separa segn carga elctrica - Fase estacionaria: grupos cargados unidos a un soporte insoluble - Fase mvil: gradiente de sal o de pH 2. Particin - Separa segn solubilidad en solventes - Fase estacionaria: Un solvente sobre un soporte slido - Fase mvil: El otro solvente fluyendo

3. Afinidad - Separa segn la afinidad de la protena por un ligando inmovilizado - Fase estacionaria: ligando unido a soporte insoluble - Fase mvil: (1) solucin sin ligando (2) solucin con ligando libre 4. Hidrofbica - Separa segn hidrofobicidad - Fase estacionaria: grupos hidrofbicos unidos a un soporte insoluble - Fase mvil: gradiente inverso de sal

5. Exclusin molecular - Separa segn tamao molecular - Fase estacionaria: dextrano o agarosa entrecruzados - Fase mvil: solucin tamponada

Intercambio inico

+ + + +

+ + + + +

+ + + + + + + +

- - -

+ + + + + + + +

- - - - - - -

Protenas adsorbidas al intercambiador inico

A baja concentracin de sal, se desprenden las protenas menos electronegativas

A mayor concentracin de sal se desprenden las protenas ms electronegativas

Cromatografa de adsorcin a colorantes


O

O CH2 N O HN NH N SO3Cibacron Blue F3GA NH SO3N

Matriz de agarosa

Cromatografa de afinidad

Cromatografa de exclusin molecular

+
+

Introduccin a la Bioenergtica

Cundo tiene lugar una reaccin qumica? (1)


- Las reacciones que tienen lugar espontneamente suelen ser exotrmicas, esto es, con desprendimiento de calor. - El calor que se desprende o absorbe en una reaccin a presin constante recibe el nombre de Entalpa (DH). Las reacciones en las que se desprende calor son exotrmicas y por convencin, la entalpa se supone negativa: DH < 0 - Sin embargo, hay reacciones endotrmicas que cursan espontneamente, DH > 0; por ejemplo, la disolucin de sulfato amnico en agua.

Cundo tiene lugar una reaccin qumica? (2)


- La disolucin de sulfato amnico en agua es un proceso por el cual se pasa de un sistema altamente ordenado, cual es el estado cristalino, a otro de mucho mayor desorden molecular. - La funcin termodinmica que mide el desorden de un sistema recibe el nombre de Entropa (DS). Puede observarse que muchas reacciones que cursan espontneamente lo hacen con incremento positivo de entropa: DS > 0.

- Sin embargo, hay procesos espontneos que cursan con disminucin de entropa, p.e.: la solidificacin del agua a 0C.

Cundo tiene lugar una reaccin qumica? (3)


- Ni la entropa ni la entalpa valen como criterio nico para definir la espontaneidad de una reaccin. - Existe otra funcin termodinmica de estado que agrupa a las dos en procesos a presin constante, la Energa Libre de Gibbs, que se define as:

DG = DH - TDS
- La energa libre de Gibbs es un criterio vlido para verificar la espontaneidad de una reaccin. Pueden cursar espontneamente aquellos procesos en los que se desprende energa libre (DG < 0); no pueden hacerlo, sin embargo, aquellos procesos en los que se absorbe energa libre (DG > 0)

Sea un sistema

La reaccin cursar de izquierda a derecha cuando las concentraciones de A y B sean tales que la energa libre del sistema sea negativa. La energa libre del sistema viene dada por: DG = DG0 + RT ln [B]

[A]

Donde DG0 es la Energa Libre Standard de la reaccin: la energa libre del sistema con los reactivos a concentracin unidad, en condiciones STP. Hay tablas que nos dan la DG0 para toda reaccin. A partir de las mismas podemos calcular si un proceso puede tener lugar espontneamente o no en unas determinadas condiciones.

Ejemplo: Calcular la energa libre del proceso de descomposicin del ster Glucosa-6-fosfato a Glucosa y fosfato inorgnico en las condiciones intracelulares, que son: Temperatura: 37 C, equivalentes a 310 K [Glucosa-6-fosfato], 1 mM [Glucosa], 0.01 mM [fosfato], 10 mM La Energa Libre Standard de la reaccin es de -3250 cal/mol

La reaccin es:
G6P + H2O G + Pi

La expresin que nos da la Energa Libre es: DG = DG0 + RT ln

[Glucosa] [Fosfato]
[Glucosa-6-fosfato]

(No se tiene en cuenta el agua porque su concentracin se considera constante) Sustituyendo, obtenemos: DG = -3250 + 1.98*310*2.303* log 10-5*10-3 10-2 Por lo tanto, en las condiciones intracelulares el proceso puede tener lugar espontneamente.

= -8900 cal/mol

Relacionado con el anterior, tendramos el siguiente problema: Cul sera la concentracin mnima necesaria de glucosa para que, siendo el resto de las condiciones iguales a las del ejemplo anterior, en la clula tuviera lugar la formacin de ster por reversin de la hidrlisis? Esta concentracin sera la que diera lugar a un valor de 0 para DG en el ejemplo anterior. As, llamando X a la conc. de glucosa,
-2 X*10 0 = -3250 + 1.98*310*2.303*log 10-3

Despejando log X obtenemos log X = 1.3 X = antilog (1.3) = 20 M

La expresin que nos da la energa libre de un proceso tiene otra importante derivacin. Para la reaccin

A
Esta expresin es:
DG = DG0

B
+ RT ln [B] [A]

En el equilibrio, DG = 0; por tanto, 0= [Beq] Pero = Keq [Aeq] DG0 [Beq] + RT ln [A ] eq

Por tanto, DG0 = -RT ln Keq

Esquema energtico del metabolismo

Estructuras complejas

Catabolismo

DG

Anabolismo

Estructuras simples

En general, podemos decir:


Reacciones catablicas: DG < 0

Reacciones anablicas: DG > 0


Supongamos una reaccin anablica mediante la cual se forma un enlace qumico entre A y B; esquemticamente,

A+B

A-B

(DG > 0)

La reaccin no puede tener lugar espontneamente. Cmo puede entonces tener lugar en el metabolismo?

Lo que ocurre en el metabolismo es que las reacciones endergnicas (DG > 0) se acoplan a reacciones exergnicas (DG < 0) de manera que : 1. La energa desprendida en una de las reacciones es absorbida por la otra. 2. La suma total de energas libres de una y otra reaccin da una DG < 0, por lo que el proceso en conjunto tiene lugar espontneamente.

As, la reaccin

A+B
Se acopla a

A-B

(DG1 > 0)

X-Y + H2O
Siendo

X + Y (DG2 < 0)

|DG2 | > |DG1|

Dando lugar a una reaccin global

A + B + X-Y + H2O

A-B + X + Y

(DG < 0)

El tipo de reaccin

X-Y + H2O

X + Y (DG2 < 0)

Que tiene lugar en los seres vivos para acoplarse a procesos endergnicos es, en la mayora de los casos, la hidrlisis de anhdridos de cido, y particularmente, la hidrlisis de polifosfatos :

O O-

O O-

O O-

O O-

R O P O P O- + H2O

R O P OH + HO P O-

El polifosfato mayoritario en las reacciones de acoplamiento energtico es el ATP, 5-Adenosina trifosfato: NH2

N O
-

O O
-

O O
-

N O N N

O P O P O P O CH2 O
-

OH

OH

De esta manera, los procesos catablicos productores de energa generan ATP, que se emplear en todas aquellas reacciones endergnicas en las que sea requerido. En general, el ATP se produce de dos maneras:

1. Por fosforilacin a nivel de substrato (procesos anaerbicos, fermentativos) Por ejemplo: La Glicolisis 2. Por fosforilacin oxidativa (procesos aerbicos, oxidativos) Por ejemplo: Ciclo de Krebs, - b oxidacin, etc.

Los dos enlaces anhdrido del polifosfato del ATP son el ejemplo de configuraciones de alta energa de hidrlisis:
O
-

O O-

O O-

O P O P O P O R O-

Existen otras configuraciones de alta energa, por ejemplo:


COO- O C O P OCH2 O-

O C CH2 O

CH3 NH

O O-

N C NH P O-

Fosfoenolpiruvato

Fosfocreatina

Consideremos ahora la reaccin de degradacin aerbica de la glucosa:

C6H12O6 + 6O2

6CO2 + 6H2O

DG0 = -684 kcal/mol

Segn lo hasta ahora expuesto, esta reaccin es fuertemente exergnica, por lo que debera cursar espontneamente.
Sin embargo, la glucosa en presencia de oxgeno es perfectamente estable y no entra espontneamente en combustin.

Metabolismo de los carbohidratos

-GLUCOLISIS ANAEROBICA O CAMINO DE EBDEM-MEYERHOFF -GLUCOLISIS AEROBICA O CICLO DE KREBS -CICLO DE CORI O LACTICO -GLUCOGENESIS -NEOGLUCOGENESIS -GLUCOGENOLISIS -CICLO DE LAS PENTOSAS

Glucolisis anaerobica

Glucolisis aerobica

Glucolisis aerobica

Metabolismo energtico: balance final de ATPs. Como ya habamos resumido anteriormente, hasta antes de ingresar a la "cadena respiratoria" tenamos un total de 4 ATPs, 10 NADHs y 2 FADHs. Si tomamos en cuenta que cada NADH equivale a 3 ATPs y cada FADH equivale a 2 ATPs, tendramos la siguiente sumatoria: 4 ATPs (de la gluclisis y formacin de Acetil CoA) + 30 ATPs (provenientes de los NADHs) + 4 ATPs (provenientes de los FADHs). Con un total de 38 ATPs como producto del metabolismo energtico de una molcula de glucosa. Fcil verdad?.

Glucogenesis

Glucogenolisis

Gluconeogenesis

Metabolismo de lipidos

Acetil Coenzima A

METABOLISMO DE LAS PROTEINAS

Metabolismo de proteinas
Transaminacin

Desaminacion

NH2 C02 + 2NH


3

C=O

NH2

Metabolismo de las proteinas

Ciclo de la Urea Ciclo del Acido rico Ciclo de la creatinina Ciclo de las Xantinas

Metabolismo de las proteinas


CICLO DE LA UREA: -Lo realizan los organismos ureotlicos,uricotlicos y amoniotlicos -Es un proceso de desaminacin del amonio a urea -En los mamferos como el hombre se realiza en el higado a fin de for mar substancias menos txicas -El cido glutmico juega un papel importante en el ciclo de la urea -Interviene la enzima glutaminasa,carbamil fosfato sintetsia(mitocon dria),Ornitina transcarbamilasa,Arginico- succinico sintetasa,Arginosuc cinasa,Arginasa

Ciclo de la urea

Metabolismo de las protenas

Ciclo de la urea

Trastornos del metabolismo de la urea

Deficiencia de ornitinatranscarbamilasa (OTC). Citrulinemia Deficiencia de arginasa Aciduria argininosuccnica Deficiencia de carbamil-fosfato sintetasa (CPS) Deficiencia de N-acetil-glutamato sintetasa (NAGS)

Acido rico

Enfermedad de la Gota

Creatinina
Deriva del metabolismo de la creatina Abunda en el msculo como fosfocreatina Es una forma de almacn energtico en el msculo Su depuracin renal es a los 25 a 30 ml/minuto de la sangre Sus cfras normales en sangre son de 25-35mgs/dl Es un parametro que nos permite indicar el grado de depuracin o filtrado glomerular y se excreta por tbulo contorneado proximal su disminucin en orina indica disminucin del filtrado con creatin mia sanguinea= insuficiencia renal.

Creatina

Introduccin a la Enzimologa

Clasificacin y nomenclatura de enzimas Reacciones enzimticas

Nombre sistemtico:

Grupo transferido

ATP: hexosa fosfotransferasa


Donador Aceptor

Nmero sistemtico Enzyme Comission

Grupo Subgrupo

EC 2.7.1.1
Sub-subgrupo

Enzima

Nombre comn: Hexokinasa

1. Oxidorreductasas
2. Transferasas 3. Hidrolasas 4. Liasas
Clasificacin de enzimas: Grupos

5. Isomerasas
6. Ligasas

Grupo 1: Oxidorreductasas
Catalizan reacciones de oxidorreduccin

Ared + Box

Aox + Bred

A : es el reductor o dador electrnico; en el curso


de la reaccin se oxida (pierde electrones)

B : es el oxidante o aceptor electrnico; en el curso


de la reaccin se reduce (gana electrones) En las reacciones redox, siempre tienen que estar presentes a la vez el aceptor y el dador electrnico.

Dador: Aceptor oxidorreductasa


Glucosa : O2 oxidorreductasa
Dador Aceptor

EC 1.1.3.4

Nombre comn: Glucosa oxidasa

Los subgrupos se forman segn la naturaleza del dador:

1.1.-.- Sobre grupos alcohol 1.2.-.- Sobre grupos aldehido 1.3.-.- Sobre grupos -CH-CHetc.

Nomenclatura alternativa en oxidorreductasas:


1. Deshidrogenasas 2. Oxidasas 3. Peroxidasas 4. Oxigenasas 5. Hidroxilasas 6. Reductasas

Grupo 2: Transferasas
Catalizan reacciones de transferencia de grupo:

A-X + B

A + B-X

Dador: Aceptor - Grupo transferido - transferasa


ATP: D-Hexosa Fosfotransferasa
Nombre comn: hexokinasa

EC 2.7.1.1

Clasificacin de las transferasas


2.1.-.2.2.-.2.3.-.2.4.-.2.5.-.2.6.-.2.7.-.2.8.-.Grupos monocarbonados Grupos aldehido o ceto Aciltransferasas Glicosiltransferasas Alquil- o Ariltransferasas Grupos nitrogenados Grupos fosfato Grupos sulfato

Grupo 3: Hidrolasas
Catalizan reacciones de hidrlisis

A-B + H2O

A-OH + H-B

No se suelen utilizar nombres sistemticos en las hidrolasas. Muchas de ellas conservan el nombre primitivo: Tripsina, Pepsina, Papana, etc.

Clasificacin de las hidrolasas

3.1.-.3.2.-.3.3.-.3.4.-.3.5.-.etc.

Esterasas (carboxilesterasas, fosfoesterasas, sulfoesterasas) Glicosidasas ter hidrolasas Pptido hidrolasas Acil anhdrido hidrolasas

Pptido hidrolasas: clasificacin comn (no sistemtica)

I. Segn la situacin del enlace atacado:


- Exopeptidasas (en los extremos de la cadena) (Peptidasas) - Endopeptidasas (en el interior de la cadena) (Proteinasas) II. Segn el mecanismo cataltico: - Serin proteinasas - Tiol proteinasas - Aspartil proteinasas - Metaloproteinasas

Grupo 4: Liasas
Catalizan reacciones reversibles de adicin de un grupo a un doble enlace:

A=B + X
COOCH CH COOFumarato (trans-) H2O

AXB
COOHO CH CH2 COOL-Malato

Algunas reacciones lisicas:

- Descarboxilasas - Aldolasas - Anhidrasa carbnica - Adenilato ciclasa

Grupo 5: Isomerasas
Catalizan reacciones de isomerizacin Algunas reacciones isomersicas: - Racemasas - Oxidorreductasas intramoleculares - Mutasas o transferasas intramoleculares

Grupo 6: Ligasas
Catalizan la unin de dos grupos qumicos a expensas de la hidrlisis de un enlace de alta energa.

A + B + ATP
O bien

A-B + ADP + Pi

C + D + ATP

C-D + AMP + PPi

Algunas reacciones ligsicas:

- Aminoacil-tRNA sintetasas - Glutamina sintetasa - Carboxilasas

Regulacin de la actividad enzimtica, 2

Suele haber fenmenos de modificacin covalente de enzimas en la respuesta celular a seales qumicas: 1. Neurotransmisores 2. Hormonas 3. Factores de crecimiento 4. Estmulos morfogenticos y de diferenciacin 5. Muerte celular programada (apoptosis) 6. Estmulos antignicos 7. Luz y otros agentes fsico-qumicos

Formas de modificacin covalente, 1


Fosforilacin: Protein kinasas
R CH N O C Ser H C H N C R' CH N

H CH2OH O H

ATP

ADP

R CH N O C Ser HC H N C R' C H N

H O CH2O P OOO H

Sobre residuos de Ser, Thr y Tyr

Formas de modificacin covalente, 2 Defosforilacin: Protein fosfatasas

R CH N O C Ser HC H N C R' C H N

H O CH2O P OOO H

H2O

Pi

R CH N O C Ser H C H N C R' CH N

H CH2OH O H

Sobre residuos previamente fosforilados: Ser-P, Thr-P, Tyr-P

Formas de modificacin covalente, 3


Adenilacin: Sistema de la Glutamina sintetasa
H 2N H O CH2 O H OH OH O P O CH2 OO N N N N

R CH N O C HC Tyr H N C R' C H N

Formas de modificacin covalente, 4

ADP-ribosilacin: acta NAD+ como donador del grupo ADP-ribosa

R CH N H O C HC H N C O R' CH N H

H2N O OH NH N C H NH2 + O O OH CH2 O P O P O CH2 OOOH N O N N N

OH

Formas de modificacin covalente, 5

Rotura proteoltica: N C Zimgeno

Proteinasa especfica
N Enzima activada C N C

Concepto de Segundo Mensajero La mayora de las seales qumicas operan sobre un receptor situado en la parte externa de la membrana. Al operar sobre este receptor determinan la aparicin en el interior celular de un segundo mensajero, que desencadena la respuesta celular a la seal. Algunos segundos mensajeros: - Nucletidos cclicos: cAMP, cGMP - Ca++ - Diacilglicerol - Inositolfosfatos - xido ntrico, etc.

E
Efector

I X

R
P

Glucgeno (n)
CH2OH H HO H OH H O H OH H O H H OH H CH2OH O H OH H O H H OH H CH2OH O H OH H O ....

Pi Glucgeno fosforilasa

CH2OH H HO H OH H O H OH H O O P OO
-

CH2OH H O H OH OH H OH H H O H

CH2OH O H OH H H OH H O ....

Glucosa-1-fosfato

Glucgeno (n-1)

Subunidad de la glucgeno fosforilasa

Activacin de la fosforilasa, 1
2 ATP Fosforilasa b Fosforilasa kinasa, activa Protein kinasa inactiva (R2C2) 4 cAMP Protein kinasa activa (2C) (cAMP)4R2 Fosforilasa kinasa, inactiva 2ADP Glucgeno Fosforilasa a Glucosa-1-fosfato

El cAMP (AMP cclico) desencadena la activacin de la fosforilasa

NH2 N O
-

O O-

O OO N N

O P O P O P O CH2 O-

ATP
OH OH

Protenas G

Adenilato ciclasa
O

NH2 N N N N

Formacin de cAMP a partir de ATP

O O
-

OH

cAMP

R
a GTP b g a GDP b b g a GTP ATP a GDP

AC

cAMP

g
Activacin de la Adenilato ciclasa

L R

Ga

AC

cAMP

PKA

FK

NH2 N N O N N

O O
-

OH

cAMP fosfodiesterasa

NH2 N O
-

Metilxantinas (p.e. cafena)

N O N N

O P O CH2 O
-

OH

OH

cAMP +
Protein kinasa A

Glucgeno sintetasa

+
Glucgeno Fosforilasa

Protein fosfatasas

cAMP fosfodiesterasa

Protein kinasas
1. Protein kinasas A (Activadas por cAMP) 2. Protein kinasas G (Activadas por cGMP) 3. Protein kinasas A (Activadas por DAG) 4. Protein kinasas dependientes de Ca++-Calmodulina 5. Protein tirosin kinasas (Factores de crecimiento, etc.)

Activaciones proteolticas

N Pepsingeno C N pH < 5

Activacin del pepsingeno


C

Pepsina

Protrombina (II)
Precursores, va intrnseca

Fase 2
Protrombinasa

Fase 1
Precursores, va extrnseca

Trombina (IIa)
Fibringeno (I)

Monmero de fibrina (Ia)

Polmero de fibrina

Fase 3

Va extrnseca

VII

VIIa

X
V

Xa
Ca++ Va Complejo protrombinasa

XII XI

XIIa XIa IX VIII X V IXa Ca++ + VIIIa Xa

Va intrnseca
Trombina

Ca++ Va

Complejo protrombinasa

Protrombina Va Ca++ S S PLP Xa Complejo protrombinasa

S S
H Trombina

Aa Bb g Aa2Bb2g2 Fibringeno

Trombina

A + Monmero de fibrina a2b2g2 B Fibrinopptidos

Aa Bb g

Fragmento C-terminal del fibringeno

Monmero de fibrina

+ -

+ + +

+ - + - + - +

- + - + - + - +

+ - + + +

+ - + + - +

Fibrina (Unin no covalente)

Lys CH

HOOC NH2

CH Glu

Factor XIII (estabilizador de la fibrina)

Lys CH

OC NH

CH Glu

Formacin de enlaces covalentes en la fibrina

Enzimas en Medicina Biotecnologa enzimtica

Enzimas en el diagnstico clnico

Existe en el suero sanguneo una gran cantidad de actividades enzimticas. De la relacin


Vmax = k+2 e0 Se deduce que la medida en suero de la actividad enzimtica es una medida directa de la concentracin de enzima en dicho medio.

Alteraciones de la concentracin enzimtica en suero, 1 1. Aumentos de la actividad enzimtica

(a). Incremento patolgico de la permeabilidad de membrana


(b). Muerte y destruccin celular

(c). Induccin enzimtica


(d). Proliferacin celular

Alteraciones de la concentracin enzimtica en suero, 2

2. Disminuciones de la actividad enzimtica (a). Intoxicaciones


(b). Enfermedades crnicas

(c). Alteraciones del estado nutritivo

Algunas enzimas con inters diagnstico

1. Aminotransferasas 2. Creatin kinasa 3. Fosfatasa alcalina 4. a-Amilasa 5. Fosfatasa cida 6. Lactato deshidrogenasa 7. g-Glutamil transferasa 8. Seudocolinesterasa

Aminotransferasas (Transaminasas)
Catalizan la interconversin reversible de aminocidos y cetocidos. Utilizan piridoxal fosfato como cofactor
COOH H2N CH R1

COOH + C O R2

COOH R1

COOH R2

C O + H2N CH

Su papel es importantsimo en el metabolismo de aminocidos. En clnica se determinan las siguientes:


EC 2.6.1.1, Aspartato aminotransferasa (AST, GOT) EC 2.6.1.2, Alanina aminotransferasa (ALT, GPT)

Aspartato aminotransferasa, EC 2.6.1.1 (AST, GOT)


COOC O +
-

COO+

COOC O CH2 COOOxalacetato

COO+

H3N CH CH2 COO

H3N CH CH2 CH2 COOGlutamato

CH2 CH2 COO-

Aspartato

a-Cetoglutarato

Aparece en citosol y mitocondrias de tejidos metablicamente muy activos. Su nivel se eleva en el suero ante afecciones hepticas y miocrdicas.

Alanina aminotransferasa, EC 2.6.1.2 (ALT, GPT)


COO+

COOC O + CH2 CH2 COOa-Cetoglutarato

COOC O CH3 Piruvato

COO+

H3N CH CH3 Alanina

H3N CH CH2 CH2 COOGlutamato

Enzima citoslica, de elevada concentracin en el parnquima heptico. Se considera casi especfica de lesin heptica.

Creatin kinasa, EC 2.7.3.2 (CK, CPK)


CH3 N CH2 COOH HN C NH2 Creatina HN C NH2 ATP ADP CH3 O O-

N CH2 CO O P O-

Creatin fosfato

Creatin fosfato es una forma de almacenamiento de enlaces ricos en energa en el tejido muscular. Es el prototipo de los compuestos conocidos como fosfgenos.

Fosfatasa alcalina, EC 3.1.3.1


O R O P O- + H2O OO R OH + HO P OO-

Hidroliza con baja especificidad fosfomonosteres, a un pH alto (de ah el nombre). No se conoce con certeza cul es su funcin metablica. Aparece en gran cantidad de tejidos.

La fosfatasa alcalina presenta varias isoenzimas: - sea - Heptica - Intestinal - Placentaria

Las ms importantes son las dos primeras. Se pueden distinguir por su termoestabilidad, siendo la sea ms termolbil.
sea: Propia del tejido seo en crecimiento y de enfermedades que cursan con neoformacin sea Heptica: Propia de las clulas del rbol biliar: se eleva en las colestasis (obstrucciones biliares) asociada a partculas de elevado peso molecular

g-Glutamil transferasa, EC 2.3.2.2 (GGT)


GSH + aa g-Glu-aa + Cys-Gly

Tiene un importante papel en el transporte de aminocidos a travs de membranas. Aparece, como la fosfatasa alcalina, en obstrucciones biliares asociada a fracciones de alto peso molecular. Es una enzima inducible, y su concentracin en suero aumenta con xenobiticos (alcohol, drogas, etc.)

a-Amilasa, EC 3.2.1.1
Es una enzima producida por las glndulas salivales y el pncreas.
Es un marcador muy importante de afecciones pancreticas agudas (pancreatitis). Puede incluso aparecer en la orina, debido a su bajo peso molecular (amilasuria)

Fosfatasa cida, EC 3.1.3.2


O R O P O- + H2O OO R OH + HO P OO-

Hidroliza fosfomonosteres con baja especificidad. Presenta varias isoenzimas, una de las cuales (Fosfatasa cida prosttica) es un marcador muy fiable del cncer de prstata y que se emplea en el diagnstico precoz del mismo.

Enzimas en Teraputica: producidas por recombinacin

Adagen (adenosine deaminase) Enzon, Inc. Autorizado su uso peditrico en inmunodeficiencias congnitas. Ceredase (alglucerase) Genzyme Corp. Autorizado su empleo en enfermedad de Gaucher tipo 1 Cerezyme (imiglucerase) Genzyme Corp. Autorizado su empleo en enfermedad de Gaucher tipo 1 Pulmozyme (Dnase) Genentech, Inc. Autorizado su empleo en fibrosis qustica Activase (recombinant alteplase) Genentech, Inc. Autorizado en infarto de miocardio y embolia pulmonar

Biotecnologa enzimtica
- Procesos industriales enzimticos: * Industrias del almidn * Detergentes * Industrias lcteas * Industrias de la fruta * Antibiticos - Biosensores y biochips

Biosensores

Anodo Ctodo Membrana de Teflon

Esquema de un biosensor de glucosa

Producto

Membrana semipermeable

Substrato

Enzima inmovilizada

Inhibicin enzimtica

Inhibidor:
Efector que hace disminuir la actividad enzimtica, a travs de interacciones con el centro activo u otros centros especficos (alostricos). Esta definicin excluye todos aquellos agentes que inactivan a la enzima a travs de desnaturalizacin de la molcula enzimtica De esta forma, habr dos tipos de inhibidores:

I. Isostricos: ejercen su accin sobre el centro activo II. Alostricos: ejercen su accin sobre otra parte de la molcula, causando un cambio conformacional con repercusin negativa en la actividad enzimtica.

Los inhibidores isostricos pueden ser de dos tipos:

1. Inhibidor reversible: establece un equilibrio con la enzima libre, con el complejo enzima-substrato o con ambos:
E+I ES + I EI ESI

2. Inhibidor irreversible: modifica qumicamente a la enzima: E+I E

Inhibicin reversible
(a) El inhibidor se fija al centro activo de la enzima libre, impidiendo la fijacin del substrato: Inhibicin Competitiva (b) El inhibidor se fija a la enzima independientemente de que lo haga o no el substrato; el inhibidor, por tanto, no impide la fijacin del substrato a la enzima, pero s impide la accin cataltica: Inhibicin No Competitiva (c) El inhibidor se fija nicamente al complejo enzima-substrato una vez formado, impidiendo la accin cataltica; este tipo se conoce como Inhibicin Anticompetitiva

S E ES
Inhibicin Competitiva

E+P

I EI
Las fijaciones de substrato e inhibidor son mutuamente exclusivas; el complejo EI no es productivo

E
I S I

ES

E+P
Inhibicin No Competitiva

EI

ESI

El inhibidor se fija indistintamente a la enzima libre E y al complejo enzima-substrato ES; ni el complejo EI ni el complejo ESI son productivos

E
I

ES

E+P
Inhibicin Anticompetitiva

ESI
El inhibidor slo puede fijarse al complejo ES; el complejo ESI no es productivo

Inhibicin Competitiva
S E ES E+P
[E] [I] Ki = [EI]

I EI
Se define una constante de equilibrio de disociacin del inhibidor:

Caractersticas: - Las fijaciones de substrato e inhibidor son mutuamente exclusivas - A muy altas concentraciones de substrato desaparece la inhibicin - Por lo general, el inhibidor competitivo es un anlogo qumico del substrato. - El inhibidor es tan especfico como el substrato

Por tanto, en la inhibicin competitiva,

1. El efecto cintico del inhibidor es el aumento aparente de la Km, que aparece multiplicada por el factor (1 + i/Ki)
2. La Vmax no aparece modificada; para concentraciones muy altas del substrato, v = Vmax, igual que en ausencia de inhibidor 3. Cuanto ms pequeo sea el valor de Ki mayor ser la potencia del inhibidor competitivo.

Inhibidores competitivos

Succinato deshidrogenasa
COOCH2 CH2 COOSuccinato SDH FAD FADH2 COOCH CH COOFumarato

COOCH2 COOMalonato

COOC O CH2 COOOxalacetato

H2N N

N H N N CO OH CH2 CH2 C NH C H O COOn

OH

c. Flico

H2N N

N CH3 N N CO OH CH2 CH2 C NH C H O COOn

Methotrexate

O HN O NH CH3
Timina Anlogos de base

O HN O NH Br

5-Bromouracilo

NH2 O HOCH2 O N

Anlogos de nuclesido

Citidina
OH OH

NH2 O HOCH2 O N OH OH

Citosina arabinsido

Un paso ms all en el desarrollo de inhibidores potentes es el concepto de Anlogo de Estado de Transicin (AET)

- El inhibidor no es estrictamente anlogo del substrato, sino del Estado de Transicin de la reaccin. - La afinidad de las enzimas por los AET es enorme, del orden nM o pM, con lo que la fijacin es tan fuerte que puede considerarse irreversible

O O2N O C O

H3C N+ CH3 CH3

Susbtrato

O C

OO

H3C N+ CH3 CH3

O2N

Estado de transicin

O
O2N OH

H3C O N+ CH3 CH3

HO

Productos

O P

OO

H3C N+ CH3 CH3

O2N

Anlogo de estado de transicin

Estado de transicin

Substrato

Anlogo de estado de transicin

COOH2C
-

Aspartato transcarbamilasa
NH2 OO

NH

OOC

O P OO-

Estado de transicin

COOH2C
-

O NH CH2 O P OO-

OOC

Anlogo de estado de transicin: N-fosfonoacetil L-aspartato (PALA)

Angiotensingeno Hipotensin, hipovolemia, ortostatismo Renina Angiotensina I DRVYIHPFHL

Enzima convertidora de Angiotensina, ECA

HL

Angiotensina II DRVYIHPF Aumento de la presin arterial

Anlogos de Estado de Transicin: Captopril


R HN R' CH COO-

C O C H NH HO C C O

CH COO-

C O H 3C C H H C H S

Zn2+
Estado de transicin de la ECA

Zn2+

Captopril

Inhibicin Irreversible
- Los inhibidores irreversibles reaccionan con un grupo qumico de la enzima, modificndola covalentemente - Su accin no se describe por una constante de equilibrio Ki, sino por una constante de velocidad ki:

E+I

- A diferencia de la inhibicin reversible, el efecto de los inhibidores irreversibles depende del tiempo de actuacin del inhibidor. - Los inhibidores irreversibles son, por lo general, altamente txicos.

Algunos tipos de inhibidores irreversibles

1. Reactivos de grupos -SH


2. Organofosfricos 3. Ligandos de metales

4. Metales pesados

Reactivos de grupos -SH, 1


(a) Agentes alquilantes

Yodoacetato

ICH2 COO-

IH

E SH
(b) Compuestos insaturados

E S CH2 COOO E S N CH2 CH3 O

E SH
O N CH2 CH3

N-Etil maleimida (NEM)


O

Reactivos de grupos -SH, 2


(c) Formadores de mercptidos
HOHg COO-

p-Hidroximercuribenzoato

SH

S Hg

COO-

(d) Oxidantes Promueven la oxidacin de dos tioles a un disulfuro

Organofosfricos
H3C Ser CH CH2
H 3C F CH3 CH P O

Ser CH CH2

OH

CH3 CH

O P O CH H3C CH3

DFP: diisopropil fluorofosfato

CH H 3C CH3

- Actan sobre enzimas sernicas - nicamente sobre la Ser activa - Insecticidas: Parathion, Malathion - Inhibidores de la Acetilcolinesterasa - Neurogases

Ligandos de coordinacin de metales


Es el caso del ion cianuro, CNSe fija con gran afinidad a la sexta posicin de coordinacin del Fe hemnico, impidiendo toda modificacin posterior. Por ello acta sobre sistemas de Fe hemnico con la sexta posicin de coordinacin libre, como la citocromo oxidasa, de lo que deriva su elevadsima toxicidad

Substratos suicidas
(Inhibidores activados enzimticamente) - Se trata de molculas que se unen al centro activo de manera especfica, igual que el substrato o los inhibidores competitivos

- Una vez unidos al centro activo, la enzima transforma la molcula en una especie qumica muy reactiva que modifica covalentemente a la enzima, inactivndola - Tienen por tanto (a) la especificidad del inhibidor competitivo y (b) la potencia de los inhibidores irreversibles

Modo de accin de los inhibidores suicidas

E+I

EI

EI*

E + I*

1. El inhibidor se fija a la enzima igual que el substrato o un inhibidor competitivo convencional 2. La accin cataltica de la enzima convierte al inhibidor I en una especie altamente reactiva I* 3. I* modifica covalentemente a la enzima, inactivndola de forma definitiva al igual que un inhibidor irreversible.

Ejemplos de inhibidores suicidas, 1


- Sistema de la b-lactamasa bacteriana La utilizacin masiva de antibiticos b-lactmicos (penicilinas, sus derivados semisintticos y cefalosporinas) ha conducido a la aparicin de resistencias a los mismos. Los microorganismos resistentes a estos antibiticos lo son por producir una enzima, la b-lactamasa, que inactiva a los antibiticos b-lactmicos.

Penicilina (activa)
R CO NH N O S CH3 CH3 COO-

b-Lactamasa

R CO NH O C HN O-

CH3 CH3

COO-

c.peniciloico (inactivo)

Muy a menudo los preparados de penicilinas o penicilinas semisintticas se formulan aadiendo un inhibidor suicida de la b-lactamasa, el cido clavulnico
O C N O COO
-

CH2OH H

b-Lactamasa

O C OHN

O C

CH2OH H

c.clavulnico

COO-

O C CH CH2 Ser O HN

O C

CH2OH H

Esta molcula reacciona con la serina activa de la b-lactamasa, produciendo su inactivacin

COO-

Ejemplos de inhibidores suicidas, 2


- Sistema de la monoamino oxidasa (MAO) cerebral

Los estados depresivos, en general, estn relacionados con un descenso en la concentracin de neurotransmisores adrenrgicos (dopamina, noradrenalina, etc.) en determinadas regiones del cerebro.
Una de las enzimas encargadas de la degradacin de estos neurotransmisores es la monoamino oxidasa (EC 1.4.3.4).

Por tanto, la inhibicin de la monoamino oxidasa se emplea como teraputica de los estados depresivos. Se han desarrollado muchos inhibidores suicidas de la MAO

Noradrenalina
HO HO CHOH CH2 NH2

O2 + H2O

Monoamino oxidasa
NH3 + H2O2
HO HO CHOH CHO

La MAO es una flavoprotena: tiene un grupo prosttico flavnico (FAD) fundamental para la catlisis. Los inhibidores suicidas de la MAO inactivan al cofactor FAD.

Dihidroxifenilglicol

O H3C E S H2C N N R N NH O

N,N dimetil propargilamina (pargilina)


HC C CH N
+

CH3 CH3

Flavina

H3C

Inhibicin suicida de la MAO mediante Pargilina

N+

CH CH CH N N R NH O NH O

H3C H3C E S H2C

Flavina modificada

Catlisis

Ea Ea DG

DG

Reaccin no catalizada

Reaccin catalizada

Enzima: Protena dotada de actividad cataltica

- Enzimas proteolticas - Desnaturalizacin de enzimas - Purificacin de enzimas - Sntesis completa de una enzima

A partir de 1982, se sabe que no todas las enzimas son protenas; existen molculas de RNA con actividad cataltica, las llamadas ribozimas

Las enzimas cumplen su papel cataltico gracias a: - Fijacin estereoqumicamente complementaria del substrato - Transformacin cataltica del mismo

En ambas funciones participan:


- Cadenas laterales de los aminocidos - Grupos o molculas no proteicas: - Grupos prostticos - Iones metlicos - Cofactores

En la catlisis qumica se distingue entre:

- Catlisis homognea, cuando catalizador y reactivos estn en la misma fase fsicoqumica: Por ejemplo, la hidrlisis cida de la sacarosa. - Catlisis heterognea, cuando catalizador y reactivos estn en distinta fase fsicoqumica: por ejemplo, la reaccin en fase gaseosa entre N2 y H2 para formar amonaco (proceso Haber), que es catalizada por metales (slidos) La catlisis enzimtica tiene caractersticas de ambas

Los siguientes hechos: - Especificidad de la reaccin enzimtica - Carcter heterogneo de la catlisis enzimtica

Nos llevan a postular la existencia de un Centro Activo en la molcula de enzima, capaz de:

- Fijar especficamente al substrato - Transformarlo catalticamente.

Lisozima y su substrato

Substrato: molcula(s) sobre la(s) que acta la enzima


Actividad enzimtica: velocidad a la que cursa la reaccin enzimtica Velocidad: variacin de la concentracin en la unidad de tiempo Unidades: katal: moles.s-1 U.I.: mmoles.min-1 (a 25C) La velocidad es directamente proporcional de la concentracin de enzima; por tanto, la velocidad es una medida de la concentracin de enzima en una preparacin.

Activador: Agente que aumenta la actividad enzimtica


Inhibidor: Agente que disminuye la actividad enzimtica

Inhibidor reversible: establece un equilibrio con la enzima: E+I EI

Inhibidor irreversible: modifica qumicamente a la enzima: E+I

Cofactor (Coenzima):

tomo, ion o molcula que participa en el proceso cataltico sin ser enzima ni substrato.
Los cofactores participan de dos maneras distintas: 1. A travs de una fijacin muy fuerte a la protena y salen sin ser modificados del ciclo cataltico 2. Como un segundo substrato; salen modificados del ciclo cataltico y por lo general requieren otra enzima para volver al estado original.

Aminocido R CH COO- + O2 + H2O NH3+

LAO

Cetocido R CO COO- + H2O2 + NH4+

LAO: L-aminocido oxidasa: es una flavoprotena Las flavoprotenas tienen un grupo prosttico flavnico, que interviene en el proceso cataltico sin salir modificado del mismo
O H3C H3C N NH N NH O

Piruvato COOC O CH3 NADH + H+ NAD+

L-Lactato

LDH

COOHO C H CH3

LDH: Lactato deshidrogenasa Utiliza como cofactor NADH, el cual sale de la reaccin oxidado a NAD+. La regeneracin a NADH requerira otra enzima.

Isoenzimas: formas moleculares distintas de una enzima dentro del mismo organismo Hexokinasa: Presenta, al menos, cuatro formas distintas - Heptica - Cerebral - Muscular - Eritrocitaria

Las isoenzimas representan formas que tienen que ver con la diferenciacin celular, presentando distintas caractersticas funcionales.

Especificidad de las enzimas, 1

Especificidad absoluta:

COOCH CH COOFumarato (trans-)

H2O

COOHO CH CH2 COOL-Malato


Enzima:
Fumarato hidratasa Especfica para el ismero trans- por un lado y para el L- por otro.

Especificidad de las enzimas, 2

Especificidad de grupo:

R CO O R' + H2O Esterasa

R COOH + HO R'

Las carboxilesterasas hidrolizan todo tipo de steres, independientemente de la naturaleza de R o R

Otras caractersticas de la accin enzimtica Eficiencia cataltica En ocasiones llega a ser enorme; con nmeros de recambio del orden de 108 s-1

Las enzimas que han llegado a este lmite reciben el nombre de Enzimas plenamente evolucionadas, ya que un incremento en la actividad no tendra sentido al superar la velocidad de difusin de los substratos.

Teoras de la accin enzimtica, 1

Modelo de Llave y Cerradura (Emil Fischer)

Substrato y enzima se acoplan de forma estereospecfica, de la misma manera que una llave se ajusta a su cerradura. Modelo aceptado durante mucho tiempo; hoy se considera insuficiente al no explicar algunos fenmenos de la inhibicin enzimtica, por ejemplo

Teoras de la accin enzimtica, 2

Modelo de Ajuste Inducido (Koshland) Tanto la enzima como el substrato sufren una alteracin en su estructura por el hecho fsico de la unin. Est mucho ms de acuerdo con todos los datos experimentales conocidos hasta el momento.

Teoras de la accin enzimtica, 3 La teora del Ajuste Inducido se ampla en la actualidad definiendo la accin enzimtica como Estabilizacin del Estado de Transicin

Segn lo cual, el Centro Activo enzimtico es en realidad complementario no al substrato o al producto, sino al estado de transicin entre ambos.

O R C O R'
Substrato: un ster

OR C O R' O-

Estado de transicin: intermediario tetradrico, inestable

O R C O
-

HO R'

Productos

Cofactores enzimticos (Coenzimas)

Cofactor (Coenzima):

tomo, ion o molcula que participa en el proceso cataltico sin ser enzima ni substrato.
Los cofactores participan de dos maneras distintas: 1. A travs de una fijacin muy fuerte a la protena y salen sin ser modificados del ciclo cataltico 2. Como un segundo substrato; salen modificados del ciclo cataltico y por lo general requieren otra enzima para volver al estado original.

Los cofactores enzimticos suelen ser molculas complejas, que nuestro organismo no puede sintetizar, por lo general. Por esa razn muchos cofactores enzimticos deben ser, en todo en parte, ingresados con la dieta; muchos de ellos son, por lo tanto, vitaminas. Ni todos los cofactores son vitamnicos ni todas las vitaminas son cofactores enzimticos

Cofactores de naturaleza vitamnica; ejemplos


1. Hidrosolubles Tiamina Riboflavina Piridoxal Cobalamina c.Ascrbico Nicotinamida c.Lipoico c.Flico c.Pantotnico 2. Liposolubles Naftoquinonas

Tiamina pirofosfato Flavinas: FAD, FMN Piridoxal fosfato Coenzimas cobamdicos Ac. Ascrbico NAD+, NADP+ Lipoamida Coenzimas folnicos Pantetenas (CoA, p.e.)
g-Carboxilacin

B1 B2 B6 B12 C PP

Cofactores de naturaleza no vitamnica: ejemplos


Hemo Complejos Fe-S Quinonas Glutatin ATP UTP PAPS S-AM Carnitina Hemoenzimas, citocromos Ferredoxinas Tr.electrnico mitocondrial y fotosinttico Redox; transporte de aminocidos Transf.de fosfato y/o de energa Transf.de grupos glicosdicos Transf.de grupos sulfato Transf.de grupos metilo Transportador de grupos acil-

Vitaminas que no forman parte de cofactores enzimticos


Liposolubles Retinoides Calciferoles Tocoferoles vit. A vit. D vit. E

Nutricin Vitaminas LiposolublesEn este grupo entran las vitaminas A, D, E y K. Las mismas son solubles en los cuerpos grasos, son poco alterables, y el organismo puede almacenarlas fcilmente. Dado que el organismo puede almacenarlas como reserva, su carencia estara basada en malos hbitos alimentarios. VitaminaFuncin (interviene en)Fuente A Intervienen en el crecimiento, Hidratacin de piel, mucosas pelo, uas, dientes y huesos. Ayuda a la buena visin. Es un antioxidante natural.Hgado, Yema de huevo, Lcteos, Zanahorias, Espinacas, Broccoli, Lechuga, Radiccio, Albaricoques, Damasco, Durazno, Melones, Mamn D Regula el metabolismo del calcio y tambin en el metabolismo del fsforo.Hgado, Yema de huevo, Lcteos, Germen de trigo, Luz solar E Antioxidante natural. Estabilizacin de las membranas celulares. Protege los cidos grasos.Aceites vegetales, Yema de huevo, Hgado, Panes integrales, Legumbres verdes, Cacahuate, Coco, Vegetales de hojas verdes K Coagulacin sangunea.Harinas de pescado, Hgado de cerdo, Coles, Espinacas

Cofactores redox
Operan en procesos de transferencia electrnica, a veces como aceptores, a veces como donadores. - Cofactores piridnicos (NAD+, NADP+) - Cofactores flavnicos - Cofactores hemnicos - Ferredoxinas - Quinonas - c. Ascrbico - c. Lipoico - Glutatin

V i t a m i n a

Funcin (interviene en)

Fuente

Participa en el funcionamiento del sistema nervioso. interviene en el metabolismo de glcidos y el crecimiento y mantenimiento de la piel.

Carnes, yema de huevo, levaduras, legumbres secas, cereales integrales, frutas secas.

B 1

Metabolismo de prtidos y glcidos Efectua una actividad oxigenadora y por ello interviene en la respiracin celular, la integridad de la piel, mucosas y el sistema ocular por tanto la vista. B 2

Carnes y lcteos, cereales, levaduras y vegetales verdes

Metabolismo de prtidos, glcidos y lpidos Interviene en la circulacin sangunea, el crecimiento, la cadena respiratoria y el sistema nervioso.

Carnes, hgado y rin, lcteos, huevos, en cereales integrales, levadura y legumbres

B 3

Metabolismo de protenas y aminocidos Formacin de glbulos rojos, clulas y hormonas. Ayuda al equilibrio del sodio y del potasio. B 6

Yema de huevos, las carnes, el hgado, el rin, los pescados, los lcteos, granos integrales, levaduras y frutas secas

c i d o f l i c o

Crecimiento y divisin celular. Formacin de glbulos rojos

Carnes, hgado, verduras verdes oscuras y cereales integrales.

CONH2 + N OH CH2 OH O O OO O H H OH OH N N OH N

NH2 N

O P O P O CH2 H

NAD+

Nicotinamida - Ribosa - P - P - Ribosa - Adenina


CONH2 + N OH O CH2 OH O OO O H H OH
-

N N N

NH2 N

O P O P O CH2 OH H

NADP+

O O P O O-

NAD+, NADP+ (Formas oxidadas)


CONH2 N

NADH, NADPH (Formas reducidas)


H H CONH2

AH2

A + H+

AH2 + NAD(P)+

A + NAD(P)H + H+

Flavina (Isoaloxazina)
O H3C N N CH2 H C OH N NH O

Riboflavina (vit. B2)

H3C

Ribitol

H C OH H C OH CH2 O OO P O-

FMN: Flavin mononucletido (Riboflavin fosfato)

Fosfato

O H3C H3C N N CH2 H C OH H C OH H C OH CH2 O OO O H H OH OH N N OH O P O P O CH2 H N NH2 N N NH O

FAD: Flavin Adenin Dinucletido

O H3C H3C N N N O H 3C H 3C N N NH O H3 C H3 C NH N NH NH O NH O NH O

Forma oxidada

Semiquinona (Radical libre)

Forma reducida

Citocromos
Son protenas de tamao pequeo, que operan como transportadores monoelectrnicos debido a una transicin

Fe2+
Se distinguen tres tipos:

Fe3+

1. Citocromos A: Alto potencial redox (transportadores terminales) 2. Citocromos B: Bajo potencial redox 3. Citocromos C: Potencial redox intermedio (Se distinguen por su espectro caracterstico de absorcin)

Citocromo c

Cofactores quinnicos
O OH

Quinona

OH

Hidroquinona
AH2 A

O CH3 CH3 O O O CH3 CH3

Ubiquinona (Coenzima Q)

OH H H2C C HO HO

O O

OH H H2C C HO

O O

OH

AH2

cido Ascrbico (vit. C)

COOH S S

c. Lipoico

Lipoamida
CO CH

Lys

NH

AH2
A

S S

CO SH SH

NH

CH

Lys

Dihidrolipoamida

Glutatin: g-Glu-Cys-Gly (forma reducida, GSH)


COO+

g-Glu-Cys-Gly S
COO+

H3N C H CH2 CH2 CO NH CH CO NH CH2 COOH CH2 SH

H3 N C H CH2 CH2

S g-Glu-Cys-Gly
CH2 S S CH2

CO NH CH CO NH CH2 COO-

CO NH CH CO NH CH2 COO-

2GSH + A

GSSG + AH2

CH2 CH2 H3 N C H COO


-

Glutatin: forma oxidada, GSSG

CH2 CH2OH H3C N H3C N CH2 N


+

Tiamina (vit. B1)

O H3C N H3C N CH2 N


+

O O-

CH2 CH2 O P O P OOS

Tiamina pirofosfato, TPP

CHO HOH2C N OH CH3

Piridoxal (vit. B6)

CHO HOH2C N

O O P OOCH3
Piridoxal fosfato

CHO HOH2C N

O O P OO CH3
-

CH2NH2 O HOH2C N O P OOCH3

Piridoxal fosfato

Piridoxamina fosfato

Pteridina
H2N N OH N N H N N CO OH CH2 CH2

4-amino benzoico

C NH C H O COOn

c. Flico

Poliglutamato

H2N N

N H N N CO OH CH2 CH2 C NH C H O COOn

OH

c. Flico

Folato reductasa

Methotrexate
H2N N OH N N H NH N CO OH CH2 CH2 C NH C H O COO
-

c.Tetrahidroflico, THF
H2N N OH N NH H NH N CO OH CH2 CH2 C NH C H

DHF Reductasa

COOn

c.Dihidroflico, DHF

H2N N

NH N

OH

H2C N

CO CH2 CH2 C NH C H O COO-

OH

N5,N10 Metilen THF

H2N N

NH H N N CO OH CH2 O CH2 C NH C H O COOn

OH H

N5 Formil THF

CH2CONH2 H NH2COCH2 N H3C NH2COCH2CH2 CH3 H NH2COCH2 H CH2 CH2 N CO O NH H CH2 H3C CH O OH P O OH O H CH3 H CH2OH N CH3 H3C CH3 NC Co+ N H3C CH3 N N H CH2CH2CONH2 CH3 H CH3

CH2CH2CONH2

Cobalamina (vit. B12)

HN

NH

Biotina
COOH

CO2

O HO C N NH

Carboxibiotina
S COOH

OC HN NH HN S CO NH CO Lys CH NH OC CH R' HN CH R

Biotinil- protena

c. Pantoico
CH3

b-Alanina

CH2OH C CHOH CO NH CH2 CH2 COOH CH3

c. Pantotnico

CH3 CH3

c. Pantotnico

Cisteamina

CH2OH C CHOH CO NH CH2 CH2 CO NH CH2 CH2 SH

Pantetena

Pantetena
H HS N C O

ADP
N O H H OH N N NH2 N

H HO H O O N C O P O P O CH2 OOO H3C CH3 H H OH

Coenzima A

O
-

O O-

O O H H OH OH N OH

NH2 N N

O P O P O P O CH2 OH

5- Adenosina trifosfato (ATP)

ACIDOS NUCLEICOS

Bases Nitrogenadas

DNA

RNA : tipos

Hemostasia

Vias de la coagulacin

Coagulacin

Hemostasia

HEMOSTASIA