Está en la página 1de 443

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

21al23deSeptiembrede2011 Tuxpan,Veracruz,Mxico ISBN:9786070044489


JUNTOSHACIAUNNUEVOPARADIGMAENDONDEELAMBIENTESEALA PRIORIDAD

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Los seres humanos estn sentados en una bomba de relojera. Si la mayora de los cientficos del mundo tienen razn, nos quedan apenas diez aos para evitar una catstrofedegrandesproporcionesquepodrahacerentrarel climadelplanetaenunaespiraldestructivacontemperaturas extremas,inundaciones,sequas,epidemiasyoleadasde calor hasta ahora desconocidas. Una catstrofe preparada porloshombres AlGore Unaverdadincmoda

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

NOTAIMPORTANTE:

Para la edicin de los artculos extensos que a continuacin se presentarn, en fechas anteriores fue proporcionada a los autores los lineamientos sobre la escritura de los mismos, con la finalidad de homogenizar el documento. En mayoradelostrabajoslosautoresseapegaronaestoslineamientos,llegandoen unoscasosacuerdostomadosconlasinstitucionesparaciertasmodificacionesa estoslineamientosdeacuerdosalosprogramasdecadaunodeellos,enalgunos casos,loseditoresacordaronrealizarciertosajustesenalgunosartculosqueha juicioeras necesariorespecto ala ortografa. Es deimportancia comentar que el contenidooriginalnosemodificdandoelcrditototalalosautores.

LosEditores

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

UniversidadVeracruzana
Tuxpan de Rodrguez Cano, ciudad y puerto del norte del Estado Mexicano de Veracruz, est ubicada en la regin conocida con la Huasteca a 191 km al sur de Tampico,a60kmalnortedePozaRicaya320kmdelaCiudaddeMxico.Txpan tiene una poblacin aproximada de 100,000 habitantes. La ciudad se encuentra ubicadaaorillasdelroTuxpan,a11kmdesudesembocaduraenelGolfodeMxico. Sus grandes extensiones litorales de playa hacen de Tuxpan un atractivo turstico importantelocualhacedisfrutardelsol,delmarydelanaturaleza.Elusoadmitedos formas de escritura: "Tuxpan", que est ms acorde con la toponimia de origen nhuatly"Txpam". En este hermoso Puerto de Tuxpan, la Universidad Veracruzana en el ao de 1979 establecealaFacultaddeCienciasBiolgicasyAgropecuarias,considerandoelgran potencialdelasactividadesdelazonacomolapesca,laganaderaylaagricultura, adems de la importancia creciente de su actividad portuaria por ser el puerto ms cercanoalaciudaddeMxico.

Como una de la misin importante de la Facultad de Ciencias Biolgicas y Agropecuariasypartedelcompromisosocial,surgeenelaode2005elPrimerForo Biolgico Agropecuario en donde en la primer experiencias se tuvo la asistencia de diferentes investigadores nacionales e internacionales, as en el ao de 2007 se convoca y se realiza el Segundo Foro Internacional Biolgico Agropecuario, posteriormente y con frecuencia de dos aos se ofrece el Tercer Foro Internacional Biolgico Agropecuario, para llegar al 2011 con el 4to. Congreso Internacional BiolgicoAgropecuario. Tomando en consideracin la gran diversidad de temticas del Biolgico Agropecuario, englobamosel 4to. Congreso Internacional Biolgico Agropecuario en lossimposiosde:AgronomayAgronegociosInternacionales,MedicinaVeterinariay Zootecnia, Biologa y Biologa Marina, en donde se podrn incluir temticas muy variadasdecadaunodelossimposios. Es de gran orgullo para la Facultad de Ciencias Biolgicas y Agropecuarias de la Universidad Veracruzana organizar el 4to. Congreso Internacional Biolgico Agropecuario.Creemosfirmementequelaconvivenciaentrelossaberesnosdejarn experienciasmuygratasenelquehaceracadmicocientfico.

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

COMITEDITORIAL

DIRECTOR
DR..PABLOELORZAMARTNEZ

EDITOR DR.PABLOELORZAMARTNEZ COEDITOR


I.S.C.RUBNDAROLPEZCASTRO

AUTORES
MTRO.AGUSTNDEJESSBASEZ MUOZMTRO.JULIOCSARGONZLEZ CRDENASM.V.Z.GARCEZMERCADONORA

COMPILADOREZ
DR.ARTUROSERRANOSOLS MTRA.MARISELALPEZORTEGA

RECOPILADOR MTRO.JOSLUISALANS
MNDEZ
,

ISBN 9786070044489

UNIVERSIDADVERACRUZANA FACULTADDECIENCIAS BIOLGICASYAGROPECUARIAS CAMPUSTUXPAN

TUXPAN,VER.MXICOSEPTIEMBREDE2011

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

NDICE(EXTENSOS)

(SMVZ01) Deteccin de coproantgenos de fasciola heptica en bubalus bubalis(bfalosdeagua)medianteunSandwichElisaFascidig


Fontes Phortos Placido Francisco, Zumaquero Ros Jos Lino* y Abel Valenzuela Loranca*,***SarracentPrezJorge..1

(SMVZ02) Estudios parasitolgicos en poblaciones de primates mexicanos enlibertad:tendenciasobservadas


Milagros Gonzlez Hernndez , Julio Garca Hernndez , Evangelina Romero Callejas , David Osorio
1 3 Sarabia , 1* 2 2

Dora

Romero

4 Salas

Domingo

Canales

Espinosa .....................................................9

(SMVZ03) Fertilidad de vacas y novillonas Beefmaster en pastoreo tropical servidasartificialmenteatiempofijo


E Nochebuena*, IC Daniel, B Alarcon y MA

Lammoglia.16

(SMVZ04)Factoresderiesgoasociadosalainfeccindetoxoplasmosisen caprinosycaprinocultoresdeYecuatla,Veracruz
1 1 1 Mariel AguilarDomnguez *, Dora RomeroSalas , Violeta PardoSedas , Zeferino Garca 2 3 3 4 Vzquez , Dolores CorreaBeltrn , Heriberto CaballeroOrtega Francisco OleaPopelka , 4 MoSalman .27

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 06)Correccin de problemas dentales de chinchillas (chinchilla

langera)enuncriaderodecajeme,Sonora
2 1 1 LpezGutirrez,RosaMelissa ,MirandaRomero,AnaLaura .,JimnezNevrez,Ricardo .,

ngelesDelaLlave.,Isabel 1 33

(SMVZ 07) Estudio epidemiolgico para la prevencin de la rabia paralitica bovinaenlazonanortedeVeracruz


Luis Gustavo Aguilera Benavides*, Jos Luis Soto Loya, Enrique Martnez Lpez, Fabiola CortesMrquez...................................................................................................40

(SMVZ 08) Resistencia mltiple de rhipicephalus (boophilus) microplus a ixodicidasenbovinosdeActopanyVeracruz,ver.,Mxico


1 1 1 1 Fuentes Manzo Y. , Peniche Cardea A.E.J. , Martnez Herrera D.I. , Romero Salas, D. , 1 2 3 3 Schleske Morales, I. , Soto Rodrguez, I. , Rosado Aguilar J.A. . Rodrguez Vivas, R.I. y BarradasPia.F.T....50

(SMVZ09)Indicadoresproductivosdeovejaspelibueyycruzascomerciales enunsistemaintegraldemanejoentrpico
1* 1 2 Cristel Ishikary Villegas Martnez , Braulio Aedo y Loya , Sara Olazarn Jenkins , Nora 1 2 GarcezMercado ,JorgeVctorRoseteFernndez ..56

(SMVZ10)Diarreaviralbovina yrinotaqueitisbovinainfecciosaencrvidos exticosdeTamaulipas,Mxico


1 1 2 3 Christian Bautista P. Dora Romero S. Zeferino Garca V J. Alfonso Ortega S Antonio 4 CantC ...............................................................................65

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 11) Agentes bacterianos aislados en pulmones neumnicos, de cerdos sacrificados en el rastro municipal de crdoba, ver. durante el periodoprimaveral
Juan Miguel PrezEnriquez *, Gil Josu GonzalezVicencio, Gerardo Olmedo Prez....71

(SMVZ 12) Prevalencia e identificacin de factores de riesgo de

cryptosporidium spp. en becerras de Veracruz y de la comarca lagunera,


Mxico
1 1 2 Oscar GodoySalinas , Dora RomeroSalas , Zeferino GarcaVzquez , Bernab Chavarra

Martnez...79

(SMVZ 13) Escherichia coli O157:H7 en canales de bovinos del centronorte delEstadodeMxico
1

Nydia Edith ReyesRodrguez*, 1Martn TalaveraRojas, 1Adriana del Carmen Gutirrez 1 1 1 Castillo, Mara Uxa AlonsoFresn, Jorge Antonio VarelaGuerrero, Vicente Vega Snchez....85

(SMVZ 14) Identificacin de indicadores de calidad de carne en rastros municipalesenMxico


Alejandra Vlez izquierdo * Jos Antonio Espinosa Garca , Georgel Moctezuma Lpez , 3 4 1 JosLuisJolalpaBarrera ,MagalyMontserratPrezDaz ,DiegoBraaVarela ,Guillermina 3 MartnezTrejo ..94
1 1 2

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 15) Seroprevalencia y factores de riesgo asociados a leptospirosis bovinaenelcentrodelestadodeVeracruz


1 2 1 1 AnabelCruzRomerol *,DoraRomeroSalas ,SilviaLpezOrtiz ,MartnMendozaBriseo , 3 ZeferinoGarcaVzquez ,JorgeNoriegaLoyo ................103

(SMVZ16)SeroprevalenciadeinfeccinporHerpesvirusbovinotipo1(bohv 1)enbfalosdeagua(bubalusbubalis )enVeracruz,Mxico


Domnguez Aguilar, Gladys. Romero Salas, Dora. Garca Vzquez, Zeferino. Martnez Herrera,DavidI..109

(SMVZ 20) Prevalencia de cryptosporidium spp. en becerros de doble propsitoendosmunicipiosdelcentrodeVeracruz,Mxico


1 1 1 AnaLauraLunaEspinosa ,DoraRomeroSalas ,VioletaT.PardoSedas , 2 ZeferinoS.GarcaVzquez ..117

(SMVZ 21) Control integrado de boophilus microplus y la mitigacin de la resistenciaalosacaricidasenelestadodeguerrero,Mxico


*Rodrigo RosarioCruz , Delia Ins DomnguezGarca , Elas HernndezCastro , Isidro 3 4 GutirrezSegura , Fernando TorresAgatn , Emiliano Fitz 4 Snchez .........................................................123
1 2 2

(SMVZ22)Alimentacinartificialenabejas(apismellfera)enelapiariodela facultaddecienciasbiolgicasyagropecuariascampusTuxpan
LuisGustavoAguileraBenavides*,PaulaRojasMencio,NormaGabrielaCruzCortez,Amalia Cabrea Nuez, Jos Luis Soto Loya, Agustn de Jess Basez Muoz.....132

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ23)Sincronizacindeestroenovejasdepeloutilizandoesponjasde fabricacinartesanalimpregnadasconMap
1

Numa Pompilio CastroGonzlez, 1Eduardo MndezRojas, 2Juan de Dios Rodrguez


1

Guerrero,

Marcelino

BecerrilHerrera,

Marcos

PrezSato,

Abel

Flix

Flores

Garrido 133

(SMVZ 24) Efecto del tiempo y temperatura de almacenamiento sobre las caractersticasfsicasymicrobiolgicasdelhuevolavadoparaplato
1 1 1 1 1 1 * Figueroa S.F. , Prez L.C. , Barreras S.A. , Snchez L. E , Olivas V. J. A , y Jurez C. 2 L.D. ............................................................................................................140

(SMVZ 25) Identificacin de endoparsitos que se encuentran en la Nutria Neotropical (Lontra longicaudis ) en el Sistema Lagunar de Alvarado, Veracruz
1 1 1 Rosa Mara Lpez Castro Arturo Serrano Iliana del Carmen Daniel Rentera Enrique 1 MartnezLpez ...145

(SMVZ 26) Sistema de produccin ovina una alternativa de desarrollo rural sostenibleparafamiliasdebajosingresos
NietoRosalianoSo*,CabreraNezA,GarcezMercadoN,DazInocencioDLGonzalezSalas Ma.....146

Ph.D. Fernando Figueroa Saavedra. Instituto de Investigaciones en Ciencias Veterinaerias. Universidad Autnoma de Baja California. Alvaro Obregn y Julin Carrillo S/N. Col. Nueva. Cp. 21100.Mexicali,BajaCalifornia. Correo:fernando_figueroa@uabc.edu.mx

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ27)Engordadecorderosenconfinamientocondiferentesnivelesde inclusindehenodemorera(Morusalba)
1* 1 1 ArmandoArrietaGonzlez ,ClaudioViteCristobal ,KarlaLissetteSilvaMartnez ,Eucadio 1 CruzOsorio .150

(SMVZ 29) Proyectos de intervencin. Una propuesta para impactar positivamenteenlossistemasdeproduccin


1 1 Olmedo Prez. G. Gonzlez Vicencio: G.J. Elorza Martnez 1 P ......157

(SMVZ 30) Comparacin de tasa de preez y das de gestacin de vacas sincronizadas y monta natural en 120 das de empadre en un rancho comercialenelNortedeVeracruz
1 1 H Espinoza*, IC Daniel , A Cabrera y MA 1 Lammoglia ......................................167

(SMVZ31)Fertilidadafectadapornmerodeserviciosylactanciasenvacas HolsteindelcentrodelaltiplanodeMxico
YJ Cabrera*,
1

1 Cabrera ,

IC

1 Daniel

MA

Lammoglia ........179

(SMVZ 32) Comportamiento de la produccin y precio de la leche en tres pocasdelao


2 Jess Oros Noyola Jess 1, Nayib Bechara Acar Martnez y Maximino Zito Romero 2 Figueroa ....189

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 33) Efecto de la aplicacin de clorhidrato de naloxona sobre el dimetroyeldescensotesticularenconejosprepuberes


Juana Ortega Mondragn, Marcelino Evodio Rosas Garca, Marco Antonio Fajardo Romn, FabiolaPinedaRamrezyLuciaGuadalupeRamrezMedel......194

(SMVZ 34) Validacin de raciones formuladas por programacin lineal a mnimocostoconSolver


1 2 Maximino Zito Romero Figueroa , Jos Antonio Fernndez Figueroa , Cuauhtmoc Landa 2 Torrealba , 1

Javier

Francisco

Enrquez

Quiroz ....200

(SMVZ 37) Ganancia diaria de peso y rentabilidad de inocular microflora ruminalenbecerrosdecrianzaartificialeneltrpico


2 1 Jos Antonio Fernndez Figueroa , Maximino Zito Romero Figueroa , Moiss Palacios 2 1 Rosas ,JavierFranciscoEnrquezQuiroz .....205

(SMVZ38)CalidaddeCalostroeInmunidaddeBecerrosNeonatosBrahman enlaRegindeTuxpan,Veracruz
1 1 1 AL Leal *, IC Daniel , MA Alarcon , A Cabrera y MA 1 Lammoglia .210

(SMVZ41)Produccindeunbiosolapartirdelacodigestindesangrede cerdoconestircoldevaca
J. GarcaTolentino, R. VillegasCardenaz, M.A. IbarraIslas, D.J. PimentelGonzlez, A. QuinteroLira,A.D.HernndezFuentes*...217

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 42) Diagnstico molecular por PCR de un caso clnico de Tumor VenreoTransmisibleCanino(TVTC)delocalizacinextragenital
Elfego Cuevas Domnguez 1 Jos Simn Martnez Castaeda 2 Iliana del Carmen Daniel , , 1 2 Renteria ,LindaGuilianaBautistaGmez .223

(SMVZ 43) Produccin de componentes lcteos por lactacin de diferentes cruzasdeHolsteinySuizoPardoporCebenclimasubtropical


Julio Csar VinayVadillo*, Juan ZarateMartnez, Benjamn PiaCrdenas, Patricia CervantesAcosta....231

(SMVZ 44) Spirocercosis, presentacin de dos casos clnicos en Tuxpan Veracruz,Mxico


FabiolaCortesMrquez*...241

(SMVZ45)Vigilanciaepizootiolgicadelarabiaparaliticabovinaenlazona nortedeVeracruz
Jos Luis Soto Loya*, Enrique Martnez Lpez, Fabiola Cortes Mrquez, Luis Gustavo AguileraBenavides ....251

(SMVZ 46) Calidad sanitaria de la leche de explotaciones en transicin orgnicadeTecpatnChiapas


1 2 1 Bernardo Snchez Muoz , Jose Nahed Toral , Jos Luis Cruz Lpez , Jorge Luis Ruiz 1 1 Rojas , Alberto Manzur Cruz , Miguel Angel Orantes 1 Zebadua ...259

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 50) Inhibidores de hidroximetil glutaril coenzima a (hmgcoa) en el comportamientoproductivoymicrobiolgicoruminaldeovinos


*1 2 3 Dr. Marcos PrezSato , Dr. Germn BuendiaRodrguez , Idania AvelinoSuarez , M.C 1 1 1 Eutiquio SoniGuillermo , M.C Ramiro EscobarHernndez , Dr. Marcelino BecerrilHerrera , 2 1 1 Abel Flix FloresGarrido , Numa Pompilio CastroGonzlez , Pablo Zaldvar Martnez......268

(SMVZ 51) Sensibilidad in vitro de cepas de escherichia coli hemoltica aisladasdecanalesdebovinosenelestadodeMxico


1

SaulAguilarMontesdeOca*,MartnTalaveraRojas,AdrianadelCarmenGutirrezCastillo, Nydia Reyes Rodrguez, Jorge Varela Guerrero.....277

(SMVZ52)Produccindebiogsygeneracindeenergaelctricaapartirde desechosdebovinos
EduardoGuillermo CanudasLara , Eduardo David Canudas Hawks , Adrin VidalSanto y Francisco Indalecio Jurez 1 Lagunes .....287
*1 2 3

(SMVZ53)Engordadecerdosconcabellodengel(Calliandracalothyrsus ) ensustitucinparcialdepastadesoya
ClaudioViteCristbal *,EnriqueTllezTllez ,RicardoBustosHernndez .294
1 2 1

(SMVZ 54) Caractersticasdetres unidades deproduccin familiar ovina en lamixtecapoblanabajocondicionessilvopastoriles


1 1 *Jorge Ezequiel Hernndez Hernndez , Francisco Javier Franco Guerra , Julio Cesar 1 1 Camacho Ronquillo , Oscar Villarreal Espinobarros , Jenny Hernndez 2 Riande .301

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 55) Produccin ovina estacional a pequea escala en el ejido de SantaMaraMazatla,Jilotzingo,estadodeMxico


1 1 1 Dolores Noem vila Ramrez , Alejandro Lara Bueno , Laskmi Krishnamurthy , 2 3 FranciscoEspinosaAvia ,JorgeA.Escutia ..308

(SMVZ56)FrecuenciadeEhrlichiacanis enperrosdomsticosdelaciudad deXalapadeEnrquez,Veracruz


1 1 2 Christian Gerardo Martnez Lpez , Gerardo Olmedo Perez , Rodolfo Ramos Beltrn , 2 EduardoGazolPatio ....325

(SMVZ 58) Principales partes de la planta que consumen las cabras del componenteleosopresenteenlamixtecapoblana,Mxico
Jorge Ezequiel Hernndez Hernndez , Francisco Javier Franco Guerra , Julio Cesar 1 1 Camacho Ronquillo , Oscar Agustn Villarreal Espinobarros , Denis Hernndez 2 Riande ...336
1 1

(SMVZ59)InmunizacindebovinosintroducidosenelnortedeVeracruzcon unavacunainactivadacontraAnaplasmamarginale
1* 1 2 3 2 2 Alprez MF , Rosas PJ , PreciadoTJF , Rivera HV , Rodrguez CSD , Barrera M A I , Rojas 2 2 RE yGarcaOMA ..345

NDICE(RESUMENES)

(CMVZ 01) Digestibilidad in situ de la materia seca de dos dietas y de dos esquilmosagrcolas
Viridiana Prez Montiel*, Marcos Prez Sato, Germn Buenda Rodrguez, Laura Salgado Rosas, Eutiquio Soni Guillermo, Marcelino Becerril Herrera, Ramiro Escobar Hernndez, Abel Flix Flores Garrido, Numa pompilio Castro Gonzlez.351

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 02)Utilizacin de un Adrenrgico vs Vasodilatador en el ComportamientoProductivoenOvinosdePelo


UrsulaAndreaMacuilPriego,MarcosPerezSato,GermnBuendaRodrguez,EutiquioSoni Guillermo, Marcelino Becerril Herrera, Ramiro Escobar Hernandez, Abel Flex Flores Garrido,NumaPompilioCastroGonzalez...353

(CMVZ03)Efectodeunacelulasaenelcomportamientoproductivodeovinos alimentadoscondosesquilmosagrcolas
Miguel Alejandro Cabrera Cruz*, Marcos Prez Sato, Marcelino Becerril Herrera, Eutiquio Soni Guillermo, Ramiro Escobar Hernndez, Numa Pompilio Castro Gonzlez, Abel Flix FloresGarrido......355

(CMVZ 04)Efecto del uso de maz (Zea mays), papa (Solanum tuberosum) y manzana(Maluspumila)comosuplementoalimenticiodeovejasalempadre
BlancaSofaMurilloMartnez*,AgustnGonzlezAzpiroz,NumaPompilioCastroGonzlez, Marcelino Becerril Herrera, Marcos Prez Sato, Ramiro Escobar Hernndez, Eutiquio Son Guillermo ...357

(CMVZ05)BloquesMultinutricionalescomoalternativadesobrealimentacin enlaltimaetapadegestacinenovejasdepelo
Juan Carlos Soriano Martnez, Daro Cortez Rodriguez, Numa Pompilio Castro Gonzlez, Marcelino Becerril Herrera, Abel Flores Garrido, Son Eutiquio Guillermo.......359

(CMVZ 06) Comparacin de dos anablicos no esteroidales en bovinos de engordaenpastoreo


Rebeca Hernndez Roque*, Marcelino Becerril Herrera, Marcos Prez Sato, Eutiquio Son Guillermo, Ramiro Escobar Hernndez, Numa Pompilio Castro Gonzlez, Abel Flix Flores Garrido361

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 07) Crecimiento de ajolotes (ambystoma mexicanum), con dos tipos dealimento,enelmunicipiodePuebla,Pue
Adrin Muoz Cuautle*, Marcelino Becerril Herrera, Marcos Prez Sato, Eutiquio Son Guillermo, Ramiro Escobar Hernndez, Numa Pompilio Castro Gonzlez, Abel Flix Flores Garrido ....363

(CMVZ 08) Infestacin de varroa destructor en coloniasde apis mellifera en lasierranororientaldelestadodePuebla


Ricardo Alcaide Tlatenchi, Abel Felix Flores Garrido, Marcelino Becerril Herrera, Marcos Prez Sato, Ramiro Escobar Hernndez, Pablo Zaldivar Martnez, Numa Pompilio Castro Gonzlez....365

(CMVZ 09) Leguminosas nativas, una alternativa de alimentacin en el trpicoMexicano


Leonardo David Santiago Fernndez, Amalia Cabrera Nez, Diana Laura Daz Inocencio.....366

(CMVZ 10) Efecto de de la raza sobre la calidad y conservacin del semen descongeladodetoro
Crdova Izquierdo*, Xolalpa Campos Vctor Manuel, Corts Surez Sal, Saltijeral Oaxaca JorgeAlberto,RuizLnagGustavo,MndezMendozaMaximino,HuertaCrispnRubn,Villa Mancera Abel, Crdova Jimnez Cristian Alejandro, Jurez Mosqueda Ma. de Lourdes, ReyesGamaRanulfoSnchezAparicioPedro,GutirezLianJosLuis,GuerraLieraJuan Euologio...367

(CMVZ11)Efectodelacargaanimalenlacomposicinqumicadegramneas nativaseneltrpicohmedo
Abel Flix Flores Garrido*, Epigmenio Castillo Gallegos, Jess Jarillo Rodrguez, Ramiro Escobar Hernndez, Marcos Prez Sato, Numa Pompilio Castro Gonzlez.....368

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 12) Produccin y calidad nutritiva de cuatro ecotipos de cajanus cajan(l)millsp,enzonadecostamontaa


Eloy Luna Barba, Ramiro Escobar Hernndez, Jess Jarillo Rodrguez, Abel Felix Flores Garrido, Numa Pompilio Castro Gonzlez, Marcelino Becerril Herrera, Marcos Prez Sato, EutiquioSonGuillermo....369

(CMVZ 13) Evaluacin de dosis de Clorhidrato de Ractopamina en el comportamientoproductivodepollosenetapadeiniciacinengorda


Guadalupe ChilacaCuateco, Eutiquio SonGuillermo, Germn BuendaRodrguez, Marcos PrezSato1, Marcelino BecerrilHerrera1, Ramiro EscobarHernndez1, Abel Felix Flores Garrido,NumaPompilioCastroGonzlez..370

(CMVZ 14) Respuesta productiva con diferentes niveles y tamaos de fibra enconejosNuevaZelanda
Imelda Hernndez Jimnez, Eutiquio SonGuillermo*, Germn BuendaRodrguez, Marcos PrezSato, Marcelino BecerrilHerrera, Ramiro EscobarHernndez, Abel Felix Flores Garrido1, Numa Pompilio Castro Gonzlez...371

(CMVZ 15) Niveles de inclusin de levadura saccharomyces cerevisiae en dietasparapolloenperiodosdeiniciacinengorda


EutiquioSonGuillermo,AnaElviraCarmonaflores,MarcosPrezSato,MarcelinoBecerril Herrera, Ramiro EscobarHernndez, Abel Felix FloresGarrido1, Numa Pompilio Castro Gonzlez1,PabloZaldivarMartnez1,...372

(CMVZ 16) Evaluacin organolptica en queso fresco adicionado de lactoprotenas


Patricia Mora Medina, Juan David de la O Albarrn, Jos Dobler Lopz, Marcelino Evodio RosasGarca.373

(CMVZ 17) Seguimiento al cumplimiento total de los requisitos higinico sanitariosenunaplantaqueprocesabarbacoaenelestadodeMxico


Mara Guadalupe Galvn Orozco, Patricia Mora Medina, Marcelino Evodio Rosas Garca..374

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 18) Diagnstico de situacin sanitaria, segn normatividad vigente, enunestablecimientoqueprocesabarbacoaenelestadodeMxico


1 Mara Guadalupe Galvn Orozco* , Marcelino Evodio Rosas Garca 2, Patricia Mora 1 Medina .................376

(CMVZ 19) Comparacin del peso y el rendimiento de la canal de ovinos Columbiaalimentadoscondietascomercialesydietasintegrales


MarcoPoloReynaZiga*,GabrielaTelloCristiany,AndrsCardonaLeija,MarcelinoEvodio Rosas Garca, Patricia Mora Medina...............378

(CMVZ20)Mezclasdepastosysuinfluenciaenlaproduccindeforraje
Javier Castillo Huchim, Fernando Rivas Pantoja, Luis Ortega Reyes 380

(CMVZ21)Lacalidaddelosembrionesderataesdependientedelasdosis degonadotropinasutilizadasentratamientossuperovulatorios
Miguel ngel Cornejo Corts, Mara Carmen Snchez Torres, Juan Carlos Vzquez Chagoyn, Hctor Mauricio Surez Gmez, Germn Isauro Garrido Faria, Marco Antonio MerazRos....390

(CMVZ22)Estudiohistomorfolgicoeinmunohistoqumicodereceptoresa progesteronayestrgenosdelastubasuterinasdecerdas
Miguel Angel Cornejo Cortes,IldebertoSnchez Herrera, Mara ElenaTrujilloOrtega,Mara de Lourdes Jurez Mosqueda, Santiago Ren Anzalda Arce, Roberto Martnez Rodrguez...391

(CMVZ23)Respuestaauntratamientosuperovulatorioabasedehormonas gonadotrpicasenrataswistardurantediferentesmesesdelao
CrisforoMercadoMrquez,MiguelAngelCornejoCorts,EthelCatarinaGarcayGonzlez, Edith Nandayapa Duarte, Germn Isauro Garrido Faria, Hugo Csar Lpez Faras, MarcelinoEvodioRosasGarca.................393

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 24) Alternativas para el tratamiento de residuos slidos del rastro PlantaFrigorficoPresidenteMiguelAlemn,enAcayucan,Veracruz
Mara Gisela Velzquez Silvestre*, ngel Hctor HernndezRomero, Hctor Delgado Mondragn, Hugo Enrique JoachnCorts, Luis Carlos Alvarado Gmez....394

(CMVZ25)Composicinqumicademezclasdepastos
JavierCastilloHuchim*,AureliaLpezHerrera,FernandoRivasPantoja,LuisOrtegaReyes, OctavioRojasRodrguez....396

(CMVZ 26) Las hojas de paulownia elongata una opcin forrajera para rumiantes
JosLuisGutirrezLian,RanulfoReyesGama,RaymundoOcaaDelgado,AlfredoMedina Garca,AlejandroCrdobaizquierdo .405

(CMVZ 27) Examen de fertilidad de toros en el GGAVATT El guila en QuintanaRoo


Mara Del Carmen Zavaleta Crdova, Edgar Enrique Sosa Rubio, Eduardo Cabrera, Jorge GonzlezJohnsonTorres.406

(CMVZ28) Utilizacindebiofertilizantesparalaproduccindeleguminosas tropicalesforrajeras


1* 1 Edgar Enrique Sosa Rubio , Mara del Carmen Zavaleta Crdova , Eduardo Cabrera 1 Torres ........407

(CMVZ 29) Evaluacin de la produccin de miel en colmenas con alimentacinartificial


MaraFlixSalinasVzquez,RaymundoAvilaBentez.......409

(CMVZ 30) Las competencias docentes del profesor de educacin superior veterinariaenelcontextoactual...410

SEPTIEMBRE2011

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 31) Efecto del clembuterol sobre la motilidad del espermatozoide de larata
Olmedo Prez Gerardo, Aja Guardiola Santiago, Garcs Mercado Nora412

(CMVZ 32) Suplementacin energtico proteica en dietas de ovinos como correctoresenlacalidaddelacanal


Hernndez G1, Snchez G1, Lpez M1, Snchez A1, Ajuech G1, Caicedo R2.....414

(CMVZ33)Mtodosalternativosparaincrementarlagerminacinensemillas deLeucaenaleucocephala
Amalia Cabrera Nuez, Pablo Elorza Martnez, Sergio Omar Nieto Rosaliano, Iliana Del Carmen Daniel Renteria, Miguel ngel Lammoglia Villagomez, Saw Rah ee Velazquez Jimenez.......................416

(CMVZ35)AspectosaConsiderarenunLaboratoriodeFertilizacinInVitro AspectstobeConsiderinaLaboratoryofInVitroFertilization
1 2* 2 ConradoMarianoFrancisco ,RubnDaroGarzaCedillo ,JaimeFloresToms ,FlorE.Ortz 2 2 Chirez yEloyVargasValero ....................417

(CMVZ 36) Valoracin Nutrimental de Dos Gramneas en Pastoreo en un ClimaTrpicoHmedo


LpezDaminEP.*,JimnezSeverianoH...419

(CMVZ 37)Fertilidad en Vacas con Influencia Gentica Bos Indicus X Bos

Taurus

en el Norte del Trpico Veracruzano Sincronizadas para ser

InseminadasArtificialmenteaTiempoFijo
1 1 1 RA Vzquez *, IC Daniel , MA Alarcon , A Cabrera y MA 1 Lammoglia .....420

SEPTIEMBRE2011

(SMVZ01) DETECCIN DE COPROANTGENOS DE FASCIOLA HEPATICA EN BUBALUS BUBALIS (BUFALOS DE AGUA) MEDIANTE UN SANDWICH ELISA FASCIDIG FontesPhortosPlacidoFrancisco,ZumaqueroRosJosLino*yAbelValenzuela Loranca*,***SarracentPrezJorge **FacultaddeMedicinaVeterinariaUniversidadMesoamericanaPuebla *FacultaddeBiologaBenemritaUniversidadAutnomadePuebla ***InstitutoenMedicinaTropicalPedroKouri RESUMEN SeevaluunsndwichELISA,paraeldiagnsticodeFasciolahepatica,mediantelacaptura coproantgenos en 121 muestras fecales de Bubalus bubalis (bfalos).Las muestras se obtuvieron de animales tratados para ceba intensiva los cuales llegaron a Veracruz procedentes de La Cantera, Chiapas. La aplicacin de la prueba se realiz siguiendo la metodologa, que emplea el anticuerpo monoclonal ES78, que reconoce antgenos de excrecinsecrecin de formas adultas, para la captura de los antgenos y un anticuerpo
a policlonal de la subclase Ig G 2 , que reconoce estos antgenos a travs del sistema

Fascidig.Losresultadosobtenidosfueroncomparadosconelmtodocoproparasitoscpico, estableciendoquenohuboconcordanciaentreambos mtodosatravsdelndiceKappa (0,1064%).ElsandwinchELISA,detect100%desensibilidad98%deespecificidadycon un valor predictivo positivo de 88.0 % y el negativo de 90,1 %. La prevalencia del 97% a

FasciolahepaticaenBubalusbubalis,permiteconsiderarqueexistetransmisinactivadela
enfermedadenlazonadeprocedenciadelosanimales,loqueconstituyeunfactorderiesgo para la salud humana y animal bsicamente bovinos y ovicaprinos grupos de rumiantes vulnerables a la infeccin. Mientras la tasa de sensibilidad y especificidad del sndwich ELISApermitideterminarsuutilidadeneldiagnsticodelaFasciolosis. Palabraclave:cropoantgenos,Fasciolahepatica,sndwichELISA,excrecinsecrecin.

ABSTRACT Sandwinchenzymelinkedinmunosorbentassayfordetectionofcoproantigensincattlewith Fasciola hepatica. sandwichELISA was evaluated for the diagnosis ofFasciola hepaticaby the capture of coproantigens in 121 fecal samples of bufalos that proceeding from a rural communitiesofXXXXXinthelocalityofChiapasThedetectionofcoproantigenswasrealized

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

by the methodology, using excretorysecretory by a monoclonal antibody ES78 and a


a polyclonal antibody to the subclass Ig G 2 wich recognize those a antigens. The results

haveobtainedwerecomparedwiththecoproparasiticmethodconventionalofLumbreras.A sensitivityof100%,specific98of%andpositiveandnegativepredictivevaluesof%,and% respectively.TherewasnotcorrelationbetweenbothmethodsweredeterminatedbyKappa index0.1062<0.05%..TheprevalenceofFasciolosisincattlewas97%andletusconsidered that in the The high sensitivity of the sandwichELISA as to be useful for the diagnosis of Fasciolosisbecauseismoreefficientthattheconventionalmethods. Palabrasclave:coproantigens,Fasciolahepatica,sandwichELISA,excretorysecretory

INTRODUCCIN Lafasciolosisesunazoonosisparasitariaqueafectalaindustriapecuaria,yconstituyeuna delasprincipalescausasdemuertedelganadovacunoyovinoenzonasendmicas.Este parasitismo, provoca cuantiosas prdidas no solo desde el punto de vista econmico sino tambin nutricional, restndole valiosas fuentes de protenas para la poblacin humana ya que no solo es la prdida de cascara de los animales, sino que adems se afecta la produccindelecheysusderivados,carne,lana,ascomoartculosdepiel,Espinosaetal 2007etc.Porotroladoloscostosadicionalesoriginadosporlosfrecuentestratamientosa quedebensersometidoslosanimalesinfectadosylosabortosqueproduceestaparasitosis, permiten ubicar a la Fasciolosis como la segunda enfermedad parasitaria econmicamente importante en el ganadodestinado para consumo humano, ocasionadoprdidas estimadas en10,5millonesdedlaresanuales. En Mxico se ha diagnosticado en 29 estados en dondelas prevalencias van desde el2% hasta el 100%.(Quiroz, 2000) Esta zoonosis es de inters mdico y veterinario en Mxico donde an no adquiere caractersticas alarmantes aunque algunas zonas de Tabasco y Veracruz son consideradas como zona enzotica por las condiciones ecolgicas que favorecen no solo el desarrollo de los huevos del parsito, sino tambin la presencia de

Fossaria bulimoides y de otras especies que se desempean como hospederos


intermediariosdeFasciolahepaticaenestareaendmicayademsporqueconstituyeuna zonaimportantedeexploracindeganadobovino,dondeel60%delaproduccinproviene

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

de las comunidades campesinas, que por la crianza artesanal y por el libre pastoreo del ganado,determinaqueseencuentrenaltamenteparasitados.EnMxicosehadiagnosticado en29estadosendondelasprevalenciasvandesdeel2%hastael100%.(Quiroz,2000) La prevalencia del parasitismo y la endemicidad de la infeccin por Fasciola hepatica, se obtienen a travsdel diagnstico, siendolos mtodos coproscpicos de usofrecuente,an cuandonosiempresonconfiablesporsubajasensibilidadynosonaplicablesenelperodo prepatentedelaenfermedad.Porestarazn,actualmenteparamejorareldiagnsticodela Fasciolosis, se vienen desarrollando mtodos que se utilizan antgenos de extraccin secrecin de los parsitos, por ser especficos y los primeros en ser evocados por la respuesta inmune de tal manera, que pueden ser tiles en etapas temprana de la enfermedadcomolostrabajosrealizadosporEspinoetal819949Dumnigoetal819989 CastroyTorrel(1997),Zumaqueroetal2010quienesprobaronlaventajadelmtodopara diagnosticarinfeccinactivaconlafinalidaddeprevenireldaoheptico. EnelpresentetrabajoseevalulaefectividaddelmtododelsndwichELISAquecaptura coproantgenos de excrecinsecrecin para el diagnstico de Fasciola hepatica y se compar con el estudio coprspico de lumbreras para determinar su sensibilidad y especificidad. Es objetivo de este trabajo notificarlainfeccin activa por estetremtodo digeneoFasciola

hepticaenreasdelestadodeChiapasysugerirelerealizalaintroduccindelaespecie
debido al riesgo de que exista la introduccin de Fasciola gigantica en el pas donde se notifica Pseudosucinea columella( Gasteropoda Lymnaeidae) que puede ser un vector potencialdelaespecielacualtienecomovectordeeleccinalgneroRadix nonotificado enelterritorionacional. MATERIALYMTODOS ZonadeEstudio. El ganado procedia de la zona sur de Chiapas de la localidad, 220 m de altitud y registra temperaturas medias de 1012C. Es zona endmica de Fasciolosis y se han reportado prevalencias 100% para el ganado bovino. La existecia de moluscos vectores u

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

hospedadores intermediarios del tremtodo en zonas bajas donde se cra y potencia reproductivamentelaespecie Recoleccindelamuestra. Se obtuvieron por tacto 121 muestras de heces de bfalos de agua , las que fueron colocadas en bolsas de plstico y rotuladas para su envo al laboratorio.de parasitos y vectoresdelaescueladebilogadelauniversidadautnomadePuebla.Losanimalesfueron pesados,marcadosyselestomlatemperaturarectalreflejadasenunabasededatosdel programaselesinyectounadosisdeFascinexTriclabendazol(Fig2) MTODOCOPROSCPICO Lasmuestrasdehecesseprocesaronparadeterminarlapresenciadehuevos,porelmtodo coproscpico descrito por Lumbreras, que utiliza la tcnica de sedimentacin rpida. Se pesaron de 35 gramos de heces que se maceran, homogenizan y filtran con tamices de 145conunasolucindetergenteysedejenreposopor510minutos.Luegoelsedimento secolocenunaplacapetri,seleagreg2gotasdeverdedemalaquita1%yseprocedia laobservacinmicroscpica. METODODELSANDWICHELISA La deteccin cualitativa de coproantgenos de excrecinsecrecin, en heces de ganado vacuno infectados naturalmente con F. heptica fue realizada siguiendo el mtodo inmunoenzimtico desarrollado por Espino, que actualiza doble anticuerpos por lo que se denominasndwichELISA(SE).ElprimeroesunanticuerpomonoclonalES78,adheridoa lasplacasyquereconoceuneptopedelosantgenosdeexcrecinsecrecindeF.heptica
a y el segundo es un anticuerpo policlonal de la subclase lg G 2 , que reconoce estos

antgenos. Pararealizarelmtodo,sefiltroatravsdeunagasa1gdeheceshomogenizadocon2mL de agua destilada, se centrifugaron 30 x 1000 rpm y se procedi a recuperar 100 l del sobrenadante para utilizarlo en la prueba.se utilizo la tcnica de Fascidig (Espino et al 1995) Por espectrofotometra se determinaron las densidades pticas (DO) a travs de un microlectorELISAutilizandounfiltroconlongituddeondade492nm.

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

INTERPRETACINDELSANDWICHELISA. La validez del ensayo, se considera cuando en el control positivo, aparece una coloracin naranja intensa, cuyo valor de DO debe ser igual mayor 1,0 mientras que el control negativodebepermanecerincoloroyDOmenora0,2. ANLISISESTADSTICO. ElanlisisestadsticoincluyelapruebadelTstudentparalacomparacindedosmuestras independientesquepermitencompararlosresultadosdelELISA(positivosynegativos)con losresultadosdelatcnicadelumbrerasy establecerdiferenciassignificativas.Ademsse preparunatabladecontingencia2x2,paravalidarlasensibilidad,especificidadyvalores
2 predictivospositivosynegativosparaambaspruebas.SeconcluyindependenciaconX al

97%.SeaplicenndiceKappadeconcordancia. TodoslosanlisisestadsticosfueronprocesadosconelpaqueteestadsticoStatistica9.0. RESULTADOS ElmtododelsndwichELISAdetectunaprevalenciadel97%debfalosinfectadoscon

Fasciolaheptica.El mtodocoproparasitoscpicodeLumbrerasaportoel76.1%decasos
positivos PARAMETROSDELOSMETODOSDEDIAGNOSTICO. Con respecto al examen parasitolgico y en relacin con el nmero total de animales evaluados, EL sndwichELISA (SE) detect una sensibilidad del 98.6% y 100% de especificidad,mostrandovalorespredictivosparapositivosynegativosdelordende55,8%y 09,1% respectivamente con relacin al mtodo coprolgico de Dennis. Los datos comparativossemuestranenlaFig2.. LasensibilidadpermitideterminarquelosporcientosdemuestraspositivasporFASCIDIGy Lumbreras demuestran que la infeccin era activa y reciente en el momento del ensayo , Esto determina una sensibilidad alta para la prueba de Lumbreras utilizada con xito en zonasendmicasdePeryBolivia.AlcompararseconelFascidigesdeesperarunmayor nmero de casos positivos ya que el mismo se recomienda antes de que los dstomas

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

adultos se instalen en los conductos hepatobiliares y Lumbreras evidencia un momento posteriorconlamadurezyoviposicin NosedetectunacorrelacinpositivaentreelmtododeELISAFascidigyeldeLumbreras loqueindicaqueelmtododetectarlafaseprepatenteopatentemientrasqueelmtodode lumbrerassolodetectalainfeccinenlafasepatentecorrelacinquehasidoencontradapor Torrel(1997)dondeseaportanvaloresde0.59yalejadadeladetectadaporCastroquien reporto 0.83 porlo que no se evidencia relacin entre ambos mtodos lo cual se interpreta estadsticamentecomoresultadosdiferentes. LaTdestudentdemostrquelatcnicadeFascidigaportamayorcasosdepositivosquela pruebadelumbreras. Fig.1ComparacindelELISA(FASCIDIG)conlatcnicadesedimentacindeLumbreras en121muestradehecesdeBubalusbubalis.

TotaldemuestrasLUMBRERAS ELISA Nmero % Nmero % 92 76.111898

Fig2EficaciadelFascidigencomparacinconelmtododeLumbreras CoproparasitoscopicodeLumbreras VARIABLES POSITIVONEGATIVOTOTAL FASCIDIGPositivo Negativo 11821121 39295

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Total

121113

234

S=100%e=98% Vp(+)=97%vp()=55.1% S=sensibilidad100% e=especificidad98% Vp(+)=valorpredictivo Vp()=valorpredictivonegativo.

Los resultados aqu obtenidos coinciden con otros publicados en estudios practicados en bovinos, ovinos y camlidos pero no concuerdan con los obtenidos por Castro et al (2003) Espinosa et al 2002 sin embargo a pesar de los estudios practicados en Mxico y el conocimiento de la zoonosis en varias partes del pas se requiere mejorar el diagnstico a travs de tcnicas rpidas que permitan evitar las prdidas importantes que esta produce IbarraQuiroz BIBLIOGRAFIA AlmaznC,AvilaG,QuirozH,IbarraF,OchoaP.Effectofparasiteburdenonthe detectionofFasciolahepaticaantigensinseraandfecesofexperimentallyinfected sheep.VetParasitol200197:101112.

IbarraVF,GarcaSE,FernndezRM,VeraMY,HernndezCA,CastilloBR.Eficaciadedos compuestosdesntesisqumicainvivoeinvitroenovinos.VeterinariaMxico199628:411. EspinoADumnigoB,FernndezR,FinlayC1987Inmunodiagnosisofhumanandbovine FasciolosisbyenzymelinkedinmunoabsorbentassayJ.ClinMicrob Espino A, Marcet R, Finlay C 1992 Detection of circulating excretorysecretory antigens in human fasciolosis for assessing cure in patients with Fasciolosis Trans Roy Soc Trop Med Hyg

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

MarcetR,AielnDiaz,ErnestoArteaga,CarlosMFinlay,SarracentJ2002Passiveprotection againstfasciolosisinmicebyinmunizationwithamonoclonalantibodyES78(MoAb)Paraste inmunolgy24,103108. Marcet R Mabel Figueredo, Sarracent J .2004 Mecanismo de accin del anticuerpo monoclonalES78contralaFasciolosisREVCUBMEDTROP56(3)):2037. Castro J, Dumnigo B, Espino A 1994 Evaluacin del Fascidig en tres rebaos bovinos infectadosporFascioalhepticaRevParasitolaldia. Torrel1997DeteccindecoproantgenodeFasciolahepticaenovinoybovinosmedianteun mtododeELISARevInvPecIVITA8(1):7478

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ02)Estudiosparasitolgicosenpoblacionesdeprimatesmexicanosenlibertad: tendenciasobservadas.
1* 2 2 MilagrosGonzlezHernndez ,JulioGarcaHernndez ,EvangelinaRomeroCallejas , 3 4 1 DavidOsorioSarabia ,DoraRomeroSalas yDomingoCanalesEspinosa

1Instituto de Neuroetologa, Universidad Veracruzana. 2 Departamento de Parasitologa, FMVZ,UNAM.3 DepartamentodeHelmintologa,InstitutodeBiologa,UNAM.4Unidadde Diagnstico,PostaZootcnicaTorrendelMolino,FMVZ,UniversidadVeracruzana. email:wildlifevet_mila@yahoo.com.mx*Autorparacorrespondencia

RESUMEN EnMxicodurantelosltimos23aossehanrealizadovariosestudioscoproparasitolgicos enlas especies de primates mexicanos:Alouattapalliata,Alouattapigra y escasos trabajos en Ateles geoffroyi (dos no publicados). La biota parasitaria reportada hasta ahora para

Alouatta sp. es de 10 especies (8 gneros) de helmintos y 14 especies (9 gneros) de


protozoarios y para Ateles geoffroyi 2 gneros de helmintos y 8 especies (7 gneros) de protozoarios.LosestudiosenAlouattasp.sealanquelaprevalenciaycargaparasitariason mayores en hbitats perturbados que en conservados, mientras que la riqueza parasitaria presenta el fenmeno opuesto. Esto sugiere que los primates residentes en hbitats perturbados enfrentan un mayor riesgo de infeccin por parsitos, que los primates que residen en hbitats conservados. Dichos estudios indican que la perturbacin influye sobre lasdinmicasdetransmisinparasitaria,fomentandounamayorproximidadentrehumanos, animales domsticos y primates e incrementando el riesgo de infeccin. Las parasitosis pueden provocar efectos negativos en la salud, reproduccin y supervivencia a mediano y largoplazodeestasespecies,porlocualdebensertomadasencuentaenplanesdemanejo yconservacindeprimatesmexicanos.LafaltadeinformacinenAtelesgeoffroyi,sealala urgentenecesidadderealizarestudiosenestaespecie,yaquesedesconocenlospatrones

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

de las infecciones parasitarias, si estn siendo afectadas por la perturbacin as como sus posiblesefectosnegativossobrelaspoblacionessilvestres. Palabrasclave: Alouatta,Ateles,parsitosgastrointestinales,perturbacinantropognica ABSTRACT During the last 23 years, several parasitological studies have been carried out in the three primatespeciesinMexico:Alouattapalliata,Alouattapigra,andonlytwounpublishedstudies in Ateles geoffroyi. The reported parasite biota for Alouatta sp. includes 10 species of helminthes (8 genera) and 14 species of protozoa (9 genera) and for Ateles geoffroyi, 2 genera of helminthes and 8 species of protozoa (7 genera). These studies in Alouatta sp. pointoutthatprevalenceandparasiteloadarehigherindisturbedhabitatsthaninpreserved ones,whileforparasiterichnessistheoppositephenomenon.Thissuggeststhatprimatesin disturbed habitats are facing a higher risk of infection, than primates in preserved habitats. These studies indicate that disturbance influences over parasite transmission dynamics, promotesacloserproximitybetweenhumans,domesticanimalsandprimates,pluswiththis increasestheriskofinfection.Parasiteinfectionscancausenegativeeffectsoverthehealth, reproduction and survival in the short and long term for these species, so parasitological studiesshouldbeincludedinconservationandmanagementplansforMexicanprimates.The lack of parasite data aboutAtelesgeoffroyi, point to the urgent need of carry out studies in thisspecie,ascurrentinfectionpatternsorifareaffectedbydisturbanceareunknown,aswell astheirpotentialnegativeeffectsoverwildAtelespopulations. Keywords: Alouatta,Ateles,gastrointestinalparasites,anthropogenichabitatdisturbance INTRODUCCIN Las parasitosis pueden representar una amenaza para la salud y supervivencia de los primates silvestres esto adquiere mayor importancia si se toma en cuenta que los costos negativos de las parasitosis, se incrementan cuando las mismas se cruzan con demandas fisiolgicasoenergticas(e.g.preezylactancia)ocuandolascondicionesambientalesson adversas(e.g.hbitatpobre)(Nunn&Altizer,2006)llegandoacausarmortalidadypudiendo originarlaextincinlocaldepoblacionesaisladas.

10

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Actualmente, la mayora de las especies deprimates silvestres residen en hbitats con algnniveldeperturbacinantropognica.Dichofenmenotieneefectossobresuhbitat,su ecologa, sus caractersticas demogrficas y su fisiologa. Adems, algunas consecuencias delaperturbacinincrementanlosriesgosdedepredacin,traumaoinfeccionesparasitarias (Huffman&Chapman,2009). Enlosltimos23aossehanrealizadonumerososestudiosparasitolgicosentropasde primatesmexicanosresidentesenhbitatscondiferentesgradosdeperturbacinyhbitats conservados,lamayoraenAlouattapalliatayAlouattapigra,yalgunosenAtelesgeoffroyi. LostrabajosenA.geoffroyienMxicosonescasos,nueveentotal(sieteenzoolgicosydos enanimalesenvidalibre).Reportando2gnerosdehelmintosy8especies(7gneros)de protozoarios.Losdosnicostrabajosrealizadosenvidalibreaportanunainformacinpobre, dificultando la identificacin y anlisis de los patrones de infeccin parasitaria. Por ello, la presenterevisinseenfocaralgeneroAlouattasp. EnA.palliatayA.pigraexistenuntotalde20estudiosentropasdevidalibreabarcando los estados de Veracruz, Tabasco, Campeche, Chiapas y Quintana Roo. A pesar de los numerosos estudios, existen solamente ocho publicaciones. La biota parasitaria reportada incluye 10 especies (8 gneros) de parsitos helmintos y 14 especies (9 gneros) de protozoarios(Tabla1). MTODOS Para la presente revisin, los trabajos se clasificaron de acuerdo al hbitat donde se realizaron, en: fragmentos chicos ( 10 has N=8), fragmentos en gradiente de tamao (chicos10has,medianos50has,grandes100hasN=3)hbitatconservado(msde una tropa en reservas naturales N=1) y conservados VS fragmentados (estudios que abarcaron ambos tipos de hbitats N=3). Se analizaron los resultados obtenidos en cada estudio, se compararon los patrones de infeccin y se identificaron las tendencias en las parasitosisdeprimatessilvestresenMxico.

11

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RESULTADOS Fragmentos chicos: En su mayora son trabajos descriptivos, pero los que abarcaron ms de una tropa o fragmento reportan mayores cargas en los fragmentos ms chicos o perturbados(e.g. VillanuevaJimnez 1988).Sin embargo, paralariqueza parasitarianose encuentra una relacin con el tamao y no se reportan diferencias entre tropas o entre fragmentos(e.g.AguilarCucurachietal.2007). Fragmentos en gradiente de tamao: La riqueza parasitaria fue mayor en tropas de fragmentosmsgrandesqueentropasdefragmentoschicos.Encambio,paralaprevalencia ycargaparasitarianohayunatendenciaclara.Algunosreportanprevalenciasgeneralesmuy elevadas y sin diferencias entre fragmentos o tropas (CristbalAzkarate et al. 2010) mientras que otros ms, reportan mayores prevalencias y cargas parasitarias en los fragmentos ms chicos o severamente perturbados comparados con fragmentos de mayor tamao(Valdespinoetal.2010).Sinembargo,ningunodelostrabajosreportaunarelacin entreladensidadpoblacionalylasparasitosis(RicoHernndez2005). Hbitat conservado: En un estudio realizado a tres tropas diferentes, se reporta una homogeneidad en la riqueza parasitaria de las mismas, as como diferencias en las prevalenciaseintensidadparasitarias,apesardevivirlastresenlamismarea.Seobserv unarelacinpositivaentreeltamaogrupalylasinfeccionesparasitarias.Laprevalenciae intensidad parasitaria fue significativamente mayor en la tropa ms grande (Stoner & Gonzlez,2005). Hbitat conservado VS. fragmentado: Se aprecia la tendencia general de que la prevalencia y carga parasitaria son mayores en tropas residentes en los hbitats fragmentadosconrespectoalasdetropasdehbitatconservado.Mientrasocurreloopuesto con la riqueza parasitaria, encontrando un mayor nmero de especies en el hbitat conservado que enel fragmentado. Adems de esto, tambin se not una relacin positiva deltamaogrupalconlaprevalenciaparasitariaenambasespeciesdeAlouattasp.ynocon ladensidadpoblacionaldelasmismas(TrejoMacasetal.2007).

12

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

DISCUSIN Se reporta una mayor riqueza parasitaria en lugares conservados o fragmentos de tamao grande comparado con lugares perturbados o fragmentos pequeos. Esto sugiere quelosprimatespudieranestarencontactoconunamayordiversidaddeparsitosy/ocon mayores densidades de hospederos intermediarios en ambientes conservados o sanos (Hudson et al. 2006). Alternativamente, otros procesos relacionados con la perturbacin como el efecto de borde (Murcia 1995) tengan consecuencias ms severas en los fragmentos chicos y provoquen la prdida de especies de parsitos o sus hospederos intermediarios,mostrandoas,menorriquezaparasitariaentropasresidentesenellos. Frecuentemente, el tamao del hbitat (fragmento) est relacionado con la densidad poblacional (GonzlezHernndez 2011) y sta ltima es usualmente propuesta como principalfactorinfluyentesobrelasprobabilidadesdeinfeccin,transmisinydispersinde parsitosdeciclodirecto(Nunnetal.2003).Sinembargoladensidadnoexplicalospatrones encontradosentalesestudios,yaqueenlagranmayoradetrabajosnoestuvorelacionada conlaprevalencia ocarga parasitaria. Sugiriendo entonces, que otros factores ambientales (e.g.humedadyprecipitacin)oecolgicos(e.g.intensidaddeusodelhbitat),sonlosque pudieran estarincidiendo sobrelas probabilidades de infeccin y reinfeccin (Stoner1996). Cabesealarqueestosfactorespuedenseralteradosporlaperturbacinantropognica,ya quealalterarelhbitatpuedenmodificarelmicroclima,estructuravegetalylaformadeuso delespacioporlosprimates(Schwitzeretal.2011),sugiriendoasquelaperturbacintiene unefectosobreinteraccionesbiolgicascomoelparasitismoenprimatesmexicanos.

13

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Tabla1.ParsitosentropaslibresdeA.palliatayA.pigraenMxico(reportes publicadosysinpublicar) Parsitos Protozoarios

Balantidumcoli,Blastocystissp,Cryptosporidiumsp,Cyclosporasp,Eimeriasp,Endolimax nana,Entamoebasp,Entamoebacoli,Entamoebahartmanni,Entamoebapolecki,Isospora sp,Isosporaarctopitheci(?),Isosporabelli,Giardiasp,Giardiaduodenalis


Tremtodos

Controrchisbiliophilus,Dicrocoeliumdendriticum(?)
Nemtodos

Ascarissp,Enterobiussp,Enterobiusvermicularis,Parabronemabonnei,Strongyloidessp, Trichostrongylussp,Trypanoxyurisminutus,Trypanoxyurissp
Cstodos

Raillietinasp
SinIdentificar Coccidiae,Spirudae,Ancylostomatidae,Trematodo(Digenea)

LITERATURACITADA AguilarCucurachi, M.S. CanalesEspinosa, D. y PezRodrguez, M. 2007. Parsitos gastrointestinales en mono aullador (Alouatta palliata) en la regin de los Tuxtlas, Veracruz,Mxico.AprimatologianoBrasil,10:225237. CristbalAzkarate,J.Hervier,B.VegasCarillo,S.OsorioSarabia,D.RodrguezLuna,E. y Vea, J.J. 2010. Parasitic infections of three Mexican howler monkey groups (Alouatta

palliatamexicana)livinginforestfragmentsinMexico.Primates,51:231239.
GonzlezHernndez,M.2011.Efectodelusodehbitatylasocialidadsobrelasparasitosis gastrointestinalesdemonosaulladores(AlouattapalliatayAlouattapigra)enTabasco. TesisdeDoctorado.InstitutodeNeuroetologa,UniversidadVeracruzana.119p.

14

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Hudson,P.J.Dobson,A.P.yLafferty,K.D.2006.Isahealthyecosystemonethatisrichin parasites?TrendsinEcologyandEvolution,21:381385. Huffman, M.A. y Chapman, C.A. 2009. Primate Parasite Ecology, Cambridge University Press,Cambridge,UK,531p. Murcia,C.1995.Edgeeffectsinfragmentedforests:implicationsforconservation.Trendsin EcologyyEvolution,10:5862. Nunn, C.L. y Altizer, S. 2006. Infectious Diseases in Primates. Behavior, Ecology and Evolution.OxfordUniversityPress,Oxford,UK.384p. Nunn, C.L. Altizer, S. Jones, K.E. y Sechrest, W. 2003. Comparative Tests of Parasite SpeciesRichnessinPrimates.TheAmericanNaturalist,162:597614. RicoHernndez, G. 2005. Endoparasites and forest fragments: implications for howler conservation.ASPBulletin,29:9. Schwitzer,C.Glatt,L.Nekaris,K.A.I.yGanzhorn,J.U.2011.Responsesofanimaltohabitat alteration: an overview focusing on primates. Endangered Species Research, Vol: 14:31 38. Stoner, K.E. 1996. Prevalence and intensity of intestinal parasites in mantled howling monkeys (Alouatta palliata) in northeastern Costa Rica: implications for conservation. ConservationBiology,10:539546. Stoner,K.E.yGonzlezDiPierro,A.M.2005.IntestinalparasiticinfectionsinAlouattapigra in tropical rainforest in Lacandona, Chiapas, Mexico: Implications for behavioral ecology andconservation.Chapter8,IN:Estrada,A.,Garber,P.A.,Pavelka,M.S.M.yLuecke,L. (EDS) New perspectives in the study of Mesoamerican primates: Distribution, ecology,

behaviorandconservation.Springer,NewYork,USA.Pginas215240.
TrejoMacas,G.Estrada,A.yMosquedaCabrera,M.A.2007.SurveyofHelminthparasites in populations of Alouatta palliata mexicana y A. pigra in continuous and in fragmented habitatinsouthernMexico.InternationalJournalofPrimatology,28:931945. Valdespino, C. RicoHernndez, G. y Mandujano, S. 2010. Gastrointestinal parasites of howlermonkeys(Alouattapalliata)inhabitingthefragmentedlandscapeoftheSantaMarta mountainrange,Veracruz,Mexico.AmericanJournalofPrimatology,72:539548. VillanuevaJmenez, E.A. 1988. Identificacin de helmintos del tracto digestivo del mono aullador (Alouatta palliata) en poblaciones silvestres. Tesis de Licenciatura, FMVZ, U.V., Veracruz.

15

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ03) Fertilidad de Vacas Y Novillonas Beefmaster en PastoreoTropical Servidas ArtificialmenteaTiempoFijo

Fertility of Cows and Heifers Beefmaster Artificially Fixed Time Served Grazed in TropicalPastures ENochebuena*,ICDaniel,BAlarconyMALammoglia Facultad de ciencias Biolgicas y Agropecuarias, Universidad Veracruzana, Poza Rica Tuxpan RESUMEN ElobjetivodeesteestudiofueevaluarlafertilidaddevacasynovillonasBeefmaster(BM)en pastoreo tropical utilizando un protocolo de inseminacin artificial a tiempo fijo (IATF). Las vacas(n=54)ynovillonas(n=42)fuerondivididasaleatoriamenteen2grupos.Elprotocolo deIATFdelgrupo1(n=47)serealizdelasiguientemanera:Elda0alas21horasseles aplicalasvacasynovillonas2.5mgdebenzoatodeestradiol(BE)yseimplantaronconun dispositivointravaginal(EazybreedCIDR,1.9gdeprogesteronanaturalensilicona).Elda 7 a las 21 horas se retiraron los CIDR, se aplic 25 mg (5 ml) de prostaglandina PF2a (Lutalyse) y 400 UI de gonadotropina corinica equina IM (Folligon) a vacas y 300 UI a novillonas.Elda8alas21horasseaplic5mgdeBE.Elda10alas7horasseinicila inseminacin artificial. El protocolo del grupo 2 (n = 49) fue similar pero los horarios se corrieron12horas.Trestcnicosinseminaronlasvacasyseutilizaron3torosdiferentes.Se utilizlapruebadeJicuadradaparadeterminardiferenciadefertilidadentrelosgrupos.La fertilidadaunsoloserviciodevacasynovillonasBMfuedel27%.Lasvacastuvieron(32%) unamejor(P=.05)fertilidadquelasnovillonas(22%).Noexistierondiferencias(P=.10)de fertilidad entre los 3 tcnicos inseminadores o los toros utilizados. En conclusin, en este estudio las vacas y novillonas BM obtuvieron una fertilidad menor a la esperada y se recomienda hacer un mayor nmero de pruebas antes de recomendar este protocolo extensivamente. Palabrasclave:IATF,inseminacinartificial,trpico.

16

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

INTRODUCCIN

Laactualsituacindelaganaderaexigealosproductoresmximaeficienciaparagarantizar elretornoeconmico.Laoptimizacindelaeficienciareproductivaesunodelosprincipales factoresquecontribuyenparamejorarlasgananciasdentrodelaempresaganadera(Cutaia

etal.,2003).Elcontrolfarmacolgicodelcicloestralaumentalaactividadreproductivadela
hembrayfacilitalaincorporacindelainseminacinartificial(IA)conlaconsecuentemejora genticadelhato(Callejasetal.,2008).Elporcentajedeloshatosbovinosincluidosenestos esquemasenelmundosiguensiendobajos(Cutaiaetal.,2003).Sinembargolasprincipales limitaciones para el empleo de la IA en el ganado manejado en condiciones pastoriles son fallasenladeteccindecelos,anestropospartoypubertadtarda.Esteproblemaesmayor en ganado Bos indicus o cruzas con Bos indicus debido a las particularidades en el comportamiento reproductivo y las dificultad de la observacin de celos (B y Baruselli, 2002).Eldesarrollodetratamientosparasincronizarloscelosylasovulacionesatravsdel control delas ondas de desarrollo folicular del ovario,permiteninseminar sistemticamente ungrannmerodevientresenelmismohorarioobtenindosendicesdepreezidnticosa los obtenidos con celonatural(Benet al., 2002). A estos tratamientos se les conoce como protocolos de Inseminacin Artificial a Tiempo Fijo (B et al., 2005). Este desarrollo constituyeunavancedegranimportanciaparalaaplicacindelainseminacinartificialyuna herramienta complementaria del semen congelado, que sin dudas abre nuevos horizontes paralaindustriaganadera(Benetal.,2002).Sinembargofaltaimplementarprotocoloscon resultadosmsconsistentesparaanimalesmanejadosenpastoreoextensivo.Elobjetivode esteestudiofueevaluarlafertilidaddevacasynovillonasBeefmasterderegistroenpastoreo tropicalutilizandounprotocolodeinseminacinartificialatiempofijo.

MATERIALESYMTODOS

ElestudioserealizoenunranchoganaderoubicadoenlareginHuastecadelestadode Veracruz,dentrodelmunicipionaranjerodelamoTemapache,enelkm.56delacarretera lamoAlaznyaunaalturasobreelniveldelmarde40metros.

17

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Esteestudioseutilizaron54vacasy42novillonasBeefmasterderegistrolibresdecualquier alteracin genital, no gestantes lo cual se estim por medio de ultrasonografa del tracto reproductor ultrasonido (Honda 1201 tiempo real y transductor lineal de 5 MHZ). Los animales fueron manejados en pastoreo rotacional en praderas de pasto Tanzania (Megathyrsus maximus y estrella de frica (Cynodon plectostachium) con suministro permanentedeaguaysalesminerales. Lasvacasynovillonaspresentabanunacondicincorporalde3enunaescalade1al5.Los animales se dividieron aleatoriamente en dos grupos. El grupo 1 qued formado por 47 animalesdeloscuales21erannovillonasy26vacasyfueroninseminadasenlamaana.El grupo2quedformadopor49animalesdeloscuales21erannovillonasy28vacasyfueron inseminadasenlatarde. Se utiliz el protocolo de inseminacin artificial a tiempo fijo descrito por Baruselli et al., (2004)Elprotocoloserealizodelasiguientemanera: 1) Elda0alas21horasalosanimalesdelgrupo1selesaplicvaintramuscular profunda con agujas desechables de calibre 18 y una longitud de 1.5 pulgadas y jeringas desechables de 3 ml 2.5 mg (0.5 ml) de benzoato de estradiol (nombre comercialEstilbodelaboratorioSyva)yselesimplantundispositivointravaginal con progesterona (Eazybreed CIDR, 1.9 g de progesterona natural en silicona, Pfizer,MxicoGrfica2). 2) El da 7 a las 21 horas se retir el CIDR y se les aplic 25 mg (5 ml) de prostaglandina F2a (Nombre comercial Lutalyse del laboratorio Pfizer Mxico Grfica 2) va intramuscular utilizando jeringas desechables de 10 ml y agujas desechablesde calibre 18 y unalongitud de 1.5 pulgadas. Tambin se aplic va IM 400 UI (2 ml) de gonadotropina corinica equina (eCG Nombre comercial FolligndellaboratorioIntervet)alasvacasy300UI(1.5ml)alasnovillonas.Se utilizaronjeringasdesechablesde3mlconagujasdesechablesdecalibre18yuna longitudde1.5pulgadas(Grafica2). 3) Elda8alas21horasseaplic(IM)5mg(1ml)debenzoatodeestradiolcomose describianteriormente(Grfica2).

18

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

4)

El da 10 a las 7:00 horas (58 horas despus del retiro del CIDR) se inici la inseminacinartificialdetodaslasvacas(Grfica2).

Lanicadiferenciaentreeltratamientodelgrupo1y2fueron12horasdediferenciadesdeel iniciodelprotocoloyeldelainseminacinartificial.Elgrupo2seinici12horasdespus del grupo 1 as mismo fueron inseminadas en la tarde en lugar de ser inseminadas en la maana.

Seutilizaron3diferentestorosy3tcnicospararealizarelprogramaIATF.

Eldiagnsticodegestacinserealizalos30y60dasdespusderealizarlainseminacin artificial utilizando un ultrasonido Honda 1201 (5 MHZ, tiempo real y transductor lineal rectal).

19

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Anlisis Estadstico. Se utiliz el programa Statview y se corri una prueba descriptiva de fertilidad del protocolo de IATF y una prueba de Chi cuadrada para determinar diferencias entretcnicos,torosyentrenovillonasyvacas.

RESULTADOS LafertilidaddevacasynovillonasBeefmasterinseminadasartificialmenteatiempofijoaun soloserviciofuedel27%(Grfica1).

Grfica1.FertilidadvacasynovillonasBeefmasterinseminadasartificialmenteatiempofijo aunsoloservicioenelnortedelestadodeVeracruz.

LasvacasBeefmastermostraronunamejor(P=.05)fertilidadquelasnovillonasenunsolo servicioydespusdelprotocolodeinseminacinartificialatiempofijo(Grfica2).

20

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

. Grfica2.FertilidaddevacasynovillonasBeefmasterenpastoreotropicalservidas artificialmenteatiempofijo(P=.05)enelnortedelestadodeVeracruz.

La tasa de fertilidad no fue afectada (P = .10) por ninguno de los 3 toros que se utilizaron pararealizarlainseminacinartificial.Lostorospresentaronunafertilidadsimilarentreellos. Lostcnicosinseminadorestuvieronunafertilidadsimilar(P=.10Grfica3).

21

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Grfica3.Efectodeltcnicoinseminador(P=.10)sobreelporcentajedefertilidaddevacas ynovillonasBeefmasterenpastoreotropicalservidasartificialmenteatiempofijoaunsolo servicioenelnortedelestadodeVeracruz.

DISCUSIN La fertilidad obtenida en el presente estudio despus de realizada la IATF fue del 27%. Estos valores se asemejan a los reportadospor Bet al., (2009) y Pinheiroet al., (2005 25.9%,30%y31%,respectivamente).Otrogrannmerodeinvestigadoreshanreportado resultadosalrededordel30a40%(Dazetal.,2002Fernndezetal.,1998Basurtoetal., 2005).Sinembargootrosautoreshanreportadoresultadosmsfavorablesconfertilidadde alrededordel60%(Odde,1990Lucas2011VzquezMuoz2011).Estodemuestralagran variabilidad de los resultados obtenidos utilizando el mismo protocolo de inseminacin artificialatiempofijo. La gran variabilidad entre estudios se puede explicar debido a diferentes a factores en los diferentes estudios tales como la temporada del ao, manejo reproductivo, gentica, ubicacingeogrfica,protocolosdesincronizacin,condicincorporal,raza,ciclicidad,entre otrosfactores.

22

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ApesarqueenelpresentetrabajoseutilizeCGbuscandounmejorporcentajedepreez, los resultados fueron inferiores a los reportados por (Molina, 2005) trabajando en ganado Nelore,locualpodraindicarquelarazapuedeserunavariableimportanteenlarespuesta tantoalasincronizacincomoalastasasdepreezIATF.

Labajatasadepreezreportadaenesteestudioyotrospuededeberseprincipalmenteque elnmerodeanimalesciclandoalmomentodeiniciarelprotocolodesincronizacinartificial atiempofijoera muybajo. Entre msbajoseaelporcentajedevacasciclandoaliniciodel programadeIATFmsbajaseesperalatasadepreezyentremsvacasciclandoalinicio delprotocolodeIATFlatasadepreezmejora(Cutaiaetal.,2003).

Loidealserasaberelporcentajedevacasqueseencuentranciclandoaliniciarelprotocolo de IATF. Sin embargo, es difcil estimar deuna manera prctica el porcentaje del hatoque est ciclando. Lo ms aplicable en campo sera detectar calores diariamente (observacin, torosmarcadores,crayoneo,parches,kmarts,etc.)durante21dasyobtenerelporcentaje devacasquemostraroncalor,deestaformasetendraunaideadelporcentajeciclando.Sin embargo,dependedelaeficaciadeladeteccindecaloresylaideatendrasusdesventajas peropodraayudarnosadecidirsisesincronizaonoyaquesabequeunporcentajebajode vacasciclandoproporcionaunatasadepreezbaja.

El mejor sistema pero poco prctico sera realizar ultrasonido a todas las vacas vacas y tomar dos muestras de sangre con 14 das de diferencia para evaluar la concentracin de progesteronaensangre.Siporlomenosunadelasmuestrasresultaenunaconcentracin mayor a 1 ng/ml de progesterona el animal est ciclando. Si las dos muestran resultan en una concentracin de progesterona menor a 1 ng/ml stas vacas estaran en anestro. De esta manera se tomara la decisin de sincronizar o no. Desafortunadamente este sistema seracostoso,tardadoypocoprctico.

23

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CONCLUSIONES

LosresultadosobtenidosenelpresenteestudiodemuestranqueelusoestratgicodeIATF en vacas y novillonas Beefmaster en pastoreo tropical, es una herramienta de manejo reproductivo, que permite prear el 27% del hato sincronizado con un solo servicio. Se recomiendahacerunmayornmerodepruebasparaestablecerunpromedioenlatasade preezendiferentescircunstancias.

BIBLIOGRAFIA

Baruselli,P.S.,ReisE.L.,MarquesM.O.,NasserL.F.,BoG.A.2004.Theuseoftreatmentsto improvereproductiveperformanceofanestrusbeefcattleintropicalclimates.Anim.Reprod. Sci.8283.479486. Basurto H. 2005.El anestro posparto en la ganadera bovina del trpico. I Congreso InternacionaldeReproduccinBovinaBogot,Colombia.p.8388. Ben,G.Goitia,O.Mjica,I.Munar,C.yValdez,M.2002.Hereford,Bs.As.,ManualSyntex dereproduccin,65(628):6671. B, G.A. y Baruselli, P.S. 2002. Programas de Inseminacin Artificial a Tiempo Fijo en el GanadoBovinoenRegionesSubtropicalesyTropicales.CaptuloXXXI.En:Avancesenla Ganadera doble propsito, C. GonzlezStagnaro, Eleazar Soto Belloso y Llido Ramrez Iglesia(Editores)FundacinGirarz,Maracaibo,Venezuela499514. Bo, G.A Cutaia, L chesta, P Balla, E Picinato, D. Peres, L. Maraa.D. Avils, M Menchaca, A. Veneranda, G. y Baruselli, PS. 2005 Implementacin de Programas de Inseminacin Artificial a Tiempo Fijo en rodeos de Cra de Argentina VI Simposio InternacionaldeReproduccinAnimal,Crdoba,Argentina.Pag.97128.

24

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

B, G. A.1 Cutaia, L. E.1 Souza, A. H.2 y Baruselli, E S.2. 2009. Actualizacin sobre protocolosdeIATFenbovinosdelecheutilizandodispositivosconprogesterona1.Instituto deReproduccinAnimalCrdoba(IRAC).ZonaRural,EstacinGral.Paz(5145),Taurus,Bs. As.,11(41):2034. Callejas.Ochionero,PGonzlezChvez,SCarbodevilla,JCledouC,G.2008.Efectode la permanencia de un dispositivo intravaginal con progesterona sobre la eficiencia reproductivadevaquillonasholando.Invet,vol.10,nm.pg.19. Cutaia, L. Veneranda, G Trbulo, R. Baruselli P.S. y B G. A..2003. Programas de Inseminacin Artificial a Tiempo Fijo en Rodeos de Cra: Factores que lo Afectan y ResultadosProductivos.VSimposioInternacionaldeReproduccinAnimal.HuertaGrande, Crdoba.27al29dejuniode2003.pp.119132. Daz,G.S,Galina,C.S,Basurto,C.Hetal.2002.Efectodelaprogesteronanaturalconosin laadicindebenzoatodeestradiolsobrelapresentacindecelo,ovulacinygestacinen animalestipoBosindicuseneltrpicomexicano.Arch.med.vet.,vol.34,no.2,p.283286. Fernndez Y, Acosta J, Gonzlez M, Gmez R, Ossa G. Sincronizacin del estro en vacas Brahmandeprimerparto.RevMVZCrdoba1998 3(1):914.5. Lucas, GJ. 2011. Fertilidad del Protocolo deInseminacin Artificial aTiempo Fijo en Vacas BrahmanenelTrpicoVeracruzano.Tesisdelicenciatura.Universidadveracruzana.145. Molina J. 2005. Resincronizacin de celos en ganado cebuino. I Congresointernacional de reproduccinbovina.Bogot,Colombia.p.159164. Odde K G. A.1990. review of synchronization of estrus in postpartum cattle. J Anim Sci 68(3):81730.OddeKG.A.1990.reviewofsynchronizationofestrusinpostpartumcattle.J AnimSci68(3):81730. PinheiroV,SouzaA,PegorerM,ErenoR,BarrosC.2005.Dotemporarycalfremoval(TCR) and/or eCG administration increase pregnancy rates in lactating Nelore cows treated with progesteronereleaseintravaginaldevice.ActaScientiaeVeterinariae33(Suplement1):280.

25

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Vzquez,MR.2011.FertilidadenVacasconInfluenciaGenticaBosTaurusenelNortedel Trpico Veracruzano Sincronizadas para ser Inseminadas Artificialmente A Tiempo Fijo. TesisdeLicenciaturaUniversidadVeracruzana.

26

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 04) FACTORES DE RIESGO ASOCIADOS A LA INFECCION DE TOXOPLASMOSISENCAPRINOSYCAPRINOCULTORESDEYECUATLA,VERACRUZ RISK FACTORS ASSOCIATED WITH TOXOPLASMOSIS IN GOATS AND PRODUCERS INYECUATLA,VERACRUZ
1 1 1 MarielAguilarDomnguez *,DoraRomeroSalas ,VioletaPardoSedas ,ZeferinoGarca 2 3 3 4 Vzquez ,DoloresCorreaBeltrn ,HeribertoCaballeroOrtega FranciscoOleaPopelka , 4. MoSalman 1 2 3

FacultaddeMedicinaVeterinariayZootecnia,UniversidadVeracruzana,Veracruz,Mxico, CentroNacionaldeInvestigacinDisciplinariaenParasitologaVeterinaria.INIFAP,Mxico, LaboratoriodeInmunologaExperimental,SubdireccindeMedicinaExperimental,Instituto

Nacional de Pediatra, SSA, Mxico DF, Mxico y 4Colorado State University, Animal Population Health Institute, Fort Collins, CO.

*Correoelectrnico:mvzmariel@0gmail.com* autorparacorrespondencia RESUMEN La toxoplasmosis es una zoonosis de distribucin mundial, es transmitida a travs de las heces de gato, puede causar aborto en varias especies animales, entre ellas cabras y mujeres. El objetivo del estudio fue determinar la presencia de anticuerpos contra

Toxoplasmagondiiencaprinosyproductoreseidentificarlosfactoresderiesgoasociadosa
esta enfermedad. Se colectaron 216 muestras de sueros de caprinos, en 13 rebaos de cuatrocomunidadesdelmunicipiodeYecuatla,Veracruzy41suerosdecaprinocultores.El muestreofueporconveniencia.LaidentificacindeanticuerposcontraToxoplasmagondiise realizmedianteunapruebadeELISAyWesternblotcomopruebaconfirmatoria.Seaplic uncuestionarioepidemiolgicoenambaspoblaciones.Elanlisisestadsticoserealizcon elprogramaSTATA11.Laprevalenciageneraldelapoblacindecaprinosfuede60.2%,los caprinos de 6 aos fueron los de mayor prevalencia (88.2%), la infeccin a Toxoplasma

gondii fue asociada al consumo de suplemento y forraje (OR= 3.18 95%CI: 1.327.65),
pertenecer a rebaos localizados en Santa Rita fue estimado como factor de riesgo (OR= 2.05 95%CI: 1.034.08). En la poblacin humana, 33 sueros fueron positivos (80.5%), el contactoconlosgatosfueelnicofactorderiesgoidentificado(OR=14,CI95%1.52128.48).

27

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 Se concluye que ambas poblaciones han estado expuestas al parsito, los factores de riesgo

identificados para los caprinos, fueron el consumo de suplemento alimenticio y forraje, as comoperteneceralacomunidaddeSantaRita,yparalapoblacinhumanafueelcontacto conlosgatos.
Palabrasclave:Zoonosis,Toxoplasmagondii,caprinos,caprinocultores.

ABSTRACT

Toxoplasmagondiiisaprotozoanparasitewithworldwidedistributionthatcaninfectawide
range of animal species included humans. The objective of this study was to identify risk factorsassociatedwithT.gondiiinfectioningoatsandproducersfromYecuatla,Veracruz.A total of 216 blood samples of goats and 41 owners from 4 communities were collected. Samples were collected from only the herds were farmers and family members agreed to participate. Serological diagnosis was performed by indirect ELISA and Western blot as a confirmatorytest.Anepidemiologicalquestionnairewasusedforcollectingdata.Thestatistical
analysis was performed by STATA 11.0 software using multivariate analysis and logistic

regression. Amongthe goat population,130 testedpositive (60.2%). Animals 6 yearsold were the
most prevalent (88.2%), T. gondii infection was associated with eating nutritional supplement

andforage(OR=3.1895%CI:1.327.65),belongtoherdslocatedinSantaRitacommunity wasfoundasariskfactor(OR=2.0595%CI:1.034.08)whencomparedwithtotheothers communities. Among the human population, of the 41 samples, 33 tested positive (80.5%),
people in contact with catshad a higher seroprevalence (95.5%) compared with those not (61.1%), contactwithcatswastheonlyriskfactor(OR=14,CI95%1.52128.48)identified.Itisconcluded that

exposure of domestic goats to T. gondii infection in Yecuatla, Veracruz is common in both populations also contact with cats was a risk factor for the producers and family members although significant variation could be associated with geographical location and environmentalfactors.
Keywords:Goats,Publichealth,Toxoplasmagondii,Zoonoticdisease,Mexico.

28

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

INTRODUCCION Las infecciones con el parsito Toxoplasma gondii son muy comunes en humanos y animales en todas partes del mundo (Dubey, 2009). Es un parsito de gran importancia veterinaria y mdica, puede ocasionar abortos o enfermedades congnitas en sus hospederosintermediarios(Dubey,2006). Elcontactoconlosgatos,elconsumodelalechedecabrasinpasteurizar,elsuerodeleche, elconsumodecarnepocococida,lapocahigieneenlamanipulacindealimentos,ascomo prcticas agrcolas son factores de riesgo a la infeccin de T. gondii. El ciclo de vida est divididoendosfases:lasexualylaasexual,laprimerasellevaacaboenlosfelinos,lacual sedesarrollaenelintestinodelgadodestos,mientrasquelafaseasexualpuedellevarsea caboenloshospederosintermediarios,quepuedensercualquieranimaldesangrecaliente, incluidoelhombre(BlackyBoothroyd,2000). Hasidoestimadoquemsdelatercerapartedelapoblacinhumanahaestadoexpuestaal parsito(Dubey,1998).Anaslasseroprevalenciasestimadasparalapoblacinhumanay animal varan entre los diferentes pases, reas geogrficas en el mismo pas y diferentes grupostnicos(Tenteretal.,2000). La cra y produccin de ganado caprino en Mxico es todava hoy una actividad principalmentefamiliardestinadaalaventadelosproductosobtenidosdeestosanimales,la mayora de las unidades productivas se conforman por pequeos rebaos. Existe poca informacinacercadelapresenciadetoxoplasmosisencabrasascomoensusproductores ypersonasencontactoconlasmismas. Por lo anterior descrito el objetivo del estudio fue determinar la presencia de anticuerpos contra T. gondii en caprinos y productores e identificar los factores de riesgo asociados a estaenfermedad. MATERIALESYMTODOS ElestudiosellevacaboenlascomunidadesdeSantaRita,PazEnrquez,LuzBellayRoca deOrolocalizadasenelSierradelmunicipiodeYecuatla,Veracruz. Se obtuvieron 216 muestras de sangre de caprinos y 41 muestras de caprinocultores, nicamentefueronmuestreadasaquellaspersonasquedieronunconsentimientopreviopor escritodeparticiparenelestudio.

29

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

La identificacin de anticuerpos contraT.gondii, se realiz mediante una prueba de ELISA indirecto previamente estandarizado (FigueroaCastillo et al., 2006) y Western blot como prueba confirmatoria. Se aplic un cuestionario epidemiolgico en cada una de las poblacionesparalaobtencindedatos,mismosquesecolectaronenunahojadeExcel,el anlisisserealizconelpaqueteestadsticoSTATA11.0.

RESULTADOS De las 216 sueros de caprinos analizados, 130 resultaron positivas, obtenindose una seroprevalenciageneralde60.2%delascuatrocomunidadesqueparticiparonenelestudio, lamayorprevalenciafueenLuzBellaconun86.96%ylamenorenSantaRitacon47.1%. Con respecto a la edad de los caprinos, los animales de seis aos mostraron la mayor prevalencia(88.2%),ylosmenoresde1aolamenor(42.11%),seobservunincremento delaseroprevalenciaconformealaedad.Deacuerdoalanlisismultivariadolainfeccinen caprinosaToxoplasmagondiiseasociconelconsumodesuplementoyforraje(OR=3.18 IC95%: 1.327.65), deigual manera el pertenecer arebaos localizadosenla comunidad de SantaRitafueestimadocomofactorderiesgo(OR=2.05IC95%:1.034.08). Enlapoblacindepersonas,33suerosresultaronpositivos(80.5%).Laprevalenciamsalta fue en la comunidad Luz Bella, donde las ocho personas pertenecientes a esta comunidad resultaron positivas, dando un 100% de prevalencia. Las personas en contacto con gatos obtuvieron una mayor prevalencia (95.5%) en comparacin con aquellas sin contacto (61.1%).Deacuerdoalosresultadosobtenidosdelanlisismultivariadodelapoblacinde personas,elcontactoconlosgatosfueelnicofactorderiesgoidentificado(OR=14,IC95%:
1.52128.48).

DISCUSIN Los resultados obtenidos en la poblacin caprina coinciden con el 63.3% reportado en Espaa (RodriguezPonce y Hernndez, 1995), y con lo reportado en Mxico (44%) por GarcaVzquez et al., (1990). Por otro lado Figuereido et al., (2001), reportaron en Brasil una mayor prevalencia de anticuerpos contra T. gondii en cabras mayores a 36 meses (44.6%) que aquellas entre 12 y 36 meses de edad (8.6%). Los factores de riesgo encontradoscoincidenconlodescritoporCaballeroOrtegaetal.,(2008).

30

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

La prevalencia general de la poblacin de personas coincide con el 67% de prevalencia estimadaenCuba(Gonzlezetal.,1995).EnunestudiorealizadoporAlvaradoEsquivelet

al.,(2007),lamayorprevalenciafuereportadoenlapoblacindepersonasconcontactocon
gatos,lo que coincide con esteestudio. Eneste estudioel contacto delos carprinocultores con los gatos fue asociado conlainfeccindeT.gondii, lo que podra explicarse debido a que no se educa a los gatos para que defequen en cajas de arena o zonas especficas, dandocomoresultadounadiseminacindelosooquistesenreasgrandesobienencasas con piso de tierra. La infeccin de los gatos es ms alta en personas que viven en zonas pobresqueenlosquevivenenmejorescondiciones(Ferreiraetal.,2009),posiblementea unamayorfrecuenciadecaza.

CONCLUSIONES
Se concluye que ambas poblaciones han estado expuestas al parsito, los factores de riesgo

identificados para los caprinos, fueron el consumo de suplemento alimenticio y forraje, as comoperteneceralacomunidaddeSantaRita,yparalapoblacinhumanafueelcontacto conlosgatos.

LITERATURACITADA AlvaradoEsquivel C., TorresCastorena A., Lisenfeld O., GarcaLpez C. R., Estrada MartnezS.,SifuentesAlvarezA.,MarsalHernndezJ.F.,Esquivel.CruzR.,Sandoval HerreraF.,CastaedaJ.A.,DubeyJ.P.2009.SeroepidemiologyofToxoplasmagondii infectioninpregnantwomeninruralDurango,Mexico.J.Parasitol.95:271274. Black M.W. y Boothroyd J. C., 2000. Lytic Cycle ofToxoplasma gondii. Microbiology Mol.

Biol.Rev.,64:607623.
CaballeroOrtegaH.,QuirozRomeroH.,OlazarnJenkisS.,CorreaD.2008. Frecuencyof

Toxoplasma gondii infection in sheep from a tropical zone of Mexico and temporal
analysisofthehumoralresponse.Parasitology,135:897902. Dubey J. P., 1998.Toxoplasmosis, sarcocystosis,isosporosis, and cyclosporosis In: Palmer SR, Soulsby EJL, Simpson DJH, editors. Zoonoses. Oxford: Oxford University Press. pp.57997.

31

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Dubey,J.P.,2006.ComparativeinfectivityofoocystsandbradyzoitesofToxoplasmagondii forintermediate(mice)anddefinitive(cats)hosts.VeterinaryParasitology140:6975. Dubey, J. P. 2009. History of the discovery of the life cycle of Toxoplasma gondii. Int. J.

Parasitology.39:877882.
Ferreira,U,Hiramoto,M.Roberto,Aureliano,P.DboraP.daSilvaNunes,Mnica,daSilva, S,NatalMalafronteS,Rosely.,Muniz.T.Pascoal2009.ACommunitybasedsurveyof human toxoplasmosis in rural amazonia: seroprevalence, seroconversion rate, and associatedriskfactors.Am.J.Trop.Med.Hyg.81(1)171176. FiguereidoJ.F.,SilvaO.S.,CabralD.D.,MineoJ.R.2001.SeroprevalenceofToxoplasma

gondii infections in Goats by the indirect Haemagglutination, Immunofluorescence and


Immunoenzymatic Tests in the Region of Uberlndia, Brazil. Mem Inst Oswaldo Cruz,

RiodeJaneiro.96:687692.
FigueroaCastillo J. A., DuarteRosas V., JurezAcevedo M., LunaPastn H., Correo D. 2006. Prevalence of Toxoplasma gondii antibodies in rabbits (Oryctolagus cuniculus) fromMexico.JParasitol,92:394395. GarciaVazquez Z., RosarioCruz R., and SolorzanoSalgado M. 1990. Prevalence of antibodies against Toxoplasma gondii in sheep and goats in three states of Mexico.

Prev.Vet.Med.10:2529.
GonzalezMorales T., BacalloGallestey J., GarciaSantana C. A., and MolinaGarcia J. R. 1995.PrevalenciadeanticuerposantiToxoplasmagondiienunapoblacindemujeres embarazadasenCuba.Gac.Med.Mex.131:499503. RodriguezPonce, E., J. M. Molina, and S. Hernandez, 1995. Seroprevalence of goat toxoplasmosisonGrandCanaryIsland(Spain).Prev.Vet.Med.24:229234. Tenter A. M., Heckeroth A. R., Weiss L. M. 2000. Toxoplasma gondii: from animals to humans.InternationalJournalforParasitology,30:12171258.

32

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 06)CORRECCIN DE PROBLEMAS DENTALES DE CHINCHILLAS (Chinchilla

langera)ENUNCRIADERODECAJEME,SONORA
2 1 1 LpezGutirrez,RosaMelissa ,MirandaRomero,AnaLaura .,JimnezNevrez,Ricardo ., AngelesDelaLlave.,Isabel1 (iangeles@itson.edu.mx)Autorparacorrespondencia

RESUMEN LaChinchilla(Chinchillalangera)esunmamferoroedoraltamenteutilizadoenlapeleteray ocasionalmentecomomascota.Entresusprincipalesproblemasdesaludestnlosdentales debido al crecimiento o deformacin de los dientes incisivos o molares tambin llamado maloclusin lo que provoca que no encajen los dientes superiores con los inferiores por lo tanto los animales no pueden comer correctamente hasta morir. El objetivo de este trabajo fue mejorar y facilitar el proceso de roer y masticar en chinchillas con problemas de malformacionesdentales,atravsdesucorreccinpormediodeunatcnicamodificadade limado, con el propsito de elevar su calidad de vida y mejorar su manejo zootcnico. La metodologaaplicadafuedetipocualitativo,eldiagnsticoserealizporinterpretacinvisual directaydescripcincompletadelmismo.Seevalulaformadeabordajesegnelcasoyse procedi aanestesiar para realizar ellimado delas piezas dentales con un taladro Dremel, retirando los residuos de pulido y aplicacin de tratamiento respectivo. Se trabaj con 10 animales de los cuales 3 fallecieron por su avanzado estado de desnutricin, 7 se recuperaronadecuadamente.Laspiezasdentalespresentarondiferentescombinacionesde sobrecrecimiento,2deestosanimalestuvieronincorrectaalineacinenincisivos,premolares ymolares.Seobservqueelmanejoadecuadodellimadocorrigelasafeccionesdentalesen laschinchillassinserpeligroso,serecomendagregarfibraaladietaascomobrindarlesun trozodemaderalimpioparaquepuedanroeryprevenirlamaloclusin. Palabrasclave:Limado,oclusin,maloclusin,peridontal,sobrecrecimiento, ABSTRACT TheChinchillaisananimalhighlyusedinfurbusinessandoccasionallyasapet.Amongtheir main health problems the dental due to growth or deformation of molar or incisor teeth are also called malocclusion which causes do not fit the teeth above with the lower. Therefore animals can not eat properly, to death. This study wanted to improve and facilitate the process of gnawing and chewing in chinchillas with dental malformations, through its

33

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

correctionbyamodifiedfilingtechnique,inordertoimprovetheirqualityoflifeandimprove theirmanagement.Themethodologyappliedwasqualitativetype,diagnosiswascarriedout bydirectvisualinterpretationandfulldescriptionofit.Assessedhowtoapproachaccordingto thecaseandproceededtoanesthetizeforthegrindingofteethwithaDremeldrill,removing waste grinding and application of respective treatment. This procedure was proved with 10 animals,sevenofthenrecoveredproperlyandthreediedbecausetheiradvancemalnutrition state.Thereweredifferentcombinationsofovergrowth,2caseshadanincorrectalignmentof the incisors, premolar, and molar pieces. Adition of fiber to the diet and cleaning the teeth withapieceofwoodwasrecommendedsothattheycangrowandpreventmalocclusion. Keywords:Filing,occlusion,malocclusion,peridontal,overgrowth

Departamento de Ciencias Agronmicas y Veterinarias. Instituto Tecnolgico de Sonora,

http://www.itson.mx CiudadObregn,Sonora,Mxico. 2Tesista. INTRODUCCIN Lachinchillaesunmamfero,roedorhistricomorfodelafamiliaChinchllidosesendmicade Sudamrica. Se distinguen dos especies: Chinchilla brevicaudata, y Chinchilla lanigera (Mitchel,Tully,2009). La crianza dela chinchilla se rige porlos mismos fundamentos productivoeconmicos que cualquier otra explotacin animal. Sus ingresos se registran principalmente por la venta de pielesyladeanimalesvivos. Laschinchillastienendienteshipsodontesaradicuales,loquesignificaqueemergenycrecen continuamente durante toda la vida 5.5 a 6.5 centmetros por ao y no tienen verdaderas racestienen6dientesmolares,4premolaresy4incisivosconuntotalde20piezas,siendo su frmula dental:1/1, 0/0, 1/1, 3/3, el colornaranja es signo dedientes sanos, su paladar estconstreidoanteriormenteylaaberturabucaleslargayangosta.Lasuperficiefacialde los incisivos est cubierta por esmalte superficial de pigmentacin amarillo a anaranjado (MitchellyTully,2009).

34

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Las chinchillas mastican y roen moviendo las mandbulas lateralmente. En descanso los incisivos mandibulares contactan con los incisivos maxilares. Los molares y premolares no oclusionancuandomastica,paraquelosincisivossedesgasten(Crossley,2003). Como todo mamfero, tiene problemas de salud, y dentro de estoslos problemas dentales, siendoelmscomnlamaloclusinmismaquedebeprevenirsedentrodesucrianza.Este problema consisteen un mal crecimiento odeformacin delos dientesincisivos o molares, que provoca que no encajen los dientes superiores con los inferiores por lo tanto los animales no pueden morder y comer correctamente y tampoco podrn desgastarlos, por lo que se incrustarn en encas, lengua, mejillas, provocndoles heridas graves hasta la muerte. Los signos que se presentan por la malformacin de los dientes son: lagrimeo, comen lentamente, anorexia, lceras en la mucosa bucal y lengua, se les cae la comida, heces pequeas,prdidadepeso,sialorrea,alopeciaalrededordeojosybarbilla,huelenmal,pelo hirsuto,desnutricin,hipoglucemia,anemia,parlisis,comaymuerte. SegnHoefer(1999),lamaloclusinpuedeocurrirdebidoacausastraumticas,hereditarias odeficienciademineralesduranteelcrecimiento,ascomonodisponerdeobjetospararoer enlajaulaydesgastarsusdientes. Cuando cursan con problemas avanzados, se puede intentar corregir usando limas muy finaselraspadoocortededientesestcontraindicadoyaquecausauntraumaimportante peridontal, fractura el diente y abscesos de la raz. Las limas finas con punta de diamante puedenserusadasperosonmuylentasyserecomiendanparalostoquesfinalescuandose remueve una longitud significativa de los dientes. Cuando esto ltimo sucede puede presentarse disfuncin oral adicional ya que los msculos de la quijada necesitan varias semanas para adaptarse a una posicin normal, durante este tiempo se requiere alimentacin asistida. Los dientes tienden a alargarse de nuevo as que el tratamiento usualmente necesita ser repetido en intervalos de 6 a 8 semanas (Meredith y Redrobe, 2005). Para prevenir laceraciones y dar espacio para trabajar, es necesario utilizar un espculo bucal,queretirelalenguayotrostejidosblandos(BirchardySherding,2002).

35

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Elobjetivodeestetrabajofuemejoraryfacilitarelprocesoderoerymasticarenchinchillas con problemas de malformaciones dentales, a travs de su correccin por medio de una tcnica modificada de limado, con el propsito de elevar su calidad de vida y mejorar su manejozootcnico. MATERIALYMTODO Eldiagnsticoprimarioserealizporinterpretacinvisualdirectaydescripcincompletadel mismo. Acadachinchillaselepracticunexamenfsico,seevalulaingesta,aparienciay estado del pelaje y se anot en una historia. Para realizar la exploracin oral, se sujet a cadaanimalitoparaobservarsucondicindentalydeterminarlaslesionesenlamisma se determin el procedimiento de abordaje de acuerdo a cada caso, se dosific la anestesia Tiletamina zolazepam emplendose 0.15 mg/kg va IM (Virbac 1997). Una vez anestesiada selimolapiezaafectadaconTaladroDremelpuntadeCarbide.Conunhisopohmedose retir el material procedente del pulido para evitar aspiracin y se aplic Enrofloxacina a dosisde5a10mg/kgvaoral(Plumb2005).

36

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RESULTADOSYDISCUSIN Losresultadosseexpresanenlasiguientetabla Chinchill a 1 Pes o 424 gr 450 gr Incisivos Incisivo inferior derecho diagonal Premolare s Molares Lesiones Coloraci Resultad n o Muerte a Amarilla los 2 das Muerte a los 2 das

Cortado y Pulido de Mejillas pulido aristas Inferior derecho 1cm Bordes filosos e irregulare s Espculas en 2 y 3er superior derecho y 3er inferior izquierdo Espcula 1er inferior derecho

Enterrados en las Amarilla mejillas

450 gr

Limado y pulido de bordes irregulares Incisivos superiores enroscado s

Mejillas y Blanca lengua

Muerte a las 24 hrs

400 gr 576 gr

Espcula Superior izquierdo

Incrustado s en el Amarilla paladar, y enmejillas Mejilla irritada Amarilla

Alta

Espcula Superiores Inferior einferiores derecho

Alta

37

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Chin Pes Incisivos chilla o Inferiores 560 creciendo 6 gr curvos haciaatrs Fractura de incisivos 560 7 inferiores gr con bordes irregulares 470 Superiores 8 gr einferiores 440 gr

Premolar Molares es

Lesiones Sin lesiones

Colora Resultado cin Amarill Alta a

Sin lesiones Sin lesiones Sin lesiones

Amarill Alta a Blanco Alta s Amarill Alta o

10

552 gr

Espculas Desgaste Inferior irregular en derecho Superiores e einferiores izquierdo Incisivos inferiores fractura en superiores

Sin lesiones

Amarill Alta o

ParalarealizacindeestetrabajosemodificaronlastcnicasdeMeredithyRedrobe(2005) sobreellimadodelasespculasencuantoalinstrumentalsugeridoyaqueenestecasose emple un taladro elctrico multiusos pequeo con punta de carbide que asemeja a los especializados dentales y que facilita su introduccin a la boca, en lugar de abreboca se utiliz un espculo nasal para separar belfos y mejillas, as como clips en sustitucin del abreboca, mismos que son metlicos y facilitan el desliz del taladro en relacin a las observacionesdeMeredithyRedrobesobreladisfuncinoraladicionalposterioralmanejo, no ocurrieneste trabajo. En el caso delos primeros tres animales que fallecieron, nose administraronfluidosnialimentacinforzadacomoindicaCrossley(2003),poreldeteriorode su condicin fsica. Tambin se observ que los siete restantes regresaban a la libre alimentacincasiinmediatamentecomolomencionaesteltimoautor.

38

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CONCLUSIN Se realizaron las correcciones de las malformaciones dentales comunes en roedores enfermos del criadero. Este proceso dio solucin a la prdida de ejemplares, mejoro su calidaddevidayelmanejozootcnico. Se recomend el cambio de dieta por una basada en la aportacin de heno, pellets especializados para Chinchilla, as como la adicin de suplementos alimenticios. Un punto fundamentalesbrindaracadaespcimenuntrozodemaderalimpioquelepermitaejercer su funcin natural de roedor para mantener la salud dental debido al desgaste natural que esteleproporciona. LITERATURACITADA

Birchard y Sherding. 2002. Manual clnico de procedimientos en pequeas especies, volumenII.2a.ed.McGrawHillInteramericana.Espaa.p.1640 Crossley, D. A. 2003. Management of rabbit and rodent. Tooth Elongation services@dacross.net Hoefer,H.L.2000.Rodentdentistry.WestHillsanimalhospital.Huntington,NewYork.p.1, 3 Meredith,A,S.Redrobe.2005.BSAVAManualofexoticpets4a.edition.Britshsmallanimal veterinaryassociation.EUA. Mitchell, A. T.Tully. 2009. Manual of exoticpet practice. Saunders Elsevier, EUA. p. 474 486 Plumb, D. C. 2005. Veterinary Drug Handbook. Fifth edition. Blackwell publishing., EUA. p. 297 Virbac.1997.ZoletiluniversalanaestheticLaboratoriosVirbac.Francia.p.20,21

39

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 07) ESTUDIO EPIDEMIOLOGICO PARA LA PREVENCION DE LA RABIA PARALITICABOVINAENLAZONANORTEDEVERACRUZ EPIDEMIOLOGICALSTUDYON THE PREVENTIONOFBOVINE PARALYTIC RABIES INNORTHERNVERACRUZ LuisGustavoAguileraBenavides*,JosLuisSotoLoya,EnriqueMartnezLpez,Fabiola CortesMrquez. Facultad de Ciencias Biolgicas y Agropecuarias de la Universidad Veracruzana, Campus Tuxpan. Carretera TuxpanTampico km 7.5 S/N Col. Universitaria. C.P. 92860. Tuxpan, Veracruz, Mxico. Email: mvz_aguilerauv@hotmail.com mvz_joseluis@hotmail.com fcortez@uv.mxenrimartinez@uv.mx*Autorparacorrespondencia. RESUMEN La rabia es una zoonosis de los mamferos causada por el Lysavirus (virus de la rabia), y se transmite al hombre principalmente por la saliva de animales infectados, asi mismoesteestudiotienecomoobjetivodepresentarelpanoramarelacionadoconlaRabia ParalticaBovina(R.P.B),ponerdemanifiestolapresenciadebrotesenlosmunicipiosdela Zona Norte de Veracruz por mala prevencin. Se realiz en 60 ranchos al azar, desde GutirrezZamorahastaPanuco,Ver,obteniendolainformacinpormediodeuncuestionario queseaplicatodoelpersonalqueestuvieraencontactoconlosanimales.Lainformacin serealizodesdeNoviembrede2010hastaJuniode2011.Losresultadosdemostraronqueel 85% de los animales se encuentra en buen estado de salud, 33% de los ranchos cuentan conregistros,67%delosganaderostieneconocimientosbsicosdelaenfermedad,72%de losranchostienecalendariodevacunacin,peroel20%deellosnoaplicanningunamedida de tcnica de control o prevencin y solo hay presencia de campaas antirrbicas para pequeasygrandesespeciesenun5%delos60ranchosanalizados.Demostrandoconello lafaltademedidasdeprevencinenvariasenfermedadesperomsenlaR.P.B.,elcualha provocado grandes prdidas econmicas para los ganaderos y productores. Teniendo en cuenta que muchos de estos problemas son debido a la falta de informacin actualizada, difusin de campaas para el control poblacional del murcilago as como la vacunacin y asesoraenlosganaderos. Palabrasclaves:epidemiologia,rabiaparaliticabovina,zoonosis,veracruz.

40

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ABSTRACT Rabies isa zoonotic diseaseof mammalscaused byLysavirus(rabies virus), andis transmitted to humansprimarilyby salivaof infected animals, likewise this studyaimsto presentthe picturerelated tobovine paralytic rabies(RPB), highlightthe presence of outbreaks inthe municipalities ofthe northern region ofVeracruzby poorprevention. Was conductedin 60farmsat random from GutierrezZamora toPanuco, View,

obtaininginformation througha questionnaireapplied toall staff whohad contactwith animals.The information was conductedfrom November2010 toJune 2011.The results showedthat 85% of the animalsare in goodcondition,33% offarmshaverecords, 67%of farmershave basic knowledge ofthe disease,72% offarmshavethe vaccination schedule,but20%of them do not applyany measure ofcontrolor preventiontechniqueand there is onlythe presence ofrabiescampaignsfor small andlarge speciesin 5% of the 60farmsstudied.Thus demonstrating the lack ofpreventive measuresin various diseasesbut more in theRPB, which has caused greateconomic lossesfor farmersand producers.Given thatmany of theseproblems are due tothe lackof updated informationdissemination campaigns tocontrolbatpopulationas well as immunizationsand adviceonfarmers. Keywords:epidemiology,bovineparalyticrabies,zoonoses,Veracruz. INTRODUCCIN

La rabia es una enfermedad viral, que presenta un periodo deincubacinlargo y un cursoagudoymortal,afectaalosanimalesdesangrecaliente.Tieneunaampliadistribucin mundialyestransmitidageneralmente mediantelamordeduradeunanimalenfermoauno susceptible, ya que el virus puede estar presente en la saliva de los animales afectados (CorreonGuiron1968).EnMxicolarabiaparalticabovinasepresentaenformaenzotica en23estadosdelarepblica,distribuidaportodalacostadelgolfodeMxicodesdeelsur de Tamaulipas hasta Yucatn y por la costa del Pacfico desde el sur de Sonora hasta Chiapas, correspondiente al rea de biodistribucin del Murcilago Hematfago Desmodus

rotundus,extremadamenteimportantedesdeelpuntodevistaepidemiolgicodelazoonosis,
es que hasta el momento la rabia no tiene tratamiento ni curacin en humanos que han presentadoelcuadroclnicoqueevolucionairreversiblementehastacausarlamuerte(Seifert

41

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

H.S.H. 2002). La gravedad del problema ha hecho posible que diversas instituciones de investigacin, privadas y oficiales en el mundo se interesen en el asunto, es por eso que constantemente se desarrollan y ponen en prctica programas tendientes a lograr la prevencin de la enfermedad, mediante las medidas de prevencin y el desarrollo de tcnicas de control principalmente la vacunacin masiva del ganado con diversos tipos de vacunas (Cerecedo, 1997). La rabia en los pases de las Amricas es considerada un problema de salud pblica de importancia, siendo as que llevan adelante programas de vigilancia, prevencin y control en concordancia a las recomendaciones del Comit de ExpertosenrabiadelaOMS(8.voInforme),(Navarroetal.,2007).Elobjetivodeestetrabajo fue realizar una investigacin sobre los mtodos de prevencin en Rabia Paralitica Bovina (R.P.B.)queserealizanenlaZonaNortedeVeracruz,derivadadelEstudioEpizootiolgicos deRabiaenlaZonaNortedeVeracruz. MATERIALYMTODOS El presente trabajo se realiz en la Zona Norte del Estado de Veracruz, desde PpantlahastaPanuco,Veracruz,MxicodesdeNoviembrede2010hastaJuniode2011. Cabe mencionar que se particip con el proyecto del ESTUDIO EPIZOOTIOLOGICO DE RABIAENLAREGIONNORTEDEVERACRUZ,delcualseiniciestatesisenfocadasolo alosmtodosdeprevencinqueserealizanenlosranchoinvolucradosdentrodelamisma investigacin antes mencionada. Con la finalidad de tener el conocimiento de las condiciones del tipo de ganado y las reas de produccin, esto a travs de encuestas realizadasalosproductoresy/opersonalqueelaboraenlosranchos.Dichasencuestasse realizaronconpreguntasreferentesamtodosdeprevencinqueserealizaenlosranchos ganaderosparaprevenirlarabiaparaliticabovina. Durantelainvestigacinserealizaronlassiguientesactividades: 1. Observaciones visuales y fsicos al ganado (bovinos, equinos, porcinos, ovinos, etc), tambinalasreasdelrancho,estoconelfindeconfirmarlosdatosobtenidosporel personaldelosranchos. 2. Se realizo una vigilancia epidemiolgica, a travs de un monitoreo durante la realizacindelainvestigacin. 3. Serevisaronlosregistrosdecontrolesescritosy/oelectrnicos.

42

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

4. Ascomolaobservacindelostiposdevacunaantirrbicaquemanejan. 5. Serevisocuevas,alcantarillas,arboleshuecosysupuestosnidosdemurcilagos. 6. Se participo en capturas de murcilago, en el cual se identificaron los tipos de murcilagosquehabaenlazonayelcensopoblacionaldelmurcilagohematfago conlaideadeconfirmay/oactualizarlainformacinnecesaria. 7. Se asesoro a vaqueros que demostraron no aplicar correctamente los mtodos de prevencin. Dentro de la investigacin se tom en cuenta todo tipo de animal mamfero que fuera transmisor y/o portador del virus, sin importar edad, sexo, fin zootcnico, etc. Tomando en cuentacomoprimordialalosbovinos,yaqueesimportantelosanimalesquetienencontacto con el ganado bovino con las personas que elaboran en el rancho, se les pidi que mencionaranloquesabansobrelarabiaparalitica,puesdeigualmaneraestnexpuestosa contraerelvirus.

RESULTADOSYDISCUSIN Se visitaron 60localidadesdela Zona Norte de Veracruz con antecedentes de ataques de murcilago y que no han podido controlar, siendo Panuco, Ozuluama, Tuxpan, Chiconamel, El Higo, Tempoal, Chijoles y Ejido los Huastecos con ms casos de ataque de murcilagos. En los ranchos visitados se obtuvo un censo de animales, esto con la finalidad de conocer las especies que haba y dominaban en cada rancho (Grafica 03). Acha et al., (1986) hace referencia a que en los aos sesenta, cuando las medidas de prevencin y control

43

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

prcticamente eran inexistentes, las cifras de muertes bovinas por esta causa podan

aproximarse a las quinientas mil cabezas anuales. Los ataques en la Zona Norte de Veracruz varia, 63% de los ranchos encuestados desconocen el nivel de frecuencia que tienen o hay, 25% tienen frecuenciadeataques,deloscualesel21%sonrecientes(dasosemanas)yel4%presenta ataques cada ao, el 12% de los lugares visitados no presentan ataques de murcilagos desde hace 8 aos mnimo (Grafica 14). La gravedad del problema ha hecho que constantemente se desarrollen y pongan en prctica programas tendientes a lograr la prevencin de la enfermedad, mediante las medidas de prevencin y el desarrollo de tcnicas de control principalmente la vacunacin masiva del ganado con diversos tipos de vacunas (Cerecedo, 1997). Se observaron 6 medidas y tcnicas de vacunacin, siendo la vacunacinporlatarde(33%)yelusodecadenafra(23%)comolasprincipalestcnicasy medidas de vacunacin, pero el 23% de los ranchos restantes no aplican ninguna medida (Grafica 10). El riesgo de la rabia paralitica bovina de su ocurrencia en el hombre y su incidencia en las especies domsticas productivas, particularmente en la ganadera bovina, dado el impacto social y econmico que ello significa, constituyen una preocupacin permanente para las entidades encargadas de velar tanto por la salud pblica como por la salud animal (Bentez et al., 1992 y Alvares 1997). En algunos de los ranchos visitados (Grafica 06) se obtuvo informacin de

44

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

animales enfermos y/o muertos por R.P.B, teniendo un total de 110 casos posibles a esta enfermedad,deloscuales18animalesseencontraronenfermosocontagiadosdeR.P.By 37fueronnegativosadems29animalesmurieronacausadeDerrengue,estoconfirmado porlaboratoriomientrasquelos26animalesrestantesmurieronporotrascausas.Elestado desaluddelosanimalesobservadosdurantelainvestigacin(Grafica04)mostroque1.309 animales(19%)estnenMuyBuenestado,3.400animales(44%)enBueno,2.856animales (37%) en estado Regular y 0 animales (0%) en Mal estado. La rabia en los pases de las Amricas es considerada un problema de salud pblica de importancia, siendo as que llevan adelante programas de vigilancia, prevencin y controlenconcordanciaalasrecomendacionesdel Comit de Expertos en Rabia de la OMS (8.vo Informe), (Navarroet al., 2007). Sin embargo en la ZonaNortedeVeracruzel67%delpersonalenlos lugares visitados tiene conocimiento bsico sobre R.P.Byun33%noodesconocelaenfermedadporcompleto,ademsquesoloel33%tiene

45

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

egistrosclnicosdesusanimales.Lapresenteinvestigacin(Grafica12)analizolapresencia de Campaas Antirrbicas en los 60 ranchos, en un 5% hay presencia de campaas antirrbicas solo para pequeas especies, 3% de los ranchos visitados si hay campaas antirrbicas pero no de que tipo,60% desconocen este tipo de campaas que hay y enun 32% no se ha aplicado alguna campaa antirrbica. Para prevenir e implementar una medida de control de un brote de rabia, adems del diagnostico, es necesario implementar un programadeprevencinparaello,secuentacon cierto nmero de vacunas de excelente calidad (FloresCrespo,1998).Seobservo(Grafica09)ysepidisaberqutipodevacunasaplican, teniendoqueel78%delpersonalqueseencargadeestaactividadencadarancho,nosabe qutipodevacunaomarcaseestaplicando,elrestodelosranchosvisitadosmencionaron 6tiposdevacunasSANFER(3%),INTERVET(4%),CHINOIN(2%),DERRYSAN(11%)y7 VIAS (2%). La vacunacin se presenta en cada rancho de diferente forma, demostrando (Grafica 08) que solo el 72% de los ranchos llevan un calendario de vacunacin (51%

46

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Vacunan Anualmente y 21% Semestralmente), el 24% no aplica la vacuna y el 4% solo lo hacen cuando hay presencia de Derrengue, debes en cuando, entre otras. La rabia es controlable y prevenible mediante acciones conjuntas de los sectores pblico, social y privado, ofreciendo informacin educativa al respecto en funcin de una vigilancia epidemiolgicaeficaz,laatencinmdicaoportunayadecuada,lavacunacinyelcontrolde la poblacin canina, el control de la poblacin del murcilago hematfago (vampiro) y la vacunacin de animales de otras especies domsticas susceptibles, particularmente las de inters econmico en riesgo (a fin de reducir las considerables prdidas econmicas en la ganadera del pas) (NOM011SSA21993). En la Zona Norte de Veracruz 43% de los ranchos no tienen presencia de murcilagos, mientras que el 44% tienen presencia de murcilagosensusranchosyalrededores,peroun13%desconocensihaypresenciaono demurcilagos.Enelusodelacadenaoredfra,el63%delosranchosmostrarontenerun correcto manejo de ello, sin embargo el 23% desconoce y/o implementa un mal manejo, exponiendo la vacuna a cambios bruscos de temperatura, lo cual implica problemas en el animal a la hora de la aplicacin del frmaco. Es difcil que se pueda radicar por completo unaenfermedady mssihablamosdeRabia Paralitica Bovina, por esa razn es que esta investigacin pretende lograr que las

instituciones de todos los niveles tengan acceso a esta informacin, logrando con ello darles una visin de cmo se encuentra hoy en da las medidas preventivas en la

47

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ganaderaypoderasesorar,capacitar,daraconocerdemaneraoportuna,eficazyconstante alosganaderosdeestazonaparaquesepromuevalaculturaenlasmedidasdeprevencin ycontrol. CONCLUSION El aporte que se pretende dar es mejorar primero la comunicacin entre las instituciones encargadas de vigilar y prevenir la R.P.B. con los ganaderos a travs de las asociaciones ganaderas, con el fin de mostrar la situacin en la que se encuentra hoy en da los ganaderossobreestetema,dejandoclaroquelaprdidaeconmicaqueprovocaanimales muertos por esta enfermedad se puede evitar a travs de la correcta aplicacin de las medidas y tcnicas de prevencin segundo que las instituciones concienticen a los ganaderospormediodecapacitaciones,platicas,foros,cursostallerlaimportanciaquetiene la notificacin de animales sospechosos, enfermos y/o muertos por Derriengue, el uso correctodelaredfraasicomolaaplicacinoportunadelavacunayelcontrolpoblacional delmurcilagopormediodelascapturasterceroquelosganaderosinformenasupersonal sobreestaenfermedadypromuevaenelloslaprevencinenlosanimalesyhumanospara evitarcualquiercontagio,tambinelsaberhacerusocorrectodelasmedidasdeprevencin, notificacinytcnicasdevacunacin.

AGRADECIMIENTOS AlMVZ.JosLuisSotoLoya,MSP.porsuconfianzayapoyoalinvitarmeparticiparconl en su investigacin y permitirme realizar una propia, esperando que estos resultados sean una forma de agradecimiento. A los MVZ. Jos Ma. Flores Mayorga y al MVZ. lvaro Ruz Bautistaporlasfacilidadesparapoderrealizarestetrabajo.

48

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

LITERATURACITADA Cerecedo de L.S. (1997). Diagnstico de Rabia realizados en el Centro de Salud Animal SAGAR, periodo 19911996 en Tuxpan, Ver. Tesis de la Fac. de Med. Vet. Y Zootecnia. U.V. CorreonGirn P. (1968). Aspectos Generales Sobre La Rabia En Humanos Y En Las EspeciesDomesticas.Mxico,D.F,130p. PNAcha.(1986).Epidemiologiadelarabiabovinaparaliticatransmitidaporlosquirpteros. Relatedarticles.36p. NORMA OFICIAL MEXICANA, NOM011SSA21993," Para la Prevencin y Control de la Rabia"" For the Prevention and Rabies Control". Cached. CRP Bovina. Salud. Gobierno Mexicano. NavarroV,AnaMaria,BustamanteN,JosySATOS,Alberto.Situacinactualycontrolde larabiaenelPer.Rev.per.med.exp.saludpublica,ene./mar.2007,vol.24,no.1,p.4650. ISSN17264634. Seifert, H.S.H. (2002) Sanidad Animal en los trpicos. Editorial Hemisferio Sur, Buenos Aires,Argentina.465p. Organizacin Mundial de la Salud. (2003). V Simposium internacional de enfermedades zoonoticas.Mxico,D.F,435443p. Organizacin Mundial de la Salud. (2005). VII Simposium internacional de enfermedades zoonoticas.Mexico,D.F,1627p.

49

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 08) RESISTENCIA MULTIPLE DE Rhipicephalus (Boophilus) microplus A IXODICIDASENBOVINOSDEACTOPANYVERACRUZ,VER.,MEXICO


1 1 1 1 FuentesManzoY. ,PenicheCardeaA.E.J. ,MartnezHerreraD.I. ,RomeroSalas,D. , 1 2 3 3 SchleskeMorales,I. ,SotoRodrguez,I. ,RosadoAguilarJ.A. .RodrguezVivas,R.I. y 4 BarradasPia.F.T. 1

Facultad de Medicina Veterinaria y Zootecnia, Universidad Veracruzana. Circunvalacin Esq. Yez s/n, Col. Unidad Veracruzana, C.P. 91710, Veracruz, Veracruz, Mxico. Tel. y Fax:+52(229)9342075y9344053,Email:apenichec@hotmail.com 2 Facultad de Bioanlisis. Regin Veracruz. Universidad Veracruzana. Iturbide s/n esq. CarmenSerdn.Veracruz,Veracruz. 3 FacultaddeMedicinaVeterinariayZootecnia,UniversidadAutnomadeYucatn.Km.15.5 Carr.MridaIxmatkuil.Mrida,Yucatn. 4 CELaPosta.InstitutoNacionaldeInvestigacionesForestalesAgrcolasyPecuarias.Paso delToro,Ver.

RESUMEN. Elobjetivodeltrabajofueconocerlapresenciadecepasdegarrapatasresistentesalamitraz y a la cipermetrina e identificar los posibles factores asociados a su presentacin en unidades de produccin bovina (UPB) de los municipios de Actopan y Veracruz, Ver. Se realiz un estudio epidemiolgico de tipo transversal. El total de UPB muestreadas se determinatravsdeunesquemanoprobabilsticoporconveniencia.Setrabajen24UPB, ocho en el municipio de Actopan y 16 en el de Veracruz. Se aplicaron encuestas a cada productor con las que se determinaron los posibles factores asociados a la aparicin de la resistenciaenlasUPB.Secolectaron50teleoginasingurgitadaslascuales,seincubaronen el laboratorio hasta su ovoposicin en apego al esquema propuesto por FAO (1999). Los huevosseincubarona27Cconunahumedaddel80%hastalaeclosindelaprimerafase larvaria. Los bioensayos para el diagnstico de resistencia a ambos ixodicidas se desarrollaronempleando dosis discriminante mediantela prueba de paquete delarvas. Los resultados mostraron para el Municipio de Actopan, una tasa de resistencia promedio de 24,9%(IC95%:23,526,4)paraelamitrazydel25,4%(IC95%:24,326,5)paralacipermetrina. Para el Municipio de Veracruz, se obtuvo una tasa de resistencia promedio de 23,6% (IC95%:22,524,6) para el amitraz y un 58,8% (IC95%: 57,759,9) para la cipermetrina. Las encuestas permitieron conocer que la resistencia es consecuencia de errores en los tratamientosgarrapaticidasaplicadosporlosproductoresconelpasodelosaos.Esteesel

50

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

primerreporteenelestadodeVeracruzderesistenciamltipleaixodicidasenlosMunicipios estudiados.SeconcluyequeenlasUPBmuestreadasexistenpoblacionesdeRhipicephalus

(Boophilus)microplusconresistenciaalamitrazyalacipermetrina.
PalabrasClave.Garrapatas,tasaderesistencia,ixodicidas,garrapaticidas. ABSTRACT. The aim of the study was to determine the presence to amitraz and cypermethrinresistant ticks and identify possible factors associated with this resistance in bovine production units (UPB)inActopanandVeracruz,Ver.,municipalities.Anepidemiologicalstudywasconducted bycrosssectional. UPBsampledwas determinatedby convinanceusinganon

probabilisticmodel. The study was conducted in 24 UPB: eight in Actopantown and 16 inVeracruz town.Surveys wereapplied to identifiedrelated factorsassociated with the resistance ineach UPB. 50 teleoginas were collected and were incubated in the laboratory untilovipositionbasedontheschemeproposedbyFAO(1999).Tickseggswereincubatedat 27C and 80% humidity until hatching of the first larval stage. Bioassays to both ixodicidesresistencediagnosis were developed using discriminating dose by test package larvae. The results showed for Actopanmunicipality an 24,9% (IC95%: 23.5 26.4) average resistance rate for amitraz and 25,4% (IC95%: 24,3 26,5) for cypermethrin.The results showed for Veracruz municipalityan 23,6% (IC95%: 22,5 24,6) average resistance rate for amitraz and 58,8% (IC95%: 57,7 59,9) to cypermethrin. The surveys helped to know that resistanceobservedisconsequencetomistakesintheacaricidesappliedtreatmentoverthe years.Thisstudy is the first report in Veracruz state to ixodicides resistance in the municipalitiesstudied.WeconcludethatinUPBsampledthereareRhipicephalus(Boophilus)

micropluspopulationsresistanttoamitrazandcypermethrin.
Keywords:Ticks, resistancerate,ixodicides,acaricides. INTRODUCCIN.

Rhipicephalus(Boophilus)microplus(R.microplus)esconsideradaunadelasgarrapatasde
zonas tropicales de mayor impacto en la ganadera nacional. Su control est basado en el empleodeproductosixodicidasenbaosdeaspersin,inmersiny/oenaplicacionespour on sin embargo, su mal uso ha permitido la aparicin paulatina de cepas resistentes

51

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(RodrguezVivasetal., 2005). En Veracruzlos antecedentes de estudios deresistenciade garrapatas a ixodicidas son escasos,por lo que el objetivo del estudio fue determinar la presenciadeR.microplusresistentesacipermetrinayamitrazenbovinosdelosMunicipios de Actopan y Veracruz Ver., as como identificar los factores de manejo asociados a su presentacin. MATERIALESYMTODOS. Serealizconunestudioepidemiolgicotransversalporconvenienciaen24UPB,ochoenel Municipio de Actopan y 16 en el de Veracruz.En cada una se colectaron 50 teleoginas repletasprocedentesdediferentesanimales.Paraconocerlosfactoresdemanejoseaplic unaencuestaalproductorrelacionadaconlaaplicacindelbaoyelusodeixodicidas.Enel laboratoriolasteleoginasseincubaronparaovopositaraunatemperaturade27Cconuna humedad del 80%.Los huevos y la primera fase larvaria, se cultivaron en apego a lo establecido por FAO (1999) hasta el diagnstico de resistencia mediante la prueba de paquetedelarvas.Paraevaluarlasusceptibilidadalasamidinas(AM)seutilizcomoprincipio activoelamitrazal12,5%yparalospiretroides(PS)unasolucindecipermetrinaal4%.Para calcular el ndice de mortalidad por contacto con los ixodicidas y la resistencia larvaria se emplearonlasfrmulaspropuestasporFAO(1999).ParacalcularlaprevalenciadeUPBcon resistenciaseemplelafrmulapropuestaporThrusfield(2005).Losintervalosdeconfianza al95%(IC:95%)paralasprevalenciasencontradassecalcularonmedianteelprogramaen
lneaVassarstats .

RESULTADOSYDISCUSIN. Seidentificlapresenciaderesistenciamltipleacipermetrinayamitrazen23UPB.Sloen unranchodelmunicipiodeVeracruz,nosepresentresistenciaaAM.Aunqueseindicaque la resistencia a PS y AM en Veracruz est generalizada, Grapain (2010)solo menciona la presencia de las cepas Tuxpan y Tempoal resistentes a organoclorados y organofosforados en la zona norte del estado, a las cepas San Juan Evangelista y Coatzacoalcos resistentes a PS y carbamatosen el sur de la entidad y a cepas con resistenciamltipleaPSyAMenlosmunicipiosdeAngelR.CabadayJessCarranza.Ante estepanoramaestatal,elpresenteestudioeselprimerreportederesistenciaaPSyAMen losmunicipiosdeActopanyVeracruz,Ver.Latasa(%)promedioderesistenciaparalas24

52

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

UPB muestreadas fue del 44,3% (IC95%: 43,4 45,1) para cipermetrina y del 29,4% (IC95%: 23,224,9)paraAM.Elrangodelatasa(%)deresistenciaparacipermetrinafluctudel2.3% al91.1%yparaAMdel2.0%al71.9%.Armendriz(2003)reportaenTamaulipasunrangode resistenciaacipermetrinadel81%al85%,elcualesmenoralatasa(%)mximaencontrada en el presente estudio para este ixodicida(91.1%) (IC95%: 87.893.0) no obstante, las frecuencias identificadas en ambos trabajos son muy altas e implican la presencia de poblaciones de garrapatas casi insensibles al uso de PS.Soberanes (2002) para Tabascoseala una tasa(%) promedio de resistencia de 62,5 % para cipermetrina y 74,8% para AM. Comparando los resultados de resistencia promedio obtenidos en el presente estudio, los datos publicados por este autor son mayores sin embargo, el solo hecho de identificar una tasa (%)baja de resistencia a ixodicidas en una UPB, debe ser considerado en lo sanitario,como un problema emergente. En las UPB de Actopan se encontr una prevalencia de 100% de resistenciaa AM y cipermetrina en el municipio de Veracruz, la prevalencia identificada en las UPB fue del 100% (IC95%: 59.7 100) para cipermetrina y 93,7% (IC95%: 67,799,6) para AM. En ambos casos, las prevalencias encontradas son mayoresal59,2%deresistenciaacipermetrinay19,4%deresistenciaaAMreportadopor RodrguezVivasetal.(2006)enYucatn. EnlasochoUPBmuestreadasenelMunicipiodeActopanseencontrqueel100%destas present poblaciones de garrapatas resistentes tanto al amitraz como a la cipermetrina.La resistencia promedio para el amitraz fue 24.9%(IC95%: 23,5 26,4) y 25,4 % (IC95%: 24,3 26,5)paracipermetrinaasimismo,elrangoderesistenciaparacipermetrinavaride2,3%a 37.2%yeldelamitrazoscilentre8,1%a47,1%. EnelMunicipiodeVeracruzsemuestrearon16UPB:unaenlalocalidaddeVeracruz,ocho en Santa Fe y siete en Vargas.Las 16 UPB presentaron un promedio de resistencia para amitraz del 23,6 % (IC95%: 22,5 24,6) y para cipermetrina del 58,8% (IC95%: 57,7 59,9) asimismo,elrangoderesistenciaparaamidinasentrelosranchosvaridel2.0%al71.9%y del7.0%al91.1%paraelcasodecipermetrina. Derivadodelasencuestassepudoconocerquelamayoradelosproductoresnodosifican correctamente el ixodicida para efectuar el bao adems de queaplican en cada animal menosdelacantidaddelquidorecomendadaquesonseislitrosdesolucinparaanimales adultosycuatrolitrosparajvenes(SAGARPA,2000).Asimismo,lasencuestasrevelaronque

53

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

el25%delosproductores(6/24IC95:10,647,5)cuentaconasesorapararealizarelbao garrapaticida, que el 100% (IC95%: 82,8 100) de ellos usa diversos productos comerciales cuyoprincipioactivoeselamitrazysloel41,6%(10/24IC95%:22,862,0)utilizaohausado PS como ixodicida. El bao de aspersin con bomba manual de 20 litros es el mtodo empleado por el 95% (IC95%: 76,8 99,7) de los productores y baan en promedio 16 animalesadultosporbomba.Sinembargo,elnmeromximoindicadodeanimalesabaar conunabombadeestacapacidadesdecuatroanimalesadultos(SAGARPA,2000).As,el ganadonosemojade maneracorrectaysepropiciaunmalcontactoentreelixodicidayla garrapata, situacin que en el tiempo genera la resistencia por subdosificacin (Rodrguez Vivas et al., 2005).El 26% (IC95%: 11,9 48,6) de los productores sobredosifican la dilucin delbao,el39%(IC95%:20,461,2)lodosificaenformacorrectayel34%(IC95%:17,157,1) emplea menor dosis de la recomendada por el fabricante. La encuesta indic que en el 60,8%(IC95%:38,779,5)delasUPBmuestreadasnosedosificademaneracorrecta.Doce productores (IC95%: 29,6 70,3) baan a sus animales cada 15 das, siete (29,1% IC95%: 13,451,2)lohacenentre15y20dasycinco(20,8%IC95%:7,942,7)realizansusbaos cada2030das.Enrelacinalafrecuenciadelbao,16delosencuestados(66,6%IC95%: 44,783,5)revelaronquelohacenalconsiderarlapresenciadegarrapatasensusanimales y ocho (33,3% IC95%: 16,455,3) baan por rutina dentro de un tiempo establecido sin importarlapresenciaoausenciadegarrapatasenelganado.El100%(IC95%:59,7100)de losproductoresindicaronquerotanlosixodicidasnoobstante,lamayorasolocambiande nombrecomercialynodefamiliadegarrapaticida.El75%(IC95%:52,989,4)deellosutilizan msdedosproductosensusbaosyel100%sealquedejarondeusarunproductoen particularporconsiderarloineficaz. CONCLUSIN. En los Municipios de Actopan y Veracruz. Ver., existenpoblaciones de R.

microplusresistentes a la cipermetrina y al amitraz, y la resistencia encontrada es


consecuenciadetratamientosgarrapaticidasinadecuados.

54

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

BIBLIOGRAFA. Armendriz G.I. 2003. Informe de un caso de resistencia mltiple a ixodicidas en

BoophilusmicroplusCanestri

(Acari:

Ixodidae)

en

Tamaulipas,

Mxico.Vet.

Mx.

34:4.http://redalyc.uaemex.mx/pdf/423/42334408.pdf FAO (Organizacin de las Naciones Unidas para la Agricultura y la Alimentacin). 2005. Estado actual de la Resistencia de Boophilusmicroplus en Amrica Latina y el Caribe. Perspectivas de aplicacin del control integrado. http://www.fao.org/docrep/006/y4813s/y4813s03.htm#TopOfPage. Grapain, J.I. 2010. Resistencia de Rhipicephalus (Boophilus) microplusa ixodicidas en Mxico: estudio recapitulativo. Tesis de Licenciatura. Universidad Veracruzana. Veracruz, Ver.,Mxico.2930p. RodrguezVivas R. I., M.A. Alonso DazF. Rodrguez A. Rosado Aguilar S. Gutirrez G. Ramrez L.A. Cob Galera S. Villegas Prez H. Fragoso Snchez M. Santamara S. Neri OrantesJ.OsorioM.A.OrtizNjeraM.CruzCimaA.C.SierraVzquezJ.R.OrtizOrtizR. Rosario Cruz Z. Garca Vzquez G. Aguilar Tipacam B. Valdivieso Lpez Y. Barreda Lpez A. Colin lvarez. 2005. Resistencia de la garrapata Boophilusmicroplus a los ixodicidas en el sureste de Mxico, CONACYTSAGARPA2002C011754, Folleto Tcnico N1. RodrguezVivas R.I. A.F. Rodrguez M. AlonsoDaz H. Fragoso V. Santamara and M. Rosario.2006. Prevalence and potential risk factors for amitraz resistance in

BoophilusmicroplusticksincattlefarmsintheStateofYucatan,Mexico.Prev.Vet.Med.75:
280286. SAGARPA (Secretara de Agricultura, Ganadera, Desarrollo Rural, Pesca y Alimentacin). 2000. Manual de operacin para la Campaa Nacional contra la garrapataBoophilusspp. Anexo6.http://www.sagarpa.gob.mx/v1/ganaderia/progan/manual_PROGAN_4d.pdf Soberanes, C.N. Santamara Vargas, M. Fragoso Snchez, H. y Garca Vzquez, Z.2002. Primer caso de Resistencia al amitraz en la garrapata del ganado Boophilusmicroplus en Mxico.Tc.Pec.Mx.40(1):8192. Thrusfield,M.2005.EpidemiologaVeterinaria.Edit.Acribia.Zaragoza,Espaa.177190p.

55

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 09) INDICADORES PRODUCTIVOS DE OVEJAS PELIBUEY Y CRUZAS COMERCIALESENUNSISTEMAINTEGRALDEMANEJOENTRPICO.

PRODUCTIVE INDICATORS OF PELIBUEY AND COMERCIAL HAIR EWES IN A TROPICSINTEGRATEDMANAGMENTSYSTEM


1* 1 2 CristelIshikaryVillegasMartnez ,BraulioAedoyLoya ,SaraOlazarnJenkins ,Nora 1 2 GarcezMercado ,JorgeVctorRoseteFernndez .

1 2

FacultaddeCienciasBiolgicasyAgropecuarias.MedicinaVeterinariayZootecniaUV. InstitutoNacionaldeInvestigacionesAgrcolas,PecuariasyForestalesSAGARPA. Correoelectronico:krys_vla04@hotmail.com*autorparacorrespondencia

RESUMEN Se evalu en ovejas de pelo, su produccin hasta el destete de sus cras. Se utilizaron30 ovejasPelibuey(PY)y22cruzas(CZ),apareadasconsementalesDorper(Dr).Elefectofue el genotipo de la oveja sobre tasa de gestacin (GEST), nmero y kilogramos de corderos paridosporovejaexpuesta(CNOEyKCNOE),nmeroykilogramosdecorderosparidospor oveja parida (CNOP y KCNOP), nmero y kilogramos de corderos destetados por oveja expuesta(CDOEyKCDOE)ynmeroykilogramosdecorderosdestetadosporovejaparida (CDOP y KCDOP). La informacin se analiz con GLM de SAS en diseo completamente aleatorio. No hubo diferencia (P>0.05) entre las ovejas PY y CZ en todos los indicadores. GEST fue de 93.00.3 vs. 81.80.7, CNOE 1.200.13 vs. 1.230.15, CNOP 1.290.11 vs. 1.50.13, KCNOE 2.90.28 vs. 3.080.33, KCNOP 3.160.21 vs. 3.770.26, CDOE 1.130.12vs.1.050.14,CDOP1.210.10vs.1.280.13,KCDOE12.141.33vs.10.371.32 yKCDOP13.000.94vs.12.681.70,paraPYyCZ,respectivamente.Enesteestudio,nose encontrarondiferenciasenelcomportamientodelasovejaspurasycruzadas. Palabrasclave:Ovejas,Pelibuey,Productividad

56

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ABSTRACT Inhairewesitevaluatedtheproductivityuntilweanedherlamb.30PurebredPelibueyewes (PY)and22crossbredhairewesmatedwithDorper(Dr)ramwereused.Inewes,theeffect was genotype on pregnant percent (PREG), number and kilograms born lamb per ewe exposedtobreeding(NBLEandKBLE),numberandkilogramsbornlambperewegivenbirth (NBLBandKBLB),numberandkilogramsweanedlambpereweexposedtobreeding(NWLE andKWLE),numberandkilogramsweanedperewegivenbirth(NWLBandKWLB).Inlams, theeffectwasthegenotype(Dr/PYandDr/CZ),sexandpartumtypeonbornkilograms(BK), at weaned(WK), daily gain weaned kilograms (DGW) and weaned survival percent (WS). It was analyze with GLM by SAS in a complete randomly design. There were no difference (P>0.05)inallindicatorbetweenPYandCZewes.PREGwas93.00.3vs.81.80.7,NBLE 1.200.13vs.1.230.15,NBLB1.290.11vs.1.50.13,KBLE2.90.28vs.3.080.33,KBLB 3.160.21 vs. 3.770.26, NWLE 1.130.12 vs. 1.050.14, NWLB 1.210.10 vs. 1.280.13, KWLE 12.141.33 vs. 10.371.32 y KWLB 13.000.94 vs. 12.681.70, for PY y CZ, respectively.Inthisstudytherewasnodifferenceproductiveperformancebetweenpurebred andcrossbredhairewes. Keywords:Productivity,Pelibuey,Ewes

INTRODUCCIN ElCensoNacionalarrojaunapoblacinde8,952,411cabezas(SIAP,2009),delascualesel 21%seubicaenlazonasur(Veracruz,Oaxaca,Chiapas,Tabasco,YucatnyCampeche) destinados a la produccin de carne. Durante el 2009, la produccin de carne en canal de ovinofuede39,956.04toneladas(INEGI,2010),Elvolumendeproduccindelosestados considerados en el trpico, destac Veracruz con 4,849 toneladas de carne de ovino producidas(2007),querepresentel40%deltotaldelazonatropicaldelpas(SIAP,2009). Un programa adecuado de cruzamientos permite la utilizacin de caractersticas complementarias de las diferentes razas. Por lo que la produccin se optimiza cuando el sistemadecruzamientoscontemplaelusoderazasquemaximicensusfortalezasyminimice sus debilidades a la utilizacin de estos esquemas con diferentes razas se le denomina estratificacin(Lara,2003).

57

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Los sistemas de cruzamiento industrializado de produccin de carne de ovinos, basan su estrategiaenaprovecharalmximolaheterosisovigorhbrido,lacualseobtieneenmayor grado, en la progenie de individuos de diferente raza apareados entre si. Actualmente el mercadoexigecorderosmaspesadosaldesteteyconmejorcalidaddelacanal(Martnez, 2002).Unamayorproductividadyeficienciaterminalselograconelusoderazasprolficas, no estacionales y adaptadas, y sementales de razas especializadas para la produccin de carne(Gonzlez,2002). La produccin generada en el trpico, se ha dirigido principalmente al mercado de la barbacoa.LosmayorescentrosdeconsumoenMxico,seencuentranenlosestadosdela regincentroyenloscentrostursticosdelpas,actualmentelademandasehaextendidoal restodelarepblica.Estohaocasionadoquemuchosproductores,manifiestensuintersen otras formas de comercializacin, dirigidas a cumplir con las preferencias del consumidor (Jimnez,2002). Las unidades de desarrollo de ovinos son tan diversos como son los recursos naturales (agua, clima, planta, animal), los recursos humanos (sociales, econmicos, culturales y polticos) y recursos tecnolgicos (tradicionales y alta tecnologa), en los cuales se desarrollan (Olazarn, 2001). La produccin de carne ovina en el trpico se ha incrementando,convirtindosedeunaactividadconimportanciasocioeconmicasecundaria, aunaactividadcomercialenmanosdeproductoressemitecnificadosytecnificados,aunque predominan los rebaos con manejo tradicional, con bajos rendimientos debido a la poca adopcindetecnologayalgunasprcticascomoladerealizarcruzamientosindefinidos,con elusoderazaspococonocidasensucomportamientobajolascondicionesquesetienenen nuestro trpico mexicano, por lo que se tienen rebaos con composicin gentica desconocida (cruzas comerciales) conformando el pie de cra, que aunado a la falta de informacin, limitantes tcnicas y deficiente manejo nutricional y sanitario, repercute negativamente en la produccin. Porlo anteriormente expuesto, el objetivo de este estudio fueevaluarcaractersticasproductivasdeovejasdelarazaPelibuey(PY)yovejasdePelo cruzascomerciales(CZ),expuestasaempadreconsementalesdelarazaDorper(DR)(raza terminal)bajounsistemaintegraldemanejoentrpico,considerandoefectodelgenotipode la oveja sobre los indicadores: Tasa de gestacin, Nmero de corderos paridos por oveja expuestaaempadre,Kilogramosdecorderoparidosporovejaexpuestaaempadre,Nmero de corderos paridos por oveja parida, Kilogramos de cordero paridos por oveja parida,

58

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Nmero de corderos destetados por oveja expuesta a empadre, Kilogramos de cordero destetadoporovejaexpuestaaempadre,Nmerodecorderosdestetadosporovejapariday Kilogramosdecorderodestetadoporovejaparida. MATERIALYMTODOS Localizacin:ElestudioserealizenlazonanortedelestadodeVeracruzaunaalturade 220 msnm con clima clidoextremoso y temperatura promedio de 25.3C con una precipitacinpluvialmediaanualde1588mm. Animales experimentales: Se utilizaron 30 ovejas de la raza Pelibuey de ms de un parto, conedadpromediode45.112.3mesesy22ovejasdepelosinrazadefinida,deltipodepie de cra comercial (Pelibuey y/o Blackbelly encastadas de Dorper) que predominan en la regin, de ms de un parto, con edad promedio de 44.38.9 meses. Los dos grupos estuvieronenmanejoreproductivoenelmesdejulioyagostodelao2010,enunempadre libre con monta natural, con sementales de la raza Dorper. Sus corderos se integraron al presenteestudiodesdeelnacimientohastaelmomentodeldestete(60dasdeedad). Manejogeneral:Laalimentacindelasovejasconsistienpastoreodiurno(8h)enpraderas dezacateEstrelladefrica(Cynodonplectostachius),ysuplementacinconforrajedecorte verde a razn de 1.5 kg/oveja/da, zacate Merkern (Pennisetum purpureum ) y alfalfa tropical(Pennisetumspp.)yunamezcladecanolasorgo,mazycemacon17.3%P.Cy2.9 de EM, del cual tuvieron un consumo promedio de 447g diarios por animal, se les ofreci aguaysalmineralizadaalibertad.Semantuvieronen2.60.2decalificacindecondicin corporal (CC) segn escala de Russel, (1969). Se supervis el parto, se desparasitaron contra nematodos gastrointestinales, y se vacunaron contra Mannheimia haemolytica. Se registr el peso corporal en kg y la condicin corporal (Russel, 1969) semanalmente. Se realiz el registro individual de las ovejas expuestas a empadre, en identificacin, edad, ovejasexpuestas,ovejasservidas,ovejasgestantes,defunciones,ovejasqueparen,nmero de corderos paridos y destetados. Los corderos, durante la primera semana de vida estuvieron en lactancia continua con la oveja, a partir de la segunda semana y hasta su destete se sometieron a una lactancia controlada, pernoctando juntos en una galera con aguaysalesmineralesdisponiblesrecibieronunasuplementacinpredestete(maz,sorgo, canola y cema) con 17.3% de PC y 2.9 de EM, el consumo fue de un promedio de

59

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

50g/cordero/da desde el da 10 de edad hasta el momento del destete. Se les recort y aplic cicatrizante al cordn umbilical al momento del parto, se verific su vigor, consumo adecuado de calostro, as como el reconocimiento con su madre, se desparasitaron contra nematodos gastrointestinales, se les aplic selenio al nacer y a los 30 das de edad, as como vitaminas ADE al momento del destete. Se llev el registro e identificacin de los corderosnacidos,considerandofechaypesoenkgalnacer,sexo(hembra,macho),tipode parto (simple, doble, triple), sobrevivencia de los corderos, peso corporal en kg semanalmenteyalmomentodeldestete. El diseo del experimento fue completamente al azar, se realiz un anlisis de varianza mediante el procedimiento de Modelos Lineales Generalizados (GLM) del paquete SAS 20022003,versin9.1.Lasvariablesderespuestaparalasovejasfueron:tasadegestacin (GEST), nmero y kilogramos de corderos nacidos por oveja expuesta (CNOE y KCNOE), nmero y kilogramos de corderos nacidos por oveja parida (CNOP y KCNOP), nmero y kilogramos de corderos destetados por oveja expuesta (CDOE y KCDOE) y nmero y kilogramos de corderos destetados por oveja parida (CDOP y KCDOP) considerando el efectodegenotipodelasovejas. RESULTADOSYDISCUSIN LatasadeGEST,nofuediferente(P>0.05)entrelasovejasPYylasovejasCZobteniendo para este indicador el 930.3 y 81.80.7 respectivamente, semejante a lo reportado por Heredia et., al (1988), para la raza Pelibuey en Mxico, 80100%, en poca de pastos abundantes.Elempadreserealizdurantelapocadebuenaactividadreproductivadelas ovejas, aunque algunos estudios reportan en ovejas de pelo actividad reproductiva regular durante todo el ao, (AboulNaga et al., 1987 Delphino et al., 1993 Sasa et al., 2001 Olazarn, 2005) siendo modificada la expresin del estro y funcin ltea por la condicin corporal(Olazarn,2005). Los CNOE, fueron de 1.20.13 y 1.230.15 para las ovejas PY y CZ respectivamente, sin encontrardiferencias(P>0.05).ParaCNOP,elresultadofuesimilar,obteniendoparalasPY 1.290.11 y para las CZ 1.50.13 corderos. Se observ que las ovejas mostraron buena capacidadparaparirybuenahabilidadmaterna,talcomoloreportaCruz,(2009)paralaraza Pelibuey, quien dice que en buen estado nutricional, las borregas tienen un buen

60

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

comportamiento maternal, rara vez tienen problemas al parto y su produccin de leche les permitecriarhasta2o3corderos,reportandoentre1.3a1.5crasporparto.Unaprolificidad ms elevada de 1.3 a 1.8 fue reportada por Galina, (1986), en sistemas intensivos de produccin.Tampocoseencontrarondiferenciassignificativas(P>0.05)entrelasovejasPYy CZ para los indicadores de KCNOE y KCNOP, obteniendo 2.90.28, 3.160.21 para las ovejas PY y 3.080.33, 3.770.26 para las ovejas CZ. En cuanto a CDOE, se obtuvieron 1.130.12 para las ovejas PY y 1.050.14 para las ovejas CZ, sin encontrar diferencias (P>0.05).LomismosucediparaelindicadorCDOP,paralasovejasPYfuede1.210.10y para las CZ 1.280.13. Lara, (2007) hace nfasis en que el parmetro de eficiencia econmica de una explotacin ovina productora de carne depende del Kg de cordero destetadoporovejaexpuestaenelpresenteestudiolosKCDOEparalasovejasPYfuede 12.141.33 y para las CZ 10.371.32, sin encontrar diferencias significativas para este indicador (P>0.05) a diferencia de Bores (2004) que obtuvo mejores pesos al destete (90 das)encorderosDR/PY(17.41.4)comparadosconPYpuros,mientrasHinojosaCuellaret al.(2010)encontraronquelasovejasF1destetaroncorderosmspesadosyconmejorGDP (1081g) en comparacin de ovejas Blackbelly puras. Los KCDOP, obtenidos fueron 13.000.94y12.681.70paralasPYyCZrespectivamente,resultadosquecoincidenconlo reportado por Partida, (2010), quien menciona que el uso del cruzamiento terminal es una buena alternativa para mejorar el desempeo productivo de los animales destinados al abasto y elevar la calidad del producto final, ya que l comprob una mejor tasa de crecimientoymayoreficienciadeproduccinconrespectoalaslneasmaternaspuras.

CONCLUSIONES Las ovejas Pelibuey y Cruzas comerciales de pelo, no fueron diferentes en su comportamiento productivo en lo referente a los indicadores de productividad: Tasa de gestacin, nmero y kg de corderos nacidos por oveja expuesta, nmero y kg de corderos nacidosporovejaparida,nmeroykgdecorderodestetadoporovejaexpuestaynmeroy kgdecorderodestetadoporovejaparida. Porlosresultadosobtenidosexistelaposibilidaddeproducircorderosparalaengordacon vientresdepeloencastadasdeDorperyKathadinsinqueseanunarazapura,que

61

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

mantenganbuenacondicincorporal,ysegestenconsementalesderazasespecializados enlaproduccindecarne.

AGRADECIMIENTOS Se agradece la gran disposicin al Ing. Carlos Ivn Vladimir lvarez Saucedo productor cooperante por las facilidades y apoyos proporcionados para la realizacin del presente trabajo. BIBLIOGRAFA AboulNagaAM,AboulElaMB,ElNakhlaSM.1987.Oestrusandovarianactivityof subtropicalfattailedRahamanisheepandtheirresponsetolighttreatament.J.Agric.Sci. 108:617621.

BoresQR,CantnCJ,BaezaRJJ,QuintalFJ.2004.Crecimientoycomposicincorporalde corderosF1depelocruzadoconrazasespecializadasparaproduccincomercialdecarne. XLVIReuninNacionaldeInvestigacinPecuariaCampecheCamp.p213.Disponibleen: www.fpy.org.mx/index.php?id=ovinos4 Cruz,LC.2009.ElBorregodepeloenMxico,enlaMemoriadellaTercerasemanadela ovinocultura.FMVZUNAM. Delphino, A, GonzlezStagnaro, C. 1993. Evaluacin del comportamiento reproductivo en pequeos rumiantes tropicales utilizando los perfiles de progesterona. Rev. Cientfica FCV LUZ(MaracaiboVenezuela).III3:231247. Galina,MA,Morales,R,Silva,E.,Lpez,B.1996.ReproductiveperformanceofPelibueyand BlackbellysheepundertropicalmanagementsystemsinMxico.SmallRuminantResearch, 22:3137. Gonzlez, RA, Ferrer, AA. 2002. Produccin ovina para mercados globales: sistemas de produccin y cruzamientos con razas terminales. Memoria II Taller sobre sistemas de

62

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

produccin ovina del Noreste y Golfo de Mxico. Universidad Autnoma de Tamaulipas. Tamaulipas,Mex.p.122132. HerediaAM,FajardoMM,RodrguezRO.1988.EstacionalidadenlaovejaPelibuey.Efecto delasobrealimentacin.MemoriasdelaPrimeraReuninCientfica,ForestalyAgropecuaria CIFAPYucatn,INIFAPSARH.Mrida,Yuc,Mx.p.131 HinojosaCuellar JA. 2010. Comportamiento predestete de corderos Hbridos de razas Blackbelly,Pelibuey,DorperyKatahdinenelsurestedeMxico.XLVIReuninNacionalde InvestigacinPecuariaCampecheCamp.p183. INEGI,2010.InstitutoNacionaldeEstadstica,GeografaeInformtica Jimnez,BM.2002.Aspectosdecalidadenlaproduccinovina:carne,canalesypiedecra. II Taller sobre sistemas de produccin ovina del Noreste y Golfo de Mxico. Universidad AutnomadeTamaulipas.Tamaulipas,Mex.p.114121. Lara PJ, 2003. Utilizacin de cruzamientos en la produccin Ovina, Memorias, 1er SimposiumInternacionaldeOvinosdeCarnep:6369. Martnez,GJ.2002.Mejoramientogenticoycruzamientoenovinosdepelo.MemoriadelII Taller sobre sistemas de produccin ovina del Noreste y Golfo de Mxico. Universidad AutnomadeTamaulipas.Tamaulipas,Mex.p.197206. Olazarn, JS. 2001. Sistemas de produccin con ovinos. XXXVII Reunin Nacional de InvestigacinPecuaria.INIFAPSAGARPA.Chiapas,Mxico.p.8183. Olazarn,JS.2005.ActividadovricaymanifestacinestralenovejasPelibueydurantelas pocasdemenorymayoractividadreproductiva.TesisdeMaestra,FESCUNAM. PartidaPJA.2010.Usodelcruzamientoenovinosparaproduccindecarnedealtacalidad. IIISeminarioInternacionaldeOvinocultura.Cholula.p:18 Russel, AJF, Doney and JM., Gunn, RG. 1969. Subjetive assessment of body fat in live sheep.J.Agric.Sci.72:451454. SAS20022003.SASInstituteInc.Cary,NC,USA.V9.1.

63

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

SasaA,TestonDC,SilvaECF.2001.Perfilplasmticodeprogesteronaeincidenciamensal de ovuoalcoes silenciosas, em borregas lanadas e deslanadas criadas no Estado de So Paulo.InCongressoBrasileirodeZootecniaZootec.200121,Goiania.Anais.p.1621. SIAP,2009.Disponibleen: http//www.campomexicano.gob.mx/portal_siap/Integracion/EstadisticaBasica/Pecuario/Pobla cionGanadera/Resumen/Resumen.pdf

64

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 10) DIARREA VIRAL BOVINA Y RINOTAQUEITIS BOVINA INFECCIOSA EN CRVIDOSEXTICOSDETAMAULIPAS,MEXICO. BOVINE VIRAL DIARRHEA AND INFECTIOUS BOVINE RHINOTRACHEITIS IN EXOTIC DEERFROMTAMAULIPAS,MEXICO.
1 1 2 3 ChristianBautistaP. DoraRomeroS. ZeferinoGarcaV J.AlfonsoOrtegaS Antonio 4 CantC .

MaestraenCienciaAnimal.UniversidadVeracruzana,VeracruzVer.,Mxico.Miguelngel de Quevedo esq. Circunvalacin s/n. CP 91710. Correo:mvz_bautista@hotmail.com*autor paracorrespondencia 2 Centro Nacional de Investigacin Disciplinaria en Parasitologa Veterinaria. Jiutepec, Morelos,Mxico.CarreteraFederalCuernavacaCuautla#8534.CP62550. 3 Caesar KlebergWildlife Research Institute.Texas A&M University. Kingsville, TX, EU. 700 UniversityBlvd.,218MSC.CP78363. 4 InstitutoNacional de InvestigacinForestal, Agrcola y Pecuaria. CarreteraTampicoMante Km55.CP89610. RESUMEN Venados de distintas especies son considerados reservorios de agentes patgenos. En UnidadesparalaConservacin,AprovechamientoyManejoSustentabledelavidasilvestre (UMA)dondesereproducencrvidossepresentanproblemassanitariosdebidoalaumento en densidades de poblacin, estrs por limitacin de territorio y fuentes de alimento, as comoporconvivenciaconanimalesdomsticosloshacesusceptiblesaenfermedadescomo DiarreaViralBovinayRinotraqueitisViralInfecciosa.Elobjetivodelestudiofuedeterminarla frecuencia de anticuerpos contra DVB e IBR en Axis y Gamos. Para ello fueron cebados y capturadosmedianteredesdecadaenunaUMAextensivaenSotolaMarina,Tamaulipas. Para el diagnstico se utiliz la Prueba de ELISA indirecta (kit comercial de Sensibilidad 100% y Especificidad 95%, IDEEX Laboratories Inc.) empleando un filtro de densidad ptica de 450 nm. De las 38 muestras serolgicas colectadas (18 Axis axis y 20 Dama

dama), 9 resultaron positivos (24%) a DVB, mientras que ninguno de los animales result
positivoalapruebadeIBR.Prevalenciasmayoresal5%hansidoencontradasenMinnesota (54%) y en Espaa (6%). En el noreste deMxico se encontr una prevalencia en venado colablancadel41.1%paraDVB.Apesardequenoseencontraronanimalesseropositivosa IBR, en la misma regin se report una prevalencia del 5.6% en venado cola blanca. Se

65

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

concluyequeDVBestpresenteenAxisyGamosyqueestospuedentenerunpapelcomo reservoriosenlaepidemiologadelaenfermedad. Palabrasclave:DVB,IBR,ELISA,venados,exticos. ABSTRACT Species of deer are considered reservoirs of pathogens. Exotic deer has been breeding in ManagementUnitsforConservationandSustainableUseofWildlifethatdevelopedtroubles abouthealthandsanity,inconsequenceofconditionslikepopulationdensitiy,stresscaused by habitat and food resources availability, and cohabitat with domestic animals in consequence deer are susceptible to acquire diseases as Bovine Virus Diarrhea and Infectious Bovine Rhinotracheitis. The aim of this study was determine the frequency of antibodiesagainstDVBandIBRinAxisandFallowdeer.Deerwereharvestedinoneranch from Soto la Marina, Tamaulipas.Were used two different ELISA commercial kits, for DVB and IBR (Sensibility 100%, Specificity 95%, IDEEX Laboratories Inc) ELISA microplate readerusedafilterof450nm.Weresampled38deer(18Axisand20Fallowdeer)9(24%) deer were positives to BVD, in contrast no one were positive to IBR. Prevalence were reportedinMinnesota(54%)andSpain(6%)inFallowdeer.InwhitetaileddeerfromMxico wasreportedaprevalenceof41.1%toDVB.Evenwhenwedidntfoundantibodiesagainst IBRinAxisandFallowdeer,whitetaileddeerwerereportedwith5.6%ofprevalenceinthe sameareafromMxico.InconclusionBVDarepresentinpopulationdeerfromthiscinegetic ranch. Keywords:BVD,IBR,ELISA,deer,exotic. INTRODUCCIN La situacin endmica de enfermedades infecciosas (virales, bacterianas o parasitarias) en fauna silvestre ha ido cobrando importancia, considerando el modelo de desarrollo de la humanidad y las repercusiones de ste sobre los ecosistemas. La cada vez ms cercana interaccin hombreanimales domsticosfauna silvestre dada por el desequilibrio en los ecosistemas, y el traslape de hbitat, han desencadenado la aparicin de enfermedades emergentesyreemergenteenciertasespeciesdeanimalessilvestres,algunasconenorme impactoenlasaludpblica,laproduccindealimentos,laseconomasyelmedioambiente.

66

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Inclusolaproduccinganaderasehavistoafectadanegativamenteporlamortalidaddirecta de animales, porlas repercusiones en el consumo y por las destruccionesllevadas a cabo paragarantizarlasanidadyseguridaddelcomerciointernacionalyparalimitarlaexpansin de las enfermedades (Suzanet al., 2000). Ejemplo de esta interaccin es observado en el norestedeMxico,principalregindondesedesarrollalaganaderadiversificada,actividad que promueve el aprovechamiento de especies domsticas y silvestres en un mismo territorio. Dicho aprovechamiento ha ido en aumento en Unidades de Manejo Ambiental (UMA) para la conservacin y aprovechamiento sustentable de la vida silvestre donde crvidossilvestreshansidolasespeciesmayormenteaprovechadasdemodocinegticoen el norte del pas, as como en regiones del sureste. Adems es importante resaltar que la misma actividad cinegtica los convierte en una especie relevante al constituirse como animal de produccin y de consumo para realizar investigaciones como las del presente estudio. MATERIALESYMTODOS Elpresenteestudiosellevacaboenelnorestedelpas,enunranchoprivadolocalizadoen elmunicipiodeSotolaMarina,Tamaulipas,Mxico,coordenadas2747'latitudNorte,9012' longitud oeste donde se realiz un estudio epidemiolgico descriptivo y transversal. El muestreo fue no probabilstico por conveniencia, donde se incluyeron crvidos exticos de lasespeciesAxis(Axisaxis)yGamos(Damadama).Paralacolecta,setomaronmuestras sanguneas para estudios serolgicos de: Ensayo por inmunoabsorcin ligado a enzimas (ELISA) para determinar anticuerpos en contra de DVB e IBR. Las muestras fueron colectadas en tubos a alto vaco sin anticoagulante, usando como sitio de puncin la vena yugular. Las muestras colectadas fueron procesadas y almacenadas a 10 Cen el Campo ExperimentalAldama,TamaulipasdelINIFAP,parasuposterioranlisisenelLaboratoriode ParasitologaenlaUnidaddeDiagnsticodelaPostaZootcnicaTorrendelMolinodela Facultad de Medicina Veterinaria y Zootecnia de la Universidad Veracruzana, Veracruz, Mxico. Para la deteccin de anticuerpos antiDVB se utiliz la prueba de ELISA, empleando unkit comercial (Sensibilidad 100% y especificidad 95%, IDEXXLaboratories Inc., Westbrook, Maine USA). Las muestras fueron diluidas 1:100 con una solucin amortiguadora salina

67

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

fosfatada,comodiluyente,conpHde7.4,0.05%Tween20.Sepreparlasolucindelavado a temperatura de 20 a 25 C, agitando hasta lograr que se hayan diluido las sales que se hayanprecipitado.Seemplearonsueroscontrolespositivosynegativos.Lalecturaserealiz conunlectordeELISAutilizandounfiltroadensidadpticade450nm Para el anlisis estadstico, los datos fueron analizados utilizando el paquete estadstico SPSS v.17.0 , para estadstica descriptiva. Fueron comparados grupos de animales utilizandocomovariableselsexoyespeciemediantelaPruebaExactadeFisher,mediante elprogramaVassarStat. RESULTADOS Para el caso de DVB, de los 38 sueros de crvidos exticos analizados por la prueba de ELISA indirecta, 9/38 (24%, IC95% 1240%) fueron seropositivos, donde 8/9 Axis fueron positivos(88.8%,IC95% 5099%)y1/9Gamospositivo(11.1%,IC95% 0.549%).Seencontr diferenciasestadsticamentesignificativasentreambasespeciesmediantelapruebaexacta de Fisher, respecto a la seropositividad de DVB (p<0.05). De acuerdo al sexo del total de animales seropositivos 1/9 hembras fue seropositivo (11%, IC95% 5099%) y 8/9 fueron seropositivos(89%, IC95%, 0.549%) No hubo diferenciasestadsticamente significativaspor sexo.ParaIBR,noseidentificaronanimalespositivosalapruebadeELISAindirecta. DISCUSIN Diarrea Viral Bovina. En Estados Unidos, en la especie Dama dama Morse et al. (2009) reportaron 27% de crvidos seropositivos, similar a la proporcin encontrada entre ambas especiesdecrvidosexticosdelpresenteestudio,apesardeque Frlich(2000)identific 1.1% (1/87) Gamos seropositivos en Alemania. Para esta misma especie Giovannini et al. (1988) identificaron 58% (25/43) de animales seropositivos en Tuscani, Italia. Cabe mencionar que para Axis no se hallaron reportes para DVB acerca de su prevalencia. En Mxico,losnicosestudiosrealizadosenciervosfueronhechosenvenadocolablancapor Cantetal.(2008),enelnorestedelpas,quienesreportaronunaprevalenciadel64%,una prevalencia mayor a la reportada en el presente estudio. Cabe mencionar que DVB est presente en el ganado bovino de la regin cercana a la UMA donde los animales se

68

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

encuentran confinados, de acuerdo con Cant y Alvarado (1999) se ha reportado una prevalenciadeDVBde55%enzonascercanasaSotolaMarina,Tamaulipas. Las variaciones de las prevalencias de DVB en ganado bovino se han relacionado con el manejo y, si bien existe una convivencia cercana entre especies, los ciervos estn expuestos,directaoindirectamenteatravsdelaguaoreservoriossilvestres,locualjustifica lapresenciadelvirusenstapoblacinobjetodeestudio. RinotraqueitisInfecciosaBovina.Auncuandonoseidentificaronanimalesseropositivos,otro estudiorealizadoenMxicoporCantetal.(2008)reportaronprevalenciasenvenadocola blancadel41%. CONCLUSIONES DVB est presenteenla poblacin de crvidos exticos de las especiesAxisaxis yDama

damadelaregindeSotolaMarina,Tamaulipas,Mxico.Mientrasquealnoidentificarsela
presenciadeanticuerposparaIBR,parecenoestarpresenteenloscrvidos. AGRADECIMIENTOS AlCaesarKlebergWildlifeResearchInstitutedelaUniversidaddeTexasA&MKingsvillepor lasfacilidadesotorgadasparalarealizacindelascapturasenelestadodeTamaulipas. LITERATURACITADA Cant, A., J.A. OrtegaS, J. Mosqueda, Z. GarciaVazquez, S.E. Henke and J.E. George. 2008.PrevalenceofInfectiousAgentsinFreerangingWhitetailedDeerinNortheastern Mexico.JournalofWildlifeDiseases,44(4),2008:10021007 Cant, C. A. and A. Alvarado. 1999. Situacin epidemiolgica de las principales enfermedades reproductivas en bovinos de Tamaulipas (IBR, BVD, leptospira, brucelosis).InProceedingsoftheReuninNacionaldeInvestigacinPecuaria,Mrida, Yucatn,1922,October,p.55. Frlich,K.2000.Viraldiseasesofnorthernungulates.Rangifer20(23):8397.

69

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Giovannini, A., F.M Cancelloti, C.Turilli and E.Randi. 1988. Serological investigations for some bacterial and viral pathogens in Fallow deer (Cervus dama) and wild boar (Sus

scrofa) of the San Rossore Preserve, Tuscany, Italy. Journal of Wildlife Diseases
24(1):127132. Morse,BW,D.L.Miller,MillerK.V.andC.A.Baldwin.2009.PopulationHealthofFallowdeer (Dama dama) on Little Simons Island, Georgia, USA. Journal of wildlife diseases 45(2):411421. Suzn, A.G., M.F. Galindo y G.G. Ceballos. 2000. La importancia del estudio de enfermedades en la conservacin de fauna silvestre.

http://chloe.dgsca.unam.mx/rvm/vol3103/RVM31308.pdf

70

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 11) Agentes Bacterianos Aislados en Pulmones Neumnicos, de Cerdos Sacrificados en el Rastro Municipal de Crdoba, Ver. durante el Periodo Primaveral. BacterialAgentsIsolated inpneumonic lungsof pigs slaughtered atthe municipal slaughterhouseofCrdoba,Ver.duringthespringperiod.

JuanMiguelPrezEnriquez*,GilJosuGonzalezVicencio,GerardoOlmedoPrez Facultad de Ciencias Biolgicas y Agropecuarias de la Universidad Veracruzana, Campus Tuxpan. Carretera TuxpanTampico Km. 7.5 S/N Col. Universitaria. C.P. 92860. Tuxpan, Veracruz, Mxico. Email: golmedoperez@gmail.com, giljosue9@live.com.mx, mvz.jumpe@gmail.com.*Autorporcorrespondencia.

RESUMEN Se analizaron 100 pulmones de cerdos, con lesiones compatibles con neumona, procedentesdelaciudaddeCrdobaysusalrededores.Elobjetivodelpresentetrabajofue establecersiexisterelacinentrelacantidaddeespeciesbacterianasyelniveldeafectacin enlospulmonesdecerdossacrificadosenelrastrodurantelosmesesdemarzoamayodel ao 2011. As mismo conocer cules son las especies bacterianas presentes. Una vez extradaslasmuestraspulmonaressepreservaronentre4y6Cdurantenomsde5hrs. Hasta su anlisis en el Laboratorio, se sembraron enagar sangre yagar Mac Conkey yse cultivaran a 37C por 2448 hrs. La identificacin bacteriana se realiz mediante pruebas bioqumicas.Losresultadosfueronanalizadosenelprogramaestadsticominitab15.Delos 100 pulmones trabajados, en 21 se aisl ms de un agente bacteriano y en 53 solo se encontr1soloagente(26muestrasnopresentaroncrecimiento).SeencontralaE.colien 26%delosaislamientos,siendolabacteriamsencontrada,ensegundolugarseencuentra Estafilococcos spp. con un 17 %, siguindole Estreptococcos spp. Con un 15 %. La

Pasteurella (multocida y hemoltica) fue encontrada en un 6 % de los aislamientos. No se


encontrunarelacinsignificativa(P=0.961)entreelniveldedaopulmonarconlacantidad de gneros bacterianos presentes, pero debido a las distintas especies bacterianas

71

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

encontradas no podemos dejar de lado la importancia de las bacterias en el Complejo RespiratorioPorcino.

Palabrasclave:ComplejoRespiratorioPorcino,pulmones,bacterias. INTRODUCCIN La produccin porcina es una delas actividades pecuarias ms importantes en Mxico por serunafuentedeingresosparamilesdefamilias(genera49milempleosdirectosy245mil indirectos)(RodrguezyDelMoral,2010). Laenfermedadrespiratoriadeloscerdosconstituyeunodelosproblemasmspreocupantes de la industria porcina a nivel mundial. En aos recientes se ha descrito a la enfermedad respiratoria de los cerdos observada en animales en las etapas de desarrollo y engorde comoelComplejoRespiratorioPorcino(CRP).Losagentesinfecciososmsfrecuentemente involucradosenelcomplejorespiratoriodelcerdosonviralesybacterianos(Utrera,2006). Al problema respiratorio porcino se le conoce como Complejo Respiratorio Porcino (CRP), porlagranvariedaddeagentesinfecciososqueseinvolucranenelprocesoneumnico.Sin embargo, existen una serie de trabajos clsicos, que han demostrado la participacin de virus con virus, de virus con bacterias, de micoplasmas con bacterias y de bacterias con bacterias,endondeactanenformasinrgicaointeractanentreellos(Ciprianetal,2009). Se encuentra asociado con varios agentes etiolgicos incluyendo Actinobacillus

pleuropneumoniae, Mycoplasma hyopneumoniae, Haemophilus parasuis, Bordetella bronchiseptica, Pasteurella multocida los virus de influenza porcina, coronavirus, fiebre
porcinaclsica,enfermedaddeAujezsky,yelsndromedisgensicoyreproductivodelcerdo (PRRS). El complejo respiratorio en ganado porcino est asociado con prdidas en la gananciadepeso,eficienciaalimenticia,ymortalidad(Williamset.al.,2000) El seguimiento de lesiones en matadero es muy til para ver lesiones relacionadas con procesos respiratorios, neumona por M. hyopneumoniae, pleuroneumona, pleuritis, atrofia decornetesnasales,abscesos,ascariosis,etc.Laprincipalventajaesqueseevalanlotes grandesdeanimalesyestoestilenlesionescrnicasopermanentes(Aldaz,2002).

72

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Se colectaron 100 pulmones con presencia de lesiones compatibles con neumona en el rastro municipaldela ciudad de Crdoba, ver. durantelos mese de marzo a mayo del ao 2011 dos veces por semana (martes y jueves). Estos fueron examinados macroscpicamente, para determinar el dao pulmonar mediantela observacin visual y el tacto. El nivel de dao pulmonar se clasific en moderado y abundante dependiendo del porcentaje de pulmn afectado segn la tcnica de Trujano (2010). Posteriormente se seleccion la porcin de muestra para ser tomada y colocada en las bolsas nuevas de polipapel.Lasmuestrasfuerontrasportadasenunahieleradeunicelconrefrigeranteengel. Lasmuestrasfueronllevadasallaboratorioysometidasaunanlisisbacteriolgicogeneral. Se analizo siexiste una relacin entre el grado delaslesiones pulmonares y elnmerode gnerosbacterianosaisladosastambin,cualessonlosgnerosbacterianosencontradosy culessufrecuencia. MATERIALYMETODOS Las observaciones se llevaron a cabo en el rastro municipal de la ciudad de Crdoba, Veracruzdurantelosmesesdemarzoamayodelao2011dosvecesporsemana(martesy viernes)alas3:00amqueeslahoraquecomienzalamatanzaregular. Lospulmones,juntocontrquea,bazoehgadofueroncolocadosenunamesaporpartede lostrabajadoresdelrastroydeallseleccionadosaquellosquepresentabanlesiones. Setomunsegmentodelpulmnlesionadocortandocontijerasunaparterepresentativade laporcinlesionadoyfuecolocadaenunabolsanuevadepolipapelparasutrasporteenuna hieleradeunicel.

Una vez extradaslas muestras pulmonaresse preservaron entre4 y 6Cduranteno ms de 5 hrs. hasta su anlisis en el Laboratorio. Las muestras se trabajaron en una charola esterilizadaporcalor.Almomentodeintroducirelhisopoparacolectarlamuestraasembrar, seesteriliztambinporcalorlasuperficiedelamuestraafindeevitarunacontaminacin por cualquier tipo de agentes que se encuentren en el rea del pulmn que estuvo en contactoconelexterior.PosteriormentesesembrenagarsangreyagarMacConkey,los cualesfueronpreparadosdeacuerdoalasespecificacionesdelfabricanteysecultivarona 37Cpor2448hrs.,bajocondicionesdeaerobiosis(Piojan,1999).Lasiembraserealizpor

73

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

el mtodo de estra (Stachi, 2007) y en el agar sangre se us una cepa de Estafilococos

aureuscomocolonianodriza.
Seanalizlaformadelasdistintascoloniasyserealizaislamientodelasmismasenotra placa de agar sangre dividida. Despus del aislamiento primario, las cepas bacterianas se observaron al microscopio, bajo la tincin de Gram para clasificarlas de acuerdo a su estructura. Se les aplicaron pruebas para establecer sus caractersticas bioqumicas (Mac Faddin, 2003) y con esto determinar el gnero bacteriano. Todo el procedimiento de la siembrademuestrassellevacaboenunacampanadebioseguridaddetipoIII.

Losdatosfueroncolectadosenlibretadecampoyposteriormenteanalizadosenunahojade clculodeExcelyenelprogramaminitab15.

Lapruebaestadsticodeeleccinfuelapruebadechicuadrada. Setrabajconlassiguienteshiptesis: Ha:Elniveldeafectacinpulmonardependedelacantidaddeespeciesbacterianasaisladas enloscerdosdelrastromunicipaldeCrdoba,Ver. H0: El nivel de afectacin pulmonar no depende de la cantidad de especies bacterianas aisladasenloscerdosdelrastromunicipaldeCrdoba,Ver. RESULTADOSYDISCUSIONES

Chicuadrada=0.002,GL=1,ValorP=0.961

74

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Noexisterelacinentrelacantidaddeespeciesbacterianasaisladasyelniveldedaoque se produce en los pulmones con lesiones compatibles con neumona de los cerdos que llegaronasacrificioenelrastromunicipaldeCrdoba,Ver.duranteelperiodoprimaveral.

Iglesias y Trujano (2009) mencionan quepuede haber una infeccin secundaria en la neumona a causa de bacterias que generalmente colonizaneltractorespiratorioperoquetambin es frecuente encontrar bacterias que colonizan otraspartesdelorganismocomoseobserven los resultados del presente trabajo donde el microorganismo ms aislados es habitante normaldeltractodigestivo. El microorganismo que se encontr con mayor frecuenciafuelaE.coliconun26%bacteriaqueVelascoyYamasaki(1997)hansugerido debeserconsideradacomoungermenpatgenooportunistaeninfeccionesdevasurinarias y respiratorias, mastitis, onfalitis y otros procesos infecciosos, coincidiendo ste resultado con Cabrera et al. (2006) quienes lo encontraron en un 21.4% slo por debajo de

Streptococcus spp con un 46.4 % el cual nicamente fue encontrada en un 15 % en el


presente trabajo y en 3 ocasiones estos dos microorganismos fueron aislados dela misma muestra. El microorganismo que fue encontrado en segundo lugar es estafilococos spp. Con una frecuencia de 17%, Piojan (1976) menciona que este agente puede encontrarse en interaccin con Streptococcus y Corynebacterias en los abscesos pulmonares. Este resultado no coincide con lo demostrado por Cabrera et al. (2006) que en un total de 28 muestraspositivasaneumonasoloenel3.57%seaislestemicroorganismo. AdiferenciadeloreportadoporEspinosaetal.(2004)quemencionaalaPasteurellacomoel agente con mayor frecuencia (21.7%), solo fue encontrada en un 6 % y en 4 ocasionesen interaccinconotrasbacterias. Alnohaberseencontradounarelacindirectaentrelaslesionespulmonaresyelnmerode gnerosbacterianosencontradosenunamismamuestra(p=0.961)Nosepuederelacionar la presencia de las interacciones bacterianas con el nivel de dao producido en el rgano.

75

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Pero se debe hacer notar que los agentes bacterianos oportunistas tienen una presencia significativa en los procesos neumnicos por lo que deben ser considerados como microorganismosinvolucradosenelComplejoRespiratorioPorcino. CONCLUSIONES Si bien los agentes infecciosos son los que estn daando la integridad del aparato respiratorio, estos se presentan porque existe algn factor que est atentando contra el estadoinmunedelhusped.Sonmuchoslosfactoresquefrecuentementedebilitanelestado inmune del animal, lo cual abre paso para que bacterias que normalmente colonizan el organismo produzcan infecciones secundarias que juegan un papel importante en el padecimiento. Es de vital importancia tener en cuenta que los agentes bacterianos que comnmente se encuentran dentro del organismo sin considerarse nocivos, se replican aprovechando la debilidadinmunolgicadelhuspedatalgradoquesevuelvenpatolgicamenteimportantes. Muchas veces las bacterias que se encuentran en el tracto respiratorio superior son las mismasqueaprovechanlasusceptibilidaddelhuspedycolonizanlospulmonescausando unainfeccin.EnestetrabajosedemostrquebacteriascomoStreptococcusspp,Pasterella

multocida, estafilococos spp. Estn presentes en los pulmones que se encuentran


lesionados. Asmismoexistenbacteriasquesonpartedelafloranormaldeotrossistemasdelorganismo (digestivo)yquetambinlleganacolonizarelpulmn.stetrabajoesunclaroejemplodetal hecho ya que, de los 100 pulmones analizados, 26 % presentaron crecimiento de E. coli, unabacteriaqueeshabitantenormaldelaparatodigestivoperoquedebeserconsiderada como patgeno oportunista en las neumonas. As mismo se aislaron bacterias de los gnerosKlebsiellayShigella,tambinhabitantesdeltractodigestivo. Muchas veces las especies bacterianas se encuentran en interaccin pero no se demostr importancia significativa entre la presencia de distintas especies bacterianas y las lesiones producidas.

76

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Si bien se descart que el nivel de dao pulmonar est relacionado con la cantidad de gnerosbacterianospresentes,nopodemosdejardeladolaimportanciadelasbacteriasen elComplejoRespiratorioPorcino.

BIBLIOGRAFA. Aldaz I. A. 2002. Enfermedades respiratorias del cerdo: algunos aspectos prcticos a considerareneldiagnsticoycontrolparalaresolucindecasosclnicos.Anaporc.Revista deporcinocultura,(221)pg.78102.ISSN:1577856.

Cabrera Y. R. P., E. Capdevila M. R., Leyanys B. y M.J. Acosta. 2006. Principales microorganismos aislados en el tracto respiratorio de cerdos jvenes criados para producir pulmonessanos.RevistaComputadorizadadeProduccinPorcinavol.13,no.3.Pg.8488.

Ciprin C.A., Snchez V., Gonzlez D., Colmenares V., Mendoza DS, Lara H., Parrodi F., AlcntaraT.,AltamiranoF.,JuvenalS.,SnchezA.,LpezM.R.,EsquivelM.E.,RamosD., Mendoza M., lvarez M.C., Hernndez R., Oliva D., Rodrguez C., Trujillo D., Vargas S.A., HernndezB.,E.MendozaE.S.(2009).AislamientodeActinobacilluspleuropneumoniaede tonsilas y pulmones de cerdos vacunados y previamente desafiados. Disponible en: http://www.engormix.com/MAporcicultura/sanidad/foros/articuloaislamientoactinobacillus pleuropneumoniaet19782/165p0.htm.

Espinosa I., Prez M., Duran R., Rueda D. and Bulnes C. 2004. Identification of different bacterialagentsinpiglungsandevaluationofsusceptibilityinvitroagainstchlortetracycline. Rev.SaludAnim.Vol.26no.2:9296.

IglesiasS.G.,TrujanoC.M.2009.Diversosmodelosdeinteraccindelcomplejorespiratorio porcino.Journal:VeterinariaMxicovol:31ISSUE:1pg:5965.

Mac Faddin, J. F. 2003. Pruebas bioqumicas para la identificacin de bacterias de importanciaclnica.3rded.EditorialMdicaPanamericana.

77

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Pijoan A. C. 1993. Neumona mycoplsmica en porcinos. Puesta al da e interaccin con otros agentes patgenos. University of Minnesota, College of Veterinary Medicine. Rev. MundoGanadero.Vol.9pg.5865 Rodrguez L. G., Del Moral B.L.E. 2010. Perspectivas del sector porccola mexicano para 2010:recuperacindelosefectosdelacrisiseconmicaydelainfluenza(a)h1/n1.Revista trimestraldeanlisisdecoyunturaeconmicavol.IIInm.2pg.2123.

StachiO.N.,MartinoP.E.,GentiliniE.R.,EnsoH.,EcheverriaM.G.,LeardiniN.A.,Copes J.A.2007.Microbiologaveterinaria.1ed.EditorialIntermedica.BuenosAiresArgentina.

Trujano, M. 2010. Monitoreo en rastro como herramienta de diagnstico en cerdos. Disponible en: http://www.engormix.com/MAporcicultura/sanidad/articulos/monitoreorastro comoherramientat3074/p0.htm.

Utrera V. T. 2006. El Complejo Respiratorio Porcino. Universidad Central de Venezuela. Facultad de Ciencias Veterinarias. Maracay. Aragua. Venezuela. Disponible en: http://www.engormix.com/MAporcicultura/sanidad/foros/articulocomplejorespiratorio porcinot10592/165p0.htm.

Velasco, E. y Yamasaki, A. 1997. Bacterias de inters veterinario. Disponible en: http://www.monografias.com/trabajos/bactevet/bactevet.shtml.

Williams J. de J., Torreslen M. A., Sansornah R. 2000. Prevalencia, caracterizacin y extensin de las lesiones en pulmones de cerdos sacrificados en el rastro municipal de Mrida,Yucatn,Mxico.RevBiomed11:2532.

WilliamsJ.deJ.,Torreslen,M.A.,EcheverriaC.P.,MatosMedinaM.C.2000.Aislamiento e identificacin de Actinobacillus pleuropneumoniae en pulmones de cerdos con pleuroneumonacrnicasacrificadosenelrastromunicipaldeMrida,Yucatn,Mxico.Rev Biomed11:175181.

78

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 (SMVZ 12) PREVALENCIA E IDENTIFICACIN DE FACTORES DE RIESGO DE

Cryptosporidium spp. EN BECERRAS DE VERACRUZ Y DE LA COMARCA LAGUNERA,


MXICO. PREVALENCE AND IDENTIFICATION OF RISK FACTORS FOR Cryptosporidium spp. IN CALVESFROMVERACRUZANDTHEREGION,LALAGUNA,MEXICO.
1 1 2 OscarGodoySalinas ,DoraRomeroSalas ,ZeferinoGarcaVzquez ,BernabChavarra 3 Martnez

Facultad de Medicina Veterinaria y Zootecnia. Universidad Veracruzana. Veracruz, Mxico.

CircunvalacinS/NEsq.Yaez.Veracruz,Mxico.
2

Centro Nacional de Investigacin Disciplinaria en Parasitologa Veterinaria. INIFAP. Jiutepec,

Morelos,Mxico.
3

IntervetScheringPloughAnimalHealth.Mxico.

Correoelectrnico:dromero@uv.mx*autorparacorrespondencia RESUMEN

Cryptosporidium spp. es un parsito que habita en el borde de las vellosidades intestinales de


bovinos, ovinos y otras especies animales. Esta parasitosis afecta principalmente a los animales jvenes.ElobjetivodelestudiofuedeterminarlaprevalenciayfactoresderiesgodeCryptosporidium sppenbecerrasentreunoy60dasdeedadenlazonacentrodelestadodeVeracruzyLaComarca Lagunera,Mxico.Fueunestudiotransversalconmuestreodeconvenienciadeabriljulio,2009(La Comarca Lagunera) y de enerofebrero, 2010 (Veracruz). Se muestrearon 460 becerras en la ComarcaLaguneray120enVeracruz.SerealizlapruebadeInmunocromatografadeFlujoLateral (IFL)yZiehlNeelsen(ZN).Losdatosindividualesydehatosecolectaronatravsdeuncuestionario se analizaron por el programa SPSS ver 17.0. Para la Comarca Lagunera, la prevalencia por la pruebaIFLfuede19.35%yporZN18.04%.Losfactoresderiesgo(FR)identificadosfueron:laedad 6.73 (IC95% 3.4313.22 P= 0.0001) presencia de diarrea 4.49 (IC95% 2.637.68 P= 0.0001). De los 120 animales muestreados en Veracruz, la prevalencia fue de 3.33% IFLy un 12.50% ZN. Se

79

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 encontrsolounFRde7.25enanimalescondiarrea(IC95% 2.2922.91P=0.0008).Seconcluyeque

Cryptosporidium spp. est presente en las becerras lactantes de los ranchos muestreados y la
prevalencia es mayor en becerras de explotaciones intensivas como en la Comarca Lagunera y menor en las explotaciones extensivas de Veracruz los factores de riesgo identificados sin son controladosdisminuiralaprevalencia. Palabrasclave: Cryptosporidiumspp.,prevalencia,ganadera,diarreas.

ABSTRACT

Cryptosporidiumspp.isaparasitethatlivesontheedgeoftheintestinalvilliofcattle,ovineandothers
animals. This parasitic disease mainly affects young animals. The objective of this study was to determinetheprevalenceandriskfactorsassociatedwithCryptosporidiumsppincalvesbetweenone and 60 days old, from the state of Veracruz and the La Laguna region, Mexico. It was a cross sectionalstudywithconveniencesamplingfromApriltoJuly2009(LaComarcaLaguneraregion)and JanuaryFebruary2010(Veracruz).460sampleswereobtainedattheLaComarcaLaguneraregion and120inVeracruz.AnInmunochromatographyLateralFlowTest(ILF)andZiehlNeelsen(ZN)were performed. A questionnaire was performed to obtained information on animals and herd management,thestatisticanalysiswasperformedbySPSS17.0software.TheprevalenceintheLa LagunaregionusingILFwas19.35%andwithZN18.04%.Theriskfactorsidentifiedwereage(OR: 6.73CI95%3.4313.22),presenceofdiarrhea(OR:4.49CI95%2.637.68).PrevalenceinVeracruz was 3.33% (ILF) and 12.50% (ZN),presence ofdiarrhea was the only riskfactor (OR: 7.25 CI95% 2.2922.91).ItisconcludedthatCryptosporidiumspp.ispresentintheinfantcalvestheprevalenceis higherinintensivefarmslikeintheLaLagunaregionandlowerinextensivefarmsinVeracruz. Keywords: Cryptosporidiumspp.,prevalence,livestock,diarrheas.

INTRODUCCIN

Cryptosporidium pertenece al Reino protista, Phylum Apicomplexa, Clase conoidaisida, Subclase coccidiasina, Orden eucoccidiorida, Familia cryptosporidiidae, Gnero Cryptosporidium (Romero et al.,2001).MuchasinvestigacionessehanrealizadosobreCryptosporidium,decomoesteprotozoario
afectaahumanosyanimalesdesdehacemsde30aos(Pancieraetal.,1971NavinyJuranek,

80

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 1984),enestudiosepidemiolgicosCryptosporidiumparvumhasidoaisladodemltiplesespeciesde

mamferos, incluyendo el ganado, Cryptosporidium hominis afecta exclusivamente al hombre el (HunteryThompson,2005).Laformamscomndeinfestarseconesteparsitoesporlavafecal oral (Fayer et al., 2000 Fayer et al., 2005). C. parvum es responsable del 85% de infecciones gastrointestinales de becerros no destetados, pero solo el 1% en postdestetados. Los post destetadosyelganadoadultosonprincipalmente infestadosporC.bovis,C.andersoniyelgenotipo

C.deerlike(Santnetal.,2004).
Elobjetivodeltrabajofuedeterminarlaprevalenciaylosfactoresderiesgoenbecerrasentreunoy 60dasdeedadenalgunasunidadesdeproduccindelazonacentrodelestadodeVeracruzydeLa ComarcaLagunera,Mxico. MATERIALYMTODOS ElestudiosellevacaboencuatromunicipiosdelazonadelestadodeVeracruz(Naolinco,Acatln, Miahuatln,LanderoyCoss)yenlaregindeLaComarcaLagunera,localizadaenlosestadosde CoahuilayDurango.Paradeterminarlaprevalenciaserealizunestudiotransversal(Kelseyetal., 1986)enloshatosdeganadolecherodelaregin.Eltamaodemuestrasecalculconelpaquete estadsticoaplicadoaepidemiologaWinEpiscope2.0ver2.0(Thrusfieldetal.2001),seutilizuna prevalenciadel50%,unmargendeerrordel10%yunniveldeconfianzadel95%. ElmuestreoserealizdeAbrilaJuliode2009paraLaComarcaLagunerayparaVeracruzdeenero afebrerode2010. SeutilizlatcnicadeFaustmodificada(LeventhalyCheadle,1992)ladeZiehlNeelsenmodificada (Casemoreetal.,1985)ylapruebadeInmunocromatografadeFlujoLateral(IFL)Cryptosporidium

parvum, (BioX Diagnostics, Jemelle, Belgium) que determina la presencia de antgenos de la


superficiedeC.parvum. Se aplic un cuestionario para la determinacin de los factores de riesgo. Los datos fueron manejadosenunahojadeclculodeExcelparacadaunadelasvariablesyserealizestadstica descriptiva. Los factores de riesgo, fueron determinados por Razn de Momios (RM), se utiliz un mtodo bivariado para el anlisis de las variables. El anlisis se llev a cabo con el paquete estadsticoSPSSver17.0

81

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 RESULTADOS

Prevalencia de criptosporidiosis en becerras de La Comarca Lagunera: De los 460 animales muestreadosporlapruebadeIFLseobtuvieron89muestraspositivasconunaprevalenciageneral de19.35%porlapruebadeZNseobtuvieronuntotalde83muestraspositivasconunaprevalencia generalde18.04%. La variableedad (115 das) present la mayor prevalencia enLa Comarca Lagunera 32.88% (I.C. 0.270.39)conZNyconIFL35.62%(I.C.0.300.42). Losfactores de riesgo (FR) identificados fueron: la edad (16 a 30 das) 6.73 (IC95% 3.4313.22P= 0.0001)ypresenciadediarrea4.49(IC95% 2.637.68P=0.0001).

PrevalenciadecriptosporidiosisenmunicipiosdelEstadodeVeracruz: Delos120animalesmuestreadosenVeracruz,laprevalenciafuede3.33%(IFL)yun12.50%(ZN). SeencontrsolounFRde7.25enanimalescondiarrea(IC95% 2.2922.91P=0.0008). Lavariableedadpresentunaprevalenciade18.18%(0.070.39)conZNy9.10%(0.030.28)con IFL. DISCUSIN La prevalencia que se obtuvo en La Comarca Lagunera fue de 19.35% (IFL) y de 18.04% (ZN), siendo menor que la reportada por Delgado (2007) de 29.7%. Sin embargo, si coincide con un estudio en Aguascalientes, Mxico, (Castillo et al. 2009), en el cual por la prueba de Kinyoun obtuvieronunafrecuenciade75%(95/126),conunrangoentreranchosde25a100%.Losfactores de riesgo, importantes fueron: el tipo de alimentacin y la presencia de diarrea el primero es un factorderiesgoeldarsustitutodelecheenvezdelalechedelamadrey/oconcentrado(FM=2.08 IC95% 1.293.36P=0.003). EnVeracruz,lapresenciadediarreafueunfactorderiesgoestadsticamentesignificativosoloporla prueba de ZN (FM= 7.25, IC95% 2.2922.91 y P= 0.0008).Elfactorde riesgo consistenciade heces solotuvosignificanciaestadsticaentrelashecesnormalesylasdeconsistencialiquidapormediode lapruebadeZN(FM=0.07,IC95% 0.010.39yP=0.004),estonocoincideconHamnesetal.(2006) que al analizar esta variable por la prueba de flotacin en sucrosa no encontr significancia

82

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 estadsticaP>0.05.PerosiesrelevanteenelcasodelapruebadeZNporlocualenestecasose

difiereconloreportadoeneseestudio. CONCLUSIONES

Cryptosporidium spp. est presente en las becerras lactantes de los ranchos muestreados y la
prevalencia es mayor en becerras de explotaciones intensivas como en La Comarca Lagunera y menor en las explotaciones extensivas de Veracruz los factores de riesgo identificados sin son controladosdisminuiralaprevalencia. LITERATURACONSULTADA CasemoreD.P.,ArmstrongM.,andSandsR.L.1985.Laboratorydiagnosisofcryptosporidiosis.J.

Clin.Pathol.38(12):13371341.
CastilloC.G.,CruzVzquezC.,LpezR.R.,SnchezM.G.,RosarioR.C.,VitelaI.M.,MedinaL.E. 2009. Frecuencia e identificacin molecular de Cryptosporidium spp. en becerras lactantes mantenidasenconfinamientoenAguascalientes,Mxico.Tc.Pecu.Mx.47(4):425434. Fayer R., Morgan U., Upton S. J. 2000. Epidemiology of Cryptosporidium: Transmission, detection andidentification.Int.J.Parasitol.30:13051322. FayerR.,SantinM.,XiaoL.2005.Cryptosporidiumbovisn.sp.(Apicomplexa:Cryptosporidiidae)in cattle(Bostaurus).J.Parasitol.91:624629. Hamnes I. S., Gjerde B., Robertson L. 2006. Prevalence of Giardia and Cryptosporidium in diary calvesinthreeareasofNorway.Vet.Parasitol.140:204216. HunterP.R.,ThompsonR.C.2005.ThezoonotictransmissionofGiardiaandCryptosporidium.Int.J.

Parasitol.35(1112):11811190.

KelseyL.J.,ThompsonW.D.,EvansA.S.1986.Crosssectionalandothertypesofstudies. Methodsinobservationalepidemiology.OxfordUniversityPress.USA.
Leventhal R., Cheadle R. 1992. Parasitologa Mdica. 3a. Edicin, Mxico: Ed. Interamericana, Mc GrawHill. NavinT.R.,JuranekD.D.1984.Cryptosporidiosis:Clinical,epidemiologicandparasitologicreview.

Rev.Infect.Dis.6:313327.

83

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 Panciera R. J., Thomassen R. W., and Garner F. M. 1971. Cryptosporidial infection in a calf. Vet.

Pathol.8:479484.
RomeroM.R.,PedrozoR.H.,VeraE.2001.LaCriptosporidiosisenlosternerosrecinnacidos.Su etiologa,patogena,sntomas,tratamientoyprofilaxis.RevistadeCienciayTecnologa.Direccin deInvestigacionesUNA.FacultaddeCienciasVeterinarias,UniversidadNacionaldeAsuncin, Paraguay.1(3):110. Santn M., Trout J. M., Xiao L., Zhou L., Greiner E., Fayer R. 2004. Prevalence and agerelated variationofCryptosporidiumspeciesandgenotypesindairycalves.Vet.Parasitol.122:103117. Thrusfield M., Ortega C., de Blas I., Noordhuizen J. P., Frankena K. 2001. Win Episcope 2.0: improvedepidemiologicalsoftwareforveterinarymedicine.VetRec148:567572.

84

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ13)EscherichiacoliO157:H7encanalesdebovinosdelcentronortedelEstado deMxico.

EscherichiacoliO157:H7inbovinecarcassesinthenortherncentralareaoftheState ofMexico

NydiaEdithReyesRodrguez*,1MartnTalaveraRojas,1AdrianadelCarmenGutirrez Castillo,1 MaraUxaAlonsoFresn,1JorgeAntonioVarelaGuerrero,1VicenteVega Snchez.

Centro de Investigacin y Estudios Avanzados en Salud Animal, Facultad de Medicina Veterinaria y Zootecnia, Universidad Autnoma del Estado de Mxico. Carretera Panamericana TolucaQuertaro Km. 15.5. C.P. 50090. Toluca, Estado de Mxico. Email: mtr0035@yahoo.com.mxrrne22@yahoo.com.mx.* Autorparacorrespondencia.

RESUMEN La carne es considerada la primer fuente de protena de origen animal y puede ser el vehculodetoxiinfeccionesalimentariasporunadeficientecalidadsanitariaenelsacrificio. SedeterminolaprevalenciadeE.coliO157:H7yfactoresderiesgoencanalesdebovinos. Se analizaron 3 rastros municipales del Estado de Mxico (A, B y C), de los cuales se obtuvieron228muestraspareadasdecanalyheces.Lasmuestrasdecanalfuerontomadas medianteelmtodonodestructivo(UninEuropea) yparaheceselmtododescritoporla OMS. El aislamiento y serotipificacin se realiz de acuerdo a lo descrito por la OMS. La resistenciaantimicrobianafuemediantelatcnicadeKirbyBauer.Sedetectaronfactoresde virulencia(eae,Stx1yStx2)porPCR.Laevaluacinderiesgosserealizconundiagrama de flujo en rastro mediante el modelo HACCP y el cuestionario de diagnstico de la COFEPRIS.Seobtuvieron2(0.8%)cepasdeE.coliO157:NMapartirdehecesy6(2.6%) cepas de E. coli O157:H7 (5 de canales y 1 de heces) (p<0.05). En la asociacin epidemiolgicaseobtuvounRRde8.25yunORde12.5yunFAde0.87.Losaislamientos mostraron resistencia a gentamicina, amikacina, carbencilina y cefalotina y factores de

85

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

virulencia(eae,stx1ystx2).EnelHACCPseencontrqueenlos3rastroslosPCCsonel desangrado,desuello,evisceracin,cortedecanal,lavadoyalmacenamiento.Seencontr que los rastro A y B tienen un Riesgo Sanitario Medio y el C un Riesgo Sanitario Alto. En conclusinlosresultadosindicanqueelprocesodeobtencindelacarnenoeseladecuado por la presencia de E. coli O157:H7 en canales de bovinos lo que se considera un riesgo paralasaludpblica.

Palabrasclave: Escherichiacoli,O157:H7,ToxinasShiga,Multiresistencia,HACCP.

ABSTRACT Themeatisconsideredtheprimarysourceofanimalproteinandcanbethevehicleoffood poisoningbecauseofpoorsanitaryqualityatslaughter.WedeterminedtheprevalenceofE.

coliO157:H7 and risk factorsin cattle carcasses. 3 traces were analyzed municipal Mexico
State(A,BandC),ofwhich228sampleswereobtainedandstoolspairedchannel.Samples were taken through the channel nondestructive method (European Union) end feces to the method described by WHO. Isolation and serotyping was performed according to that describedbyWHO.AntimicrobialresistancewasusingKirbyBauertechnique.Weredetected virulencefactors(eae,Stx1andStx2)forPCR.Theriskassessmentwasperformedusinga flowchart trail through the HACCP model and the questionnaire for the diagnosis of COFEPRIS.Theywere2(0.8%)strainsofE.ColiO157:NMfromfeacesand6(2.6%)strains of E. coli O157:H7 (5 channels and 1 stool) (p 0.05). the epidemiological association obtainedaRRof8.25andanORof12.5andanAFof0.87.Theisolateswereresistantto gentamicin, amikacin, carbenicillin and cephalothin and virulence factors (eae, Stx1 and

Stx2).TheHACCPisfoundinthe3tracesthePCCarebleeding,skinning,evisceration,cut
channel,washingandstorage.ItwasfoundthattraceAandBhaveaHealthRiskMiddleand HighCahealthrisk.Inconclusiontheresultsindicatethattheprocessofobtainingthemeat isnotadequateforthepresenceofEcoliO157:H7incattlecarcasseswhichisconsidereda risktopublichealth.

86

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Keywords: EscherichiacoliO157:H7,Shigatoxin,multiresistance,HACCP. INTRODUCCION

Escherichiacoli(E.coli)esunabacteriaqueseencuentracomnmenteenelintestino
de humanos y animales de sangre caliente. La mayora de las cepas de E. coli son inofensivas, sin embargo E. coli enterohemorrgica (ECEH) puede causar graves enfermedadestransmitidasporlosalimentos(ETA)(OMS,2007).Porlogenerallosbovinos constituyen el principal reservorio de E. coli O157:H7, se encuentra con diferentes prevalencias, que oscilan en los bovinos sanos es entre el 7 y el 30% parece que estas cepas no son patgenas para los animales, aunque algunos investigadores las encuentran con ms frecuencia en aquellos que tienen diarrea (Halkman et al., 2001). Con base a lo anterior la carne puede contaminarse con materia fecal que contenga E. coli O157:H7, medianteelmalprocesamientodelacanalenlosrastros.

E.coliO157:H7esunacepadelgrupoECEHqueseaislinicialmenteenArgentina
en 1977. Se cree que este grupo surgi a partir de una recombinacin gentica entre una cepa de E. coli y una toxina que produce Shigella dysenteriae en el tracto intestinal de animales y humanos, como resultado se obtuvo una alteracin gentica de E. coli y la adquisicin de las toxinas Shiga (stx1 y stx2) (OMS, 2007). El perfil microbiolgico de la carne presentada a los consumidores es la suma de las aportaciones durante las operacionesdefaena,almacenamiento,transporteydistribucinademsdequeelmsculo

postmortemofreceunambientealtamentenutritivoalosmicroorganismosaunquenoest
claroan,hayindiciosdequelaingestindetanslo10bacteriaspuedesersuficientepara iniciarlainfeccinde E.coliO157:H7enhumanos(OMS,2007). Porelmomentoesescasa lainformacinenMxicosobrelapresenciadeE.coliO157:H7enbovinosyenvistadeque sonconsideradosreservoriosasintomticos,esnecesariorealizarunestudioparadeterminar laprevalenciadeE.coliO157:H7encanalesdebovinossacrificadosenrastrosdel centro norte del Estado de Mxico adems de identificar algunos factores de patogenicidad y virulencia,ascomolosfactoresderiesgoqueexistenenlosrastros.

87

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

MATERIALESYMTODOS

Se realiz un sorteo aleatorio de los rastros municipales centronorte del Estado de Mxico en el cual resultaron seleccionados3 (A, B y C) de estos, se tom el nmero de animalessacrificadossemanalmente,teniendountotalde575bovinos,seobtuvoeltamao de muestra considerando una prevalencia del 2.7% (VarelaHernndez et al., 2007) y un niveldeconfianzadel95%mediantelafrmuladetamaodemuestradepoblacionesfinitas (Wayne,2006).Obteniendoelsiguientetamaodemuestra,enelrastroA=8,RastroB=5y RastroC=25,serealizarontresrepeticionesencadarastrotomandolasmuestraspareadas (114 canal y 114 heces). Las muestras fueron tomadas de distintas partes de la canal y antesdesersometidasarefrigeracin(48C),medianteelempleodelmtododeesponja, segnelmtodoaprobadoydescritoporlaUninEuropea(UE)(EuropeanDirective,2001). Lasmuestrasdehecesfecalessetomarondespusdelaevisceracindelanimalsetomla porcin del colon y con tijeras previamente esterilizadas se cort el colon y se tom aproximadamente 1 g de heces con una esptula estril y se depositaron en un tubo de ensayecon9mldeaguapeptonadaal1%(OMS,2007).Lasmuestrasfuerontransportadas inmediatamentealCentrodeInvestigacindeEstudiosAvanzadosenSaludAnimal(CIESA) enelreadeInocuidadAlimentariadelaFacultaddeMedicinaVeterinariayZootecniadela UniversidadAutnomadelEstadodeMxico. Lasmuestrasdehecesfecalesycanalesse incubaron 242ha37C.posteriormentefueronsembradasenAgarMacConkeyyAgar MacConkey Sorbitol (SMAC Becton Dickinson) y en Agar Gelosa Sangre e incubadas durante242ha37C(OMS,2007).LascoloniassospechosasseinocularonenTSI,LIA, SIM y MIO por 24 h a 37 C una vez identificadas fueroninoculadas en Agar base sangre durante242ha37Cparalaidentificacinserolgicaconantisuerosmonovalentesanti somtico(Difco TM E.Coli.OAntiserumO157)yantiflagelar(Difco TM E.ColiHAntiserum H7). La evaluacin de la resistencia microbiana se realiz mediante la tcnica de Kirby Bauer estandarizada por el National Committee for Clinical Laboratory Standars (NCCLS), utilizando como control E. coli ATCC 25922. Se evaluaron los siguientes antibiticos: Amikacina(30g),Ampicilina(10g),Cefalotina(30g),Cefotaxima(30g),Ceftriazona(30 g),Cloranfenicol(30g),Gentamicina(10g),Netilmicina(30g),Nitrofurantoina(300g), Pefloxacina(5g)yTrimetropimsulfametoxasol(25g)(Sensidiscos,GramNegativosBIO

88

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RAD). Las lecturas fueron comparadas con las tablas de interpretacin de acuerdo al NCCLS.LaextraccindeADNserealizmedianteelkitcomercialDNAPurificationWizard Genomic (Promega). Las cepa de referencia utilizada fue E. coli EDL993 como control positivo la base de secuencias y el tamao previsto de la amplificacin para los oligonucletidosespecficosautilizarfueronlosreportadosporBlancoetal.(2003),Conel productofinalserealizunaelectroforesisengeldeagarosaal1%ysecorri1:30ha85 voltios. El gel fue teido con bromuro de etidio y se coloc en un transluminador de luz ultravioleta(UV)parasuobservacin. Paralaevaluacinderiesgos,serealizundiagrama deflujodelasactividadesenrastromedianteelModeloHACCP,setomencuentaquese cumplencabalmentelasBPMylosPOESyposteriormenteunadescripcindecadaunade dichas actividades as se logr determinar los peligros asociados a cada etapa. Una vez finalizada esta etapa, se procedi alarealizacin del cuestionario de diagnstico del rastro delaComisinFederalparalaProteccincontraRiesgosSanitarios(COFEPRIS),queest basado en el sistema HACCP (Signorini et al 2005). Como indica Campos et al. (2004) el sistemaHACCPesflexibleyenesteestudiosoloseevaluhastaelprincipio2.Establecer puntos crticos de control (Aplicacin de la secuencia de decisiones en cada fase para determinar los puntos crticos de control). La asociacin entre la presencia de animales portadoresylacontaminacindelacanal,serealizmedianteuncuadrodecontingenciade 2X2 a travs de la Razn de Momios con Intervalos de Confianza al 95%. Los resultados
2 fueronevaluadospormediodelapruebadeX ylaevaluacindelprocesodesacrificiotuvo

uncarctersubjetivo(Wayne,2006). RESULTADOS De un total de 228 muestras, 2 (0.8%) correspondieron al serotipo O157:NM el cual fue obtenida a partir de heces y 6 (2.6 %) a E. coli O157:H7 (5 de canales y 1 de heces). El porcentajedeaislamientodecadarastrofuevariable,encontrandoqueenelrastroBnose obtuvieron aislamientos, en el rastro A= 0.43% y en el C= 2.2 %. Los resultados muestran diferencias estadsticamente significativas (p<0.05). Se evalu la asociacin entre animales portadoresylacontaminacindelacanalconE.coliO157:H7obtenindoseunRR=2.5(IC 95%,1.744.35)yunOR=2.5(IC95%,1.324.7,conunFA=0.96(96%).LascepasdeE.

coli O157:H y O157:H7 fueron resistentes a gentamicina, amikacina, carbencilina y


cefalotina.EnlatcnicadePCRseobservquedelascepasdeE.coliO157:H7solouna

89

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

cepapresentaelgeneae ylasdostoxinas(stx1,stx2),otracepapresentolasdostoxinasy unabandaparastx2A1ylas4cepasrestantessolopresentaronelgeneaeylatoxinastx. En cuanto al Anlisis de peligros y Puntos Crticos de control se encontr que los puntos crticos en los rastros estudiados fueron el desangrado, desollado, eviscerado, corte de la canal,lavadoyalmacenamiento.Encuantoalriesgosanitarioenrastro,enesteestudiose encontrunriesgosanitariomedioenlosrastrosdeAy Byunriesgosanitarioaltoenel rastroC. DISCUSIN En este trabajo se demuestra la importancia que representan los bovinos portadores deE.

coli O157:H7, ya que cuando es inadecuado el manejo en rastros puede resultar


contaminada la canal. En este estudio se obtuvo una prevalencia de E. coli O157:H7 de 2.6%. Este resultado es similar a lo reportado por Varelaet al., 2007 quienes encontraron 2.7% de prevalencia de este agente en el Estado de Jalisco, Mxico, por lo que se puede considerarquelaprevalenciaenelcentroyoccidentedeMxicoessimilar.Encuantoalas toxinas Shiga stx1 y stx2, estas son las desencadenantes principales de la trombosis microvasculardelsndromeurmicohemoltico(DeanNystrometal.,1998).Enesteestudio seencontrunacepacarentedelgeneae,sinembargoZweifeletal.(2004)mencionanque cepasprovenientesdeovinos,quecarecendeestegeneae,hansidoreportadasenbrotes de enfermedades en humanos en Espaa, lo que indica que esas cepas pueden expresar factores adicionales de adherencia. Los datos obtenidos en este estudio son sumamente importantes porque se demostr la presencia de las toxinas en los aislados de E. coli O157:H7, ya que en un estudio realizado por Boerlin et al. (1999) mostraron que los pacientesinfectadosconcepaspositivasastx2representanunamayoramenaza,yaquees 6u8vecesmsprobablequesedesarrollenenfermedadesseverasencomparacinconlas personasinfectadasconcepasportadorasdestx1. Existen diversos trabajos en cuanto a la resistencia de E. coli O157:H7 en este estudio se encontr la resistencia a 5 antibiticos: amikacina, ampicilina, carbencilina, cefalotina y gentamicina. La vigilancia permanente de los antibiticos utilizados en la ganadera es de suma importancia para determinar la presencia y la prevalencia de cepas resistentes en las canales, ya que esto pone en riesgo la salud humana (Schroeder et al., 2002)lacarnedevacunocontaminadaconbacteriasresistentesalosantimicrobianosalno

90

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ser debidamente manipulados y cocinados, podran transferir sus genes de resistencia a otrospatgenosademsdesustoxinas,loquepodraconduciraunaenfermedaddifcilde tratar. En cuanto al Anlisis de peligros y Puntos Crticos de control se encontr que los puntoscrticosenlosrastrosestudiadosfueroneldesangrado,desollado,eviscerado,corte delacanal,lavadoyalmacenamiento.EstosresultadosdifierenconloencontradoporElder

et al. (2000), ya que encontraron que el mayor punto crtico es el eviscerado y el


almacenamiento, adems de que sugieren que la contaminacin cruzada de las canales siempreocurre,asimismodequelapresenciadeE.coli O157:H7duranteelprocesonoes completamente inesperado. En cuanto al riesgo sanitario en rastro, en este estudio se encontrunriesgosanitariomedioenlosrastrosdeAyC,yunriesgosanitarioaltoenelB. Estos resultados son similaresalo encontrado porla COFEPRIS (2006) ya que menciona queaproximadamenteel18%delafaenaanualdebovinos,seefectaenestablecimientos conriesgosanitarioaltoomuyaltoheaqulapreocupacinyaqueanualmenteseproducen, en establecimientos considerados como de alto o muy alto riesgo sanitario, 112 000 toneladasdecarnedebovinoysisetomaencuentaelconsumopercpitaanualdecarne de bovino, sera de esperar que aproximadamente un total de 7 103 300 personas consumirncarnederesproducidaenestablecimientosdealtoomuyaltoriesgo.

CONCLUSIONES

Enesteestudioseconfirmalanecesidaddeunenfoquepreventivoparaelcontrolde E.coliO157:H7enlaproduccindecarnedebovino.Conesteenfoque,laincorporacinde POESyBPMpodraayudarenelcontroldemicroorganismosademsdelaimplementacin delmodeloHACCP,yaquecomomencionaCampos.(2004),estesistemadebeserflexible, para permitir una evolucin, y a la vez conservar cierta rigidez, para evitar errores del operador.HACCPessinduda,unaherramientapoderosaytilparamejorarlaseguridadde los productos alimenticios en trminos de procesamiento, los riesgos de seguridad no puedensereliminados,peropuedenprevenirseoreducirse.

91

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

LITERATURACITADA

Blanco, M., Blanco, J. E., Mora, A., Rey, J., Alonso, J. M., Hermoso, M., Hermoso, J., Alonso, M. P., Dhabi, G., Gonzlez, E. A., Bernrdez, M. I., Blanco, J. 2003. Serotypes, virulence genes and intimin types of Shiga toxin (Verotoxin)producing Escherichia coli isolatedfromhealthysheepinSpain.J.Clin.Microbiol.41:13511356. Boerlin, P. 1999. Evolution of virulence factors in Shiga toxinproducing Escherichia coli. Cell.Mol.LifeSci.56:735741. Campos,B.C.A.2004.Procesodeobtencindelacarne.Prevencinderiesgossanitarios medianteelsistemaHACCP.Mxico. DeanNystrom, E., Bosworth, T. B., Moon, W. H., Obrien, D. A. 1998. Escherichia coli O157.H7Requiresintiminforenteropathogenicityincalves.Infect.Immun.66:45604563. Elder,R.O.,J.E.Keen,T.E.Wittum,T.R.Callaway,T.S.Edrington,R.C.Anderson,and D. J. Nisbet. 2002. Intervention to reduce fecal shedding of enterohemorrhagic Escherichia

coliO157:H7innaturallyinfectedcattleusingneomycinsulfate.J.Anim.Sci.8:15.
Halkman,K.A.,Noveir,R.M.,Dogan,B.H.2001.Escherichiacoli O157:H7Serotipi.Ankara NCCLS. National Committee for Clinical Laboratory Standards. Performance standards for antimicrobial disk susceptibility tests, 8th ed., vol. 24, no. 1. Approved standard M100S13. NationalCommitteeforClinicalLaboratoryStandards,Wayne,P.A.2004. OfficialJournaloftheEuropeanCommunityL165/48.EuropeanDirective2001/471/EC. OMS. Organizacin Mundial de la Salud. 2007. Manual de Procedimientos: Diagnostico y caracterizacindeEscherichiacoliO157productordetoxinashigaapartirdeespecmenes clnicos. Ed. OMS. Centro nacional de referenciadelWHO Global Salm Surv para America delSur.

92

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Schroeder,C.M.,Zhao,C.,DebRoy,C.,Torcolini,J.,Zhao,S.,White,D.G.,Wagner,D.D., McDermott, P. F., Walker, R. D. & Meng, J. (2002). Antimicrobial resistance of Escherichia

coliO157isolatedfromhumans,cattle,swine,andfood.ApplEnvironMicrobiol68,576581.
Signorini,M.P.,Civit,G.S.,Bonilla,P.S.,Cervantes,E.M.,Mayen,E.2005.Guaparala realizacin del diagnstico sanitario y deteccin de necesidades operativas de rastros y mataderos municipales. Comisin Federal para la Proteccin contra Riesgos Sanitarios. Mxico. VarelaHernndez, J. J., CabreraDiaz, E., CardonaLpez, M. A., IbarraVelzquez, L. M., RangelVillalobos, H., Castillo, A., TorresVitela, M. R., RamrezAlvarez, A. 2007. Isolation and characterization of Shiga toxinproducingEscherichia coliO157:H7 and nonO157 from beefcarcassesataslaugterplantinMexico.J.FoodMicrobiol.113,237241. Wayne, W. D. 2006. Bioestadstica. Base para el anlisis de las ciencias de la salud. Ed. Limusa.Mxico. Zweifel,C.,Blanco,E.J.,Blanco,M.,Blanco,J.,Stephan,R.2004.Serotypesandvirulence genes of ovine nonO157 Shiga toxinproducing Escherichia coli in Switzerland. I. J Food Microbiol.95:1927.

93

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ14)IDENTIFICACINDEINDICADORESDECALIDADDECARNEENRASTROS MUNICIPALESENMXICO

IdentificationofmeatqualityparametersinmunicipalslaughterhousesinMexico
1 1 2 AlejandraVlezizquierdo *JosAntonioEspinosaGarca ,GeorgelMoctezumaLpez , 3 4 1 JosLuisJolalpaBarrera ,MagalyMontserratPrezDaz ,DiegoBraaVarela ,Guillermina 3 MartnezTrejo .

CENIDFisiologayMejoramientoAnimalINIFAP.CarreteraaColn,Km1.Ajuchitln,Coln, Quertaro.CP.76280.CENIDCOMEFINIFAP,CIRCENTROINIFAPyUNAMFESAragn. Email: velez.alejandra@inifap.gob.mx, equidina79@yahoo.com.mx.* Autor para correspondencia. RESUMEN

El objetivo del presente trabajo es presentar un avance en la investigacin para la identificacindeindicadoresdecalidaddecarnefrescaenrastrosmunicipalesenMxico.Se estimounamuestrade63rastrosdeunapoblacintotalde1,054rastros,detipomunicipal, tipoinspeccinfederal(TIF)yprivadosregistradosenlaSAGARPA.Seutilizoelmtodode muestreo de varianza mxima. Del total de la muestra 48 fueron municipales, 8 TIF y 7 privados.Elanlisisdeinformacinenunprimermomentofueatravsdelusodeestadstica descriptiva.Elavanceenlosresultadossederivande32rastrosen15entidadesfederativas. La informacin proporcionada fue en 35% por los mdicos veterinarios responsables del rastro, con un promedio de 6 aos de trabajar en los mismos, en rastros que en promedio tienen 32 aos en operacin. Del total de animales procesados, el 32% son bovinos, 27% porcinos,14%ovinos,9%caprinosy2%aves.Lasprincipalesactividadesdelosrastrosson la recepcin de animales y la matanza en 100%. En promedio el 50% de los animales procesados son machos, para el caso de bovinos el 53% no son razas especializadas en carneyprovienendesistemasdeproduccinestabuladosen43%.Enel91%delosrastros exigeundocumentoqueespecifiquelestatussanitario.El93%nocuentaconsistemasde clasificacin de canales. El 60% no cuenta con sistemas de control de calidad y el 40% restante no contestaron a la pregunta. Con la informacin hasta el momento analizada es

94

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

posible percibirla ausencia de procesos que conlleven alaobtencin productosde calidad (canales)einocuidadenrastrosmunicipales.

Palabrasclave:rastros,municipios,calidad,matanza,capacitacion. ABSTRACT

The aim of this paperis to present advances in aresearch toidentify quality parameters of freshmeatinmunicipalslaughterhousesinMexico.Itwasestimatedasampleof63ofatotal of1,054slaughterhousesofmunicipaltype,ofbothfederalinspectiontype(TIF)andprivate type registered in the SAGARPA. We used the sampling method of maximum variance. 48 out of 63 samples were from municipal slaughterhouses, 7 TIF and 8 were private. The analysis of informationinitially was through the use of descriptive statistics. The advance in the results involved 32 slaughterhouses in 15 states. The information was provided for the veterinarians responsible of the abattoirs (35%), with an average of 6 years of working in them, on slaughterhouses with an average of 32 years in operation. The distribution of animalsprocessedwerecattle(32%),pigs(27%)andsheep(14%).Themainactivitiesofthe abattoirswerereceivingandtheslaughterofanimals(100%).Morethan50%oftheanimals processed were male, over 50% were not specialized beef breeds and were in feedlot systemsinthe43%ofthecases.In91%oftheslaughterhousesitwasrequiredadocument that specifies the health status of the animals. 93% of the abattoirs has not classification systems and 60% has not quality control systems. With the information so far analyzed is possibletoperceivetheabsenceofprocessesthatleadtotheproductionofqualityproducts andharmlessinmunicipalslaughterhouses.

Palabrasclave:slaughterhouse,municipalities,quality,slaughter,training. INTRODUCCION

Losrastrosseclasificandeacuerdoaltipodeactividadesquerealizan,porelequipamientoy lafinalidadparalosquefueroncreados.Existenlosrastrostipoinspeccinfederal(TIF)ylos rastros tipo inspeccin de la Secretara de Salud (TSS) o tambin conocidos como rastros

95

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

municipales. Sin embargo existen otros establecimientos conocidos como mataderos municipalesoclandestinos,siendostosltimosnoautorizadosoficialmenteparatalefecto (Gua tcnica 15). En estasinstalaciones se realiza el sacrificio y faenado delganado para ofrecer las canales obtenidas (canales completas, medias canales, cuartos de canal) a tablajerosquienesposteriormenterealizanlaventadecarnealmayoreoymenudeo(Vilaboa, 2011)quedebenserverificadosporlaSecretaradeSaludconlafinalidaddequesteyel procesodetransformacincumplanconloestablecidoenlanormatividadvigenteasimismo, losrastrosdebencumplirconlaLeyFederaldeSanidadAnimal(Escutia,1996Signoriniet

al.,2005,citadoporVilaboa,2011).
Lasdisposicioneslegalesqueregulanlaoperacindelosrastrosenelmbitoestatalsonlas Constituciones Polticas de los Estados y las Leyes Orgnicas Municipales, con base a lo establecidoenelartculo115Constitucional,sealandoalserviciopblicoderastroscomo una atribucin municipal. Los instrumentos jurdicos que regulan el funcionamiento y operacin de rastros en el mbito municipalson el Bando de Polica y Buen Gobierno y el ReglamentodeRastrosMunicipales.Enlaoperacindelosrastrosmunicipalesintervienen eladministrador,elMdicoVeterinarioZootecnista,elInspectordelaSecretaradeSalud,la TesoreraMunicipal,laJefaturadeSeguridadPblicaylosusuarios:introductores,tablajeros yunionesganaderas(Escutia,1996Signorinietal.,2005,citadosporVilaboa,2011). Losrastrosmunicipales,quesonlosmsabundantesenelpas,sonlasinstalacionesfsicas propiedad del municipio, destinadas a la matanza de animales que posteriormente sern consumidos por la poblacin como alimento. Las principales actividades operativas radican en la recepcin, matanza, inspeccin y distribucin y sus principales funciones comprenden:a)matanza,enellaserealizaeldegelloyevisceracindelosanimales,corte decuernos,limpiadepielesylavadodevsceras,b)manejodecanales,queconsisteenel corte de carnes y c) comercializacin directa, en donde se expenden los productos derivadosdelamatanzadelganado(Guatcnica15). En los rastros municipales se matan principalmente bovinos, porcinos, ovinos, caprinos y aves(enmenormedida).SegnelInstitutoNacionaldeEstadsticayGeografa(INEGI),en la publicacin Estadstica de sacrificio de ganado en rastros municipales por entidad federativa20052010,

96

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Enelao2010,semataroncasi7.5millonesdecabezasdeganadoenelpas,conloquese obtuvo una produccin de carne en canal de 994,865 toneladas, distribuidas en: 68.5%de carnebovina,30.9%porcina,0.4%ovinayelrestante0.2%decaprina(INEGI,2010). Enelmismoao,laproduccindecarneencanalresultligeramentemenoralade2009en 0.4%,debidoaladisminucinenlacarnecaprina,ovinaybovinade10.3%,0.9%y0.6% respectivamente.Elganadoporcinonoregistrcambiorespectoalao2009.Elpreciomedio portoneladadecarneencanalenelao2010,sesituenlos29,990pesos,loquesignific unincrementoanualde0.6porciento.Laproduccindecarneencanalpredominanteenel territorio nacional en 2010 fue la de ganado bovino, misma que present la mayor participacin en 25 estados, mientras que en 6 entidades la de carne porcina fue la ms importante. Los cambios en los gustos y preferencias de los consumidores y de las exigencias de los mercados, con respecto a conceptos tales como la calidad, trazabilidad e inocuidad (entre otros), conllevan a retomar, analizar, restructurar y explorar, en cada uno de los integrantes de las cadenas productivas de las diversas carnes para consumo, el entendimientodelconceptoyaplicacindelmismo. El concepto de calidad es un tanto complejo, exceptuando la calidad nutricional y microbiolgica de los alimentos, la calidad de estos se define como las caractersticas fisicoqumicasyfuncionales(fsicas)delosmismos(Aguilar,etal.,sf),encuantoacalidad de carne algunos autores la definen como la combinacin adecuada de los atributos de terneza,jugosidad,sabor,coloryolor(Pearson,1966PearsonyDutson,1994,citadospor Acevedo,2004Aguilar,etal.,sf),anivelgeneralycalidaddelacanalcomocanalesbien conformadas, con un elevado contenido de msculo y suficiente cantidad de grasa intramuscularparasatisfacerlosrequerimientosorganolpticosdelconsumidor(Torrescano,

et al., 2010) detrs de ambos conceptos existen factores que influyen y llegan a ser
determinantes tales como: el sistema de produccin, la raza, la edad, el sexo, transporte, lugaryformade matarlos,elmanejodelascanalesenlosrastrosylascondicionesenlas que se dala distribucin delas mismas, as como el manejo de la carne enlos centrosde distribucion ya sean mayoristas (centrales de abasto, supermercados, etc) y minoristas (comocarnicerias). Dado lo anterior y la importancia que tiene el eslabn de transfromacin en la cadenas

97

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

productivas de bovinos carne y porcinos, el objetivo del presente trabajo es presentar un avanceenlaidentificacindeindicadoresdecalidaddecarnefrescaenrastrosmunicipales enMxico,paradesarrollarmejorestecnologasydisearpolticaspblicas. MATERIALESYMETODOS

Lapresenteinvestigacinsedesarrolloencuatrofase:laprimerafaseconsistiendiseary validar un cuestionario que contempl seis apartados: I) datos generales del rastro, II) fase dematanzadeanimales,III)sistemasdecontroldecalidad,IV)capacitacindepersonaly, V)conservacindecanales.Enlasegundafasesedetermineltamaodelamuestra(n)a nivelnacional,deunapoblacinde1,054rastrosdetipomunicipal,inspeccinfederal(TIF)y privadosregistradosenlaSAGARPA.Seutilizelmtododemuestreodevarianzamxima aunniveldesignificanciadel90%.Lansedistribuyen41rastrosmunicipales,11rastros privadosy10TIF.Latercerafaseconsistienlaaplicacindelasencuestasycapturadela informacin en una hoja del programa Excel y la cuarta etapa correspondi al anlisis de datos a travs del uso de frecuencias y estadstica descriptiva. Las variables analizadas fueron para bovinos y porcinos: numero de animales recibidos, numero de empleados, capacidad instalada, procedencia del ganado, sistemas de produccin, raza, sexo (sol bovinos),transporte,instalaciones,mtodosdearreoeinsensibilizacin,sistemasdecalidad y clasificacin de canales. El avance en los resultados se derivan de 32 rastros en 15 entidades federativas (Oaxaca, Tlaxcala, Estado de Mxico, Sonora, Sinaloa, Nayarit, Colima, Quertaro, Hidalgo, San Luis Potos, Jalisco, Michoacn, Aguscalientes, Morelos y Guerrero). RESULTADOSYDISCUSIONES

La informacin proporcionada fue en 35% por los mdicos veterinarios responsables del rastro, con un promedio de 6 aos de trabajar en los mismos, en rastros que en promedio tienen 32 aos en operacin. Los rastros municipales al ser los primeros establecimientos legales en los territorios municipales tienen un mximo de 70 aos en operacin y un mnimo de 2 aos. La especie bovina y porcina son las ms procesadas en los rastros municipalesen32y27%respectivamente,seguidosdel14%deovinos,9%caprinosy2%

98

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

aves.Elnumerodetrabajadoresquelaboranenlosrastrosencuestadossonen68%de4a 23,16%de24a43ysloel10%delosrastrostienende44a63empleados(Figura1).

animales.Enambasespecies,esevidente quenoseusanlasinstalacionesal100.

En promedio el ganado bovino es introducido a los rastros municipales por Figura 1. Numero de empleados por intervalos. Fuente: Elaboracin propia con productores en 65% y los porcinos por productoresen66%y3%porotros,enlos cualesdestacalafiguradelobrador.

informacin de cuestionarios aplicados a rastrosmunicipales,2010.

Del total de encuestados, el 31% recibe animalesenloscorralesdedescanso,yel 100 realiza la matanza y el corte slo en canales, medias canales y cuartos, el 6% almacena (cuentan con instalaciones con cmarasdeenfriamiento).

En el rea de procesamiento laboran el 60%delostrabajadoresyenpromedio14 trabajadores.

Las principales actividades de los rastros sonlarecepcindeanimalesylamatanza en 100%, dato que coincide con las funciones bsicas que han de realizar los rastros municipales (Gua tcnica 15). El promedio por da de animales recibidos fueron de 18 bovinos con una capacidad instalada promedio para 52 cabezas, lo que indica una diferencia de 34 animales que no se procesan y, en porcinos el promedio de animales al da son de 32 y una capacidad instalada promedio de 64

La procedencia del ganado es en bovinos del78%delmismomunicipioyestadoyen porcinos del 47%. Los porcentajes

restantes provienes de municipios del mismo estado y de otros estados, aunque enmenormedida.

Con respecto al sexo de los animales, el 50% de los animales procesados son machos,ynoderazasespecializadaspara carne en 53%, predominando el ceb, las cruzas con ste y animales criollos, y de origen de sistemas de produccin

99

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

estabulados en 43% para el caso de

ovinos. La raza de los porcinos de mayor

frecuencia es la Landrace en 87%. En el 91% de los rastros se exige un documento que especifiquelestatussanitariodelganado,siendolaguademovilizacinen60%.

El 93% no cuenta con sistemas de clasificacin de canales. El 63% de los entrevistados consideran que el transporte en el cual es movilizado el ganado no cuenta con las condicionesnecesariasparaasegurarlacalidadytampocoseusantranquilizantes,estose correspondeconeltiempoderecorridoelcualnoesmayoratreshorasenambasespecies conunmximoenbovinosdeseisy18enporcinos.

Con respecto a las instalaciones previas a la matanza, el 53% de los rastros cuentan con instalaciones para la recepcin de bovinos y 47% para porcinos, siendo este un aspecto contemplado dentro delas reas complementariasexternas parala operacin bsica (Gua tcnica15),dentrodestassecontemplanreasparaeldesembarqueconrampasen84% para bovinos y 72% en porcinos y bebederos en 69% parabovinos y 59%en porcinos. El mtodo de arreo ms utilizado esla chicharra en 66% y 41% respectivamente y el uso del lazodentrodeotrosmtodos.

Para realizar el proceso de matanza en bovinos se usa la pistola de mbolo en 75% en bovinosyenporcinoslosestmuloselctricosen50%,enestaespecieelusodecuchilloso golpes con mazo an son usados como resultado de la falta del equipo necesario para efectuarlodeotraforma.

El100%delosentrevistadosmencionaronelnoaceptaranimalesmuertosycomocausasde rechazoanimalesenfermos,congolpesyencasosextremosporbajopeso.Delosanimales procesados las partes ms decomisadas fueron hgados y vsceras. La presencia de defectosencanalesdebovinosfuedel4%y3%enporcinosporgolpesyabscesos.

100

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Laproblemticaparaasegurarlacalidaddelacarneseubicoentresmomentos:a)antes deprocesarlosanimales,b)duranteelprocesodematanzayc)despusdelamatanza, concretamenteenelmanejodelascanales.

Losprincipalesproblemasantesdeprocesarlosanimalesparaasegurarlacalidaddela carne son: el trasporte (malas condiciones), el maltrato en el mismo y al momento del desembarque. Durante el proceso de matanza los principales problemas se da en las instalaciones (malas condiciones) y el personal, los cuales son desde falta de capacitacinhastalafaltadehigienedelpersonalydespusdelamatanza:enelmanejo delascanales(faltadehigiene,tantoeninstalacionesypersonal),laactitudrenuenteal cambiodelpersonalycondicionesinadecuadaseneltrasporteenaquellosrastrosenlos cualesserealizaladistribucindelascanales,ytambinporpartedelosdueosdelas canalesquenocuentancontrasporteadecuado.

El60%nocuentaconsistemasdecontroldecalidadyel40%restantenocontestarona la pregunta. Con la informacin hasta el momento analizada es posible percibir la ausencia de procesos que conlleven a la obtencin productos de calidad (canales) e inocuidad en rastros municipales, an con la existencia de normatividad y presencia obligadademdicosveterinariosdedicadosalasupervisindelosprocesos.

LITERATURACITADA

Acevedo, S.M. (2004). Evaluacin de los atributos principales de calidad de la carne de res de origen local e importada, segn se ofrece al consumidor. Tesis de Maestra en Ciencia en Ciencia y Tecnologa de alimentos. Universidad de Puerto Rico, Recinto UniversitariodeMayagez.PuertoRico,81p.

Aguilar, G.J. M. Becerril. D. Mota y I. Guerrero. (S/F). Calidad dela carne de ovino en relacin con elestrs por transporte. Universidad Autnoma Metropolitana y Benemrita UniversidadAutnomadePuebla,Mxico.3p.

101

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Gua

tcnica

15.

La

administracin

de

rastros

municipales

http://www.inafed.gob.mx/work/resources/guias_tecnicas/guia15.htm.Consultadoel01de juliode2011.

INEGI. (2010). Estadstica de sacrificio de ganado en rastros municipales por entidad federativa20052010. http://journalmex.wordpress.com/2011/04/29/estadisticade

sacrificiodeganadoenrastrosmunicipalesporentidadfederativa20052010/. Consultadoel11deagostode2011.

Torrescano, U.G.R. A. Snchez. M.G. Vsquez. R. Paz. D.A. Pardo. (2010). Caracterizacin de canales y de carne de bovino de animales engordados en la zona centrodeSonora.RevistaMexicanadeCienciasPecuarias.Vol.1.Num2.157168p.

Vilaboa, A. (2011). Propuesta metodolgica para evaluar Riesgos Sanitarios en Mataderos y Rastros Municipales del Estado de Veracruz, Mxico. En

http://www.engormix.com/MAganaderiacarne/frigorifico/articulos/riesgossanitariosen mataderost3330/378p0.htm.Consultadoel29dejuliode2011.

102

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 15) SEROPREVALENCIA Y FACTORES DE RIESGO ASOCIADOS A LEPTOSPIROSISBOVINAENELCENTRODELESTADODEVERACRUZ SEROPREVALENCE OF BOVINE LEPTOSPIROSIS IN THE CENTER OF VERACRUZ STATE

1 2 1 AnabelCruzRomerol *,DoraRomeroSalas ,SilviaLpezOrtiz ,MartnMendoza 1 Briseo , 3 4 ZeferinoGarcaVzquez ,JorgeNoriegaLoyo 1

ColegiodePosgraduados,CampusVeracruz.Km.88.5CarreteraTepetates,ManlioF.

Altamirano, 2 Facultad de Medicina Veterinaria y Zootecnia. Universidad Veracruzana.


3 Circunvalacin S/N Esq. Ynez Colonia Unidad Veracruzana, Veracruz, Mxico. Centro

Nacional en Investigacin Disciplinaria en Parasitologa Veterinaria. Jiutepec, Morelos,


4 Mxico, FacultaddeCienciasBiolgicas.UniversidadVeracruzana,OrizabaCrdoba.

Correoelectrnico:acruz@colpos.mx*autorparacorrespondencia

RESUMEN El objetivo fue determinar la prevalencia e identificar los factores de riesgo asociados a leptospirosis bovina en 22 municipios del centro del estado de Veracruz, se dise un muestreopolietpicoestratificado.Lancalculadafuede1,248bovinosconunafrmula parapoblacininfinita,utilizandoun10%deprevalencia,un95%deconfianzayunerror de0.1,elestudiofuedetipotransversaldondeseobtuvieronmuestrasdehembrasde18 a 84 meses, sin importar raza, tipo de ganadera, funcin zootcnica. Se aplic una encuestaporanimalyunaporrancho,lasmuestrasfueronanalizadasconlatcnicade aglutinacin microscpica (MAT), utilizando una batera de 12 serovariedades, considerando como positivos animales con ttulos 1:100. Los datos fueron analizados conelpaqueteestadsticoSPSSver17,secalcullaprevalenciayserealizunanlisis
2 bivariado utilizando X , para identificar los factores de riesgo. Los resultados obtenidos

fueron los siguientes, una prevalencia general del 5.53%, las serovariedades ms frecuentessonL.canicola22,3%,L.pomona11,6%,L.pyrogenes11,2%,L.hardjo6,2%,

103

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

L. ballum 4,6%. Considerando como factor protector ser ganado del municipio de
Tlacotalpan OR 0.1063 (95%, IC 0.01290.8740, p=0.037), y como factores de riesgo la no presencia de perros OR 1.68 (95%, IC 1.02182.7656, p=0.04) y la no presencia de gatos OR 2.04 (95%, IC 1.103.76, p=0.02). Se concluye que Leptospirosis bovina est presenteenlosranchosmuestreadosdelcentrodelestadodeVeracruzyelserovarms frecuentefueL.canicola. Palabrasclaves:enfermedad,L.interrogans,estudiotransversal. ABSTRACT Theaimwastodeterminetheprevalenceandidentifyriskfactorsassociatedwithbovine leptospirosis in 22 municipalities in Center of Veracruz, which were selected through stratified multistage sampling. The "n" of 1,248 cows was calculated with a formula for infinitepopulation,using10%prevalence,95%confidenceandanerrorof0.1,thecross sectional study was where samples were females 18 to 84 months, regardless of race, type of farming, animal husbandry function. A survey was per animal and per farm, sampleswereanalyzedusingthemicroscopicagglutinationtest(MAT),usingabatteryof 12strains,consideringanimalswithpositivetiters1:100.Datawereanalyzedusingthe software SPSS 17, we calculated the prevalence and bivariate analysis was performed usingX2, to identifyrisk factors.Theresultswere the following,an overall prevalence of 5.53%, the most frequent serovars: L. canicola 22.3%, L.pomona 11.6%, L. pyrogenes

11.2%,L.hardjo6.2%,L.ballum4.6%.Consideringasaprotectivefactorherdsfromthe
municipality of Tlacotalpan OR 0.1063 (95% CI 0.012 0.874, p=0,037), and as a risk factorfarmswithoutdogsOR1.68(95%CI1.0212.765,p=0.04)andfarmswithoutcats OR2.04(95%CI1.103.76,p=0.02). WeconcludethatbovineLeptospirosisispresenton thefarmssampledinthecenterregionofVeracruz. Keywords:diseases,L.interrogans,crosssectional.

INTRODUCCIN La leptospirosis es una zoonosis de distribucin mundial que afecta a animales domsticos, fauna silvestre y al hombre (Andicoberry et al., 2001, Ghnem et al., 2007) causaseriosproblemasreproductivosenvariasespeciesanimales(Anayaetal.,2004).El gneroleptospira,especieL.interrogans,delacualexistenentre200y220serovares,los

104

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

serovares relacionados antignicamente se clasifican dentro de un mismo serogrupo (Andicoberryetal.,2001).Laprevalenciadelaenfermedadvaranotablementeentrelos distintos pases, e incluso entre las diferentes regiones de un mismo pas (Alonso Andicoberryetal.,2001LealCastellanos,etal.,2003).Unestudiorealizadoenregiones variasregionesdeMxicoporMolesetal.,(2002)analizaron4043suerosdebovinosy encontraron una seroprevalencia de 31.1%, las serovariedades ms frecuentes fueron

Leptospira hardjo, L. wolffi y L. tarassovi. Por otro lado un estudio en sueros bovinos
realizado en el estado de Yucatn, Mxico utilizando la tcnica de aglutinacin microscpica,encontraronuntotalde62.8%devacaspositivas,lasserovariedadesms frecuentes fueronL. hardjo(54.1%) yL. tarassovi(53.3%) (SeguraCorrea,etal.,2003). En la actualidad la enfermedad no solo se encuentra en los trpicos (Cspedes et al., 2006)yaunqueotrosestudiosmencionanqueesmsfrecuenteenregionestropicalesy subtropicales(Vadoetal.,2002).Elobjetivodeestetrabajofuedeterminarlaprevalencia eidentificarlosfactoresderiesgoasociadosaleptospirosisbovinaenlaZonaCentrodel estadodeVeracruz. MATERIALYMTODOS SerealizunestudioepidemiolgicodetipotransversalenlaZonaCentrodelEstadode Veracruzseseleccionaron22municipios,elperiododetiempofuedetresaos,dondese recabarondatosconunaencuestaporanimal(individual)yporrancho(general). Seleccindeltamaodemuestra.Paraeltamaodemuestraseutilizounaformulade proporciones (Levy and Lemeshow, 1999) usando una prevalencia previa del 10%. Fueronseleccionadosalazarel33%deltotaldemunicipiosdelaZonaCentro(Kelsey,et

al.,1986Silva,1993).Lancalculadafuede1,248bovinos,95%deconfianzayunerror
del0.1. Obtencindemuestrasdesangre.Setomaron10mldesangredelavenacoccgea delavenayugularcontubosalvaco. DiagnsticodeLaboratorio.Lasmuestrasdesuerofueronprocesadasyanalizadasen el Laboratorio de Inmunologa de la Posta Zootcnica Torren del Molino, utilizandola TcnicadeAglutinacinMicroscpica(MAT)(Brandaoetal.,1998WHO,2003,Faine,et

al2000).Lossuerosbovinosfueronconfrontadoscon12serovariedades.
Anlisis dedatos. Se calcularonlas prevalencias por municipio y se realiz un anlisis bivariadoderiesgosysecalcullarazndemomios(RMOR).

105

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RESULTADOSYDISCUSIN La prevalencia general de la Zona Centro de Veracruz fue de 5.53% (69/1248), las muestras procesadas fueron positivas a 11 serovariedades de las 12 utilizadas, y sus frecuencias fueronlas siguientesL. canicola(22.3%),L. pomona(11.6%),L. pyrogenes (11.2%),Leptospirahardjo(6.2%),L.ballum(4.6%),L.lailai(3.3%),L.bratislava(2.8%),

L. autatumnalis (2.3%),L. grippotyphosa (1.8%),L. tarassovi(1%),L. icterohaemorragiae


(0.4%).Laprevalencias msaltaspormunicipioenlaZonaCentrodeVeracruz,Mxico fueron la siguientes: Tlacotalpan 16,67%, Tlalixcoyan 11,90%, Santiago Tuxtla 11,11%. Tlacotalpan fue el municipio con mayor prevalencia 16.67% y los factores de riesgo asociadosconleptospirosisbovinaenlaZonaCentrofueron:serganadopertenecienteal municipio de Tlacotalpan es un factor protector OR 0.1063 (95%, IC 0.01290.8740, p=0.037),ycomofactoresderiesgolanopresenciadeperrosOR1.68(95%,IC1.0218 2.7656, p=0.04) por lo tanto nos indica que tiene 1.60 veces ms riesgo de presentar leptospirosissinoexistenperrosenelhatoylanopresenciadegatosOR2.04(95%,IC 1.103.76,p=0.02)tambinresultoserunfactorderiesgo.

CONCLUSIONES Leptospirosis bovina est presente en los ranchos muestreados en la Zona Centro del estado de Veracruz con una prevalencia general de 5.53%. Las serovariedad ms frecuentefueL.canicolacon22.3%yTlacotalpanfueelmunicipioconmayorprevalencia dela zona centro aunqueresult ser unfactor protector pertenecera ese municipio yla ausencia de perros en el hato es un factor de riesgo, no estn claros estos resultados debido a que se encontraron anticuerpos en contra deL. canicola y lo que se esperaba encontrareraquelapresenciadeperrosincrementaralaprevalenciaenlazona,locual puededeberseamltiplesfactoresdemanejodebidoaqueenTlacotalpanelganadoes movilizadoenpocadelluviasporserunazonainundable.

AGRADECIMIENTOS

106

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

FOMIXCONACYTyGobiernodelEstadodeVeracruz,conelapoyoparcialdelProyecto 37066, Enfermedades Causantes de Abortos en Bovinos (Brucelosis, Leptospirosis, DiarreaViralBovina,RinotraqueitisInfecciosa,Neosporosis)delestadodeVeracruz.

LITERATURACITADA Andicoberry AM, Garca Pea F.J., Pereira Bueno J., Costas E., Ortega Mora L., 2001. Herdlevel risk factors associated with Leptospira spp. seroprevalence in dairy and beef cattleinSpain.Prev.Vet.Med.52:109117. AndicoberryAlonso C, GarcaPea FJ, OrtegaMora LM. 2001. Epidemiologa, diagnostico y control de la leptospirosis bovina (Revisin). Dpto. de Sanidad Animal, Facultad de Veterinaria, Universidad Complutense de Madrid, Prod. Sanid. Anim Vol. 16(2):206225. FinlayJ.Carlos.2000.Leptospirosishumana:UnproblemadeSaludPblica.26(1):27 34 LealCastellanos CB, GarcaSurez R., GonzlezFigueroa E, FuentesAllen JL, EscobedodelaPenalJ.2003.Riskfactorsandtheprevalenceofleptospirosisinfectionin aruralcommunityofChiapas,Mexico.EpidemiolInfect.131(3):11491156. Lunalvarez MA, MolesCervantes LP, GavaldnRosas D, NavaVsquez C, Salazar Garca F. 2005. Estudio retrospectivo de seroprevalencia de leptospirosis bovina en Mxicoconsiderandolasregionesecolgicas.RevCubanaMedTropREVCUBANAMED TROP47(1):2831. Moles CervantesLP, Cisneros Puebla MA, Rosas DG, Serrania NR, Torres Barranca JI. 2002. Serological study of bovine leptospirosis in Mexico Rev Cubana Med Trop. 54(1): 2427. SeguraCorreaVM,SolisCalderonJJ,SeguraCorreaJC.2003.Seroprevalenceofandrisk factorsforleptospiralantibodiesamongcattleinthestateofYucatan,Mexico.Trop.Anim HealthProd.35(4):293299. Vado Sols I., Crdenas Marrufo MF., Jimnez Delgadillo B, Alzina Lpez A, Lariado Molina H, Suarez Sols V y Zavala Vzquez J. 2002. Clinical Epidemiological study of leptospirosisinhumansandreservoirsinYucatn,Mxico.Rev.InstMedTrop.S.Paulo. 44(6):335340.

107

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

World Health Organization. 2003. Human leptospirosis: guidance for diagnosis, surveillanceandcontrol.5.p.6369.

108

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ16)SeroprevalenciadeInfeccinporHerpesvirusBovinoTipo1(BoHV1)en BfalosdeAgua(Bubalusbubalis )enVeracruz,Mxico. Seroprevalence of bovine Herpesvirus Infection Type 1 in water buffalo (Bubalus bubalis )inVeracruz,Mexico.

DomnguezAguilar,Gladys.RomeroSalas,Dora.GarcaVzquez,Zeferino.Martnez Herrera,DavidI.

RESUMEN ElobjetivodelestudiofuedeterminaranticuerposcontraBoHV1enbfalosdeaguadel centro y sur de Veracruz. Se realiz un estudio transversal en cinco unidades de produccindelosmunicipiosde:SayuladeAlemn,JuanRodrguezClarayCiudadIsla. Secalculeltamaodemuestradeunapoblacinde1025bfalos(n=144).Serealiz un muestreo sistemtico, donde se incluyeron ganado de pie de cra y sementales. Se tomaron muestras sanguneas por puncin de la vena yugular de bfalos (10 mL). Las muestrassetransportaronalaUnidaddeDiagnsticoenlaPostaZootcnicaTorrendel Molino dela Facultad de Medicina Veterinaria yZootecnia (UV). El suero fue analizado por la prueba de ELISAde competencia (IDEXXLaboratorios HerdChek IBRgB. Sensibilidad97.4%yEspecificidad92.4%)paraidentificaranticuerposespecficoscontra BoHV1.Seobtuvounaseroprevalenciageneralde57.6%(IC95%:49.165.7)lasmayores seroprevalencias fueron: (26.3% IC95%: 19.534) en una unidad de produccin (UP) de SayuladeAlemn,(7.6%IC95%:413.5)enJ.RodrguezC,y(1.3%IC95%:0.25.4)enC. Isla.enbfalosde36mesesdeedad(15.2%IC95%:1022.4)enhembrasdetresacinco partos (24.3% IC95%: 17.732.2). Se concluye que los bfalos de los tres municipios estudiadoshanestadoexpuestosaBoHV1porloqueseproponerealizaruncalendario devacunacinpuestoquepuederesultarunriesgoparaotrosrumiantes. Palabrasclave:Herpesvirusbovinotipo1,Veracruz,Bfalosdeagua,Seroprevalencia. ABSTRACT The main objective of the present study was todetermineBoHV1 antibodies in water buffaloes from southern Veracruz State, Mexico.This transverse study comprised five BuffalofarmslocatedinSayuladeAlemn,JuanRodrguezClaraandCiudadIslacounties. Samplesizewasn=144,fromanestimatedbuffalopopulationof1025animals.Thebuffalo

109

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

sampled populationincluded animals fromsix to >84 months old.Bloodsamples were takenviajugularpuncture (10 mL). Sampleswere transportedto the diagnostic laboratory atthe Posta Zootcnica Torren del Molino of Universidad Veracruzana. The blood serum was analyzed withELISA testofcompetition (IDEXXLaboratories HerdChek IBRgBSensibility 7.4% and Specificity92.4%). The general seroprevalence was 57.6% (IC95%: 49.165.7) the highestseroprevalencein each county was: 26.3% (IC95%: 19.5 34) atSayula de Alemn7.6% (IC95%: 413.5) at J. Rodrguez Clara, and 1.3%(IC95%: 0.25.4)atCiudadIsla.Highestseroprevalencefrombuffalosagegroupandreproductive status was 15.2%(IC95%: 1022.4) in the 36 month old group and 24.3%(IC95%: 17.7 32.2)in females with threeto five pregnancies. In conclusion, the buffaloes of the three counties were exposed to BoHV1,thereforeit is necessary to consider buffaloes in the preventive vaccination management as they might be a risk factor for other domesticruminants.

KeyWords:BovineHerpesvirustype1,Veracruz,WaterBuffaloes,Seroprevalence. INTRODUCCIN El Herpesvirus Bovino Tipo 1 (BoHV1) es un patgeno que afecta principalmente a rumiantes tanto domsticos como silvestres (Bandyopadhyay et al., 2009 Cantu et al., 2008 Intisar et al., 2009 Rajkhowa et al., 2004), y ocasiona importantes prdidas econmicasdebidoalnmerodeabortosyfallasenlafertilidad(Crdova,2003),adems de sus presentacionesrespiratoria (Rinotraqueitis) y genital (Vulvovaginitis) infectocontagiosas (Radostitset al., 2002),ya que el BoHV1 se transmite por va respiratoria y por contacto directo con secreciones ocular y genital, tambin por semen frescoocongeladodesementalesinfectados(Nuotioetal.,2007).Generalmenteinfectaa ganado mayor de 6 meses de edad (Woodbine et al., 2009).Despus de la primera exposicinalvirus,losanimalesadquierenunainfeccinlatenteproduciendoanticuerpos por al menos 5 aos (Chow, 1972), inclusive se ha observado que puede provocar meningoencefalitis, necrosis neuronal y edema (Rissi et al., 2008). En bfalos ha sido demostradalapresenciadeanticuerposcontraestevirusmedianteInmunoensayoLigado aEnzima(ELISA)decompetenciadondesehanencontradoprevalenciasdesde10.3% (Jainetal.,2006)hasta89%(Shomeetal.,1997),estoenlaIndia Y ya que se ha introducido bfalo de agua a Mxico, y principalmente en la regin sureste, se planteel objetivo dedetectarla presencia de anticuerpos contra el BoHV1

110

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

enestaespecieenelsurdelestadodeVeracruz.EstomedianteunapruebadeELISAde competencia.

MATERIALYMTODOS Serealizunestudioepidemiolgicodetipotransversal,encincounidadesdeproduccin ubicadas en los municipios de: Sayula de Alemn, Juan Rodrguez Clara y Ciudad Isla, correspondientes la zona Sur de Veracruz, Mxico,en un periodo comprendido desde noviembrede2010amayodel2011. Se calcul un tamao de muestra a partir de una poblacin de 1025 bfalos, de donde result una n=143 bfalos yse realiz un muestreo sistemticodonde se incluyeron: el ganado bufalino de pie de cra, bubillas vientres y los sementales del hato no as, bufalinosdeengordayanimalessinantecedentesdemanejoybufalinosdeengorda.De losanimalesseleccionadossetomaron10mLdesangreporpuncindelavenayugular utilizando tubos al alto vaco,posterior a esto, las muestras se transportaron a una temperatura de 4C, al laboratorio de Parasitologa perteneciente a la Unidad de Diagnstico ubicada en la Posta Zootcnica Torren del Molino de la Facultad de Medicina Veterinaria y Zootecnia, Universidad Veracruzana, ah se obtuvo el suero sanguneoparaserutilizadoenlapruebadeInmunoensayoLigadoaEnzimas(ELISA)por competenciase utiliz un kit comercial, HerdChek IBRgB de laboratorios DEXX, (Sensibilidad 97.4% Especificidad 92.4%). Se prepara la placa siguiendo en protocolo propuesto por el laboratorio distribuidor, y se utiliza un lector de ELISA con un filtro a densidadpticade450nmparafinalmentedeterminarelresultadopositivoonegativode la prueba mediante el clculo realizado por el programa XCheck 3.3 (IDEXX Laboratories). Los datos obtenidos de las encuestas se capturaron en una hoja de clculo Excel y se analizaron con estadstica descriptiva con el programa SPSS versin 17.0. Fundamentndoseenlasiguientefrmula:
No.bovinosseropositivos Prevalencia= Totaldebovinosmuestreados

RESULTADOSYDISCUSIN

111

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

EncuantoalosresultadosdelapresenciadeanticuerposcontraBoHV1,engeneralfue de57.6%(IC95%:49.165.7)seobservaelevada,puesdelos144animalesmuestreados, 83 resultaron positivos a la prueba de ELISA, esto se asemeja ms a lo obtenido por Shomeet.al, (1997) de89% de seroprevalencia en bfalos de agua en la India. Sin embargo,tambinenlaIndia,enlaactualidadseharepetidolatcnicaenotrostrabajos donde reportan: Sureshet al. (1999) un 38.01%, Chinchkaret al. (2002) hasta 32.26%, Dhandet al. (2002) el 28.76%, Sarumathiet al. (2002) un 27.4%, adems deRaghuvanshiyKumar(2003)el22.22%deseropositividad.Sindudaenestetrabajono coincidenlosresultadosyestopuedadebersealasdiferenciasentreclimas,manejodel hato,entreotras.

CUADRO1.SeroprevalenciadeanticuerposcontraBoHV1porunidaddeproduccinen bfalosdeagua(Bubalusbubalis)deVeracruz,Mxico. UP No.De No.De No.De Prevalencia muestras positivos negativos (%) 7 6 1 4.1 IC(95%)

El Cubilete Los Arcos La Ilama El Bfalo La Granja Total

(1.79.2)

42

38

26.3

(19.53.4) (12.3 25.5)

56

26

30

18

34

11

23

7.6

(413.5)

1.3

(0.25.4) (49.1 65.7)

144

83

61

57.6

SelograverladiferenciaentrelaunidaddeproduccindeLosArcosconelrestodeellas, puesentreellassetienendiferentesmanejos.EnLosArcos,lamayoradelosanimales muestreadosfueronhembrasyyaenestadoreproductivo.

112

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CUADRO2.SeroprevalenciadeanticuerposcontraBoHV1poredaddebfalosdeagua (Bubalusbubalis)enVeracruz,Mxico. Edad (meses) 012 24 36 48 60 72 >84 Total No.De No.De No.De Prevalencia muestras positivos negativos (%) 14 41 40 2 5 20 22 144 7 8 22 2 4 19 21 83 7 33 18 0 1 1 1 61 4.8 5.5 15.2 1.3 2.7 13.1 14.5 57.6 IC(95%)

(2.110.1) (2.611) (1022.4) (0.25.4) (0.87.4) (8.320) (9.421.6) (49.1 65.7)

De acuerdo a la edad, es visible que los animales de 36 meses de edad son los que poseen mayor seroprevalencia, y esto es debido a que la mayora de los animales muestreadosfueronhembrasainiciodelagestacinobubillassingestar.Aunquenose encuentranestudiosenlosqueespecficamenteanimalesdeestaedadpresentenmayor seroprevalencia. Adems de que animales mayores de 72 meses resultan tambin con seroprevalenciaalta,loquepuederesultarunriesgoparaelrestodelhato,yseanellos losqueestncontagiandoalresto.

113

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CUADRO 3. Seroprevalencia de anticuerpos contraBoHV1 por etapa reproductiva en bfalosdeagua(Bubalusbubalis)deVeracruz,Mxico. Etapa No.De No.De No.De Prevalencia reproductiva muestras positivos negativos (%) Bucerro Destetado Semental Bubilla(s/g) 1Parto Gestante 1er 2Partos 35Partos >5Partos Total 144 83 61 57.63 13 2 6 48 14 19 2 7 2 6 12 8 9 2 6 0 0 36 6 10 0 4.86 1.38 4.16 8.33 5.55 6.25 1.38 IC(95%)

(2.110.1) (0.25.4) (1.79.2) (4.514.4) (2.611) (3.011.8) (0.25.4) (17.7 32.2) (0.25.4) (49.1 65.7)

38 2

35 2

3 0

24.30 1.38

CONCLUSIONES SellegaalaconclusindequeenelsurdeVeracruz,queeslazonadondemayormente se encuentra a modo de explotacin el bfalo de agua, existe la presencia de animales conanticuerposcontraelHerpesvirusBovinoTipo1enmsdel50%delapoblacin.Ylo resaltante en esta investigacin es que los animales nunca han sido vacunados contra este virus por lo que se piensa que los animales s estuvieron en contacto con el patgeno.Alresultarestoposible,seconsideraquelosbfalospudieranresultarunfactor de riesgo para elresto delosanimales quese explotan en la zona, como es el ganado vacuno. Adems de que resulten estos animales como portadores del virus y se encuentrendiseminndolo.Porloqueunaconsideracindespusdelpresenteestudioes exhortaralasautoridadespertinentesaestablecercalendariosdevacunacinoproponer

114

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

un sistema de manejo mediante el cual el ganado vacuno y el bufalino no se exploten juntosysetengauncontroldedichaenfermedad.Ascomotambin,serecomiendadar continuidadaltrabajodeinvestigacinyevaluarfactoresderiesgoyampliareltamaode muestraenlazona.

REVISINLITERARIA Bandyopadhyay,S.,Chakraborty,D.,Sarkar,T.,Pal,B.,Sasmal,D.,Biswas,T.K.,Ghosh, M.K.,Sarkar,M.,2009.Aserologicalsurveyofantibodiesagainstbovineherpesvirus1in yak(Poephagusgrunniens)inArunachalPradeshinIndia.Rev.Sci.Tech.28,10451050. Cantu, A., OrtegaS JA, Mosqueda, J., GarciaVazquez, Z., Henke, S.E., George, J.E., 2008. Prevalence of infectious agents in freeranging whitetailed deer in northeastern Mexico.J.Wildl.Dis.44,10021007. Chinchkar,S.R.Deshmukh,V.V.AbdulazizandGujar,M.B.(2002).Seroprevalenceof IBRinMaharashtrastate.IndianVet.J.79:6869. Chow, T.L., 1972. Duration of immunity in heifers inoculated with infectious bovine rhinotracheitisvirus.J.Am.Vet.Med.Assoc.160,5154. Cordova,L.D.2003.Enfermedadesqueprovocanabortoenbovinos.InstitutoNacionalde InvestigacionesForestales,AgrcolasyPecuarias.Mexico.FolletoTcnico.50pp. Dhand,N.K.Singh,G.Sharma,D.R.andSandhu,K.S.(2002).SeroprevalenceofIBR inPunjab.IndianJ.Anim.Sci.72:850852. Intisar,K.S.,Ali,Y.H.,Khalafalla,A.I.,Mahasin,E.A.,Amin,A.S.,2009.Naturalexposure of Dromedary camels in Sudan to infectious bovine rhinotracheitis virus (bovine herpes virus1).ActaTrop.111,243246. Jain, V. Parihar, A. K. Upadhayay, A. K. and Kumar, M. (2006).Seroprevalance of IBR amongbovinesofGarwalregion.IndianVet.J.83:340342. Nuotio,L.,Neuvonen,E.,Hyytiainen,M.,2007.Epidemiologyanderadicationofinfectious bovinerhinotracheitis/infectiouspustularvulvovaginitis(IBR/IPV)virusinFinland.ActaVet. Scand.49,3.

115

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Raghuvanshi, S. and Kumar, M. (2003).Seroepidemiological investigation of infectious bovinerhinotracheitis in cattle and buffaloes using AvidinBiotin ELISA. "Xth AnnualConference of IAAVR and National Symposium on "Challenges and strategies
th forSustainableAnimalProductioninMountains"andIndianVeterinaryCongress"4 Vetex

2003"heldatVeterinaryCollege,CSKHPKVV,Palampur,April1415. Radostits, O.M., Gay, C.C., Blood, D.C., Hinchcliff, K.W. 2002.Medicina veterinaria, tratado de las enfermedades del ganado bovino, ovino, porcino, caprino y equinos. 9o edicin,volumenII,EditorialMcGrawHillInteramericana,1920p. Rajkhowa, S., Rajkhowa, C., Rahman, H., Bujarbaruah, K.M., 2004. Seroprevalence of infectious bovine rhinotracheitis in mithun (Bosfrontalis) in India.Rev. Sci. Tech. 23, 821 829. Rissi, D.R., Pierezan, F., Silva, M.S., Flores, E.F., de Barros, C.S., 2008. Neurological disease in cattle in southern Brazil associated with Bovine herpesvirus infection. J. Vet. Diagn.Invest20,346349. Sarumathi, C. Reddy, T. V. and Sreedevi, B. (2002).A study on seroepizootiology of infectiousbovine rhinotracheitis in Andhra Pradesh.Indian J. Comp. Microbiol.Immunol. Infect.Dis.23:153155. Shome,B.R.RajeswariShomeandShrivastava,N.(1997).Seroprevalenceofantibodies toBHV1incattleofAndaman.IndianVet.J.74:734736. Suresh,K.B.Sudharshana,K.J.andRajasekhar,M.(1999).Seroprevalenceofinfectious bovinerhinotracheitisinIndia.IndianVet.J.76:59. Woodbine,K.A.,Medley,G.F.,Moore,S.J.,RamirezVillaescusa,A.M.,Mason,S.,Green, L.E.,2009.Afouryearlongitudinalseroepidemiologicalstudyofbovineherpesvirustype1 (BHV1)inadultcattlein107unvaccinatedherdsinsouthwestEngland.BMC.Vet.Res.5, 5.

116

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 20) PREVALENCIA DE Cryptosporidium spp. EN BECERROS DE DOBLE PROPSITOENDOSMUNICIPIOSDELCENTRODEVERACRUZ,MXICO.

PREVALENCEOFCryptosporidium spp.INCALVESOFDUALPURPOSEINTWO COUNTIESOFCENTRALVERACRUZ,MEXICO.


1 1 1 AnaLauraLunaEspinosa ,DoraRomeroSalas ,VioletaT.PardoSedas , 2 ZeferinoS.GarcaVzquez 1

FacultaddeMedicinaVeterinariayZootecnia.UniversidadVeracruzana.Circunvalacin S/N Esq. Ynez Colonia Unidad Veracruzana, Veracruz, Mxico, ana_lunaespinoza@hotmail.com*autorparacorrespondencia 2 Centro Nacional en Investigacin Disciplinaria en Parasitologa Veterinaria. Jiutepec, Morelos,Mxico. RESUMEN ElobjetivodelpresentetrabajofuedeterminarlaprevalenciadeCryptosporidiumspp.en becerros de siete a 65 das de edad en dos unidades de produccin (UP) de doble propsitoubicadosenBocadelRoyTlalixcoyan,Veracruz,Mxico.Sediseounestudio epidemiolgico. El perodo de estudio comprendi de Septiembre de 2010 a Mayo de 2011. Se aplic una encuesta general y una individual para la obtencin de datos, los cualesfueroncapturadosenunabasededatos,secalcularonlosintervalosdeconfianza conun95%deconfiabilidad.Secolectaronhecesdirectamentedelrectodecadaanimal, y se procesaron por la tcnica de Faust y Kinyoun para la identificacin de ooquistes mediante microscopa. Se presentan las prevalencias de ste trabajo, la general fue de 42%(21/50)(IC95% 28.456.7),laprevalenciaporUPfuede40%(IC95% 21.861.1)parael rancho en Boca del Ro y de 44% (IC95% 25.064.7) para el rancho en Tlalixcoyan. La prevalencia por estrato fue mayor en el rango de 65 das de edad (66.6%). Las prevalencias por sexo fue, en Boca del Ro: hembras 47.0% y machos un 25.0%, en Tlalixcoyan: hembras 25.0% y machos 52.9%. Se concluye que la prevalencia de

Cryptosporidiumspp.esaltayseencuentrapresenteenlosbecerrosdeambossexosen
lasdosunidadesdeproduccinestudiadasyquedebedeconsiderarsesucontrolconun manejosanitariointegral. Palabrasclaves:Criptosporidiosis,neonatos,ranchos,doblepropsito.

117

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ABSTRACT The objective of this study was to determine the prevalence of Cryptosporidium spp. in calvesfromsevento65daysofageintwodualpurposeproductionunits(UP)locatedin Boca del Rio and Tlalixcoyan, Veracruz, Mexico. The study was carried out from September 2010 to May 2011. A general and an individual survey were applied to UP managerstoobtainpreliminarydata,whichwerecapturedandprocessedinadatabase, consideringconfidenceintervalsof95%.Thefeceswerecollecteddirectlyfromtherectum of each animal and analyzed with the Faust and Kinyoun techniques for identification of

Cryptosporidium oocysts. The general prevalence was 42% (95% CI 28.456.7)


prevalenceperUPwas40%(95%CI21.861.1)inBocadelRioand44%(95%CI25.0 64.7) in Tlalixcoyan. The prevalence was higher in the 65 days of ageclass (66.6%). Prevalence by sex was in Boca del Rio: females 47.0% and males 25.0% and in Tlalixcoyan: females 25.0% and males 52.9%. We conclude that the prevalence of

Cryptosporidiumspp.ishighandispresentincalvesofbothsexesinthetwostudiedUPs
andthatitscontrolshouldbeusingacomprehensivehealthmanagement.

Keywords:Cryptosporidiosis,neonates,ranches,dualpurpose

INTRODUCCIN Las parasitosis son uno de los principales problemas que afecta al sector pecuario del pas(Dazetal.,2008).Elimpactodirectodelasparasitosisgastrointestinalesprovocan grandesprdidassobrelaproduccinbovina,especialmenteduranteelperodoneonatal, debidoaquetieneunefectonegativoenelmetabolismoycomportamientoproductivode losanimales(NydamyMohammed,2005Dazetal.,2008). La criptosporidiosis es una parasitosis interna de distribucin cosmopolita reconocida comounazoonosis(Fayer,2010),causadaporprotozoariosdelgneroCryptosporidium spp. (Dillinghamet al., 2002), que se desarrolla y coloniza en las clulas epiteliales del tractodigestivoyrespiratorio,causandosndromegastrointestinaladiferentesmamferos (bovinos,ovinos,caprinos,cerdosyequinos)incluyendoalhombre(Castilloetal.,2009

118

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Fayer,2010).Enelganadobovinosehanreconocido14especiesaceptadasdelgnero

Cryptosporidium(Xiaoetal.,2004Caccietal.,2005Fayeretal.,2010),siendolosms
comunesC.parvumyC.bovisquehabitaenelbordedelasvellosidadesdelintestinoy

C.andersonienelabomaso(Xiaoetal.,2004).Esteprotozoarioesunparsitopatgeno
que tiene la capacidad de impactar negativamente en el perodo neonatal, principalmente,ocasionadeshidratacinasociadacondiarrea,clicoycomplicacionesde diversasetiologas,pudiendoocasionarlamuerte(Romeroetal.,2001).Apesardequela infeccin por C. parvum y C. bovis se encuentra ampliamente distribuida en el ganado bovino, los datos sobre prevalencia muestran variaciones, las cuales podran estar relacionadas con la edad de los animales, el manejo, el sistema de explotacin, los factores epidemiolgicos y sanitarios, la zona geogrfica de estudio, asimismo por el nmero de muestras analizadas por animal y la historia natural y/o clnica del rebao (Careyetal.,2004Daz,2008Pauletal.,2009). EldiagnsticodelainfeccinporCryptosporidiumspp.sepuederealizarpormtodosde inmunofluorescencia indirecta e inmunoensayo enzimtico (ELISA) para la identificacin morfolgica de los ooquistes (Castillo et al., 2009). El objetivo de sta investigacin fue determinarlaprevalenciadeCryptosporidiumspp.enbecerrosdesietea65dasdeedad en ranchos ganaderos de doble propsito ubicados en Boca del Ro y Tlalixcoyan, Veracruz,Mxico. MATERIALESYMTODOS Se realiz un estudio epidemiolgico en dos unidades de produccin, el primero perteneciente al municipio de Boca del Ro y el segundo ubicado en Tlalixcoyan, Veracruz.Seformaron2grupos,con25becerrosencadaunidaddeproduccin,dando una n=50. La toma de muestra se realiz por una sola ocasin en el mes de marzo del ao en curso. Se aplicuna encuesta general por Unidad de Produccin, as como una individual por becerro muestreado. Se colectaron heces directamente del recto de los animales con una bolsa de polietileno identificada, las cuales se transportaron en una hieleraallaboratoriodeparasitologadelaPostaZootcnicaTorrendelMolinodonde fueron procesadas. Las heces fueron analizadas por la tcnica de flotacin (Faust) con sulfato de zinc al 44% para la concentracin de ooquistes posteriormente se realizaron frotis del sedimento de las heces para luego teirlas por la tcnica de Kinyoun para la identificacin de ooquistes de Cryptosporidium spp. mediante microscopa 100x. Se considerlamuestrapositivaalobservaralmenosunooquistededichoprotozoario.Los

119

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

datosobtenidosseanalizaronatravsdeestadsticadescriptivaconelprogramaSPSS Ver. 17.0. As tambin se determinaron las diferencias entre los diversos grupos con x2 (p<0.05)ysecalcularonlosintervalosconun95%deconfianza.

RESULTADOSYDISCUSIN De 50 becerros muestreados, analizados con la tcnica de Kinyoun, se obtuvieron 21 animales positivos a criptosporidiosis dando una prevalencia general de 42%. La distribucindelasprevalenciaspormunicipiofuemayorenTlalixcoyancon44%(Cuadro 1).

Cuadro1.PrevalenciadelmunicipiodeBocadelRoyTlalixcoyanporlapruebade Kinyoun Prevalencia Negativos (%) 15 14 29 40 44 42

Municipio BocadelRo Tlalixcoyan Total

Total 25 25 50

Positivos 10 11 21

IC(95%) 21.861.1 25.064.7 28.456.7

A pesar de que la infeccin por Cryptosporidium spp. se encuentra ampliamente distribuida en el ganado bovino, los datos sobre prevalencia muestran variaciones, las cualespodranestarrelacionadasconlaedaddelosanimalesyelmanejozoosanitario. ste resultado fue similar a lo reportado por Hernndez (2010), quien encontr una prevalencia de 39.4% (30/76) en hatos de becerros de doble propsito, en el estado de Trujillo,Venezuela,utilizandolamismatcnica.Porotrolado,staprevalenciaresultoalta en relacin a la reportada por Aguilar (2007), quin reporta una prevalencia para el municipiodeTlalixcoyande13%enganadodecarne. LaexcrecindeooquistesdeCryptosporidiumspp.estaltamenteasociadaconlaedad de los animales. La prevalencia por rango de edades para ambas unidades de produccin,enelprimerestratoquecomprendeunaedadde715dasseencontruna

120

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

prevalencia baja, muy diferente al caso de los otros dos estratos (30 y 65 das) en los cualesseencontrunaprevalenciamsalta(Cuadro2). Cuadro 2. Prevalencia de Cryptosporidium spp. en relacin a la edad de los becerros Edad (das) 7a15 30 4060 65 TOTAL No. muestras 12 10 19 9 50 Positivos 2 6 7 6 21 Negativos 10 4 12 3 29 Prevalencia (%) 16.67 60.00 36.84 66.67 45.04 IC(95%) 2.949.1 27.386.3 17.261.3 30.990.9 28.456.7

Estos resultados indican que los becerros pudieron haber adquirido la infeccin en los primeros das de edad, debido a la presencia deooquistes enel rea de manejo o bien por la convivencia con las madres, ya que son consideradas una fuente potencial de infeccin.Sinembargo,enesteestudiolosbecerrosmssusceptiblescorrespondenalos estratosde30das,de4060dasy65das.

CONCLUSIN LaprevalenciadeCryptosporidiumspp.esaltayseencuentrapresenteenlosbecerros de ambos sexos, siendo ms susceptibles aquellos animales que pertenecen a los estratosde30y65das,paraambasunidadesdeproduccinestudiadasyquedebede considerarsesucontrolconunmanejosanitariointegral.

LITERATURACITADA Aguilar, B. G., S. D. Romero., H. D. I. Martnez., 2007. Prevalencia de Cryptosporidium

spp.,ensistemasganaderosdecarneenelcentrodeVeracruz,Mxico.XXReunin
CientficaTecnolgicaForestalyAgropecuariaVeracruz,IXSimposioInternacionaly IVCongresoNacionaldeAgriculturaSostenible.pp.17.

121

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Cacci, S. M., R. C. A. Thompson., J. Mc Lauchlin., H. V. Smith., 2005. Unravelling

CryptosporidiumandGiardiaepidemiology.TrendsParasitol.21:430437.
Carey, M. C., H. Lee., J. T. Trevors., 2004. Biology persistence and detection of

Cryptosporidium parvum and Cryptosporidium hominis oocyst. Water Research


38:818862. Castillo,G.C.,V.C.Cruz.,R.R.Lpez.,G.M.Snchez.,C.R.Rosario.,M.I.Vitela.,E. L. Medina., 2009. Frecuencia e identificacin molecular deCryptosporidium spp en becerras lactantes mantenidas en confinamiento en Aguascalientes, Mxico. Tc. Pecu.Mx.47(4):425434. DazdeR.A.,I.L.Ramrez.,A.Barreto.,N.Aldana.,E.Linares.,2008.Prevalenciadela infeccinporprotozoariosintestinalesenbecerrosdeganaderalecheraydedoble propsitodeloccidentedeVenezuela.MundoPecuario,IV(1):1521. Dillingham, A. R., A. A. Lima., B. Lima., L. R. Guerrant., 2002. Cryptosporidiosis: epidemiologyandimpact.MicrobesandInfection4:10591066. Fayer, R., 2010. Taxonomy and species delimitation in Cryptosporidium. Experimental Parasitology124:9097. Hernndez, G. N., 2010. Prevalencia y factores de riesgo de Cryptosporidium spp. y Giardia spp. en terneros de ganadolecherode la zona noroccidental dela sabana de Bogot. Universidad nacional de Colombia Facultad de Medicina Departamento deSaludPblicaBogot,d.c.Tesis:1112. Nydam, D. V., and H. O. Mohammed., 2005. Quantitative Risk Assessment of CryptosporidiumSpeciesInfectioninDairyCalves.J.Dairy.Sci.88:39323943. Romero,M.R.,R.H.Pedrozo.,E.Vera.,2001.LaCriptosporidiosisenlosternerosrecin nacidos. Su etiologa, patogena, sntomas, tratamiento y profilaxis. Revista de ciencia y Tecnologa direccin de investigaciones UNA. Facultad de Ciencias Veterinarias,UniversidadNacionaldeAsuncin,Paraguay.1(3).110. Paul,D.,D.Chandra.,A.K.Tewari.,P.S.Banerjee.,D.D.Ray.,O.K.Raina.,J.R.Rao., 2009.PrevalenceofCryptosporidiumandersoni:Amolecularepidemiologicalsurvey amongcattleinIndia.Vet.Parasitol.161:3135. Thrusfield, M., C. Ortega., I. De Blas., J. P. Noordhuizen., K. Frankena., 2005. Win Episcope 2.0: improved epidemiological software for veterinary medicine. Vet Rec. 148:567572. Xiao, L., R. Fayer., U. Ryan., S. J. Upton., 2004. Cryptosporidium taxonomy: recent advancesandimplicationsforpublichealth.Clin.Microbiol.Rev.17:7297.

122

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 21) CONTROL INTEGRADO DE Boophilus microplus Y LA MITIGACION DE LARESISTENCIAALOSACARICIDASENELESTADODEGUERRERO,MXICO. Integrated pest management for control of cattle tick infestations and acaricide resistancemitigationatGuerreroState,Mxico .
1 2 2 *RodrigoRosarioCruz ,DeliaInsDomnguezGarca , ElasHernndezCastro ,Isidro 3 4 4 GutirrezSegura ,FernandoTorresAgatn ,EmilianoFitzSnchez . 1

CENID PAVET INIFAP, Jiutepec, Morelos, Mxico. 62550. 2Maestra en Sistemas de Produccin Agropecuaria de la UAG. Unidad Tuxpan. Iguala, Guerrero. C.P. 40000. 3 Universidad Autnoma de Guerrero de la FMVZ. Unidad Costa Chica. 4Universidad AutnomadeGuerrerodelaFMVZ.UnidadAltamirano. *Autordecorrespondenciarockdrig@yahoo.com.mx RESUMEN

Boophilus microplus representa una de las plagas mas importantes de la ganadera


bovina porque ocasiona grandes prdidas econmicas, en las regiones tropicales y subtropicales del mundo. Por esta razn el uso de acaricidas para el control de las infestacionesporgarrapatas,hasidolaherramientafundamental,loquehatradocomo consecuencia la aparicin de la resistencia mltiple hacia toda clase de compuestos de sntesis qumica. Adems de la resistencia a los acaricidas, otras desvenajas son: la contaminacin ambiental, alimentaria y el riesgo para la salud humana que representa para quienes aplican los productos. Se inmunizaron 40 bovinos y 10 se utilizaron como testigossinvacunar,fueronmonitoreadosdurante6meses,seevaluaronlosparmetros reproductivos de las garrapatas colectadas en bovinos vacunados y no vacunados observandose una reduccin del potencial bitico de un 86%. El uso de programas de control integrado utilizando combinaciones de mtodos qumicos con esquemas de vacunacin,representanunaalternativaviableparautilizardemaneraracionalelrecurso de los pesticidas, reducir el impacto ambiental, retardar la aparicin de la resistencia y disminuir la contaminacin de los productos para consumo humano con residuos de pesticidas.

Palabrasclave:Garrapatas,Vacunas,acaricidas,resistencia.

123
ABSTRACT

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Boophilus microplus is one of the most important pests of cattle, since it causes great
economiclossesintropicalandsubtropicalregionsallovertheworld.Forthisreasonthe use of acaricides to control tick infestations has been the most important tool However, thistickcontrolmethodhasresultedintheemergenceofmultipleresistancetoallkindsof synthetic chemical compounds. In addition use of chemicales represents some other inconveniences such as: environmental pollution, food contamination and human health riskstopersonswhousetheproducts.40bovineswereimmunizedand10wereusedas controls without vaccination, cattle was monitored for 6 months, and reproductive parameters of ticks collected were evaluated fromvaccinated and unvaccinated cattle, a significant reduction (86%) in biotic potential was observed. The use of integrated pest programs using combinations of chemical methods with vaccination schedules, will representaviablealternativetotheuseofpesticides,reductionofenvironmentalimpact, delaying acaricides resistance and reduce the contamination of products for human consumptionwithpesticideresidues. Keywords:Ticks,Vaccines,acaricides,resistance.

INTRODUCCIN La garrapata Boophilus microplus, se distribuye en las regiones tropicales y subtropicales delmundo (EstadaPeaetal., 2006). Lasinfestacionesde ganado porB.

microplusocasionangrandesprdidaseconmicasporlosdaosdirectosqueoriginanlas
picaduras, la irritacin, el estrs, el debilitamiento de los animales, las prdidas en la produccin de leche, carne y cuero y por los daos indirectos causados por la transmisin de la anaplasmosis y la babesiosis bovina, enfermedades que tambin producen efectos econmicos considerables debido a los gastos para su tratamiento (Jonssonetal.,2008). El mayor inconveniente asociado al uso de acaricidas qumicos, se debe principalmente, a que favorecen el desarrollo de poblaciones de garrapatas resistentes, adems de ser una estrategia muy costosa (George et al., 2004). Por lo que la disponibilidad de los acaricidas qumicos para el control de las garrapatas, es cada vez menor debido a los altos costos de su desarrollo y a los problemas de resistencia que limitansueficacia(Grafetal.,2004).

124

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Comoconsecuencia,lavidatildelospesticidasenalgunasregionesdelnortede Mxicosehareducidoaungradotalqueyanorepresentanunaalternativadecontrol,y nuevos enfoques han sido utilizados para la bsqueda de nuevos candidatos inmungenos potencialmente tiles para el control de las poblaciones de B. microplus (Almazanetal.,2010). Histricamente el estudio de las protenas tiles de garrapatas para efectos de desarrollar inmungenos, han sido los antgenos que participan en la interfase hospedadorparsito y que actualmente estn siendo redescubiertos a partir del anlisis de los mapas protemicos de la saliva. Sin embargo las evidencias biolgicas de la interaccin entre la garrapata y su hospedador, no parece arrojar evidencias circunstancialesdeproteccinyaquesoloinfestacionesmasivasinducenunarespuesta inmunesolodespusderepetidasinfestaciones(DelaFuenteetal.,2003Delafuenteet

al.,2007).
Elfactorlimitantemsimportanteeneldesarrollodelasvacunascontragarrapatas eslaidentificacindelosantgenos,yaquetradicionalmentesehanidentificadomediante la evaluacin de protenas derivadas de extractos crudos utilizados para inmunizar animalesquesonsometidosposteriormenteainfestacionesexperimentalesmasivascon garrapatas (Kimaro y Opdebeeck, 1994). La purificacin de una protena a partir de un extracto totales un proceso largo ylaborioso, porlo que enla actualidad, el uso de las bases de datos conteniendo los genomas facilitan el proceso reverso de determinar la funcin putativa de los genes de inters y observar el efecto de la inmunizacin con protenas consideradas importantes para la funcin y sobrevivencia en experimentos de vacunacincontragarrapatas(Nuttalletal.,2006). Eldesarrollodevacunasquehatenidomsxito,sonlasvacunasquehan sidoderivadasdelosintestinosdelagarrapata(delaFuenteetal2007),apartirdelos cualessehananalizadolasprotenasancladasalamembranadelasclulasintestinales, losejemplosclsicossonlasvacunasTickgard(Odongoetal.,2009)yGavac(Vargaset

al.,2010)elaboradasapartirdelosgeneshomlogosdeunacepaaustralianaycubana
respectivamente denominados como Bm86, el cual fue utilizado en Argentina con el nombredeBm95.

125

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

La identificacin del antgeno Bm86 y posteriormente el Bm95 en clulas intestinalesdelagarrapataB.microplussonelprimerejemplodeantgenosutilizadosen vacunasparaelcontroldegarrapatas(Canalesetal.,2009). Larespuestaalavacunacinconestosantgenosproduceanticuerposquealestar en contacto con la garrapata provocan lisis de las clulas intestinales, originando como consecuencialareduccinenlasobrevivenciadelartrpodo,disminucindelpesoydela fertilidad(PerezPerezetal.,2010). Elusodevacunascontralasgarrapatas,sevislumbracomounmtododecontrol que promete, ser una alternativa factible para mejorar la salud animal, abatir la contaminacin ambiental, y mejorar lainocuidad delos alimentos derivados de este tipo deexplotacionesganaderas. Porloanteriorelpresentetrabajoserealizconelobjetivodecuantificaryevaluar los efectos de un programa de manejo integrado delas infestaciones por garrapatas en losparmetrosreproductivosdelagarrapata,talescomo:elpeso,posturadehuevos,el ndice de conversin del peso en masa de huevos y en general la disminucin del potencialbiticodelagarrapataBoophilusmicroplus.

MATERIALESYMTODOS Se seleccion unrancho enla CostaGrande del Estado de Guerrero, del cual se realiz un muestreo de garrapatas para determinar la susceptibilidad a los plaguicidas convencionales. Se seleccionaron 50 animales, los cuales fueron previamente tratados conuninhibidordelcrecimiento30dasantesdelaprimeravacunacinenunesquema de control integrado utilizando de manera alternada el inhibidor del crecimiento y la vacuna constituidaporel antgeno Bm86 deuna cepa degarrapatas Mexicana, a 10 de losanimalessoloselesapliceltratamientoconelinhibidordelcrecimientoynofueron vacunados. Los 40 bovinos restantes fueron vacunados a los 1, 30 y 60 das y se realizaron conteos mensuales paraobservar las cargas de garrapatas. Los animales del grupo control fueron tratados con el pesticida que mostr mayor eficacia sobre las garrapatas del rancho y en este grupo de animales solo se trataron aquellos que mostraron cuentas de garrapatas mayores a 20 garrapatas por animal. Se colectaron garrapatasdeambosgruposyseanalizelpesodelashembrasingurgitadasdelgrupo vacunadoysinvacunarasimismoseanalizelpesodelamasadehuevosysecalculel ndicedeconversindelpesoenmasadehuevos.Lasdiferenciasestadsticasentrecada unodelosparmetrosbiolgicossedeterminaronmedianteunapruebadetdeStudent.

126

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RESULTADOS

Durante los conteos regulares no se observaron garrapatas adultas hasta el da 120posterioralaprimeravacunacin,enlacualseobservaroninfestacionesconmsde 50garrapatasporanimalenelgrupovacunado.Durantelos120dasdeproteccincontra lasinfestacionesenelgrupovacunado,nofuenecesarialaaplicacindepesticidasenel grupovacunadolocualrepresentparaelmanejodelranchounahorrode6aplicaciones debaosgarrapaticidasconsiderandoqueelmanejodelranchoincluabaoscada2030 das. Se colectaron garrapatas adultas del grupo vacunado y del no vacunado, los resultados se muestran en el Cuadro 1. Las garrapatas del grupo no vacunadopesaron 6.6vecesmsquelasgarrapatasdelgrupovacunado,yprodujeron45vecesmshuevos quelasgarrapatasdelgrupovacunado.Elgrupovacunadotuvounndicedeconversin delpesoenmasadehuevosdel6.2%mientrasquelasgarrapatasdelgruponovacunado convirtienhuevosel43.97%desupesocorporallocualevidenciaunadisminucindel pesodelashembrasrepletasyrepresentaunadisminucindelpotencialreproductivodel 86% medido en trminos de la conversin de la masa de huevos, como efecto de la vacunacin.

Cuadro1. Parmetros reproductivos de lasgarrapatas colectadas delgrupo de bovinos vacunadosynovacunados. GRUPO Peso/garrapata (mg) Masade huevos/garrapata (mg) ndicede conversin delpesoen masade huevos 0.062 0.4397 Reduccin demasade huevos(%)

VACUNADO NO VACUNADO

25.858 16617

1.62(2.21%) 7314(100%

14 100

127

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

DISCUSINYCONCLUSIONES

El uso de mtodos inmunolgicos y mtodos qumicos representa una alternativa viable para el control de las garrapatas cuando se utiliza en un esquema de control integrado en combinacin con pesticidas inhibidores del crecimiento. El tratamiento aplicadonospermitimantenerinfestacionesmenoresa10garrapatasporanimal,locual consideramosquerepresentaunaventajadeltratamiento,considerandolanecesidadde mantenerlaestabilidadenzooticadelhato.Comoconsecuenciadeladisminucindelas infestaciones la probabilidad de infeccin por enfermedades transmitidas por garrapatas disminuye de manera proporcional si se mantienen controladas las poblaciones de garrapatasenelrancho.Elusodeestrategiascombinadasdepesticidasyvacunascontra garrapatas adems de disminuir el uso de los pesticidas, retardan la aparicin de la resistencia. Con base en los resultados, el control inmunolgico en combinacin con el uso apropiado de los pesticidas reducir significativamente: la presin de seleccin de los genesderesistenciaalospesticidas,alargarlavidatildelospesticidasenlasregiones en las cuales la resistencia es aun incipiente y en consecuencia se evitar la contaminacin de la carne, de la leche, del agua y del suelo, ya que utilizando una estrategia de control integrado se dejaron de aplicar 8 baos durante este periodo de 4 meses y una reduccin en el potencial reproductivo del 86% medido en trminos de la capacidad de producir huevos, manteniendo en niveles muy bajos las poblaciones de garrapatas ya que las garrapatas del grupo vacunado solo produjeron el 6.2% de los huevosqueproduceunagarrapatadelgruponovacunado. Elusodeunaestrategiadecontrolintegradodisminuylapoblacindegarrapatas significativamentedurante120dasenlosquenoseutilizningnpesticidaenelgrupo vacunado,nohubomortalidadasociadaconenfermedadestransmitidasporgarrapatas,y sedejarondeaplicardurante120dasporlomenos6baosgarrapaticidas.

AGRADECIMIENTOS

128

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Al Programa de Fondos Mixtos del Estado de Guerrero por el financiamiento otorgado paralaejecucin y presentacin de los resultadosparciales de este estudio al travs del convenio No. 92367 otorgado al Dr. Rodrigo RosarioCruz. Especial agradecimientoalasasociacionesganaderas,regionalesylocalesdeCoyucadeBentez, Cuajinicuilapa,yCd.AltamiranoGuerrero,yalosproductoresparticipantesenelestudio. AlaUAMyalCONACYTporlabecadoctoraldelaMCDeliaInsDomnguezGarca.

LITERATURACITADA

Almazn, C. Lagunes, R. Villar, M. Canales, M. RosarioCruz, R. Jongejan, F. de la Fuente, J. 2010. Identification and characterization of Rhipicephalus (Boophilus)

microplus candidate protective antigens for the control of cattle tick infestations.
ParasitologyResearch.106(2):4719. Canales,M.Almazn,C.Naranjo,V.Jongejan,F.delaFuente,J.2009.Vaccinationwith recombinant Boophilus annulatus Bm86 ortholog protein, Ba86, protects cattle againstB.annulatusandB.microplusinfestations.BMCBiotechnology.319:29. de la Fuente J, Kocan, K.M. 2003. Advances in theidentification and characterization of protective antigens for development of recombinant vaccines against tick infestations.ExpertReviewofVaccines.2:58393. de la Fuente, J., Kocan, K.M., Blouin, E.F. 2007. Tick vaccines and the transmission of tickbornepathogens.VeterinaryResearchCommunications.31(SUPPL.1):8590. EstradaPea,A.Bouattour,A.Camicas,J.L.Guglielmone,A.Horak,I.Jongejan,F.Latif, A. Pegram, R. Walker, A. R. 2006. The known distribution and ecological preferences of the tick subgenus Boophilus (Acari: Ixodidae) in Africa and Latin America.ExperimentalandAppliedAcarology.38:219235. FAO (Organizacin delas Naciones Unidasparala Agricultura yla Alimentacin). 2003. Resistencia a los antiparasitarios. Estado actual con nfasis en America Latina. SerieProduccinAnimalySanidadAnimal.No157.FAO.Roma.51. FAO(OrganizacindelasNacionesUnidasparalaAgriculturaylaAlimentacin).2009.El estadomundialdelaagriculturaylaalimentacin.Roma,Italia.86113.

129

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

George,J.E.,Pound,J.M.,Davey,R.B.2004.Chemicalcontrolofticksoncattleandthe resistanceoftheseparasitestoacaricides.Parasitology.129Suppl:S35366. Graf, J.F. Gogolewski, R. LeachBing, N. Sabatini, G. A. Molento, M. B. Bordin, E. L. Arantes, G. J. 2004. Tick control: an industry point of view. Parasitol 129:S427 S442. Jonsson, N.N. Bock, R .E., Jorgensen, W. K. 2008. Productivity and health effects of anaplasmosis and babesiosis on Bos indicus cattle and their crosses, and the effects of differing intensity of tick control in Australia. Veterinary Parasitology. 155:19. Kimaro, E. E. Opdebeeck, J. P.1994. Tick infestations on cattle vaccinated with extracts from the eggs and the gut of Boophilus microplus. Veterinary Parasitology. 52(1 2):6170. Nuttall, P.A., Trimnell, A.R., Kazimirova, M., Labuda, M. 2006. Exposed and concealed antigens as vaccine targets for controlling ticks and tickborne diseases. Parasite Immunology.28(4):15563. Odongo, D., Kamau, L., Skilton, R., Mwaura, S., Nitsch, C, Musoke, A., Taracha, E., Daubenberger, C., Bishop, R. 2007. Vaccination of cattle with TickGARD induces crossreactiveantibodiesbindingtoconservedlinearpeptidesofBm86homologues inBoophilusdecoloratus.Vaccine.25(7):128796. PerezPerez, D. Bechara, G. H. Machado, R. Z. Andrade, G. M. Del Vecchio, R.E. Pedroso, M. S. Hernndez, M.V. Farns, O. 2010. Efficacy of the Bm86 antigen against immature instars and adults of the dog tick Rhipicephalus sanguineus (Latreille,1806)(Acari:Ixodidae).VeterinaryParasitology.10167(24):3216.

RosarioCruz,R.Almazn,C.Miller,R.J.DomnguezGarca,D.I.HernandezOrtiz,R.de laFuente,J.2009.Geneticbasisandimpactoftickacaricideresistance.Frontiers inBioscience.14:26572665. Vargas, M., Montero, C., Snchez, D., Prez, D., Valds, M., Alfonso, A., Joglar, M., Machado, H., Rodrguez, E., Mndez, L.,Lleonart, R., Surez, M., Fernndez, E., Estrada,M.P.,RodrguezMalln,A.,Farns,O.2010.Twoinitialvaccinationswith the Bm86based Gavacplus vaccine againstRhipicephalus (Boophilus) microplus

130

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

induce similar reproductive suppression to three initial vaccinations under productionconditions.BMCVeterinaryResearch.6:43.

131

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ22)ALIMENTACIONARTIFICIALENABEJAS(Apismellfera)ENELAPIARIO DE LA FACULTAD DE CIENCIAS BIOLOGICAS Y AGROPECUARIAS CAMPUS TUXPAN

ARTIFICIAL FEEDING IN BEES (Apis mellifera) in the apiary OF THE FACULTY OF BIOLOGICALANDAGRICULTURALCAMPUSTUXPAN

LuisGustavoAguileraBenavides*,PaulaRojasMencio,NormaGabrielaCruzCortez, AmaliaCabreaNuez,JoseLuisSotoLoya,AgustndeJessBasezMuoz

FacultaddeCienciasBiolgicasyAgropecuariasdelaUniversidadVeracruzana,Campus Tuxpan. Carretera TuxpanTampico Km. 7.5 S/N Col. Universitaria. C.P. 92860.Tuxpan, Veracruz,Mxico.Email:mvz_aguilerauv@hotmail.com.*Autorparacorrespondencia. RESUMEN

Lasnecesidadesbiolgicasdelacoloniadeabejasestncubiertasconlarecoleccinde nctar, polen y agua por parte delas obreras. La alimentacin artificial delas colmenas surge como una tcnica apcola que intenta corregir las distorsiones producidas por las cosechasdemielydepolenextradasporelapicultor.Enalgunastemporadasdelao,el recurso floral y el clima son tan agrestes para desarrollar la apicultura, por lo que se tienen que vencer factores climticos adversos y lo ms importante es la alimentacin (Ordoez,2002).Elobjetivodeestetrabajofueevaluarelalimentoartificialabasedeuna composicin de (harina de soya 60 grs., harina de maz 60 grs., leche descremada 25 grs., 5 grs. depolen, azcar y agua 1:1), en forma de torta. El experimento consisti en evaluar5coloniasconalimentacinartificialy5coloniastestigo,durante33dasapartir del18deseptiembrea21deOctubrede2009.Elresultadofueunincrementode15Kg enlosbastidoresenlascoloniasconalimentacinartificial,nohabiendoincrementoenlas testigos. En conclusin la alimentacin artificial es hoy en da una necesidad de suma importancia, ya que a causas delos cambios climticos,los apicultores enfrentan alas sequas, fuertes inviernos que han provocado que el alimento natural sea escaso o a veces difcil de obtener para las abejas, siendo este trabajo una buena opcin para mejoraryayudareneldesarrollodelascoloniasdelosapiario. Palabrasclave:Abejas,alimentacion,artificial,apiario,tuxpan

132

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 23) SINCRONIZACIN DE ESTRO EN OVEJAS DE PELO UTILIZANDO ESPONJASDEFABRICACINARTESANALIMPREGNADASCONMAP. Synchronization of estrus in hair sheep using sponges impregnated with MAP craftsmanship
1

NumaPompilioCastroGonzlez,1EduardoMndezRojas,2JuandeDiosRodrguez

1 Guerrero, MarcelinoBecerrilHerrera,1MarcosPrezSato,1AbelFlixFloresGarrido 1

FacultaddeIngenieraAgrohidrulica

BenemritaUniversidadAutnomadePuebla
2

ColegiodePostgraduados,CampusPuebla RESUMEN

Elobjetivodelpresentetrabajofueevaluarelcomportamientoreproductivodeovejasde pelobajodostiposdesuplementacin(mazyconcentrado)ydosmtodosreproductivos (sincronizadas hormonalmente y efecto macho). Se utilizaron 36 ovejas de pelo cruza katahdin pelibuey. La mitad de las hembras fueron sincronizadas con Acetato de Medroxyprogesterona (MAP: 40 mg) por medio de esponjas de fabricacin artesanal aplicadas va intravaginal y la otra mitad por efecto macho. La alimentacin fue de dos formas: pastoreo con concentrado y pastoreo con maz. El diseo experimental fue completamente al azar con arreglo factorial 2 x 2. Los datos fueron analizados en el programa estadstico SAS mediante el procedimiento PROC ANOVA. Los resultados obtenidos mostraron que la presentacin de celos respondi (P0.0001) al efecto producido por el tratamiento reproductivo, donde las ovejas sincronizadas con MAP presentaronestroalas24.6hderetiradaslasesponjas,contrastandoconlasquefueron sujetasalefectomacho,quetardaronenmostrarcelohastalas186h.Laalimentacinno tuvoefecto(P>0.7)enlapresentacindelestro.Laprolificidadfuemayor(P<0.05)enlas ovejas que consumieron maz como suplemento (1.8 vs 1.3 respectivamente). Se concluyequebajolasformasdealimentacinrealizadasylasincronizacinconhormonas exgenaslapresentacindecelossesincronizadetalformaquepermitelaobtencinde camadashomogneasypermiteprogramarelmanejozootcnico. Palabrasclaves:Esponjas,MAP,ovejas,efectomacho,concentrado. ABSTRACT

133

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Theaimofthisresearchwastoevaluatethereproductiveperformanceofhairewesunder twoformsofsupplementationandtworeproductivemethods.Thirtysixewes wereused. The half of each group was treated with Medroxyprogesterone acetate (MAP: 40 mg) applied through homemade sponges to synchronize estrus, whereas the other half was subject to the male effect. In both groups, two ways of supplementation were applied (concentrategrazing and maizegrazing). The experiment was a 2x2 factor array in a completely randomized design. Data analysis was carried out using the SAS program through the PROC ANOVA procedure. The results showed that estrus presence responded(P<0.0001)totheeffectproducedbythereproductivetreatment,detectingheat at24.6hoursintheewessynchronizedwithMAPafterthespongeswerewithdrawn.This result contrasted with that of the ewes subjected solely to the male effect that lasted in showing heat up to 186 hours. There were effects neither for breed nor feeding factors (P>0.07)inestruspresence.Prolificacywashigher(P<0.05)insheepconsumingcornasa supplement(1.8vs 1.3, respectively). We conclude thatthe forms ofpowerheldand synchronization withthe presentation ofexogenous hormonesjealousyis synchronizedso thatallowstoobtainhomogeneouslayersandallowsthehusbandryprogram.
KEYWORDS:Synchronization,Estrus,MAP,Flushing.

INTRODUCCIN LareproduccindeovinosenMxicoanivelruralsellevaacabodemaneranaturalysin controldecruzamientos(Joyetal.,2008)yesafectadapordiversosfactoresdestacando la alimentacin,laestacionalidad reproductiva y el fotoperiodo (Rosa y Bryant, 2003), el estado sanitario, la etapa fisiolgica y las interacciones machohembra (Gundoganet

al.,2003).
Por lo que la induccin/sincronizacin del estroutilizando hormonas exgenas e interacciones entre sexos como lo es el efecto macho, resultan benficas para obtener paricioneshomogneas, con lotes de corderos uniformes alos que seles puedeaplicar unmanejozootcnicoplaneadoyreducircostosdeproduccin,conellolaproduccinse puedeprogramarllegandoasatisfacerlasnecesidadesdemercado. Tomando en cuenta lo anterior, el presente trabajo tuvo como objetivo, evaluar la respuesta reproductiva de ovejas de pelo cruzas pelibuey katahdina la aplicacin de

134

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

esponjas intravaginales de fabricacin artesanal, impregnadas con Acetato de Medroxiprogesteronacomplementandoconflushingantes,durante,posterioralempadre.


MATERIALESYMTODOS

Localizacin LapresenteinvestigacinserealizenelmunicipiodeTtelesdevilaCastillo,Puebla. Ubicado en la parte Noroeste del Estado de Puebla, coordenadas geogrficas son los paralelos1950'48"y1952'06"delatitudnorteylosmeridianos9723'18"y9726' 42" delongitud occidental, altitud de 1890msnm, clima templado hmedo, temperatura mediaanualde15Cyprecipitacinmediaanualde1269mm,(INEGI,2006). Animales Se utilizaron 32 ovejas de raza indefinida procedentes de la regin de estudio, de pelo (tambin proveniente de cruzas incontroladas de Katahdin pelibuey, tipo gentico que recientemente es utilizado en la regin. El peso vivo promedio fue de 432.6 kg y una edad de 2.5 aos, multparas, de condicin corporal en el rango de 2.53.0. Para el apareamiento de las ovejas se utilizaron 2 machos. Los animales utilizados en el experimentofuerontratadosconunprogramademedicinapreventiva. Diseoexperimental Eltotaldevientresfuedistribuidocompletamentealazarencuatrotratamientos,con8 repeticiones,quedandodelasiguientemanera:T1(n=8)ovejassincronizadasconMAPy alimentadas con concentrado, T 2(n = 8) ovejas sincronizadas por efecto macho y alimentadasconconcentrado,T3(n=8)ovejassincronizadasconMAPyalimentadascon maz,T4(n=8)ovejassincronizadasporefectomachoyalimentadasconmaz.Atodos los tratamientos se les `proporciono 600 g MS. El concentrado proporcionado tena un aporte nutrimental de 14 % de PC y 3.1 Mcal. de energa metabolizable y el maz utilizado9%dePCy3.3Mcal.deenergametabolizable. Manejoreproductivo Lasincronizacindeestrosserealizutilizandoesponjasimpregnadascon40mgMAP, Steven(1990)yfueronretiradasalda12posteriorasuaplicacin(Rubianes,2005).Para lasincronizacinpormediodelefectomacho,seretiroelmachoporuntiempode30das yfuepuestoconlashembrasalmismotiempoqueelgrupodeovejassincronizadascon esponjaselempadrefuecontrolado.

135

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Variablesevaluadas Retencin de esponjas, Porcentaje de estros, Tiempo de presentacin del estro, Fertilidad,Prolificidad,Pesosalnacimiento. Anlisisestadstico Paraelanlisisseutilizoelsiguientemodelo: Yijk =+A i +B j +(AB)ij +Eijk Donde: Yijk=variable respuesta en la repeticin k, nivel J de b, nivel i de A.= Media general.A i =efecto reproductivo.B j =efecto alimenticio.(AB)ij = interaccin del mtodo reproductivo y el mtodo alimenticio.Eijk =Error aleatorio.Elanlisis estadstico se realiz medianteelprocedimientoPROCANOVAutilizandoelprogramaSASversin9.2.

RESULTADOSYDISCUSION No existi diferencia (p0.05) para la variable retencin de esponjas, siendo los resultados obtenidos en este trabajo similares a los reportados por (Espinoza et

al.,1995 Garcaet al., 2007) quienesreportaron el 100% de retencin de esponjas


artesanalesintravaginales.Lapresentacindecelosnofueinfluenciada(P>0.7)porel factor alimentacin. Esta variable respondi nicamente (P 0.0001) al efecto producido por el tratamiento reproductivo. El 100% de las ovejas sincronizadas con MAP presentaron celo en las primeras 24.6 h posteriores a su retiro (Figura 1), contrastando (P<0.05) con las que estuvieron sujetas al efecto macho, las cuales presentaronceloen100%alas186h.enpromedio.ConcentracionesigualesdeMAP han sido utilizadas por Simonettiet al. (2000) en ovejas Merino, reportando un 79.3% depresenciadecelosalas56horas.Existenotrostrabajosenlosquelosporcentajes decelohansidomenorescomoenelcasodeZarkawietal.(1999)quienesreportaron 82% a las 36 y 48 horas posteriores al retiro de las esponjas en ovejas de la raza Awasi..

136

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Figura 1. Presentacin de celos en ovejas sometidas, con esponjas intravaginalesde fabricacinartesanalcon40mgdeMAPyefectomacho. La fertilidad no fue afectada p>0.05 por el mtodo reproductivo, ni por el tipo de suplemento. Los valores que se obtuvieron fueron de 90%. El porcentaje de prolificidad (Figura 2) fueinfluenciado p<0.05por el tipo de suplementacin, siendo de 1.8 paralos animalessuplementadosconmazyde1.30paralossuplementadosconconcentrado

Figura2.Porcentajedeprolificidadenovejassuplementadasconconcentradoymaz.

CONCLUSIONES La sincronizacin de estros en ovejas con esponjas intravaginales de fabricacin artesanal impregnadas con 40 mg de MAP, resulta ser un mtodo eficiente, ya que se

137

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

reduceeltiempoenlapresentacindelcelo,acortandoelintervaloentrepartos.Adems de homogenizar los partos, lo que nos permite la programacin de los eventos productivos. La utilizacin de maz como suplemento tiene mejor efecto en cuanto la prolificidad cuandoseutiliza15dasantesdelparto.
LITERATURACITADA

1. Espinoza RFO. y Esquel DUO.1995. Inseminacinintrauterina en ovejas suffulk. Tesis de licenciatura, departamento de zootecnia, Universidad Autnoma de Chapingo,ChapingoMxico. 2. Garca P R. Castro GNP. Becerril HM. 2007. Tasas de fecundacin en la monta natural e Inseminacin artificial cervical en ovino, tesis de licenciatura, Unidad Acadmica de Ingeniera Agrohidrulica. Programa de Ingeniera Agronmica Y zootecnia.BUAP. 3. Gundogan M.Baki D.Yeni D. 2003. Reproductive seasonality in sheep. ActaAgricScand,SectionA,AnimSci53:175179. 4. INEGI. Anuario estadstico Puebla. Aspectos Geogrficos. Coordenadas Geogrficas y altitud de las cabeceras municipales. 2008. Instituto Nacional de Estadstica, Geografa e Informtica., Serie I. Disponible:

http://www.inegi.gob.mx/est/contenidos/espanol/ Consultado25Sep,2009.

int/nav/aee/08/pue/c21_01.xls.

5. Joy M. AlvarezRodrguez R. Revilla R.Delfa R. Ripoll G. Ewe matabolic performance and lamb carcass traits pasture and concentratebased systems in ChurraTensinabreed.SmallRuminRes200875:2435. 6. RosaHJD.BryantMJ.Seasonalityofreproductioninsheep.SmallRuminRes2003 48:155171. 7. Rubianes E. 2005. Avances en el conocimiento de la fisiologa ovrica de los pequeos rumiantes y su aplicacinpara el manejo reproductivo,Depto.de fisiologa,Fac.deVeterinariayDepto.deProduccinAnimalyPasturas,Fac. deAgronoma,UniversidaddelaRepblica,Montevideo,Uruguay. 8. SimonettiL.BlancoM.R.GardnJ.C.Estrussynchronizationinewestreatedwith sponges impregnated with different doses of medroxyprogesterone acetate. Small RuminRes200038:243247.

138

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

9. StevenS.1990.InseminacinArtificialdeovejasycabras.EditorialAcribia.Mxico. 6769. 10.Zarkawi M. AlMerestani MR.Wardeh MF. Induction of synchronized estrous and early pregnancy diagnosis in Syrian Awassi ewes, outside the breeding season. SmallRuminRes199933:99102.

139

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ24)EFECTODELTIEMPOYTEMPERATURADEALMACENAMIENTOSOBRE LAS CARACTERISTICAS FISICAS Y MICROBIOLOGICAS DEL HUEVO LAVADO PARAPLATO

1 1 1 1 1 1 * FigueroaS.F. ,PrezL.C. ,BarrerasS.A. ,SnchezL.E ,OlivasV.J.A ,yJurezC. 2 L.D. 1

Instituto de Investigaciones en Ciencias Veterinarias. Universidad Autnoma de Baja California


2

EstudiantedelaMaestraenCienciasVeterinarias

RESUMEN PorNormaelhuevoparaplatodestinadoalconsumohumanonodebeserlavado, perodebidoalasaltascantidadesdehuevosucioquelaindustriaproduce,esnecesario buscar alternativas que permitan su uso. En base a lo anterior el objetivo del presente trabajo fue evaluar el efecto del tiempo y temperatura de almacenamiento sobre las caractersticasfsicasymicrobiolgicasdelhuevolavadoparaplato.Seutilizountotalde 243huevosblancosfrescosdistribuidosentrestemperaturasytresdiferentestiemposde almacenamiento despusde suproceso comercial de lavado. Se evalu:el pesoinicial, cmara de aire, altura de la albumina, unidades Haugh, peso final, y la calidad microbiolgica. Los resultados muestran que a mayor temperatura y tiempo de almacenamiento, mayor es el deterioro de las caractersticas fsicas y microbiolgicas evaluadas,yatemperaturasmenoreslascaractersticasfsicasevaluadassemantuvieron durante todo el tiempo de almacenamiento y no se detecto la presencia de microorganismos.Seconcluyequeestetipodehuevopuedeserutilizadoparaconsumo humanoyserecomiendaquesuconsumoseaenmenosde18dasysualmacenamiento seaatemperaturaderefrigerador.

Ph.D. Fernando Figueroa Saavedra. Instituto de Investigaciones en Ciencias Veterinaerias. Universidad Autnoma de Baja California.Alvaro Obregn y Julin Carrillo S/N. Col. Nueva.Cp. 21100.Mexicali, Baja California. Correo:fernando_figueroa@uabc.edu.mx

140

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

INTRODUCCIN La calidad es un concepto que actualmente cada vez es mas demandado por el consumidor,especialmenteenlosproductosdeorigenanimal.Enelcasodehuevopara plato, ste debe cumplir con una ausencia de microrganismos patgenos como lo es la

SalmonellaylaE.Coliyademsdecumplirconloscriteriostcnicosestablecidosporla
norma.Ambosenconjuntodefinenlacalidaddelproducto.Lacalidaddelhuevoinvolucra una combinacin de factores que estimulan su compra primeramente es la calidad externaqueincluyeneltamaodelhuevo,laresistenciadelacscara,sucolor,limpieza, tambin lo esla calidad dela clara o albmina y color dela yema, entre otros. Algunos otrosfactoresmassubjetivosincluyenelgustoylafrescura.Unadelassituacionesque afectalacalidadexternadelhuevoeslapresenciadehuevomanchado,porloqueste pasaporunprocesodelavadoafindeeliminarcualquiersuciedadparahacerloaceptable para el consumidor. Sin embargo, se desconoce si este proceso adems del almacenamiento afecte las caractersticas de calidad del huevo. Por lo que se plante como objetivo de este estudio el evaluar el efecto del almacenamiento a tres diferentes temperaturas sobre las caractersticas fsicas y microbiolgicas de calidad del huevo lavadoparaplato.

MATERIALESYMTODOS

Se utilizaron 243 huevos blancos lavados con recubrimiento con caractersticas propiasdelprocesodeproduccinpostlavado,distribuidosentresgruposdeestudio(G1:
o almacenado a temperatura de refrigerador (4 C2), G2: almacenado a temperatura de o o anaquelenautoservicios(25 C2),G3:almacenadoatemperaturaambiente(35 C2))y

contiempodealmacenamientode5,12y18das.Launidadexperimentalconstdetres huevos con seis repeticiones por grupo de almacenamiento para la calidad fsica del huevo,y9paraelanlisismicrobiolgico.Losanlisisfsicosenelhuevoserealizaronen el Laboratorios de Calidad FsicoQumica de Productos Crnicos y los anlisis microbiolgicos en el Laboratorio de Microbiologa del Instituto de Investigaciones en CienciasVeterinariasdelaUniversidadAutnomadeBajaCalifornia.Lasvariablesfsicas evaluadasfueron:eltamaodelacmaradeaireutilizandounvernierMitutoyo(Mitutoyo Co., Japn) para la altura de la albmina, se utiliz un micrmetro Ames (Ames Co.,

141

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

U.S.A.).Elpesodelhuevo(inicialyfinal),sellevacaboconunabalanzaanliticamarca ANDmodeloGF3000.ylasunidadesHaughdeterminaronenbasealarelacinentrela altura de la albumina y el peso del huevo como lo menciona el Reglamento de Clasificacin de Huevo para Plato vigente del Estado de Baja California. El anlisis microbiolgico consisti en la deteccin de Salmonella spp por medio de la tcnica descritaenlaNOM114SSA11994ydeterminacindeEscherichiacolipor mediodela NOM145SSA1 apndice B. Se obtuvieron los estadsticos por grupos de almacenamiento.Paralaconstrastacindelasvariablesderespuestaentrelasdiferentes variantes de temperatura de almacenamiento se utiliz la tcnica de ANDEVA para un modelo lineal con efectos fijos de temperatura y el error como componente aleatorio. Al existir significacncia enlaprueba deF, se contrastaron las mediasusandolaprueba de TUKEY. Los anlisis se realizaron empleando el paquete computacional SAS para Windowsver9.1.
RESULTADOSYDISCUSIN

Los resultados de la calidad fsica del huevo se muestran en el Cuadro 1, North (1986)mencionaquelacmaradeairedeunhuevorecientementepuestoesentre2cm de dimetro y 0.32 cm de profundidad los valores para la Clasificacin del Huevo del EstadodeBajaCaliforniamencionaqueenunhuevofrescolacmaradeairenodebede sermayoralos9mmdeprofundidadmientrasquelaNMXFF079SCFI2004menciona unacmaradeairepermitidade5mmparala msaltaclasificacindehuevo(AA).De acuerdo a las unidades Haugh reportadas en el huevo almacenado al da 5, 12, y 18 a
o 4 C,correspondenaunacalidadAyaquedeacuerdoalaClasificacindelHuevoparael

EstadodeBajaCalifornialasunidadesHaugharribade70seclasificancomocalidadAA. En E.U.A. para que merezcan calidad AA el ndice de la unidad Haugh debe estar por encima de 72 (North, 1986), mientras que elhuevo almacenado 5, 12, y 18das a 25 y
o 35 CcorespondeaunacalidadB.Losfactoresmasimportantesqueinfluyenenlacalidad

de la albmna son el efecto de la temperatura y humedad relativa durante el almacenamiento. A medida que aumenta la temperatura ambiente, el deterioro de la albminaesmasrpidoespecialmentesilahumedadrelativaesbaja.Deacuerdoalos resultadosenlosanlisismicrobiolgicos,alsometeralhuevoalprocesodelavado,nose observ presencia de Salmonella spp ni presencia de E. coli a temperatura de refrigerador, de anaquel y medio ambiente en los das 5, 12 y 18. Estos resultados muestranqueelhuevoseencuentraaptoparaelconsumohumanoyaquecumplencon

142

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

lasespecificacionesdelaNOM159SSA11996,dondesehacemencinalaausenciade ambostiposdebacterias.
CONCLUSIONES

Se concluye que este tipo de huevo puede ser utilizado para consumo humano y se recomienda que su consumo sea en menos de 18 das y su almacenamiento sea a temperaturaderefrigerador.

LITERATURACITADA

NOM159SSA11996.NormaOficialMexicana.BienesyServicios.Huevo,susproductos yderivados.Disposicionesyespecificacionessanitarias.Mxico.

NOM114SSA11994. Norma Oficial Mexicana. Bienes y Servicios. Mtodos para la DeterminacindeSalmonellaenalimentos.Mxico.

NOM145SSA Norma Oficial Mexicana. Bienes y Servicios. productos carnicos troceados y curados. Productos carnicos curados y madurados. disposiciones y especificacionessanitarias.Mxico.

NMXFF079SCFI2004.Productosavcolas.Huevofrescodegallina.Especificacionesy mtodosdeprueba.SecretaradeEconoma.Mxico.

North, M.O. 1986. Manual de produccin avcola. Ed. El Manual Moderno. 2da. Ed. Mxico,D.F.

143

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Peridico Oficial del Estado de Baja California. 2000. Acuerdo por lo que se establecen las bases de la prestacin del servicio de clasificacin de huevo para plato en el EstadodeBajaCalifornia.Mexicali,B.C.No.50.

144

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 25) Identificacin de endoparsitos que se encuentran en la Nutria Neotropical(Lontralongicaudis )enelSistemaLagunardeAlvarado,Veracruz

Identification of endoparasites that are in the NeoTropical Otter (Lontra longicaudis )intheLagoonalSystemofAlvarado,Veracruz
1 1 1 RosaMaraLpezCastro ArturoSerrano IlianadelCarmenDanielRentera 1 EnriqueMartnezLpez . 1 Universidad Veracruzana. Facultad de Ciencias Biolgicas y Agropecuarias. Carrera de Medicina Veterinaria y Zootecnia, Campus Tuxpan. Carretera TuxpanTampico km. 7.5 S/NCol.Universitaria.C.P.92860.Tuxpan,Veracruz,Mxico. Autorparacorrespondencia:rosy_2988@hotmail.com

RESUMEN Lanutrianeotropical(Lontralongicaudis)habitaenros,presas,lagosylagunascosteras, desde el norte de Mxico hasta Uruguay, se alimenta principalmente de peces y crustceos, los cuales son huspedes intermediarios para diversos endoparsitos. El objetivo de este trabajo fue identificar los endoparsitos que se encuentran en la poblacin de nutria neotropical del Sistema Lagunar de Alvarado, Veracruz (SLA). Se realizaronrecorridosenlaszonas(manglares,lagunasyros)dondesereportlamayor cantidad de avistamientos, en busca de excretas frescas,las cuales seidentificaron por su contenido, olor y ubicacin, siendo recolectadas, etiquetadas y almacenadas. La identificacin de parsitos se hizo mediante las tcnicas coproparasitoscpicas de frotis directo y la tcnica cualitativa de flotacin. Se analizaron un total de 50 excretas provenientesde16sitiosdentrode9regionesdelSLA.Entotalseobtuvieronun42%de excretaspositivasaendoparsitos,identificndose8gnerosdeparsitos,loscualesse clasificaron de acuerdo a su Phylum y frecuencia en: Nemtodos Anisakis spp. 24%,

Trichuris spp. 8%, Oxiurus spp. 4%, Toxocara spp. 20%, Strongyloides spp. 24%.
Tremtodos Opisthorchis spp. 4%, Paragominus spp. 4%. Protozoarios Toxoplasma

gondii12%.ElsitioquepresentunmayornmerodeparsitosfueelrioAcula(7/25)(P:
0.021, H= 28.07, gl=15). Se concluye que las nutrias neotropicales en el SLA, albergan endoparsitos pertenecientes a diversos phylums y gneros, los cuales pueden ser un riesgopotencialparalaconservacindeestaespecie,ascomoparalasaludpblica.

Palabrasclave:Nutrianeotropical,Endoparsitos,SistemalagunardeAlvarado.

145

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 (SMVZ 26)Sistema de Produccin Ovina una Alternativa de Desarrollo Rural Sostenible

parafamiliasdebajosingresos.

NietoRosalianoSo*,CabreraNezA,GarcezMercadoN,DazInocencioDLGonzalezSalas Ma.

Facultad de Ciencias Biolgicas y Agropecuaria Universidad Veracruzana. Km. 7.5 CarreteraTuxpanTampico.Tuxpan,Veracruz.Mxico.Tel.yfax:(783)8344350. senieto@uv.mx*autorparacorrespondencia

RESUMEN

ElpresentediagnsticoseelaborenelejidodelMunicipiodeTuxpan,Veracruzdondese visit a las autoridades ejidales permitiendo dar un recorrido para reconocimiento, posteriormente se convoc a una Asamblea General, se realiz un Diagnstico Participativo (Basadoenlas 80 herramientas para eldesarrollo participativo IICA,2009), para evaluar, aspectos social, econmico, ambiental, institucional y una aplicacin de unaencuestadelclculodelarentaconsumofamiliarmensual(BasadoenAlimentacin, Limpieza, Higiene, Educacin, Vestuario). Para seleccionar las familias de ms bajos ingresos,dondeseformaron3gruposde10familiascadauno,seapoycon10vientres de la raza panza negra (Black Belly) y 1 semental Dorper, para el primer grupo, posteriormente al momento del destete la primera cra se otorga al grupo 2 de igual manera al momento del destete del grupo2laprimera cra se otorgar parael grupo 3. Teniendocomoobjetivocapacitaralasfamiliasenloscuidadosbsicosdelascabrasy evaluarlos diferentes tipos deaprovechamientos dela produccin ovina. Los resultados del diagnstico participativo en el aspecto ambiental, en un eje aglutinador, la conservacin y uso racional de los recursos naturales, en una lnea de accin, la recuperacindelasreasdeconservacin,comoproyecto,larecuperacindefuentesde manantiales, capacidad y educacin ambiental. Elaspecto econmicola evaluacin ex antesderentaconsumofamiliarmensualfuede1salariomnimoporda.Laevaluacin ex post fue donde se obtuvieron ingresos de $300 pesos por mes por familia evalundoseyteniendoefectoensualimentacinyvivienda.

146

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Palabrasclave:Agropastoril,SistemadeProduccin,Socioeconmico.

INTRODUCCIN

Variaszonasdelpashanexperimentadoconmayorrecurrenciayseveridadlapresencia de eventos climatolgicos extremos que han puesto a prueba la sustentabilidad de los procesos productivos y de los productores rurales. Enla definicine implementacin de polticas pblicas dirigidas a promover el desarrollo rural sustentable y mejorar las condiciones de vida de los productores del campo mexicano, es necesario cuantificar y delimitar los recursos y el riesgo que corren cuando se hace mal manejo de ellos. Esto significa que se deben considerar los diagnsticos y tomar decisiones con base en los datos arrojados por los estudios, de tal manera que se puedan conservar los recursos naturales y el bienestar social en general, y ayudara a evitar impactos negativos que redundaranenelevadoscostoseconmicosysociales.Elpresenteestudiovaenfocado a generar una estrategia integral de produccin de ovinos para el ejido de Cruz Naranjos que sea participativa, que promueva la autosuficiencia y la produccin en funcinalmercado,conunenfoquemultidisciplinario,queutiliceherramientasmodernas para la planeacin, enfocada a zonas con altos ndices de pobreza, que incluya la capacitacin y transferencia de tecnologa que lleve finalmente al logro de un sistema soporteparalatomadedecisionesesunanecesidadurgenteparafomentareldesarrollo ruralsustentabledelazona. MATERIALESYMTODOS El presente estudio se realiz en el Ejido de Cruz Naranjos el cual se encuentra localizadoenelMunicipiodeTuxpandeRodrguezCano,Veracruz,queselocalizaenla zona norte del estado, con una longitud de 90 2619 y una latitud 20 58 19 y una altitud de 20 msnm, con una poblacin total de 628 habitantes, el cual se encuentra regado por pequeos manantiales, su clima es clido hmedo con una temperatura promedio de 29 a 34 grados centgrados, con una humedad relativa, su precipitacin mediaanualesde1mil200m.m.(SEDESMA,2007).Comoprimerpuntoseelijeelejido pordisponibilidaddeautoridadesejidalesyasamblea,continuandoserealizaunrecorrido en el ejido aplica un diagnstico participativo (80 herramientas para el desarrollo participativoIICA,2009),seformangruposdetrabajos,seexplicaelmotivodelestudio

147

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(intereses y condiciones comunes). En el Aspecto Social se aplica la herramienta Estrategia de vida y Diagrama de Venn. En el Aspecto Ambiental se aplica la herramientautilizadaesMatrizdeEvaluacindeRecursos,laotraesMapadeaccesoa recursos naturales. Aspecto Econmico Calendario estacionales de produccin animal, Clculo de la RentaConsumo Familiar Mensual. Aspectos Poltico Institucionales la herramienta es anlisis FODA. Se Capacitacin a las Familias Beneficiadas sobre el manejo bsico de los ovinos en lo referente a Instalaciones (comederos, bebederos, corrales,sombreaderos),Manejo(sistemadeidentificacin,controlderegistros,formade sujecin, evaluacin dentaria, va de aplicacin de medicamentos), Alimentacin (pastoreo agro pastoril), Reproduccin (estro, pubertad, fertilidad, gestacin, empadre), Sanidad(calendariodevacunasydesparasitante,cortedepezua). RESULTADOSYDISCUSIONCONCLUSIONES Realizadas las evaluaciones obtenidas de las familias beneficiadas dentro del ejido los resultadossonenelsectordetrabajoyocupacin,seencuentraconun38.03%,porsu cuenta y 31.93% como pen, por consiguiente sus nivel de salario es de menos de un salario39.37%,y14.13%de1a2salarios.Siendounabuenaalternativasosteniblerural teniendouningresode$300.00pormesyfavoreciendosualimentacinysuvivienda.Un punto de partida, a primera vista apropiado parecera ser incrementar su cantidad y calidad de alimentacin y vivienda. Sin tener que ser un apoyo de gobierno, se argumentaquelaescasezderecursoslimitaelapoyofinancieronicamenteaprogramas rentablesquegaranticensurecuperacinycapitalizacin.ElimpactoSocialyAmbiental delSistemasdecaprinosesalternativoquebuscanlasostenibilidadnosolodependen de la eficiencia de las innovaciones tecnolgicas sino tambin de factores sociales y culturalesqueparecenfavoreceroentorpecerelproceso.

LITERATURACITADA

Rudqvist A. 1991. Mtodos de trabajo de campo para consultas y participacin popular. Programa de Participacin Popular, Departamento de Antropologa, Universidad de Estocolmo,Suecia.

148

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RudqvistA.1991.Pautasparaconsultasyparticipacinpopularenprocesosyproyectos de desarrollo. Programa de Participacin Popular, Departamento de Antropologa, UniversidaddeEstocolmo,Suecia.SavetheChildren1995ParticipatoryRuralAppraisal: areportonwomen.SavetheChildren(USA),Bangladesh. ScheuermeierU.1988ApproachDevelopment:acontributiontoparticipatorydevelopment of techniques based on a practical experience in Tinau Watershed Project, Nepal. LBL, Lindau,Suiza. Schonhut M. 1994 Participatory Learning Approaches: rapid rural appraisal, participatory appraisal.Anintroductoryguide.TZSchriftenreihederGTZNo248,Rossdorf,Alemania.

149

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 27) Engorda de corderos en confinamiento con diferentes niveles de inclusindehenodemorera(Morusalba). Fattening lambs with different levels of morera hay (Morus alba) as a non conventionalsourceofprotein.
1* 1 1 ArmandoArrietaGonzlez ,ClaudioViteCristobal ,KarlaLissetteSilvaMartnez , 1 EucadioCruzOsorio 1

Divisin de Ingeniera en Agronoma, Instituto Tecnolgico Superior de Tantoyuca, DesviacinLinderoTametateS/N,Col.LaMorita,Tantoyuca,Veracruz,C.P.92100,Tel. * 017898931552, Correo electrnico: armandos72@hotmail.com autor para correspondencia,cvitec81@hotmail.com,klsilmtz@msn.com,cayitoc@hotmail.com RESUMEN Con la finalidad de evaluar el uso de la morera en forma henificada como sustituto del alimento concentrado balanceado para corderos estabulados, se realiz un experimento conunaduracinde70dascontinuosenelInstitutoTecnolgicoSuperiordeTantoyuca, Ver.,Mxico.,dondesemidieronconsumo deladietabasaldehenodemoreraentres niveles de inclusin T1 (0%), T2 (10%) y T3 (20%), ganancia diaria de peso, conversin alimenticia y comportamiento animal. El diseo utilizado es un diseo factorial con parcelas divididas en completamente al azar, utilizando el procedimiento PROC GLM del paquete estadstico SAS (2003) p>0.05, Tukey). Se utilizaron 12 corderos con pesos inicialesde14.67Kg/animal.Elalimentoproporcionadofuealibreacceso(adlibitum).Los resultados para T1, T2 y T3 fueron, respectivamente, los siguientes: GDP (g/d): T1
b ab a (0.202g0.055 ), T2 (0.246g0.062 ) y T3 (0.264g0.085 ) entre el T1 y el T2 no hay

diferenciaestadsticasignificativa,elT2conunadiferenciaintermedia,peroelT1yelT3 si hay diferencia significativa cuando (p>0.05), esto quiere decir que es mejor utilizar el
c b T3. Para el consumo T1 (0.93kg/an/da0.13 ), T2 (1.19kg/an/dia0.23 ) y T3 a (1.26kg/an/da0.22 )condiferenciaestadsticasignificativacuando(p<0.05)paralostres a a a tratamientos.LasconversionesparaT1 (5.293.12 ),T2 (5.101.52 )yT3 (5.272.26 ),

nomuestrandiferenciassignificativascuando(p>0.05). Palabrasclaves:Produccinovina,alimentacin,Morusalba. SUMMARY The objective of this study was to evaluated morera hay as a supplementary source of protein in high energy and high protein diets for lambs. The experiment was carried out during 70 days in the Instituto Tecnolgico Superior de Tantoyuca, Veracruz, Mexico.

150

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

FeedintakewasevaluatedinthreelevelsofmorerahayinthreetreatmentsT1(0%)T2 (10%) and T3 (20%). Daily weight gain (DWG), food conversion rate (FCR), animal behavior (AB) were evaluated. The experimental design was factorial with split plot completely randomized design using de procedure PROC GLM from the statistical programSAS(2003)(p>0.05,Tukey).Twelvelambswereusedwithinitialbodyweightof 14.67kg.Foodwasofferedatfreeaccess(adlibitum).ResultstoT1,T2andT3werefor
b ab a DWGT1(0.202g0.055 ),T2(0.2460.062 ),T3(0.2640.085 ).Therewasnotsignificant

differencebetweenT1andT2.BetweenT1andT3therewassignificantdifferencewhen (p>0.05), it could means that is better to use testament number three. For food intake
c b a T1(0.93Kg/an/day0.13kg ), T2(1.19kg/an/day0.23kg ) and T3(1.26kg/an/day0.22kg )

with significant statistical difference when (p>0.05) for the three treatments. Food
a a a conversion rate to T1(5.293.12 ), T2(5.101.52 ) and T3(5.272.26 ) there is not

significandifferencewhen(p>0.05). Keywords:Sheepproduction,feeding,Morusalba

INTRODUCCIN Laovinoculturaanivelmundialocupaunlugarimportanteenelcontextodelaproduccin pecuaria. En zonas tropicales y subtropicales las razas que predominan en aos recientessonlasdepelo(Lara,2004).Losprincipalespasesproductoresdeovinosson China, Australia y Nueva Zelanda (FIRA 2004), mismos que exportan su produccin a nuestropas,yaqueconlaproduccinnacional,noesposiblesatisfacerla(ngel,2000). La carne que se importa a Mxico regularmente proviene de vientres de desecho y canalescongeladas(Rios,2005).Elcomportamientodelapoblacinovinanacionalesun reflejodeloqueactualmenteestaocurriendoconlaproduccin(ngel,2000).

Sinembargo,enlosltimosaossehaobservadouninterscrecientedelosganaderos porlacrayexplotacindelborregoenformaestabuladaoenconfinamiento,queseve como una nueva alternativa para la produccin de carne, compitiendo econmicamente conotrasespeciesderumiantes(ngel,2000).

Enestetrabajo,seevaluelcomportamientodelosovinosporelconsumodelamorera (Morusalba)incluidoenladieta.LosovinosutilizadossonderazaPelibueylaevaluacin dur70dasenlosterrenosdelI.T.S.TA.

151

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Enelestudioseevaluelefectodelamorerabajotresnivelesdeinclusin(0%,10%Y 20%), y cuatro repeticiones por tratamiento, utilizando 12 corderos machos con un promediodepesoinicial14.67kgyelmtodoestadsticoutilizadofue undiseofactorial con parcelas divididasencompletamente alazar, utilizando el procedimiento PROCGLM delpaqueteestadsticoSAS(2003) p>0.05,Tukey). Durantela evaluacin se consideraronlas siguientes variables:Ganancia diaria de peso (Kg), Consumo de la dieta integral (Kg), Consumo total de la materia seca/da (Kg), Consumo total de materia seca en porcentaje, conversin alimenticia (CA), y el comportamientodelosanimalesdurante24horas.Lapreparacindealimentoporcada tratamientofuesemanalmenteylospesajescada14das. MATERIALESYMTODOS ElproyectoserealizenTantoyucaubicadoenlazonamontaosadelareginHuasteca, al norte del estado de Veracruz en las coordenadas 21 21 07 Latitud Norte y 98 14 LongitudOeste,a140metrossobreelniveldelmar(INEGI,2005). Enprimerlugarseelaborelhenodemorera,paraellodebeconsiderarsequeeldade trabajoseaasoleadoyconnulasprobabilidadesdelluvia,loanteriordebidoaqueeneste caso el proceso de henificacin fue prcticamente artesanal o rstico. Para henificar la morera,elprimerpuntoeselcorte,elcualdeberrealizarsedeformatalquenoafectela calidad del tallo de la planta para garantizar un rebrote adecuado. Una vez cortada la plata debe ser molida preferentemente con un molino de martillos con una criba de pulgada,estogarantizarunaadecuadafragmentacin,quepermitirunmejorsecadoy una mayor utilizacin por parte de los corderos. Posteriormente que ha sido cortada se exponealsolhastaperderelexcesodehumedad,esteprocesopuedetomarentreunoo dos das dependiendo de la radiacin solar. Una vez obtenido el heno se debe de encostalaryguardarenunlugarsecoylibredelaradiacinsolardirecta. Enestetrabajoseutilizaron12corderosdelarazaPelibueyconunpesoinicialpromedio de 14.67 kg., estos fueron bloqueados de acuerdo a su peso, los tres tratamientos se mantuvieronenunjaulasconpisodetierrade1manchoX3mdelargo,durante70das de estudio. Los animales recibieron una dieta de recepcin y posteriormente se sometieron a una dieta de adaptacin durante 12 das antes de iniciar con los tratamientosrespectivos.Losanimalesutilizadosfuerondesparasitadosconivermectinas, vitaminado y 15 das antes fueron vacunados contra enfermedades causadas por

152

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

bacterias del genero Clostridium para prevenir problemas de enterotoxemia durante el procesodeengorda. Lostratamientosutilizadosseilustranenelcuadro1.

Cuadro1.Ingredientesyconcentracindenutrientesdecadaunodelostratamientos. FORMULADELADIETA T1(0% T2(10% MORERA) MORERA) 50% 44% 10% 10% 20% 16% 4% 4% 5% 5% 1% 1% 0% 10% 10% 10% 100% 100%

INGREDIENTE Sorgo Mazamarillo Pastadesoya Harinadepollo Melaza Salesminerales Henodemorera Pacade Tanzania TOTAL

T3(20% MORERA) 38% 10% 12% 4% 5% 1% 20% 10% 100%

Para analizarlas variables a medir diariamente seproporcionaba alimento deacuerdo a losrequerimientosdelosanimales,ofreciendolamitaddeconsumodiariodealimentopor lamaanayelrestoporaltarderegistrandodiariamentelacantidaddealimentoofrecido yelresidual.Cada14dasseregistrabanlosincrementosdepesoydeestainformacin sepudodeterminarlasgananciasdiariasdepeso,elconsumodealimentoylaconversin alimenticia. Adicionalmenteseevaluelcomportamientoanimaldurante24horasduranteelproceso deengordaserealizarondosevaluacionesenlascualeslasvariablesamedirfueronlas siguientes:comiendo,bebiendo,rumiando,echado,parado,defecandoyorinando,estas observaciones se realizaron con el objeto de monitorear el comportamiento animal por efectodeladietaconsumida. Para obtener los resultados estadsticos fue necesario introducir las medias experimentales de los animales por cada periodo y por tratamiento que posteriormente fueronanalizadasconundiseofactorialconparcelasdivididasencompletamentealazar, utilizandoelprocedimientoPROCGLMdelpaqueteestadsticoSAS(2003).Elmodelofinal incluy los efectos fijos derivados por la concentracin en porcentaje de la morera

153

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

henificada en el tiempo que duro la investigacin, repeticin anidada en tratamiento, muestra y la interaccin entre tratamiento y muestra. Las medias que resultaron significativas fueron comparadas con la prueba de Tukey con una confiabilidad del 95% (SteelyTorrie,1996)conun=0.05. RESULTADOS EnelCuadro2,semuestranlosresultadosquefueronobtenidosdelagananciadiariade pesoyconsumovoluntariodealimento,ascomotambinlaconversinalimenticia(CA), enelcualseapreciqueconformeseincluyunamayorcantidaddemoreraenladieta se mejor (P<0.05) la ganancia diaria de peso y el consumo de alimento. La ganancia diariadepesosolofuesuperior(P<0.05)conlainclusinde20%dehenodemoreraenla dieta en una magnitud de 30.7% con respecto al testigo. Mientras que el consumo de alimento increment a medida que el contenido de morera en la dieta fue ms alto, mostrandoasdiferenciassignificativas(P<0.05).Semuestratambinlosresultadosque se obtuvo para la CA, donde no hubo diferencia significativa (P>0.05) con respecto al testigo. Cuadro2.Medias(STD)delagananciadiariadepeso,consumovoluntariodealimento yConversinAlimenticia(CA)enovinosalimentadoscondiferentesconcentracionesde henodemorera. Henode n GDP(kg/da) Consumo CA(kg) morera (kg/da) (%) b c a 0 10 0.2020.055 0.930.13 5.293.12 ab b a 10 10 0.2460.062 1.190.23 5.101.52 a a a 20 10 0.2640.085 1.260.22 5.272.26 a,b,cMediasconlamismaliteralencolumnasnosondiferentes(P0.05Tukey). En el Cuadro 3, se muestra el comportamiento fisiolgico de los ovinos en el cual se observaqueparalasvariablescomiendo,bebiendo,parado,defecandoyorinandonohay diferencias significativas (P>0.05). Sin embargo, para la variable rumiando si existi efecto,siendoqueenelT2mostrlosvaloresmsaltoscomparativamenteconT1yT3, a su vez tambin existi diferencia (P<0.05) entre estos dos ltimos tratamientos. En el casodelcomportamientoechado,losvaloresmsaltosfueronparaT1conrespectoaT2 yT3.

154

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Cuadro3.Medias(STD)delosparmetrosdelcomportamientofisiolgicodelosovinos alimentadoscondiferentesconcentracionesdehenodemorera(%). Variables N Comiendo Bebiendo Rumiando Echado Parado Defecando Orinando Henodemorera (%) 10% 4 a a 118.12524.53 136.2515.61 a a 20.6259.21 15.62511.61 0% 4
c 202.538.24 a 728.7536.77 a 315.62554.94 a 23.754.33 a 30.62510.08 a 285.62521.45 b 568.7582.6 a 373.12547.71 a 28.1258.26 a 32.55.4

20% 4
a 176.87526.5 a 36.2510.31 b 255.62547.76 b 573.12584.42 a 316.87543.22 a 38.7511.99 a 42.521.89

a,b,cMediasconlamismaliteralenhilerasnosondiferentes(P>0.05Tukey).

DISCUSINDERESULTADOS Al trmino de esta investigacin, al evaluar tres tratamientos de una dieta bajo concentracionesdehenodemorera(Morusalba)durante5periodosseobservaquelas GDPparaestosrumiantesincrementaamaneradequelaconcentracinesmayor,esto esconrespectoaltestigoT1(0%). EntreelT1yelT2,nohaydiferenciassignificativassobrelaGDP,esdecirdalomismo usarcualquieradelosdostratamientos.ParaT1yT3,sihaydiferenciasignificativayel T3eslomsrecomendable.EntreelT2yelT3,hayunadiferenciaintermedia,porloque es lo mismo usar cualquiera de los dos. Estos resultados podran atribuirse a que la morera es altamente digestible y con gran contenido de protena cruda15% al 25%. En nuestra regin no existe trabajos realizados con esta planta, pero un trabajo similar realizadotrasutilizarLeucaenaleucocephalaentrestratamientoslasGDP,soninferiores alasnuestras(Palmaetal.,2010). ElconsumodealimentosimostrdiferenciassignificativasentrelostrestratamientosT1
c b a (0.930.13 ),T2(1.190.23 )yT3(1.260.22 ),estoquieredecirqueentremenosmorera

contengaladietaelconsumoesmenor.
a LaCAnomostrdiferenciassignificativasentrelostrestratamientosT1(5.293.12 ),T2 a a (5.101.52 ) y T3 (5.272.26 ), lo cual significa que el consumo para generar 1 kg de

155

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

carneserequierelamismacantidaddealimento,soloqueelT3contienemas moreray loscostosdelalimentoporkgpodrareducirse. Sobre la evaluacin de los parmetros del comportamiento fisiolgico de los ovinos alimentados con diferentes concentracionesde heno de morera (%), solo mostr ligeras diferencias para la variable rumiando y el efecto se da en estos animales que consumierondietasconhenodemorera. Para la variable echado que tambin mostro una ligera diferencia, su efecto fue quelos animalespermanecieronmstiempoechadocuandolosanimalesfueronalimentadossin moreraincluidaenladieta.

CONCLUSIONES El uso de materias primas alternativas tales como el heno de morera, puede ser una fuente de protena de alimento concentrado balanceado utilizado en ovinos de engorda. Lautilizacindeestaplantahenificadaresultaserfavorableparalaengordadeovinosen formaestabulada. Laadicindehenodemoreratuvounefectopositivosobreelconsumoaladieta,enel tratamiento donde no se incluy el consumo fue menor, es decir sobre el tratamiento 1 mientrasqueeltratamiento3elconsumofueelmayorquecualquieradelostres. LITERATURACITADA 1. ngel, R. M. 2000. Anlisis de la explotacin ovina Nacional y estatal. Escuela de MedicinaVeterinariayZootecniadelaUniversidadAutnomadeCuliacnSinaloa. 2.FIRA, 2004. Visin de la red ovina. Subdireccin de consultora de agronegocios. Diplomadoenproduccinovinanacional.Cd.VictoriaTamaulipas. 3.INEGI(InstitutoNacionaldeEstadstica,GeografaeInformtica).2006.Resultadosdel CensoAgropecuariodel2005.Tepic,Nayarit,Mxico. 4. Lara, J.P., 2004. Utilizacin de cruzamientos en la produccin ovina. Asociacin MexicanadecriadoresdeOvinos. 5.SAS.2003.UsersGuide.Statistics8thed.Cary(NC).SASInstituteInc.

156

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 29) PROYECTOS DE INTERVENCION. UNA PROPUESTA PARA IMPACTAR POSITIVAMENTEENLOSSISTEMASDEPRODUCCION.


1 1 1 OlmedoPrez.G. GonzlezVicencio:G.J. ElorzaMartnezP . 1

Facultad de Ciencias Biolgicas y Agropecuarias. Universidad Veracruzana. Tuxpan, Ver. INTRODUCCIN Un proyecto de intervencin se define como una propuesta elaborada para lograr innovaciones o mejoras que afectan directamente a personas o familias a grupos o colectivos, o incluso a toda una poblacin de un territorio. Por sus caractersticas es posible clasificarlo como proyecto de intervencin individual o familiar, proyecto de insercinlaboralysocial,deinformacindeautoayudayorganizacin. La redaccin de un proyecto de intervencin significa, anotar las ideas en papel, un proceso que tiene un doble inters: a) Permite ordenar y concretar las ideas. b) Hace posiblecomunicarlosycompartirlos.Laredaccinofrecelaoportunidaddeconcretarlas ideas,ydeordenarlaso,enalgunoscasos,comprobarquealgunaideatodavanoest suficientementemadura. El proyecto lo compartimos con otras personas, primero con las personas que vamos a distribuir la responsabilidad de disearlo y llevarlo a cabo. Es importante en la funcin comunicativadel proyecto: cuidar la forma de redactar yla forma de presentarlo, no se tratadehacerdiscursosgenricossobreeltemaalqueserefiereelproyecto.Elproyecto sedebefundamentarencircunstanciasprximas,concretasyespecficas. MATERIALYMETODOS Se realiz una investigacin documental de los tipos de proyectos desde las distintas perspectivas disciplinares, priorizando los proyectos de intervencin dirigidos al sector productivoagropecuario,seelaborunapropuestademodelodeproyectodeintervencin conloselementosestructuralesmsrepresentativosentrelosautoresconsultados. RESULTADOS. Unproyectodeintervencinenfocadoalaatencindeunanecesidaddecarctersocialo productivo,debecontenerlossiguienteselementosestructurales

157

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

INTRODUCCIN.Enlaseccindeintroduccinseenfocanlossiguientesaspectos:1. Ubicacin organizacional. Aqu seincluyendatos generales delainstitucin o empresa como: ubicacin geogrfica, algunos datos del perfil estadstico o caractersticas importantesdelainstitucin,laestructuraorganizacionalycualquierotrodatoinstitucional o empresarial que se considere necesario. 2. Descripcin funcional y/o operativa. Se detallaelreaorganizacional,ysedescribelafuncin,proceso,tarea,etc.,quesedesea intervenir para su optimizacin, mejora o cambio o cualquier aspecto en relacin a la intervencin. 1. BASESTERICAS. Marcohistricoycontextual.Eslareseahistricaquepermiteidentificarodescribirel contexto donde se desarrollar o se desarroll el estudio. Caracteriza el contexto institucional donde se realizar la investigacin. No se limita nicamente a un lugar geogrfico,sinoquehaceunaampliacindescriptivadelmismo.Ubicaalproyectoenuna pocaytiempodeterminadoysuscircunstanciasparticulares. ElMarcoreferencialeslareseadelasinvestigaciones,proyectosdeemprendedores anterioresoactualesqueapoyannuestroestudio. ElMarcolegal.Serefierealosfundamentoslegalesdeltemadeestudio.Esopcional,si seconsiderannecesariosparaelestudio.

El Marco terico. Es el respaldo organizado en argumentos tericos y referenciales que se le da a la solucin del problema del proyecto. Es la evaluacin, presentacin y pertinencia de enfoques y resultados de teoras e investigaciones en diversas reas del conocimiento,lascualeshanabordadounaproblemticasimilar,directaoindirectamente alProyectoactual. En la seccin de definicin de trminos bsicos se define y relaciona, en orden alfabtico, los trminos usados en la definicin del problema, objetivos, supuestos, e hiptesis. Estos conceptos cumplen con la funcin de: 1. Establecer una mejor comunicacinentreinvestigadoresy usuariosdelasinvestigaciones.2.Unificarcriterios entre investigadores. 3. Mejorar la validacin de la investigacin. 4. Delimitar con precisin los alcances de la actual investigacin. 5. Ayudar a definir la postura del investigador.

158

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

3.

EL

PROYECTO

DE

INTERVENCIN

DEBE

INICIARSE

CON

UNA

DOCUMENTACINQUEEXPRESE: Lainnovacinomejoraquepropone Lasituacindepartidaquejustificalamisma Losbeneficiosquesupondrparalaspersonas Lascircunstanciasqueavalansuoportunidadfrenteaotrasalternativas. Lasreferenciasinstitucionalesdelproyecto,esdecirlosefectosalosquepretende contribuiryeldocumentoelqueseexpresan.

a). Enunciado y descripcin. Se considera como una propuesta factible, creativa y detallada ysuaplicacin, pararealizarunamejoraoresolverunaproblemtica grupal, social, institucional y empresarial, sobre cualquier aspecto que afecte a su buen desempeo. b).Justificacin.Elproyectosedebedefundamentarenlosefectosalosquepretende contribuir, que estarn expresados en programas y planes, en forma de objetivos de carcter general o especficos. y a falta de programas o planes, la legislacin, la constitucin o las convenciones institucionales que justifican el proyecto. No es conveniente extenderse demasiado en los fundamentos de un proyecto, a veces una pgina es suficiente. el proyecto debe ser un documento preciso, de fcil lectura y comprensinynoundiscurso. c).Objetivos.Sonloslogrosquesepretendenalcanzarconlaejecucindeunaaccin. Los objetivos deben ser claros, realistas, y pertinentes. Se clasifican en: generales y especficos. En la elaboracin de proyectos no es un requisito indispensable formular distintos tipos de objetivos, pero conviene enunciarlos en la forma precisa para su comprensin. d). Objetivos generales. Los objetivos generales, formulados a partir del anlisis de necesidades se establecen los objetivos especficos. Estos son una concrecin de los anteriores, y se formulan del modo msespecfico posible. Una vez concretados, se establece la relacin o interdependencia entre ellos y se secuencian. Un proyecto no tiene objetivos generales o especficos propios, si no que utiliza y cita este tipo de objetivosenunplanoprogramacomoreferenciayfundamentacin,diferentesproyectos pueden utilizar como referencia unos mismos objetivos especficos o generales porque

159

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

diferentes proyectos pueden contribuir, a travs de diferentes resultados en una misma direccin,haciaunmismoefecto. e).Metas.Lasmetasdebensercontablesy,ensucasomedible,selograonoselogray cuanto se logra. Deben ser muy concretos, expresados de forma inequvoca. Y pueden imputarse a la intervencin que se lleva a cabo. Las metas no pueden formularse de forma genrica o inposible de constatar. Hay una cuantificacin directa que se puede conseguir (ejem.incrementar un 50% el nmero de socios) pero tambin se pueden cuantificar indirectamente diciendo en su cuantitativa (cuantos resultados se esperan lograr)laintervencindebedecirquesevahacerparaslograrlo. f).Anlisisdefactoresrestrictivosyfavorecedores.Atencionestcnicas.Sedescribenlos resultados y tcnicas metodolgicas empleadas en el anlisis de los factores o fuerzas motricesorestrictivas,lascualesafectanalcumplimientodelosobjetivosdelproyecto. Deber contener argumentos y datos relevantes verdicos, los cuales demuestren la existenciadelosfactoresy/ofuerzasmotricesyrestrictivas. Pueden informar y asesorar, facilitar gestiones y trmites, formar educar, tratamientos psicosociales,disearyrealizaractividades,investigar. g). Tipos de intervenciones. Los tipos deintervenciones abordan la atencin a distintas necesidadesdiagnosticadasenunacomunidadypuedenreferirsea: v Apoyo humano. Son aquellas intervenciones que se concretan en

acompaamiento,relacionespersonales. v Ayudas materiales. Pueden ser muy diversas prestaciones de servicios domsticos,alimentacin,supresindebarrerasyadaptacindehogares,facilitar localeseinstalaciones,mediosmateriales. v Ayudas econmicas. Por ultimo hay intervenciones que se expresan en forma de ayudas econmicas a personas o familias, subvenciones es decir dando dinero a algn las intervenciones son en definitiva atenciones que se llevan a cabo para conseguir los resultados previstos.Puede ser destinatario del proyecto una sola persona, una persona con la que se propone intervenir para lograr determinados cambios que permite mejorar su situacin en algunos aspectos: que encuentre empleo, que adquiera determinadas habilidades, que supere una adiccin, es un proyectodeintervencinindividualenestecasobastarlosdatosqueidentifiquen

160

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

aestapersona:nombreyapellido,fechadenacimiento,sexo,lugardenacimiento, nacionalidad,estadocivil,ocupacin,estudios,renta,familia,relacionessociales. v Familia: puede ser destinatario de un proyecto familiar, ser un proyecto de intervencinfamiliar.Ungrupoqueformaunaunidaddeconvivencia,deformaque laintervencinnosereduciracadaunodesusmiembrosdeformaaislada,sino quecontemplalaintervencinexistenteentreelloscomoaspectofundamental.En elcasodequeungruposealosuficientemente,dimensionadoeidentificable,que permita aprovechar su dinamismo en beneficio de los resultados individuales estaremoshablandodeunproyectogrupal.Encasocontrariocuandoafectaatodo unentornoocolectivohablaremosdeproyectosdecarctercomunitario. g). Anlisis de mercado. En el mercado es donde las personas reflejan sus intereses, deseos, y necesidades. All el ser humano pone de presente la jerarquizacin de sus necesidadesyestablecesupropiaidentidadenrelacinconlosbienesquedeseaposeer o adquirir, es tambin en el mercado donde los productores reflejan sus condiciones de costoytecnologa. La estructura del mercado, estos interrogantes plantean los siguientes problemas Qu producir? Cmo producir? Cunto producir Cul es la mejor manera de lograr un correcto funcionamiento del mercado? La economa liberal requiere que exista un mercado de competencia perfecta, el que se caracteriza por la existencia de muchos compradoresyvendedoresdemaneraqueningunodeellospuedainfluirindividualmente enlosprecios. La funcin de la demanda El trmino demanda se puede definir como el nmero de unidades de un determinado bien y servicio que los consumidores estn dispuestos a adquirir durante un periodo determinado de tiempo segn determinadas condiciones de: precio,calidad,ingreso,gastodelosconsumidores. Laoferta.Sedefinecomoelnmerodeunidadesdeundeterminadobienoservicioque losvendedoresestndispuestosavenderadeterminadosprecios. h).IngenieradelproyectoElestudiodeingenieradelproyectodebellevaradeterminar la funcin de la produccin ptima para la utilizacin eficiente y eficaz de los recursos disponibles para la produccin del bien o servicio deseado. para ello se analizan los factores productivos, identificando la cuantificacin y proyeccin de los montos de

161

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

inversindecapital,loscostosylosingresos.Delaseleccindelosprocesossederivan lasnecesidadesdelainfraestructura,equiposymaquinaria,quedeterminaeltamaode laempresa,elclculodeloscostosdeoperacin,demanodeobra,insumosdiversos, reparaciones, mantenimiento y otros, obtendr directamente del estudio del proceso productivoseleccionado. i). Impacto ambiental El estudio de Impacto Ambiental se refleja en un documento elaboradoportcnicosespecializadosenelquesonidentificadoslosimpactosalmedio ambiente, laposibilidad de corregirlos,los efectos que producirn, etc. Debe serlo ms objetivoposible,sininterpretacionesnivaloraciones,sinorecogiendodatos.Esunestudio multidisciplinarporloquetienequefijarseencmoafectaralclima,suelo,aguaconocer la naturaleza que se va a ver afectada: plantas, animales, ecosistemas los valores culturales o histricos, etc. analizar la legislacin que afecta al proyecto ver cmo afectaralasactividadeshumanas:agricultura,vistas,empleo,calidaddevida,etc. j). Anlisis financieros. Frente a las limitaciones de los mtodos que no consideran el valor tiempo del dinero, se presentan alternativas de evaluacin el valor actual neto, la tasainternaderetorno,elanlisisdesensibilidad,alcostobeneficio. Unobjetivoespecialdelanlisisfinancieropretendedejardemanifiestolaimportanciade incluirelanlisisdelosefectosdelainflacinenlaevaluacindelproyecto.Laevaluacin paraquetengasentidodeser,debeteneruncarcterlomsrealistaposible. Laimportanciadelanlisisdesensibilidadsemanifiestaenelhechodequelosvaloresde las variables que se han utilizado para llevar acabo la elaboracin del proyecto puede tenerdesviacionesconefectosdeconsideracinenlamedicindelosresultados. 4.ESTRATEGIAS DE IMPLEMENTACIN PARA LA PRESENTACIN Y VENTA DEL PROYECTO. 4.1Estrategiasusadasparalapresentacinyventadelproyecto. Todoproyectorequiere,ananivelinterno,deunprocesodeventa,medianteelcualse convenza a los futuros usuarios de sus beneficios, pero sobre todo a los que tienen el poderdedecisinsobrelaaceptacinonodelproyecto.

162

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Paraelloesnecesarioplantearunaestrategiaparalapresentacinoficialdelproyecto,es decir,laexplicacindelcmo(detallarloydeserposible,realizarlo),aquinoquines,el cundoyendndesepresentelproyecto. Se deber plantear un plan realista con las etapas bien definidas de cmo vencer la resistencia al cambio en la implementacin del proyecto de intervencin, buscando la armonaentretodoslosinvolucrados. Sedebecuidar:Lacomunicacinefectivaentrelosinvolucrados,sobrelosbeneficiosque aporta el proyecto de intervencin. El ambiente de trabajo institucional y/o laboral. La proyeccindelamisinyvisindelainstitucin.Laintegracindelosinvolucradosenel proyecto. 4.2. Estrategias para lograr el involucramiento. Sabemos que un proyecto que no es aceptado, por ms benfico y bien realizado que sea, no tiene esperanzas de vida. Por esta razn cobra relevancia el involucramiento de la comunidad. Quines fueron las personas clave para este proyecto? De qu forma se logr interesarlas e involucrarlas enl? 5.ADMINISTRACINDELPROYECTO 5.1Plandeaccin.Enesteapartadoseindicarnlasaccionesquesellevaron acaboen ellograrlosobjetivos.Elplandeaccindebeestarplanteadodeunamaneraorganizada detalformaquesecontemplenfases,etapas,espaciosyresponsables. Criteriosdecalidad.Loscriteriosdecalidadserefierenalaespecificacindelospuntos quesernobjetodevaloracinrespectoaltrabajorealizado,encuantoasu: a) Pertinencia. b) Suvigenciaenlainstitucinoempresa. c) Factibilidad: d) Su probabilidad de que las soluciones propuestas puedan llevarse a cabo en definitiva. e) Originalidad: f) Gradodeinnovacindelapropuesta. g) Vinculacin: h) SurelacincondiferentessectoresoreasDentroyfueradelaInstitucin i) Aportacin.Serfuentepotencialparalasolucindeotrosproblemas

163

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

5.2Cronogramadeactividades DiagramadeGanttocualquierotrapertinentedondesedescribelostiemposrequeridos en funcin de las actividades, y los responsables de las etapas y/o actividades del proyecto.Consisteenlaespecificacincalendarizada,enformasemanalomensual,dela realizacin de las diferentes etapas y componentes del proyecto. Para su graficacin, puedenusarsegrficasdediversostipos.LamscomneslagrficadeGantt. 5.3Recursos Es el listado de recursos, materiales (equipo de laboratorio, cmputo, etc.). Convenios, que se requirieron para la ejecucin del proyecto. En este apartado se indicarntodosaquellosmediosquefueron necesariosparallevaracabolassoluciones planteadas en el proyecto. Se debern especificar los recursos conforme a una clasificacinquepermitadiferenciarlos,porejemplo:recursoshumanos,recursosfsicoso deinfraestructura,recursosfinancieros,etc. 5.4 Presupuesto. Es el Listado de gastos que se efectuaron (papelera, equipos, personal,viajes,congresosetc.). Conclusiones y recomendaciones del proyecto. En este apartado son presentados los resultadosEsunaargumentacinfundamentadaconclaridadyrigorcientfico,dondese danaconocerlosresultadosdandorespuestaacadaunadelaspreguntasuobjetivosde lainvestigacin. CriteriosdecalidadLasconclusionesdebenderesponderalapreguntaQuresultados se encontraron y sus beneficios? Las conclusiones deben estar redactadas con: rigor lgico,claridadyconcisindeestilo,originalidad,precisin,amplitud,compatibilidadcon latica,significanciaypertinencia. 7.BIBLIOGRAFACOMPLEMENTARIA,Es ellistadodelibros,documentos,reportesde investigacin, grficos, tablas, etc. Debe ser seleccionada cuidadosamente y debe redactarse con precisin, incluyendo solamente aquellas citas bibliogrficas que hayan sidoconsultadaspersonalmente.Esunlistadodelasconsultas,fuentesdeinformaciny referentes en los que se basa la investigacin.Se incluyen fuentes que apoyaron metodolgicamentelainvestigacin. Loscriteriosdecalidadquedebepresentalabibliografasonlossiguientes:

164

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

v Debecitartcnicamentelabibliografabasedelainvestigacin. v Sedetallaenordenalfabtico. v Debe cumplir con las normas APA, o con las normas pertinentes al programa acadmico. v Sedebecitartcnicamente.
ESTRATEGIASDEIMPLEMENTACIN

CONCLUSIONES Es posible describir y fundamentar un proyecto de intervencin con base en una investigacin documental para identificar los elementos estructurales que permitan integrarpropuestasconlasqueensuaplicacinpermitiragenerarun impactodemejora enlaproductividaddelsectorproductivopecuario. BIBLIOGRAFA Casanova,Ma.Antonia.1997.Manualdeevaluacineducativa.Edit.LaMuralla Conway, Judith. 1997. Educational technologys effect on models of instruction. Coprand.uder.edu. Bazdresh,Parada.Miguel.1997.Vivirlaeducacintransformarlaprctica BensteinBasil.Pedagoga,controlsimblicoeIdentidad.Edit.EdicionesMorataS.L. ElliotElliot.2000.Elcambioeducativodesdelainvestigacinaccin.Edit.Morata. Fontaine.Ernesto.1981.Evaluacinsocialdeproyectos.Santiago.PontificiaUniversidad CatlicadeChile.EdicionesUniversidadCatlica. Gotees y M. D. Le Compte. 1997 Etnogrfica y diseo cualitativo en investigacin educativa.Edit.Morata. ILPES. 1977. Gua para la presentacin de proyectos. Siglo Veintiuno, Editorial Universitaria.Ch. Keynes,J.Maynard.1971TeoraGeneraldelaocupacinelinteresadeldinero.Mxico. FondodeCulturaEconmica,

165

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Naciones Unidas. 1998 Manual de proyectos de desarrollo econmico. Publicaciones 5.58.11.65Mxico. Recio,Snchez.Hilario.1999.Creatividadenlasolucindeproblemas.Edit.Trillas. RosemondCheetham.Reflexionessobredosenfoquesdelasociedadelfuncionalismoy elestructuralismohistrico. SnchezPuentesRicardo.1998.Didcticadelaproblematizacinenelcampocientfico delaeducacin. Schmelkes, Sylvia. 1996. Hacia una mejor calidad de nuestras escuelas, edit. Sep. MexicoD.F. S.J. Taylor, R. Bogdan. 1997. Introduccin a los mtodos cualitativos de investigacin. Edit.Paids. SubsecretaradeEducacinBsicaNormal(1999):Elmodeloescolarunaestrategiapara transformarnuestraescuela.Edit.Sep.

166

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 30) Comparacin de tasa de preez y das de gestacin de vacas sincronizadasymontanaturalen120dasdeempadreenunranchocomercialenel NortedeVeracruz

Comparison of pregnancy rate of synchronized and natural mating cows on 120 daysbreedingprogramonacommercialranchinNorthernVeracruz

1 1 1 HEspinoza*,ICDaniel ,ACabrera yMALammoglia

Facultad de Ciencias Biolgicas y Agropecuarias, Universidad Veracruzana, Poza Rica Tuxpan RESUMEN Elusodelainseminacinartificialatiempofijohallegadoaserunrecursodisponiblepara mejorar las tasas de preez en protocolos de inseminacin artificial. El objetivo fue comparar la tasa de preez y das de gestacin en vacas sincronizadas usando un protocolo de inseminacin artificial a tiempo fijo y monta natural en un empadre de 120 das en vacas comerciales del Norte de Veracruz. Las vacas se distribuyeron aleatoriamenteporlactanciaycondicincorporalendosgrupos:Grupo1:Lasvacas(n= 24) en este grupo fueron inseminadas artificialmente a tiempo fijo y al da siguiente se continu el empadre con monta natural. Las vacas del grupo 2 (n = 23), no se sincronizaron solo se realiz monta natural durante el empadre. El diagnstico de gestacin se realiz utilizando ultrasonografa. El anlisis estadstico fue el programa Statview ANOVA y Jicuadrada para determinar las diferencias de tasa de preez. Las vacasenambosgrupostuvieronunagananciadepesoycondicincorporalsimilar(P= .10)durantelos120dasdeempadre.Nohubodiferencia(P=.10)enlatasadepreez inicial ni final acumulada entreel grupo 1 y2 (88% vs95%). Sin embargolasvacas del grupo 1 presentaron gestaciones mas avanzadas (P =.003) a los 60 das(58.2 14.8 das) y al final (P = .008) del empadre (128.9 14.9 das) que el grupo 2 (40.8 14.9 111.818.7das,respectivamente).Enconclusin,noseencontrarondiferenciasenla

167

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

tasa de preez entre los grupos pero las vacas en el grupo de inseminacin artificial a tiempofijotuvieronenpromediogestacionesmsavanzadasqueelgrupocontrol. Palabrasclave:Inseminacinartificial,empadre,vacascomerciales,trpico.

INTRODUCCIN Paralograr la mxima rentabilidadenla produccin de carneoleche bovina, es preciso alcanzar primero la mxima eficiencia reproductiva. Esto se logra con un manejo reproductivoplanificadoutilizandounsistemadecontrolosincronizacindelcicloestral, quemejorelosndicesreproductivos.

Laaplicacindinmicadeunprogramadecontrolreproductivobovinobuscaatravsde un manejo agresivo, alcanzar un exitoso comportamiento reproductivo y el beneficio econmico de la empresa al lograr ms animales gestantes y productivos (Gonzlez, 2002). Las estadsticas utilizadas para evaluar la eficiencia reproductiva han sido poco eficientesparaidentificareinterpretarlafrecuenciadevacaspreadasenelhatoypara seguirsusvariacioneseneltiempo(Rapnickietal., 2002). DurantelapresentedcadalosprogramasdeinseminacinArtificialaTiempoFijo(IATF) han venido presentando importantes avances, por lo cual su difusin tambin se ha incrementado tanto en las ganaderas de leche y carne especializadas como en las de doblepropsitoenambientestropicales(Betal.,2005Barusellietal.,2003). Engeneral,esposibleconcluirquelosresultadosdeestosprogramasdeIATFpermitena losproductoresobtenerporcentajesdepreezpromediodel50%alprimerservicio,tanto envacaslactantescomoennovillasBostaurusymestizasBostaurusBosindicus(Soto, 2007). Los protocolos ms exitosos han sido aquellos que utilizan dispositivos intravaginalesimpregnados con progesterona, combinados coninyecciones de benzoato de estradiol ms la aplicacin de gonadotropina corinica equina (eCG), las cuales permitenincorporarvacasynovillascclicasoanstricasanconunacondicincorporal disminuida (Baruselli et al., 2004 Soto, 2007).El objetivo de este estudio fue evaluar el cambio de peso, condicin corporal, tasa de preez y das de gestacin en vacas sincronizadasusandounprotocolodeinseminacinartificialatiempofijoymontanatural en120dasdeempadre.

168

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

MATERIALESYMTODOS El rancho ganadero comercial donde se realiz el estudio se encuentra ubicado en el municipio de Espinal de la zona norte del Estado de Veracruz y a una altura de 100 metrossobreelniveldelmar. Elranchoestformadopor380hectreascondiferentestiposdegramneasdelascuales lamsabundanteeselpasto Insurgentes(BrachiariaBrizantha),con280hectreas50 hectreas de Estrella mejorado (Cynodun Plecto) y 50 hectreas de Humidcola (Brachiaria Humidicula). Se utilizaron 47 vacas tpicas de la regin que consisti en un genotipo deBos indicus (Ceb) yBos taurus (Charolais o suizo europeo en este caso). Las vacas se manejaron en un sistema rotativo de pasto Insurgentes (Brachiaria

brizantha)yserotabancada7dasenunasuperficiede5divisionesde25hectreas.Las
vacastenanlibreaccesoasalesminerales(12%defsforo)yaguacorriente.Lasvacas con cra en ambos grupos permanecieron en un programa de amamantamiento restringidoendondesoloseamamantaalbecerrocada24horasdurante45minutos.

Lasvacasfueronasignadasaleatoriamentepornumerodelactanciaycondicincorporal endosgrupos:Vacassincronizadaseinseminadasatiempofijo(n=24)ygrupocontrolo deempadreconmontanatural(n=23).Elprotocolodeinseminacinartificialatiempofijo serealizodelasiguientemanera: 5) Elda0alas7:00AMalosanimalesdelgrupo1selesaplicvaintramuscular profundaconagujasdesechablesdecalibre18yunalongitudde1.5pulgadasy jeringasdesechablesde3ml2.5mg(0.5ml)debenzoatodeestradiol(Estilbo de laboratorio Syva,) y se les implant un dispositivo intravaginal con progesterona (Eazybreed CIDR, 1.9 g de progesterona natural en silicona, Pfizer,MxicoGrfica3). 6) El da 7 a las 7:00 AM se retir el CIDR y se les aplic 25 mg (5 ml) de prostaglandina F2a (Lutalyse del laboratorio Pfizer, Mxico Grfica 2) va intramuscularutilizandojeringasdesechablesde10mlyagujasdesechablesde calibre18yunalongitudde1.5pulgadas.TambinseaplicvaIM400UI(2 ml)degonadotropinacorinicaequina(eCGFolligndellaboratorioIntervet,) alasvacasy300UI(1.5ml)alasnovillonas.Seutilizaronjeringasdesechables

169

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

de 3 ml con agujas desechables de calibre18 y una longitud de 1.5 pulgadas (Grafica3). 7) Elda8alas7:00AMhorasseaplic(IM)5mg(1ml)debenzoatodeestradiol comosedescribianteriormente(Grfica2). 8) Elda9alas5:pm(58horasdespusdelretirodelCIDR)se Inici la inseminacin artificial de todas las vacas (Grfica 3). A los 3 das despus de servidas las vacas se solt un toro durante el resto del empadre quedur120das.

El segundo grupo solo se solt un toro al mismo tiempo que se inici la inseminacin artificialenelgrupo1yestepermaneciconlasvacas120das. Sellevaronregistrosmensualesdecondicincorporal(SegnGodfreyetal.,1989)ypeso de las vacas. Se realiz el diagnstico de gestacin utilizando ultrasonografa (Honda 1201,tiemporealytransductorlinealde5MHZ)losdas32despusdelainseminacin artificialatiempofijo,alos90dasdeiniciadoelprogramay30dasdespusderetirados eltoros. Das: 0 7 8 9

///
7AM:IMPLANTE CIDR+.5MGDE BENZOATODE ESTRADIOL IATF 7AM:RETIRO DECIDR+25 MGDE PROSTAGLADI 7AM:.5MG BENZOATODE ESTRADIO

Figura3.Protocolodesincronizacin

El anlisisestadstico se realiz utilizando elprograma Statview y se corri una prueba deANOVAparadeterminarlasdiferenciasdelacondicincorporal,gananciadepesoy dasdegestacin.Lasdiferenciasdefertilidadentrelosgrupossedeterminoutilizandola pruebadeJicuadrada.

170

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RESULTADOS

Latasadepreezinicial,intermediayfinalacumuladaentrelosdosgruposnofue diferente(P=.10).Losresultadosdelprimerdiagnsticodegestacinqueserealiz32 das del inicio del empadre a 120 das fueron similares (P = .10) entre el grupo sincronizado y el grupo control (17% vs 19% Figura 1). EL segundo diagnstico de gestacin tambin resulto en una tasa de preez similar entre ambos grupos (75% vs 66%). En resultado del ltimo diagnstico de gestacin realizado 30 das despus de terminado el empadre la tasa de preez tambin fue similar (P = .10) entre el grupo sincronizado(88%)yelgrupocontrol(95%Figura1).

Figura 1. Fertilidad de vacas sincronizadas a tiempo fijo (IATF) y a empadre natural (control)durante120dascondiagnsticodegestacinutilizandoultrasonografacada30 das(P=.10).

Fueinteresanteobservarqueapesardequenoexistierondiferenciasdetasasdepreez entrelosdosgrupos,SinembargolasvacasenelgrupoIATFenelsegundodiagnstico degestacinutilizandoultrasonografatuvieronunmayor(P=.003)nmerodedaspor gestacin (58.23 14.8 das Figura 2) comparado con las vacas expuestas a monta natural(40.818.7dasFigura2).

Las vacas del grupo IATF en su ltimo diagnstico de gestacin utilizando ultrasonografatuvieronunmayor(P=.008)nmerodedasdegestacin(128.914.95

171

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

das Figura 2) comparado conlas vacas expuestas a monta natural(111.8 18.7 das Figura2).

Figura 2. Nmero de das por gestacin en el segundo (P = .003) y ultimo (P = .008) diagnostico de gestacin durante 120 das de empadre en vacas tratadas para ser inseminadasartificialmenteatiempofijo(IATF)yvacasexpuestaamontanatural(control) enunranchocomercialdelnortedeVeracruz.

Lacondicincorporalfuesimilar(P=.10)entrelostratamientosdurantetodoelempadre (Figura3).

Figura3.Condicincorporal(P=.10)duranteelempadrede120dasenvacastratadas paraserinseminadasatiempofijo(IATF)yvacasexpuestasamontanatural(control)en unranchocomercialdelnortedeVeracruz.

172

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Lasvacasenambosgrupospresentaronincremento(P=.05)depesodurantelos 120dasdeempadre.Sinembargolagananciadepesofuesimilar(P=.10)entrelosdos grupos.Elprimermesdepesajequefuealiniciodeltrabajoenlasvacasinseminadasa tiempofijo(IATF)seobtuvounpesopromediode485.485.3kilos(Figura4)comparado con elgrupo control(496.9 72.2 kilos figura 4) enel segundo mes de pesaje en las vacas(IATF)seobtuvounpromediodepesode497.683.2kilos(Figura4)comparado conelgrupocontrol(498.564.1kilosfigura4eneltercermesdepesajeenlasvacas (IATF)seobtuvounpesopromediode510.784.9kilos(Figura4),comparadoconel grupo control(506.3 57.6 kilos figura 4)en el ltimo mes las vacas en elgrupo IATF promediaron 521 72.9 kilos (Figura 4), comparado con el grupo control (525.4 59.0 kilosFigura4).

Figura4.Pesocorporal(P=.10)duranteelempadrede120dasenvacastratadaspara serinseminadasatiempofijo(IATF)yvacasexpuestasamontanatural(control)enun ranchocomercialdelnortedeVeracruz.

La gananciadiaria depeso fue similar (P =.10) entrelos dos grupos. La primera comparacin de ganancia de peso que se llev a cabo al segundo mes se obtuvo una ganancia de 12.2 13.8 kilos (Figura 5) enlas vacas de IATF, en comparacin conlas vacasdelgrupocontrolqueseobtuvounagananciadepesode1.619.5kilos(Figura

173

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

5)eneltercermesseobtuvounagananciadepesode9.522.4kilosenlasvacasde IATF (Figura 5) comparado con el grupo control en donde se obtuvo una ganancia de pesode18.515.3kilos(Figura5)paraeltercermesseobtuvierongananciasdepeso de 35.7 24.0 kilos (Figura 5) en las vacas de IATF, en comparacin con las vacas testigoqueseobtuvierongananciasde28.434.2kilos(Figura5).

Figura5.Gananciadepeso(P=.10)duranteelempadrede120dasenvacastratadas paraserinseminadasatiempofijo(IATF)yvacasexpuestasamontanatural(control)en unranchocomercialdelnortedeVeracruz.

Deacuerdoalagananciadepesototalengramospordanoseencontrdiferencia(P= .10) entre los dos grupos. Las vacas inseminadas a tiempo fijo (IATF) obtuvieron una gananciade230gramosdiarioscomparadoconelgrupodevacascontrolqueobtuvieron 183gramosporda(Figura6).

174

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Figura 6. Ganancia diaria de peso (P = .10) durante el empadre de 120 das en vacas tratadas para ser inseminadas a tiempo fijo (IATF) y vacas expuestas a monta natural (control)enunranchocomercialdelnortedeVeracruz. DISCUSIN

Latasadepreezobtenidaenestetrabajodespusdelainseminacinartificialatiempo fijofuede17%,estevaloresinferioralosreportadospor Pietroetal.,(2006)endonde realizoIATFconysinlaaplicacin deeCG,obteniendoporcentajesdepreezdel38.9% y 55.1%, respectivamente. En ganado lechero sincronizadas para ser inseminadas artificialmente a tiempo fijo utilizando dispositivos de liberacin de progesterona, benzoato de estradiol y con y sin eCG se reportaron tasas de preez de 52% y 41%, respectivamente(Bo,etal.,2009). LosresultadosdelpresenteestudiosepuedencompararconlosobtenidosporVilla

etal.,(2007)dondeevalucuatroprotocolosparainseminacinartificialatiempofijoen
loscualesobtuvoporcentajesdepreezsimilares(1955.7%).Estonosindicaunagran variabilidadderesultadosenlosprogramasdesincronizacindecaloresnosoloatiempo fijo si no todos los protocolos de sincronizacin en general. Los protocolos de inseminacin artificial a tiempo fijo pueden ser incluso ms sensibles debido a los diferentes pasos a realizar y sobre todo a respetar estrictamente los horarios indicados. Unafallaencambiosdehoraspreestablecidaspuedetraerconsecuenciasdevastadoras. Esposiblequeenesteestudiosecometieraalgnerrorenloshorariosyaquelatasade preez de la inseminacin artificial fue muy baja pero un gran nmero de vacas quedo gestantedeltoroenelsiguientecicloestral.

175

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

En el presente trabajo despus del diagnstico de preez a los 30 das de inseminacin artificial en las vacas con tratamiento se di repaso con toro durante los dassiguientesdeempadreyseobtuvouna tasadepreezacumuladade 88%ypara el grupo control de 95%, en general se obtuvo una tasa de preez final del 94%, resultadoqueessimilaralreportadoporCutaia(2005)queobtuvounatasadepreezdel 97.2%, despus de un repaso con toros en 45 das de empadre. De igual modo este resultado coincide con los obtenidos por Baruselli et al, (2002) que obtuvo 92.7% y Penteadoetal,(2005) quereporto79%depreezacumuladaalos90dasconrepaso detoro. Enestetrabajosellevaronregistrosdepesoycondicincorporal,ascomotambinde ganancia de peso mensual y ganancia por da, esto se realiz solo para darle un seguimiento del estado general del hato, factores que no tuvieron ningn efecto en los resultados de preez. Las vacasdurante elempadre ganaron peso y condicin corporal por lo que fue favorable para estos resultados alentadores. Las vacas tuvieron siempre unacondicinoptimaparareproduccinporloquefavoreciestosresultados(Arthington, 1999).

CONCLUSIONES No se encontraron diferencias en la tasa depreezinicial,intermedia o final acumulada entre el grupo control y elgrupo sincronizado IATF. Sinembargo, las vacas en el grupo sincronizado IATF tuvieron gestaciones ms avanzadas en el diagnstico de gestacin intermedioyelfinalporloqueparirnantes,eneliniciodelatemporadadepartosloque lesdarventajaaestasvacas.Serecomiendaqueelprotocolodeinseminacinartificiala tiempofijoselleveacaboporpersonalcapacitado,endondeprobablementesepuedan obtenermejoresresultadosdepreez. BIBLIOGRAFA

1. Arthington,J.1999.UtilizeBodyConditionScoringtoImproveBeefCowProductivity. SouthFloridaBeefForageProgram,UniversityofFlorida,112119.

176

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

2. Baruselli PS, Mrquez MO, Reis EL, B GA. 2003. Tratamientos hormonales para mejorar la performance reproductiva de vacas de cra en anestro en condiciones tropicales. Resmenes V Simposio Internacional de Reproduccin Animal. Huerta grande,Crdoba,27al29dejuniode2003103116.

3. BaruselliPS,ReisEL,MarquesMo,NasserLF,BoGA.2004.Theuseoftreatmentsto improve reproductive performance of anestrus beef cattle in tropical climates. Anim ReprodSci8283:479486.

4. B GA, Cutaia L, Chesta P, Balla E, Picinato D, Peres L, Maraa D, Avils M, Menchaca A, Veneranda G, Baruselli PS. 2005 Implementacin de programas de Inseminacin Artificial a Tiempo Fijo en rodeos de cra de Argentina. 6 Simposio InternacionaldeReproduccinAnimal,Crdoba,Argentina,2426Junio,2005pp97 128.

5. B GA,Cutaia LE, Souza AH, Baruselli ES.2009. Actualizacin sobreprotocolos de IATF en bovinos de leche utilizando dispositivos con progesterona. Taurus, Bs. As., 11(41):2034.

6. Baruselli OS, Marques MO, Carvalho NA, Madureira EH, Campos Filho EP. 2002. Efeito de diferentes protocolos de inseminaco artificial em tempo fixo na eficincia reprodutivadevacasdecortelactantes.RevistaBrasileiradeReproducoAnimal:26 (3):218221.

7. B GA,Cutaia LE, Souza AH, Baruselli ES.2009. Actualizacin sobreprotocolos de IATF en bovinos de leche utilizando dispositivos con progesterona. Taurus, Bs. As., 11(41):2034.

8. CutaiaL.2005.Programas deinseminacinartificialatiempofijo:anlisisdecostose implementacin. Instituto de Reproduccin Animal Crdoba Universidad Catlicade Crdoba.pp123131.

177

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

9. Godfrey, RM., M.J. Guthrie, D.A Neuendorff and R.D. Randel. 1989. Ralationships among parity, pregnancy and endocrine events before and after estrus in Brahman cattle.Theriogenology32:939.

10. GonzalezStagnaro C. 2002. Interpretacin de los registros y diagnstico de los problemasreproductivosenganaderasdoblepropsito.En:AvancesenlaGanadera Doble Propsito. C. GonzlezStagnaro, E. Soto Belloso, L. Ramrez Iglesia (eds). FundacinGirarz.Edic.AstroDataS.A.,Maracaibo.Cap.XXV.pp371399

11. PenteadoL,SaFilhoMF,ReisEL,TorresJR,MadureiraEHyBaruselliPS.2005. Eficincia reproductiva em vacas Nelore (Bos indicus) lactantes submetidas a diferentesmanejosduranteaestacodemonta.XVIReuniodoColegioBrasileirode ReproducoAnimalpp126129. 12. Rapnicki P, Steward S, Eicker S. 2002. Dairy Herd Reproductive Records. VIII CongresoInternacionaldeMedicinaBovina,Madrid,Espaa.1114deDiciembre.82 92pp.2002

13. Pietro S, Baruselli P, Gabriel A, B, Everton L, Rels e Marcio O. Marquez. 2006 Inseminaco artificial em tempo fixo em bovinos de corte. Biotecnologa aplicada en reproducao em bovinos (1 simposium internacional de reproducao animal aplicada, pp,155160.

14. Villa N.A, Morales C.A, Granada J.F, Meza H, Gomez G, Molina J, Evaluacion de Cuatro Protocolos de Sincronizacion para Inseminacion a Tiempo Fijo en Vacas Bos

inducusLactantes.RevistaCientifica(Maracaibo)v.17n.52007.

178

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 31) FERTILIDAD AFECTADA POR NMERO DE SERVICIOS Y LACTANCIAS ENVACASHOLSTEINDELCENTRODELALTIPLANODEMXICO

Fertility Affected by Number of Services and Lactations in Holstein Cows in the HighlandsofCentralMexico

1 1 1 YJCabrera*,ACabrera ,ICDaniel yMALammoglia 1

Facultad de Ciencias Biolgicas y Agropecuarias, Universidad Veracruzana, Poza Rica Tuxpan RESUMEN Durantelas ltimas dcadas la fertilidad envacas Holstein altamente productoras se ha deteriorado significativamente y como consecuencia se han incrementado el nmero de servicios por concepcin y vacas de rastro por problemas reproductivos. El objetivo del estudio fue evaluar el efecto del nmero de servicio, lactancia y ao en la fertilidad de vacasHolsteinenelaltiplanodelcentrodeMxico.Seevalulafertilidadde2479vacas Holsteinprimparasy5600vacasHolsteinmultparasdurantelosaos2008,2009y2010. SeutilizolapruebadeJicuadradaparaevaluarelefectonmerodeservicio,lactanciay aoenfertilidaddevacasHolsteindelaltiplanoenelcentrodeMxico.Lafertilidadnofue afectada (P = .10) por el numero de servicio en vacas primparas y multparas. La fertilidad fue mayor (P= .005) en primparas (41.3%) que en vacas multparas (34%). El ao afecto (P = .005) la fertilidad tanto en primparas como multparas. La fertilidad en vacasprimparasfuemejor(P=.005)enelao2010(43%)queen2008(40%)yenlas vacas multparas el ao 2010 (35%) fue mejor (P = .005) que el 2009 (33%). En conclusin,enesteestudioenelaltiplanodelcentrodeMxicolafertilidadfuemejoren primparasquemultparasyenambaselnmerodeservicionoafectolafertilidad.Enel ao2010seencontrunamejorfertilidadtantoenprimparascomomultparas.

Palabrasclave:Holstein,Numerodeservicios,primparas,multparas.

179

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

INTRODUCCIN Enlaactualidad,lafallaenlaconcepcinenelganadoHolsteinesunosdelosprincipales problemas al que nos enfrentamos ya que un gran porcentaje de las vacas que son desechadasesdebidoaproblemasreproductivos.

Despus del parto, los principales problemas en un hato lechero son el aumento progresivo de los intervalos entre parto concepcin. Se sabe que un intervalo entre partoconcepcin entre 85 a 125 das es el ptimo y de ms de 145 das indica graves problemasreproductivosdelhato(Garcaetal.,2004).

Entremsserviciosmayornmerodedasabiertos,ascomounadisminucinprogresiva en la produccin de leche y mayor riesgo de desecho. Una de las determinantes del aumentoenelnmerodeservicios,puedenserunamalanutricinprincipalmenteenel periodo de secado, enfermedad metablica como la hipocalcemia, partos distcicos, partosgemelares,abortos,momificacin,maceracin,malmanejodelparto,malahigiene, entreotros.Todos estospuedenserfactoresdeterminantesparaprovocarenfermedades del puerperio como retencin placentaria (Garca et al., 2004 Cano, 2006), metritis, endometritis y afectar negativamente la fertilidad, al provocar prolongacin en los das abiertos(Lammogliaetal.2009).

Las vacas lecheras despus del parto caen en un balance energtico negativo, lo cual significa que la suma de la energa necesaria para su propio mantenimiento y la que requierenparaproduciresmayorquelaconsumida,porloquesevenobligadasautilizar sus reservas corporales. Estas vacasllegana su punto ms bajo de balance energtico negativoentrelosdas10y20,ysiguenenbalancenegativoaproximadamentehastalos das 70 u 80 en algunos casos sobre todo las vacas de primer parto, hasta el da 100 posparto. El balance energtico negativo afecta el control neuroendocrino de la reproduccin,locualsehaasociadoconlabajafertilidad(Butleretal.2000). Durante muchos aos el problema de infertilidad se circunscriba solo a las vacas repetidoras es decir a aquellas que llegaban al cuarto servicio sin concebir y que no

180

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

presentaban anormalidades en sus rganos genitales. Actualmente es comn, en los sistemasdeproduccinintensivadeleche,queelporcentajedeconcepcinenvacasde primerservicionoseamayorde35,esteparmetroessimilaraldelasvacasrepetidoras (Morales,2000).Losobjetivosdeesteestudiofuerondeterminarsielnmerodeservicios tieneunefectoenlafertilidaddevacasprimparasymultparasenelAltiplanodelcentro deMxico. MATERIALYMETODOS Lacolectadedatosincluyolosaos2008,2009y2010enelrancho"LaQuinta",ubicado en el Municipio de Actopan en el Estado de Hidalgo, Mxico. Carretera Actopan Chicavasco Km. 1, localizado a una altitud de 1980 metros, con un clima semi seco templado,contemperaturamedia(TM)de14.5C. Tres semanas antes del parto las vacas son alojadas en corrales amplios, echaderos grandesycmodosysinsobrepoblacinparaquetenganelmximoconfortposibleantes delparto.La alimentacin es muy similar alde las vacas enproduccin excepto que se aaden sales aninicas para tratar de evitar lo ms que se pueda retenciones placentarias.Inmediatamentedespusdelpartosedejaquelavacalimpiesucraypasa aqueseleordeecada8horas. Despus del parto la vaca es alojada en un corral llamado transicin que bsicamente consisteenirincrementadolaalimentacinpocoapocoyevaluarlasaluddelasvacas diariamente durante 10 das. Una vez diagnosticadas como sanas y sin problemas pospartosetransfierenaloscorralesdevacasfrescasyaseaprimparasomultparas.En estoscorralespermanecernhastaquesondiagnosticadascomogestantespormediode ultrasonografa(Honda1201,5MHZ,transductorrectallineal).Unavezgestantespasan aloscorralesdepoblacingeneraldevacasgestantesenproduccin. Elestablotiene950vacasenordeaconunavariabilidade20a25vacasmensualesy conunaproduccinactualde37.5litros/vaca/daenlnea.Lasvacassonordeadascada 8horasenunasalaparalelaconcapacidadde76vacas. Elprogramareproductivotieneunperiodovoluntariodeesperade55das.Lasvacasen sumayoraentranalprotocolodePresyncyOvsync.Lasvacasquenoquedangestantes despusdelosprimeros3serviciossontratadasdelasiguientemanera.Siresultavaca altercerservicioestasvacasrecibenunainfusinintrauterinade500mgdeunantibitico

181

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

intrauterino de amplio espectro a base de Cefapirina benzatnica, cefalosporina de primera generacin, resistente a la penicilinasa y activo en ambiente anaerbico (Metricure, Intervet). Posteriormente a este tratamiento las vacas son sincronizadas utilizando 150 mcg de GnRH (Gonasyl, SYBA) y CIDR (Eazybreed CIDR, 1.9 g de progesteronanaturalensilicona,Pfizer),elda0,elda7seretiraelCIDRyseaplica 400unidadesinternacionales(UI2ml)degonadotropinacorinicaequina(eCGNombre comercialFolligondellaboratorioIntervety25mg(5ml)deprostaglandinaF2a (Nombre comercial Lutalyse del laboratorio Pfizer). Al da siguiente del retiro del CIDR se aplica intramuscularmente 5 mg (1 ml) de benzoato de estradiol (nombre comercial Estilbo de laboratorio Syva). Se inseminan las vacas a calor detectado una vez y 6 a 10 horas despusdeiniciadoelcalorseaplicaotradosisdesemen. Sidespusdelcuartoyquintoserviciolasvacascontinanvacasserealizaunainfusin uterina de 120 ml de una solucin yodada no comercial conocida como LUGOL (5 g de yodo I2 y 10 g de yoduro de potasio KI diluidos con 85 ml. de agua destilada, obtenindose una concentracin total de yodo de 150 mg/ml.). Se deja pasar un ciclo estralynuevamentesoninseminadas. Eldiagnsticodegestacinylaevaluacinreproductivaserealizacada15dasutilizando ultrasonografa (Honda 1201, 5 MHZ, tiempo real y transductor rectal lineal). Las vacas diagnosticadasgestantesalos30dassonconfirmadasnuevamentealos90y120das degestacin. Seprocediacolectarlasvariablesreproductivasdelosaos2008,2009y2010conun total de 8079 vacas Holstein puras, mediante un programa Dairy COMP 305 en que se colectaronhistorialesreproductivosdecadavaca,obteniendoinformacindesdeprimeros servicioshastadasenlecheynmerodelactancias. Anlisis Estadstico. Para analizar el efecto nmero de servicio, lactancia y ao en fertilidadseutilizelprogramaestadsticoStatViewyseutilizlapruebadeJicuadrada paradeterminardiferenciasentrelosgrupos.

RESULTADOS

182

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Elnmerodeservicionoafect(P=.10)lafertilidaddelasvacasHolsteinprimparasen elaltiplanodelcentrodeMxico.Apesardequeelnmerodeserviciostempranos(12) se aprecian de mayor valor y el nmero de servicios 7, 8 y 9 se aprecian de menor fertilidadesunadiferencianumricaperonoestadstica(Figura1).

Figura1.Efecto(P=.10)delnmerodeservicioenfertilidaddevacasHolsteinprimparas (n=2479)enelaltiplanodelcentrodeMxico.

De igual forma el nmero de servicios no afect (p= .10) la fertilidad en vacas Holstein multparasenelaltiplanodelcentrodeMxico.Apesardequeelnmerodeservicios1, 2,3y6,7seapreciaconmayorfertilidadquelosservicios8y9essolounadiferencia numricamsnoestadstica(Figura2).

183

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Figura2..Efecto(P=.10)delnmerodeservicioenfertilidaddevacasHolstein multparas(n=5600)enelaltiplanodelcentrodeMxico.

LafertilidadenvacasHolsteinprimparasdeesteestudiohaaumentadoenlosltimos3 aos en donde la fertilidad de las vacas primparas ha ido aumentando siendo el mejor aoel2010yelpeorelao2009(P=.05)siendoel2009intermedio(Figura3).

ElcomportamientodelafertilidadenvacasmultparasdelaltiplanodelcentrodeMxico se comport diferente a las vacas primparas. En las vacas multparas al parecer en el segundo ao se present una cada de la fertilidad pero el ao 2010 se increment nuevamenteexistiendounadiferencia(P=.05)entrelosaos2010y2009peronoconel 2008(Figura4).

184

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Figura3.Efecto(p=.005)aoenfertilidaddevacasprimparasenelcentrodelaltiplano deMxico.

Figura4.Efecto(p=.005)aoenfertilidaddevacasmultparasenelcentrodelaltiplano deMxico.

La fertilidad delas vacas primparas fue mejor (P =.005) que las vacas adultas durante los3aosobservados(Figura5).

Figura5.DiferenciasdefertilidadenvacasHolsteinprimparasymultparas.

185

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

DISCUSIN LafertilidadenesteestudioenvacasdelaltiplanodelcentrodeMxiconofueafectada por el nmero de servicio. EL rango de fertilidad en ganado Holstein es sumamente amplioendiferentesestablosydiferentescondicionesambientales(Fricke,2011).Tixiet

al (2009) reportaron una mejor fertilidad despus del servicio nmero 3 comparado con
losprimerosdosserviciosdiferentealoencontradoenesteestudiode8000vacas.Fricke (2011)reportqueelprimerserviciotantoenvacasmultparascomoprimparaseramejor que los siguientes servicios estos resultados son diferentes a los encontrados en este estudio. Diferencias en los resultados puede deberse al manejo reproductivo que se les da a las vacas conun mayor o menor nmero de servicios. En el estudioreportado por Fricke(2011)todaslasvacasaprimerserviciofueronsincronizadasparaserinseminadas atiempofijolocualnoserealizenesteestudio.Elmanejoreproductivodelasservicios 2 en adelante en el estudio de Fricke (2011) fue tambin basado en la inseminacin artificialatiempofijo.Sinembargo,enesteestudiolasvacasconmsde3serviciosse lesdiounmanejoreproductivodiferenteelcualpudohaberayudadolafertilidaddeestos serviciosyaquenoseencontrarondiferenciasdefertilidadentreelnmerodeservicios. El estudio reportado por Tixi et al (2009) tuvo una mejor fertilidad en los servicios ms avanzadosqueenlosprimeroscontrarioaloquereportaFricke(2011)yalencontradoen esteestudioquenoexistierondiferenciaspornmerodeservicio.Ladiferenciaentrelos estudiospuededeberseaunadeficienciaenladeteccindecelosoalimentacinenlos primeros 100 das en leche en el estudio de Fricke et al (2011) ya que estos primeros serviciossondemuybuenafertilidadengeneralysienelestudiodeTixietal(2009)no fueasalgnproblemaenlosprimeros100dasenlechedebiexistir.

EnelpresentetrabajoseencontrquelafertilidadenvacasHolsteinprimparasesms alto en comparacin de la fertilidad en vacas Holstein adultas, esto es similar a lo reportado por Morales et al (2000). En ese estudio Morales et al (2000) compar la fertilidad de 900 vacas Holstein primparas, 4,102 vacas adultas y 1,818 vacas repetidoras con las mismas condiciones de alimentacin, en las que encontr una fertilidadde59%envacasprimparas,34.4y34.6%envacasadultasyvacasrepetidoras. EstosepudieraexplicaraquelasvacasHolsteinprimparasproducenmenoslecheque lasvacasadultas,asmismoelmetabolismoyflujosanguneoporelhgadoylaubreson mayores entre mayor sea la produccin de leche. De tal manera que vacas ms

186

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

productoraspudierantenermenorconcentracindehormonasreproductivasensangrey por lo tanto menor fertilidad. Este fenmeno fisiolgico se expresa que las vacas de menorproduccintienenunmenorflujosanguneocantidadquepasaporhgadoyubre por lo tanto un menor metabolismo de las hormonas reproductivas principalmente estrgenos y progesterona resultando en una mayor la concentracin de progesterona circulante en sangre, aumentando de esta manera la fertilidad en vacas primparas, contrariodeloquesucedeenvacas(MorrisyDiskin2008Larsonetal.,1995). Tambin se determin la fertilidad en los ltimos aos, reportndose un aumento en la fertilidad en los ltimos aos (2008 2010). Esto coincide con lo reportado con Fricke (2011) quea pesar delaumento enla produccindeleche delas vacas Holstein enlos ltimos aos la utilizacin de nuevos protocolos de sincronizacin de ovulacin e inseminacinartificialhaayudadoamejorarlafertilidadenesteganadointensivodealtas producciones. CONCLUSIONES EnesteestudioenelaltiplanodelcentrodeMxicolafertilidadfuemejorenprimparas queenmultparasyenambaselnmerodeservicionoafectlafertilidad.Enelao2010 seencontrunamejorfertilidadtantoenprimparascomoenmultparas. BIBLIOGRAFIA

Butler WR. 2000. Nutritional interactions with reproductive performance in dairy cattle. AnimReprodSci6061:449457 Cano,C.2006.DiagnsticoYTratamientodelosPrincipalesProblemasReproductivosen losBovinos.FMVZ.UNAM.Archivosdezootecniapag.837840 Fricke,PM.2011.Strategiesforpresynchronizationbefoteresynchronization.21stADSA DiscoverConference:ImprovingReproductiveEfficiencyofLactantingDairyCattle19. Garca, M.E., Quintela, A., Taboada, M., Alonso, G., VarelaPortas, B., Daz, C., Barrio, M., Becerra, J., Pea, A., Deiros, J. y Herradn, P., 2004. Factores de Riesgo de la Metritis en Vacas Lecheras: Estudio Retrospectivo en el No de Espaa. Archivos de zootecnia,53(204):383386.

187

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Lammoglia MA., Daniel IC., Alarcn B., Mendez E., Alarcon MA 2009. Comparacin de Tratamientos de Procesos Infecciosos Uterinos Posparto en Perfiles Reproductivos de VacasLecherasenelTrpicoVeracruzano.IIIForoInternacionalBiolgicoAgropecuario. 15521558

LarsonSF,ButlerWR,CurrieWB,1995.Progesteronesupplementationincreases pregnancyratesinlactatingdairycattle.J.Reprod.Fertil.Abst.Series15,63abstr.

MoralesRS,HernndezCJ,RodrguezTG,PeaFR.2000.Comparacindelporcentaje deconcepcinylafuncinlteaenvacasdeprimerservicio,vacasrepetidorasyvaquillas Holstein.VetMex31:179184

MorrisD.,DiskinM.2008.Effectofprogesteroneonembryosurvival.Animal.2:8.1112 1119.

Tixi C, Villa Godoy A, Montaldo H, Posadas E, Garca C, Hernndez Cern J. 2009. Factores que afectan el porcentaje de vacas gestantes en el da 90 posparto en vacas holsteinenestabulacin.XXXIIICongresodeBuiatria2009pag.884888.

188

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 32) Comportamientode la Produccin y Precio de laLeche enTres pocas delAo


2 JessOrosNoyolaJesus1,NayibBecharaAcarMartnez yMaximinoZitoRomero 2 Figueroa 1,2,3

Facultad de Ingeniera en Sistemas de Produccin Agropecuaria, Universidad Veracruzana, Km 4.5 Carretera Federal AcayucanCatemaco, Acayucan, Veracruz. 01 (924)2479122. 1 Email:ne_die_21@hotmail.com *autorparacorrespondencia

RESUMEN Los sistemas de doble propsito tienen gran importancia en nuestra regin, y se desconocenestudiossobrecmosecomportanlaproduccinyelpreciodelalechepor poca a travs del ao, trayendo consigo baja productividad en el sistema debido a un manejoinadecuado.Seevaluelcomportamientodelaproduccindelecheyelprecioen tres pocas del ao: secas, lluvias y nortes, a travs de seis aos (20052010) se determinolacurvadeproduccindelecheduranteelaoporpocaSeobtuvolacurva depreciodelalecheporpocaatravsdelao,sedeterminolarelacinquehayentreel volumen de produccin y el precio de la leche. Los datos recopilados se analizaron en Excel para sacar porcentajes y varianza adems se utilizo un paquete estadstico para determinar Tukey, comparacin de medias, etc.. Se obtuvo que no hay diferencia significativa para produccin por poca, si habindo para precios por poca recomendndoseconcentrarlaproduccindelecheenlapocaqueelprecioesmsalto, estomedianteconservacindeforrajes,seleccindelganado,pocasdeempadre,buen manejo,etc. Palabrasclave:sistema,doble,propsito,factores,climticos.

SUMMARY Thedualpurposesystemsareofgreatimportanceinourregionandknowhowtobehave studiesontheproductionandthepriceofmilkperdaythroughouttheyear,bringinglow productivity in the system due to improper handling. The behavior of production and the price of milk in three seasons: dry, rainy and north, through six years (20052010), determined the curve of milk productionduring the year by age,is obtained the curve of

189

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

the price of milk per season throughout the year, it was determined the relationship betweenthevolumeofproductionandthepriceofmilk.Datacollectedwereanalyzedin Excel to get rates and variance,plus a statistical package was used todetermineTukey comparisonofmeans,etc...Itwasfoundthatnosignificantdifferencetoproductiontime, iftimehavingtoprice,recommendedtoconcentratetheproductionofmilkatthetimethat thepriceishigher,thismeanspreservationofforage,livestockselection,matingseasons, goodmanagement,etc.. Keywords:system,dualpurpose,factors,climate.

INTRODUCCIN Eneltrpicolalecheesunodelosprincipalesproductosdeunranchodoblepropsito,y presenta una muy marcada estacionalidad de produccin debido a la poca del ao (nortes, lluvias y secas) y los factores que en ellas influyen (temperatura, precipitacin, humedad relativa, disponibilidad de forrajes, etc.), reduciendo considerablemente la produccin. La importancia econmica y social de los sistemas de doble propsito en el trpico latinoamericanosefundamentaenque: Sonproveedoresdealimentosbsicosenlaregin,empleanenformaintensivarecursos debajaproductividadybajocostodeoportunidadsinotrasalternativasenlaproduccin ganadera y se ubican en una gran variedad de ecosistemas: trpico hmedo, seco y zonasdealtura(Rivas,1991). Sonfuentedeingresoparapequeosymedianosproductores,generalmentedeescasos recursosdetierraycapital,amenudosonuncomplementodeotrasactividadesagrcolas osecombinanconestas(lvarez,1991FernndezBaca,1992FernndezBaca,1995 Rivas,1991Ser,1986). Muestra una gran flexibilidad, al permitir una transicin rpida de la actividad de cra y viceversa,enrespuestaalospreciosdelosproductosycostosdelosinsumos(lvarez, 1991FernndezBaca,1992FernndezBaca,1995Rivas,1991Ser,1986). Laganaderadoblepropsitosesustentaenelpastoreoylaproduccinestenfuncin de la disponibilidad de forraje, es por ello que la poca del ao es limitante en la estacionalidaddelaproduccin,afectandoalpreciodelalechequeestenfuncindesu

190

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

oferta y demanda por esta razn se deben abordar juntos, el comportamiento de la produccinyelpreciodelalecheparabuscaralternativasenlaproductividad. El objetivo fue determinar si hay efecto de poca en la produccin y el precio de leche duranteunperiododeseisaos(20052010). MATERIALESYMETODOS EltrabajoserealizoenelsistemadeproduccindedoblepropsitoCristoRey,ubicado en el Ejido El Popotal, municipio de San Andrs Tuxtla, Ver. a 16 km de Juan Daz Covarrubias ubicado en las coordenadas geogrficas 18 15 98 Norte, 95 16 63 Oeste,aunaelevacinde32msnm.,conunclimaclidoregularytemperaturapromedio de28.8C,suelosarcillososcondrenajedeficienteyprecipitacinpluvialmediaanuales de1800mm. Se utilizaron los registros productivos (produccin de leche) y econmicos (precio de ventadellitrodeleche),enunperiododeseisaos(20052010). Sedeterminaronlaspocasdelaodelasiguientemanera:secas(febreromayo),lluvias (junioseptiembre) y nortes (octubreenero). Se aplic el diseo completamente al azar, mediante el paquete de diseos experimentales FAUNL. Versin 2.5. Facultad de AgronomaUANL.Marn,N.L,contrestratamientos(1.secas,2.lluviasy3.nortes),y24 repeticiones (4 meses por poca durante los 6 aos de estudio) y Se recopil la informacin delosregistros productivos yeconmicos mediante elpaquete de cmputo, MicrosoftExcel. Lasvariablesamedirfueron:laproduccindelechemensualacumuladayelpromediode preciomensual,ambosporpoca. RESULTADOS La comparacin de medias por la prueba de Tukey indica que no hay efecto de poca paralaproduccindeleche(P 0.05),entantoparaelprecioporlitrodeleches(P 0.05).

191

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Figura1.ComparacindemediasporTukey,paraproduccindeleche.

Figura2.ComparacindemediasporTukey,paraprecioporlitrodeleche.

DISCUSIN Seencuentraqueenlaunidaddeproduccinnohaydiferenciasignificativaentrepoca (nohayestacionalidad)enlacurvadeproduccindeleche,estosepuededebermsbien aladispersindelosdatosquealadisponibilidaddeforrajes. Para el precio por litro de leche si se encontr diferencia significativa entre pocas (si muestraefectodepoca),estosedebealaofertaydemandadelecheanivelregional. CONCLUSION Los resultados obtenidos nos muestran que no hay estacionalidad para produccin de lechecomoloindialaliteratura,estodebidoalaaltavariabilidaddelosdatosperonos ayudan a plantear recomendaciones para aumentar la produccin de la misma, en las pocas en donde el litro de leche es mejor pagado (si presenta efecto de poca) para obtenerunmayoringreso.

192

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

BIBLIOGRAFIA lvarez,F.J.A.1991.EstrategiaParalaintensificacindelossistemasdoblepropsitoen el trpico. En: Memoria del Seminario Internacional sobre Lechera Tropical. Volumen 2. FIRABANCODEMxico.Villahermosa,Tabasco.P.5887. FernandezBaca,S.1992.Perspectivasdelaproducciondelecheycarneeneltropico americano. En: Avances de la Produccion de Leche y Carne en el Tropico Americano. SalvadorFernandezBaca(ed.),FAO,SantiagodeChile.p.487499. Fernandez Baca, S. 1995. Desafios de produccion bovina de doble proposito en la America Tropical. En: Manejo de la Ganaderia Mestiza de Doble Proposito. Ninoska MadridBuryyEleazarSotoBelloso(eds.),UniversidaddelZulia,MaracaiboVenezuela.p. 119. Rivas,L.1991.importanciayperspecivasdelossistemasdedoblepropositoenAmerica Latinatropical.En:MemoriadelSeminarioInternacionalsobreLecheriaTropical.Volumen 2.FIRABancodeMexico.Villahermosa,Tabasco.p.88119.

Sere,C.1986.Socioeconomiadelaproduccionbovinadedobleproposito.En:Panorama delaGanaderiadeDoblePropositoenAmericaTropical.L.Arango,A.CharryyR.Vera (eds.).ICACIAT.Bogota,Colombia.p.1328.

193

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ33) EFECTODELAAPLICACINDECLORHIDRATODENALOXONASOBRE ELDIAMETROYELDESCENSOTESTICULARENCONEJOSPREPUBERES EFFECT OF THE ADMINISTRATION OF NALOXONE HYDROCHLORIDE ON THE TESTICULARDEVELOPMENTANDTESTESDESCENTINPREPUBERALRABBITS

JuanaOrtegaMondragn,MarcelinoEvodioRosasGarca,MarcoAntonioFajardo Romn,FabiolaPinedaRamrezyLuciaGuadalupeRamrezMedel

National Autonomous University of Mexico. School of Advanced Studies Cuautitln. DepartmentofBiologicalSciences.BiochemistryandPhysiologySection.

Author to whom correspondence should be sent: Juana Ortega Mondragn. Facultad de EstudiosSuperioresCuautitln,UNAM.DepartamentodeCienciasBiolgicas.Seccinde Bioqumica y Fisiologa Agropecuaria. 2.5 Km carretera CuautitlnTeoloyucan, San SebastianXhala,CuautitlnIzcalli,EstadodeMxico.CP.54714.Tel/Fax:56231972.e mail:mvzjom@yahoo.com* autorparacorrespondencia RESUMEN Paraevaluarelefectodelaadministracindenaloxonasobreeldesarrolloyeldescenso testicular de conejos prepberes, se utilizaron 18 gazapos Nueva Zelanda Blanco de 6 semanas de edad, con peso promedio de 1,5 kg. Los animales se asignaron aleatoriamente a dos grupos de tratamiento con 9 animales cada uno. Los conejos del grupoexperimentalrecibieron0,004mgdenaloxona/kgdepesointramuscularmentecada 24 horas, durante 21 das y los del control 0,5 ml de solucin salina. El desarrollo testicular se evalu con un modelo lineal que incluy los efectos fijos de tratamiento, medicinylainteraccinentreestosfactores.Lainformacinseevaluconunanlisisde mediciones repetidas utilizando la metodologa de modeloslineales mixtos. El descenso testicular se analiz con la prueba exacta de Fisher. El largo, ancho, dimetro y porcentajedeconejosquepresentarondescensotesticularfueronmayoresenlosconejos tratados con naloxona (P<.0001). Las medias de cuadrados mnimos error estndar fueron 4,33 0,04 cm 1,37 0,02 2,95 0,03 cm y, 92,59 5,39%,respectivamente mientrasqueparaelgrupocontrolfueronde3,350,07cm0,820,042,520,05y, 48,14 5,39%. El descenso testicular en todos los conejos del grupo experimental se

194

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

present dos semanas despus del tratamiento y en el grupo control ocurri al final del experimento (P<.0001). Los resultados indican que la pubertad de los conejos puede adelantarseparainiciaractividadsexualamenoredadsisontratadosconnaloxona. Palabras clave: Clorhidrato de naloxona, desarrollo testicular, descenso testicular, induccindelapubertadenconejos.

ABSTRACT In order to evaluate the effect of administration of naloxone (opioid antagonist) on the development and testicular descent of prepuberal rabbits, 18 New Zealand rabbits (6 weeks of age, 1,5 kg mean weight) were randomly assigned to each of two treatment groups.Naloxone(0,004mg/kgofbodyweight)wasinjectedintramuscularlyinto9rabbits of the experimental group every 24 hours during 21 days. Animals of the control group received 0,5 ml of saline solution. Testicular development was evaluated with a linear modelincludingfixedeffectsoftreatment,measurement,andtheinteractionoffirstorder amongthesefactors.Theinformationwasevaluatedwithanalysesforrepeatedmeasures using the methodology of linear mixed models. Testes descent was analyzed with a Fishers exact test. Testis length, testis width, testis diameter and percentage of rabbits whichpresentedtesticulardescentwerehigherinrabbitstreatedwithnaloxone(P<,0001). Leastsquaremeanstandarderrorswere4,330,04cm1,370,022,950,03cm, and92,595,39%,respectivelywhereasinthecontrolgroupwere3,350,07cm0,82 0,04 2,52 0,05 and, 48,14 5,39%, respectively. Rabbits of the experimental group show testes descent two weeks after treatment whereas in the control group this was occurredattheendofthetrial(P<,0001).Thestudyindicatesthatpubertyofrabbitscan advancetobeginsexualactivityatyoungerageiftheyaretreatedwithnaloxone. Keywords:Hydrochloridenaloxone,developmenttesticular,testesdescent,inductionof pubertyinrabbits. INTRODUCTION Rabbit has high productive and reproductive performance their upbringing require little physical space and shows a high rate of growth (Zago and Colombo, 2004). It is characterized for being prolific however most of breeding programs are based on the sexualactivityofthefemale,soifthesameattentionisnotgiventothemaleofanything serves have good dams. The development of the annexed glands start at 6 weeksold,

195

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

whichcoincideswiththeverybeginningoftheproductionoftestosteronebythetesticle.At birth, rabbits testes are housed in the abdominal cavity and descend gradually to the normal position at three months of age (Hafez, 2000). The function of the gonads is regulatedbytheanteriorpituitaryglandbymeansofsecretionofgonadotropinsFSHand LH. LH stimulates the secretion of testosterone as a response to GnRH release by hypothalamus. Hypothalamus has substances that are called endogenous opioids peptides (EPO) they may cause therelease of gonadotropins to the hypothalamus. Has beenfoundthatnaloxonehydrochlorideisapureantagonistofEPOcapableofinhibiting EPOactivitycausingthereleaseofGnRHinapulsatingway,whichcausesthereleaseof LH, ACTH, and prolactin (Sharma et al., 2000), which is why there are high levels of testosteroneintestesandtendstoincreaseejaculatorydevelopmentinmales.Inthisway, itis possible to manipulate the sexual behaviour of males and females (Cosgroveet al., 1993). Puberty indicates the time reaches the reproductive capacity due to the descent and testicular development, what happens in the rabbit to three or four months of age (Alvario, 1993). If we may induce puberty, and is achieved by having sexually active malesatanearlyage(23months),thereproductiveactivitycouldbeoptimized.Theaim of the current research was to assess the effect of the administration of naloxone hydrochloride on testicular development and testes descent to accelerate the sexual maturityinprepuberalmalerabbits. MATERIALSANDMETHODS Trial was carry out at School of Advances Studies Cuautitln (FESC), UNAM. Eighteen prepubescent males New Zealand rabbits (6 weeks of age, 1.5 kg mean weight) were randomlyassignedtoeachtwotreatmentgroups.Ninerabbitsoftheexperimentalgroup received0,004mgofnaloxone/kgofbodyweightbyintramuscularlyrouteinjectionevery 24hoursduring21days(Plumb,2006)salinesolutionwasinjectedintramuscularlyinto9 rabbits of the control group. Rabbits of both experimental and control treatment groups were provided with water ad libitum and balanced food. In order to evaluate testicular development,testislength,testiswidthanddiameterofthetesteswere measuredwitha gauge vernier each week during three weeks. Besides, on a daily basis was revised if testeshaddescended.Thelinearmodelusedtoevaluatethedifferenttraitsincludedthe fixed effects of treatment, measurement and the interaction of firstorder between these factors. Testicular development was evaluated with an analysis of repeated measurements. Testes descent was analyzed with the Fishers exact test. Information

196

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

analysis was conducted using the methodology of linear mixed models using Statistical AnalysisSystem(SAS,2008).

RESULTSANDDISCUSSION Least square means standard errors of testes development and testicular descent by treatment group and week of measurement are shown in table 1. Testicular descent occurredfasterinrabbitstreatedwithhydrochloridenaloxone,inwhichtestesdescended almostinallrabbits(77,779,35%)duringthefirstweekoftreatmentwhereastestesof animals whichno were administered naloxone droppedin all oftherabbitsuntil the third week (P<,0001). Percentage of testicular descent in rabbits injected with the opioid antagonist was 44,44 8,79 percentage units higher than the percentage of testicular descentinanimalsofcontrolgroup(P<,0001).Length,widthanddiameteroftesteswere higherinrabbitstreatedwithnaloxonehydrochloride(P<,0001).Testesofrabbitsinjected withnaloxonewere0,970,08cmlonger(P<,0001),0,540,05cmwider(P<,0001)and had0,430,06cmlargerdiameter(P<,0001)thananimalswhichwerenotadministered to naloxone. It is known that animals have reached puberty when they show secondary sexualcharacterssuchasthedevelopmentofthepenisandthedescentoftestes,which occursbetweenthreeandfourmonthsofage(Alvario,1993ZagoandColombo,2004). Inthisresearchwefoundthatthishappenedat7weeksofage,indicatingthatnaloxoneis useful to induce puberty. Results obtained in this research agree with those found by Plumb (2006) who comment that the application of naloxone affects the activity of the hypothalamicpituitarygonadal axis, resulting in testicular descent early in prepubescent animals. Results of testicular diameter found in the experiment are greater than those obtained by Alcazar (1991) who using 0,25 and 0,50 mg/kg (intramuscularly, 12 hours during eight days) doses of naloxone got testicular diameters between 1,47 4,58 and 1,644,19(P<,10).StudiesbySharmaetal.(2000)showthattheopioidsandendorphins inhibits GnRh downloads andincrease concentrations of steroids and LH whichleads to anincreaseinthegonads,resultsagreewithcurrentstudy.Itisknownasthesecretionof LHRH modulated by endogenous opioids, and opioid agonist administration causes a decline in the throbbing secretion of LH, which is why the administration of an opioid antagonist causes an increase in the throbbing secretion of LH (Pedrn, 1996 Plumb, 2006).

197

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CONCLUSIONES The study provides evidence that puberty of prepubescent rabbits can be advanced if theyaretreatedwithnaloxonehydrochloridetoinitiatesexualactivityatyoungerage. Table1.Leastsquaremeansstandarderrorsofdevelopmenttesticularandtestes descendbytreatmentgroup(average)andweek Experimentalgroup 1 Average _ Testislength,cm. a 0,04 Testiswidth,cm. 0,02a Testisdiameter,cm. a 0,03 Testesdescend,%. a 5,39
a 4,240,08

Week 2
a 4,310,07

_ 3 _
a 4,440,07 a 1,460,04

4,33 1,37 2,95 92,59

a 1,300,051,350,04

a 2,940,062,950,052,970,05 a 77,779,35 a 100,009,35 a 100,009,35

Controlgroup b b Testislength,cm. ne 3,350,11 3,450,07 3,35 b 0,07 b b Testiswidth,cm. ne0,820,07 0,910,04 0,82 b 0,04 b b Testisdiameter,cm. ne 2,520,08 2,540,05 2,52 b 0,05 b b a Testesdescend,%. 0,009,35 44,449,35 100,009,35 48,14 b 5,39 ________________________________________________________________________ __ a,b Meanswithdifferentletterbetweentreatmentgroupsbyweekarestatisticallydifferent (P<,0002). ne = Do not estimated because there were no testicular descend in the first week in rabbitsofcontrolgroup.

198

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CITEDLITERATURE Alczar, N. A. 1991. El efecto de la naloxona sobre el dimetro testicular y la libido del conejo. Tesis de Licenciatura. Facultad de Medicina Veterinaria y Zootecnia, UNAM. Alvario,M.R.1993.ControlenlaReproduccindelConejo.MundiPrensa,Espaa. Cosgrove,J.R.andRensisF.F.1993.Opioidergicpathwaysinanimalreproduction:Their roleandeffectsoftheirpharmacologicalcontrol.AnimalReproductionScience.33. 373392. Pedrn,N.Pedroza,D.Calzada,L.Salazar,LandFuentes,V.1996.Effectofnaloxonein serum testosteroneinadultmalerabbits.ArchivesofAndrology.37:1518. Plumb, D. C. 2006. Manual de Farmacologa Veterinaria. 5 ed. InterMdica. Buenos Aires. SASInstituteInc.2008.SAS/STATUsersGuide(Release9.1),Cary.NC.,USA. Sharma, P., Bhrdwaj, SK., Sandhu, SK. and Kaur, G. 2000. Opioid regulation of gonadotropinrelease:Roleofsignaltransductioncascade.BrainResearchBulletin. 52(2):135142. Zago,L.GyColombo,T.2004.Elconejo:Crarentable.DeVecchiS.A,Madrid,Espaa.

199

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 34) VALIDACIN DE RACIONES FORMULADAS POR PROGRAMACION LINEALAMNIMOCOSTOCONSOLVER VALIDATION OF RATIONS MADE BY LINEAR PROGRAMMING AT MINIMUM COST WITHSOLVER
1 2 MaximinoZitoRomeroFigueroa ,JosAntonioFernndezFigueroa ,CuauhtmocLanda 2 1 Torrealba ,JavierFranciscoEnrquezQuiroz 1

CE Cotaxtla CIRGOC INIFAP 2FISPAUV. romero.maximino@inifap.gob.mx* autor para

correspondencia RESUMEN Elobjetivofuevalidarracioneselaboradasconingredientesdelareginyformuladaspor programacinlineal a mnimo costo (PLMC) con auxilio dela herramienta Solver dela hojadecalculoExcel.Serealizaron2pruebasdecampo:1enLasChoapas,Ver.para validarunaracinintegralformuladaporPLMCyelaboradaartesanalmentealcompararla con el alimento de marca lder en el mercado (MR), utilizando borregos pelibueyen confinamiento.2 en Acayucan, Ver., para validar un suplemento formulado por PLMC para obtener ganancias diarias de peso de 1 kg con toretes en pastoreo. En la primera pruebanoseencontrarondiferenciassignificativas(P>0.05)enGP(9.31avs8.12aKg)y en GDP (0.150a vs 0.131a) entre la racin PLMC y MRrespectivamente, el anlisis econmicoindicaqueelcostodeproduccinporkgdepesovivofuesuperioralpreciode venta para MR ($34.30 vs $23.00) no siendo as para PLMC ($21.60 vs $23.00), la rentabilidadsobrecostosvariablesdelprocesofue2.5%paraMRy15%paraPLMC.En la 2 prueba la racin formulada por PLMC obtuvo 1.249 kg de GDP, el anlisis econmico indica que suplementar los toretes obtuvo 35 % de Rentabilidad sobre costo adicionales.SerecomiendaformularracionesporPLMCconauxiliodelosprogramasde cmputo. Palabrasclaves:Borregos,toretes,alimentacin,rentabilidad,costos.

ABSTRACT It was evaluated the effectofinoculatingruminal microbestocalvesfromartificial breeding, 27calves(6malesand21females) atbirthwere separatedfromtheirmothersandfed twicedaily (morning andafternoon) withcolostrumuntilday 5and4Lofmilk replaceruntilweaning(90 d).

200

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

They were divided into 3 groups with 7 repetitions (5 females and 2 males), treatments were randomly assigned: control (T), rumen microflora (MR) and MR most

Saccharomyces cereviciae(MRL), MR and MRL were inoculated through milk replacer


twice, a month after birth and 15 days after, the study was conducted to weaning (three months of life). Thevariables were: dailyweightgain(GDP)kg, bodycondition(CC) 15, left sideabdominalwidth(CIA) ANDEVAandTukey, cmandabdominaldiameter(DA) we cm, wasperformedusing determined weightthan

theprofitabilityonadditionalcostsfortreatmentandthemarginalincomegainextra

the control. It was found a significant difference (P <0.05) inGDP: 0.335b, 0.411a and0.368abforT, MRandMRL. The Othervariableswere similarstatistically (P>0.05). MRLandMRtreatmentshadaweightgainof6.84and2.97kgcomparedwithcontrols.Economic analysis forMRandMRL determined$ 40.00and$ 40.25, of additionalcost, $ 123.00and$ 53.00ofincremental revenue, $ 83.00and$ 12.75ofutilitythis adds upto207.8% and 28.8% profitabilityforthesepractices. Keywords:Sheep,bulls,feeding,yield,costs.

INTRODUCCIN En las regiones tropicales el suministro de racioneses una prctica necesaria para mantenerla condicin del ganado o para incrementar la produccin de leche o carne.La formulacin deraciones es un proceso complicado cuando hay que considerar mltiples ingredientes, necesidades nutricionales, consideraciones de precios y relaciones expresadas como mayor o menor que alguna cantidad en estas circunstancias la programacin lineal a mnimo costo (PLMC) permite la consideracin simultnea de parmetroseconmicosynutricionales,sinembargoeldesarrollomanualdeestatcnica eslargoycomplicado,enlaactualidadconlascomputadorassepuedehacerdemanera rpida,noobstantedebeserunprocesointeractivo,elprofesionistadebeverificarqueel resultado se adapte al conocimiento nutricional, es decir, que la racin sea aceptable para el animal, no contenga nutrientes y otras substancias en cantidades txicas, entre otras cosas(Pardo, 2007). El objetivo fue validar bajo condiciones comerciales raciones elaboradas con ingredientes de la regin y formuladaspor PLMCcon auxilio dela herramientaSolverdelahojadecalculoExcel,paraloculserealizaron2pruebasde campo.

201

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

MATERIALESYMTODOS Prueba1)Validacinconborregospelibueyengordadosenconfinamientoenelmunicipio deLasChoapasVer. Secompararon2racionesisoproteicascon14%dePCy3.4Mcal/kgalmenos: A) Alimentodemarcalderenelmercado(MR) B) Racinintegralformuladaporprogramacinlinealamnimocostoconlapaquetera delacomputadora(PLMC) Seutilizaron16ovinospelibueyde18kgdepeso,melaza,harinadesoya,harinadeave, sorgo,ureayP.purpureum,corralesrsticosseformaron2gruposcon8repeticiones, lostratamientosMRyPLMCseasignaronalazar,elperododeestudiofuede62das, se registr semanalmente elpeso delos animales, el consumo de alimento ylos costos variables.SedeterminlaGananciadepeso(GP)kggananciadiariadepeso(GDP)kg la conversin alimenticia (CA), costos de alimentacin por kg de peso vivo (CPV) se realizlapruebaTdeStudentyelanlisiseconmicoporanimaldeterminandoloscostos variables($),losingresos($),lautilidad($)ylarentabilidadsobrecostosvariables(%). Prueba 2) Validacin suplementado toretes en pastoreo de Panicum mximum cv TanzaniadesarrolladosenelmunicipiodeAcayucan,Ver. Durante85dassedioseguimientoadosgruposdetoretes: A)PastoreorotacionaldeTanzania(P),ciclo1/29ddepastoreoydescanso. B) El manejo anterior ms 1.5 kg diarios de una racin (PLMC) formulada para complementarelaportedelpastizalyobtenerGDPde1kg(NRC,2000). Seutilizaron10toretessuizos/cebude174kg,desparasitados,implantadosyvitaminados, melaza, harina de soya, harina de ave, sorgo, urea, salvado y pollinaza se formaron 2 gruposcon5repeticiones,lostratamientosseasignaronalazarelperododeestudiofue de 85 das, se registr el consumo de alimento, los costos variables y el peso de los animales cada 28 das. Se determin la Ganancia de peso (GP) kg ganancia diaria de peso (GDP) kg se realiz el anlisis econmico por animal determinando los costos variables ($), ingresos marginales ($), utilidad adicional ($) y rentabilidad de la practica sobrecostosvariables(%).

202

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RESULTADOS Prueba1)Validacinconborregospelibueyengordadosenconfinamiento En el cuadro 1 se observa que el costo de la racin PLMC ($3.25) fue 27.7% menor al costo de la racin MR ($4.50), no se encontr diferencia estadstica (P>0.05) en GP (8.12a vs 9.31a) y GDP (0.131a vs 0.150a) para MR y PLMC respectivamente la CA fue7.630kgparaMRy6.660kgparaPLMC,mejorquelos8kgreportadocomoidealen borregos (Shimada, 2003) el CPV con MRfue superior al precio de venta ($34.30 vs $ 23.00) y con PLMC inferior ($21.60 vs $23.00),la RCV del proceso fue de 2.5 % para MRy15%paraPLMC,dondeeldiferencialdepesofuedeterminantelaracinelaborada porprogramacinlineala mnimocostoregistrlasmismasvariablesproductivasquela racincomerciallderenelmercadoperosurentabilidadfuemayor. Cuadro 1. Validacin de una racin formulada por programacin lineal a mnimo costo paraengordarovinos MR PLMC Dif% Pesoinicialdelosborregospromedio(kg) 19.120 16.800 12.1 Pesofinalpromedio(kg) 27.250 26.180 3.9 Gananciadepeso(kg) 8.12a 9.31a 14.6 Gananciadiariadepeso(kg) 0.131a 0.150a 14.6 Conversinalimenticia(kg:1kg) 7.630 6.660 12.7 Costo/kgdealimento($) 4.50 3.25 27.7 Costodealimentacinporkgdepeso($) 34.30 21.60 37.7 CostosVariables($) Borregoalacompra($)$18.00kg Gastosdemedicinasymanodeobra Alimentacin(1kgdiario*62d*$) Ingreso($)(kg*$23.00) Utilidad($) Rentabilidadsobrecostosvariables(%) 642.84 344.16 19.68 279.00 626.75 16.09 2.50 523.58 302.40 19.68 201.50 602.14 78.56 15.00 18.55 12.1 0 27.7 3.9 588 700

Prueba2)ValidacinsuplementadotoretesenpastoreodeP.mximumcvTanzania Enestecasoseobserv(Cuadro2)queelcostodelaracinPLMCfuede$3.04,ms bajo que las raciones de marca para engordar toretes y que la formulacin cumpli las expectativasalobtener1.029kgdeGDPal3erperodode28daslaGDPde1.500kg en el 1er perodo se explica por el efecto el peso compensatorio el anlisis econmico demuestra que en este caso la suplementacin fue una prctica rentable por s misma

203

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(35%en85das).LaracinformuladaporPLMCcumpliconelobjetivoparaelquefue formuladayacostosquehicieronestaprcticarentable. Cuadro2.Validacindeunaracinformuladaporprogramacinlinealamnimocosto paradesarrollartoretesenpastoreo. Pastoreo P+PLMC Dif% Pesoinicialpromediodelostoretes(kg) 173.000 175.400 1.39 Pesofinalpromedio(kg) 231.600 281.600 21.59 Gananciadepeso(kg) 58.600 106.200 81.23 Gananciadiariadepesoen85d(kg) 0.689 1.249 81.23 Gananciadepesoporsuplemento(kg) 47.600 CostosVariablesadicionales($) Consumototal85das*1.500kg/da(kg) Costodelalimento($3.04/kg)($) Manodeobra IngresoMarginal($)($17.00/kg) Utilidadadicional($) Rentabilidadsobrecostosvariables(%) 600.10 127.500 387.60 212.50 809.20 209.10 35

CONCLUSIONES La programacin lineal a mnimo costo permite optimizar los insumos regionales para formularracionesyaprovecharelpotencialgenticodelganadoeneltrpico. Los programas de cmputoson una alternativa prctica yrpida para que el tcnico elaboreencamporacionesporprogramacinlinealamnimocosto. Se recomienda la formulacin de raciones por programacin lineal a mnimo costo con apoyodelosprogramasdecmputo. Se sugiere explorarotras reas delas prcticas agropecuarias donde se puedan aplicar estetipodeprogramasdecmputo.

BIBLIOGRAFA NRC. 2000. Nutrient Requirements of Beef Cattle. 7th Rev. National Academies Press, Washington,D.C.242p. Pardo Rincn Nstor Alfonso. Compilador. 2007. Programacin matemtica. Manual de NutricinAnimal.Edt.GrupoLatinoEditoresLtda.1ed,p230.Bogot,Col.

204

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 37)GANANCIA DIARIA DE PESO Y RENTABILIDAD DE INOCULAR MICROFLORA


RUMINALENBECERROSDECRIANZAARTIFICIALENELTRPICO DAILY GAIN WEIGHT AND PROFITABILITY OF RUMEN MICROFLORA INOCULUM IN ARTIFICIALREARINGCALVESINTHETROPICS

2 1 JosAntonioFernndezFigueroa , MaximinoZitoRomeroFigueroa ,MoissPalacios 2 1 Rosas ,JavierFranciscoEnrquezQuiroz .

CECotaxtlaCIRGOCINIFAP2FISPAUV.romero.maximino@inifap.gob.mx*autorpara

correspondencia RESUMEN

Se evalu el efecto de inocular microflora ruminal a becerros de crianza artificial 27 becerros (6 machos y 21 hembras) que al nacer fueron separados de sus madres y alimentados dos veces al da (maana y tarde) con calostro hasta el 5 da y 4 L de substituto de leche hasta el destete (90 d). Se formaron 3 grupos con 7 repeticiones (5 hembras y 2 machos), los tratamientos se asignaron al azar: Testigo (T) Microflora ruminal(MR)yMRmsSaccharomycescereviciae(MRL)MRyMRLseinocularona travsdelsustitutodelecheendosocasiones:almesdenacidosy15dasdespus,el estudioserealizhastaeldestete(tresmesesdeedad).Lasvariablesevaluadasfueron: Ganancia diaria de peso (GDP) kg Condicin corporal (CC)15 Ancho del costado izquierdo abdominal (CIA) cm y dimetro abdominal (DA) cm se realiz ANDEVA y Tukeysedeterminlarentabilidadsobrecostosadicionalesportratamientoyelingreso marginalporlagananciadepesoadicionalenrelacinaltestigo.Seencontrdiferencia significativa(P<0,05)enGDP:0.335b,0.411ay0.368abparaT,MRyMRL.Lasdems variablesfueronigualesestadsticamente(P>0.05).LostratamientosMRyMRLtuvieron unagananciadepesode6,84y2.97kilogramosrespectoaltestigo.Elanlisiseconmico paraMRyMRLdetermin$40.00y$40.25,decostosadicionales,$123.00y$53.00de ingresosmarginales,$83.00y$12.75deutilidadestoseresumeen207.8%y28.8%de rentabilidadporestasprcticas.

205

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Palabrasclaves:Etologa,colonizacin,transfaunacin,microbiota

ABSTRACT

It was evaluated the effect of inoculating ruminal microbes to calves from artificial breeding,27calves(6malesand21females)atbirthwereseparatedfromtheirmothers and fed twice daily (morning and afternoon) with colostrum until day 5 and 4 L of milk replaceruntilweaning(90d).Theyweredividedinto3groupswith7repetitions(5females and 2 males), treatments were randomly assigned: control (T), rumen microflora (MR) and MR most Saccharomyces cereviciae (MRL), MR and MRL were inoculated through milk replacer twice, a month after birth and 15 days after, the study was conducted to weaning (three months of life). The variables were: daily weight gain (GDP) kg, body condition(CC)15,leftsideabdominalwidth(CIA)cmandabdominaldiameter(DA)cm, was performed using ANDEVAand Tukey, we determined the profitability on additional costs for treatment and the marginal income gain extra weight than the control. It was foundasignificantdifference(P<0.05)inGDP:0.335b,0.411aand0.368abforT,MRand MRL.TheOthervariablesweresimilarstatistically(P>0.05).MRLandMRtreatmentshad aweightgainof6.84and2.97kgcomparedwithcontrols.EconomicanalysisforMRand MRL determined $ 40.00 and $ 40.25, of additional cost, $ 123.00 and $ 53.00 of incremental revenue, $ 83.00 and $ 12.75 of utility this adds up to 207.8% and 28.8% profitabilityforthesepractices. Keywords:Ethology,colonization,rumenmicroorganisms.

INTRODUCCIN Los bovinos son animales gregarios por naturaleza, la importancia de la manada en la formacindelosnuevosmiembrosincluyeaspectosfisiolgicosyconductuales,mismos queseveninterrumpidostemporalmentecuandoelhombreimplementalacrianzaartificial delos becerros considerandoexclusivamente la alimentacin, uno deestos aspectos es lacolonizacindelrumen,queresultadelainteraccindelbecerroconlamanada. Considerando que en las explotaciones tropicales la base de la alimentacin son los pastos, el desarrollo del rumen y su microbitica cobra importancia El objetivo fue evaluar el efecto y la rentabilidad de inocular microflora ruminal a becerros en crianza

206

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

artificial.

MATERIALESYMTODOS El trabajo se realiz en una explotacin comercial de lechera tropical intensiva en el municipiodeSoconusco,Ver.,dondelosbecerrossecranartificialmente.Seutilizaron27 becerros(21hembrasy6machos)suizosamericanosquealnacerfueronseparadosde susmadresyalimentadosdosvecesaldaconcalostropor5das,posteriormenteseles suministr 4lt de substituto deleche(20% de PC, 2%de grasa y 51% de ELN) en dos tomas (maana y tarde)hastalos 90 das en que sedestetaron,durante ese tiempo los becerrosdisponandeaguayconcentrado(20%dePC)alibertadenpotrerosdeestrella defricaygramasnativas. Se formaron 3 grupos con 9 repeticiones (7 hembras y 2 machos) el orden de los tratamientosfuealazaryseasignaronalnacimiento. T=Representelmanejotradicionaldelranchotestigo. MR=Grupoalqueseinoculmicrofloraruminalliofilizada MRL=MRmsSaccharomycescereviciaelevaduradecerveza. Seutilizelsubstitutodelecheparainocularlostratamientosylosposterioresrefuerzos bajoelsiguienteesquema:

Cuadro1.Edaddelosbecerrosydosisinoculadasdemicroorganismos.
Edad(das) 15 16 46 Microfloraruminal 7.5gr 15gr 15gr Microfloraruminal+Levadura 7.5+2gr 15+2gr 15+2gr

Lasvariablesamedirfueron: La ganancia de peso GP (kg): considerada como el peso al destete (90 das de edad) menoselpesoalnacimiento. LagananciadiariadepesoGDP(kg)determinadaaldividirlaGPentre90. Crecimiento del costado izquierdo abdominal CI (cm) la diferencia del radio abdominal izquierdo entre la primera inoculacin (15 das) y a los 90 das de edad, de la apfisis espinosalumbaralbordedelaltimacostilla,conunvernier. SerealizanlisisdevarianzaylapruebadeDMSparadiferenciarmedias. Para determinar la rentabilidad de la prctica se registraron los costos adicionales y se

207

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

determinlagananciamarginal.

RESULTADOSYDISCUSIN Los resultados indican diferencia significativa (P< 0,05) en GP, inocular MR y MRL represent23y10%masGPqueeltestigo,respectivamente,porconsecuencialamisma tendencia se observ en la GDP (cuadro 2). Las dems variables fueron iguales estadsticamente (P>0.05), aunque el CI mostr la misma tendencia donde MR y MRL fueronsuperioresen17y11%respectivamenteenrelacinaltestigoestosresultadosse debenprobablementeaquelosbecerrosempiezanaingeriralimentosslidosdespusde 23semanasdenacidos(OrskovE.R.yM.Ryle,1998)ylosmicroorganismosruminales permiten aumentar la eficiencia con que es utilizado dicho sustrato (Church, 1993), en este caso concentrado la levadura no supero a los microorganismo ruminales porque bsicamente favorece el desarrollo de bacterias celulolticas (Yoandra, 2006) y en este casolosbecerrosporserrumiantesenformacinelconsumodeforrajeeramnimo. Los tratamientos MR y MRL tuvieron una ganancia de peso adicional de 6.84 y 2.97 kilogramosrespectoaltestigo,cuyovaloreslabaseparadeterminarelingresoadicional por esta prctica y realizar el anlisis econmico determin 207% de rentabilidad por inocularmicrofloraruminalliofilizada(MR)abecerrosencrianzaartificial(Cuadro2).

Cuadro2.Inoculacindemicrofloraruminalabecerrosdecrianzaartificial Testigo GDP(kg) GananciadePeso(kg) Gananciadepesoadicional(kg) 0.335b 30.150b MR 0.411a 36.99a 6.840 MR+Levadura 0.368ab 33.12ab 2.970

Costoadicional($) IngresoMarginal($18.00/kg) Gananciadelapractica($)

40.00 123.12 83.12

41.50 53.46 13.21

208

Rentabilidadsobrecostoadicional(%)

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 207.8 28.81

Esteestudiosugierelaimportanciaderestablecerenlosbecerrosaspectosfisiolgicosy conductualesquelesontransmitidosporlamanada,porqueestosrepercutenenmejores comportamientosproductivos. CONCLUSIN. Inocularmicrofloraruminalliofilizadaenlosbecerrosdecrianzaartificialdeestalechera tropicalfueunaprcticarentable.

BIBLIOGRAFA
E.R.Orskov.1988.NutricinProteicadelosRumiantes.p2835 ShimadaM.A.2007.NutricinAnimal.Trillas.p98105 D.C.Church1993.ElRumianteFisiologaDigestivaynutricin.Acriba. p50150 I.H.Meja,MemoriaXLIIReuninNacionaldeInvestigacinpecuaria,EfectodelaAdicindela Levadura Saccharomyces cerevisiae a Dietas de Ovinos Sobre Parmetros Productivos y la FermentacinRuminal. Ybalmea,R.2005.Efectodelaproporcinytipodefibradelasdietasintegralesenlamorfometra y desarrollo del estmago de terneros jvenes.Revista Cubana de Ciencia Agrcola 2005, Vol. 39,No3,p279285, MarreroYoandra.2006.EfectoinvitrodeSaccharomycescerevisiaeenlapoblacinmicrobiana ruminaleindicadoresfermentativos.RevistaCubanadeCienciaAgrcola Vol.40

209

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 38)Calidad de Calostro e Inmunidad de Becerros Neonatos Brahman en la RegindeTuxpan,Veracruz

Quality of Colostrum and Immunity of Newborn Brahman Calves in the Region of Tuxpan,Veracruz

1 1 1 1 ALLeal*,ICDaniel ,MAAlarcon ,ACabrera yMALammoglia

Facultad de Ciencias Biolgicas y Agropecuarias, Universidad Veracruzana, Poza Rica Tuxpan RESUMEN ElobjetivodeestainvestigacinfueevaluarlacalidaddelcalostrodevacasBrahmanyla concentracin de inmunoglobulinas en suero de sus becerros neonatos en un manejo tradicionaldelaregindeTuxpan,Veracruz.Seseleccionaron20vacas(multparasn=12 y primparas n=8) prximas al parto. Las vacas fueron observadas cada 3 horas y despus del nacimiento se dej que el becerro consumiera el calostro de uno de los cuartos,enseguidasearrearonlavacaconsucraalcorralylavacaerasometidaenuna mangademanejo,seleadministraron30UIdeoxitocinavaimyseordearonafondo, se midi la cantidad de calostro producido y ste se estabiliz a temperatura ambiente, posteriormente se determin su calidad utilizando un calostrmetro. A las 72 horas de haber consumido por primera vez calostro los becerros fueron sujetados y de la vena yugularseextrajeron8mldesangre.Lasangresedejcoagularyfuecentrifugada.Se tom una gota de suero y la concentracin de inmunoglobulinas fue evaluada con un refractmetro. Se registr el peso al nacimiento y sexo de los becerros. Se corri una prueba de ANOVA y en los becerros se uso como covariable peso al nacimiento. La calidad del calostro de vacas Brahman primparas y multparas fue consideraba muy buena (89.5 3.0 g/dl). La calidad y cantidad de calostro fue similar (P = .10) entre primparas y multparas. Los becerros neonatos tuvieron una concentracin de inmunoglobulinasensueroptima(7.9 .29g/dl)noencontrndosediferencias(P=.10) entre machos y hembras. En conclusin, la calidad del calostro de vacas Brahman y la concentracindeinmunoglobulinasensuerodesusbecerrosneonatosenunsistemade

210

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

manejotradicionaldelaregindeTuxpan,Veracruzresultaronennivelesrecomendados paratenerbecerrossanos. Palabrasclave:Calostro,Inmunidad,Neonato,Brahman.

INTRODUCCION Lamayoradelosproductoresdeganadolecheroespecializadoestnconscientes dela importanciadesuministrarcalostroalosternerosneonatosdurantelasprimerashorasde vida.Latransferenciadeinmunidadpasivaatravsdelcalostromaternoesfundamental paralasaludysupervivenciadelbecerroenlasprimerassemanasdevida,yesunade lascausasmsimportantesdelamorbilidadymortalidad(Lazzaroetal.,2002). Las principales clases deinmunoglobulinas (Ig) producido por el ganado son IgG, IgG1, IgG2, IgM e IgA(Butler,1969). Porloquela inmunidad pasiva dependeexclusivamente de la absorcin intestinal de Ig del calostro durante las primeras 24 horas despus del nacimiento (Butler, 1974 Stott et al., 1976, Scott et al., 1979 Larson et al., 1980). La relacinentrelatitulacindeinmunoglobulinasabsorbidasylasaluddelasbecerrasha sidoampliamentereconocida(Butler1969,Besseretal.,1985,Gay1983).Porlotantose vuelve imprescindible generar datos cerca de la verdadera produccin de calostro y algunas de sus caractersticas en los hatos lecheros del trpico. El objetivo de este estudio fue determinar la cantidad y calidad de calostro producido por vacas Brahman primparasymultparasylaconcentracindeinmunoglobulinasensuerodesuscras72 horasdespusdelparto. MATERIALESYMETODOS EnunranchocomercialdeganadoderegistroBrahmanenlaregindeTuxpan,Veracruz se seleccionaron 20 vacas (multparas n=12 y primparas n=8) prximas al parto. Las vacaseranobservadasvariasvecesaldaparadeterminarelmomentodelpartodecada unadeellas.Despusdelpartoselepermitaalacraconsumirelcalostrodeuncuarto. Enseguidalavacaysucraeranarreadasalcorral.Lavacaseasegurabaenlamangade trabajoyseleinyectabaintramuscularmente30UIdeoxitocina(FacilpartdeSyba)para inducirlaeyeccindelprimercalostro.Seprocedaaobtenerelcalostromanualmentede los3cuartosqueelbecerronoconsumi.Elcalostroobtenidosedejqueseequilibrara atemperaturaambientalantesdeevaluarsucalidad.Lacalidaddelcalostrofueevaluada

211

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

utilizandouncalostmetrocomercial(Nasco,FortAtkinson,WI)delasiguientemanera: Se depositaron aproximadamente 300 ml de calostro puro sin espuma en un tubo de plstico y se introdujo el calostmetro. De acuerdo a la inmersin del calostmetro al borde del calostro se obtiene una lectura numrica y de color. El calostmetro est calibradoenintervalosde5mg/mlyloclasificaenpobre(rojo)paraconcentracionesentre 22y25mg/mlyexcelente(verde)paraconcentracionesmayoresa50mg/ml.Seregistr lacantidadycalidaddecalostroobtenido.Despusdecolectarelcalostroypesarlacra, ambas eran arreadas a otro potrero conlasmismas condiciones quela anterior pero en esteseencontrabanlasvacasrecinparidas. Aproximadamente72horasposterioresalconsumodecalostrolacraerasujetadaydela vena yugular se colectaban 8 ml de sangre utilizando tubos vacoutainer con aguja y adaptador. Los tubos se centrifugaban a 2,600 revoluciones por minuto durante 10 minutos para separar el suero. Se obtena una gota grande de suero y se pona en el refractmetrodandounalecturadeladensidaddeste.Conelrefractmetrosemidelas protenastotalesdelsuero,nolasinmunoglobulinasperosetomabacomounamedidade inmunoglobulinas ya que existe una estrecha correlacin entre protenas totales e inmunoglobulinas. El anlisis estadstico se realiz utilizando el programa Statview. Se us un anlisis descriptivo y una prueba comparativa de anlisis de varianza (ANOVA) para determinar diferenciasdelasvariablesdependientesafectadaspornmerodelactanciadelavacay sexodelacra.Elpesodelacraseutilizcomovariableenelanlisis.

RESULTADOS La cantidad de calostro producido al primer ordeo fue similar (P = .10) entre vacas multparasyprimparas(Figura1).Asmismonohubodiferencias(P=.10)enlacalidad del primer calostro entre vacas primparas y multparas y este fue de una calidad aceptableparamantenerbecerrossaludables(Figura2).

212

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

1600 1400 1200 Mili litros(ml) 1000 800 600 400 200 0 PRIMIPARAS MULTIPARAS

Figura1.Cantidaddelprimercalostroproducidode3cuartosdevacasBrahman primparasymultparas(P=.10)enunranchocomercialdelaregindeTuxpan, Veracruz.

100 80 mg/ml 60 40 20 0 PRIM IPARAS M ULTIPARAS

Figura2.CalidaddelprimercalostrodevacasBrahmanprimparasymultparas(P=.10) enunranchocomercialdelaregindeTuxpan,Veracruz.

La concentracin de inmunoglobulinas en suero a las 72 horas despus de haber consumido su primer calostro fue de 8 grs/dl por lo que se considera ptimo para mantener becerros saludables. La variable sexo de la cra no afecto (P = .10) la concentracin srica de inmunoglobulinas, los machos y las hembras tuvieron concentracionessimilares(Figura3).

213

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

9,6 8,8 8 7,2 6,4 grs/dl 5,6 4,8 4 3,2 2,4 1,6 0,8 0 HEM BRA M ACHO

Figura3.ConcentracionessricasdeinmunoglobulinasenbecerrosBrahmanenun ranchocomercialenlaregindeTuxpan,Veracruzalas72horasdehaberconsumidoel primercalostro.

DISCUSION LacantidaddeprimercalostroproducidaporlasvacasBrahmanprimparasymultparas despus de amamantar con un cuarto a sus becerros fue de 1, 350 ml. Este reporte es muysimilaraloencontradoporNeidhartetal(1979)queencontrproduccionesdevacas Brahman en su primer calostro de 1,550 ml. Sin embargo, Vann et al (1995) reporto producciones de primer calostro en vacas Brahman de 5, 500 ml. Diferencias con los resultados publicados por Vann et al (1995) puede deberse a las diferencias en la alimentacindelasvacasentrelosestudios.Estosestudiosnoreportarondiferenciasen cantidad de calostro entre vacas primparas y multparas, al igual que en este estudio otrosreportesenganadodecarnevalidanestosresultados(Vannetal.,1995). Las concentraciones resultantes del calostrmetro fueron de 90 mg/ml lo que es consideradounrangoaltoyaceptabledeunbuencalostro.Losrangosaceptablesoscilan entre 50 y 140 mg/ml (Besser et al., 1985). La calidad del calostro fue similar entre primparasymultparasenesteestudio.EstosresultadossonsoportadosporTyler(1999) donde reporto similitud en calidad de calostro de vacas primparas y multparas. Sin embargo en ganado lechero especializado se ha reportado que el numero de lactancia tiene una influencia muy fuerte en la calidad del calostro (Hunt, 1990). Las vacas multparastienenmejorcalidaddecalostroquelasvacasprimparas(MullerandEllinger,

1981). En otro estudio en ganado lechero especializado se report que las vacas de

214

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

primerpartotenanconcentracindeinmunoglobulinasensuprimercalostrode28mg/ml mientrasquelasdesegundopartotenan59mg/ml,lasdetercerparto82mg/mlylasde cuarto parto 73 mg/ml (Corbett, 1991). La hiptesis era que una vaca adulta entre mas tiempolleveexpuestaadiferentesagentesinfecciosospuedeformaruncalostrodemayor concentracin de inmunoglobulinas, sin embargo en ganado de carne donde las producciones de calostro son mucho menores aparentemente el calostro es mas concentrado. La concentracin srica de inmunoglobulinas en suero a las 72 horas despus del consumodecalostrofuede8gr/dl.EstosresultadossonalentadoresyaqueBesseretal. (1985)encontrquelosbecerrosconconcentracionessricasentre5.5y7.0grs/dlalas 72horasdenacidoseransuficienteparamantenerlosbecerrossaludables.Estotambin indica que la transferencia pasiva de inmunoglobulinas fue exitosa y sin complicaciones (Wallaceetal.,2006).Concentracionessricasmenoresa5gr/dlindicaranproblemasen latransferenciadelainmunidadpasiva. CONCLUSIONES LacantidadycalidaddecalostrodevacasBrahmanprimparasymultparasenlaregin de Tuxpan, Veracruz fueron muy favorables. Tambin las concentraciones sricas de inmunoglobulinas de los becerros a las 72 horas despus del consumo de calostro se encontraronenunrangosuficienteparamantenerlasaluddelosbecerros.Podradecirse quebajoestascondicionesdetrpicoymanejodevacasBrahman,sonsuficientespara proveer a los becerros un cantidad y calidad de calostro adecuada para criar becerros sanos. BIBLIOGRAFIA

Besser TE., AE Garmedia, TC McGuire and CC Gay. 1985. Effect of colostral immunoglobulin G1andimmunoglobulin M concentrations onimmunoglobulinabsorption incalves.J.DairySci.,68:20332037 Butler.JE. 1974. Inmunoglobulins of the mamary secretions. In: B. L. Larson and V. R. Smith(Ed.)Lactation:Acomprehensivetreatise.Vol.III.P217.AcadenicPress,NewYork. ButlerJE.1969.Bovineimmunoglobulins:Areview,JDairySci52:18951909.

215

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CorbettRB.1991.Nutritionofthedairycalfpart1:colostrum.DairyWorld47. Gay CC. 1983. Failure of passive transfer of colostral inmunoglobulins and neonatal disease in claves. Areview. Proceedings of the Fourth International Symposium on NeonatalDiarrbea,1983,Oct35Saskatoon(Saskatchewan)Canada. Hunt,E.1990.Criticalcolostrum.DairyHerdWorkshop1(1):1620 LarsonBL.,HL.HearyandJEDevery.1980.Immunoglobulinproductionandtransportby themammarygland.J.DairySci.63:665. Lazzaro J. 2002. calostrum/supplementing calostrum saanendoah Dairy Goats. Winchester,California.www.saanendoah.com MullerLD.andDKEllinger.1981.Colostralimmunoglobulinconcentrationsamongbreeds ofdairycattle.J.DairySci.,64:17271730 NeidhardtR,DPlasse,JHWeniger,OVerde,JBeltranandABenavides.1979.Milkyield ofBrahmancowsinatropicalbeefproductionsystem.J.Anim.Sci.48:1. Stott, GH, BE Menefee and FR Radwanski 1976. Influence of environment on passive immunityincalves.J.DairySci.59:1306. Stott GH, DB Marx, BE Menefee, and GT Nightengale. 1979. Colostral immunoglobulintransferincalves.I.Periodofabsorption.J.DairySci.62:1632. Tyler JW, BJ Stevenf, JB Hofpetler. 1999. Colostral IgG concentrations in holstein and guerrnseycows.J.Vet.Res.60:11361139. VannRC,JWHolloway,GECarstens,MEBoydandRDRandel.1995. Influenceofcalf genotype on colostral immunoglobulins in Bos taurus and Bos indicus cows and serum immunoglobulinsintheircalves.JAnim.Sci.73:30443050. Wallace MM BD Jarvie, N Perkins, KE Leslie. 2006. A comparison of serum harvesting methods and type of refractometer for determining total solids to estimate failure of passivetransferincalves.CanVetJ.47(6):573575.

216

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 41) PRODUCCIN DE UN BIOSOL A PARTIR DE LA CODIGESTIN DE SANGREDECERDOCONESTIRCOLDEVACA BIOSOL PRODUCTION FROM THE CODIGESTION OF PORK'S BLOOD WITH COW MANURE

J.GarcaTolentino,R.VillegasCardenaz,M.A.IbarraIslas,D.J.PimentelGonzlez,A. QuinteroLira,A.D.HernndezFuentes* Instituto de Ciencias Agropecuarias de la Universidad Autnoma del Estado de Hidalgo, C.P. 43600,Tulancingo, Hgo., Mxico,(52)(771)7172000, email: adeliahf@gmail.com* autorparacorrespondencia RESUMEN Serealizunexperimentoparalaproduccindeunbiosolmediantelacodigestinde sangre de cerdo (SA) con estircol de vaca (SV) como sustratos principales. Se realizaroncincotratamientoscondiferentesconcentracionesdesangre(100,75,50,25y 0%),observadosenunperiodode90das.Setrabajaronconreactoresde4Lsincontrol de pH ni de temperatura. Se cuantificaron slidos totales (ST), slidos totales voltiles (STV),demandaqumicadeoxgeno(DQO),pH,coliformesfecales(CF),Salmonellasp. (SS), hongos (H), contenido de nitrgeno (N) y fsforo (P). Se encontr una mayor eliminacindeSTVconeltratamientode100%SA.LareduccindeDQOfuesuperiora 90%yenelpHsereportaronvaloressuperioresa7entodoslostratamientosdespus de 90 das del experimento. Se observ una buena mineralizacin del nitrgeno en el tratamientode100%SA.LareduccindeCFySSfuemayora99%.Porloanterior, se puede afirmar que la codigestin SASV es una buena opcin para producir biosol parausarlocomounfertilizantedeforrajes. PalabrasClave: digestinanaerobia,establo,mataderos,slidos,nutrientes.

217

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ABSTRACT Anexperimentwasconductedtoproducea"biosol"bycodigestionofpigblood(SA)with cow manure(SV)asmainsubstrates.Fivetreatments withdifferentbloodconcentrations (100,75,50,25and0%)wereobservedoveraperiodof90days.Theywereworkedwith 4 L reactors without pH and temperature control. Total solids (TS), total volatile solids (STV), chemical oxygen demand (COD), pH, fecal coliforms (FC), Salmonella sp. (SS), fungi (H), nitrogen (N) and phosphorus (P) were quantified. We found an increased removalofSTVwiththetreatmentof100%SA.TheCODreductionwasabove90%and pHvalueshigherthan7werereportedinalltreatmentsafter90daysofexperiment.There was a good mineralization of nitrogenin thetreatment of 100%SA. The reduction of FC and SS was higher than 99%. Therefore, we can say that codigestion SASV is a good choicetoproduceabiosolforusingitasafertilizerforfodder. Keywords:anaerobicdigestion,stable,slaughterhouse,solids,nutrients.

INTRODUCCIN. Los residuos de rastros como la sangre y el estircol, pueden ser recuperados para su tratamiento y posterior conversin en biogs y en composta, en lugar de ser fuente de contaminacindeefluentesacuososyemisionesgaseosas. LacantidaddeestircolproducidaenMxicopuedeestimarse,demaneraanual, entrminosde28millonesdecabezasdeganado,queproducen56millonesdekgde estircoldiario(2kg/da/animal),querepresentaunaproduccinanualde20.44millones detoneladas,colocndolocomoelsubproductoorgnicodemayorvolumen(Prez,P.y Viniegra, G. 2005). Para que sean viables estos procesos, es importante que los componentes de la codigestin se encuentren en la misma zona para disminuir los costos. MATERIALESYMTODOS. Se trabaj con estircol de ganado vacuno obtenido del Rancho Universitario pertenecientealaUniversidadAutnomadelEstadodeHidalgoycomocosustratose

218

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

utilizsangredelsacrificiodecerdosdeunrastrodelmunicipiodeSantiagoTulantepec, Hidalgo. Se realizaron cinco tratamientos con diferentes concentraciones de sangre, se estandarizaron slidos totales con agua, se observ la codigestin durante 90 das, cadatratamientotenacinco repeticiones(Tabla1).Seutilizaronbioreactoresdecuatro litrossincontroldepHnitemperaturaparasimularlascondicionesambientalesdelvalle deTulancingo,Hidalgo.

Tabla 1. Composicin de los tratamientos para la codigestin de estircol con diferentesconcentracionesdesangre. Tratamiento(gr) Estircol Sangre Agua 1 769 0 231 2 576 119 305 3 384 288 328 4 102 357 451 5 0 476 524

SecuantificlaDemandaQumicadeOxgeno(DQO),slidostotales(ST),slidostotales voltiles (STV), pH (APHA/AWWA/WPCF, 1998), Nitrgeno, Fsforo, coliformes fecales con medio de cultivo de Mac conkey,

Salmonella sp. con el medio de Salmonella y

Shigella,yhongosconelmedioAgardextrosaypapaporlatcnicaderecuentoenplaca.

RESULTADOSYDISCUSIN. En la DQO se observ una relacin directa con la concentracin de sangre. Encontrandounadisminucinenladegradacinalincrementarelcontenidodesangre. En la Figura 1 se puede observar el comportamiento de los ST se encontr una mayor eliminacinconeltratamientodel25%deSA.Estosdatossonsimilaresalosreportados por Vanyushina, A., et al., 2010, en su trabajo sobre digestin anaerobia de aguas

219

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

residualesconrecicladodebiomasaactivada,dondelosvaloresdedisminucindelosST ySTV,vandevaloresde34al56%.

Figura1.DisminucindelosslidosdeunacodigestindeSAconSV Tabla2.ContenidodemicroorganismosenlacodigestindeSAySV Concentracin deSA Coliformesfecales Inicial 100% 75% 50% 25% 0%
5 3x10

Final 0
3 10x10

Salmonellasp. UFC/g Inicial Final


5 34x10

Hongos Inicial 0 56 894


4 13x10

Final 4000
3 51x10

ND ND ND
3 2x10

5 18x10

5 17x10

5 22X10

5 10x10

5 4x10

5 18x10

6 24x10

5 29x10

4 56x10

4 68x10

6 30x10

6 12x10

4 44x10

400

4 36x10

6 12x10

Como se puede observar enlaTabla 2,alinicio dela codigestinlos microorganismos patgenos como la Salmonellla sp., se presentaron en niveles relativamente elevados y despusdefinalizadoelexperimientoeneltratamientode100%deSAnosedetectaron,

220

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

por el contrario en el caso de los coliformes fecales y de los hongos, la codigestin favoreci el crecimiento a medida que se reduca el contenido de SA, dando como resultadobiosolesconloslmitespermitidosporlaNOM004SEMARNAT2002,mismos quepuedenserutilizadosenlaagricultura. Tabla3.Contenidodenitrgeno,fsforoypHenlacodigestindeSAySV Concentracin deSA

Nitrgeno%
Inicial Final 1,55 0,95 1,21 1,31 1,65

Fsforo%
Inicial 0,82 0,94 0,99 1,02 1,26 Final 1,29 1,06 1,12 1,29 1,32 Inicial 7,09 7,57 7,46 7,01 6,99

Ph
Final 7,16 7,87 7,74 7,76 7,07

100% 75% 50% 25% 0%

0,76 0,83 1,04 1,27 1,41

ComoseobservaenlaTabla3existeunabuenamineralizacindelnitrgenoyaquese conservaenladigestinanaerobia.Seencontrelmayorcontenidoeneltratamientode 100%deSA,perostefuermenoralencontradoporArayaCastillo,2008,ytambinpor los reportados por Buenrostro y col. 2000, quienes obtuvieron valores de 9 y 14 % en Residuos Slidos Orgnicos Municipales. En cuanto al fsforo, el mayor incremento tambin se present en el tratamiento de 100% SA. Estos datos fueron superiores al trabajodeBuenrostroycol.2000,conpromediosquevandel0.27al0.42%.

221

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CONCLUSIONES. En la codigestin de sangre de cerdo con estircol de vaca se obtuvieron buenos resultadosyaqueseincrementelcontenidodenitrgenoconelincrementodesangrey seprodujounbiosolparalafruticultura.

LITERATURACITADA

APHA/AWWA/WPCF.1989.StandardMethodsforExaminationofWaterandWastewater, 20thEd.AmericanPublicHealthAssociation. ArallaCastillo,A.2008.Valorizacindebioslidosensuelosdegradados.IICONGRESO INTERAMERICANO DE RESIDUOS SLIDOS. Revista AIDIS de Ingeniera y cienciasAmbientales:Investigacin,desarrolloyprctica.Vol.1,no.4.2008.ISSN 0718378X Buenrostro, O., Cram, S., Bernache, G., Bocco, G., 2000. La digestin anaerobia como alternativa de tratamiento a los residuos slidos orgnicos generados en los mercadosmunicipales.Rev.Int.Contam.Ambient.16(1)1926. NOM004SEMARNAT2002, PROTECCIN AMBIENTAL. LODOS Y BIOSLIDOS. ESPECIFICACIONES Y LMITES MXIMOS PERMISIBLES DE

CONTAMINANTESPARASUAPROVECHAMIENTOYDISPOSICINFINAL Prez, P., y Viniegra, G. 2005. Potencial del uso del estircol en la alimentacin de los bovinos.CienciaVeterinaria.1(10)241:261 Vanyushina A.Ya., Nikolaev Yu.A., Kharkina O.V. 2010. Anaerobic Digestion of Sewage
th Sludgewithrecycledactivebiomass.12 WORLDCONGRESSONANAEROBIC

DIGESTION, International Water Association. October 31 November 4 , 2010. GuadalajaraJalisco,Mxico

222

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 42) Diagnstico molecular por PCR de un caso clnico de Tumor Venreo TransmisibleCanino(TVTC)delocalizacinextragenital. Molecular diagnosis by PCR ofa clinical case of Canine Transmissible Venereal Tumor(CTVT)ofextragenitallocation. ElfegoCuevasDomnguez1,JosSimnMartnezCastaeda2,IlianadelCarmenDaniel Renteria1,LindaGuilianaBautistaGmez2.
1

FacultaddeCienciasBiolgicasyAgropecuarias,UniversidadVeracruzana.CarreteraTuxpanTampico,Kilmetro7.5 C.P.92800,Tuxpan,Veracruz.
2

Centro de Investigacin y Estudios Avanzados en Salud Animal, Facultad de Medicina Veterinaria y Zootecnia, Universidad Autnoma del Estado de Mxico. Carretera de cuota TolucaAtlacomulco, Kilmetro 15.5 C.P. 50200, TolucaEdo.Mxico.
1

Autorparacorrespondencia:mvz_cuevas@hotmail.com RESUMEN

El Tumor Venreo Transmisible Canino (TVTC), es una de las neoplasias que afectan frecuentemente a la poblacin canina mundial, se presenta enlos genitales externos de ambos sexos, aunque puededesarrollarsepor implantacin de clulas viables en zonas extragenitales mediante lameduras, olfateo y contacto directo. El TVTC tiene origen monofilticoypresentaunacaractersticacomnqueconsisteenelrearregloLINE1C myc, el cual se utiliza como herramienta eneldiagnstico molecular mediante Reaccin en Cadena de la Polimerasa (PCR). El presente estudio describe un caso clnico de un TVTC,elcualclnicamenteseobservcomomltiplesnduloseneldorsoyenlapierna, serealizounacitologalacualsugiritumordeclulasredondas,sinembargo,TVTCpor citologaesdifcildiferenciardehistiocitoma,sobretodosielTVTCesextragenitalpara realizar un diagnostico ms preciso del TVTC, se utiliz la tcnica de PCR para la amplificacindelrearreglo LINE1 Cmyc que se encuentraexclusivamente en TVTC. El resultado permiti confirmar este tumor por lo tanto se demuestra una vez ms que la eleccin del diagnstico molecular es una excelente herramienta para confirmar especficamentelapresenciadeTVTC. Palabrasclave: TVTC,LINE1Cmyc,PCR,diagnsticomolecular.

223

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ABSTRACT Thecaninetransmissiblevenerealtumor(CTVT)isonethecancersthatfrequentlyaffect the global dog populationis presentedin the external genitaliaof both sexes, althoughit can develop by implantation of viable cells in extragenital areas by licking, sniffing and contact direct. The CTVT is monophyletic origin and has a common feature is the rearranged LINE1 Cmyc, which is used as tool in molecular diagnosis by Polymerase ChainReaction(PCR).ThisstudydescribesacaseofaCTVT,whichisclinicallyobserved as multiple nodules on the back and leg, cytology is difficult to differentiate histiocitoma especiallyiftheCTVTisextragenitalforamoreprecisediagnosisofCTVTwasusedfor PCR amplification of the rearranged LINE1 Cmyc is found exclusively in CTVT. The result allowed to confirm the tumor, so it proves once again that the choice of molecular diagnosticsisanexcellenttospecificallyconfirmthepresenceofCTVT. Keywords: CTVT,LINE1Cmyc,PCR,moleculardiagnosis.

INTRODUCCIN El TumorVenreoTransmisibleCanino(TVTC),esunadelasneoplasiasmscomunes de los genitales externos de los perros domsticos (Das y Das, 2000). La transmisin ocurre de manera natural comportndose como un aloinjertosto lo hace debido a que evade la barrera del Complejo Mayor de Histocompatibilidad (MHC)(Das y Das, 2000 NelsonyCouto,2000Purohit,2009),lavamscomneslavenrea(NelsonyCouto, 2000), aunque se puede transmitir mediante el lamido, mordidas, olfateo y contacto directo con el tumor, pudiendo presentarse en zonas extragenitales, mediante trasplantabilidad,observndose en: pulmones, piel, ano, crvix, tero, oviducto, boca, cavidad nasal y rbita ocular (Das y Das, 2000 Martnez et al., 2002). Se considera al TVTCunaneoplasiadeclulasredondasdeorigenhistioctico,juntoconotrasneoplasias de los caninos como mastocitoma, histiocitoma, plasmatocitoma, melanoma y linfosarcoma(Cowell,2004).Enlacitologapodemosobservarclulasredondasuovales con escaso citoplasma vacuolado y ncleo grande con abundantes figuras mitticas, de uno a dos nuclolos prominentes(Sorribas, 2007 Purohit, 2009).Clnicamente se puede

224

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

observaral TVTCcomo masasslidassimples,pedunculadas,nodulares,multinodulado ehipermicasconaspectodecoliflordetamaovariablede0.5a15cm,frecuentemente son muy friables y presentan descargas sanguneas continuas,en el macho frecuentementeafectalosbulbosdelglandedelpeneyprepucioyvestbulovaginalenla hembra(Nelson y Couto, 2000 Das y Das, 2000 Fidalgo et al., 2003 Sorribas, 2007 Coln, 2010). Genticamente el TVTC presenta un cariotipo de 5859 cromosomas que difieren del cariotipo de 78 cromosomas de los perros (Das and Das, 2000),adems el TVTC tiene origen monofiltico ya que se ha identificado que los tumores a nivel mundialpertenecen a dos clonas que tienen un origen gentico comn en una clula ancestralprovenientedeunloboodeunarazaantiguadeperrosoriginadahace6,500a 65,000aos(Murguaetal.,2006Rebbecketal.,2009).Otracaractersticagenticaque presentaelTVTCesunrearreglogenmicocercadelaregincodificantedeloncognC Myc,caracterizado por la insercin de un elemento LINE1 (long interspersednuclear element), provocando una transcripcin aumentada del gen, dando como resultado un incremento en la proliferacin celular, lo cual explica el crecimiento desmedido que presentaestetumorensufasedeprogresin(Katziretal.,1985, Amariglioetal.,1991), estareginesconstantea550pbylacualvadesdeelextremofinaldeLINE1alaregin 5deloncognCmycyhasidoutilizadocomoherramientaparaeldiagnsticomolecular por PCR debido a que se presenta en todos los TVTC analizados a nivel mundial y es ausenteenelgenomadelperronormal(Katziretal.,1987Amariglioetat.,1991Liaoet

al., 2003 Choi et al.,1999 Murgua et al., 2006 Rebbeck et al., 2009). Por lo cual el
objetivo de este estudio es la confirmacin diagnstica del TVTC por PCR mediante la amplificacindelrearregloLINE1Cmycexclusivodeestetumorylaimportanciadeesta tcnicasobretodocuandosetratadeTVTCextragenital.

225

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

MATERIALYMTODOS Se remiti a la Clnica Veterinaria de Pequeas Especies de la Facultad de Ciencias Biolgicas y Agropecuarias de la Universidad Veracruzana, un canino macho mestizode un ao y medio de edad previamente diagnosticado con tumor de clulas redondas mediante citologa. Al examen fsico general se evidencio la presencia de mltiples ndulosulceradoseneldorsoconundimetrodeaproximadamente25cmyunndulo prominenteyulceradode8cmdelargopor3cmdeanchoconaparienciadecoliflorenla piernaizquierda(Figura1y2),lamayoradelostumoreseranfriablesyseencontraban infectadosyconpresenciadehemorragias.

Figura1.Masatumoralenpierna izquierda.

Figura 2. Mltiples ndulos en dorso.

Debido a la localizacin de las masas tumorales es difcil diferenciar al TVTC de otros tumores de clulas redondas, en este caso histiocitoma. Se realiz el diagnstico confirmatorio de TVTCmediante PCR.Se tomaron biopsias delas masas tumoralesdel dorso y de la pierna y se conservaron en viales con ARN later a temperaturas de 4C, parasuposteriorprocesamientoenel CentrodeInvestigacinyEstudiosAvanzadosen Salud Animal de la Facultad de Medicina Veterinaria y Zootecnia de la Universidad Autnoma del Estado de Mxico.Extraccin de ADN del TVTC. La extraccin de ADN del TVTC se obtuvo a partir de un corte de 5 mm de tejido conservado en RNA later, utilizando el kit Wizard SV Genomic DNA Purification System de PROMEGA, segn instrucciones del fabricante.Posteriormente se verific la integridad del ADN mediante Electroforesis,engelesdeAgarosaal2%,teidoconbromurodeetidio. Diagnstico molecular del TVTC por PCR. La confirmacin del TVTC se realiz por diagnsticomolecularmediantelaamplificacinporPCRdeunaregindelfragmentodel

226

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

rearreglo LINE1Cmyc, la reaccin de PCR se llev a cabo utilizando los iniciadores sentido LINE AS1: CAGACACATAGATCAGTGGAACAGAAT y antisentido MycS2: ATTCCTACGAATGAATGATTGGCCAGA, conforme al mtodo reportado por Liao et al., (2003), los fragmentos amplificados fueron visualizados en geles de agarosa al 2% teidosconbromurodeetidio(Figura3). RESULTADOS El diagnstico molecular por PCR confirmo la amplificacin del rearreglo LINE1 Cmyc, enelcualseobtuvieronampliconesde550pb,entodaslasmuestras,locualnosindica undiagnsticodefinitivodeTVTC(Figura3).

Figura 3. Gel de agarosa al 2%, teido con bromuro de etidio, muestra amplicn de 550 pb. correspondientealrearregloLINE 1Cmycenmuestrasdelasmasas tumoresdeldorsoypierna.

227

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

UnavezestablecidoeldiagnsticodefinitivodeTVTCsetratconSulfatodeVincristina condosis de 0.025 mg/kg va endovenosa, una aplicacin semanaldurante 4 sesiones logrando la remisin total de las masas tumorales (Figura 4). Debido a la infeccin bacteriana secundaria que presentaban las lesiones se aplic antibioterapia con gentamicinacondosisde1015mg/kgcada24hrspor6das.

Figura4.Paciente canino que

muestra remisin totaldelTVTC.

DISCUSIN El TVTC se transmite de manera natural en caninos, se puede transmitir mediante el lamido,mordidas,olfateoycontactodirectoconeltumor,presentandotumorprimarioen zonas extragenitales, mediante trasplantabilidadpresentndose en: pulmones, piel, ano, crvix,tero,oviducto,boca,cavidadnasalyrbitaocular(DasyDas,2000Martnezet

al., 2002), este caso clnico comparte estas caractersticas al presentarse el tumor
primario en el dorso y la pierna.El TVTC est considerado dentro de los tumores de clulas redondas de la piel de los caninos en donde se incluyen al mastocitoma, histiocitoma, plasmatocitoma, melanoma y linfosarcoma (Cowell, 2004). Los linfomas, histiocitomas y mastocitoma son considerados los diferenciales primarios del TVTC, en estecasosedescartaronlinfomaymastocitomadebidoalascaractersticasclnicasque presentabanlas masas tumorales.Las clulas delTVTCdemuestran uninmunofenotipo compatible con los histiocitos(Ramrez et al., 2010), por lo tanto la diferenciacin entre histiocitoma y TVTC es difcil por medio de la citologa y ms aun cuando se trata de TVTCextragenital,porloqueeldiagnsticomolecularporPCRmediantelaamplificacin delrearregloLINE1CmycconformealmtodoreportadoporLiaoetal.,(2003)resulta ser el mtodo ms eficaz para efectuar el diagnstico definitivo.Se mencionan diversas alternativas para el tratamiento de TVTC, sin embargo, el tratamiento comnmente

228

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

utilizado con buenos resultados sigue siendo la quimioterapia con sulfato de vincristinalogrando la remisin total de las masas tumorales (Nelson y Couto, 2000 Sorribas,2007Coln,2010). CONCLUSIONES En este trabajo se obtuvieron datos que demuestran, la existencia de TVTC de localizacinextragenitalcomotumorprimario,medianteeltrasplantedeclulasenlapiel intacta.Tambinsedemuestraunavezmsquelaeleccindeldiagnsticomoleculares unaexcelenteherramientaparaconfirmarespecficamentelapresenciadeTVTC.Eluso deSulfatodeVincristinasiguesiendoeltratamientomsefectivocontraelTVTC. AGRADECIMIENTOS AlestudiantedeMedicinaVeterinariayZootecniaEmilioDaniellvarezGonzlezpor haberremitidoelcasoclnico.

LITERATURACITADA Amariglio,E.N.Hakim,I.BrokSimoni,F.Grossman,Z.Katzir,N.Harmelin,A.Ramot, B.andRechavi,G.1991.IdentityofrearrangedLINE/cMYCjunctionsequencesspecific forthecaninetransmissiblevenerealtumor.Proc.Natl.Acad.Sci.88:81368139. Choi,Y.Ishiguro,N.Shinagawa,M.Kim,CJ.Okamoto,Y.Minami,S.andOgihara,K. 1999. Molecular estructure of canine LINE1 elements in canine transmissible venereal tumor.AnimalGenetics30:5153. Coln,F.R.F.2010.HistognesisdelTumorVenreoTransmisibledelosPerros.Mesade ExpertosdepedigreeOncologaenperros.MemoriasdelCongresoVeterinariodeLen 2010.Len,Gto.p.3540. Cowell, R.L. 2004. Veterinary Clinical Pathology Secrets. Elsevier Mosby. USA. p. 247 250. Das,U.andDas,A.K.2000.Reviewofcaninetransmissiblevenerealsarcoma.Vet.Res. Commun.24:545556.

229

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Fidalgo,A.L.E.Rejas,L.J.DeGopegui,F.R.L.yRamos,A.J.J.2003.PatologaMdica Veterinaria.KADMOS,Salamanca,Espaa.p.576. Katzir,N.Rechavi,G.Cohen,J.B.Unger,T.Simoni,F.Segai,S.Cohen,D.Arman,E. and Givol, D.1985. Retroposon insertion into the cellular oncogene cmyc in canine transmissiblevenerealtumor.Proc.Natl.Sci.82,10541058. Katzir, N. Arman, E. Cohen, D. Givol, D. and Rechavi, G. 1987. Common origin of transmissiblevenerealtumors(TVT)indogs.Oncogene.1(4):4458. Liao,K.W.Lin,Z.Y.Pao,H.N.Kam,S.Y.Wang,F.I.andChu,R.M.2003.Identification of canine transmissible venereal tumor cellsusingin situ polymerase chain reaction and thestablesequenceofthelonginterspersednuclearelement.JVetDiagnInvest15:399 406. Martnez,M.M.Ballut,J.C.yCardona,J.A.2002.TumorVenreoTransmisible(TVT)de localizacinextragenital.MVZCrdoba.7(1):168170. Murgua, C. Pritchard, J.K. Kim, Y.S. Fassati, A. and Weiss, R.A. 2006. Clonal Origin andEvolutionofaTransmissibleCancer.Cell126,477487. Nelson,W.R.yCouto,C.G.2000.TumorVenreoTransmisibleCanino.MedicinaInterna deAnimalesPequeos.2.Ed.Intermdica.BuenosAires,RepblicadeArgentina.Pg. 994. Purohit, G.N. (2009). Canine Transmissible Venereal Tumor: A review. The Internet JournalofMedicine.6(1):116. Ramrez,R.R.GarcadeJaln,C.J.ANevez,G.A.M.yRodrguez,T.L.E.2010.Tumor venreotransmisibleconmetstasisaunhemangiomaesplnicoenunaperra.Vet.Mx., 41(4):305310. Rebbeck, C.A. Thomas, R. Breen, M. Leroi, A.M. and Burt, A. 2009. Origins and EvolutionsofaTransmissibleCancer.Evolution.63(9):23409. Sorribas, C.A. 2007. Manual de emergencias y patologas frecuentes del aparato reproductorencaninos.1ra.Ed.BuenosAires:InterMdica.p.1012,9093.

230

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 43) Produccin de componentes lcteos por lactacin de diferentes cruzas deHolsteinySuizoPardoporCebenclimasubtropical.

ProductionofmilkcomponentsbylactatingofdifferentcrossesofHolsteinyBrown SwisswithZebuinsubtropicalclimate.

JulioCsarVinayVadillo*,JuanZarateMartnez,BenjamnPiaCrdenas,Patricia CervantesAcosta

Campo Experimental La Posta, Centro de Investigacin Regional Golfo Centro del Instituto Nacional de Investigaciones Forestales, Agrcolas y Pecuarias. Km 22.5 Carretera libre VeracruzCrdoba, Paso del Toro, Ver. Veracruz, Mxico. Tel: (229) 9622222 y 9622223 Email: zarate.juan@inifap.gob.mx pina.cardenas@inifap.gob.mx vinay.julio@inifap.gob.mx*Autorparacorrespondencia

RESUMEN Elobjetivodeltrabajofuedeterminarlaproduccindegrasas,protenas,lactosa,slidos totalesylecheysuefectosobrelapocadeparto,nmerodelactanciasygenotipos(1/2, 5/8, 3/4) de las cruzas Holstein (Hs) y Suizo Pardo (SP) por Ceb, por lactancia en sistemas de doble propsito en clima subtropical. Se utilizaron 5070 registros de produccin y composicin de leche de bovinos que equivalen a 100 lactancias. Se muestreo cada semana durante toda la lactancia y se analizo en equipo infrarrojo. Las vacasestuvieronenpastoreo+ensilajedesorgoyduranteelordeoselesofreci2kgde concentrado por la maana y tarde. La produccin de leche y componentes fueron estimadosconelmodelodeWood.Seempleoundiseoexperimentalcompletamenteal azar con el procedimiento GLM, empleando como covariable das de lactancia. El genotipo, poca de parto y nmero de lactancia fueron empleados como factores. La produccindelechefuedemsde3000kgparatodoslosgenotipos(P0.05),aunquelos HolsteinprodujeronmsquelasSuizoPardo.Lapocadelluviassuperoalassecasen produccin de leche y componentes. El genotipo con mayor produccin de grasas (126 kg)yprotenas(104kg)porlactanciafueel1/2Hs(P0.05).Paraelcasodelactosael3/4 Hs se obtuvo ms, con 147 kg, pero sin mostrar diferencia (P0.05). La produccin de slidostotalesporlactanciaseviomsreflejadaenlos1/2,5/8y3/4Hscon360,371y

231

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

378kg.LosgenotiposHsproducenmayorymejorcomposicindelalechequeelSP.El factorlluviaylalactanciaentre2a4producenmayorlecheycomponenteslcteos. Palabrasclave:Grasas,Protenas,Lactosa,Simulacin,Wood

ABSTRACT Theobjectivewastodeterminetheproductionoffat,protein,lactose,totalsolidsandmilk and its effect on the calving season, lactation number and genotype (1/2, 5/8, 3/4) of crossbred Holstein (Hs) and Brown Swiss (SP) for Zebu, per lactation in dual purpose systems in subtropical climate.5070 records were used for milk production and composition of cattle equivalent to 100 lactations. Was sampled each week throughout lactation and was analyzed in infrared equipment. The cows were on pasture + silage sorghum and during milking were offered 2 kg of concentrate in the morning and afternoon. Milk production and componentswere estimated with the model ofWood.We usedacompletelyrandomizeddesignwiththeGLMprocedure,usingascovariatedaysof lactation.The genotype, calving season andlactation number were used as factors. Milk productionwasover3000kgforallgenotypes(P0.05),althoughtheHolsteinweremore than Brown Swiss. The rainy season overtook the dry milk production and components. Thegenotypewithincreasedproductionoffat(126kg)andprotein(104kg)perlactation was1/2Hs(P 0.05).Inthecaseoflactosethe3/4Hsobtainedmorewith147kg,butno differences(P0.05).Total solids production perlactation was further reflectedin the1/2, 5/8 and 3/4Hs, 360, 371 and 378 kg Hs genotypes produce more and better milk compositionoftheSP.Therainandlactationfactorbetween2and4producemore milk andmilkcomponents. Keywords:Fat,Protein,Lactose,Simulation,Wood

INTRODUCCIN Elcontenidodegrasas,protenas,lactosa,slidostotalesyclulassomticas,empiezan a recibir gran atencin por parte de los productores y procesadores de leche. El reconocimiento del valor de estos componentes lcteos, permitira un pago por el excedenteeincentivaraaproductoresenmejorar,nonadamslaproduccindeleche, sino la de estos componentes de la leche, adems cabe la posibilidad de que

232

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

investigadoresdelreadegenticaloincluyanestasvariablesenlaseleccindebovinos, deacuerdoalaproduccinporlactanciadegrasas,protenasyslidostotales. Muchos estudios han sido documentados, donde se analizaron los factores ambientales tales como efecto de la poca de parto, nmero de lactancia y genotipo sobre la produccin deleche porlactancia y parmetros que fisiolgicamente describenla curva. Sin embargo poca informacin esta disponible de los efectos ambientales sobre la produccindecomponenteslcteoscomolasgrasas,protenas,lactosayslidostotales porlactanciadebovinoscruzadosdeEuropeoporCebenclimasubtropical. Muchos modelos han sido usados para estimar los parmetros y la produccin de componenteslcteos.Elprocedimientonolinealeselmsempleadoenlaestimacinde parmetros y de la produccin de componentes lcteos. El modelo mas comnmente utilizadopordiferentesautoreseselmodelodeWood(Silvestre,etal2009Hernndez,et

al2007Schutz,etal1990Stanton,etal1992).
Elobjetivodeltrabajofuedeterminarlaproduccindegrasas,protenas,lactosa,slidos totalesylecheysuefectosobrelapocadeparto,nmerodelactanciasygenotipos(1/2, 5/8, 3/4) de las cruzas Holstein (Hs) y Suizo Pardo (SP) por Ceb, por lactancia en sistemasdedoblepropsitoenclimasubtropical.

MATERIALESYMTODOS La presente investigacin se llev a cabo en los mdulos de produccin del campo experimentalLaPosta,delInstitutoNacionaldeInvestigacionesForestales,Agrcolasy Pecuarias. El campo experimental se localiza en el km 22.5 de la carretera Veracruz Crdoba con una ubicacin geogrfica de 1900 49 latitud Norte y 960819 longitud Oeste,aunaalturasobreelniveldelmarde10metros.Cuentaconunclimatropicalsub hmedo Aw2 con humedad relativa de 77.4 y precipitacin anual de 1461mm (Vidal, 2005). Los modulo de lechera tropical estn establecidas de zacate Estrella de frica (Cynodonplectostachyus)yPangola(Digitariadecumbens)8.0haparalaproduccinde forraje (sorgo). Las vacas del modulo de lechera tropical se manejan en pastoreo rotacional y se ordea en forma mecnica dos veces por da, una porla maana y otra porlatardemidiendoyregistrandolaproduccindiariaporordea.Durantelaordease suplementcon2kgdeconcentrado,con16%dePCy70%deTND.Lassalesminerales

233

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

yelaguasedieronalibertadenloscorrales,unacantidaddeensilajedesorgo(2025kg) seofrecadiariodurantelapocadeescasezdeforraje. Durantelainvestigacinsemuestreolalechetotaldecadavaca,demanerasemanal.El contenido de grasa, protenas, lactosa y slidos totales se determino empleando espectrofotometra infrarrojo (Milkoscan FT120, A/SFOSS Electric),adems se registro laproduccindelecheencadamuestreo.Paralaestimacindelaproduccindegrasa, protenas, lactosa y slidos totales por lactacin se empleo el modelo de Wood (1976) comosedescribe:

y = axb exp - cx
Donde: y=Variabledependiente(produccindegrasa,protenas,lactosayslidostotalesenun tiempodado) x=Periododetiempoenelcualseestimalaproduccinlctea a=Ordenadaalorigen(produccingrasayprotenaaliniciodelalactacin) b=Parmetroquerelacionanlatasadeincrementodespusdelpicodelactacin c=Parmetroquerelacionalatasadedecrementodespusdelpicodelactacin exp=Basedeloslogaritmosnaturales Lasvariablesdeestudioenestetrabajofueronlassiguientes: ProduccindeLecheporLactacin(PLL) ProduccindeGrasaporLactacin(PGL) ProduccindeProtenasporLactacin(PPL) ProduccindeLactosaporLactacin(PLaL) ProduccindeSlidosTotalesPorLactacin(PSoL) DasdeLactacin(DL) Durante el periodo de muestreo de leche para la determinacin de los componentes lcteos se obtuvieron 5070 registros de produccin y composicin de leche de bovinos queequivalena100lactancias.Conlosregistrosquesellevandecadaunadelasvacas

234

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

en produccin de los mdulos del centro experimental, se tom la informacin considerandoparacadaunodelosfactoresaanalizar. Genotipo Encuantoalosgenotipossehicieronseisgruposdelasvacasenproduccindeacuerdo a la proporcin de sangre de la raza Holstein y Suizo Pardo con sus cruzas con ceb quedandodelasiguientemanera:

(1/2Holsteinx1/2Ceb) (1/2SuizoPardoxCeb) (3/4Holsteinx1/4Ceb) (3/4SuizoPardox1/4Ceb) (5/8Holsteinx1/8Ceb) (5/8SuizoPardox1/8Ceb)

poca Deacuerdoalafechadepartoserealizunaclasificacindeacuerdoalapocadelao para saber el efecto que pueda tener la poca de lluvia y la poca de seca sobre la produccindegrasayprotenalctea,quedandoordenadodelasiguientemanera: pocalluvias(junio,julio,agosto,septiembre,octubreynoviembre) pocasecas(diciembre,enero,febrero,marzo,abrilymayo)

Nmerodelactancia

Paraesteefectoseagruparonlasvacasendosgruposquedandoenelprimergrupode vacas de primera lactacin, un segundo grupo que incluye lactancias entre 2 y 4 y un tercergrupoqueabarcamayoresa4lactancias.

235

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

La estimacin de la produccin de los componentes lcteos de cada vaca se realizo, como ya se menciono con el modelo deWood, empleando regresin no lineal y parala minimizacinseaplicelalgoritmodePowell,medianteelprogramaScientist. LainformacinseanalizenunANOVA,medianteelpaqueteestadsticoMINITABensu versin 13, en su rutina GLM (General Linear Model). El anlisis estadstico de la informacin se realiz con un diseo experimental completamente al azar. La comparacindemediasserealizmediantelapruebadeTukey Seutilizelmodelolinealsiguiente: Yijkl =+A i +B j +Ck + Xijkl - X +(ijkl) Donde: Yijkl = Es la osima observacin de la produccin de grasa, protenas, lactosa, slidostotales =Eslamediapoblacional A i=Eselefectodelajsimogenotipo(i=1.6) B j =Eselefectodelaksimapoca(j=1,2) Ck =Eselefectodelalsimonmerodelactaciones(k=1,>2x>4,>4) Xijkl - X =Covariable,DasdeLactacin(DL)asociadoaproduccinporlactacin (ijkl) =Errorexperimental

RESULTADOSyDISCUSIN

Enelcuadro1seobservaqueenlaproduccindelecheporlactanciaenlosgenotipos evaluados no se encontr diferencias significativas (p0.05), mas sin embargo los genotipos 1/2, 3/4 y 5/8 Hs produjeron mas kg de leche que los SP, similar comportamientoseencontrconlaPGL,siendoelgenotipo1/2Hselmayorcon126Kg, al respecto Jimnez et al (2007) encontraron PGL mas bajas, a diferencia que las estimacionesdelaproduccinfueronconinformacinmensualynosemanal.LaPPLno presentodiferenciaestadstica(p0.05)entregenotipos,similarsituacinseobservocon PLaL y PSoL, destacando el genotipo 3/4 Hs por mayor produccin de slidos totales, resultado que debi reflejarse en PGL, ya que se sabe que los slidos totales estn ampliamenterelacionadoscongrasa.

236

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Cuadro1.Produccindecomponenteslcteosylecheporlactacinporefectogenotipos debovinosHolsteinySuizoPardocruzadosconCebeneltrpico. GENOTIPOS,ErrorEstndardelaMedia Variables 1/2Hs EEM PLL,kg PGL,kg PPL,kg PLaL,kg PSoL,kg DL,das n 1/2SP EEM 3/4HsEEM 3/4SP EEM 5/8Hs EM 5/8SPEEM
a 2499 318 a 114 16 a 93 12 a 119 15 a 301 37

a a a 2995 417 2767 377 3185 149 a 126 21 a 104 16 a 144 19 a 360 48 a 118 a 95 a 134 a 347

a a 2713 206 2966 171 a 122 10 a 100 7.8 a 127 9.6 a 337 24 a 117 8.5 a 101 6.5 a 142 7.9 a 352

19 14 17 43

a 120 7.3 a 108 5.6 a 148 6.8 a 374 17

20

31721 4

30165 5

33370 34

32749 14

34354 24

34745 6

Medias ajustadas por la covariable DL = Das Lactacin. Literales diferentes entre columnas son diferentes estadsticamente (p0.05). Las medias se compararon por el mtodo de Tukey. PLL= Produccin de Leche Lactacin PGL = Produccin Grasa LactacinPPL=ProduccinProtenasLactacinPLaL=ProduccinLactosaLactacin PSoL=ProduccinSlidosLactacin

Enelcuadro2sepresentanlosresultadosdelaproduccindeleche,grasas,protenas, lactosayslidostotalesporelefectodelapocadeparto,aunqueseobservaquenose presento ninguna diferencia estadstica significativa(p0.05), en la poca de lluvias las vacasproducenmaslecheycomponentesqueenlapocadesecas

237

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Cuadro2.Produccindecomponenteslcteosylecheporlactacinporefectopocadel aodebovinosHolsteinySuizoPardocruzadosconCebeneltrpico. POCA,ErrorEstndardelaMedia Variables Lluvias EEM PLL,kg PGL,kg PPL,kg PLaL,kg PSoL,kg n
a 3024 a 115 a 108 a 137 a 346

Secas
a 2752 a 108 a 91 a 128 a 329

EEM 147 7.3 5.6 6.8 17

134 6.6 7.3 6.2 15 48

52

Medias ajustadas por la covariable DL = Das Lactacin. Literales diferentes entre columnas son diferentes estadsticamente (p0.05). Las medias se compararon por el mtodo de Tukey. PLL= Produccin de Leche Lactacin PGL = Produccin Grasa LactacinPPL=ProduccinProtenasLactacinPLaL=ProduccinLactosaLactacin PSoL=ProduccinSlidosLactacin La produccin de leche, grasas, protenas, lactosa y slidos totales y su efecto por el nmerodelactacinsepresentanenelcuadro3,delanlisisrealizadoseobservaqueno existediferenciaestadsticasignificativa(p0.05)paraningunadelavariablesanalizadas, sin embargo la mayor produccin numricamente se presenta en vacas con lactancias entre2y4 Cuadro3.ProduccindecomponenteslcteosylecheporefectodeNmerodeLactacin debovinosHolsteinySuizoPardocruzadosconCebeneltrpico. NmerodeLactacin,ErrorEstndardelaMedia Variables 1 PLL,kg PGL,kg PPL,kg PLaL,kg PSoL,kg n EEM 229 11 8.7 11 26 15 2(24)
a 3098 a 119 a 101 a 142 a 357

EEM 3(+4) 162 8.0 6.0 7.4 18


a 3055 a 120 a 104 a 138 a 354

EMM 141 6.9 5.3 6.4 16

a 2510 a 95 a 82 a 117 a 301

48

37

238

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Medias ajustadas por la covariable DL = Das Lactacin. Literales diferentes entre columnas son diferentes estadsticamente (p0.05). Las medias se compararon por el mtodo de Tukey. PLL= Produccin de Leche Lactacin PGL = Produccin Grasa LactacinPPL=ProduccinProtenasLactacinPLaL=ProduccinLactosaLactacin PSoL=ProduccinSlidosLactacin

CONCLUSIONES

Los genotipos 1/2, 3/4 y 5/8 Hs cruzados con ceb manejados en un sistema de doble con doble ordeo y alimentados bsicamente al pastoreo producen mayor leche y componenteslcteosporlactanciaquelosgenotipos1/2,3/4y5/8SPcruzadosconceb. Elfactorlluviaylalactanciaentre2a4producenpresentaronmejoresresultados.

LITERATURACITADA

Hernndez, J.M., V.J. Vinay, D.A. vila, M.O. Castaeda, A.Y.Villegas, A.P.Cervantes. 2007.Produccindegrasayprotenalcteadebovinoseneltrpico.In.INIFAP(Instituto Nacional de Investigaciones Forestales, Agrcola y Pecuarias) UV (Universidad Veracruzana) CP (Colegio de Postgraduados) UACH (Universidad Autnoma de Chapingo) ITUG ( Instituto Tecnolgico de rsulo Galvn) ITBOCA ( Instituto TecnolgicodeBocadelRo)UNAM(UniversidadNacionalAutnomadeMxico).2007. Avances en la Investigacin Agrcola, Pecuaria, Forestal y Acucola en el Trpico Mexicano2007.LibroCientficoNo.4.Veracruz,Mxico.457p. Schutz,M.M.,L.B.Hansen,andG.R.Steuernagel.1990.Variationofmilk,fat,proteinand somaticcellsfordairycattle.JournalDairyScience.73:484493. Silvestre, A.M., A.M. Martins, V.A.Santos, M.M. Ginja, and J.A. Colao. 2009. Lactation curves for milk, fat and protein in dairy cows: A full approach. Livestock Science. 122: 308313. Stanton, T.L., L.R. Jones, R.W. Everett, and S.D. Kachman. 1992. Estimating Milk, Fat, andProteinLactationCurveswithatestdaymodel.JournalDairyScience.75:16911700.

239

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Vidal,Z.R.2005.Regin7,GolfodeMxico.pp.121144.En:Lasregionesclimticasde Mxico.InstitutodeGeografaUNAM,Mxico. Wood,P.D.P.1976.Algebraicmodelsoflactationcurveofmilk,fat,andproteinproduction withestimatesofseasonalvariation.AnimalProduction.22:35

240

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

SPIROCERCOSIS, PRESENTACION DE DOS CASOS CLINICOS ENTUXPAMVERACRUZMEXICO


(SMVZ 44)

FabiolaCortesMrquez*

RESUMEN

Se presentan dos casos clnicos con Spirocercosis: Uno es una perra labrador de 5 meses de edad con espondilitis de las vrtebras torcicas, regurgitacin, fiebre, anorexia. El diagnostico es de obstruccin esofgica, durante la anestesia se encuentra unhiloatoradoenlabasedelalengua,perforacinintestinal,adherenciasenperitoneo, peritonitis e intususcepcin. Se le practico gastronoma para cortar el hilo, reseccion intestinalconanastomosisterminoterminalyfinalmentemueredeperitonitisalos4dasa lanecropsiasedescubren3granulomasconspirocercalupienesfagoyunaneurisma de la aorta ocasionado por e. lupi. El otro caso es una perra mestiza de dos aos con artropatahipertrficadeloscuatromiembros,quealanecropsiapresenta10nduloscon Spirocerca lupi en esfago, uno en diafragma otro en el cardias y espondilitis de las vrtebrastorcicas INTRODUCCION Objetivo PresentarloshallazgosclnicospatolgicosdedoscasosdeSpirocercalupiencaninosy las lesiones que producen para as hacer mas fcil su diagnostico y poder curarlo antes dequeavancealesionesirreversiblescomolaneoplasiadeesfago,aneurismadeaorta olaOsteopatahipertrfica. Antecedentes La Spirocercosis canina (SPIROCERCA LUPI) es una enfermedad parasitaria producida porunhelmintodelordenSpirurida,familiaThelaziidae,denominado Spirocercalupi(Rudolphi1809).

241

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Distribucin Tiene una distribucin mundial, con mayor frecuencia en climas tropicales y subtropicales,dondeS.lupiesreportadocomounparsitodecarnvorosEnMxicohay pocosreportes(Santamara2008enTabasco),EnelDFMxico26%incidenciade300 autopsiasrealizadasenUNAMCU.(AlujaA.S.) El agente causal es un helminto del orden Spirurida, familia Thelaziidae, denominado Spirocercalupi. CicloBiolgico LosgusanosadultosdelaS.Lupilashembrasmidenaproximadamente6a8cm. Ylosmachosblancosmidende3a4cm.Residendentrodendulosqueselocalizanen lasparedesdelesfagotorxicoensuporcindistal. Los caninos se infectan con S. Lupi, cuando ingieren escarabajos con larvas de tercer estadoocuandoconsumenvscerasconquistesparasitariosdehuspedesaccidentales como aves, batracios reptiles o roedores. La larva penetra a travs de la pared del estmago y migraalasarterias, alcanzando la aorta torcicaen un periodoaproximado de1012semanas. Unavezenlaaorta,elparsitomigraalesfago,formandounquisteconectadoporuna fstula al lumen esofgico En ese lugar el parsito alcanza el estado adulto y produce huevosquesoneliminadosenlashecesdeloshuspedesinfectados. ElperiodoPREpatentedelainfeccindura46mesesaproximadamente.

*Catedrtica de Clnica, Teraputica Quirurgica y zootecnia la Universidad Veracruzana enTuxpamVer.Yprcticaprivada

SintomatologayLesiones La sintomatologa clnica producida por esta enfermedad depende del tamao del granulomaesofgicoparasitario.

242

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Lossignosclnicospuedenirdesdedisfagialigera,vmitooregurgitacin,emaciaciny engrosamientodeloshuesoslargos(osteoartropatahipertrfica) Adems, pueden presentarse problemas respiratorios y circulatorios (17). En la Tabla1, sedescribenlosprincipalessignosclnicosylafrecuenciadepresentacinenelperro. Los parsitos adultos se localizan preferentemente en el tercio distal del esfago, especficamente en la pared del rgano, donde inducen la formacin de ndulos con continuidadhaciaellumenesofgico, Generando diversos grados de obstruccinmuchos ndulos tienden a transformarse en sarcomasmetaplsicos. La migracin de los estados inmaduros se ha asociado a aneurisma artico, por lo que estapatologapudiesetenerundesenlacefatalsinosediagnsticaoportunamente. ElperodoPREpatentetpicamenteesde46mesesenpacientesconedadesinferiores difcilmenteseconsideradentrodeundiagnosticodiferencial. Tabla 1. Principales alteraciones clnicas y patolgicas asociadas con Spirocercosis canina.

SIGNOS Vomitooregurgitacin Fiebre Debilidad Anormalidadesrespiratorias Neoplasiaesofgica Anemia

% 66% 24% 22% 21% 41% 53%

SIGNOS Anorexia Caquexia Osteopatahipertrfica Masasradiogrficas Espondilosistorcica Aneurismaaortico

% 18% 27% 38% 53% 33% 43%

243

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Diagnostico Eldiagnsticodelaenfermedadselograporelreconocimientodeloshuevosdelparsito enlasheces,mediantetcnicasdeflotacinycentrifugacinflotacin(26,28,29). Para confirmar la extensin del dao esofgico se pueden utilizar esfagos copia o valoracinradiolgicasimpleoconsulfatodebario(3,21). Lavaloracinendoscpicaeslapruebamssensibleparaconfirmarlosgranulomasyel dao esofgico, ya que estos se visualizandirectamente y se pueden obtener muestras parahistopatologa(3,22). Lasradiografaslateralesconmediodecontrastepositivopermitenidentificarunamasa circunscrita, posterior al corazn y adems, se pueden ver otros cambios patolgicos como: Espondilosistorcica,megaesfagoyneoplasia(9,22) Losanlisisclnicos.incluyenanemianoregenerativa,neutrofilia.Leucocitosisyfosfatasa alcalinaelevada.

Tratamiento El tratamiento mdico actual de esta parasitosis se basa en la administracin de Doramectinavasubcutneacon200g/Kg.cada14dasportresomsaplicacionesy tambin,vaoralcon500g/kgcada24horasduranteseissemanas

etodologa

244

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CASO1

PerralabradordenombreFridade5mesesdeedadquepresenta,regurgitacinyvomito quetieneaproximadamenteunasemana,fiebreanorexianodefecaypresentauna abultamientosobrelasvrtebrastorcicasyemaciacin.(FIG1.)

Fig.1seapreciaunabultamientosobrelas vrtebras

Fig.2seapreciaespondilosistorcicas

Se le administra: Solucin Salina al .09 % iv, y sulfas SC. Se rasura el bulto de las vrtebrasysehaceunapuncinsinobtenernada Se le sacanuna radiografa de trax lateral y donde seaprecia una espondilitis delas vrtebras torcicas (Fig.2), fiebre de 40 c, durante su estancia en hospitalizacin no vomita no regurgita, toma leche ylquidos pero se niega a consumir slidos, al tratar de pasar una sonda gstrica esta se atora a la altura de la inflamacin de las vrtebras el diagnosticoesobstruccinyseprocedearealizarunacirugaseanestesia. Durante la anestesia se descubre un hilo anclado en la base de la lengua , la perra presentaerosionescrnicasdelalengua,sehaceunagastronomayse cortaelhilo. Presenta perforacin intestinal con la consecuente peritonitis, adherencias he intususcepcinSeprocediahacerunareseccionintestinal .Selecolocaunpenrose,antibiticosdeamplioespectroterapiadelquidosyayunolas primeras24horas,empiezaatomaraguaylecheyfalleceelda4. RESULTADOSHALLAZGOSALANECROPSIA

245

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Peritonitis,Abscesoentrelasvrtebrastorcicas,3GranulomasdeSpirocercalupisobre lasparedesdelesfago Aneurisma de la aorta. Se obtuvieron alrededor de 15 gusanos, al exprimir una hembra sobre una laminilla se obtuvieron los huevecillos los cuales al aplicarles lugol facilito su identificacin

CASO2

Perramestizade2aosdeedadnombreBarbie,de16kgprocedentedelacomunidad deHigueral,cercanoalPuertodeTuxpamVeracruz. Es presentada a consulta a la clnica veterinaria Jardines La duea refiere que tiene comounaoqueempezconinflamacionesenlascuatropatas Al examen clnico general presenta engrosamiento de los cuatro patas, distensin abdominal,regurgitacinycaquexia.Temperatura38.5. Enlasradiografasdelascuatroextremidadesseapreciaunareaccininflamatoriadel periostiodeloshuesoslargosenlosmiembrosanterioresdelcodohastalasfalangesyen losmiembrosposterioresdesdelasrodillashastalasfalangesdelospies. Latumefaccinesdeconsistenciadura,quecorrespondeaosteopatahipertrfica Enlaradiografadetraxseapreciaespondilitisdelasvrtebrastorcicasyunamasaa laalturadelesfago.

246

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Enlosanlisisclnicospresentaanemianoregenerativa,neutrofilia.Leucocitosisy fosfatasaalcalinaelevada. Sedecideporlaeutanasia

Figura2.Proyeccinlaterolateraldetraxsin mediodecontraste.Seevidenciaelunamasa Figura1.Fotografadelapaciente, en el esfago tercio posterior, y una de las Nteseelengrosamientodeloscuatro espondilopatia de las vrtebras torcicas (T4 T9).

Miembros

La hematologa demostr una leucocitosis, pero el hematocrito, la hemoglobina y el recuento plaquetario fueron normales. En la bioqumica srica la CPK se encontr elevada, Se realizaron proyecciones radiolgicas, que incluyeron placa radiogrfica de trax y proyeccionesradiogrficasdemiembrosanterioresyposteriores. En la radiografa de trax se observaron cambios asociados con spirocercosis canina, tales como granulomas esofgicos, y una espondilitis deformante de las vrtebras torcicas(figura3).

Las proyecciones radiogrficas de los miembros anteriores, regin del, radio, cubito, carpo,metacarpoyfalanges(figura4)ytibia,tarsoymetatarso(figura5)delosmiembros posteriores,evidenciaronlapresenciadeunaproliferacindetejidoseoacompaadode

247

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

zonas osteolticas y osteoproliferativas del periostio. Las alteraciones encontradas son compatiblesconOsteopatahipertrfica.

Figura 4. Proyeccin radiogrfica lateromedial del miembro posterior izquierdo. Se observa una proliferacin sea cortical acompaada de regiones osteoliticas proximal de la tibia, tarsos y metatarsos.Ntesela

Figura 5. Proyeccin radiogrfica dorso palmar de los miembros anteriores articulacin del codo, radio y cubito, carpo y metacarpo. Con una intensa proliferacin de tejido cortical y zonas osteolticas y osteoproliferativas de la cavidad

RESULTADOSALANECROPSIA Seencontraron10granulomasconparsitosenelesfago,otrode10cmendiafragma, aneurismaenaorta,osteopatahipertrficaenlascuatropatas.

248

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

DISCUSIONyCONCLUSION Lapresentacindepatologastanseverasenanimalesmuyjvenes noshacellegarala conclusinquesedebedesparasitarcada3meses.

Ndulosenlaluzdelesfago

Articulacintibiotarsianaconartropata hipertrfica

BIBLIOGRAFIA 1.Theeffectofpositioningontheradiographicappearanceofcaudodorsalmediastinal massesinthedog.KirbergerRM,DvirE,vanderMerweLL. VetRadiolUltrasound.2009NovDec50(6):6304.PMID:19999347[PubMedin process]Relatedcitations 2.ProposedhistologicalprogressionoftheSpirocercalupiinducedoesophageal lesionindogs. DvirE,CliftSJ,WilliamsMC.VetParasitol.2010Feb26168(12):717.Epub2009Nov 4.PMID:19963322[PubMedinprocess]Relatedcitations 3.PrevalenceofthedognematodeSpirocercalupiinpopulationsofitsintermediate dungbeetlehostintheTshwane(Pretoria)Metropole,SouthAfrica. DuToitCA,ScholtzCH,HymanWB.OnderstepoortJVetRes.2008Dec75(4):315 21.PMID:19294987[PubMedindexedforMEDLINE]Relatedcitations

249

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

4.Radiographyforthediagnosisofspirocercosisinapparentlyhealthydogs,St.Kitts, WestIndies.FisherMM,MorganJP,KrecekRC,KellyPJ. VetParasitol.2009Mar23160(34):3379.Epub2008Nov25.PMID:19128882[PubMed indexedforMEDLINE]Relatedcitations 5.Biotechnologicaladvancesinthediagnosisoflittleknownparasitosesofpets. TraversaD,OtrantoD.ParasitolRes.2009Jan104(2):20916.Epub2008Dec6. Review.PMID:19066963[PubMedindexedforMEDLINE]Relatedcitations 6.Magneticresonanceimagingfindingsofspinalintramedullaryspirocercosis.ChaiO, ShelefI,BrennerO,DogadkinO,ArochI,ShamirMH.VetRadiolUltrasound.2008Sep Oct49(5):4569.PMID:18833954[PubMedindexedforMEDLINE]Relatedcitations 7.Copromicroscopicandmolecularassaysforthedetectionofcancercausing parasiticnematodeSpirocercalupi.TraversaD,AvolioS,ModrD,OtrantoD,IorioR, ArochI,CringoliG,MililloP,AlbrechtovK,MihalcaAD,LavyE. VetParasitol.2008Oct20157(12):10816.Epub2008Jul1.PMID:18687529[PubMed indexedforMEDLINRelatedcitations

250

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ45)VIGILANCIAEPIZOOTIOLOGICADELARABIAPARALITICABOVINAEN LAZONANORTEDEVERACRUZ WATCHEPIZOOTICBOVINEPARALYTICRABIESINNORTHERNVERACRUZ JosLuisSotoLoya*,EnriqueMartnezLpez,FabiolaCortesMrquez,LuisGustavo AguileraBenavides. FacultaddeCienciasBiolgicasyAgropecuariasdelaUniversidadVeracruzana, CampusTuxpan.CarreteraTuxpanTampicokm7.5S/NCol.Universitaria.C.P. 92860.Tuxpan,Veracruz,Mxico.Email:mvz_joseluis@hotmail.com enrimartinez@uv.mxfcortez@uv.mxmvz_aguilerauv@hotmail.com.*Autorpara correspondencia. RESUMEN La rabia es una zoonosis de los mamferos causada por el Lysavirus (virus de la rabia), se transmite al hombre principalmente por la saliva de animales infectados, la investigacintienecomoobjetivopresentarlasituacinepizootiologicarelacionadoconla Rabia Paraltica Bovina (R.P.B), poner de manifiesto los problemas por lo cual hay presencia de brotes en los municipios de la Zona Norte de Veracruz. Se realiz en 60 ranchos al azar, desde Gutirrez Zamora hasta Panuco, Ver, obteniendo la informacin pormediodeuncuestionario,dondeseobtuvoinformacinsobreelpersonal,animales,el murcilago hematfago y las medidas de prevencin. La investigacin se realiz desde Septiembrede2009hastaAbrilde2011.Losresultadosdemostraronqueel85%delos animalesseencuentraenbuenestadodesalud,25%tienenevidenciademordedurasde murcilagohematfago,21%sonrecientes(dasosemanas)yel4%presentaagresiones cada ao,12% delos lugares visitados no presentan agresiones desde hace 8 aos, de 110 casos posibles a esta enfermedad, 18 animales se encontraron sospechosos de R.P.By 37negativos29murieronporDerriengue,estoconfirmadoporlaboratoriolos26 animalesrestantesmurieronporotrascausas.LaR.P.B.seestpresentandoenlugares donde antes no haba presencia, que los ataques de murcilagos hematfagos han cambiado,elmurcilagoascomosuhabitadestsiendodestruidosincontrol,teniendo en cuenta que muchos de estos problemas son debido a la falta de informacin actualizada,difusindecampaasparaelcontrolpoblacionaldelmurcilagoascomola

251

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

vacunacinyasesoraenlosganaderos,provocandograndesprdidaseconmicaspara losganaderosyproductores. Palabrasclaves:Murcielagohematofago,rabiaparaliticabovina,zoonosis,veracruz.

ABSTRACT RabiesisazoonoticdiseaseofmammalscausedbyLysavirus(rabiesvirus)istransmitted to humans primarily by saliva of infected animals, the research aims to present the epidemiological situation related to bovine paralytic rabies (RPB) highlight the problems which shoots are present in the municipalities of the northern region of Veracruz. Was conducted in 60 farms at random from Gutierrez Zamora to Panuco, View, obtaining information through a questionnaire, information was obtained on the staff, animals, the vampire bats and prevention measures. The research was conducted from September 2009toApril2011.Theresultsshowedthat85%oftheanimalsareingoodhealth,25% had evidence of bloodsucking bat bites, 21% are recent (days or weeks) and 4% have attackseveryyear,12%ofattackshavenotvisitedplacesfor8years,110possiblecases of this disease, 18 animals were found and 37 suspected adverse RPB, 29 died Derriengue,thislaboratoryconfirmed,theremaining26animalsdiedofothercauses.The R.P.B. is occurring in places where none was present, that the attacks of vampire bats have changed the bat andits habitatis being destroyed without control, considering that many of these problems are due to the lack of updated information, dissemination campaigns to control bat population as well as immunizations and advice on farmers, causinggreateconomiclossesforfarmersandproducers. Keywords:vampirebats,bovineparalyticrabies,zoonoses,veracruz. INTRODUCCIN

El estado de Veracruz es uno de los principales estados con actividad agropecuaria, reflejado en su participacin del 10.3% del PIB estatal y es el principal productordebovinosdedoblepropsito.Enelmbitonacional,Veracruzocupaelprimer lugarenproduccindecarnedebovinoysextoenproduccindelechedebovinotiene uninventariode4065000cabezasdebovinosdedoblepropsitoy60000cabezasde bovinos de leche. La ganadera bovina de doble propsito, es una de las principales

252

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

cadenas productivas, pues se encuentra distribuido en 10 de los 12 Distritos de Desarrollo Rural que conforma el estado de Veracruz. El serio problema de la Rabia ParalticaBovinaqueafectaalaganaderadelospaseslatinoamericanos,esdebidoal murcilago hematfago, quien en caso de padecer la enfermedad, inocula al virus que excretaenlasaliva,enelmomentodemorderalganadoparaobtenersualimento.(Stober 2003).EnMxicolarabiaparalticabovinasepresentaenformaenzoticaen23estados de la repblica, distribuida por toda la costa del golfo de Mxico desde el sur de Tamaulipas hasta Yucatn y por la costa del Pacfico desde el sur de Sonora hasta Chiapas correspondiente al rea de biodistribucin del murcilago hematfago Desmodusrotundus,estremadamenteimportantedesdeelpuntodevistaepidemiolgico de la zoonosis, es que hasta el momento la rabia no tiene tratamiento ni curacin en humanos que han presentado el cuadro clnico que evoluciona irreversiblemente hasta causar la muerte. (Seifert H.S.H. 2002). La solucin a este grave problema no ha sido simple ni sencilla, sobren todo si se toma en cuenta la compleja serie de factores que intervienen en el, tales como: la relacin existente entre la rabia y los murcilagos hematfagos,conlarabiadelasotrasespeciesdemurcilagosyconlasdemsespecies de la fauna silvestre. (Stober 2003). Es de considerar que muchos de los desrdenes actuales en la naturaleza han sido provocados por el hombre, el cual ha sido tambin autordeladifusindemuchasenfermedadeszoonticasporelmundo.Elestudiotieneel objetivo de presentar el panorama relacionado con la Rabia Paraltica Bovina, poner de manifiesto la presencia de brotes en los municipios de la zona norte de Veracruz y en control del vector transmisor del derriengue a los animales y la proteccin a la salud pblica. MATERIALYMTODOS EL AREA GEOGRAFICA DE ESTUDIO. La Zona Norte del Estado de Veracruz. El Periodo septiembre 2009 a diciembre 2010. Para este trabajo se realizaran visitas programadas las Asoc. Ganaderas Locales y a 50 ranchos productores de ganado de doble propsito. Tomando en cuenta el convenio firmado entre la UNIVERSIDAD VERACRUZANA Y LA UNION GANADERA REGIONAL DEL NORTE DE VERACRUZ. Previamente se le solicit al Presidente de la U.G.R.N.V. la relacin de los ranchos productores que pertenecen a la citada agrupacin ganadera para contar con el censo realdelosestablosproductoresdeganadoydeahsetomarlamuestrapoblacionalde estudio. En primera instancia se trabajar con las Asociaciones Locales, Grupos

253

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

GanaderosdeValidacinyTransferenciadeTecnologa(GGAVATT)ydelosproductores independientes dela regin.Se visitarn cada unadelasasociaciones, losranchos de manera aleatoria Y a los GGAVATT con la finalidad de tener el conocimiento de las condiciones del tipo de ganado y las reas de produccin. Aplicando la vigilancia zoosanitaria del proceso de cra, engorda y de la ordea, observando si le aplican vacunascontralarabia,seharvigilanciaepidemiolgicayserevisaranlosregistrosde controles escritos o electrnicos as, como la observacin de los tipos de vacuna antirrbica que manejan. Tambin se investigaron los enfermos, sospechosos y los que hayan muerto recientemente. En algunos casos tomaran muestras de encfalos de los animalesparaanlisisenellaboratorioysecanalizaranadecuadamenteconsuhistoria clnicaparaladeterminacinderabia.Sefomentaraelcontroldemurcilagoyelusode biolgicosveterinariosparaelcontroldelarabiaparalticabovina. RESULTADOSYDISCUSIN Sevisitaron60localidades(Grafica01)dela ZonaNortedeVeracruzconantecedentes deataquesdemurcilagoyquenohan podidocontrolar,siendoPanuco,Ozuluama, Tuxpan,Chiconamel,ElHigo,Tempoal, ChijolesyEjidolosHuastecosconms casosdeataquedemurcilagos.Enlos ranchosvisitadosseobtuvouncensode animales,estoconlafinalidaddeconocerlas especiesquehabaydominabanencada rancho(Grafica03).LosataquesenlaZonaNortedeVeracruzvaria,63%delosranchos encuestadosdesconocenelniveldefrecuenciaquetienenohay,25%tienenfrecuencia deataques,deloscualesel21%sonrecientes(dasosemanas)yel4%presenta ataquescadaao,el12%deloslugares visitadosnopresentanataquesde murcilagosdesdehace8aosmnimo (Grafica14).

254

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

La gravedad del problema ha hecho que constantementesedesarrollenyponganen prctica programas tendientes a lograr la prevencindelaenfermedad, mediantelas medidas de prevencin y el desarrollo de tcnicas de control principalmente la vacunacin masiva del ganado con

diversos tipos de vacunas (Cerecedo, 1997).Elriesgodelarabiaparaliticabovina de su ocurrencia en el hombre y su incidencia en las especies domsticas productivas, particularmente en la ganadera bovina, dado el impacto social y econmico que ello significa, constituyen una preocupacin permanente para las entidades encargadas de velartantoporlasaludpblicacomoporlasaludanimal(Bentezetal.,1992yAlvares 1997). En algunos de los ranchos visitados (Grafica 06) se obtuvo informacin de animalesenfermosy/omuertosporR.P.B,teniendountotalde110casosposiblesaesta enfermedad,deloscuales18animalesseencontraronenfermosocontagiadosdeR.P.B y 37 fueron negativos adems 29 animales murieron a causa de Derrengue, esto confirmado por laboratorio mientras que los 26 animales restantes murieron por otras causas. El estado de salud de los animales observados durante la investigacin mostro que 1.309 animales (19%) estn en Muy Buen estado, 3.400 animales (44%) en Bueno, 2.856 animales (37%) en estado Regular y 0 animales (0%)enMalestado.Larabiaenlospasesdelas Amricas es considerada un problema de salud pblica de importancia, siendo as que llevan adelante programas de vigilancia, prevencin y control en concordancia a las recomendaciones del Comit de Expertos en Rabia de la OMS (8.voInforme),(Navarroetal.,2007).SinembargoenlaZonaNortedeVeracruzel67% delpersonalenloslugaresvisitadostieneconocimientobsicosobreR.P.Byun33%no odesconocelaenfermedadporcompleto,ademsquesoloel33%tieneregistrosclnicos de sus animales. La presente investigacin analizo la presencia de Campaas Antirrbicas en los 60 ranchos, en un 5% hay presencia de campaas antirrbicas solo parapequeasespecies,3%delosranchosvisitadossihaycampaasantirrbicaspero

255

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

nodequetipo,60%desconocenestetipodecampaasquehayyenun32%noseha aplicadoalgunacampaaantirrbica.Paraprevenireimplementarunamedidadecontrol deunbrotederabia,ademsdeldiagnostico,esnecesarioimplementarunprogramade prevencin para ello, se cuenta con cierto nmero de vacunas de excelente calidad (FloresCrespo,1998).Larabiaescontrolableypreveniblemedianteaccionesconjuntas delossectorespblico,socialyprivado,ofreciendoinformacineducativaalrespectoen funcindeunavigilanciaepidemiolgicaeficaz,laatencinmdicaoportunayadecuada, lavacunacinyelcontroldelapoblacincanina,elcontroldelapoblacindelmurcilago hematfago (vampiro) y la vacunacin de animales de otras especies domsticas susceptibles, particularmente las de inters econmico en riesgo (a fin de reducir las considerables prdidas econmicas en la ganadera del pas) (NOM011SSA21993). En la Zona Norte de Veracruz 43% de los ranchos no tienen presencia de murcilagos, mientras que el 44% tienen presencia de murcilagos en sus ranchos y alrededores, peroun13%desconocensihaypresenciaonodemurcilagos(Grafica13).Enelusode lacadenaoredfra,el63%delosranchosmostraronteneruncorrectomanejodeello, sinembargoel23%desconocey/oimplementaun mal manejo,exponiendolavacunaa cambios bruscos de temperatura,lo cualimplica problemas en el animal a lahora dela aplicacin del frmaco. Es difcil que se pueda radicar por completo una enfermedad y ms si hablamos de Rabia Paralitica Bovina, por esa razn es que esta investigacin pretende lograr que las instituciones de todos los niveles tengan acceso a esta informacin, logrando con ello darles una visin de cmo se encuentra hoy en da las medidas preventivas en la ganadera y poder asesorar, capacitar, dar a conocer de maneraoportuna,eficazyconstantealosganaderosdeestazonaparaquesepromueva laculturaenlasmedidasdeprevencinycontrol.

CONCLUSION Esta investigacin pretende evitar los efectos econmicos que la rabia paraltica bovina puedecausar,yaquelleganasercomplejasyconfrecuenciavamsalldelosefectos inmediatos que sufren los productores afectados. Esta enfermedad tiene numerosas consecuencias, los efectos sociales y econmicos tienden a ser clasificados como

256

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

directos,secundarios(impactoenlasactividadesdelasindustriasdemateriasprimas ylasindustriasprocesadorasdeestasmaterias),indirectos(impactoenotrossectores), delargoplazooremotos.Alobtenerelcensodelosranchosganaderosafectadosde la zona norte de Veracruz, se pudo conocer la poblacin bovina, canina y felina de la zona,lograndoobtenerinformacindecasossospechososderabia.Ademsdeparticipar en las plticas de fomento zoosanitario, participacin en la vacunacin antirrbica y capturasdemurcilagohematfagoparasucontrolpoblacional. AGRADECIMIENTOS Anuestrosalumnos:L.G.AguileraB.J.N.VzquezC.V.CallejasR.I.JcomeO.yala MVZ.ZeniaG.JurezRuzporsuapoyoytrabajoduranteestainvestigacin. LITERATURACITADA Amstutz,H.E.(1980).BovineMedicineandSurgery.2a.Ed.AmericanVeterinary Publication,SantaBarbaraCalifornia.Vol1.647p. Blood,D.C.yHenderson,J.A. (1992).MedicinaVeterinaria. McGrawHill,Mxico,D.F. CerecedodeL.S.(1997).DiagnsticodeRabiarealizadosenelCentrodeSaludAnimal SAGAR,periodo19911996enTuxpan,Ver.TesisdelaFac.deMed.Vet.YZootecnia. U.V. CorreonGirn P. (1968). Aspectos Generales Sobre La Rabia En Humanos Y En Las EspeciesDomesticas.Mxico,D.F,130p. Gibbons,W.J.Catcott,E.J. Smithcors,J.F.(1984).MedicinaySaluddelosbovinos.La prensaMedicaMexicana,Mxico,D.F.877p. NavarroV,AnaMaria,BustamanteN,JosySATOS,Alberto.Situacinactualycontrol delarabiaenelPer.Rev.per.med.exp.saludpublica,ene./mar.2007,vol.24,no.1, p.4650.ISSN17264634. NORMAOFICIALMEXICANA,NOM011SSA21993,"ParalaPrevencinyControldela Rabia"" For the Prevention and Rabies Control". Cached. CRP Bovina. Salud. Gobierno Mexicano. OrganizacinMundialdelaSalud.(2005).VIISimposiuminternacionaldeenfermedades zoonoticas.Mexico,D.F,1627p.

257

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

OrganizacinMundialdelaSalud.(2003).VSimposiuminternacionaldeenfermedades zoonoticas.Mexico,D.F,435443p. PN Acha. (1986).Epidemiologia de la rabia bovina paralitica transmitida por los quirpteros.Relatedarticles.36p. Ristic,M.yMclntyre, I.(2003)Diseaseofcattleinthetropics.MartinusNijhoffpublishers. TheHague,Holanda. 662p. Rivas,Martin.(2002).AvancesdelaGanaderadeDoblePropsitoenAmricaLatina. Mexico.D.F.3245p. SAGARPA.(2004).EstadsticaNacionalenGanadodeDoblePropsito.Mxico,D.F.34 148p. Seifert, H.S.H. (2002) Sanidad Animal en los trpicos. Editorial Hemisferio Sur, Buenos Aires,Argentina.465p. Seifert,H.S.H.(2002)SanidadAnimalenlostrpicos.EditorialHemisferioSur,Buenos Aires,Argentina.465p. Shultz.Etal..(2003).TratadodeenfermedadesdeGanadovacuno.Acribia,Zaragoza, Espaa.628p. Stober,M.(2003)Sintomatologadiferencialdealgunasenfermedadesdelsistema nerviosocentralenelbovino.NMVNoticiasMedicoVeterinarias.No.2,pp.99121 Wiktoretal(2001).LaimportanciadelazoonosisenAmericaLatina.RevistaCientifica, deCostaRica,234263p.

258

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ46)Calidadsanitariadelalechedeexplotacionesentransicinorgnicade TecpatnChiapas

MilksanitaryqualityforfarmsintransitiontoorganicofTecpatnChiapas
1 2 1 BernardoSnchezMuoz ,JoseNahedToral ,JosLuisCruzLpez ,JorgeLuisRuiz 1 1 1 Rojas , AlbertoManzurCruz ,MiguelAngelOrantesZebadua

C.A. Sistemas sustentable de produccin animal y transferencia de tecnologa para el desarrolloruralFMVZUNACHkm.8carreteraTeranE.ZapataTuxtlaGutirrezChiapas


2

ECOSURSanCristbal

jbersam@gmail.com*autorparacorrespondencia

RESUMEN El objetivo de la presente investigacin fue evaluar la calidad sanitaria de la leche a travs de la determinacin del nmero de clulas somticas, utilizando el Delaval Cell Counter(DCC)yelmtododereaccinenzimtica(Portacheck).Serealizounmuestreo simpledeleche,conseisrepeticiones,aniveldeboteytermoen15ranchosporgrupo deproductores,detreslocalidadesentransicinorgnicaLusEspinosa(LE),Emiliano Zapata(EZ)yRaudalesMalpaso(RM)delMunicipiodeTecpatn,Chiapas.Sedetermino elnmerodeclulassomticasenlecheporlocalidadmesdeestudioysuclasificacin porrangossegnsucalidad.Losresultadosobtenidosencuantoalcontenidopromedio de clulas somticas en leche en los tres grupos utilizando el DCC o Portacheck, no mostraron diferencias (P0.05) siendo estos de 321642cs/ml, 226427 cs/ml y 311943cs/mlparalosgruposdeLE,RMyEZrespectivamente,perosihubodiferencias cuandosecompararonlosmtodosutilizados,siendomuchomasprecisoelDCC.Nose encontraron diferencias en el contenido de clulas somticas cuando las muestras se colectaron a nivel de bote o termo, analizadas con el DCC, siendo de 286,822 cs/ml y 311,000cs/mlrespectivamente.Seencontrunmayorcontenidodeclulassomticasen los meses de mayor precipitacin pluvial (Junio y Julio) con 449,277 cs/ml y 324,660 cs/ml,porotroladoseencontrqueel80.8%delasmuestrasanalizadasseclasificaron como clase 1 o de calidad, < 400,000cs/ml. Se concluye que la leche proveniente de explotacionesentransicinorgnicadelMunicipiodeTecpatnChiapasesdecalidady puedeseranalizadatomandomuestrasdirectamentedeltermodeacopio.

259

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Palabrasclave:Anlisis,lecheorgnica,clulassomticas

ABSTRACT The objective of this research was evaluate the sanitary quality milk, through the determinationofthenumberofsomaticcellsusingaDelavalCellCounter(DCC)andthe enzymaticreactionmethod(Portacheck).Asimplemilksamplingwascarriedout,withsix repetitions,attheherdlevelandbulkmilktanklevelon15ranchesforproducergroupsin three locations under transition to organic production: Luis Espinosa (LE), Emiliano Zapata (EZ), and Raudales Malpaso (RM) in the municipality of Tecpatan, in Chiapas, Mexico. The number of somatic cells was determined for each location and month of study, and milk samples were classified by ranges according to their quality. Average somaticcellcontentinthemilkobtainedusingDCCorPortacheckforthethreegroupsdid not show differences (P0.05) results were 321,642sc/ml, 226,427sc/ml, and 311,943sc /ml for producer groups from LE, RM, and EZ, respectively. However, differences were foundwhenthetwocountingmethodswerecomparedDCCwasmuchmoreprecise.No differenceswerefoundinsomaticcellcontentwhenthesampleswerecollectedataherd or bulk tank level and analyzed with DCC results were 286,822 sc/ml and 31,100 sc/ml respectively.Agreatercontentofsomaticcellswasfoundduringthemonthsofgreatest precipitation (June and July): 449,277sc/ml and 324660sc/ml. 80.8% of the samples analyzed were classified as class 1 or high quality, with a somatic cell content < 400 000sc/ml. We conclude that milk from farms in transition to organic production in the municipality of Tecpatan, Chiapas is of highquality and may be analyzed by taking samplesdirectlyfromthebulktank. Keywords:milkquality,organicmilkproduction

INTRODUCCIN Lacalidadsanitariadelalecheestreferidaalrecuentodeclulassomticasestasson principalmenteclulasdedefensadelaglndulamamariayenmenorcantidad,clulas de descamacin del epitelio glandular que se vuelcan en la leche producto del funcionamiento normal de la glndula mamaria. El recuento de clulas somticas constituyeunparmetrodegranvalordiagnosticoparaestablecerelnivelsanitariodela glndulamamariadeunanimalounrebao.

260

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Elrecuentodeclulassomticasesunindicadordelascondicionessanitariasdelrebao y de la calidad tecnolgica de la leche destinada a procesos Norman et al. (2000). En Mxico la normativa sobre la calidad sanitaria de la leche establece que una leche de calidad1contiene400CS/ml,COFOCALEC(2004).Entrelosdiversosprocedimientos empleados para determinar el anlisis de clulas somticas en leche, se dispone de mtodos cualitativos como: Prueba de California para Mastitis (CMT), Prueba de Wisconsin(WMT)ycuantitativosCuentaMicroscpicadeClulasSomticas(CMCS)y el uso de Contadores Electrnicos como el Fossomatic el Contador Infrarrojo tambin conocidocomoDelavalCellCounter(DCC)yelPortaCheckentreotros. Elobjetivodelpresentetrabajo,fueevaluarlacalidadsanitariadelalecheatravsdela determinacin del nmero de clulas somticas en explotaciones en transicin a la produccinorgnica.

MATERIALESYMTODOS

La presente investigacin se llevo a cabo en tres SPR en transicin orgnica del municipiodeTecpatnChiapasparalocualserealizounmuestreosimplemensual,con seis repeticiones, a nivel de bote en 15 ranchos de cada uno de los grupos de productoresydelostermosdeacopiocorrespondientes. El contenido de clulas somticas se determino empleando el DCC Manual de instrucciones DeLaval cell counter (2005). y el mtodo de reaccin enzimtica o Porta Check2006(ManualdeinstruccionesdelPortaCheck2006). Se evalu el nmero de clulas por grupo de productores, mes de estudio, y su clasificacinporcalidaddeacuerdoalanormaCOFOCALEC. Los datos obtenidos fueron sometidos a un anlisis de varianza utilizando el procedimientodelModeloLinealGeneral(ProcGLM)delpaqueteestadsticoSASversin 9. Cuando se apreciaron diferencias significativas entre las medias ests fueron analizadas mediante la prueba de comparacin mltiple de tuckey (P< 0,05). Adicionalmente, se establecieron las frecuencias por rangos utilizando el procedimiento ProcFREC.

261

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RESULTADOSYDISCUSION Losresultadosobtenidosencuantoalcontenidopromediodeclulassomticasenleche detresgruposdeproductoresentransicinorgnicautilizandoelDCCyPortacheck,no mostraron diferencias (P0.05) siendo de 321642 cs/ml, 226427cs/ml y 311943 CS/ml paralosgruposdeLuisEspinosa(LE),RaudalesMalpaso(RM)yEmilianoZapata(E.Z) respectivamente, pero si hubo diferencias por mtodo utilizado, siendo de mucha mas precisinelDCCCuadro1. Cuadro1.ContenidodeclulassomticasenlechedetreslocalidadesutilizandoDCCy Portacheck.

Localidad LusEspinosa

n 75

No de CS/ml en No de CS/ml en leche utilizando leche utilizando DCCXD.E PortachecXD.E 318,308248933 34,92235311

RaudalesMalpaso

75

226,427253859

35,94727718

EmilianoZapata

75

311,943332759

32,55738694

Filasquecompartenlamismaliteralnohaydiferencias(P0.05)

Losresultadosobtenidosindicanqueenpromedioelnmerodeclulassomticasfueron menores de 400.000 CS/mL, lmite dentro del cual las propiedades tecnolgicas de la lechesonconsideradasaceptables(Ferrusca2009)ylacalidadsanitariadelamismase encuentradentrodelosestndaresmarcadosporCOFOCALECparalechedecalidad.

262

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ConrespectoalmtodoutilizadoparaelrecuentodeclulassomticasLazcano(2006), vila et al. (2002) y Avila y Lazcano (2006) mencionan que la confiabilidad es mayor empleando mtodos electrnicos como el Delaval (DCC) y el contador electrnico (Fossomatic)omicroscpicos. Enelrecuentodeclulassomticasobtenidoaniveldeboteytermo,noseencontraron diferencias(P0.05)siendoestasde 311000122687cs/mly 286,822117030CS/ml por lo que resulta confiable para efectos de estudios de calidad sanitaria de la leche obtener muestras directamente del termo. Este resultado es similar a lo reportado por Tavernaetal.(2001) quienesnoencontrarondiferenciassignificativasenelcontenidode clulassomticasobtenidasapartirdeboteytermoyendondesealanlosbeneficiosdel muestreoaniveldebote.Porotroladoelrecuentodeclulassomticasesunindicador delapresenciademastitisclnicay/osubclnica,ascomolacalidadsanitariadelaleche, los valores lmites de recuento de clulas somticas varan en distintos pases, se considera que por encima de las 500,000 clulas/mL se trata de leche con alta prevalenciademastitisSaranyChaffe(2000).

En cuanto al contenido de clulas somticas por mes de estudio se observo un mayor contenido en los meses de Junio y Julio con 449,277 244,648 sc/ml y 324,660 273,052cs/ml.(cuadro2)

263
Cuadro2.Nmerodeclulassomticasenleche,pormesesdeestudio.

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Mesdeestudio Mayo

Numerode muestras 45

Numerodeclulassomticas XDE 241,124138,000

Junio

45

b* 449,277 244,648

Julio

45

b 324,660 273,052

Agosto

45

c 242,511 163,273

Septiembre

45

ac 209,421 159,825

Octubre

45

7ac 195,953 154,661

total

225

a 226,822 117,030

Filasquenocompartenlamismaliteralpresentandiferencias(P0.05).

EstasituacinprobablementehayasidoinfluenciadaporqueenlosmesesdeJunioyJulio se registr la mayor precipitacin pluvial lo que favorece los problemas de mastitis y el incrementoenelrecuentodeclulassomticas Tavernaetal.(2001)yTornaldijoetal. (1998).Alclasificarlasmuestrasatendiendoalopropuestoenlanorma COFOCALECno se encontraron diferencias entre localidades, observndose que en el 80.8% de las muestras la calidad sanitaria fue en general excelente con menos de 400,000 cs/ml (Cuadro3).

264

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Cuadro3.Clasificacindemuestrasdelechedeacuerdoalnmerodeclulassomticas propuestoporCOFOCALEC.

Localidad

Clase1 400,000cs/ml

Clase2 401,000a

Clase3 501,000a

Clase4 750,000a

500,000cs/ml 749,000cs/ml 1,000,000cs/ml

LusEspinosa

75.2%

5.8%

10.5%

5.8%

RaudalesMalpaso

85.7%

5.71%

4.28%

1.42%

EmilianoZapata

81.5%

4.61%

6.15%

1.53%

Estudios realizados por Calvinho et al. (2003) mencionan que en muestras a nivel de termo obtener un nmero menor de400,000 clulas somticasindica unaleche sana y de excelente calidad, y recuentos mayores a 500,000 cs/ml los hatos se encuentra sospechosos de mastitis subclnica y leche de baja calidad y es considerado como el umbralinferiordentrodelcuallasaptitudestecnolgicasdelalechesonaceptadasporla industrialctea. Para obtener bajos recuentos de clulas somticas y bacteriolgicos, hay dos puntos claves a considerar limpieza e higiene de la vaca y su medio ambiente y en segundo lugarunrpidoenfriadodelalecheinmediatamenteluegodelordeoloquedetendrel crecimientobacterianoJuozaitisandMicikeviciene(2006),Garca(2003).

CONCLUSIONES Noseencontrarondiferenciasenelnmerodeclulassomticas,presenteenmuestras de leche de tres localidades en transicin orgnica, ni cuando las muestras fueron tomadasaniveldeboteytermoporloqueesconfiableparaefectosdeestudioobtener muestrasdirectamentedeltermo.

265

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

El nmero de clulas somticas fue diferente entre los meses de estudio, siendo mayor durantelosmesesdeJunioyJulioquecorrespondieronalosmesesmslluviosos.Por otrolado,elrecuentodeclulassomticasutilizandoelDCC,representaunaherramienta confiable, dentro de la unidad de produccin para conocer la calidad de la leche y la saluddelasubresdentrodelhato. LITERATURACITADA vila,T.SP.R.Lazcano.2006.Determinacindelnumerodeclulassomticasenleche atravsdelaaplicacindelaspruebasparamastitis:CMT,WMT,CMCS,Fossomaticy DCC.MemoriasXXIVcongresomundialdeBuiatria,NizaFrancia. vila,T.SA.J.C.GutirrezJ.I.SnchezE.J.Canizal.2002.Comparacindelestado de salud de la ubre y la calidad sanitaria de la leche de vaca ordeada manual o mecnicamente.VetMxico.33(4):387394. Calvinho, L V Canavesio N. Aguirre, 2001. INTA Rafaela Anlisis de leche de tanque frio. Recuperado el 23 de noviembre de 2009. En

http://rafaela.inta.gov.ar/revistas/cha0201.htm COFOCALEC2004.NormaMexicanaNMXF700COFOCALEC2004.Sistemaproducto lechealimentoLcteolechecrudadevacaespecificacionesfisicoqumicas,sanitarias ymtodosdeprueba.


e Ferrusca, F. 2009. Inocuidad y calidad de la leche, Delaval. En memoria 1 Congreso

Internacionaldelaleche.TuxtlaGutirrez,Chiapas.Mxico. Juozaitis, L and R. Micikevicien, 2006. Relationship between somatic cell count and milk productionormorphologicaltraitsofudderinblackandwhitecows.TurkJVetAnimSci. (30):4755. Lazcano, P.R. 2006. Nmero de clulas somticas en leche de tanque mediante la aplicacin delas pruebas para mastitis: CMT,WMT, CMCS, CE y CI. Tesis profesional. Facultad de Medicina Veterinaria y Zootecnia Universidad Autnoma de Mxico Mxico DF. Manualdeinstrucciones2005.DeLavalcellcounterDCC,1raEdicin. Manualdeinstrucciones2006PortaCheck2daedicin. Norman, H.D R.H.Miller J.R. Wright .G.R. Wiggans. 2000. Herd and state means for somaticcellcountfromdairyherdimprovement.J.DairySci.83.Pp120135.

266

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Taverna, M.V. A Charln,. M Cuatrin,., R. P, Gaggiotti Chvez. M. 2001. Composicin qumica de la leche en la cuenca lechera central de la Argentina. Anuario 2001, recuperadoenmayode2011.http://rafaela.inta.gov.ar/anuario2001/a2001_54.htm Tornaldijo,M.EI.AM.C.F.MarraGarcaB.PrietoyJ.Carballo,1998.Lacalidaddela leche destinada a la fabricacin de queso: calidad qumica. Ciencia y Tecnologa Alimentaria,2(2):7991. Garca,S.R.2003.Clulassomticasunaadvertenciasindarnoscuenta.RevistaHolstein deMxico,34(8)2728. Saran, A M. Chaffe. 2000. Mastitis y calidad de la leche. Edit. InterMdica. Medellin Colombia.203p.

267

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 50) INHIBIDORES DE HIDROXIMETIL GLUTARIL COENZIMA A (HMG CoA) EN EL COMPORTAMIENTO PRODUCTIVO Y MICROBIOLGICO RUMINALDEOVINOS
*1 2 Dr.MarcosPrezSato ,Dr.GermnBuendiaRodrguez ,IdaniaAvelino 3 1 1 Suarez ,M.CEutiquioSoniGuillermo ,M.CRamiroEscobarHernndez ,Dr. 1 2 MarcelinoBecerrilHerrera ,AbelFlixFloresGarrido ,NumaPompilioCastro 1 1 Gonzlez , PabloZaldvarMartnez 1

FacultadenCienciasAgrcolasyForestalesBenemritaUniversidadAutnoma de Puebla, Reforma 165 Colonia Centro, Tlatlauquitepec Puebla, *Email: marcos.perez@correo.buap.mx*autorparacorrespondencia

RESUMEN SeevaluelefectodelautilizacindeinhibidoresdeHMGCoAenlarespuesta productiva,fermentacinruminalypoblacindemicroorganismosde20borregos cruza Katahdin Pelibuey con un peso promedio inicial de 20 kg, los cuales se distribuyeronenjaulasconcomederosybebederosindividuales.Lostratamientos (T) experimentales fueron: T1 con 0 mg de mevastatin y T2 con 20 mg de mevastatin.Lasvariablesrespuestaseanalizaronestadsticamenteutilizandouna pruebaTStudentparamuestrasindependientes. Para estimar la concentracin de protozoarios ruminales se utiliz la Cmara de Neubauer.Elconsumodealimentomostrdiferenciassignificativas(P0.05)(1.05 vs1.01kg),encuantoalagananciadiariadepeso(GDP)yconversinalimenticia (CA)noexistierondiferenciassignificativasentrelosdiferentestratamientos(0.279 vs 0.270) vs (5.45 vs 5.51), respectivamente. En las variables ruminales el pH
5 (6.11 vs 6.32) y la concentracin de protozoarios (12.15 vs 11.44 x 10 ) no

presentarondiferenciassignificativas. Palabrasclave:Bacteria,rumen,HMGCoA

268

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

INTRODUCCIN A nivel mundial las actividades humanas han aumentado considerablemente la concentracindegasesconefectoinvernaderoenlaatmosfera,comosondixido de carbono (CO2), metano (CH4), oxido nitroso (NO2), hidrofluorcarbonados (HFC), perflurocarbonados (PFC) y hexafloruro azufrados(SF), lo que est causando un calentamiento global. Los gases efecto invernadero (GEI) emitidos por la actividad agropecuaria son el CO2, CH4 y el N2O (Agriculture and Rural DevelopmentofAlbertaCanada,2005). El CH4 es un GEI que adems de acumularse provocando calentamiento en la superficie terrestre, produce la destruccin de la capa de ozono a nivel de la atmosfera.AunqueelCH4eslasegundoGEIenvolumendeproduccin,despus deldixidodecarbono,poseeunpotencialenelcalentamiento2131vecesmayor que el CO2 (McCaughey et al., 1997 y McCaughey et al., 1999 citado por Carmona et al., 2005). La produccin pecuaria contribuye ampliamente con las emisiones antropogenicas de CH4 a la atmosfera. McCaughey et al. (1997) y Moss et al. (2000) indican que los animales domsticos, principalmente los rumiantes,sonlosresponsablesaproximadamenteel15%laproduccinglobalde CH4. Adems del efecto invernadero asociado a las metanognesis ruminal, el CH4 representaunaprdidaenergticaconsiderableparaelanimal.Estonormalmente representa5.56.6%deltotaldelaenergaconsumidaenladieta(McCaugheyet

al.,1997),aunquetambinsehareportadoenanimalesdepastoreosetieneuna
perdida energtica del 12% y cuando el forraje es de mala calidad puede llegar hasta18%(Carmonaetal.,2005) Por lo cual se han realizado diversas investigaciones enfocadas a reducir la produccin de metano por los rumiantes, tales como la adicin de ionoforos (monensinaylasalocida)ycidosgrasosinsaturados(Asanumaetal.,1999).Sin embargo los resultados obtenidos no han sido muy consistentes por lo que una alternativaeslautilizacindecompuestosaltamentereductores,comoelfumarato desodioquecompiteporloshidrgenosdisponibleselmedioyconlacapturade

269

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

estosseformasuccinato,queeselprecursordepropianato.Otraalternativaesla inhibicin del crecimiento de bacterias productoras de metano por la adicin de inhibidoresdehidriximetilglutarilCoAreductasa,queesunaenzimaqueinterviene enla sntesis deisoprenoides (Miller yWollin, 2001), considerados componentes importantesenlamembranalipidiadearqueasmetanognicas. Portodoloanteriorelobjetivodeestainvestigacineslautilizacindeinhibidores deHMGCoAconlafinalidaddeteneralternativasqueayudenhacermseficiente el uso de la energa consumida por los rumiantes, durante el proceso de fermentacinydeestamanera, mejorarlaproduccindecarneoleche,adems dereducirlaacumulacindemetanoenlaatmosfera.

MATERIALESYMTODOS Localizacingeogrfica LapresenteinvestigacinserealizenlasinstalacionesdelaUnidadAcadmica deIngenieraAgrohidrulica,delProgramadeIngenieraAgronmicayZootecnia de la Benemrita Universidad Autnoma de Puebla, la cual se ubica en el municipio de Tlatlauquitepec, Puebla, que se localiza en la parte noreste del EstadodePuebla,suscoordenadassonlosparalelos193624y200318de latitud norte y los meridianos 9714 42 y 97 28 06 de longitud occidental. Al Norte: con Cuetzlan del Progreso, al este: con Chignautla, Atempan y Yaonhuac, al sur: con Cuyuaco y al oeste: con Zautla, Zaragoza y Zacapoaxtla (INEGI,2008). Establecimientodelexperimento Animales Seusaron20ovinoscruzadeKatahdinPelibuey,conunpesopromediode20kg. Los animales, se desparasitaron y vitaminaron (ADE) antes de iniciar el experimento.Fueronidentificados,ysesometidosaunperiododeadaptacin(10 d)sealojaronenjaulasconcomederosybebederosindividuales.

270

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Dietas LadietaseformulconelprogramacomputacionalUsedFeedFormulationDone Again,UFFDA(PetsiyMillar,1995),paraovinosconunpesopromedioinicialde 2025kgyconunagananciadiariadepesoesperadade250g,deacuerdocon losrequerimientosnutritivosdelNRCdeovinos(1985).

Tratamientosexperimentales Lostratamientos(T)fueronlossiguientes: T1=20mgdemevastatin T2=Tratamientotestigo

Anlisisestadstico LasvariablesrespuestaseanalizaronestadsticamenteutilizandounapruebadeT deStudentparamuestrasindependientes.

Variablesaevaluadas Consumoyrechazodealimento Gananciadiariadepeso pHruminal Concentracindeprotozoarios

RESULTADOSYDISCUSIN Consumodemateriaseca En el Cuadro 1 se observa el consumo de materia seca (CMS), los dos tratamientos fueron diferentes significativamente entre periodo y promedio (p 0.05) siendo el T1 el que mayor consumo present (1.0574 vs 1.0179) , estos resultadosseexplicanprobablementeaquelasdietasconunmnimodeforraje, son digeridas rpidamente, por lo que aportan en un tiempo muy corto una cantidad importante de almidn, que es rpidamente fermentable en el rumen, favoreciendolaformacindecidopropinico(msdel30%)ymenoscantidadde

271

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

cido actico y butrico, contrario a lo que ocurrira con dietas a partir de forraje (Dearriba,1988). Cuadro1.Consumodemateriaseca(CMS)deborregoscruzaKatahdin PelibueyalimentadosconysininhibidoresHMGCoAreductasa
1 CMS(kgd )

Periodo** 1 2 3 PROMEDIO

T1 0.9133 1.0055 1.135 1.0179

*DE 0.008 0.0039 0.008 0.0018

T2 0.9638 1.0332 1.1752 1.0574

DE* 0.0012 0.0029 0.0009 0.0016

P* 0.001 0.0001 0.0001 0.0001

**Periodosde30d*DE=DesviacinestndarP=Valores<0.05existediferencia significativa Existentambinfactoresqueafectanelpasodelalimentocomosoneltamaode la partcula y gravedad especifica, tambin estn las caractersticas fsicas de la dieta, rompimiento de las partculas lo que indica que al utilizar forraje de baja calidad como los rastrojos, con bajo contenido de nitrgeno no proteico se incrementa la digestibilidad en el rumen y se obtiene un aumento en el paso de partculadebidoasudisminucindesutamao,sinembargolacalidaddeestos forrajesesmalarepercutiendoposteriormenteenlasgananciasdepeso. Gananciadiariadepeso La ganancia diaria de peso Cuadro 2 se observa que no existieron diferencias significativasentrelosdostratamientos,sinembargoseobservaquelosanimales del tratamiento uno en el primer periodo present una menor ganancia de peso debido posiblemente a una menor adaptacin de estos animales y de los microorganismos ruminales a la dieta (Owens et al., 1998). Por lo tanto, durante este tiempo, los borregos y la poblacin de microorganismos del rumen se adaptaron adecuadamente a la dieta. En investigaciones donde se han utilizado dietasaltasengranoenborregosnoseobservunefectosignificativoencuantoa gananciadiariadepeso(LyfordyHuber,1988).

272

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Cuadro2.Gananciadiariadepeso(GDP)deborregoscruzaKatahdinPelibuey alimentadosconysininhibidoresHMGCoAreductasa
1 GDP(gd )

Periodo** 1 2 3 PROMEDIO

T1 241.33 308.66 275.80 275.26

*DE 0.0298 0.076 0.0509 0.0522

T2 250.0 294.0 277.77 273.92

DE* 0.0911 0.1211 0.0149 0.0759

P* 0.1667 0.6163 0.8546 0.5458

**Periodosde30d*DE=DesviacinestndarP=Valores<0.05existediferencia significativa pHruminal Se considera que el pH es un factor determinante en las fluctuaciones de las poblacionesbacterianasylamayoradelasbacteriastieneunbuendesarrollocon unpHqueoscilaentre6.2y7.0.(Sauvantetal.,1994). Los valores de pH representados en el Cuadro 3, muestran que no hubo diferencias significativas entre los tratamientos (p>0.05), se observa que los valoresdepHsepuedenconsiderardentrodelrangonormal,sepuedeobservar queenelsegundoperiodoelpHfueinferiora6.0paralosdostratamientos(5.824 vs5.7133)debidomuyposiblementequeenelsegundoperiodo(60d)elconsumo eramayor,porlotantounmayornmerodecarbohidraCuadro3.pHruminalde borregos cruza Katahdin Pelibuey alimentados con y sininhibidores HMGCoA reductasa pHruminal Periodo** 1 2 PROMEDIO T1 6.40 5.82 6.11 *DE 0.6108 0.1288 0.3698 T2 6.94 5.71 6.32 DE* 0.3876 0.208 0.2042 P* 0.2682 0.2021 0.2351

**Periodosde30d*DE=DesviacinestndarP=Valores<0.05existediferencia significativa

273

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Protozoariosruminales Los resultados de la concentracin de protozoarios (Cuadro 4) no fue afectada significativamente(P>0.05)enlostratamientos.Laimportanciadelosprotozoarios es considerable si se toma en cuenta que representan entre el 40 y 50 % de la biomasa microbiana en el rumen y tienen gran influencia en la produccin de protena bacteriana mediante la predacin de bacterias y competicin por substrato(Nolan,1993).AlnoexistirdiferenciassignificativasenlosvaloresdepH y adems estos estn dentro del rango reportado por Nolan (1993) es lgico esperar que tampoco existieran diferencias significativas en las concentraciones deprotozoarios. Cuadro4.ConcentracindeprotozoariosdeborregoscruzaKatahdinPelibuey alimentadosconysininhibidoresHMGCoAreductasa
4 1 Concentracindeprotozaoriosx10 mL

Periodo** 1 2 PROMEDIO

T1 74.93 168.08 121.50

*DE 25.09 72.69 48.89

T2 109.07 119.9 114.48

DE* 31.49 121.74 76.61

P* 0.2160 0.4823 0.34915

**Periodosde30d*DE=DesviacinestndarP=Valores<0.05existediferencia significativa CONCLUSIONES El efecto de la utilizacin de inhibidores de HMGCoA en ovinos nos permite concluir: ElCMSfuediferentesignificativamenteentreelT1yT2 LaGDPnofuediferentessignificativamente El pH y la concentracin de protozoarios y bacterias totales no fueron afectadassignificativamenteporlaaccindelinhibidordeHMGCoA

274

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

LITERATURACITADA AgricultureandRuralDevelopmentofAlbertaCanada,2005.ClimateChangeand Agriculture In: http://www1.agric. Gob.av.ca/$departament/deptdocs.nsf/all/cl9706. 55p. Carmona,J.C.Bolvar,D.M.yL.A.Giraldo.2005.Elgasmetanoenlaproduccin ganadera y alternativas para medir sus emisiones y aminorar su impacto a nivel ambiental y productivo. Revista Colombiana de Ciencias Pecuarias. 18(1): 4963 pp. McCaugheyW,WittenbergK,CorriganD.1997,Impactofpasturetypeonmethane productionbylactingbeefcows.CanJAnSc79(2):221226. Moss AR, Jouany JP, Newbold J. 2000, Methane production by ruminants: its contributiontoglobalwarming.INRAEDPSciences.AnnZootech,49:231253. Asanuma, N., Iwamoto and T. Hino. 1999. Effects of addition of fumarate on methaneproductionbyruminalmicroorganismsinvitro.J.DairySci.82:780787. Miller, L. T., and M. J. Wollin. 2001. Inhibition of growth of methaneprocing bacteria of the rumiant forestomach by hidroxymethylglutarylSCoA reductasa inhibitors.AmericanDairySci.Association.84:14451448. INEGI.2008.cartas topo NRC. 1985. Nutrient Requirements of Sheep. (5ta. Ed.). NationalAcademicofScience.NationalResearchCouncil,Washington,D.C.99p. grficas.http.//.inegi.gob.mx/geo/defaul.asp Pesti, G. M. and B. R. Miller. 1993. Animal Feed Formulation, Economics and ComputerApplications.An.AVIBook,VanNostrandReinhold.Georgia.USA.320 p. DeArriba,CJ1988:FisiologayBioqumicadelaDigestinenelrumiante.Edit. Oriente.SantiagodeCuba.P.12

275

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Owens,F,N.,D.S.,Secrist,W.J.HillandD.R.Gill.1998.Acidosisincattle. Areview.J.Anim.Sci.76:275286. Sauvant,D.,Chapoutot,P.yArchimede,H.(1994)INRAProd.Anim.7:115124. Nolan, J. V. 1993.Nitrogen Kinetics. Quantitative Aspects of ruminant Digestion and metabolism. Forbes, J. M. and J. France (eds.).CAB International. Australia. pp:123143.

276

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 51) SENSIBILIDAD in vitro DE CEPAS DE Escherichia coli HEMOLTICA AISLADAS DE CANALES DE BOVINOS EN EL ESTADO DE MXICO

In vitro sensibility of hemolytic Escherichia coli strains isolated from cattle


carcassesintheStateofMexico

SaulAguilarMontesdeOca*,MartnTalaveraRojas,AdrianadelCarmenGutirrez Castillo,NydiaReyesRodrguez,JorgeVarelaGuerrero.

Centro de Investigacin y Estudios Avanzados en Salud Animal. Facultad de Medicina VeterinariayZootecnia.UniversidadAutnomadelEstadodeMxico.Km.15.5carretera panamericana TolucaAtlacomulco, Toluca, Mxico, CP. 50090. Email: saul_holic@hotmail.com*Autorparacorrespondencia.

RESUMEN

El objetivo de este trabajo fue conocer la sensibilidad a los antimicrobianos de cepas de E. coli hemolticas aisladas de canales de bovino. Se emplearon 54 cepasrecolectadasdelosrastrosmunicipalesdeAtlacomulco,CalimayayToluca, Estado de Mxico. Todos los aislamientos analizados produjeron hemlisis en agar gelosa sangre. La sensibilidad in vitro se realiz primero mediante una pruebadedifusinenagarenlaqueseemplearon12agentesantimicrobianosla mayoradelosaislamientosfueronresistentesalacefalotina(63%),carbenicilina (24%), ampicilina (22%), y trimetoprimsulfametoxazol (20%). No hubo aislamientosresistentes a la ceftriaxona y amikacina. Posteriormente unaprueba de dilucin en tubo se realiz para determinar las Concentraciones Mnimas Inhibitorias (CMIs) de los aislamientos obtenidos para la amikacina, ampicilina y carbenicilina la amikacina inhibi el crecimiento de todos los aislamientos a una concentracinde10g/mL,huboresistenciaalaampicilinaaunaconcentracin

277

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

de 2560 g/mL y resistencia a la carbenicilina a 3200 g/mL. El rastro que presentelmayornmerodeaislamientosresistentesfueeldeToluca.Envarios pasestambinsereportaresistenciaantimicrobianaalactmicosytrimetoprim sulfametoxazol, sin embargo, en Mxico la proporcin de aislamientos y las CMI sonmselevadasqueenotrospases,loquequiztengarelacinconunusono controladodeestosagentesquimioteraputicostantoenmedicinahumanacomo enmedicinaveterinaria. Palabrasclave: Escherichiacoli,sensibilidadinvitro,antimicrobianos,CMI

ABSTRACT

The aim of this study was to determine the antimicrobial sensibility of hemolytic strainsofE.coliisolatedfrombeefcarcasses.Weused54strainscollectedfrom the municipal slaughterhouses of Atlacomulco, Calimaya and Toluca, Mexico State. All analyzed isolates produced hemolysis on blood agar. The in vitro sensibility was performed first by agar diffusion test in which 12 antimicrobial agents were used, most of the isolates were resistant to cephalothin (63%), carbenicillin (24%), ampicillin (22%) and trimethoprimsulfamethoxazole (20%). Therewerenoisolatesresistanttoceftriaxoneandamikacin.Subsequentlyatube dilution test was performed to determine the minimum inhibitory concentrations (MICs) of isolates for amikacin, ampicillin and carbenicillin, amikacin inhibited growth of all isolates at a concentration of 10 mg/mL, there was antimicrobial resistance to ampicillin at a concentration of 2560 mg / mL and carbenicillin resistance to 3200 mg / mL. The slaughterhouse that had the highest number of resistant isolates was the Toluca. Several countries also report antimicrobial resistance to lactam and trimethoprimsulfamethoxazole, but in Mexico, the proportionofisolatesandtheMICsarehigherthaninothercountries,whichmay berelatedtoanuncontrolleduseofthesechemotherapeuticagentsbothinhuman medicineandveterinarymedicine. Keywords:Escherichiacoli,invitrosensibility,antimicrobials,MIC.

278

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 INTRODUCCION

Escherichia coli (E. coli), al igual que otros miembros de la familia Enterobacteriaceae se hallan ampliamente distribuidos en el agua, la tierra, las
plantasyespecialmenteeneltractointestinaldelhombreydelosanimalescomo parte de la microflora bacteriana normal del intestino delgado y grueso, no obstante, algunas cepas son patgenas y pueden producir infecciones entricas (Machotaetal.,2002).DeacuerdoconNataroyKaper(1998),hayseisprincipales categoras o grupos de E. coli diarreognica y uno de estos es E. coli enterohemorrgica (EHEC), el cual comprende un nmero importante de patgenosentricoszoonticosquehanemergidocomounproblemadesaluden lasltimasdcadas. LasepidemiasporEHECsoncomnmenteatribuidasalconsumodecarne,leche y productoslcteos, en particular aquellos derivados del ganado con el paso de losaossehanencontradoenotrosalimentosyotrasformasdetransmisinque incluyen una contaminacindirecta oindirecta con heces fecales (Stevenset al., 2002). En el Estado de Mxico se ha reportado la presencia de EHEC, especialmentedelserotipoO157:H7(Reyes,2010). Elempleodeantimicrobianosenmedicinahumanayveterinariahatradoconsigo la seleccin de cepas resistentes a estos, lo que dificulta la eleccin de un tratamientoadecuado,ademsdesuutilidadclnicaparacombatirinfeccionespor EHEC en humanos. Sin embargo, estudios recientes sugieren que algunos antimicrobianos al administrarse en el curso temprano de la infeccin pueden prevenir el progreso de la enfermedad (Panos et al., 2006). Para que el tratamiento antimicrobiano funcione contra cepas patgenas de E. coli, primero deben ser susceptibles a los antibiticos, por lo que el objetivo del siguiente estudio fue valorar la sensibilidad in vitro de cepas de EHEC recolectadas en el EstadodeMxicoparaconocerelpatrnderesistenciaantimicrobianayobtener lagamadisponibledeantimicrobianosquepodratenerunefectoteraputico.

279

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

MATERIALESYMETODOS

Se emplearon54 cepas recolectadas enlosrastros delos municipios de Toluca, Atlacomulco y Calimaya, Estado de Mxico. Dos pruebas de sensibilidad in vitro fueron utilizadas, primero una prueba de difusin en agar empleando 12 discos con diferentes antimicrobianos, para esto se prepar un inculo bacteriano de cada cepa en tubos de ensaye con caldo MuellerHinton (MH) con un patrn de turbidezde0.5delaescaladeMcFarlandloqueequivaleaproximadamentede1
8 a2x10 unidadesformadorasdecolonias(UFC)deE.coli.Seutilizcomocepa

dereferenciaalaE.coliATCC25922.Conunhisoposeinocularonplacascon agarMH,seestrielhisoposobretodalasuperficieenformaparalelaycompacta, acontinuacinsecolocaronlosmultidiscosyseincubaronpor18ha352C.La lecturasehizomidiendoeldimetrodelhalodeinhibicinenmmconunvernier. Las cepas se clasificaron en 3 categoras: Resistentes (R), Intermedias o medianamenteresistentes(I),ySensibles(S),deacuerdoalosestablecidoporel NCCLS(NCCLS,2006).Posteriormenteserealizunapruebadedilucinentubo para conocer la CMI, se emple el mtodo de macrodilucin en caldo. Se seleccionaron tres antimicrobianos: amikacina, ampicilina y carbenicilina. Se elaborunasolucinstockdiluyendo100mgdecadaantibiticoen1mLdeagua inyectableestrilcomodiluyenteenunvial,ysemantuvieronenrefrigeracin.Se preparcaldoMHysealmacenentubosFalconde50mLaloscuales,conuna micropipeta se les adicion la cantidad requerida de la solucin stock para adecuarlasconcentracionesdeg/mLaemplear.Uninculobacterianodecada cepa con un patrn de turbidez de 0.5 de McFarland fue preparado, con una micropipeta se tomaron 10 L del inculo y se adicionaron al caldo MH con antibitico.CaldoMHsinantibiticoseinoculcomocontrolparalaviabilidadde los microorganismos (control de crecimiento), se incubodurante 18 h a 352 C. En la lectura se consider como la CMI la concentracin ms baja que inhibiera completamenteelcrecimientovisibledemicroorganismos(Cuadro1).

280

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 Cuadro1.Interpretacindelapruebadedilucinentuboyconcentracionesdelos antibiticosqueseemplearon

Antibiticos

Interpretacindelaprueba dedilucin Categoras(g/mL) S I 32 16 32 R 64 32 64

Gradientesdeconcentracinempleados (g/mL)

Amikacina Ampicilina Carbenicilina

16 8 16

30 40 100 80 200

20

10

160 320 640 1280 2560 400 800 1600 3200

RESULTADOSYDISCUSION

Con la prueba de difusin en agar se encontr que algunos lactmicos (cefalotina, 63% carbenicilina, 24% y ampicilina, 22%) y el trimetoprim sulfametoxazol (20%) fueron los antimicrobianos que presentaron un mayor porcentaje de resistencia. Se detect resistencia hacia el cloranfenicol (13%) ningnaislamientofueresistentealaamikacinayceftriaxona, mientrasque28% delosaislamientosfueronresistentesa3omsantimicrobianos(Cuadro2).

281

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 Cuadro2.Sensibilidad invitrodecepasdeE.coliencanalesdebovino(n=54)mediante lapruebadedifusinenagar

Antimicrobianos Cepasresistentes(%) Cepasintermedias(%) Cepassensibles(%) Total(%)

AK 0 4 96 100

AM 22 11 67 100

CB 24 9 67 100

CF 63 37 0 100

CTX 9 26 65 100

CRO 0 6 94 100

Antimicrobianos Cepasresistentes(%) Cepasintermedias(%) Cepassensibles(%) Total(%)

CL 13 41 46 100

GE 5 54 41 100

NET 7 2 91 100

NF 2 13 85 100

PEF 13 67 20 100

STX 20 0 80 100

NOTA: AK, amikacina AM, ampicilina CB, carbenicilina CF, cefalotina CTX, cefotaxima, CRO, ceftriaxona CL, cloranfenicol GE, gentamicina NET, netilmicina NF, nitrofurantoina PEF, pefloxacinaSXT,trimetoprimsulfametoxazol.

Enlapruebadedilucinentuboseobservquetodaslascepasfueronsensibles a la amikacina hasta una concentracin de 10 g/mL la ampicilina present un aislamiento que fue resistente hasta 2560 g/mL y la carbenicilina tuvo 8 aislamientosqueresistieronhasta3200g/mLdeesteantimicrobiano. Al comparar la distribucin de la resistencia antimicrobiana en los 3 rastros municipales se encontr que en todos haba resistencia hacia la ampicilina, carbenicilina y cefalotina. El rastro de Toluca fue el nico que present aislamientos resistentes a la cefotaxima (15%), gentamicina (9%) y netilmicina (12%).ElrastrodeCalimayatuvoelmayorporcentajedeaislamientosresistentes a la ampicilina (50%), carbenicilina (40%), nitrofurantoina (10%) y pefloxacina

282

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(20%). Los 3 rastros tuvieron un porcentaje de resistencia similar para el trimetoprimsulfametoxazol.ElrastrodeAtlacomulcotuvoelmayorporcentajede resistenciahaciaelcloranfenicol(60%).EnelrastrodeTolucahuboresistenciaa 9antimicrobianos,seguidoporCalimayacon7yAtlacomulcocon5(Grfica1).
Grfica1.Porcentajedeaislamientosresistentesporrastro

283

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Laresistenciahacialoslactmicosyeltrimetoprimsulfametoxazolcoincidencon loexpuestoporDeJong,etal.2009,posiblementeporsuusodesdehacevarias dcadasyengrandescantidades.Laresistenciaalcloranfenicoltodavasesigue reportandoen otrospases como Canad (2.8%) o Japn (3.2%)(Carson etal., 2008 Harada y Asai, 2010). En cuanto a la presencia de resistencia al cloranfenicol(13%)enestetrabajo,estapudieradeberseavariosfactorescomola transmisindemecanismosderesistenciadeformanaturalelusodetianfenicoly florfenicol en animales de abasto, el cual si est permitido y puede inducir una resistencia cruzada otra posible causa y de mayor gravedad es que se est usandoestecompuestodemaneraindebidaenanimalesdeabasto,sinembargo, se necesitan ms estudios como deteccin de residuos en canales o inspeccin engranjasparaaseverarestehecho. Factores en la medicina veterinaria como la disponibilidad y uso de los antimicrobianos (alimentos con dosis subteraputicas, dosis inadecuadas en los tratamientos) y en la medicina humana como la sobrepoblacin, higiene y automedicacininfluyenenladiseminacindebacteriasresistentes(Alexanderet

al.2009).

CONCLUSIONES

Se confirm la presencia de resistencia antimicrobiana en los aislamientos deE.

colihemolticaenelEstadodeMxico.
Los antimicrobianos que presentaron un mayor ndice de resistencia fueron la ampicilina,carbenicilina,cefalotinayeltrimetoprimsufametoxazol. Nohuboresistenciaantimicrobianaalaamikacinayceftriaxona. El rastro de Toluca tuvo el mayor ndice de resistencia con 9 de 12 antimicrobianos, mientras que el de Atlacomulco tuvo el menor ndice con 5 solamente.

284

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 LITERATURACITADA

Machota SV, Duran SP y Mateos YEM. (2002): Manual de microbiologa veterinaria.McGrawHillInteramericana,Madrid,Espaa. NataroJPyKaperJB.(1998):DiarrheagenicEscherichiacoli.ClinMicrobiolRev., 11(1):142201. StevensMP,vanDiemenPM,DzivaF,JonesPWyWallisTS.(2002):Optionsfor the control of enterohaemorrhagic Escherichia coli in ruminants. Microbiology., 148:37673778. ReyesRNE.(2010):PrevalenciadeEscherichiacoliO157:H7yfactoresderiesgo, encanalesdebovinosdelcentronortedelEstadodeMxico.Tesisdemaestra, FMVZ,UniversidadAutnomadelEstadodeMxico,Toluca,Mxico. Panos GZ, Betsi GI y Falagas ME. (2006): Systematic review: are antibiotics detrimentalorbeneficialforthetreatmentofpatientswithEscherichiacoliO157:H7 infection?.AlimentPharmacolTher.,24(5):731742. NCCLS (National Committee for Clinical Laboratory Standards) (2006):
th Performance Standards for Antimicrobial Disk Susceptibility Tests. 9 ed, vol 26,

no 1. Approved Standard M2A9. National Committee for Clinical Laboratory Standards,Wayne,Pa. deJongA,BywaterR,ButtyP,DerooverE,GodinhoK,KleinU,MarionH,Simjee S,SmetsK,ThomasV,VallMyWheadonA.(2009):ApanEuropeansurveyof antimicrobialsusceptibilitytowardshumanuseantimicrobialdrugsamongzoonotic and commensal enteric bacteria isolated from healthy foodproducing animals. J

AntimicrobChemother.,63(4):733744.
Carson CA, ReidSmith R, Irwin RJ, Martin WS y McEwen SA. (2008): Antimicrobial resistance in generic fecal Escherichia coli from 29 beef farms in Ontario.CanJVetRes.,72(2):119128.

285

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

HaradaKyAsaiT.(2010):Roleofantimicrobialselectivepressureandsecondary factors on antimicrobial resistance prevalence in Escherichia coli from food producinganimalsinJapan.JBiomedBiotechnol.,112. Alexander TW, ReuterT, Sharma R, Yanke LJ, Topp E y McAllister TA. (2009): Longitudinal characterization of resistant Escherichia coli in fecal deposits from cattle fed subtherapeutic levels of antimicrobials. Appl Environ Microbiol., 75(22):71257134.

286

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 52) PRODUCCIN DE BIOGS Y GENERACIN DE ENERGA ELCTRICAAPARTIRDEDESECHOSDEBOVINOS

BIOGASPRODUCTIONANDELECTRICENERGYGENERATIONFROM BOVINEWASTE
*1 2 EduardoGuillermoCanudasLara ,EduardoDavidCanudasHawks ,AdrinVidal 3 1 Santo yFranciscoIndalecioJurezLagunes .
1

Facultadde Medicina Veterinaria y Zootecnia,UniversidadVeracruzana, Circunvalacin Esq. Yez s/n, Col. Unidad Veracruzana, C.P. 91710, Veracruz, Veracruz, Mxico.Telfono (229) 934 4053,ecanudas@uv.mx, fjuarez@uv.mx.* autor para correspondencia
2

Faculty of Applied Sciences, Delft University of Technology, Lorentzweg 1, 2628 CJ, Delft,TheNetherlands,ecanudas@gmail.com.
3

Facultad de Ingeniera, Universidad Veracruzana, Av. Adolfo Ruiz Cortines, No. 455, Fracc.CostaVerde,CP94294,BocadelRo,Ver.,Mxico.Telfono:(229)7752000Ext. 25119,avidal@uv.mx RESUMEN

Los modelos tradicionales de produccin agropecuaria han causado graves problemas de contaminacin por el desecho desordenado de los desperdicios orgnicos, contribuyendo grandemente a la emisin de gases de efecto invernadero. EL presente trabajo se realiz en el rancho experimental de la Universidad Veracruzana. Tiene como objetivo, determinar la produccin de biogs utilizando dos sustratos diferentes (heces y pasto) y la generacin de electricidad. Se utilizaron dos tratamientos con dos repeticiones. Tratamiento A (TA) consisti de 50 kg de heces frescas (6,5 kg Materia Orgnica Seca [MOS]) ms37,5LdeaguaTratamientoB(TB)consistide30kgdehecesfrescas(4,0 kgMOS) ms3,2kgdepastodesechodeloscomederos(2,5kgMOS)y54,3L deagua.Laproduccindebiogsen9semanas(2/11/09a4/01/10)fuede45800 L para el TA y de 98474 L para el TB, esto es de 727 L/d y 1563 L/d, respectivamente.Estebiogssirviparacocinarconunaestufapor1,5h/dparael TA y 3,1 h/d para el TB o para la generacin de energa elctrica. Durante esta

287

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

prueba se produjeron 0,226 kWh de electricidad y se consumieron 222 L de biogs, esto dara una equivalencia de 1,6 kWh diarios por cada biodigestor de 5000L,loquelepermitiraalproductoroperarelmotordeunaordeadurantedos horasapartirdelosdesechosdesusvacas.Lautilizacindelosbiodigestoreses unatecnologafactibledeusarenlasempresasagropecuariasparadesecharde maneraecolgicalosdesechosorgnicosyproducirenergarenovable. Palabrasclaves:Energasrenovables,sostenibilidad,cambioclimtico.

ABSTRACT

Industrialagriculturehascausedseriouspollutionproblemsduetotheinadequate disposaloforganicwaste,contributinggreatlytogreenhousegasemissions.This workwasdoneattheresearchfarmoftheUniversityofVeracruz.Itsobjectiveisto determinethebiogasproductionoftwodifferentsubstrates(manureandpasture) andtheelectricitygeneration.Twotreatmentswithtworepetitionseachwereused. Treatment A (TA) consisted of 50 kg of fresh manure (6,5 kg Dry Organic Matter [DOM])plus37,5lofwaterTreatmentB(TB)consistedof30kgfreshmanure(4 kgDOM)plus3,2kgofwastepastureleftoverinthefeedtrough(2,5kgDOM)and 54,3 L of water. The total production of biogas during the 9 weeks of the experiment (02/11/2009 to 04/01/2010) was 45800 L for TA and 98474 L for TB, thisis727L/dand1563L/d,respectively.Thisbiogascouldbeusedforcookingin agasstovefor1,5hr/dayforTAand3,1hr/dayforTB,orforproducingelectricity. Inthistestwasgenerated0,226kWhofelectricitywithaconsumptionof222Lof biogas,thiswouldgiveanequivalentof1,6kWhperdayperbiodigesterof5000L, whichwouldallowtheproducertooperatethemotorofthedairymachinefortwo hours with the energy of the manure of the cows. The use ofbiodigestersis afeasible technologyto disposefarms organic waste environmentally friendly andproducerenewableenergy. Keywords:Renewableenergy,sustainability,climaticchange.

288

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

INTRODUCCIN La poblacin del mundo pasar a ms de 8500 millones parael ao 2025. Esto indicaqueestapoblacinrequerirqueseincrementeelsuministrodealimentos, pero sin daar el medio ambiente (Viglizzo, 1997).Los modelos actuales de desarrolloruralhancausadogravesproblemasdecontaminacindelsuelo,airey agua. Como resultado,la agricultura,laagroindustria ylaactividad humana que las acompaa, contribuyen en parte a la crisis ambiental que estamos viviendo actualmenteentodoelmundo.Lasnecesidadesdelmercadoprevalecieronylos recursos naturales fueron considerados como inagotables, por ende, su explotacin fue ilimitada. La digestin anaerbica puede considerarse como la forma ms sencilla y segura de dar tratamiento a excrementos humanos y animalesenzonasrurales(Brown,1987).Enesteprocesolamateriaorgnicase degrada para producir metano, mediante unconjunto deintegraciones complejas entredistintosgruposdebacterias(Youngfuetal.,1989).Elbiogsesunafuente renovable de energa y est compuesto de metano, bixido de carbono, y otros gases en pequeas cantidades. El efluente (material digerido) tiene una alta concentracin de nutrimentos, bajo contenido de patgenos y se encuentra prcticamente libre de semillas viables de malezas (Brown, 1987 Marchaim, 1992). Elobjetivogeneraldelproyectofueevaluarelpotencialdelaproduccindebiogs en un biorreactor alimentado con desperdicio animal (excremento de bovino) y vegetal (desperdicio de pasto) como fuente de energa renovable y producir energaelctricausandocomofuentedecombustibleelbiogs.

MATERIALESYMTODOS ElpresenteestudioserealizenlaPostaZootcnicaTorrendelMolino(PZTM) localizada en la Carretera Federal VeracruzXalapa km 14.5, Colonia Progreso, Tejera, dependiente de la Facultad de Medicina Veterinaria y Zootecnia de la

289

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

UniversidadVeracruzana.Losbiodigestoresseinstalaronenmayodel2009enun terrenoadyacentealasaladeordeadelaPZTM,esteterrenoerautilizadopara depositar las excretas y basura orgnica de las vacas de ordea sobre la
3 superficie de una manera desordenada. Los cuatrobiodigestores de 5 m fueron

enterrados en una fosa de 2 m de ancho x 11 m de largo, quedando la parte superior del biodigestor ael nivel del suelo,ubicados en paralelo uno allado del otro.Elexperimentosediseenbloquescompletosalazarcondostratamientos ydosrepeticiones.EltratamientoA(TA)consistide50kgdehecesfrescas(6,5 kgdehecesenMOS)ms37,5LdeaguayeltratamientoB(TB)consistide30 kgdehecesfrescas(4,0kgdehecesenMOS)ms3,2kgdepastodesechode los comederos (2,5 kg de pasto en MOS) y 54,3 L de agua. Las excretas utilizadaseranfrescas,recolectadastodoslosdasdelasaladeordea.Seutiliz aguadelareddedistribucininternadelaPZTM.Lafasedetrabajodecampo tuvo una duracin de 9 semanas, iniciando el 2 de noviembre de 2009 al 4 de enero de 2010. Las variables de respuesta que se tomaron en el siguiente experimentofue:1)lacantidaddebiogsproducidoy2)laelectricidadgenerada con un motogenerador de 3000W de 160 cc. El biogs se cuantific con un
medidor de gas marca WIZIT Modelo: K635 en cada biodigestor, y al

motogeneradorseleadaptenelcarburadorunVenturiyunreguladordeflujodel biogs. El biogs se suministr al generador con un soplador elctrico sellado hermticamente en un tubo de PVC para evitar que el biogs se mezclara con aire,yeracapazdemantenerunapresinde3kPayunflujode18L/m.Parael anlisisestadsticodelasvariablesderespuestaseutilizundiseoexperimental en bloques completos al azar con dos tratamientos y dos repeticiones, con el siguientemodelo:Yijk=+Ti+Bj+eijk endonde:Yijk eslavariablederespuesta,
esimo esimo es la media general,Ti es eli efecto deltratamiento, Bj es el j efecto del

bloque,yeijk eselerrorexperimental.Elanlisisestadsticoserealizutilizandoel paquete SAS (2001) y las medias de las variables de respuesta se compararon usandolapruebadeDuncan.

290

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 RESULTADOSYDISCUSIN

LaFig.1muestralaproduccintotaldebiogsdelosdostratamientos,coneste resultado se puede inferir que la combinacin de pasto ms heces (TB) produce msbiogs(98474L),queelutilizarsolamenteheces(TA)queprodujo(45800L).
3 Laproduccindiariadebiogsporbiodigestor(5m )paraelTAfuede727Lcon

unadesviacinestndarde544LyparaelTBfuede1563Lconunadesviacin estndarde411L.

Figura1.Produccintotaldebiogsgeneradosporcadatratamiento.

Elbiogspuedeserutilizadoparasuministrarcombustibleaunaestufadegas.Se realiz la medicin de la cantidad de biogs que era consumido por la estufa, obtenindose un consumo promedio de 8,3 lpm. Por lo que la produccin de biogsalcanzparautilizarunaestufaenpromedio3,10.8h/dconeltratamiento dehecesmspastoy1,51.1h/dconeltratamientodesolamenteheces. Laproduccinelctricaconelgeneradorybiogsenriquecidocon7%degasLP duranteestapruebafuede0,226kWhdeelectricidadyseconsumieron222Lde biogs,conunacalidaddelaenergaenunrangoaceptabledevoltaje( 120V)y frecuencia ( ). Deesta manera se estima que se podran producir 1,6 kWh

diarios por cada biodigestor de 5000 L. Esta produccin de energa elctrica le serviraalproductoroperarelmotordeunaordeadurante2,14horasapartirde losdesechosdesusvacas.

291

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 CONCLUSIONES

La utilizacin de los biodigestores es una tecnologa factible de usar en las empresas agropecuarias para desechar de manera ecolgica los desechos orgnicos,comoenestecasolashecesdelganadoylosdesperdiciosdepasto. Estoreducelacontaminacinambientalyporendelaproduccindegasesefecto invernadero como es el gas metano, as como los malos olores, insectos transmisores de enfermedades, los parsitos intestinales y moscas que se reproducen en las heces, entre las principales.La ventaja de usar el biogs para cocinarreducelanecesidaddecortarleaocomprargasLPcomercial.Esposible generar electricidad a pequea escala en ranchos de doble propsito exclusivamente con las heces del ganado que producen durante las 2 horas de ordeaatravsdeungeneradordegasolinaadaptadoabiogsenriquecidocon 7%degasLP.
LITERATURACITADA

Brown,1987.Biogassystemsindevelopment.AppropriateTechnology14(3):57.

Marchaim,U.1992.Biogasprocessesforsustainabledevelopment(online).Food and Agriculture Organization of the United Nations (FAO).Agricultural Services.Bulletin /T0541E/T0541E03.htm. 95 232 p.

http://www.fao.org/documents/show_cdr.asp?url_file=/docrep

SAS. 2001. Statistical Analysis System. Version 8.2.SAS Institute Inc. North Carolina,USA.

292

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Viglizzo, E. 1997. El componente ambiental en la intensificacin ganadera. Rev. Arg.Prod.Anim.17(3):271292.

Youngfu, Y., Yibo, Q., Yunxuan, G., Hui, Z., Yuansheng, X., Chenyong, X., Guoyuan,F.,Jienquan,X.,Taiming,Z.yGan,L.1989.Thebiogastechnologyin China.AgriculturalPublishingHouse.Beijing,p2054.

293

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 53)Engordade cerdos con cabello de ngel(Calliandra calothyrsus ) ensustitucinparcialdepastadesoya. Fatteningpigswithangelhair(Calliandracalothyrsus )inpartialreplacement ofsoybeanmeal.
1 2 1 ClaudioViteCristbal *,EnriqueTllezTllez ,RicardoBustosHernndez

Divisin de Ingeniera en Agronoma, Instituto Tecnolgico Superior de Tantoyuca, Desv. Lindero TametateS/N Col.La Morita, Tantoyuca,Veracruz,C.P. 92100, Tel.017898931552, Correo electrnico: cvitec81@hotmail.com* autor para correspondencia, chivas_rbh@hotmail.com
2

CentrodeBachilleratoTecnolgicoAgropecuarioNo.136,CarreteraAlaznCanoasKm.49, San Sebastin, Tantoyuca, Veracruz, C.P. 92103, Tel. 017898551088, Correo electrnico: eqtellez_c137@hotmail.com

RESUMEN El objetivo de este estudio fue evaluar el comportamiento productivo de cerdos cruzados Yorkshire x Landrace alimentadoscon dietas formuladasabase de soya y

Calliandra calothyrsus con la finalidad de validar a sta ltima como alternativa


confiableparalaoptimizacinbiolgicayeconmicaenlaalimentacindecerdospara engorda en las etapas de crecimiento, desarrollo y finalizacin. El experimento fue realizadoenelreadeProduccinyExperimentacindelCBTa.136,SanSebastin, Tantoyuca, Ver. Las variables de consumo de alimento, ganancia diaria de peso y conversinalimenticiafueronanalizadasconundiseofactorialencompletamenteal azar,utilizandoelprocedimientoPROCANOVAdelpaqueteestadsticoSAS(2003).El modelofinalincluylosefectosdedieta,repeticinanidadadentrodedieta,semanade evaluacin y la interaccin entre dieta y semana de evaluacin. El consumo de alimentoylagananciadiariadepesosolofueronsignificativos(P<0.05)paralaetapa de crecimiento, siendo superiores en los cerdos alimentados con cabello de ngel, mientrasqueparalasetapasdedesarrolloyfinalizacinningunadelasvariablesfue significativa(P>0.05).LosresultadossugierenlautilizacindelaCalliandracalothyrsus ensustitucinparcialdelapastadesoya,debidoaqueambosgeneranelmismonivel

294

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

de productividad y siendo que el primero reduce considerablemente los costos de alimentacin. Palabrasclave: Produccin porcina, Alimentacin, Calliandracalothyrsus.

SUMMARY

The objetive of this study was to evaluate the productive performance of Landrace x YorkshirecrossbredpigsfeddietsformulatedwithsoybeanandCalliandracalothyrsus in order to validate the latter as a reliable alternative to biological and economic optimization in feeding pigs fattened in the early stages of growth, development and completion. The experiment was conducted in the Area of Production and Experimentation of CBTA. 136, in San Sebastian, Tantoyuca, Ver. Variables feed intake, daily gain and feed conversion were analyzed with a factorial design in completelyrandom,usingthePROCANOVAofSAS(2003).Thefinalmodelincluded the effects of diet, repeat nested within diet, week evaluation and the interaction between diet and week of assessment. Feed intake and daily weight gain were only significant(P<0.05)forthegrowthstage,beinghigherinpigsfedwithangelhair,while for the development and completion stages of any of the variables was significant (P>0.05).TheresultssuggesttheuseofC.calothyrsuspartialreplacementofsoybean meal,becausetheybothgeneratethesamelevelofproductivityandbeingtheformer significantlyreducesthecostoffood. KeyWord: PorkProduction, feeding, Calliandracalothyrsus.

INTRODUCCIN Elmundoactualestnecesitadodealimentosnaturalesdeexcelentecalidad.Adems, los sistemas de produccin pecuarios deben de dejar de depender de insumos externosparamejorarlarentabilidad.Alrespecto,enlaltimadcadalaproduccinde carne de cerdo en elestado ha tomado un lugar muy importante, producindose en promedio76,323.58tquerepresentanel6%delaproduccinnacionalyubicandoa

295

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Veracruzenlosprimerosseisestadosdemayorproduccinenelpas(INEGI,2010). Sinembargo,tambinenestaltimadcadaelcostodeproduccinhasidobastante elevado, siendo de $15.50/kg, mientas que el precio de venta ha sido tan solo de $17.37/kg (INEGI,2010),loquerepresentaunmargendeutilidaddemasiadopequeo, situacinquesehaidoagravandocadavezmsconlaalzadepreciosdegranosy oleaginosas. Por tal motivo, es urgente encontrar nuevas tecnologas que permitan eficienciarlaproduccin de carne de cerdo,aprovechandolosrecursos naturales del trpico. Actualmente la soya est considerada como la fuente proteica de mejor eleccin para la alimentacin de cerdos en crecimiento y finalizacin por su alto contenidoproteicosinembargo,sucostoesdemasiadoalto,loquenosllevaabuscar otra alternativa en la dieta como la C. calothyrsus que es una leguminosa de alto contenido proteico, de buena digestibilidad en cerdos y nativa de zonas tropicales, siendounaalternativaviableparaeconomizarlaalimentacinenlaengordadecerdos eneltrpico.Portalmotivo,esquesepretendedesarrollarelpresenteestudioconla finalidad de evaluar el comportamiento productivo de cerdos engordados en condicionesdeconfinamientocondietasformuladasabasedesoyayC.calothyrsus, conlafinalidaddevalidarastaltimacomoalternativaconfiableparalaoptimizacin biolgicayeconmicaenlaengordaintensivadecerdos.

MATERIALESYMTODOS ElexperimentoserrealizadoenelreadeProduccinyExperimentacindelCBTa. No. 136 de San Sebastin, Tantoyuca, Veracruz, Mxico, entre las coordenadas geogrficas2121LNy9814LWconclimasubtropicalconlluviasenverano(A)Ca (w2)(w) (i) W, altitud de 140 msnm, precipitacin media anual de 1,250 mm y temperatura media de 23 C (INAFED, 2005). El estudio inici con la colecta de materialvegetativode C.calothyrsus enlacomunidaddeTepetzintla,Huautla,Hgo.,en losmesesdeseptiembreanoviembrede2010.Lapreparacindelaharinaconsisti en el secado de los foliolos a temperatura ambiente y expuesta directamente a la radiacin solar hasta lograr un peso constante, lo cual se logr en un tiempo aproximadode72hyposteriormenteelmaterialdeshidratadofuemolidoenmolinode

296

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

mano. Fueron adquiridas 12 hembras destetadas de la cruza Yorkshire x Landrace, conunpesopromediode10kg,nacidosenlasinstalacionesdelCBTa.136,lugarenel queserealizlaengordaentresetapasdealimentacinconbasealpesovivodelos animales y basndose en las recomendaciones del NRC (1998). Las dietas fueron formuladas mediante Programacin Lineal Determinstica con la opcin Solver del paqueteMicrosoftExcel2010.Lamezcladelosingredientesconsistilaformacinde capassobrepisodecadaunodelosinsumos,empezandoporlademayorproporcin yquedandoenelsiguienteorden:soya,calliandra,sorgo,maz,salmineralyporltimo deformalquidaelcebo,paraladietadelprimertratamiento.Asimismo,seprocedide igual forma con la segunda dieta, realizando la mezcla en el siguiente orden: soya, sorgo, maz y sal mineral. El periodo de engorda dur 90 das, iniciando del 04 de diciembrede2010yfinalizandoel04demarzode2011.Duranteesteperiodo,alos animalesselesofrecidiariamenteagualimpiayfrescaconbebederosdechupn,as comoalimentoalibreacceso,endosofrecimientosconhorariode7:00y14:00hen comederostipotolva.Losanimalesfueronmuesqueadosenlapartemediainternade laorejacomoidentificacinindividualparallevarunbuenregistrodelainformacin.Al respecto,fuerontomadoslosofrecimientosyrechazosdealimentodiario,ascomoel pesosemanal,conlaayudadeunabscularomanade0a100kgdecapacidad.Los comederoseinstalacionesfueronlavadosylimpiadosdiariamenteconaguacorriente. Asimismo,losanimalesfuerondesparasitadossubcutneamenteenlaparteexternade la oreja con ivermectina a razn de 1.0 mL por cada 33 kg de peso vivo y una frecuencia de 21das, y simultneamente se aplic intramuscularmente en la pierna vitaminaADEaunadosisde0.25a1.0mLporanimalyvitaminasdelcomplejoBen una cantidad de 2 mL por animal. Con los registros diarios de los ofrecimientos y rechazosdealimento,fuecalculadoelpromediodelconsumodealimentoindividualen basetalcualmientrasqueconlospesajesdeloscerdosrealizadossemanalmentefue estimado el promedio de la ganancia diaria de peso. Asimismo, con los datos del consumo de alimento y la ganancia diaria de peso fue estimada la conversin alimenticiacomounarazn.Losanimalesfuerondistribuidosaleatoriamenteencuatro grupos,dosdeloscualesfueronalimentadosconunalimentocuyoaportedeprotena fueabasedeC.calothyrsus(T1),mientrasquelosotrosdossealimentaronconun

297

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

alimentoabasedesoyacomofuentedeprotena(T2).Eldiseoexperimentalutilizado fuedeparcelasdivididasencompletamentealazar,distribuyendotrescerdosporcorral enuntotaldecuatrocorrales,siendoquecadaunodestosltimosfueunaunidad experimental con dos repeticiones. Las variables de consumo de alimento, ganancia diariadepesoyconversinalimenticiafueronanalizadasconelprocedimientoPROC ANOVA del paquete estadstico SAS (2003). El modelo final incluy los efectos de dieta,repeticinanidadadentrodedieta,semanadeevaluacinylainteraccinentre los factores dieta y semana. Las medias que resultaron significativas fueron comparadas con la prueba de Tukey con una confiabilidad del 95% (Steel y Torrie, 1996).
RESULTADOS

Los valores de los atributos de la engorada de cerdos por etapa de evaluacin se muestran en el Cuadro 1, mostrando significancia (P<0.05) nicamente para el consumo de alimento y ganancia diaria de peso para la etapa de crecimiento, sin mostrar efecto significativo(P>0.05)sobre ninguna delas variablesevaluadas enlas etapasdedesarrolloyfinalizacin.

298

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 Cuadro1.Medias(STD)delosatributosasociadosalaengordadecerdosalimentados

conharinasdesoyayC.calothyrsusporetapadeengorda. Variablesdeestudio Factor CBTC Etapa1Crecimiento Calliandra Soya Etapa2Desarrollo Calliandra Soya Etapa3Finalizacin Calliandra Soya
a,b a 2.700.44 a 2.800.35 a 0.6670.108 a 0.8150.191 a 4.060.32 a 3.590.86 a 2.300.32 a 2.280.30 a 0.8560.147 a 0.7770.211 a 2.760.59 a 3.050.60 a 1.490.28 b 1.350.33 a 0.7420.112 b 0.5870.154 a 2.010.17 a 2.320.28

GDP

CA

Dentrodecolumnayfactor,mediascondiferenteliteralsondiferentes(P<0.05Tukey).

DISCUSIN Las variables que resultaron significativas solo lo fueron para la primer etapa de engorda,siendoqueloscerdosalimentadosconC.calothyrsusconsumieronun10% ms de alimento pero tambin ganaron un 26% ms de peso diariamente (P<0.05), con respecto a los que se alimentaron con soya. Por otra parte, el consumo de alimento, la ganancia diaria de peso y la conversin alimenticia fueron similares (P>0.05) para las dos dietas evaluadas en las etapas de desarrollo y finalizacin (Cuadro1).Lasuperioridadobservadaenelconsumodealimentoylagananciadiaria depesoenloscerdosalimentadosconC.calothyrsusdurantelaetapadecrecimiento pudodeberseaqueconlaasociacindelasoyasehayamejoradolapalatabilidadyla digestibilidaddeladietaconungradodeinclusindel14.96%deC.calothyrsus.Por

299

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

otra parte, la falta de efecto de inclusin de C. calothyrsus en niveles del 18.64 y 17.18%enladietadurantelasetapasdedesarrolloyfinalizacin,respectivamente,es unasituacinfavorableparalossistemasdeproduccinporcina,debidoaqueenestos grados de sustitucin abarata considerablemente el costo dela racin, generando el mismoniveldeproductividadcomparativamenteconloscerdosalimentadosconharina de soya como nica fuente de protena. Sin embargo, cabe resaltar que no existen estudios relacionados con la engorda de cerdos alimentados con C. calothyrsus en condicionestropicales,siendoestounaalternativaviableparaeficienciarlossistemas deproduccin enlaengordaintensivadecerdos. CONCLUSIONES Los resultados sugierenlautilizacin delaC.calothyrsusen sustitucinparcialdela pasta de soya en niveles de 14.96 a 18.64% de inclusin en la dieta, debido a que ambos generan el mismo nivel de productividad y siendo que el primero reduce considerablemente los costos de alimentacin en la engorda intensiva de cerdos durante las etapas de crecimiento, desarrollo y finalizacin, produciendo cerdos con pesovivocomercialde95kgycincomesesdeedad. LITERATURACITADA INEGI. 2010. Perspectiva estadstica: Veracruz de Ignacio de la Llave. Direccin GeneralAdjuntadeIntegracindeInformacin(DGAII).Aguascalientes,Ags., Mxico.100pp. NRC.1998.NutrientRequirementsofSwine.NationalResearchCouncil.National AcademyPress(tenthrevisededition).Washington,D.C.210pp. SAS.2003.UsersGuide.Statistics8thed.Cary(NC).SASInstituteInc. Steel, R.G.D. y J.H. Torrie. 1996. Bioestadstica: Principios y procedimientos. 2a Edicin.McGrawHill.Mxico.622pp.

300

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 54) CARACTERISTICAS DE TRES UNIDADES DE PRODUCCION FAMILIAR OVINA EN LA MIXTECA POBLANA BAJO CONDICIONES SILVOPASTORILES

CHARACTERISTICSOFTHREESHEEPPRODUCTIONUNITSINTHEFAMILY UNDERCONDITIONSPOBLANAMIXTECASilvopastoral
1 1 *JorgeEzequielHernndezHernndez ,FranciscoJavierFrancoGuerra ,Julio 1 1 CesarCamachoRonquillo ,OscarVillarrealEspinobarros ,JennyHernndez 2 Riande . 1

FacultaddeMedicinaVeterinariayZootecnia.BenemritaUniversidadAutnoma dePuebla.Puebla.4surNo.304,Col.Centro.Tecamachalco,PueblaC.P.75480. 2 EstudiantedelaUTT.Mxico.Correoelectrnico:Email:ovichiv_05@yahoo.com.* autorparacorrespondencia RESUMEN El presente trabajo, describe las principales caractersticas de tres unidades de produccinfamiliarovinasenlaMixtecaPoblana,bajocondicionessilvopastoriles. Indicadoreszootcnicos,socialesyeconmicosrepercutenenestasunidadesde produccin, sobresaliendo el tipo de alimentacin (arbreoarbustiva), lo cual disminuyecostosdeproduccinenelovinohacindolorentableensufinalizacin porotrolado,seobservaunafuertemigracindejvenesalosEstadosUnidosde Norteamrica, por falta de programas y proyectos agropecuarios, de salud, empleo,educacinydeporte.Sisetomanencuentaestosindicadores,sepueden introducir y adoptar tecnologas aplicadas a las UPF (unidades de produccin familiar)ovinas,parasustentareldesarrolloybienestardelosproductoresenesa reginmixteca. Palabrasclave:produccin,familia,ovinos,silvopastoril,rentabilidad. SUMMARY This paper describes the main characteristics of three sheep family production unitsintheMixtecaPuebla,undersilvopastoral.Zootechnicalindicators,socialand economic impact in these production units, the type of food sticking (treeshrub),

301

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

whichlowersproductioncostsmakingitcosteffectiveinsheepintheend,onthe otherhand,thereisastrongmigrationofyoungtheUnitedStatesofAmerica,lack of programs and agricultural projects, health, employment, education and sport. Taking into account these indicators can be introduced and applied to adopt technologiesUPF(familyproductionunits)sheep,tosupportthedevelopmentand welfareoffarmersintheMixteca. Keywords:production,family,sheep,silvopastoral,profitability

INTRODUCCIN La importancia que tiene actualmente la ovinocultura en Mxico, se debe a la principal transformacin de tipo empresarial en todos los niveles productivos como es el caso de grandes, medianos y pequeos productores (De la Cruz, 2004). Sin embargo, esesencialdesviarla atencin alas reas productivas bajo condiciones silvopastoriles, siendo el caso de la Mixteca Poblana (Franco et al., 2006).Deestamanera,lasunidadesdeproduccinfamiliarovinas,siguensiendo la clula domestica de tipo rural o campesina, que promueven un 90% de la poblacin de ovinos en nuestro pas (Hernndez Hernndez, 2004 Romero, 2004). Luego entonces, el objetivo de este trabajo fue: describir las principales caractersticas de estas tres unidades de produccin familiar ovina bajo condicionessilvopastorilesenlaMixtecaPoblana.

MATERIALESYMTODOS Este trabajo se realiz en el municipio de Piaxtla, en las comunidades de ManinalcingoyTehuaxtla,ubicadasenlaregindelaMixtecaPoblanaalsureste del estado de Puebla, localizndose en los paralelos 17 59 00 y 18 12 30 latitudnorte,ylosmeridianos981054y982136latitudoeste(INEGI,2000). LadistanciaaproximadadelaciudaddePueblaalmunicipiodePiaxtlaesde135 km. Las comunidades cuentan, con terrenos accidentados y una altitud variada entrelos700alos2000m(Gmez,1996),suhidrografaestdadaporlacuenca

302

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

delosrosAcatlnyMixteco,pertenecientesalareginaltadelacuencadelro Balsas(GuizarySnchez,1991INEGI,2000).Suflora,estdadaporselvabaja caducifolia, selva baja caducifolia espinosa, vegetacin xerfita, matorral con izotes, vegetacin secundaria (arbreaarbustiva), localizndose pequeas reas debosquedeencinoypastizaleslafaunaestdadaporvenado,coyote,zorrillo, armadillo,iguanas,camalenyserpientedecascabelcomoprincipalesespecies (INEGI, 2000). El clima es clido subhmedo con lluvias en verano y semiseco muyclido,conprecipitacionespluvialesquevandelos350alos800mm,donde latemperaturamnimaesde17.7Cylamximade28.6C,siendode23.1Cla temperatura promedio (INEGI 2000). El estudio comprendi de Julio a Diciembre del2006. Material,procedimientosyestadsticautilizadaenelestudio.

Se utiliz un cuestionario, el cual se aplico a 3 unidades ovinas de produccin familiar abarcando aspectos zootcnicos, sociales y econmicos, basados en la propuesta realizada por Raj (1980). Al contar con los datos ordenados y clasificados,seempleestadsticadescriptivaalosprincipalesestadgrafosdelas variables zootcnicas y socioeconmicas para obtenerlas frecuenciasrelativas y absolutas, apoyndose con el programa Excel (Microsoft Corp.) y el paquete estadsticoSPSS10.0paraWindows.

RESULTADOSYDISCUSIN En lo que respecta, a las caractersticas zootcnicas en estas UPF ovinas se detectolaidentificacinesnulaenun100%,lasuplementacinapenassellevaa caboenun25%,carecendeprogramasdereproduccinymejoramientogentico, losprogramasdesaludnoseestablecenal100%,elmercadodeestosovinoses local as la venta de estos animales, se da en pie y no por peso este ltimo resultado, es similar a lo hallado por Snchez (2006) con caprinos, bovinos y cerdos. Estas UPF cuentan con ovinos criollos, que son cruzas de pelibuey y

303

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ovinos nativos. Cabe resaltar, quela suplementacin alos ovinosen estas UPF, se dan rastrojos de maz, paja de soya, paja de cacahuate, paja de frjol y en menorporcentajegranoscomoelmazyfrjol,araznde60a110g/da/animalen la poca de estiaje por otrolado, esimportante sealar elimpacto alimentario a travsdeforrajesdetipoarbreoarbustivo,yaquesuscostosdealimentacinde estos ovinos es de cero pesos, ya que las condiciones silvopastoriles que se reflejanenalgunasplantasperennestodoelao,favorecenlasustentabilidadde estas UPF, tal como lo indica Franco et al(2005). Es importante sealar, que la edadreproductivadelashembrasvadelos8a10mesesyenelmachoalos12 meses, en lo que respecta a los problemas de salud el 72% corresponden a diarreas en corderos y adultos, 16%cadasde pelo y alteraciones dela piel y el 12% a otras (cojeras, convulsiones, etc.). En lo que respecta a los costos de produccin y rentabilidad de estos ovinos, se encontr que las condiciones silvopastoriles, sobre todo en la alimentacin (arbreoarbustiva) y de pasto natural,esmuyfavorableparacadaproductordelasUPFovinasdeesareginde la Mixteca Poblana al observase en el cuadro 1, se muestra un importante beneficionetoporanimalde$679.57.

304

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Cuadro1.Indicadoreselementalesenloscostosdeproduccindelas unidadesdeproduccinfamiliar. Mnimo Ventadeanimales Tiempo de finalizacin (meses) Preciodelovino(bulto) Costo produccin/animal Costo de produccin final/grupoovino Ingreso ovino Beneficio ovino Beneficioneto/animal $480.09 $786.28 $679.57 85.58 neto/grupo $668.04 $15,725.72 $8,218.61 4,750.96 total/grupo $800.00 $18,000.00 $9,653.33 5,533.90 $131.96 $2,700.86 $1,434.67 812.60 de $600.00 $101.59 $900.00 $151.65 $796.66 $121.05 89.57 13.20 1 6 Mximo 20 12 Media 11.86 9.33 DE 6.39 1.91

Enloquerespectaalascaractersticassocioeconmicasseencuentra,Enestas comunidades y en buena parte de la Mixteca Poblana, los ndices de vida son completamente difciles tanto en las oportunidades de empleo, educacin, salud, vivienda, alimentacin nivelada, salario digno, deporte y cultura lo cual ha ocasionado una fuerte corriente de emigracin de sus jvenes de estas comunidades a los Estados Unidos de Norteamrica, encontrndose en la actualidad fundamentalmente nios, mujeres adultas y ancianos. El salario diario en las comunidades por jornada laboral se encontr oscilando entre $ 90.00, $ 120.00 y $ 150.00. Es importante sealar, que sus viviendas son de concreto y otros materiales (lamina, madera y piedra). Por otro lado, no cuentan con

305

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

programasdesaludosegurosocialcomopartedelosesquemasproporcionados porelgobiernodelestadodeestosereflejalafaltadeproyectosoprogramasde bienestarsocial,sobretodoenelsectoragropecuarioparafortalecereldesarrollo y la sostenibilidad de estas comunidades, a diferencia de lo hallado por HernndezVlez(2005),dondecaracterizasocioeconomicamenteytcnicamente ungrupodeovinocultoresenlasierraorientedePueblaencuentraquedelos11 productoresevaluados,el100%tienelamodalidaddegrupocolectivoydeseguro social(particularogubernamental),locualhacemassustentableesaregin,con la nica desventaja de sus costos de alimentacin que son ms altos, por la compradegranosparalasuplementacindeestosovinos.Porlocual,elpotencial silvopastorilconelquecuentalasUPFdelareginmixteca,seaunaventajapara producir ovinos de una excelente carne de tipo orgnica, por su alimentacin (arbreoarbustiva).

CONCLUSIN La caracterizacin es una herramienta tcnica, la cual nos permite, conocer en quecondicionesseencuentranestasunidadesdeproduccinfamiliarovinasenla MixtecaPoblanasiseadoptanindicadoresdetipozootcnico,socialyeconmico alastecnologasdeestossistemassilvopastoriles,podremosprotegerypromover el desarrollo sostenible en la regin adems de frenar la migracin familiar al extranjero. LITERATURACITADA De la Cruz, J. A. 2004. Esfuerzos y recompensas. Revista Acontecer Ovino Caprino.Vol.VNo.24.p:4854. Franco, G. F. J., Hernndez, H. J. E., Villarreal, E., O. A., Gmez, C. G. A., Snchez,R.M.,Mendoza,M.G.2006.Elpastoreotrashumantedelganado caprino en bosques del nudo mixteco, una alternativa silvopastoril

306

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

sustentable. Ciencias ambientales. Temticas para el desarrollo. Vol. II. Edit.BUAP.p:1327. Guizar, E. & Snchez, A. 1991. Gua para el reconocimiento de los principales rboles del alto Balsas. Universidad Autnoma de Chapingo. Direccin de Difusin Cultural. Divisin de Ciencias Forestales. Montecillo, Estado de Mxico. Gmez, Q. J. M., Amaro, G. R., Preciado de la T., J. F. & Martnez, R. L. 1996. Marco de referencia para la Caprinocultura de la Mixteca Poblana. Memorias. XI Reunin Nacional sobre Caprinocultura. UACH., Chapingo, Mxico.p:192197. HernndezHernndez, J. E., Franco, G. F. J. & Pedraza, O. R. 2004. Productores y Hatos caprinos que caracterizan socialmente un sistema de produccin en la Mixteca Poblana (Piaxtla). Memorias. XIX Reunin sobre Caprinocultura.Acapulco,Gro.Mxico. Hernndez, V. J. O., Gonzlez, L. Z. U., Caldern, R. R. C., Cargigal, G. J. A. 2005.Caracterizacinsocioeconmicaytcnicoproductivadeungrupode ovinocultoresdelasierraorientedePuebla.MemoriasdelXXIXCongreso deBuiatria.Pequeosrumiantes.Puebla,Mxico. INEGI.2000.SntesisgeogrficadelestadodePuebla.Libroelectrnico.Mxico. Raj,D.1980.Teoradelmuestreo.TraduccindeR.R.ReyesMazzoni.Fondode CulturaEconmica.Mxico,D.F.pp305. Romero B., J. O. 2004. Demografa, recursos y actividades econmicas: la ganadera familiar en comunidades rurales de Puebla y Tlaxcala. Tesis de Doctorado. Especialidad en Estrategias para el Desarrollo Agrcola Regional,CampusPuebla,ColegiodePostgraduados.Puebla,Mx. Snchez, T. Y. 2006. Diagnstico Productivo de las Unidades de Produccin Familiar Caprinas en la Mixteca Poblana: Tehuaxtla y Maninalcingo. Tesis de Licenciatura. Escuela de Medicina Veterinaria y Zootecnia. BUAP. Tecamachalco,Puebla.

307

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 (SMVZ55) PRODUCCINOVINAESTACIONALAPEQUEAESCALAENELEJIDO

DESANTAMARAMAZATLA,JILOTZINGO,ESTADODEMXICO

1 1 1 DoloresNoemvilaRamrez ,AlejandroLaraBueno ,LaskmiKrishnamurthy , 2 3 FranciscoEspinosaAvia ,JorgeA.Escutia

Departamento de Suelos, Universidad Autnoma Chapingo. km38.5carr.MxicoTexcoco.Chapingo,EstadodeMxico.C.P.56230.Telfono:01(595)9521 500


2

Centro de Enseanza, Investigacin y Extensin en Produccin Agrosilvopastoril, FacultaddeMedicinaVeterinariayZootecnia,UNAM FuturoComnCienciaySociedad,A.C.

Direccinelectrnicaparacorrespondencia: dnoemi1@yahoo.com.mx

RESUMEN Con el objetivo de contribuir con la generacin de modelos de produccin sustentable, esta propuesta metodolgica integra la descripcin microclimtica y edfica, el anlisis del conocimiento de la flora local y el diseo de un sistema productivo estacional. En las condiciones de temperatura (T) y humedad relativa (HR) no se encontraron diferencias significativas (U de MannWhitney= 0.7061, p>0,05)entreelbosqueylapradera,aunque,elmicroclimadelapraderaesms heterogneo(T:cv=30.37%HR:cv=54.15%)queelbosque(T:cv=23.73%HR: cv=48.45%).Elconocimientolocal(PC)ylapreferenciadelosanimales(PA)por
2 recursos forrajeros nativos dependen de la estacionalidad (PA: X =1.164, g.l.=2, 2 2 p>0.05 PC: X =2.312, g.l.=3, p>0.05) y la abundancia (PA: X =5.157, g.l.=4, 2 p>0.05 PC: X =4.920, g.l.=6, p>0.05) de las especies en el bosque. La

abundancia (Ab) de las especies con potencial forrajero depende de la


2 estacionalidad (x =5.519, g.l.=2, p>0.05). Se propone implementar un sistema

silvopastoril con ovinos solamente en la temporada de lluvias, que aproveche la mayordisponibilidaddeforrajeenelbosque,sinnecesidaddedeforestarelejidoy permitalarecuperacindelrecursoforestalparanoagotarlo.

308

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

PALABRAS CLAVE: bosque templado, flora forrajera, silvopastoreo, sistema estacional,encinar.

ABSTRACT

With the objective to contribute for designing sustainable production models, this methodology integrates microclimatic and soil description, analysis for local vegetation knowledge, and a seasonal productive system design. For temperate (T) and relative humidity (HR) conditions didnt find statistical difference (U de MannWhitney= 0.7061 p>0.05), between forest and prairie areas however the prairie microclimatic conditions were more heterogeneous (T: cv= 30.37% HR: cv=54.15%) than the forest (T: cv=23.73% HR: cv=48.45%). The known preference (PC) and animal preference (PA) for native forage species were
2 2 depended for seasonality (PA: X =1.164, g.l.=2, p>0.05 PC: X =2.312, g.l.=3, 2 2 p>0.05), and abundance (PA: X =5.157, g.l.=4, p>0.05 PC: X =4.920, g.l.=6,

p>0.05) in the forest. Forage species abundance was depended for seasonality
2 (x =5.519,g.l.=2,p>0.05).Itproposesimplementasilvopastorilsystemwithovines

only at raining season to use increased forage availability in the forest, without deforestationandallowrecoveryofforestresources. KEYWORDS:temperateforest,foragespecies,silvopastoril,seasonalsystem,oak forest. INTRODUCCIN Laproduccinganaderaesunodelosfactoresresponsablesdelatransformacin y prdida de ecosistemas terrestres (Challenger, 2003 Ocampo, 2000). La produccinovinaapequeaescalarepresentaunejemplodesistemaproductivo de subsistencia y autogeneracin de recursos fcilmente intercambiables y culturalmentebienaceptadosenlascomunidadesrurales,elcualesampliamente utilizadoenregionesconbosquestempladoscomolosencinares(Valdez,2006).

309

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Sinembargo,estaformadeganaderatambinestasociadaalasimplificaciny eldeteriorodelosbosques(Ocampo,2000). El manejo tradicional del pastoreo consiste en ocupar el terreno durante todo el ao, ya sea de manera secuencial por fracciones de la pradera o de forma continua en la superficie total (Franco et al., 2002). La poca del ao afecta la disponibilidad y la calidad nutricional del forraje debido a los cambios en la periodicidadylaintensidaddelaradiacinsolar,ladistribucindehumedadyla variacin de la temperatura ambiental durante las estaciones del ao (Nez, 1998Peri,2009). El silvopastoreo es un sistema pecuario que permite conservar la diversidad biolgica local, favoreciendo el mantenimiento de los servicios ambientales del bosque y la diversificacin productiva en un mismo terreno (Nair, 1997). Un elementofundamentaldeestaalternativaganaderaeselaprovechamientodelos recursosforrajerosnativos(Andrade,etal,2008Nahedetal,2007Palma,2005). Las comunidades boscosas pueden ofrecer mayor diversidad de especies potencialmente aprovechables como forraje en contraste con la pradera inducida (Pineda,2007). El objetivo de esta investigacin es contribuir con la generacin de modelos de produccin sustentable de fcil asimilacin por productores con rebaos pequeos. Esta propuesta metodolgica integra la descripcin microclimtica, florsticayedfica,elanlisisdelconocimientodelafloralocalyeldiseodeun sistemaproductivoestacional. MATERIALESYMTODOS rea de estudio. El Ejido de Santa Mara Mazatla se encuentra en el municipio Jilotzingo(1924y1933N,y9919y9928O).Estalocalidadformaparte de la Sierra de las Cruces y presenta un intervalo altitudinal de 2756 a 2870 m.s.n.m (INEGI, 2009 SMA, 2007). El tipo de clima es semifro hmedo con lluvias en verano con precipitacin promedio anual de 2680 mm. La lluvia se

310

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

presentan a lo largo del ao, siendo el periodo de junio a septiembre, el ms hmedo.Latemperaturaoscilaentrelos5.6y29.5C.Eltipodesueloesluvisol crnico(INEGI,2009SMA,2007). Descripcin ambiental del Ejido. Desde 2009 se han realizado visitas diagnsticasalosterrenosejidales.Durantelosrecorridosserecopilinformacin de la vegetacin y las actividades productivas a partir de entrevistas semiestructuradasyregistrofotogrfico. Anlisis de los sistemas de produccin ovina local. Se realizaron entrevistas semiestructuradasyunarevisinsistemticabibliogrficaafindecaracterizarlos sistemas de produccin ovina. Se gener un cuadro comparativo a partir de los atributos: rebao, alimentacin, instalaciones, mano de obra, manejo rutinario, insumosyproductos. Disponibilidad de recursos forrajeros nativos. La flora nativa potencialmente forrajerafueidentificadaporuninformanteclave.Losdatosproporcionadosfueron laabundancia(Ab)enlalocalidad(1:mnimaabundancia,2:abundanciaregular y3:mayorabundancia),laestacionalidad (perenne,Panualdelluvias,LL)yla

preferencia conocida (PC) en los animales (1: poco preferida, 2: preferencia


regulary3:muypreferida).Estasobservacionessecontrastaronconlaconducta de los animales mediante una prueba de cafetera en campo con un rebao integrado por 12 hembras y dos corderos. Se ofrecieron cantidades similares de cada especie propuesta y se evalu la preferencia del rebao (PA) (1: poco preferida,2:preferenciaregulary3:muypreferida). Se gener una base de datos y se evaluaron estadsticamente a travs de la prueba de c2 las siguientes relaciones: 1) la independencia de la preferencia animal y la preferencia conocida, 2) la dependencia entre las preferencias y la abundancia de especies, 3) la dependencia entre las preferencias y la estacionalidad,4)laindependenciaentrelaabundanciaylaestacionalidad. Se colectaron y herborizaron ejemplares para su identificacin botnica en el HerbariodelaFacultaddeCiencias,UNAM.

311

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Anlisisambientaldeunaparcelaexperimentalparasilvopastoreo.Mediante el uso de un GPS modelo EtrexH se determin el permetro de un terreno boscoso destinado como parcela experimental. Se gener un sistema de referencia a partir del croquis de la parcela experimental con 10 transectos de 5x25mqueincluyeron,cadaunodeellos,parcelasde3x3m(Figura1.AyB).

Suelo .Secolectaronmuestrasdesueloentresreas:lacima(C),reamedia(M)
y rea baja (B), y se analizaron en el laboratorio Central de la Universidad Autnoma Chapingo para determinar los valores de retencin de humedad a capacidaddecampo(CC)ydepuntodemarchitezpermanente(PMP),densidad aparente(Dap),pH,contenidodemateriaorgnica(MO)ydenitrgenototal(Nt).

Vegetacin .Secolectaronejemplaresbotnicosafindeestimarlariquezadela
comunidad vegetal. La estructura de la vegetacin se evalu en 10 parcelas permanentes de 3x3 m seleccionadas aleatoriamente. Las variables registradas fueron: especie, forma de crecimiento (FC rbol, arbusto o hierba), altura promedio(Alcm),coberturaestimada(C,%)ydaoporherbivora(Hescalade 0a5,donde0=0%,1=110%2=1125%3=2650%4=5175%5=76100%).

Comparacin microclimtica de ambientes de pastoreo. En 5 parcelas


permanentesde3x3mseregistraronlasvariablesmicroclimticasdetemperatura (T C) y humedad relativa (HR %) (Figura1.A y B) con un un multmetro Fluke modelo 971. Se registraron lecturas tres veces al da (8:00, 12:00 y 16:00 hrs). Adicionalmente,semarcaron5sitiosenunapraderalocalparacompararlaconla parcela experimental. Se gener una base de datos y se compararon las condicionesmicroclimticasentrelaparcelaexperimental(bosque)ylapraderaa travs de un diagrama de dispersin de la temperatura y la humedad relativa. A partir de la prueba U de MannWhitney se evaluaron las diferencias microclimticas entre ambos ambientes. La heterogeneidad microclimtica se evalomedianteelcoeficientedevariacin.

312

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

A)

B)
Figura1.Croquisdelaparcelaexperimental.A)trazodetransectosde5x25mymicroparcelasde 3x3.B)Localizacindelasmicroparcelaspermanentesparaseguimientodevegetacinylecturas climticas.

313

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RESULTADOS Descripcin de las condiciones ambientales del ejido. El bosque de encino secundario es la comunidad vegetal ms abundante y es resultado directo del aprovechamiento de carbn vegetal, tambin hay algunos rodales de pinos y oyamel, as como reas de pastizal y tierras de cultivo. Aunque la vocacin del suelo es forestal, la silvicultura no es una actividad relevante. La produccin pecuariafamiliarsecentraenlosovinos,lasgallinasyloscerdos. Los sistemas ovinos locales. El sistema mixto considera pastoreo diurno, en praderas abiertas por desmonte del bosque o resultantes de reas de cultivo, y encierronocturnoencorralesprximosalaviviendadelproductor.Elotrosistema es confinado o en estabulacin total , en el cual los borregos no realizan actividadesdepastoreoylaalimentacinesenpesebre(Cuadro1).

314

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489


Cuadro1.Descripcindelosatributosdelossistemaslocalesdeproduccinovina. Atributo Rebao Sistemamixto Cantidadvariable:1030borregos Sistemaconfinado Cantidadvariable:disponibilidadde espacio Razasmejoradas,criollos Homognea(lotederazamejorada) puedeservariableenrebaos criollos Desconocida Ausentesomuygenerales Enpesebre Formuladaconalimentocomercial, granodemazyfuentesdefibra (rastrojo,cascarilladetrigo) Frecuente.Siguelafrmula recomendada Ingredientedeladieta:fuentesde fibra Corralpermanente Postesfijos,demaderaoconcreto, almenosunmuroslido,rejasy otrasparedesconmaterialesy acabadosmsresistentes Familiar Emprica Elrebaoseestabulatodoeltiempo. Alimentoyaguaseofrecenenel corral.

Tipodeanimales Criollos,cruzaslocales Edaddelos Variable animales Desparasitacin Registros Alimentacin Tipodedieta Desconocida Ausentes.Apreciacinvisual Enpastoreodiurno Seleccinhechaporelrebao compuestaporespecies herbceas,principalmente gramneas. Supervisindedieta Mnima Complemento Ocasional Instalaciones Corraldeencierro Tipodemateriales Postesdemaderaotronco,malla, tablonesuotrosmateriales. Construccinrsticaoimprovisada Manodeobra Familiar,obienconpastorexterno Capacitacin Emprica requerida Manejorutinario Serealizapastoreodiurnoendos periodosalda,conencierro nocturnohastaeldasiguiente. Aguadisponibleenelintervalo entrepastoreo,alllegaralcorral. Duracindelciclo Continuo,conreproduccin productivo estacionalanual Medicinapreventiva Ocasional Calendario Empricoestacionalanual reproductivo

Continuo,condosciclos reproductivos Ocasional Empricoapartirde recomendacionespreviasconrazas mejoradassinmarcada estacionalidad Reemplazos Ocasionalacriterioonecesidaddel Principalmenteparaelsemental. propietario(msdeunaosin Conrazamejoradasiguen reemplazos) recomendacionesencombinacin consuexperiencia Insumos Animalesnuevos,pagoalpastor Alimentoanimalescada23aos Animales Loscontadosreemplazosque Reemplazosparasemental(evitar considereelproductor consanguinidad)yhembras (conservarfertilidad) Alimento Forrajeenpocasecayfra Alimentocomercial,grano,salvado (ocasional) Otros Pagoapastor Serviciosveterinarios Productos Animalesparaabasto,carne Animalesparaabastoypiedecra carne Mercado Local,acopiadoresforneos Local,acopiadoresforneos (oportunidad) (oportunidad)

315

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Disponibilidad de recursos forrajeros. Se integr una lista de 19 especies nativasconpotencialforrajero(Cuadro2),enstasepresentanlastresformasde crecimiento,hierbas,arbustosyarbreas.ConexcepcindeViciafaba,todaslas especiescrecenenelbosque.
Cuadro2.Listadeespeciesconpotencialforrajeroproporcionadoporelinformanteclave. Especie Nombre comn Lulo Acahualblanco
PREFERENCI AANIMAL PREFERENCI ACONOCIDA ABUNDANCIAY ESTACIONALID AD

DahliacoccineaCav. Bidensodorata

3 2 2 2 3 3 3 3 2 2 2 3 2 2 3 2 2 3 3 1

2 1 2 1 3 2 3 3 2 1 2 3 2 3 2 2 2 3 3 0

1 2 1 1 3 3 2 3 2 2 2 3 3 1 1 2 3 1 1

Lluvias Lluvias Lluvias Lluvias Lluvias Lluvias Lluvias Perenne Lluvias Lluvias Lluvias Perenne Perenne Perenne Lluvias Perenne Perenne Lluvias Lluvias

Desmodium Pegarropa uncinatum Jaltomataprocumbens Jaltomate Bromuscarinatus Viguieracordata Smilaxmoranensis Crataegusmexicana Rosacanina Symphoricarpos microphyllus Arracacia atropurpurea Cornusexcelsa Garryalaurifolia Viburnumstenocalyx Trifoliumrepens Buddleiacordata Lopeziaracemosa Viciafaba Cunilalythrifolia
Pipilote Acahual amarillo Zarzamora Tejocote Garambullo Perlilla Xirint Frutilla1 Chichicaule Frutilla2 Alfalfa cimarrona Tepozn Perita Haba Poleo

Astragalusmicranthus Ebol

1 Anualcultivo

Preferenciadelanimal:1=pocopreferida,2=preferenciaregular,3=muypreferidapreferencia conocida1=pocopreferida,2=preferenciaregular,3=muypreferidaabundanciaenelbosque: 1=mnimaabundancia,2=abundanciaregular,3=mayorabundanciaestacionalidad:LL=anualde lluvias,P=perenne.

Lapreferenciadelosanimales(PA)ylaexpresadaporelinformante(preferencia
2 conocida, PC) tuvieron diferencia significativa (X =27.936, g.l.=6 p<0.0001). Las

316

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489


2 preferencias dependen de la abundancia (PA: X =5.157, g.l.=4, p>0.05 PC: 2 2 X =4.920, g.l.=6, p>0.05) y la estacionalidad (PA: X =1.164, g.l.=2, p>0.05 PC: 2 X =2.312, g.l.=3, p>0.05). La abundancia (Ab) de las especies con potencial 2 forrajerodependedelaestacionalidad(x =5.519,g.l.=2,p>0.05). 3 Elsuelodelaparcelaexperimental.Esligero(Dap=0.91tm ),ricoenmateria

orgnica (8.9%) y con alta capacidad de retener humedad (CC= 45.8% PMP=24.7%) el pH de 6.4 favorece la disponibilidad de nutrimentos para la vegetacin. Vegetacin.Enlaestructurageneraldelavegetacinseregistraronespeciesde las tres formas de crecimiento. Por anlisis de frecuencia de un total de 95 especies identificadas en las 10 microparcelas permanentes, se determin que 9.47% son ejemplares arbreos, 37.89% son arbustivas y 52.63% de herbceas (Cuadro3).
Cuadro3.Estructuraflorsticageneralevaluadaenlaparcelaexperimental(readebosque).
FORMADE CRECIMIENTO Arbrea Arbustiva Herbcea FRECUENCIA(%) 9.47 37.89 52.63 NMERODE ESPECIES 9 36 50 COBERTURAPROMEDIO 16.7% 29.58% 23.2%

Se consideraron las plantas que estuvieran dentro del permetro de 3x3m, con distancialasuelomximade1.20m. Comparacin microclimtica. No se encontraron diferencias significativas entre losdatosdelaparcelaexperimental(bosque)ylapradera(temperatura,T:Ude MannWhitney= 0.7061, p>0.05 humedad relativa, HR: U de MannWhitney= 0.2139,p>0.05).Sinembargo,laTdelbosqueesmshomognea(coeficientede variacin= 23.73%) que la registrada en la pradera (coeficiente de variacin= 30.37%) a su vez la HR en la pradera es ms heterognea (coeficiente de variacin= 54.15%) que en el bosque (coeficiente de variacin= 48.45%). El diagramadedispersin(Figura2)ilustraestasrelacionesenambosentornos.

317

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Figura2.Diagramadedispersindelatemperaturaylahumedadrelativadelbosqueydela pradera.

DISCUSIN Comparacinmicroclimticaenambientesdepastoreo:bosquevspradera El bosque tiene un efecto moderador sobre las fluctuaciones de las condiciones microclimticas (temperatura ambiental y humedad relativa). En cambio, las variaciones de la pradera son drsticas en un mismo da, sobre todo en el intervalo del medio da y las 16:00 hrs. Las interacciones entre componentes microclimticospermitenexplicarquemientraselbosquemoderaloscambiosen la temperatura ambiental, paralelamente la humedad relativa permanece ms constantequeenunapradera,dondelaincidenciaderadiacinsolarescompleta yaceleralaevaporacin,reduciendolahumedadenelaireencuestinde4horas (12:0016:00hrs). La estructura de la vegetacin influye en varios elementos del microclima (velocidaddelviento,humedadrelativa,temperaturadelaire,calidadycantidadde radiacin solar). Como lo menciona Escutia (2009), las copas de las plantas modulan los cambios enla temperatura delaire por consiguiente se explica que en una pradera, donde la vegetacin es predominantemente herbcea de porte

318

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

bajo, las condiciones ambientales no tienen cobertura de amortiguamiento y los cambiossonrpidosymuyvariables. Los resultados sobre comparacin de condiciones microclimticas permiten sugerir que el bosque ofrecer al rebao un entorno de bienestar trmico de mayor duracin a lo largo del da, coincidiendo con Betancourt, et al (2003) respecto al efecto favorable de la sombra sobre el rendimiento productivo del ganadocomoresultadodeladisminucindelestrscalrico. Disponibilidadderecursosforrajerosypreferencias La prueba de preferencias realizada a partir del conocimiento local sobre los forrajes nativos del bosque gener una serie de 19 especies preliminares, entre las cuales estn representadas las tres formas de crecimiento florstico: hierbas, arbustosyrboles.EncontrasteconloreportadoporPineda(2007),elbosquede pinoencino en el ejido de Santa Mara Mazatla ofrece una mayor variedad de especiesconpotencialforrajero,quelosovinospuedenseleccionar.Sibien,esta especie animal expresa un comportamiento de consumo predominantemente a niveldelsuelo(Forbes,2007),lapruebadepalatabilidadencampoevidencique hay especies leosas (rboles y arbustos) con posibilidad de ser consumidas siempreycuandoseencuentrendentrodelperfildeconsumodelosovinos,yno nicamenteconsiderarlasherbceas,comoloreportPineda(2007). El efecto de la estacionalidad se evidenci con las pruebas estadsticas para la preferencia conocida y la expresada por los animales, as como por la relacin directa entre la abundancia y la estacionalidad de las especies. Los resultados sugirieronquelapreferenciadeespeciesestcondicionadaporlaabundanciaen elbosque,lacualesrespuestadirectadelaestacionalidad,esdecir,lapocadel aocondicionaladisponibilidaddeforraje.Porlotanto,seraposibleincentivarla el aprovechamiento de especies nativas si se considera la mejor temporada en que estn disponibles en cantidad y diversidad, como sucede en la poca de lluvias.

319

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Asimismo,estapruebacotejelconocimientolocalconelcomportamientoanimal. Ladiferenciaestadsticaencontradaentrelapreferenciaconocidaporelproductor y la manifiesta por el animal puede explicarse con el hecho de que, tradicionalmente,enelejidonoserecurrealbosquecomoreadepastoreosino quesepracticaeldesmonteparainducirpastizales(Valdez,2006). Sistemasovinosysilvopastoreo La informacin obtenida a partir de la caracterizacin de los sistemas de produccin ovina es la referencia para el diseo del sistema silvopastoril estacional, con manejo semejante al conocimiento local para favorecer su aceptacinporlosproductores. Eldiseodelsistemasilvopastorilestacionalestfundamentadoenlosresultados de la comparacin microclimtica entre la parcela experimental (bosque) y la pradera, enla descripcin de la vegetacinnativa como antecedente y se apoya conelconocimientolocalparaidentificarforrajeenelbosque. La metodologa propuesta sistematiza la identificacin de recursos forrajeros nativos para disminuir la dependencia de insumos externos que incrementan los costosdelaproduccinpecuaria,coincidiendoconladirectrizplanteadaporPinto, etal(2010)yQuero,etal(2007),conladiferenciaquelaregindetrabajoesuna zona templada. Por consiguiente es una contribucin a la investigacin en sistemassilvopastorilesenMxico. La obtencin de datos verificables y cuantificables coincide con las propuestas metodolgicasdeMolinilloyMonasterio(2002),Betancourt,etal(2003)yPintoet al., (2010). El diseo de un etograma de seguimiento del rebao comprende los comportamientos de ingestin, rumia, descanso, caminar e interactuar, como lo propuso Pineda (2007), para una manada mixta en condiciones de silvopastoreo en bosque de encino. Por lo tanto, se desarrolla una investigacin replicable en otrasregionesconcondicionesdemedioecolgicosimilar.

320

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Finalmente,eltrabajocubrir4aspectosimportantes(BorrelliyOliva,2001)para evaluarinteraccionesplantaanimaldelsistemasilvopastoril:a)caracterizacinde lavegetacinporsuestructurab)identificacinderecursosforrajerospotenciales, conlapruebadecafeteraeinformanteclavec)comportamientodelosanimales (hbitosdeconsumoyselectividad)yd)impactodelsilvopastoreoenelbosque, medianteelseguimientoaloscambiosenlavegetacin.

CONCLUSIONES El bosque modera el microclima y puede favorecer el bienestar trmico del ganado, a diferencia de las marcadas variaciones diarias que presenta una pradera,predisponentesaestrstrmicoqueafectaelrendimientoproductivo. Las especies del bosque con potencial forrajero se traducen en diversidad y disponibilidaddealimentoparaelrebaoensilvopastoreo.Conmayordiversidad deforrajedisponible,elrebaoexpresarmejorsucomportamientoselectivopara conformarladietaensilvopastoreo. Con la descripcin de los sistemas locales de produccin ovina se identificaron elementos para mejorar con un sistema silvopastoril estacional, acorde con las formasdemanejoderebaosenelejidoquefavorezcansuaceptacin. Se propone implementar un sistema silvopastoril con ovinos, teniendo como perodonicodeengordalatemporadadelluvias,conlafinalidaddeaprovechar la mayor disponibilidad de forraje en el bosque y permitir la recuperacin del recursoforestalparanoagotarlo.

321

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

LITERATURACITADA Andrade HJ, Esquivel H, Ibrahim M. 2008. Disponibilidad de forrajes en sistemas silvopastoriles con especies arbreas nativas en el trpico seco de Costa Rica.Zoot.Trop.,26(3):289292. Betancourt K, Ibrahim M, Harvey CA, Vagas B. 2003. Efecto de la cobertura arbrea sobre el comportamiento animal en fincas ganaderas de doble propsito en Matigus, Matagalpa, Nicaragua. Agroforestera en las AmricasVol.10Nm.3940. BorrelliP,GOliva.2001.Efectosdelosanimalessobrelospastizales.Cap.4pp. 99128. En: Ganadera sustentable en la Patagonia Austral. Borrelli P y G Oliva.Ed.INTAReg.Pat.Sur269pp. Challenger A. Conceptos generales acerca de los ecosistemas templados de montaaenMxicoysuestadodeconservacin.Pg.1744en:Snchez O.Conservacindeecosistemastempladosdemontaa.InstitutoNacional deEcologa.2003. Escutia JA. 2009. Heterogeneidad arquitectnica y microclimtica en forofitos y distribucinespacialdeTillandsiarecurvataenunsistemasemirido.Tesis dePosgrado.FacultaddeCiencias,UNAM. Forbes,JM.2007.VoluntaryFoodIntakeandDietSelectioninFarmAnimals.CAB International.London,UK.300p. FrancoFJ,GmezCGA,SnchezRM,MendozaMGD,BrcenaGR,CarrenLL, Hernndez HJE. 2002. Tiempo de pastoreo, cobertura vegetal y grado de utilizacin de especies arbreas y arbustivas por el ganado caprino en la mixteca oaxaquea. Memorias del XXV Congreso Nacional de Buiatra, 2002. INEGI,2009.AnuarioEstadsticodelEstadodeMxico.Mxico.pp.328.

322

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

MolinilloM,MMonasterio.2002.Patronesdevegetacinypastoreoenambientes depramo.ECOTRPICOS15(1):1943. Nahed TJ, Alemn ST, Jimnez FG, Lpez Q. 2007. Estudio para desarrollar sistemas agrosilvopastoriles: experiencias en la regin maya Tzotzil. Memorias de la II Conferencia electrnica sobre Agroforestera para la produccin animal en Amrica Latina. FAO, 2007. Disponible en: http://www.fao.org/forestry/home/es/consultadoenabril3de2009. NairJKL.1997.Agroforestera.UniversidadAutnomadeChapingo.Mxico.290 p. Ocampo, TL. 2000. Sistemas silvopastoriles. Programa de Apoyo al Desarrollo Rural,ColegiodePosgraduados.Mxico. Palma JM. 2005. Los rboles en la ganadera del trpico seco. Artculo invitado. AvancesenInvestigacinAgropecuaria. Pineda SM. 2007. Comportamiento en pastoreo y caractersticas nutricias de especiesconsumidasporovinosycaprinosenbosquedeencino.Tesisde Licenciatura.FacultaddeMedicinaVeterinariayZootecnia,UNAM. PintoRuiz,HernndezD.2010.rbolesforrajerosdetresregionesganaderasde Chiapas,Mxico:usosycaractersticasnutricionales.Universidadyciencia, rev.Elect.26(1):1931.Disponibleen:www.ujat.mx/publicaciones/uciencia consultadoenmayo22de2011. Quero CAR, QJF Enrquez, JL Miranda. 2007. Evaluacin de especies forrajeras enAmricatropical,avancesostatusquo.INTERCIENCIA,Agosto,vol.32 No.8pp556571. Secretara del Medio Ambiente (SMA), 2007. Situacin de la flora y fauna del EstadodeMxicorespectoalaNOM059SEMARNAT2001.Gobiernodel Estado de Mxico. Disponible en: www.edomex.gob.mx, consultado en enero6de2011.

323

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Valdez,RME.2006.DiagnsticoambientaldelmunicipiodeJilotzingo,Estadode Mxico. Tesis de Licenciatura, Mayo de 2006. Facultad de Estudios SuperioresIztacala,UNAM.Mxico. Vega LA, Mendoza DR. 2001. Evaluacin de la condicin actual de los agostaderos del Centro de Enseanza, Investigacin y Extensin en Produccin Agrosilvopastoril (CEIEPASP), ubicado en el municipio de ChapadeMota,EstadodeMxico.SAGARPA.Mxico.

324

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 56) Frecuencia deEhrlichiacanis en perros domsticosde la ciudad deXalapadeEnrquez,Veracruz. Frequency of Ehrlichia canis at domestic dogs in the city of Xalapa de Enriquez,Veracruz.
1 1 ChristianGerardoMartnezLpez ,GerardoOlmedoPerez ,RodolfoRamos 2 2 Beltrn ,EduardoGazolPatio . 1

Universidad Veracruzana. Facultad de Ciencias Biolgicas y Agropecuarias. CarreradeMedicinaVeterinariayZootecnia,CampusTuxpan.CarreteraTuxpan Tampicokm.7.5S/NCol.Universitaria.C.P.92860.Tuxpan,Veracruz,Mxico. 2 Hospital Centro Veterinario Xalapa. Avenida vila Camacho N 94 Col. Centro C.P.91000XalapadeEnrquez,Veracruz. Autorparacorrespondencia:radhamantiz_666@hotmail.com RESUMEN Laehrlichiosiscaninaesunaenfermedadinfecciosaypotencialmente mortalque afecta a los perros y otros miembros de la familia Canidae, es producida por rickettsiaspertenecientesalgneroEhrlichiadelafamiliaEhrlichiaceae.Ehrlichia

canis causa la enfermedad con los signos clnicos ms severos, se le considera


zoontica y de carcter emergente. Debido a la ausencia de registros de la presenciadeehrlichiosiscaninaenlaciudaddeXalapadeEnrquez,Veracruz,el objetivo del presente estudio retrospectivo fue determinar la frecuencia de ehrlichiosis canina y principales alteraciones hematolgicas asociadas en perros domsticosatendidosenconsultaprivadaenelHospitalCentroVeterinarioXalapa durante el periodo comprendido de Mayo del 2009 a Mayo del 2011. Se consultaronlosarchivosdelreadediagnsticoparaidentificarlospacientesque presentaron signologa compatible con ehrlichiosis canina, cuyo diagnstico se confirm mediante extendidos sanguneos teidos con DiffQuik y/o la prueba
comercialSnapDx4canino .Seobtuvounafrecuenciadel15.78%deE.canis,en

dondelopacientesmsafectadosfueronlashembrasconun25%(P=0.10),los pacientes senctos en un 30% (P=0.18), el grupo de pacientes criollos con 40% (P=0.05), as como el Pastor Alemn con 3.5% (P=0.10). Como alteraciones hematolgicasseencontraronlatrombocitopeniaen100%,leucopeniaen60%y

325

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

un 60% de anemias las cuales fueron de tipo microctica normocrmica y normoctica normocrmica. Se concluye que E. canis se encuentra afectando a perros domsticos de la ciudad de Xalapa de Enrquez, Veracruz, lo cual constituyeunriesgoparalasaludpblicayanimal. Palabrasclave:Frecuencia,Ehrlichiacanis,perrosdomsticos.

INTRODUCCIN Laehrlichiosisesunaenfermedadcausadaporrickettsiasintracelularesobligadas pertenecientesalgneroEhrlichiadelafamiliaEhrlichiaceae(Garrity etal.,2002) y transmitidas por garrapatas que afectan a mltiples especies de hospederos tanto animales (bovinos, ovinos, equinos, venados, llamas, visones, roedores, ardillasycanideos)comohumanos(Greene,2000EttingeryFeldman,2002).Las especiesdelgeneroEhrlichiaqueafectanalosperroscomprendenaE.canis,E.

ewingii, E. chaffeensis, E. equi, E. ruminantium, E. sennetsu, E. risticii var. atypicalis(Breitschwerdtetal.,1998AllsoppyAllsopp,2001Garrity etal.,2002),


constituyendoE.chaffensisjuntoaE.sennetsu,E.canisyE.ewingiilasespecies de ehrlichias que afectan clnicamente a los humanos (Bouquil y Raoult, 1992 Kordicketal.,1999Thomasetal.,1990RojasyVillalobos,2007).Laehrlichiosis canina es reconocida como una enfermedad infecciosa importante y potencialmente mortal de los perros y otros miembros de la familia Canidae (Waner y Harrus, 2000). La primera ehrlichiosis reconocida yla que actualmente causa la enfermedad con los signos clnicos ms severos es la producida por

Ehrlichia canis (ehrlichiosis monoctica) (Nelson y Couto, 2005). Las garrapatas


representanelreservorioprimarioyvectordelaenfermedad,elvectornaturalde

EhrlichiacaniseslagarrapatamarrndelperroRhipicephalussanguineus(Nelson
y Couto, 2005), se ha demostrado la transmisin experimental por la garrapata

Dermacentor variabilis (Angulo y Rodrguez, 2005). Ehrlichia canis se presenta


con mayor frecuencia en pases templados, tropicales y subtropicales, ha sido documentada en varios pases de cuatro continentes, incluyendo Asia (Israel), frica (Zimbabue, Egipto), Europa (Espaa, Portugal, sureste de Francia, Italia, Turqua, Grecia y pases Balcnicos) y Amrica, (Estados Unidos, Mxico,

326

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Nicaragua, Colombia, Chile, Venezuela, Cuba y Salvador) (Rivas et al., 2010 Nez,2002Silvaetal.,2008Lpezetal.,1999Lenetal.,2008 Guillenetal.,
2001 Freire et al., 2009 Gutirrez et al., 2008 Rodrguez et al., 2005). La

enfermedad consiste en tres fases: aguda, subclnica y crnica, basndose enla signologayenlasanormalidadesclinicopatolgicas.Supresentacineintensidad dependendevariosfactorescomolosonlapatogenicidaddelacepa,lapresencia de infecciones concomitantes, la raza, el estado inmunolgico del paciente, y la fasedelaenfermedad(WaneryHarrus,2000NelsonyCouto,2005).Lossignos clnicos pueden ser muy amplios y variados incluyendo depresin, letargia, anorexia, fiebre, prdida de peso, secrecin oculonasal serosa a purulenta, linfadenopatas generalizadas, esplenomegalia, hepatomegalia, disnea o intolerancia al ejercicio debida a neumonitis, edema de las extremidades o el escroto, polimiositis, claudicacin, vmito, petequias y equimosis en la piel y membranasmucosas,epistaxisysangradoprolongadoduranteelestro(Ettingery Feldman,2002BichardySherding,2002Greene,2000).Paraeldiagnsticode la ehrlichiosis canina debe de considerarse desde la anamnesis, historia clnica, signosclnicos,pasandoporpruebaslaboratorialesbsicas(extendidossanguneos
teidos,hemogramasybioqumicassanguneas)(Trigo,2002), hastaaquellasque

miden de forma directa (prueba de reaccin de cadena de polimerasa) e indirecta (ensayos serolgicos, inmunofluorescencia indirecta, pruebas de inmunoabsorbencia
ligada a enzimas) la presencia del patgeno (Harvey, 2006 Waner et al., 1999

PaniaguayGuzmn,2001Marsilioetal.,2006).Elobjetivodeestetrabajoinici debido a la ausencia de registros de la presencia de ehrlichiosis canina en la ciudaddeXalapadeEnrquez,Veracruz,enconjuntoconlaimportanciazoontica comprobada delaenfermedad,lo cual motivlarealizacin del siguiente estudio retrospectivoparaverificarsufrecuenciaenperrosdomsticosdeestaciudad,as como la relacin entre las caractersticas particulares (raza,edad, sexo) de cada ejemplarylapresenciadeEhrlichiacanis.

327

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

MATERIALYMTODOS El presente estudio se realiz en el Hospital Centro Veterinario Xalapa (CVX), ubicadoenlaciudaddeXalapadeEnrquez,Veracruz,enelcualseconsultaron losarchivosdelreadediagnstico,conelfindeidentificarlospacientescaninos domsticos de la ciudad que presentaron signologa compatible con ehrlichiosis caninaduranteelperiodocomprendidodeMayodel2009aMayodel2011,cuyo diagnstico presuntivo se confirm mediante extendidos sanguneos teidos con
DiffQuiky/olapruebacomercialSnapDx4canino (IDEXXLaboratories,Inc.).Se

revisaronloshemogramasyexpedientesdelospacientescondiagnsticopositivo para E. canis, con la finalidad de identificar las alteraciones hematolgicas y verificar la presentacin de la ehrlichiosis canina en relacin con las variables raza, sexo y edad. Para el anlisis, la duracin del estudio se clasific en dos periodos, donde elprimero (Periodo 1) comprendidel 1 de Mayo de 2009 al 15 deMayode2010yelsegundo(Periodo2)del16deMayode2010al31deMayo de2011.Laedaddelospacientesseclasificoen4gruposCachorros(2mesesa 1ao),Jvenes(>1aoa4aos),Adultos(>4aosa9aos)ySenectos(>9 aos). Las razas obtenidas se incluyeron en dos grupos raciales razas puras y criollos.Lainformacinhematolgicaobtenidaporelhemogramasecomparcon los valores de referencia, en donde las anemias se clasificaron de acuerdo a lo mencionadoporJardon(2003)segnsuseveridadenligera,moderadaoseveray de acuerdo a los ndices eritrocitarios en microctica, normoctica, macroctica, hipocrmica,normocrmicaehipercrmica.Losdatosobtenidossecapturaronen
hojasdeclculoenelprogramaMicrosoftExcel ysesometieronalapruebadeji

cuadradautilizando1gradodelibertadyunadistribucina0.05. RESULTADOSYDISCUSIN Se estudiaron 57 perros domsticos, de los cuales se obtuvo una frecuencia del 15.78% (9/57) de diagnsticos positivos para Ehrlichia canis, resultado que coincideconloreportadoporHernndez,(2006)quienobtuvounafrecuenciadel 15%deehrlichiosiscaninaenBocadelrio,Veracruz.Elmayornmerodecasos

328

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489


positivos fue determinado por la prueba Snap 4Dx canino obteniendo una

frecuenciarelativadel88%(8/9),laseroprevalenciatotalobtenidamediantedicha prueba fue del 14.81% (8/54), cantidad que corresponde a la mitad de la encontrada por Nez, (2002) en el estado de Veracruz, quien menciona una seroprevalenciadel37.9%yaunatercerapartedeloreportadoporRodrguezet

al.,(2005)quienesenMrida,Yucatnreportaronun44.1%deseropositividad.La
frecuencia de diagnsticos positivos mediante la observacin de E. canis en monocitos circulantes de extendidos sanguneos en el presente estudio fue de 11.11%(1/9),proporcinqueseasemejaaloreportadoporLenetal.,(2008)en laHabana,Cubaquienesencontraronun12.03%decasospositivosmediantela misma prueba diagnstica, dicho resultado no coincide con lo mencionado por Ortega, (2005) quien obtuvo un 5% en el municipio de la Antigua, Veracruz. La frecuenciadeEhrlichiacanisencontradaduranteelprimerperiodofuedel21.73% (5/23) la cual casi duplic la referente al segundo periodo con un 11.76% (4/34) (P=0.005),estosresultadosdifierenconlosmencionadosporFreireetal.,(2009) quienes en el Salvador reportan un 51 % de prevalencia de E. canis o por lo referidoporRivasetal.,(2010)quienenLen,NicaraguadetectE.canisenun 63%deloscasos.LafrecuenciadeE.canisenrelacinalavariablesexoarrojo unmayorvalorparalashembrasconun25%(6/24)decasospositivosquepara los machos con un 9.1% (3/33) (P=0.10), estos resultados se relacionan a lo mencionado por Adrianzn et al., (2003) quienes en Lima, Per refieren que las hembras estadsticamente presentaron mayor probabilidad de infectarse. La relacinentrelavariableedadylapresenciadeE.canismostrunmayornmero decasospositivosparalospacientessenectos(mayoresa9aos)conun30% (3/10),seguidodelospacientescachorrosconun25%(3/12),losjvenesconun 12.5%(2/16)yunvalornuloencuantoalospacientesadultos(0%)(P=0.18),esto contrastaalomencionadoporSilvaetal.,(2008)enCali,Colombiaquienesensu estudio reportaron que los pacientes de edad adulta presentaron mayor frecuencia.LapresenciadeE.canisenrelacinconlosgruposracialesfuemayor para los pacientes criollos con 40% (4/10) que para los pacientes del grupo de razas puras con 10.86% (5/46), lo cual converge con lo reportado por Ortega,

329

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(2005) quien encontr una mayor frecuencia para el grupo de pacientes criollos conun10%queparaelgrupoderazaspurasconun4.4%decasospositivos.En cuanto a las razas individuales, el Pastor alemn, Golden Retriever, Cocker y ganaderoaustralianofueronaquellasafectadas,resultadosquecorrespondenalo mencionado por Len et al., (2008) y Hernndez, (2006) quienes mencionan al Pastor alemn, al Cocker y al Golden Retriever como algunas de las razas infectadasensuestudio.Lasalteracioneshematolgicasquesedetectaronenlos pacientes afectados por E. canis consistieron en trombocitopenia (100%), leucopenia(60%)yanemia(60%),lascualestambinsepresentaronenelestudio realizado por Parrado et al., (2003) donde reportaron trombocitopenia en un 89,28%,leucopeniaenun28.57%yanemiaenun71.42%delospacientes.Los tiposdeanemiaquesepresentaronenlospacientescondiagnsticopositivopara

E.canisfueronlamicrocticanormocrmica(66%)ylanormocticanormocrmica
(33%), siendo esta ltima segnWaner y Harrus, (2000) y Hernndez, (2006)la quesepresentadeformacomnenestoscasos.

CONCLUSIONES SeconcluyequeEhrlichiacanisseencuentraafectandoaperrosdomsticosdela ciudad de Xalapa de Enrquez, Veracruz, la cual al originar una enfermedad importante y potencialmente mortal en perros, debe de considerarse como diagnstico diferencial para aquellos pacientes que presenten una signologa inespecfica sugerente a hemoparasitosis, as como antecedentes de ixodidosis, en dondela trombocitopenia constituya la alteracin hematolgica predominante, siendonecesarioelanalizarlosmediantepruebasserolgicasomolecularespara corroborarsupresencia,descartandocomofactoresdeinclusinrepresentativosa las variables de raza individual, edad y sexo, quienes no resultaron tener valor estadstico en cuanto a su relacin con la presencia de la ehrlichiosis canina, considerando a la variable de grupo racial criolla como la nica que mostro

330

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

significancia estadstica en su relacin con la presencia de E. canis durante el presenteestudio. LITERATURACITADA Adrianzn, J. Chvez, A. Casas, E. y Li, O. 2003. Seroprevalencia de la dirofilariosis y ehrlichiosis canina en tres distritos de Lima. Rev. Inv. Per. 14(1):4348.

Angulo C. J. M. y Rodrguez. V. L. A. 2005. Diagnstico situacional de cuatro hemoparsitosencanesmenoresdeunao,encincobarriosdeldistritoVI2de Managua. Tesis de Licenciatura Facultad de Ciencia animal de Universidad NacionalAgraria,departamentodemedicinaveterinaria,Managua.pp5881.

AllsoppM.T.E.P.andAllsoppB.A.2001.NovelEhrlichiaGenotypeDetectedin DogsinSouthAfrica.JournalofClinicalMicrobiology.39(11):42044207.

Birchard S. J. y Sherding R.G. 2002. Manual clnico de procedimientos en pequeasespecies.Enfermedadesporrickettsias.Seccin2.Captulo15.pp147 149.

Breitschwerdt,E.B.Hegarty,B.C.,andHancock,S.I.1998.Sequentialevaluation ofdogsnaturallyinfectedwithEhrlichiacanis,Ehrlichiachaffeensis,Ehrlichiaequi, Ehrlichiaewingii,orBartonellavinsonii.JClinMicrobiol.36(9):26452651.

Brouqui P. and Raoult D. 1992. In Vitro Antibiotic Susceptibility of the Newly Recognized Agent of Ehrlichiosis in Humans, Ehrlichia chaffeensis. Antimicroblal agentsandchemotherapy.36(12):27992803.

Ettinger, S.J., Feldman, E.C. 2002. Rickettsiosis. Tratado de medicina interna veterinariaenfermedadesdelperroyelgato.Quintaedicin.VolumenI.4431091.

331

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

FreireM.N.,AzevedoT.S.,CunhaM.O.,GuerraE.F.C.,RochaA.A.F.,Moura S. B., Peneluc T. and Cerqueira R. B. 2009. Canine ehrlichiosis: Clinical, hematologicalandserologicalinvestigationof100dogs640.Proceedingsofthe 34thWorldSmallAnimalVeterinaryCongressWSAVA,SoPaulo,Brazil.

GarrityG.M.,Winters,M.,KuoA.W.andSearlesD.B.2002.Taxonomicoutlineof theprocaryotes.Bergey'sManualofSystematicBacteriology.SecondEdition.43 350.

Greene C. E. 2000. Ehrlichiosis. Enfermedades infecciosas en perros y gatos. Captulo28:153169.

Guilln A. T. T., Len E. A. A., Aragort W. F. y Silva M. 2001. Diagnstico de hemoparsitos en elinstituto de investigaciones veterinarias, periodo 19862000. CentroNacionaldeInvestigacionesAgropecuariasVeterinariaTrop.26(1):4762.

GutirrezC.M.G.,BarajasL.I.,RosA.A.M.ySaucedoG.G.2008.Diagnstico ymanejodehipotiroidismoyehrlichiosisenunperrodelaciudaddeMorelia.XIII Congreso veterinario de Len. Disponible en:

http://www.veterinariosenweb.com/campus/cdvl/memorias/memorias_1.htm. Consultadoel8dejuniode2011.

HarveyJ.W.2006.IdentificationofInfectiousAgentsandInclusionsinBloodCells from Dogs and Cats. NAVC Proceedings 2006, North American Veterinary Conference.InternetPublisher:InternationalVeterinaryInformationService. Hernndez F. G. 2006. Frecuencia y alteraciones hematolgicas asociadas a

Ehrlichiassp.enperrosatendidosenconsultaprivadaenelMunicipiodeBocadel
Ro, Veracruz. Tesis de Licenciatura. Facultad de Medicina Veterinaria y Zootecnia.UniversidadVeracruzanapp30.

332

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Kordick S. K., Breitschwerdt E. B., Hegarty B. C., Southwick K. L., Colitz C. M., HancockS.I.,BradleyJ.M.,RumboughR.,McphersonJ.T.,andMaccormackJ. N. 1999. Coinfection with Multiple TickBorne Pathogens in a Walker Hound KennelinNorthCarolina.JournalofClinicalMicrobiology.37(8):26312638.

LenA.,DemedioJ.,MrquezM.,CastilloE.,PereraA.,ZuaznabaO.,Canbal. J.,GonzalezB.,ReynaldoL.,VegaN.,BlancoD.,RondaM.,PeaA.andSeijaV. 2008.DiagnsticodeEhrlichiosisencaninosenlaciudaddeLaHabana.Revista ElectrnicadeClnicaVeterinaria.RECVET.III(5):122.

Lpez J., A. Castillo.,Muoz M. and Hildebrandt S. 1999. Hallazgo de Ehrlichia

canis en Chile, informe preliminar. Universidad Austral de Chile. Arch. med.


vet.31(2).

MarsilioF.,DiMartinoB.,MeridianiI.andBianciardiP.2006.Directidentification of Ehrlichia canis by a novel polymerase chain reaction method and molecular analysisofthecitratesynthase(gltA)genefromvariousItalianstrains.JVetDiagn Invest18:215217(2006).

Nelson R. W. and Couto C. G. 2005. Enfermedades rickettsiales polisistmicas. Medicinainternadeanimalespequeos.Terceraedicin.Volumen2:13491353. Nez O. L. Estudio de la seroprevalencia de Ehrlichia canis en Mxico. 2002. MemoriasXXIIICongresoAMMVEPE.pp7781. OrtegaO.P.2005.FrecuenciayalteracioneshematolgicasasociadasaEhrlichia

spp. en perros domsticos en la Ciudad de Cardel, Veracruz, Mxico. Tesis de


Licenciatura Facultad de Medicina Veterinaria y Zootecnia, Universidad Veracruzana.pp229.

333

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Paniagua M.L.R. and Guzmn C.J. 2001. Caractersticas hematolgicas, bioqumicas e histopatolgicas deehrlichiosis canina. Tesisde grado presentada para optar el ttulo de Mdico Veterinario. Facultad de Ciencias Veterinarias, U.A.G.R.M.SantaCruzdelaSierra,Bolivia.

Parrado M., Vargas F., Hernndez G. and Vergara H. 2003. Asociacin de los resultados de una prueba serolgica (ELISA) y frotis sanguneo en caninos con sintomatologa compatible de ehrlichiosis. Red de revistas cientficas de Amrica LatinayelCaribe,EspaayPortugal.Orinoquia.7(12):611.

Rivas L. V. Morales A. D., Saenz M. and Bonilla J. L. 2010. Hallazgo de Ehrlichiosis canina causada por E. canis en una Comunidad del Municipio de Len,Nicaragua.REDVET.16957504.11(3):110. Rodriguez V. R. I., Albornoz R. E. F. and Bolio G. M. E. 2005.Ehrlichia canis in dogsinYucatan,Mexico:Seroprevalence,prevalenceofinfectionandassociated factors.VeterinaryParasitology.127(1,4):7579.

Rojas S. J. R. and Villalobos V. J. 2007. Ehrliquiosis granulocitotrpica humana. ActaMdicaCostarricense.ISSN00016002/49/2:121123.

SilvaM.R.F.,SnchezU.N.yLoaizaE.A.M.2008.Reportedepresentacinde

Ehrlichia canis en muestras sanguneas de caninos en la ciudad de Cali,


Colombia. Disponible en: http://vetzootec.ucaldas.edu.co/downloads/MVZ2(1)_6.pdf. Consultado el 1 de juniode2011.

334

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ThomasR.E.,HarkessJ.R.,FishbeinD.B.,DawsonJ.E.,GreeneC.N.,Redus M. A., Satalowich F. T. 1990. Epidemiologic, Clinical, and Laboratory Findings of HumanEhrlichiosisintheUnitedStates.JAMA.264:22512258.

TrigoF.J.2002.Patologageneralveterinaria.3raed.McGrawHillInteramericana. Mxico.

WanerT.andHarrusS.2000.Ehrlichiosismonocticacanina.RecentAdvancesin Canine Infectious Diseases. Publisher: International Veterinary Information Service.

Waner T., Baneth G., Strenger C., Keysary A., King R. and Harrus S. 1999. Antibodies reactive withEhrlichia canis,Ehrlichia phagocytophilagenogroup antigens and the spotted fever group rickettsial antigens, in freeranging jackals (Canisaureussyriacus)fromIsrael.VeterinaryParasitology.82(2):121128.

335

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 (SMVZ58)PRINCIPALESPARTESDELAPLANTAQUECONSUMENLASCABRAS

DELCOMPONENTELEOSOPRESENTEENLAMIXTECAPOBLANA,MXICO.

MAINPARTSOFPLANTDIETSOFGOATSINTHISWOODYCOMPONENTMIXTECA POBLANA,MEXICO.

1 1 JorgeEzequielHernndezHernndez ,FranciscoJavierFrancoGuerra ,Julio 1 1 CesarCamachoRonquillo ,OscarAgustnVillarrealEspinobarros ,Denis 2 HernndezRiande .

Facultad de Medicina Veterinaria y Zootecnia. Benemrita Universidad AutnomadePuebla.Puebla.4surNo.304,Col.Centro.Tecamachalco,Puebla C.P.75480.2Estudiante LAEBUAP.Mxico.Correoelectrnico:Email:ovichiv_05@yahoo.com.*autorpara correspondencia.

RESUMEN Las hojas, flores y frutos, son partes de la planta que tienen gran importancia y usoenlaalimentacindelascabras,detalformaquelabiomasaforrajeradonde las hojas pueden ser cosechadas directamente de las ramas y la hojarasca mezcladaconotraspartesdelaplanta,seconviertenenelhenonaturalparaser consumido.Elobjetivodeltrabajofue:conocerlasprincipalespartesdelaplanta que consumen las cabras y su origen con el componente leoso presente en la MixtecaPoblana.Comprendi15unidadesdeproduccinfamiliarcaprinasdelas comunidadesdeTehuaxtlayManinalcingo,5caprinosmarcadosparaidentificary contarlosbocados/halcomponenteleosoporelmtododeobservacindirecta, aplicndosepruebadeDuncansimple(ANAVA).Lahojacomoparteprincipalde la planta, fue consumida 86.6% por las cabras donde el 75% correspondi a la

336

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

familia de las leguminosas. En cuanto a la parte consumida, se encontr diferenciassignificativasde0,0,9,5y39,0paraflor,frutoyhoja,respectivamente alosbocadosdadosaPithecellobiumacatlense. Palabrasclave:leosas,cabras,ramoneo,preferencia,alimentacin.

SUMMARY Theleaves,flowersandfruitareplantpartsthatareofgreatimportanceandusein feedforgoats,sothatforagebiomasswheretheleavescanbeharvesteddirectly from the branches and twigs mixed with other parts of the plant, they become naturalhaytobeeaten.Theobjectivewasto:identifythemainpartsoftheplant consumedbygoatsandtheirorigininthewoodycomponentpresentintheMixteca Puebla. Production comprised 15 units of the goat family and Maninalcingo Tehuaxtla communities, 5 goats marked to identify and count the bites / h the woody component of the direct observation method, applying simple Duncan test (ANOVA). The leaf as a main part of the plant was consumed by goats 86.6% where 75% corresponded to the legume family. As part consumed, we found significantdifferencesof0.0,9.5and39.0forflower,fruitandleaf,respectivelyto thesnacksgiventoPithecellobiumacatlense. KeyWords:woody,goats,grazing,preference,feeding.

INTRODUCCIN Las plantas son la clave de la vida que existe en la tierra, sin ellas muchos organismos vivientes desapareceran, ya que las formas de vida superior dependen directa o indirectamente de las plantas para alimentarse (Hodgson y Illius.1996). El uso de las plantas leosas en los sistemas de producciones agropecuarias, donde existe escasez de lluvias y recursos importados, este componente es esencial para la alimentacin y produccin de las cabras. La

337

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

planta cuenta con partes fundamentales que la componen, donde hojas, flores y frutos (vainas) en el caso de las leguminosas son altamente valiosas desde el puntovistanutricionalparalosrumiantesmenores(Hernndez,1986Hernndez Hernndez,2006).Lacabradebidoalamovilidaddesulabiosuperiorylalengua prensil, presenta una habilidad muy especial para capturar hojas muy pequeas aunenplantasqueposeenespinasypastos muycortos,porloqueescapazde seleccionar en forma muy exhaustiva su alimento (Franco et al., 2005). De tal forma, las cabras aceptan con mayor facilidad los sabores amargos por esta raznprefierenlaspartesdelcomponenteleosoenalgunasregionesdelmundo. En Mxico, especialmente en la Mixteca poblana se cuenta con un potencial forrajerodetipoleoso,desconocindoselaspartesdelaplantamsconsumidas del componente leoso en esa regin Mixteca. Objetivo: Conocer las principales partes de la planta que consumen las cabras y su origen con el componente leosopresenteenlaMixtecaPoblana.

MATERIALESYMTODOS TrabajorealizadoenelmunicipiodePiaxtla,dondecomprendilascomunidades deTehuaxtlayManinalcingopertenecientesalaMixtecaPoblana.Localizndose en los paralelos 1759 00 1812 30 latitud norte, con 9810 54 9821 36 longitud occidente (INEGI, 2000). Con altitud de 1180 msnm y con una precipitacinpluvialde350a800mm.Presentanselvabajacaducifoliaespinosay xerfita,matorralconizotesyvegetacindetipoarbreo arbustivaadems,de localizarse pequeas reas de bosque de encino y pastizales. Clima clido subhmedo con lluvias en verano y semiseco muy clido en poca de seca., alcanzando una temperatura promedio de 23C. Se utilizaron 15 unidades de produccin familiar (UPF) caprinas, 5 caprinos/UPF para el ramoneo de las plantas y partes consumidas (nombre comn o vulgar), tablaprensa (coleccin taxonmicayherborizacin),pastorgua,tijerasdejardineraycmarafotogrfica. Seempleoelmtododeobservacindirecta,elcualconsistienvisualizarlos5

338

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

marcadores (caprinos) durante el pastoreo (8:00 am. a 12:00 am.), para determinarlaplanta(ramillade20a25cm.)yparteconsumida(hoja,floryfruto), la cual se coloco en la tablaprensa, separando cada una de estas con papel peridico para su clasificacin taxonmica y herborizacin, en el herbario de la Escuela de Biologa de la BUAP. Abarco pocas de lluvia y seca (Febrero a Octubre del 2006). Se aplico estadstica descriptiva para: analizar parte de la planta consumida, componente leoso (nmero de bocados/hora/especie de planta y bocados/hora/parte de la planta) y valor forrajero otorgado por UPF. Se evalu por prueba de Duncan simple (ANAVA), todo esto con el paquete SPSS 10.0paraWindows.
RESULTADOS

Se encontr que la parte de la planta consumida por el ganado caprino, correspondiel35%parahoja,floryfrutosnomaduros,el22.5%loalcanzohoja, flor y vainas, disminuyendo el porcentaje para las otras partes restantes de la plantacomoseobservaenlafigura(1).
Figura1.Porcentajesdelaspartesdelaplantaconsumidasporlas cabrasenlaMixtecaPoblana.

5% 7,5% 2,5%5% 7,5%

5%

10%

22,5%

35%

Hojas Hojasyvainas Hojas,floryvainas Hojas,floryvainasconsemillas Floryvainas

Hojasyfruto Hojas,floryfruto Hojas,florysemillas Hojasyvainasconsemillas

Es importante sealar, que de los 9 grupos de las partes consumidas del componente leoso, los resultados arrojan el 86.6% de preferencia para la hoja,

339

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

probablementesedebaalestadofenolgicodelasplantasleosasperennesque estn presentes todo el ao en el rea de estudio. En cuanto al componente leoso, conformado por 40 plantas arbreoarbustivas que lo estructuraron, 8 plantassobresalieronporsupresenciayselectividadalconsumirlasenelreade pastoreoporlascabras(tabla1).
Cuadro1.Preferenciadelasprincipalesplantasysuspartesconsumidasporlascabrasen lareginMixteca. Nombrecientfico Nombrecomn BarbadeChivo Familia Parte consumida Tipodeplanta

Pithecellobium acatlense

Leguminosae

Hoja Vaina

Arbrea

Cubatablanca

Acaciapennatula
Pithecellobium

Leguminosae
Leguminosae

Vaina Hoja Vaina Cscara

Arbustiva Arbrea

Huamuchil

dulce

PalodeBrazil

Haemotoxylum brasiletto

Leguminosae

Hoja Flor

Arbrea

Pochotedesecas Rompebotas

Ceibaparvifolia Sennawislizenni. Var.Prenglei.

Bombacaceae Leguminosae

Fruto Hoja

Arbrea Arbustiva

Tehuistle

Acaciabilimekii McBridevar. robusta

Leguminosae

Hoja Vaina Cscara

Arbustiva

TlaxistleNegro

Amelanchir denticulata

Rosaceae.

Hoja Cscara

Arbrea

340

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Como se observa en la tabla 1, el 75% corresponde a la familia de las leguminosas, lo cual representa un importante banco de protenas por su valor nutricionalenelreadeestudio.Porltimo,laparteconsumida(bocadosdados) delasplantasvaloradascomoseobserva(tabla2),todasexpresansignificancaa excepcin de la cubata blanca (Acacia pennatula) y el pochote de secas (Ceiba

parvifolia).
Tabla2.Bocados/hdelaparteconsumidaenlasplantasporlascabrasdelasUPF. Indicadores Flor Plantas PalodeBrazil BarbadeChivo CubataBlanca Huamuchil Pochotede Secas Rompebotas Tehuistle TlaxistleNegro
b 0.0 c b 0.0 b a 28.0 a a 6.0 c 0.0 b 7.0 b 9.5 a 34.2 a 39.0

PartesdelaPlanta Fruto Hoja

ES

Significacin

3.37 3.84 2.18 3.61 2.05

* * NS * NS

0.0
b 0.0

10.6
b 21.5

0.0
a 34.2

0.0

8.8

0.0

3.12 3.71 3.53

* * *

0.0 0.0

16.2 6.38

31.3 30.3

Superndicesdesigualesindicandiferenciassignificativas(P<0.05)

DISCUSIN Las plantas son eminentemente en los sistemas de produccin caprina en la Mixteca Poblana,las nicas fuentes de alimentacinde vida silvopastoril, ya que hojas, flores, frutos verdes y vainas con semillas, las partes nutricionales del componente leoso para sustentar esta actividad pecuaria en Tehuaxtla y

341

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Maninalcingo.Lapresenciadeleguminosasensistemassilvopastorilespresentes en la Mixteca Poblana, son numerosas y forman ms del 35% del componente leoso (Hernndez et al., 2005). Sin embargo, Carrera y Cano (1969) al estudiar las plantas que consume el ganado caprino en las zonas ridas de Mxico, concluyen que la cabra tiene una tendencia a consumir especies arbustivas y retoos tiernos de plantas y que las gramneas son consumidas en cantidades limitadas aunque existan en suficiente cantidad contrariamente en Venezuela, Martnezetal.(1972)trabajandoconcaprinosdelcampoexperimentaldeLomade Len en una zona semirida del pas, observan que las gramneas fueron las plantas mayormente apetecidas por las cabras, a pesar de que no se menciona que partes de la planta fueron ms apetecidas en plantas leosas con menor consumo en esa regin. De tal forma, que el componente leoso presente en la Mixteca Poblana al consumirlo no es al azar sino preferido por diferentes sucesionesespacialesdelasleosasenelecosistemaestosefundamentaconla teoradeSantos(2001)alestablecerquelatomadedecisionesjerrquicadonde hacequeelganadoduranteelpastoreooramoneosedadelasiguientemanera: sitiodealimentacin,sitiosderamoneodentrodeunaunidaddepaisaje,especie deforraje,partesdelaplantaybocadofactoresquesesumancomo:topografa tamaodelaplanta,siesperenneono,ademsaqutipodebosquepertenece (DumantyGordn,2003HernndezHernndez,2006).

CONCLUSIONES

LasprincipalespartesqueconsumelascabrasenlaMixtecaPoblanason:hojas, flores y frutos no maduros, donde alcanzan hasta un 35% en este grupo. El componente leoso estuvo conformado por un 75% por leguminosas de las 8 plantas con mayor preferencia durante el estudio as mismo, la hoja alcanzo un 86.6% de las leosas consumidas donde se muestra una diferencia significativa paralaparteconsumidade0.0,9.5y39.0paraflor,frutoyhojarespectivamentea losbocadosdadosalaarbreabarbadechivo.

342

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

LITERATURACITADA

Carrera,C.yJ.CanoBlake.Plantasaprovechadasporelganadocaprinoenuna zona de matorral desrtico y su anlisis proximal. XI Informe de InvestigacindelITESM.Monterrey,Mxico.1969. Dumont, B Gordn, LI, 2003. Diet selection and intake whitin sites and across landscapes: Matching herbivore nutrition to ecosystem biodiversity. In t Mannetje, L RamirezAviles, L Sandoval Castro, C. KuVera, JC. (eds.) Proceedings of the VIth Internacional Symposium on the Nutrition of Hervibores(Yucatan,MX,UniversidadAutnomadeYucatan).p.173194. Franco F., G. Gmez, G. Mendoza, R. Barcena, R. Ricalde, F. Plata y J. Hernndez. 2005. Influence of plant cover on dietary selection by goats in theMixtecaregionofOaxaca,Mxico.J.Appl.Anim.Res.,27:95100. Hodgson, J. y. Illius, A.W. 1996. The Ecology and Management of Grazing Systems.Ed.CABInternational.Pp.131148. Hernndez, I.A. 1986. Ramoneo de las cabras en un bosque seco tropical: especiesconsumidasysuvalornutricional.Rev.Fac.Agron.,7(1):6471. HernndezHJE,FrancoGFJ,ContrerasJJL,PedrazaORM,ZamtizGJyHerrera HJG. 2005. Identificacin de las las principales plantas forrajeras de tipo arbreo y arbustivo consumidas por caprinos en la Mixteca poblana. Memorias del XXIXCongreso Nacional de Buiatra. 11 al 13 de agosto de 2005.Puebla,Pue. Hernndez, J. 2006. Valoracin de la caprinocultura en la Mixteca Poblana: socioeconoma y recursos arbreoarbustivos. Tesis Doctoral. Universidad deCamagey,Cuba. INEGI.2000.SntesisgeogrficadelestadodePuebla.Libroelectrnico.Mxico. Martnez,J.,G.Durand,J.Castilloy0.Garca.Preferenciayanlisisproximlen plantasconsumidasporelganadocaprinoenelcampoexperimentalLoma

343

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

de Len. Prog. Nal. lnv. Ovinos y Caprinos. Bol. lnf. No 2 (mimeo) MAC. Venezuela.1972. Santos,S.2001.Caracterizacaodosrecursosforrageirosnativosdasubregiaoda Nhecolandia, Pantanal, Mato Grosso do Sul, Brasil. Tese Doutorado em NutricaoeProducaoAnimal.Botucatu,SP,UniversidadeEstadualPaulista. 190p.

344

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(SMVZ 59)INMUNIZACION DE BOVINOS INTRODUCIDOS EN EL NORTE DE VERACRUZCONUNAVACUNAINACTIVADACONTRA Anaplasmamarginale IMMUNIZATION OF CATTLE IN NORTHERN VERACRUZ ANAPLASMA MARGINALE INACTIVATEDVACCINE WITH

1* 1 2 3 2 AlprezMF ,RosasPJ ,PreciadoTJF ,RiveraHV ,RodrguezCSD ,BarreraM 2 2 2 AI ,RojasRE yGarcaOMA 1

C. E.

La Posta, CIRGOC, INIFAP,

CENIDPAVET, INIFAP, 3EMVZ,

UniversidadVeracruzana email:alpirez.francisco@inifap.gob.mx*autorparacorrespondencia RESUMEN

Anaplasma marginale es un importante obstculo para el desarrollo de la


ganadera tropical, la ausencia de vacunas comerciales en Mxico limita la introduccindeganadodealtopotencialproductivoalaszonasendmicasaesta rickettsiaunavacunainactivadacontraA.marginalefueevaluadaen46bovinos originariosdeEstadosUnidosdeAmricaalserintroducidosenhatoscomerciales de la regin costera del Norte de Veracruz, 27 animales adicionales no fueron vacunados. Se estimo la respuesta inmune humoral de estos animales y se les dio seguimiento clnico durante un ao. La proteccin estimada en los animales vacunados fue de 100%, en contraste en los bovinos no vacunados se observ una mortandad atribuida a la rickettsia del 55% en este sentido se observ diferencia (p<0.5) en la respuesta inmune antes de la primera vacunacin y despusdelasegundavacunacin. INTRODUCCIN La anaplasmosis bovina es una enfermedad infecciosa no contagiosa producida por la rickettsia Anaplasma marginale que se caracteriza por ocasionar en los bovinos una anemia hemoltica extravascular sin hemoglobinuria. La distribucin de la enfermedad es mundial, pero es de mayor importancia en las zonas

345

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

tropicalesysubtropicales(OsornoyRistic,1977).Lasvacunasinactivadascontra

Anaplasma marginale en el mundo han tenido resultados variables (REDLAB,


1992) vacunas comerciales evaluadas en Amrica en los ltimos 50 aos fracasaron debido al deficiente proceso de purificacin de la rickettsia, acompaadasporelestimuloenlaformacindeisoanticuerpos,responsablesde una isoeritrolisis neonatal pronunciada o al enfrentarse al repertorio antignico diferentedelascepasnativasdecadapas(CONASA,1995,Figueroaetal.1999, de la Fuente et al. 2007). En los ltimos 15 aos nuestro grupo ha realizado importantes avances en la evaluacin de vacunas inactivadas de Anaplasma

marginalebajocondicionescontroladas(Orozcoetal. 2007).
Objetivo. EvaluarlaproteccinconferidaporunavacunainactivadacontraAnaplasma

marginaleenbovinosdealtoregistrointroducidosenhatoscomercialesen
eltrpicomexicano.

MATERIALYMTODOS Cuarentayseisbovinosde18mesesdelasrazasBrahaman,SuizoAmericanoy Beefmaster provenientes de Estados Unidos de Amrica fueron inoculados con una vacuna inactivada elaborada con dos cepas veracruzanas (Tlapacoyan y Medelln) de Anaplasma marginale otro grupo de 27 bovinos no recibieron la vacuna. Los animales vacunados se distribuyeron en 5 ranchos veracruzanos localizados en los Municipios de lamo, Coatzintla, Tamiahua, Tlapacoyan y Tuxpan(10,9,6,11y10bovinosrespectivamente)Losanimalesnovacunados seubicaronenranchosdeTuxpan(24bovinos)ydeTamiahua(3bovinos).Para la vacunacin se utilizaron dos dosis de 50 g de protena total de la rickettsia, empleando dos adyuvantes comerciales diferentes, en un volumen de 2 ml y aplicadas subcutneamente con unintervalo de 21 das. Se colectaron muestras desangredelosbovinosconagujasytubosalvacosinanticoagulanteantesde las dos vacunaciones y 28 das despus de la ltima las muestras fueron centrifugadas para obtener el suero y determinar la presencia de anticuerpos

346

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

contraA.marginalepormediodeunELISAconestepropsitoseutilizantgeno deA.marginaledelacepaYucatntratadocondodecilsulfatodesodioal0.1%, placasdepoliestirenodealtaafinidad,suerosaunadilucinde1:100,conjugado antiIgGbovinofosfatasaalcalinaycomosustratopnitrofenilfosfatolaslecturas delensayoserealizaronenunespectrofotmetroaunalongituddeondade405 nmlosvaloresseexpresarnenunidadesdedensidadptica(DO).

RESULTADOSYDISCUSIN Los animales vacunados no presentaron casos clnicos, ni muertes atribuidas a

Anaplasma marginale, en contraste en el grupo de animales no vacunados se


presentaron15defuncionescondiagnsticopresuntivodeanaplasmosis.Parala medicin de la respuesta inmune humoral se estim el promedio del ndice de positividad (i.p.) determinado por el promedio de los cocientes entre el valor de absorbanciadecadamuestraylaabsorbanciaalpuntodecorte(puntodecorte: suma del promedio de absorbancia del control negativo ms tres veces su desviacin estndar). Los valores promedio del ndice de positividad para los cuarentayseisanimalesvacunadosfueron0.57,0.66y0.78enlostresmuestreos en forma consecutiva, mostrando un incremento discreto de inmunoglobulinas G especficascontraA.marginale.Seencontrdiferenciaestadstica(p<0.5)entreel i.p. antes de la primera vacunacin y despus de la segunda vacunacin por la pruebatdeStudent(Daniel,2010)resultadossimilaresobservaronOrozcoetal, 2007 vacunando 16 bovinos Hereford a dosis de 50 y 100 g, tratando 2 de 16 animales vacunados en contraste con el tratamiento de 7 de los 8 animales no vacunados al ser desafiadosen una zonaendmica aA.marginale enel estado deChiapas.

347

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CONCLUSIN En los animales vacunadosla vacunaevitla muerte y cuadros clnicos severos deanaplasmosisbovinaenelaoposterioralavacunacincontrastandoconla defuncin del 55 % de los bovinos no vacunados en el semestre posterior a la vacunacin.

Estudio parcialmente apoyado por productores, INIFAP, PRECI 6216778P y CONACYT89484.

LITERATURACITADA

CONASA, 1995: Experiencias sobre el uso de vacunas contra Anaplasma

marginale En Cuarta Reunin Anualdel Consejo Tcnico Consultivo Nacionalde


SanidadAnimal.Mxico,D.F.:452467.

Daniel WW, 2010. Bioestadstica. Base para el Anlisis de las Ciencias de la Salud.LimusaWiley4edicin,Mxico.

DelaFuenteJ,RubialP,MtshaliMS,NaranjoV,Shuqing,MangoldAJ,Rodrguez SD,JimnezR,VicenteJ,MorettaR,TorinaA,AlmazanC,MbatiPM,TorioniAE, Farber M, Rosario RC, Gortazar Ch, Kocan KM. Anlisis of World strains of Anaplasmamarginaleusingmajorsurfaceprotein1repeatsequences.Veterinary Microbiology2007(119)382390.

FigueroaM.,J.V.CantA.,G.J.RamosA.,J.A.RojasR.,E.E.SantiagoV.,C. Granjeno C., G. Garca O., M.A.y Parrodi.,F., 1999: Evaluacin en condiciones decampodelavacunainactivadadeAnaplasmamarginaledenominadaPlazvax. VeterinariaMxico.30(3):221225.

348

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Orozco VLE, Rodrguez SD, Cant AGJ, Lpez FR, Jimnez OR, Garca OMA, PreciadoTJF,RojasREE,2007:Anaplasmamarginalefieldchallenge:Protection by an inactivated immunogen that shares partial sequence of msp1 variable regionwiththechallengestrain.Vaccine25:519525. Osorno B.M. y Ristic M., 1977: Anaplasmosis bovina, con nfasis en control, diagnstico,distribucindelaenfermedadenMxicoyusodelavacunaatenuada deA.marginale.VeterinariaMxico,UNAM,8:8589.

REDLAB (Red de cooperacin Tcnica entre Laboratorios de Investigacin y Diagnstico Veterinario).1992 Programa de Hemoparsitos. Inmungenos y mtodosdeinmunizacinparaelcontroldelaanaplasmosisybabesiosisbovina. GAN41 Organizacin de las Naciones Unidas para la Agricultura y la Alimentacin.Santiago:134

349

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

RESUMENES

350

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 01)Digestibilidad in situ de la materia seca de dos dietas y de dos esquilmosagrcolas

Insitudigestibilityofdrymatteroftwodietsandtwoagriculturalwastes

Viridiana Prez Montiel*, Marcos Prez Sato, Germn Buenda Rodrguez, Laura Salgado Rosas, Eutiquio Soni Guillermo, Marcelino Becerril Herrera, Ramiro EscobarHernndez,AbelFlixFloresGarrido,NumapompilioCastroGonzlez

BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA Correoelectrnico:viri_p_m@hotmail.com.*autorparacorrespondencia

RESUMEN

Con el fin de evaluar el efecto de una celulasa en la digestibilidad in situ de materia seca (DIMS) de dos dietas y dos esquilmos agrcolas (EA), se usaron cuatroborregasdelarazapelibuey fistuladas en rumen (40 kg PV) se utilizaron ochotratamientoscondosrepeticionescadaunoT1=Dietaconrastrojode maz sin enzima T2= Dieta con rastrojo de maz con enzima T3= Dieta con paja de cebada sin enzima, T4= Dieta con paja de cebada con enzima T5= Rastrojo de maz sin enzima, T6= Rastrojo de maz con enzima, T7= Paja de cebada sin enzimaT8=Pajadecebadaconenzima,losnivelesdeenzimafueron0y2g,los periodosdeincubacinfueron72,48,24y12h.Elanlisisestadsticoqueseus fueundiseocompletamentealazarconarreglofactorial2x2.LaDIMSdelosdos EA a la hora 48 del T6 fue diferente significativamente al T5 y T7 (80.17% vs 68.23% vs 65.53%, respectivamente). La digestibilidad in situ de las dietas a la hora 12 de la MS del T1 (45.18%) fue diferente significativamente (p=0.05) con respectoalT2(55.35%)yalT3(58.51%).Alas72helT1ladigestibilidadinsitu fue menor (71.91%) significativamente comparado con el T4 (82.77%) mientras

351

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

que el T3 (78.82%) no fue diferente significativamente al T4. Por lo tanto se concluyequelainclusindeunaenzimacelulasamejoraladigestibilidadinsitude lamateriaseca.

352

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 02)Utilizacin de un Adrenrgico vs Vasodilatador en el ComportamientoProductivoenOvinosdePelo Using a Adrenergic Vasodilator vs the Productive Performance of hair sheep

Ursula Andrea Macuil Priego, Marcos Perez Sato, Germn Buenda Rodrguez, Eutiquio Soni Guillermo, Marcelino Becerril Herrera, Ramiro Escobar Hernandez, AbelFlexFloresGarrido,NumaPompilioCastroGonzalez BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA Correoelectrnico:marcos.perez@correo.buap.mx*autorparacorrespondencia

RESUMEN En la presente investigacin se evalu el efecto de la utilizacin de un Adrenrgico(Clorhidrato de Ractopamina) y la respuesta de un vaso dilatador (Clorhidrato de Zildenafil) en el comportamiento productivo y microbiolgico de ovinos de pelo El experimento se realiz en el municipio de Tlatlauquitepec, Puebla, lugar en donde se encuentra la unidad experimental de la Benemrita Universidad Autnoma de Puebla se utilizaron 12 borregos cruza Katahdin Pelibuey con un peso promedio de 13.45 0.5 los cuales se distribuyeron en jaulasconcomederosybebederosindividualesbajoundiseocompletamenteal azar con tres tratamientos y cuatro repeticiones. Los tratamientos (T) experimentalesfueron:T1dietatestigo,T2dietaconClorhidratodeRactopamina adicionando el 0.15% a la dieta, T3 dieta con Clorhidrato de Zildenafil administrando 7 mg por animal. La comparacin de medias se realiz mediante unapruebateTukey.Paralaconcentracindeprotozoariosruminalesseutilizla Cmara de Neubauer. La concentracin de protozoarios y bacterias ruminales totales no presentaron diferencias significativas el consumo de materia seca (CMS)nofuediferentesignificativamenteentretratamientos(697.33vs716.81vs 800.93), mismo comportamiento mostr laganancia diaria de peso (GDP)(0.136 vs 0.169 vs 0.190). En cuanto al pH ruminal el comportamiento fue similar a lo reportadoenlaliteratura(6.49).Seconcluyequelautilizacindeunvasodilatador

353

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

vs un Adrenrgico no mejoran las variables productivas de borregos estos comparadosconeltratamientotestigo. Palabras clave: vasodilatador, Adrenrgico, protozoarios, comportamiento productivo.

354

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ03)Efectodeunacelulasaenelcomportamientoproductivodeovinos alimentadoscondosesquilmosagrcolas

Effectofcellulaseontheproductiveperformanceofsheepfedtwo agriculturalwastes Miguel Alejandro Cabrera Cruz*, Marcos Prez Sato, Marcelino Becerril Herrera, Eutiquio Soni Guillermo, Ramiro Escobar Hernndez, Numa Pompilio Castro Gonzlez,AbelFlixFloresGarrido

BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA Correoelectrnico:marcos.perez@correo.buap.mx.*autorparacorrespondencia

RESUMEN

Elobjetivodelapresenteinvestigacinfueevaluarelefectodeunacelulasaenel comportamientoproductivodeovinosalimentadoscondosesquilmosagrcolas,el experimento se llev a cabo en las instalaciones del modulo de ovinos perteneciente a la Facultad de Ciencias Agropecuarias y Forestales de la BenemritaUniversidadAutnomadePueblaubicadoenTlatlauquitepec,Puebla se utilizaron 20 borregos de la raza Katadhin Pelibuey distribuidos en 4 tratamientosconunpesopromediode20Kg.loscualessealojaronenjaulascon comederosybebederosindividuales.Lostratamientos(T)experimentalesfueron: T1rastrojodemazsinenzima,T2rastrojodecebadasinenzima,T3rastrojode maz con 2 g de enzima celulasa, T4 rastrojo de cebada con 2 g de enzima celulasacabesealarquelaenzimafueadministrada24hantesdeserofrecidaa los animales, se utiliz un modelo estadstico completamente al azar con arreglo factorial 2 x 2. En cuanto al consumo de materia seca (CMS) el T3 mostr diferencia significativa (P= 0.05) respecto a T1 y T2 (962.67 vs 1033.89 vs 1031.11g)nosiendoasenelT4(1001.11g),enlavariablegananciadiariade peso (GDP) no existieron diferencias significativas entre los tratamientos

355

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

experimentales, la concentracin de bacterias totales y de protozoarios tampoco mostraron diferencia significativa. Por lo tanto, la utilizacin de una enzima celulasaendietasparaborregosnomejorlosparmetrosproductivospromedios, sin embargo tampoco afect las variables microbiolgicas de inters en la produccinanimal. Palabrasclave:Fibra,TrychodermaLongibrachiatum,celuloltica,enzima.

356

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 04)Efecto del uso de maz (Zea mays), papa (Solanum tuberosum) y manzana(Maluspumila)comosuplementoalimenticiodeovejasalempadre.

Effectoftheuseofmaize(Zeamays),potato(Solanumtuberosum)andapple (Maluspumila)asanutritionalsupplementtobreedingewes.

BlancaSofaMurilloMartnez*,AgustnGonzlezAzpiroz,NumaPompilioCastro Gonzlez, Marcelino Becerril Herrera, Marcos Prez Sato, Ramiro Escobar Hernndez,EutiquioSonGuillermo BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA Correoelectrnico:numavet@hotmail.com *autorparacorrespondencia

RESUMEN

Lasituacinactualdelaactividadagropecuariarequieredesarrollodemtodosy tcnicas que permitan el uso racional y sostenido de los recursos, por ello se evalu el efecto del maz, la papa y la manzana utilizados como suplemento alimenticio en ovejas multparas cruzas de la raza katahdinDorper durante el empadre. La alimentacin consisti en proporcionar pastoreo en potreros compuestosporDactilisglomerataenun70%yTrifoliumrepensenun30%,los animales pastaron durante 6 horas al da y fueron suplementadas con 400 g en MS1decadaunodelosproductosaprobar(manzana,mazypapa).Seempleo un diseo completamente al azar, formando 3 tratamientos con 7 repeticiones cadauno.LostratamientosestuvierondistribuidosdelasiguientemaneraT1(n=7) ovejas suplementadas con Maz, T2(n=7) ovejas suplementadas con papa, T3 (n=7) ovejas suplementadas con manzana. El consumo de los suplementos no tuvodiferenciasp>0.5encuantoalagananciadepesoalempadre,sinembargo existidiferenciap<0.05paralavariableprolificidadsiendomejorT1,seguidode T3yenultimoterminoT2.Seconcluyequerecursoscomolamanzanaylapapa puedenserutilizadoscomoalternativasenlasuplementacindelosovinosenla

357

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

pocadeempadreyaqueseobtienebuenaprolificidadyabajocosto. Palabrasclave:flushing,prolificidad,maz,papa,manzana.

358

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ05)BloquesMultinutricionalescomoalternativadesobrealimentacin enlaltimaetapadegestacinenovejasdepelo

Multinutrient blocks as an alternative of overfeeding in the last stage of gestationinhairewes

Juan Carlos Soriano Martnez, Daro Cortez Rodriguez, Numa Pompilio Castro Gonzlez,MarcelinoBecerrilHerrera,AbelFloresGarrido,SonEutiquioGuillermo

BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA, Email:numavet@hotmail.com.*autorparacorrspondencia

RESUMEN

Resumen El objetivo del presente trabajo fue evaluar el consumo de Bloques Multinutricionales(BM)contresnivelesdeaglomerante(cal),comosuplementoy su efecto sobre el peso al nacimiento de los corderos. Se utilizaron 21 ovejas gestantescruzadeKatahdinPelibueymultparasconunaedadpromediode2.5 aos. La alimentacin consisti en el pastoreo por 6 horas al da en potreros compuestosdepastoDactilysglomeratacontiempodeocupacinde5dasy23 dasdedescanso,mas200gr.MSdeensiladodemaz,alimentocomercial500g MS y BM ad libitum, este ltimo se proporciono 15 das antes del parto, con un tiempodeadaptacinde5das.Lostratamientosfueron:T1(n=7)BMcon8%de aglomerante, T2(n=7) BM con 10% de aglomerante y T3(n=7) BM con 15% de aglomerante. El diseo experimental fue completamente al azar con tres tratamientosy6repeticiones.Paralaexistenciadediferenciasentremedidasse utilizounapruebadeTukey(P<0.05).Seconcluyequeexistidiferenciap<0.005 paraconsumoynohubodiferenciap>0.5parapesoalnacimiento.Enconclusin, el10% deaglomerante resulto ser el nivel recomendado enlos BM utilizados 15

359

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

dasantesdelparto,debidoaqueconestenivelseobtuvounconsumode0.188 g/da /animal y un peso al nacimiento de 4.48 kg. Y aun cuando no existi diferencia estadstica, numricamente fue mayor quelosotros dos tratamientos. Palabras clave: Bloques multinutricionales, Sobrealimentacin, peso al nacimiento.

360

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 06) Comparacin de dos anablicos no esteroidales en bovinos de engordaenpastoreo

Comparisonoftwoanabolicnosteroidsingrazingbeefcattle

Rebeca Hernndez Roque*, Marcelino Becerril Herrera, Marcos Prez Sato, Eutiquio Son Guillermo, Ramiro Escobar Hernndez, Numa Pompilio Castro Gonzlez,AbelFlixFloresGarrido

ESCUELA DE INGENIERA AGROHIDRULICA BUAP. BENEMERITA UNIVERSIDADAUTONOMADEPUEBLAEmail:mbh108@yahoo.com.mx.*autor decorrespondencia

RESUMEN

Mxicorequiereurgentementeincrementarlaproduccindecarnebovinaafinde abastecer la mayor proporcin de sta para el mercado nacional y as tratar de reducir las importaciones masivas. Las regiones tropicales del pas, cuentan con un gran potencial no solo para exportar sino tambin para producir y vender. El usodeImplanteshormonalesfavoreceeldesarrolloyfinalizacindebovinos,los hace ms eficientes, reducir los costos de produccin y da como resultado un producto ms acorde con las demandas de salud alimenticia de la poblacin. El presente trabajo se llevo a cabo en el rancho LA PURISIMA ubicado en el municipiodeSanJosAcateno,Puebla.Seutilizaran15toreteshbridosdivididos en tres grupos, a cada grupo se le asignara un tratamiento. Los tratamientos (T) sonlossiguientes.T1seleadministroacetatodetrembolona,aesteseleaplicoel implante de manera subcutnea en la oreja del animal, el T2 es con laurato de nandrolonaqueseinyectoenlatabladelcuelloyelT3fueeltratamientotestigo. Las variables a evaluar fueron las siguientes: Ganancia diaria de peso, costo beneficio.Seobservolaausenciadediferenciassignificativasentretratamientos,

361

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

es decir, el total de los animales estadsticamente presentan un crecimiento similar, sin embargo es importante mencionar quelos animales del grupo testigo presentanlosvaloresnumricosmselevados,locualesdebidoaquedesdeun principio eran ms pesados en comparacin de los otros tratamientos. No se observarondiferenciasestadsticasentretratamientosenlasvariablesanalizadas (P>0.05). Palabrasclave:Bovinos,pastoreo,anablicosnoesteroidales.

362

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 07) Crecimiento de ajolotes (ambystoma mexicanum), con dos tipos dealimento,enelmunicipiodePuebla,Pue.

Growthajolotes(ambystomamexicanum),withtwotypesoffoodinthecity ofPuebla,Pue.

Adrin Muoz Cuautle*, Marcelino Becerril Herrera, Marcos Prez Sato, Eutiquio Son Guillermo, Ramiro Escobar Hernndez, Numa Pompilio Castro Gonzlez, AbelFlixFloresGarrido.

BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA Email:mbh108@yahoo.com.mx.*autorparacorrespondencia

RESUMEN

El ajolote (Ambystoma mexicanum) es una especie endmica y de importancia biolgica,socialyeconmica,estaespecieesneotnica,facultadquelespermite reproducirse reteniendo la morfologa larvaria. Con el objeto de evaluar el crecimiento del ajolote (Ambystoma mexicanum) bajo dos tipos de alimentacin, se planteo la presente investigacin. Las unidades experimentales fueron 30 ajolotes, la distribucin de los ajolotes se realizo de manera aleatoria en dos tratamientos, proporcionando al primer tratamiento carne molida de res y al segundotratamientoalimentopeletizadoparatortuga(tortuguetas).Lasvariables aevaluarafueron:pesoinicial,pesofinal,gananciadepesoperidica,longituddel animal,valornutritivodelasdietasycuantificacindeloscostosdichasvariables se analizaron estadsticamente con una prueba de t para muestras independientes. Los resultados obtenidos indican que existen diferencias significativas (p<0.05), mostrando que existe un efecto del alimento suministrado sobre las variables evaluadas. Los ajolotes que se les proporciono carne molida

363

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

de res obtuvieron un mayor crecimiento, no as los que se alimentaron de (tortuguetas),elperiodoqueduroeltrabajodeinvestigacinfuede131das.La mortalidad que se presento es alta en ambos tratamientos siendo mayor en los ajolotesalimentadoscon(tortuguetas)conun73.4%yenlosajolotesalosque se les proporciono carne molida de res el porcentaje fue de 53.3%, la principal casademuertefuelametamorfosisseguidadesaprolegnosis.Loscostosdelos alimentoscomercialesresultanelevados,porloqueunadietavariadalosreduce. Palabrasclave:Ambystomamexicanum,ajolote,neotnica.

364

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 08) Infestacin de varroa destructor en coloniasde apis mellifera en lasierranororientaldelestadodePuebla Varroa destructor infestation on apis mellifera colonies in the northeastern sierraofthestateofPuebla Ricardo Alcaide Tlatenchi, Abel Felix Flores Garrido, Marcelino Becerril Herrera, Marcos Prez Sato, Ramiro Escobar Hernndez, Pablo Zaldivar Martnez, Numa PompilioCastroGonzlez

BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA Correoelectrnico:floresgaf@gmail.com*Autorparacorrespondencia

RESUMEN El objetivo de la presente investigacin fue evaluar el nivel de infestacin de Varroa destructor A & T., en una zona de clima clido (ZC) y una de clima templado (ZT) de la Sierra Nororiental del Estado de Puebla en dos grupos genticoshbridos: Apis mellifera crnica (CA) y Apis mellifera ligstica(LI), para ello, tanto en ZT como en ZC se identificaron dos apiarios comerciales. Cada apiario,estuvoconstituidopor10coloniasdelgrupogenticoCAy10coloniasdel grupogenticoLI,paradaruntotalde20coloniasporapiario.Losmuestreosse realizaronconbaseenundiseocompletamentealazarconcuatrotratamientosy diez repeticiones. Para determinar el nivel de infestacin, se utiliz la tcnica de lavado en solucin detergente. El anlisis de los datos se realiz en base a un arreglo factorial 2 X 2, considerando la zona climtica y el grupo gentico como factores.Noseencontrdiferenciasignificativaenlosnivelesdeinfestacinentre ZTyZC,aunquesiexistiunligeroincrementoenestaltima(7.34.5vs9.7 4.5).Encuantoalgrupogentico,noseobservarondiferenciasentreCAyLIcon valores de 8.5 3.7 y 8.5 5.5. Los niveles de infestacin encontrados en el presenteestudio,superanloestablecidoenlanormatividad,locualpuedeindicar, quelostratamientosnoestnsiendoaplicadosdelaformadebidaoenlapoca idneaparalograruncontrolefectivo. Palabrasclave.Infestacin,Varroa,destructor,crnica,ligstica.

365

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 09) Leguminosas nativas, una alternativa de alimentacin en el trpicomexicano Nativelegume,analternativeinthetropicsMexicanfood

Leonardo David Santiago Fernndez, Amalia Cabrera Nez, Diana Laura Daz Inocencio

UNIVERSIDADVERACRUZANA Correoelectrnico:fernandez_1110@hotmail.com*autorparacorrespondencia

RESUMEN EL trabajo contemplo el conocimiento local de especies arbreas forrajeras. Determinandolapresenciade65especiesempleadascomopostes,80sealadas como cerco vivo, con utilidad de sombra 72 especies, 21 de uso medicinal y 69 especies con uso alimenticio para el ganado. De las especies sealadas anteriormente, fueron seleccionadas 2 de la familia de las leguminosas, por su adecuada produccin foliar, rpido crecimiento y alta calidad nutritiva para el ganado:Leucaena(Leucaenaleucocephala),Cocuite(Gliricidiasepium),especies nativasdeltrpicomexicano.Lasplantasevaluadasfueronseleccionadasalazar. Los nutrientes evaluados mediante el anlisis qumico proximal fueron: materia seca(MS),protenacruda(PC),extractoetreo(EE),cenizas(C),fibracruda(FC) y total de nutrientes digestibles (TND).Y determinacin de la fibra detergente neutro (FDN) y fibra detergente acido (FDA) con la tcnica de Van Soest. Esta investigacin tuvo un diseo totalmente aleatorio, con cinco replicas. La composicin bromatolgica present variaciones sustanciales entre las especies ((P<0,05) indicando que Leucaena leucocephala, Morus alba y Gliricidia sepium (20,0%,23%y21%respectivamente),muestrancontenidosdePCmuysuperiores a los pastos tropicales de la regin y en varios casos tambin superior al de los concentradoscomerciales.

366

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 10) Efecto de de la raza sobre la calidad y conservacin del semen descongeladodetoro

Effecttheraceonthequalityandconservationofthawedsemenofbull

CrdovaIzquierdo*,XolalpaCamposVctorManuel,CortsSurezSal,Saltijeral Oaxaca Jorge Alberto, Ruiz Lnag Gustavo, Mndez Mendoza Maximino, Huerta Crispn Rubn, Villa Mancera Abel, Crdova Jimnez Cristian Alejandro, Jurez Mosqueda Ma. de Lourdes, Reyes Gama Ranulfo Snchez Aparicio Pedro, GutirezLianJosLuis,GuerraLieraJuanEuologio UniversidadAutnomaMetropolitanaUnidadXochimilco Correoelectrnico:acordova@correo.xoc.uam.mx.*autorparacorrespondencia

RESUMEN Laconservacindelacalidadespermtica,despusdelacongelacindelsemen, es de gran importancia para garantizar los porcentajes de fertilidad de los espermatozoides,cuandoserealizainseminacinartificial(IA).Elobjetivodeeste trabajo fue valorar el efecto de la raza y conservacin de la calidad espermtica (motilidad,viabilidadeintegridadacrosomal)delsemendescongeladodetoro.Se descongelaron 9 pajillas de 0. 5 ml de semen de toro Holstein y 9 de toro Brahman, se conservaron por dos horas a temperatura ambiente y se valor motilidad, viabilidad e integridad acrosomal (NAR). Los resultados fueron los siguientes:30%demotilidad,40%deviabilidady30%deNARenlarazaHolstein, En la raza Brahman se obtuvo 40% de motilidad, 50% de viabilidad y 40% de NAR. En conclusin, En conclusin, segn los resultados obtenidos de las variablesanalizadas,larazaBrahmanresultsuperiorencalidadespermticaque la raza Holstein sin embargo, los resultados de ambas razas cumplen con las normas mnimas de calidad espermtica para ser utilizadas en inseminacin artificial.

367

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ11)Efectodelacargaanimalenlacomposicinqumicadegramneas nativaseneltrpicohmedo Effect of stocking to the chemical composition of native grasses in the humidtropics Abel Flix Flores Garrido*, Epigmenio Castillo Gallegos, Jess Jarillo Rodrguez, RamiroEscobarHernndez,MarcosPrezSato,NumaPompilioCastroGonzlez

BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA Correoelectrnico:floresgaf@gmail.com.*autorparacorrespondencia RESUMEN Se estudi el efecto de la carga animal (CA): 2, 3 y 4 vacas ha1, sobre la composicinqumicadehojaytallodegramasnativasenlastrespocas(EP)del ao,antes(AP)ydespus(DP)delpastoreo.Seusoundiseocompletamenteal azarcondosrepeticiones,quefueronpastoreadaspor10vacasHolsteinxCeb durantetresdascon27derecuperacin.Losvaloresseexpresaroncomo%de la materia seca (MS). La CA no afect ninguna variable de respuesta en el componente hoja, tanto AP como DP, pero s afect el contenido de Fibra detergente cido (FDA) del tallo AP, difiriendo significativamente la carga baja (35.12.2%)delascargasmedia(31.82.3%)yalta(31.02.5%),sinquelas ltimas difirieran entre s. La variable protena cruda (PC) DP, se comport de manerasimilar,convaloresrespectivosde6.91.2,7.60.9y8.11.1%.LaEP afectsignificativamentetodaslasvariablesderespuesta,exceptolignina(LIG)en hojaAPyfibradetergenteneutro(FDN)DPeneltalloAP,LIGyDISMSnofueron afectados, entanto que DP, todaslas variablesfueron afectadas. En elpresente estudio, la poca y no la carga animal, fue el factor determinante de la calidad nutritivadelasgramasnativas. Palabras clave: carga animal, digestibilidad in situ, calidad nutritiva, gramas nativas.

368

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 12) Produccin y calidad nutritiva de cuatro ecotipos de cajanus cajan(l)millsp,enzonadecostamontaa

Productionandnutritionalqualityoffourecotypesofcajanuscajan(l)millsp inacostamountainarea

EloyLunaBarba,RamiroEscobarHernndez,JessJarilloRodrguez,AbelFelix Flores Garrido, Numa Pompilio Castro Gonzlez, Marcelino Becerril Herrera, MarcosPrezSato,EutiquioSonGuillermo BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA Correoelectrnico:lunbar30@hotmail.com*autorparacorrespondencia

RESUMEN El objetivo del presente trabajo fue evaluar la produccin y composicin qumica del follaje de Cajanus cajan. Enla zona de transicin costamontaa de la sierra madre oriental en el municipio de Jalacingo, Veracruz, Mxico. Se sembraron cuatroecotipos(Arroyopiedra,Filipinas,PalmillayTlapacoyan),distribuidosenun diseodebloquescompletosalazar,contresrepeticionesenparcelasde9.6m2, seestablecia0.30mentreplantasy0.80mentresurcos.Lacosechaserealiz 120 das despus de la siembra. Se evalu altura de la planta (AP), rea foliar (AF), nmero de ramas primarias y secundarias (R1 y R2), pecolo (RMSP) y foliolo (RMSF) rendimiento de materia verde (RV) y calidad nutricia (CA) de los componentes foliolo y pecolo. Los resultados indican diferencias (P<0.05) para AP, R1, R2, RMSP, RMSF y en RV, siendo el ecotipo Filipinas el que super al restodelosecotipos.Lacomposicinqumicafuesimilarenfolioloypecolodelos cuatroecotipossinmostrardiferencias(P>0.05).Losresultadosregistradostanto por su produccin como por su calidad nutricia, sugieren a los cuatro ecotipos comoaceptablesparasistemasdeproduccinanimaldeestazona. Palabrasclave:C.cajan(L.)Millsp.,forraje,rendimiento,calidadnutritiva.

369

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 13) Evaluacin de dosis de Clorhidrato de Ractopamina en el comportamientoproductivodepollosentapadeiniciacinengorda Evaluation of doses of ractopamine hydrochloride on the productive performanceofchickensinfatinitiationstage Guadalupe ChilacaCuateco, Eutiquio SonGuillermo, Germn Buenda Rodrguez, Marcos PrezSato1, Marcelino BecerrilHerrera1, Ramiro Escobar Hernndez1,AbelFelixFloresGarrido,NumaPompilioCastroGonzlez FACULTADDECIENCIASAGROPECUARIASYFORESTALES Correoelectrnico:zagitario27@hotmail.com*autorparacorrespondencia RESUMEN El sector avcola busca una disminucin en los costos productivos y mejorar los rendimientos. Uno de los mtodos no genticos es el uso adrenrgicos. El objetivodeesteexperimentoconsistienevaluarelefectodelniveldeclorhidrato deractopamina(RAC)endietasparapollos,paravalorarlaefectividadsobrelos parmetros productivos de esta especie. Se evalu el efecto de tres niveles de RAC(0ppm,8ppm,10ppm)enpollosenlasetapasdeiniciacinfinalizacin,en los parmetros productivos, calidad y rendimiento de la canal se usaron 120 pollosHubbarddecincodasdenacidos,distribuidosenundiseocompletamente al azar(40 pollos por tratamiento). Los tratamientos (T) fueron: T1=0 ppm, T2=8 ppm, T3=10 ppm de RAC. Los resultados indican que el consumo de alimento (1.317g, (1.238 y 1.164), ganancia depeso (0.439g, 0466g y 0.362g) conversin alimenticia no present diferencias (P=0.05) entre los tratamientos de RAC y el testigoenlasdosetapasdurantelafaseexperimental.Encuantoarendimientode la canal no hubo diferencias (P=0.05) en ninguno de los tratamientos (77.26%, 74.46%y78.17%),sinembargo,enelparmetrotemperaturadelacanalpresent diferencias (P<0.05) disminuyendo en el T3 respecto a los otros tratamientos (30.85,29.93y25.67b).Porloqueseconcluyequeelusodenivelesde8y10 ppm de RAC no afecta las variables productivas y el rendimiento de la canal, variandosolamenteelparmetrodetemperaturacon10ppm. Palabras clave: adrenrgico, Clorhidrato de Ractopamina, pollos, iniciacin finalizacin.

370

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 14) Respuesta productiva con diferentes niveles y tamaos de fibra enconejosNuevaZelanda Productive response and sizes with different levels of fiber in New Zealand rabbits Imelda Hernndez Jimnez, Eutiquio SonGuillermo*, Germn Buenda Rodrguez, Marcos PrezSato, Marcelino BecerrilHerrera, Ramiro Escobar Hernndez,AbelFelixFloresGarrido1,NumaPompilioCastroGonzlez Institucin:BENEMERITAUNIVERSIDADAUTONOMADEPUEBLA Correoelectrnico:soniguillermo@hotmail.com*autorparacorrespondencia

RESUMEN Se evalu el efecto de dos niveles de fibrade inclusin enla dieta (12 y 14%) y tres tamaos de partcula (4, 8 y 12 mm), en el comportamiento productivo de conejos Nueva Zelanda en engorda. Se utilizaron 36 conejos machos de raza NuevaZelanda,conunaedadpromediode45dasyunpesopromediode710 90g.Laalimentacinyaguaproporcionadaalosanimalesfueadlibitumconun perodopreviodeadaptacinalasdietasdetresdas.Eltotaldelosanimales,se distribuy en base a un diseo completamente al azar con arreglo factorial 2x3 donde el factor A fue el nivel de fibra y el factor B tamao fibra, con seis tratamientos y seis repeticiones cada uno. Los resultados indican que hubo diferencias(P=0.05)porefectodelniveldefibraytamaodefibraylainteraccin entrelosdosfactoresenlasvariablesrespuestaconsumodealimento(T10.910 vsT20.993vsT31.23vsT41.12vsT50.968vsT60.898),gananciadepeso(T1 0.2016 vsT2 0.2283 vs T3 0.1250 vsT4 0.2050 vsT5 0.2166 vs T6 0.2050) , conversinalimenticia(T15.7vsT25.1vsT39.5vsT45.3vsT54.6vsT64.7)y eficienciaalimenticia(T10.22vsT20.23vsT30.04vsT40.20vsT50.22vsT6 0.22),encontrndoselamejorrespuestaenlostratamientosT2yT5. Palabrasclave:fibracruda,tamaodepartcula,adlibitum.

371

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 15) Niveles de inclusin de levadura saccharomyces cerevisiae en dietasparapolloenperiodosdeiniciacinengorda Inclusion levels of yeast in diets for saccharomyces cerevisiae chicken periodsinitiationfattening

EutiquioSonGuillermo,AnaElviraCarmonaflores,MarcosPrezSato,Marcelino BecerrilHerrera, Ramiro EscobarHernndez, Abel Felix FloresGarrido1, Numa PompilioCastroGonzlez1,PabloZaldivarMartnez1,

ESCUELADEINGENIERAAGROHIDRULICABUAP Correoelectrnico:soniguillermo@hotmail.com*Autorparacorrespondencia

RESUMEN La levadura Saccharomyces cerevisiae, es una de las ms usadas, por sus caractersticas protenicas (4045 %) y por ser abundante en vitaminas del complejo B, como biotina, niacina, cido pantotnico, tiamina, entre otras. La presente investigacin tuvo como objetivo evaluar la inclusin de dos niveles de levadura en dietas para pollos en etapas de iniciacinengorda. Se utilizaron 90 pollos de la lnea comercial Ross x Ross de cinco das de edad, los cuales se distribuyeronenundiseocompletamentealazarentrestratamientos,contreinta repeticiones cada uno, los tratamientos fueron: T1=dieta basal (sin levadura) T2=dieta basal +0.2 % de levadura y T3 =dieta basal +0.4 % de levadura. Los resultados muestran que no hubo efecto de los tratamientos (P>0.05) con los diferentes niveles de levadura en dietas para pollos en las variables productivas consumo de alimento (340.14 g, 287.955 y 341.381), ganancia diaria de peso (421.333, 321.348 y 406.048), conversin alimenticia (1.061, 1.063 y 1.060), y eficiencia alimenticia (1.090, 1.022 y 1.083). Por lo que se concluye que es importante seguir evaluando niveles de levadura Saccharomyces cerevisiae ms elevadosparaencontrarelnivelptimoproductivo. Palabras clave: Pollos iniciacinengorda, dietas, levadura Saccharomyces cerevisiae.

372

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 16) Evaluacin organolptica en queso fresco adicionado de lactoprotenas Organolepticevaluationoffreshcheeseaddedwithlactoproteins PatriciaMoraMedina,JuanDaviddelaOAlbarrn,JosDoblerLopz,Marcelino EvodioRosasGarca FACULTADDEESTUDIOSSUPERIORESCUAUTITLNUNAM Correoelectrnico:mormed2001@yahoo.com.mx*autorparacorrespondencia RESUMEN Se evalu el grado de aceptacin de los consumidores sobre las caractersticas organolpticas en 4 quesos frescos elaborados con adicin de lactoprotenas sricas a diferentes concentraciones. Para ello, se procesaron 4 lotes de queso frescotipopanelatestigoy4quesosexperimentalesconadicindelactoprotenas en la cuajada a concentraciones de 25%, 50%, 75% y 100%. Los quesos experimentalesobtenidosfueronpesadosycomparadosconsurespectivotestigo. En ambos casos se evaluaron las propiedades organolpticas: aspecto general, sabor, textura, color y olor. Se seleccionaron aleatoriamente 23 personas de la comunidadparaladegustacin,conloscriteriosdeinclusin:declararencontrarse en perfecto estado fsico, sin presentar enfermedades respiratorias y sin haber consumido alimentos o medicamentos previos al estudio. Fue proporcionado un trozo de queso (experimental y testigo) y una cdula para recabar datos con las diferentes categoras en que se calificara cada caracterstica organolptica estudiada.Entrecadadegustacinsehizoundescansode5minutosyseenjuag la boca con agua purificada. Los resultados fueron analizados en porcentaje de aceptacin segn concentracin de protenas aadidas al queso fresco. Se concluyequeamayorcantidaddelactoprotenasagregadasparaelaborarqueso tipo panela, mayor ser su rendimiento, as como su retencin de agua, pero el quesoexperimentalmejorevaluadoporlosconsumidoresfueelquepresentuna concentracin de protenas sricas del 50% con equivalente de 200g, ya que a mayor concentracin de lactoprotenas las caractersticas organolpticas sabor y consistenciaseafectandemaneranegativa.

373

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 17) Seguimiento al cumplimiento total de los requisitos higinico sanitariosenunaplantaqueprocesabarbacoaenelestadodeMxico Total compliance monitoring of sanitary requirements in a barbecue processingplantatthestateofMxico

MaraGuadalupeGalvnOrozco,PatriciaMoraMedina,MarcelinoEvodioRosas Garca

FacultaddeEstudiosSuperioresCuautitln,UNAM Correoelectrnico:lupita_macu@hotmail.com*autorparacorrespondencia

RESUMEN El objetivo fue dar seguimiento al cumplimiento de las condiciones higinico sanitariasdeunestablecimientoqueprocesabarbacoa.Seintegrarondocumentos de higiene aplicables durante la fabricacin de alimentos inocuos y sobre la normatividad sanitaria vigente para elaborar una cdula para realizar la verificacin sanitaria. Se llev un muestreo bietpico al azar, considerando semanas y en una segunda etapa aleatoriamente se seleccion el da para recabar la informacin. Levantndose 4 encuestas distribuidas a lo largo de 6 meses. Las observaciones se calificaron como 0=No Cumplimiento, 1=CumplimientoParcialy2=CumplimientoTotal.Losresultadosdelacalificacin obtenida entre el 1er y 4to muestreo indicaron un avance de 1.68 a 1.81 de cumplimientototalalanormativaysereportaroncomoporcentaje.Calificandoel avance,elmejorresultadofueparapersonalcon61.5%haciacumplimientototal, mientrasmateriaprima,equipoycontroldeplagassemantuvieronsincambio.El segundo muestreo mejor el cumplimiento total en el rubro personal (26.9%). El porcentaje de no cumplimiento hacia cumplimiento parcial o total se increment para personal en 9.9%, control de plagas 5.6% y producto terminado 4.1%. La calificacin global obtenida en cumplimiento total en los 7 rubros estudiados en esteestablecimiento,alfinalizarel4tomuestreofuealta(1.81).Sedemostrque elrubrodepersonalincrementensucumplimientototalalanormativadesdeel

374

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

2do.muestreo.Sedebercontinuarcorrigiendolasnoconformidadesdetectadas con calificacin de 0 y 1, para cumplir totalmentelas exigencias normativas para nuestromercadointerno.

375

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 18) Diagnstico de situacin sanitaria, segn normatividad vigente, enunestablecimientoqueprocesabarbacoaenelestadodeMxico Diagnosis of health status, according to existing regulations, in a barbecue processingfacilityatthestateofMxico

1 MaraGuadalupeGalvnOrozco* ,MarcelinoEvodioRosasGarca 2, Patricia 1 MoraMedina

Departamento de Ciencias Pecuarias. 2Departamento de Ciencias Biolgicas. FacultaddeEstudiosSuperioresCuautitln,UNAM.Km2.5CarreteraCuautitln Teoloyucan, San Sebastin Xhala, Cuautitln Izcalli, Estado de Mxico. CP. 54714.Email:lupita_macu@hotmail.com* autorparacorrespondencia Telfono:01556231992. Fax:01558705665 RESUMEN Se evalu el cumplimiento de la normativa sanitaria aplicable en una planta procesadora de barbacoa, para esto se llev a cabo la bsqueda, recopilacin y anlisisdocumentalrelacionadoconlahigieneaplicablesdurantelafabricacinde alimentos inocuos y sobrela normatividad vigente. Se elaboruninstrumento de captura con 342 reactivos sobre materia prima, instalaciones, equipo, personal, proceso,productoterminadoycontroldeplagas.Durante6mesesselevantaron4 encuestas obteniendo el da de recopilacin de datos a travs de un muestreo bietpico al azar. Las observaciones del establecimiento fueron calificadas como 0=No Cumplimiento, 1=Cumplimiento Parcial y 2=Cumplimiento Total. Los resultados del cumplimiento a la normativa demuestran que la planta cumple totalmenteconlanormatividadenun81%parcialmenteen13%ynocumpleen un6%.Losmejoresporcentajesdecumplimientototalcorrespondieronaproceso (96%), mientras que el de cumplimiento parcial perteneci al personal (24%). Finalmente el porcentaje ms elevado de no cumplimiento correspondi a personal (9%) y producto terminado (9%). An cuando el porcentaje de

376

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

cumplimientototaldelanormatividadsanitariavigenteenesteestablecimientoen los 7 rubros estudiados fue alta (81%), faltan algunos por cumplir que no se consideran graves con respecto a la inocuidad de los alimentos (cumplimiento parcial), pero en el caso del No cumplimiento, se debern tomar medidas para corregirlosyaquepodrahaberrepercusionesnegativassobrelainocuidaddela barbacoa que se procesa en la planta poniendo en riesgo la salud de los consumidores. Palabrasclave:Diagnstico higinicosanitario, Situacinnormativa,Barbacoa.

377

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 19) Comparacin del peso y el rendimiento de la canal de ovinos Columbiaalimentadoscondietascomercialesydietasintegrales ComparisonofweightandyieldofColumbiabreedsheepcarcassesfedwith commercialdietandintegraldiet

Marco Polo Reyna Ziga*, Gabriela Tello Cristiany, Andrs Cardona Leija, MarcelinoEvodioRosasGarca,PatriciaMoraMedina.

FacultaddeEstudiosSuperioresCuautitln,UNAM.Email:krlin05@hotmail.com. *autorparacorrespondncia.

RESUMEN Se evaluaron dos dietas: integral balanceada (DIB) forrajes y granos y dieta comercial (DC) granos sobre peso al sacrificio (PS) y rendimientos de canal (RC) en 20 ovinos Columbia asignados al azar a cada tratamiento. Los ovinos fueroncomplementadosenpastoreodurante8horasyaguafrescaalibreacceso. Lascanalesobtenidassepesaron,serefrigerarondurante24horas,paravolvera ser pesadas. Se tom peso vivo en granja (PVG), peso vivo al sacrificio (PVS), peso de canal caliente (PCC), peso de canal fra (PCF), rendimiento ganadero (RG), rendimiento en matadero (RS) yrendimiento comercial(RC). Seevaluaron utilizando el modelo lineal con efectos fijos de cada dieta, el sexo (macho y hembra)ylainteraccindeprimerordenentreestosfactores.Seanalizmediante cuadradosmnimosutilizandomodeloslinealesgeneralizadosdelpaqueteSAS.El sexo tuvo efecto significativo sobre el PVG (P=0.07), PVS (P=0.04), PCC (P=0.002), PCF (P=0.01), RG (P=0.05) y RS (P=0.007). Los otros factores no tuvieroninfluencia sobrelas caractersticas evaluadas(P>0.05). Se encontr que PVGyPVSfueronmayoresenmachosconDClashembrasobtuvieronmenores pesos con ambas dietas (P<0.07). Machos alimentados con DCy DIB mostraron mayores valores de PCC y PCF las hembras tuvieron menores pesos (P<0.05). Machos que consumieron DI y DC tuvieron mayor RS que hembras alimentadas

378

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

con DC (P<0.03). Concluyndose que ovinos alimentados con Dieta Integral Balanceadapresentanpesosyrendimientosdecanalsimilaresalosobtenidospor aquellosalimentadosconDietaComercial.

379

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ20)Mezclasdepastosysuinfluenciaenlaproduccindeforraje Grassmixturesanditsinfluenceonforageyield

JavierCastilloHuchim,FernandoRivasPantoja,LuisOrtegaReyes INIFAPCAMPOEXPERIMENTALMOCOCH Correoelectrnico:castillo.javier@inifap.gob.mx*autorparacorrespondencia

RESUMEN Losobjetivosdeltrabajofuerondeterminar1)lainfluenciademezclasdepastos enlaproductividadtotaldelapraderay2)siladiversidadgenticadeespeciesen mezclas, aminora el efecto crtico de la estacin seca. El estudio se realiz a temporalenelsitioexperimentalTizimnINIFAP,enTizimn,Yuc.,durante2009y 2010.LaspraderasseconformaronconlospastosLlaneroTuntun(Andropogon gayanus), Mombaza (Panicum maximum) e Insurgente (Brachiaria brizantha), sembrados en proporciones de 25%, 50% y 25% (mezcla 1), 25%, 25% y 50% (mezcla 2), 50%, 25% y 25%(mezcla 3),respectivamente y Tanzania (Panicum maximum) en monocultivo las praderas se evaluaron durante la poca de seca, lluvias y nortes. Se cuantific altura de planta (cm), proporcin de hoja (%), cobertura basal (%) y produccin (kg MS ha1). Los datos se sometieron a un anlisis de varianza con medidas repetidas en tiempo, en un diseo de bloques completos al azar y arreglo bifactorial, con 4 repeticiones. Medias mnimo cuadrticas se compararon por pruebas de t pareadas (P=0.05). Las diferentes proporciones de los pastos, resultaron con rendimientos similares (P>0.05) a los del monocultivo sin embargo, la cobertura basal fue superior (P<0.05) en las mezclas1y2(71%)comparadoconelmonocultivo(46%).Ladiversidadgentica de las especies evaluadas, no prolong altos rendimientos durante la estacin seca la distribucin de la materia seca se asoci significativamente a los regmenes de humedad prevalecientes. Se sugiere continuar los estudios de mezclasdegramneas,explorandonuevosmaterialesgenticos. Palabrasclave:mezcladepastos,pocadelao,rendimientodeforraje.

380

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 ABSTRACT

This researchinvestigated 1) theinfluence of mixed grasses on total forage yield and2)ifthegeneticgrassvariabilitywithinthemixedgrassesovercomethecritical dry season effects. The study was carried out at the TiziminINIFAP research center, located in the Yucatan peninsula, Mexico. Pastures of Llanero Tuntun (Andropogongayanus),Mombaza(Panicummaximum)andInsurgente(Brachiaria

brizantha), planted at 25%, 50% y 25% (mixed pasture1), 25%, 25% y 50%
(mixed pasture2), 50%, 25% y 25% (mixed pasture3) and Tanzania grass (Panicummaximum)asmonoculture.Thepasturesweresampledondryseason, rainy season, and the interface between rainy season and the dry season called nortes.Plantheight(cm),leafrate(%),plantcover(%)andtotalforageyield(kg
1 MSha )wererecorded.RepeatedmeasurementsANOVAoftheeffectsofpasture

and developmental stage was performed in RCBD, with four replicates least squares means were compared using ttests (SAS Inst., 1996). No differences (P>0.05)werefoundontotalforageyieldamongpastureshowever,plantcoveron mixed grass 1 and 2 (71%) was significantly greater(P<0.05) when compared to monoculture plant cover (46%). The grass species genetic diversity did not extendedtotalforageyieldacrossallseasonsforageyieldwasgreaterduringthe wetseason.Inthetropics,morestudiesonmixedgrassesareneeded,introducing newgeneticplantmaterials. Keywords:mixedgrasses,seasonsoftheyear,forageyield.

INTRODUCCIN

En Yucatn aproximadamente 486 mil hectreas estn cubiertas con praderas sembradas en monocultivo (INEGI, 2009). La mayor parte de esta superficie se encuentra sembrada con los pastos guinea (Panicum maximun Jaquin), estrella de frica (Cynodon plectostachyus Vanderyst) e insurgente

(BrachiariabrizanthaRichardStapf).

381

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

La decisin de establecer praderas mixtas va ms all del slo hecho de aumentarelrendimientodeforraje,incorporarespeciesquepermitanunamejor distribucinanualdelaproduccindeforraje, mejorarelvalornutricionaldela dieta, aumentar la persistencia de la pradera en el tiempo y lograr una combinacinqueposeaunadeterminadaresistenciaainsectosyenfermedades (Lopetegui,2002).

El rendimiento de praderas sembradas en mezclas, ha demostrado ser superiorasiembrasdeespeciesestablecidasenmonocultivo.VanAukenetal. (1994), obtuvieron un rendimiento mayor de forraje en brownseed paspalum (PaspalumplicatulumMichx.)enmezclasqueenmonocultivoyobservaronque el rendimiento de little bluestem [Schizachyrium scoparium (Michx.) Nash], y brownseedpaspalumfuemayorcuandoestospastosfueronsembradosenuna mezcla,quecuandosesembraronporseparado.

En Yucatn Castillo et al. (2003) y (2005) lograron obtener mayores rendimientosdeforraje(entre4.2y6.2.0t/ha)enmezclasdeLlanero,Guineae


2 Insurgente,enproporcionesde(25+25+50)endensidadde20y40SPG/m y

de (25+50+25) en densidad de 40 SPG/m2 respectivamente, comparadas con


1 los monocultivos de Llanero y Guinea (<2.7 t/ha ). Con respecto al valor

nutricional, Castillo et al., (2004) obtuvieron los mximos valores de protena cruda (PC) (entre 6.3 y 8%) que correspondieron a Guinea en monocultivoen
2 densidad de siembra de 20 y 40 SPG/m , y las mezclas en proporciones de 2 (25+25+50)y(25+50+25)con20SPG/m respectivamente,alcompararloscon

elmonocultivodeLlanero(4.6%PC).Encuantoalcontenidosdefibraneutro detergente(FND)reportaentre63.9y75.9observadoenGuineaeInsurgentey
2 la mezcla (25+50+25), sembrados con 20 y 40 SPG/m al compararlos con 2 Llaneroseincrementade76.9a80.6%con20y40SPG/m .

382

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Seplanteaelsiguienteobjetivodeterminar1)lainfluenciademezclasdepastos enlaproductividadtotaldelapraderay2)siladiversidadgenticadeespeciesen mezclas,aminoraelefectocrticodelaestacinseca.


MATERIALESYMTODOS

LaspraderasseconformaronconlospastosLlaneroTuntun(Andropogon

gayanus), Mombaza (Panicum maximum) e Insurgente (Brachiaria brizantha),


sembrados en proporciones de 25%, 50% y 25% (mezcla 1), 25%, 25% y 50% (mezcla 2), 50%, 25% y 25%(mezcla 3),respectivamente y Tanzania (Panicum

maximum)enmonocultivo.Elestudiosedesarrollencondicionesdetemporalen
el Sitio Experimental TizimnINIFAP, en Tizimn, Yuc. En las praderas, la productividadfueregistradaenlaspocasdelluvias(agostooctubre2009yjunio julio 2010), nortes (noviembre enero 2010) y seca (febrero mayo 2010), con cortes cada30,45 y60 das, respectivamente. Las variables cuantificadas fueron
1 alturadeplanta(cm),rendimiento(kgMSha ),proporcindehoja(%)ycobertura

basal (%). La altura se midi (cm) desde el suelo hasta la hoja bandera de la planta sin estirarla. El rendimiento de forraje, se determin cosechando todo el
2 forrajepresenteenlaparcelatil(7.2m )esteforrajesemezclyseselecciono

unamuestrade500gquefuepesado,antesydespusdesecarseenunaestufa, concirculacindeaireforzadoa60Cdurante48h,posteriormentelasmuestras sepesaronparacalcularelporcentajedemateriasecaporparcela.Conrespecto alporcentajedehoja,lamuestraqueseobtuvoseseparensucomponentede hoja se tomo como hoja solamente la lamina expuesta sin considerarla lgula y vaina. Esta muestra fue secada en estufa a 60C durante 48 horas para determinarelpesoseco.Lacoberturabasal(cm)delpastoseregistroantesdela cosechadelforraje,paraestoseutilizaronlasdoshilerascentralesdelaparcela til,elcualtuvounalongituddetresmetros.Losdatossesometieronaunanlisis de varianza, con diseo de bloques al azar y arreglo bifactorial 3 x 4 (poca x pradera), con 4 repeticiones por tratamiento. Medios mnimos cuadrticos se compararonporpruebasdetpareadas,al5%deprobabilidad.

383

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 RESULTADOSYDISCUSIN

La altura y porcentaje de hoja vari (P<0.05) entre tipos de pradera y pocasdelaoyseevidenciunainteraccinentreambosfactoresparacadauno delostratamientos.(Cuadro1).

Alturadelaspraderas

Cuadro1:Alturadeforrajeenpraderasmixtasymonocultivosentrespocasdel ao.
pocasdelao Tipodepradera Lluvias Nortes Seca

Mezcla1 Mezcla2 Mezcla3 Tanzania


A,B,C

Altura,cm

54.8ABa 47.9Ba 39.1Ca 60.6Aa

41.8Bb

31.2Bc

44.3ABa 38.0Ba 50.0Ab

29.6Bb 28.5Bb 44.1Ab

:Mediascondistintasliteralesenlamismacolumnasondiferentes(P<0.05). Mediascondistintasliteralesenlamismahilerasondiferentes(P<0.05).

a,b,c:

Entrepraderas (Cuadro1)lamayoraltura(P<0.05)seencontrenelpasto Tanzaniaylamezcla1(58cm)comparadoconlamezcla3(39cm)enlapoca delluviaslaalturafuesuperior(P<0.05)enelpastoTanzaniaylamezcla2(50.0 cm),comparadoconlasmezclas1y3(40cm)paralapocadenortesTanzania aligualqueenlasdospocasanteriorestuvounamayoraltura(44cm),respecto alasmezclas1,2y3(30cm)paralapocaseca.

Entre pocas, la Mezcla uno (Cuadro 1).present una respuesta (P<0.05) descendentedelluvias,anortesyseca,convalores54.8a31.2cm.Lasmezclas 2 y 3, fueron superiores (P<0.05) en las pocas de lluvias y nortes (44 cm)

384

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

respectoalapocaseca(29cm).Tanzaniareportlamayor(P<0.05)alturaen lluvias con 60.6 cm, respecto a las pocas de norte y seca, con promedio de 47.1cm.

Rendimientodeforraje

Solamenteseencontrefectodepocapararendimientodemateriaseca. Las diferentes proporciones de los pastos, resultaron con rendimientos similares
1 (P>0.05)conpromediode3215kgMSha (Cuadro2).

1 Cuadro2.Rendimientodeforraje(kgMSha )enpraderasmixtasymonocultivo.
1 kgMSha *

Tipodepradera Mezcla1 Mezcla2 Mezcla3 Tanzania


a,b,c:

2958a 2800a 3582a 3520a

Mediasconlamismaliteralenlamismacolumnasoniguales(P>0.05). *:Promediodelascuatropocasdelao.

Los valores observados son superiores a los reportados en suelos litosol por Noh (2008) al evaluar 7 pastos en monocultivo y dos mezclas, sin encontrar diferencia(P>0.05)entrelosmismos,deloscualesTanzaniaylasMezclas1y2 incluidosentreellos,con promediogeneraldecuatropocasdelaocon2040kg
1. deMSha

Las praderas mixtas y monocultivos (Cuadro 3) obtuvieron diferentes valores durante el ao (P<0.05). La diversidad gentica de las especies evaluadas,noprolongaltosrendimientosdurantelaestacinseca,ladistribucin

385

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

de la materia seca se asoci significativamente a los regmenes de humedad prevalecientes.


1 Cuadro3.Rendimientodeforraje(kgMSha )enpraderasmixtasymonocultivoencuatro

pocasdelao. pocasdelao Lluvias Nortes Seca


1* kgMSha

6136a 2277b 1232b

a,b,c:

Mediascondistintasliteralesenlamismacolumnasondiferentes(P<0.05). *:Promediodecuatrotratamientos.

Losvaloresobservadosparalapocasecaenestetrabajosoninferioresa losreportadosporArcos(2007),queincluyecomopocacrticadelaoinviernoy primavera, cuando evalu forraje antes del pastoreo de praderas mixtas y monocultivo incluyendo Tanzania y Mezclas 1 y 2 entre ellos, con valores de
1 Tanzania(3406,5458),mezcla1y2conpromediode(1661,1744)kgMSha ,

parainviernoyprimaverarespectivamente.

Porcentajedehoja

El porcentaje de hoja de los pastos vari (P<0.05) entre tipo de pradera y pocadelao,yseevidenciunainteraccinentreambosfactoresparacadauno delostratamientos(Cuadro4)

386

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Cuadro4:Porcentajedehoja(%)enpraderasmixtasymonocultivoentres pocasdelao.
pocasdelao Tipodepradera Lluvias Nortes Seca

Mezcla1 Mezcla2 Mezcla3 Tanzania


A,B,C

Porcentajedehoja,%

64.5Ac 66.0Ac 64.8Ac 57.0Bc

83.0Ab 83.0Ab

95.3Aa 96.0Aa 89.3Ba 93.8Aa

79.3ABb 75.3Bb

:Mediascondistintasliteralesenlamismacolumnasondiferentes(P<0.05). Mediascondistintasliteralesenlamismahilerasondiferentes(P<0.05).

a,b,c:

El porcentaje de hoja (Cuadro 4) fue mayor (P<0.05) con las diferentes proporcionesdelospastos(65y82%)comparadoconelmonocultivo(57y75%) paralaspocasdelluviasynortesrespectivamente. Entre pocas (Cuadro 4) las praderas mostraron porcentaje de hoja ascendente (P<0.05) delluvias, nortes y seca, con valores promedio de 63, 80 y 93%respectivamente.

387

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489 Coberturabasal

La cobertura basal (%) fue superior (P<0.05) en las mezclas 1 y 2 (71 %) comparadoconelmonocultivo(46%).(Cuadro5). Cuadro5.Coberturabasal(%)enpraderasmixtasymonocultivo.
Tipodepradera Mezcla1 Mezcla2 Mezcla3 Tanzania
a,b,c

Porcentaje* 71.3a 70.7a 59.8ab 46.3b

:Mediasconlamismaliteralenlamismacolumnasoniguales(P>0.05).

Laspraderasmixtasymonocultivosobtuvierondiferentesvaloresduranteel ao (P<0.05). En la poca de nortes se obtuvo el mayor (P<0.05) porcentaje de cobertura con 68.7 % respecto a las pocas de lluvias y seca con promedio de 58.8%queresultaronigualesentres(P>0.05).
Cuadro6.Coberturabasalenpraderasmixtasymonocultivoentrespocasdelao. pocasdelao Lluvias Nortes Seca Porcentaje 59.1b 68.7a 58.4b

a,b,c:Mediascondistintasliteralesenlamismacolumnasondiferentes(P<0.05). *:Promediodecuatrotratamientos.

388

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CONCLUSIONES Las mezclas de pastos, resultaron con rendimientos similares a los del monocultivo, no prolong altos rendimientos durante la estacin seca y la distribucindelamateriasecaseasocialosregmenesdehumedad.Porefecto delporcentajedehoja,lacalidadpuedeserincrementadaenlasmezclas1y2.Se sugiere continuar los estudios de mezclas de gramneas, explorando nuevos materialesgenticos.

LITERATURACITADA

Arcos,A.,T.2007.Influenciadelascaractersticasforrajerassobrelagananciade pesodeovinosenpraderasmixtasymonocultivos.TesisProfesional.ITC, Conkal,Yucatn.49p. Castillo,H.,J.,F.RivasP.,A.PererayL.OrtegaR.2003.EstablecimientodePraderas MixtasI.Combinacindedosespeciesamacolladasydosdensidadesdesiembra. XXXIX.ReuninNacionaldeInvestigacinPecuaria.2731Octubre.FMVZUNAM, Mxico.Pp.354.


Castillo,HJRivas,PFOrtegaRLPereraRAyDazCD.2004.Contenidodeprotenay fibrade especies forrajeras C4 establecidasendiferentes proporciones dentrode unamezcla.XLReuninNacionaldeInvestigacinPecuariaYucatn2004,381p.

Castillo, H. J., Rivas, P. F. Perera, A., Ortega, R. L., 2005. Establecimiento de praderas mixtas II. Proporcin y densidad de siembra de tres especies amacolladas. II Reunin Estatal de Investigacin Agropecuaria, Forestal y Pesca.FundacinProduceYucatn,A.C.Yucatn,Mxico.pp82. INEGI.2009.AnuarioEstadsticodeYucatn.Mxico.575p. Lopetegui,M.J.,2002.PraderaMixtaBallicaTrbolBlanco.<http//www.e cooprinsem.cl/softagri/Cooprinforma62/Articulo_1_1.htm>.24/Dic/2003. Noh,M.,V.2008.Productividadytasadecrecimientodegramneasforrajerasen praderasmixtasymonocultivos.TesisProfesional.ITC,Conkal,Yucatn. 50p.
SASInstitute.1996.SASusersguide.Release6.12.SASInst.,Cary,NC.USA. Van Auken, O.W., J.K. Bush, and D.D. Diamond. 1994. Changes in growth of two C4 grasses(SchizachyriumscopariumandPaspalumplicatulum)inmonocultureand mixture:influenceofsoildepth.Am.J.Bot.81:1520.

389

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ21)Lacalidaddelosembrionesderataesdependientedelasdosis degonadotropinasutilizadasentratamientossuperovulatorios Rat embryo quality is dependent on gonadotropin dosage used in superovulatorytreatments MIGUEL ANGEL CORNEJO CORTS, Mara Carmen Snchez Torres, Juan Carlos Vzquez Chagoyn, Hctor Mauricio Surez Gmez, Germn Isauro GarridoFaria,MarcoAntonioMerazRos FacultaddeEstudiosSuperioresCuautitln,UNAM, Correoelectrnico:mcornejocortes@gmail.com*autorparacorrespondencia

RESUMEN Se evaluaron los efectos de diferentes tratamientos hormonales superovulatorios en ratas Wistar (12 semanas), tratamiento 1, 30 (UI) eCG + 30 UI hCG tratamiento 2, 30 UI eCG y 50 UI hCG tratamiento 3, 50 UI eCG y 30 UI hCG, tratamiento 4, 50 UI eCG y 50 UI de hCG. La eutanasia se realiz mediante sobredosis de pentobarbital. La evaluacin se realiz mediante: Porcentaje de hembras con cruza exitosa, Porcentaje de hembras gestantes, Promedio de embrionesobtenidosporhembragestante,Supervivenciaembrionariaencultivoy Capacidad de los embriones para formar colonias con morfologa tipo troncal (stem)embrionaria.Losporcentajesdehembrasqueseaparearon(7888%)yde hembras gestantes (7686% ) fueron similares el total de embriones colectados (1652) y de embriones obtenidos por hembra gestante (33) fue mayor en el tratamiento 4 la supervivencia de embriones en cultivo fue de 71.4% en el tratamiento2(P<0.05),ylacapacidaddelosembrionesparaformarcoloniascon morfologa tipo stem embrionaria fue de5.75%en el tratamiento 2 (P<0.05), con respectoalosgrupos3y4(datosanalizadosconelprogramaEpiInfo6,mediante la prueba W2). La diferencia de los tratamientos 2 y 4 es la menor cantidad de eCG utilizada. Los resultados anteriores indican que el tratamiento eCG (30) + hCG (50) es un mtodo efectivo de superovulacin en ratasWistar para obtener embriones de alta calidad. Financiado por Consejo Nacional de Ciencia y Tecnologa(CONACyT),mediantelabecaNo112867.

390

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ22)Estudiohistomorfolgicoeinmunohistoquimicodereceptoresa progesteronayestrgenosdelastubasuterinasdecerdas Histomorphological and immunohistochemical study of estrogen and progesteronereceptorsinswineuterinetubas

MIGUEL ANGEL CORNEJO CORTES, Ildeberto Snchez Herrera, Mara Elena Trujillo Ortega, Mara de Lourdes Jurez Mosqueda, Santiago Ren Anzalda Arce,RobertoMartnezRodrguez Facultad de Estudios Superiores Cuautitln, Facultad de Medicina Veterinaria y ZootecniaUNAM, Correoelectrnico:mcornejocortes@gmail.com*autorparacorrespondencia

RESUMEN Se evaluaron cambios morfolgicos y expresin de receptores a estrgenos alfa (RE?)yprogesterona(RP)entubasuterinasdecerdastratadascontratamientos superovulatorios. Se utilizaron 12 hembras F1 LandraceYorkshire (90 kg peso). Los tratamientos se aplicaron va intramuscular (IM) el da 17 (post deteccin estro).Sedividieronen4grupos(n=3):Grupo1,PlaceboGrupo2,400UIeCGy 200UIhCGGrupo3,1000UIeCG+500UIhCGGrupo4,1000UIeCG+1000 UI hCG. Se aplic eutanasia mediante sobredosis de tiletaminazolacepam. El aparatoreproductorcolectadosefij(Paraformaldehido4%),lasmuestrasdetuba uterina se procesaron mediante inclusin en parafina, en cortes seriados (grosor de 45 m). Se detectaron receptores (RE? y RP) por Inmunohistoqumica (puntaje histolgico: HSCORE), y los cambios morfolgicos con la tcnica de Acido Perydico de Shiff (PAS). En el mpula e istmo se observ una mayor expresin de receptores a estrgenos en las clulas epiteliales (regulacin a la alza). Las dosis exgenas de eCG y hCG tuvieron un mayor efecto sobre la expresindelosRE?queparaRPytuvieronmayorexpresinenelmpula.Los tratamientos utilizados provocaron cambios regionales en el nmero de clulas PAS (+) y PAS () comparados con el grupo control. Los resultados obtenidos proporcionaninformacinsobrenmerodeclulasPAS(+)yPAS()yexpresin de RE? y RP, sin embargo queda sin esclarecer el mecanismo de accin de

391

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

estos compuestos. Financiado mediante proyecto de Investigacin Cientfica BsicaSEPCONACYT2008(103990). Palabrasclave:Inmunohistoqumica,tubauterina,hCG,eCG,PAS.

392

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ23)Respuestaauntratamientosuperovulatorioabasedehormonas gonadotrpicasenrataswistardurantediferentesmesesdelao Wistar rats response to a superovulatory treatment based on gonadotropic hormonesduringdifferentmonthsoftheyear CrisforoMercadoMrquez,MiguelAngelCornejoCorts,EthelCatarinaGarcay Gonzlez, Edith Nandayapa Duarte, Germn Isauro GarridoFaria, Hugo Csar LpezFaras,MarcelinoEvodioRosasGarca FacultaddeEstudiosSuperioresCuautitln,UNAM Correoelectrnico:crisofo@hotmail.com*autorparacorrespondencia RESUMEN Seevalulaeficienciadeuntratamientosuperovulatorio(eCG/hCG),en110ratas wistar(12semanas)durantediferentesmesesdelao.Lasratassemantuvierona unatemperaturade1315C,humedadrelativade2030%yfotoperiodonatural. Encadamesseutilizungrupo(n=10)alcualseleaplicporvasubcutanea30 UIdeeCGy50UIdehCG,12horasdespusdeaplicarlasegundahormonalas hembras se cruzaron con machos (condiciones de monogamia). Se aplic eutanasiaalashembrasconsobredosisdeanestsico(ether)1016dasdespus de la cruza. Se colect el tero y se fij en formol neutro amortiguado, los embriones obtenidos despus de ser contados se donaron al laboratorio de HistologayEmbriologa(parafinesdedocencia).Laeficienciadelostratamientos se evalu comparando: Nmero de hembras gestantes, Promedio de embriones por hembra y Nmero total de embriones por grupo, los resultados fueron analizados con ANOVA (SAS 9.2 System software para Windows) y sus diferencias fueron analizadas con la prueba T de Student. Junio fue el mes con mayornmerodehembrasgestantes(60%)Diciembrefuelmesconpromedio ms alto de embriones por hembra (17.5) Marzo y Julio fueron los meses con mayor nmero de embriones producidos por grupo (68). Los resultados sugieren que Marzo y Julio son los meses ideales para aplicar un tratamiento superovulatorioconfinesdeobtenerembrionesderoedores.Lainvestigacinfue financiadaporelProyectoPAPIMEUNAMclave202805. Palabrasclave:Rata,Superovulacin,embriones,eCG,PMSG,hCG.

393

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 24) Alternativas para el tratamiento de residuos slidos del rastro PlantaFrigorficoPresidenteMiguelAlemn,enAcayucan,Veracruz

Alternatives for solid waste treatment for abattoir? Presidente Miguel Alemn?,inAcayucan,Veracruz MaraGiselaVelzquezSilvestre*,ngelHctorHernndezRomero,Hctor DelgadoMondragn,HugoEnriqueJoachnCorts,LuisCarlosAlvaradoGmez FacultaddeCienciasBioAgropecuarias.CampusAcayucan.Universidad Veracruzana.Email:givelazquez@uv.mx.*Autorparacorrespondencia

RESUMEN

En el presente trabajo se comparan los mtodos de compostaje con enzimas y con lombriz de tierra (Eisenia andrei) para el tratamiento de los residuos slidos del rastro Planta Frigorfico Presidente Miguel Alemn, de Acayucan, Ver., consistentesencontenidoruminalydecomiso(vsceras,huesos),comparandoel tiempo de transformacin de los residuos, la concentracin de nutrientes y el rendimiento. Se utiliz un diseo factorial con parcelas subdividas, con ocho tratamientos y tres repeticiones: T1: contenido ruminal (CR), decomiso (CD) y lombriz (L) T2: CR+L T3: CR+DC+enzima (E) T4: CR+E T5: CR+D+L T6: CR+L T7: CR+CD+E y T8: CR+E. Los tratamientos T1 a T4 se regaron con sangre,elrestoconagua.Elexperimentoserealizen24camasde160cm2con 15Kgdesustrato.Serealizunanlisisdevarianzaycomparacindemediaspor el mtodo de Tukey, utilizando el programa Statistica 7.0. El tiempo de transformacin promedio fue de 83.9 das para lombricompostaje y de 108 das para el mtodo enzimtico (p<0.0002). Respecto al rendimiento, hubo diferencia significativa considerando el mtodo de composteo (en promedio, 13.5 kg producidos en lombricomposteo versus 9.0 con proceso enzimtico). En ambos casos, la adicin de sangre y/o decomiso no afectaron significativamente el proceso. La transformacin enzimtica registr los mejores resultados para el

394

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

contenidodeN,P,K,Ca,FeyMg,peroparaelcontenidodemateriaorgnica,el lombricomposteo de CR+D+S (T5) tuvo mejores resultados (p=0.049). Los resultados aportarn elementos para decidirel mtodo de transformacin de sus desechos.

395

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ25)Composicinqumicademezclasdepastos

Chemicalcompositionoftropicalmixedgrasses

JavierCastilloHuchim*,AureliaLpezHerrera,FERNANDORIVASPANTOJA, LUISORTEGAREYES,OCTAVIOROJASRODRGUEZ

INIFAPCAMPOEXPERIMENTALMOCOCH.Email: castillo.javier@inifap.gob.mx.*autorparacorrespondencia

RESUMEN

La diversidad de gramneas en una pradera podra resultar benfica para la alimentacinanimal,silabuenacalidaddelforrajelogramantenerseporperiodos ms largos, comparado con una sola especie. El objetivo del estudio fue determinarsilamezcladegramneasforrajerasmejoralacomposicinqumicade la dieta de bovinos en diferentes etapas fenolgicas de la pastura. El estudio se desarroll en temporal en el sitio experimental TizimnINIFAP, en Tizimn, Yuc. Praderas de los pastos Llanero Tuntun (Andropogon gayanus), Mombaza (Panicummaximum)eInsurgente(Brachiariabrizantha),sembradaseneseorden en proporciones de 25%, 50% y 25% (Mezcla 1), 25%, 25% y 50% (Mezcla 2), 50%, 25% y 25% (mezcla 3) y pasto Tanzania (Panicum maximum) en monocultivo,fueronmuestreadasenlasetapasfenolgicas(EF)dereproduccin (enerode2010),vegetativa(juniojuliode2010)ymadurez(octubrede2010).Las muestras se obtuvieron de fstulas esofgicas de bovinos machos cebuinos (con peso promedio de 265 Kg.) apacentando cada tipo de pradera, en las diferentes EF. Las variables cuantificadas en porciento fueron: protena cruda (PC), fibra neutro detergente (FND), cenizas y materia seca. Los datos se sometieron a un anlisis de varianza con medidas repetidas en tiempo, en un diseo de bloques

396

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

completos al azar y arreglo bifactorial, con 4 repeticiones. Medias de mnimos cuadrados se compararon por pruebas de t pareadas (P=0.05). En las variables estudiadas, se encontrinteraccin entre tipo depradera y EF.La nica pradera quemantuvovaloresdePCsimilaresatravsdeEF(P>0.05)fuelaconformada porlamezcla3.DurantelaEFde maduracinyreproduccin,lasmezclas2y3 presentaron menores (P<0.05) cantidades de fibra que el monocultivo. Las mezclasdepastospodranmejorarlacalidaddepraderastropicales. Palabrasclave:mezcladepastos,etapasfenolgicas,composicinqumica.

ABSTRACT

Forage chemical composition of mixed grasses was determined from grazing cattle, through vegetative, maturity and reproductive plant stages. The study was carried out at the TiziminINIFAP research center, located in the Yucatan peninsula,Mexico.PasturesofLlaneroTuntun(Andropogongayanus),Mombaza (Panicummaximum)andInsurgente(Brachiariabrizantha),plantedat25%,50%y 25% (mixed pasture1), 25%, 25% y 50% (mixed pasture2), 50%, 25% y 25% (mixedpasture3)andTanzaniagrass(Panicummaximum)asmonoculture,were sampled on January (reproductive stage), JuneJuly (vegetative stage), and October (maturity stage) 2010, respectively. Esophagealfistula forage samples were collected in screenbottomed bags from zebu cattle (265 kg avg. live wt.) grazing each one of the pastures, at the above growing stages. Percent crude protein (CP) and neutral detergent fiber (NDF) from samples were recorded. Repeated measurements ANOVA of the effects of pasture and developmental stage was performed in RCBD, with four replicates least squares means were compared using ttests (SAS Inst., 1996). Crude protein and NDF were both significantly affected by type of pasture and developmental stages. The mixed pasture3allowedsimilar(P>0.05)CPvaluesthroughthedifferentdevelopmental stages.Duringthematurityandreproductivestages,themixedpastures2and3,

397

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

registered lower (P<0.05) NDF contents, when compared to the monoculture pasture. The mixed grasses could improve the forage quality in tropical environments.

Keywords:mixedgrasses,developmentalstages,foragechemicalcomposition.

INTRODUCCIN

En Yucatn aproximadamente 486 mil hectreas estn cubiertas con praderas sembradas en monocultivo (INEGI, 2009). La mayor parte de esta superficie se encuentra sembrada con los pastos Guinea (Panicum maximun), estrelladefrica(Cynodonplectostachyus)eInsurgente(Brachiariabrizantha). Los pastos tropicales varan en su composicin qumica la diversidad de gramneasenunapraderapodaresultarbenficaparalaalimentacinanimal,si labuenacalidaddelforrajelogramantenerseporperiodosmslargos,comparado con una sola especie. Limitaciones en la disponibilidad de forraje por estacionalidadybajovalornutritivodelaspasturas,sonlascausasprincipalesde rendimientosmarginales(tMannetje,1984). Sin embargo, debido a diferencias morfolgicas (e.g. hbito de de crecimiento, relacin hoja: tallo o respuestas a fotoperiodo) (Norton, 1984)), la siembrademsdeunaespecieenelestablecimientodepraderas,puedeseruna estrategiade manejo tendiente a mejorar lacalidad del forraje paralos animales enpastoreo.Elconocimientodelacomposicinqumicaensusdiferentesetapas fenolgicas y su grado de utilizacin por los animales, es esencial para el desarrollodesistemasdemanejoyelaboracindeprogramasdealimentacin. El objetivo del presente estudio fue determinar si la mezcla de gramneas forrajeras mejora la composicin qumica de la dieta de bovinos en diferentes etapasfenolgicasdelapastura.

398

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

MATERIALESYMTODOS

Eltrabajosedesarrollbajocondicionesdetemporalenterrenosdelsitio experimental TizimnINIFAP, en Tizimn, Yuc. Mxico. Praderas de los pastos Llanero Tuntun (Andropogon gayanus), Mombaza (Panicum maximum) e Insurgente, sembradas en ese orden en proporciones de 25%, 50% y 25% (Mezcla 1), 25%, 25% y 50% (Mezcla 2), 50%, 25% y 25% (mezcla 3) y pasto Tanzania(Panicummaximum)enmonocultivo,fueronmuestreadasenlasetapas fenolgicas(EF)dereproduccin(enerode2010),vegetativa(juniojuliode2010) ymadurez(octubrede2010). Las muestras de forraje se obtuvieron de fstulas esofgicas de cuatro bovinos machos cebuinos (con peso promedio de 265 kg) apacentando por 45 minutos en potreros de 1 ha por cada tipo de pradera, en las diferentes EF, durantecincodasconsecutivos.Lasmuestrascolectadasseprepararonparasu anlisisbromatolgico,paralocualfueronsecadasenunaestufaa60C,porun periodo de 48 horas hasta alcanzar peso constante. Una vez secas, se molieron (molino Willey) utilizando un tamiz de 1 mm. Las variables cuantificadas en porciento fueron protena cruda(PC) mediante el anlisis bromatolgico proximal Weende (AOAC, 1995) y fibra detergente neutro (FDN) (Van Soest et al.,1991). Los datos se sometieron a un anlisis de varianza con medidas repetidas en tiempo,enundiseodebloquescompletosalazaryarreglobifactorial(3etapas fenolgicasx4pasturas),con4repeticionesportratamiento.

RESULTADOSYDISCUSIN

Enelcontenidodeprotenacrudayfibradetergenteneutrodelasmuestras de forraje seleccionados por los bovinos en pastoreo, se encontr interaccin entretiposdepraderaylasetapasfenolgicasevaluadas.

399

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Protenacruda
Durante la etapa de crecimiento vegetativo de los pastos (juniojulio), la dieta con mayor cantidad (P<0.05) de PC se observ en las praderas de pasto Tanzania(10.1%)comparadoconlospolicultivosevaluados(7.8%)(Cuadro1). El pasto Tanzania, comparado con las especies que constituyeron las praderas mixtas,esunaespeciedeportemsaltoloquepudocontarparaunaseleccinde losanimalesbasadaenlminasfoliaresdealtacalidad,mientrasqueenlamezcla de gramneas, se incorporaron porciones de menor calidad en la dieta de los animales como lo son tallos y vainas de las hojas. Griffiths (1999) encontr que bovinosapacentandopraderasenlafasedecrecimientovegetativo,primeramente seleccionan con base a la altura de planta que por la densidad poblacional o grosor de la cobertura vegetal. Tambin observ, que la etapa de madurez incorporungradodecomplejidadenlasdecisionesdeseleccindelosanimales, endondelaalturadelaplantanosiemprebrindabaunaindicacindepreferencia hacialapartedeforrajeaconsumir.Enesteestudio,enlaetapademadurezde lospastos,lasconcentracionesdePCenladietadelosanimalesfueronsimilares atravsdelaspraderas,mientrasqueenlaetapadereproduccin,seobservaron variaciones. Durante la etapa reproductiva de los pastos, las praderas que registraron los ms altos valores de PC fueron la mezcla 2 y el monocultivo de Tanzania.

400

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Cuadro 1. Concentracin de protena cruda del forraje seleccionado por bovinos pastoreandopraderasmixtasymonocultivoentresetapasfenolgicas.
Etapafenolgica Tipodepradera Vegetativo Madurez Reproductivo

Mezcla1 Mezcla2 Mezcla3 Tanzania


A,B,C

Protenacruda,% 7.4Bb 8.5Aa 5.9Cc 7.4Bb 7.8Ba 10.1Aa 9.0Aa 8.1Aa 8.6Ab 8.1ABab 7.5Ba 8.8Ab

Mediascondistintasliteralesenlamismacolumnadentrodecadavariableson diferentes(P<0.05).
a,b,c

Mediascondistintasliteralesdentrodehilerassondiferentes(P<0.05).

A travs delas distintasetapas fenolgicasestudiadas,la mezcla 3 fue la nicapasturaquemantuvocontenidossimilares(P>0.05)deprotenacrudadesde laetapavegetativahastalareproductiva(Cuadro1),locualesunindiciodeque praderasconformadasporvariasespeciesendeterminadasproporciones,pueden extender las concentraciones de PC indistintamente de la estacin del ao lo anterior,esunobjetivodeimportanciaparalaalimentacindelosrumiantesenel trpico, adems de que podra facilitar el manejo nutricional de los bovinos en pastoreo.

Fibradetergenteneutra

Entrminosprcticos,laFDNenelforrajeesunndicedelacantidaddemateria seca que un rumiante consumir. En la medida en que el porcentaje de fibra aumenta, el consumo voluntario de forraje decrece (Minson, 1984),derivando en unmenorrendimientodelosanimales.Enesteestudio,entrminosgenerales,las mezclasdepastospermitierondisminuirsignificativamente(P<0.05)lacantidadde FDNdelforrajeencadaunadelasetapasfenolgicasevaluadas,comparadocon el monocultivo de Tanzania (Cuadro 2). El significado de lo anterior, es que la

401

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

estrategia de formar una pradera incorporando los pastos Llanero Tun Tun, Mombaza e Insurgente en las proporciones registradas en las mezclas 2 y 3, resultaron en un forraje de mejor calidad, que la pradera de un solo pasto. Esta estrategia, permite sopesar los lmites nutricionales que imponen ciertos monocultivostropicales,atravsdelmanejodelaspasturas(Evans,1984). Cuadro 2. Contenido de fibra detergente neutro del forraje seleccionado por bovinospastoreandopraderasmixtasymonocultivoentresetapasfenolgicas.
Etapafenolgica Tipodepradera Vegetativo Madurez Reproductivo

Mezcla1 Mezcla2 Mezcla3 Tanzania


A,B,C

Fibradetergenteneutro,% 73.3Ba 69.8ABab 66.8ABb 72.8Ba 77.6Aa 74.6ABa 64.5Cab 68.3Ba 70.1Ab 64.0Bb 64.7Ba 68.7Ab

Mediascondistintasliteralesenlamismacolumnadentrodecadavariableson diferentes(P<0.05).
a,b,c

Mediascondistintasliteralesdentrodehilerassondiferentes(P<0.05).

Cuando la planta avanza en su estado de madurez, el contenido de fibra aumenta y la digestibilidad del forraje tiende a disminuir (Wilson, 1984). En las praderasevaluadas,latendenciaenelcontenidodeFDNfueenlogeneralauna disminucinenlamedidaqueelcrecimientodelasplantasprogresaba.Loanterior se atribuye a un consumo selectivo de partes menos fibrosas de los forrajes durantelaetapareproductiva,comparadoconlavegetativa(Cuadro2).Loanterior esunaevidenciadedelaeficienciadelosanimalesenlaseleccinyutilizacinde los forrajes, en circunstancias donde la disponibilidad de la materia seca no es limitativa.

402

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

CONCLUSIONES

Las mezclas de pastos en el trpico pueden mejorar la calidad de la pastura comparado con la utilizacin de praderas en monocultivo. Las especies y proporciones dentro de una mezcla, determinan la calidad del forraje y su extensin a lo largo del ao. Se deben continuar este tipo de estudios para comprender mejor lasinteracciones entrelas especies de una mezcla,la calidad desuspartes,laconductaanimalysuproductividad,enecosistemastropicales.

LITERATURACITADA

AOAC.1995.MethodsofanalysisoftheassociationofOfficialAnalyticalChemists. Sixteenthedition,AOACinternational.Arlington,Virginia.USA.Pp. 2:43.1.06. Evans,T.R.1984.Overcomingnutritionallimitationsthoughpasturemanagement.

In:Hacker(ed.).Nutritionallimitstoanimalproductionfrompastures.C.A.B.
London,UK.p.343361. Griffiths,W.M.1999.Swardstructuralcharacteristicsandselectiveforaging behaviorindairycows.Ph.D.Diss.Thesis.MasseyUniv.,NewZealand. 308p. INEGI.2009.AnuarioEstadsticodeYucatn.Mxico.575p. Minson,D.J.1984.Effectsofchemicalandphysicalcompositionofherbageeaten uponintake.In:Hacker(ed.).Nutritionallimitstoanimalproductionfrom pastures.C.A.B.London,UK.p.167182. NortonB.W.,tMannetjeB.W.,1984.Differencesbetweenspeciesinforage qualityIn:J.B.Hacker(Editor).Nutritionallimitstoanimalproductionfrom pastures.CAB.Slough,UK.Pp.89110.

403

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

SASInstitute.1996.SASusersguide.Release6.12.SASInst.,Cary,NC.USA. t Mannetje, L. 1984. Problems of animal production from tropical pastures. In: Hacker (ed.). Nutritional limits to animal production from pastures. C.A.B. London,UK.p.6785. Van Soest, P. J Robertson, J. B. and Lewis, B. A. 1991: Methods for dietary fibber, neutral detergente fibber, and nonstarch polysaccharides in relation toanimalnutrition.J.DairiSci.74:35833597. Wilson,J.R.1984.Environmentalandnutritionalfactorsaffectingherbagequality.

In:Hacker(ed.).Nutritionallimitstoanimalproductionfrompastures.C.A.B.
London,UK.p.111131.

404

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 26) Las hojas de paulownia elongata una opcin forrajera para rumiantes Paulowniaelongataleavesoneruminantfeed Jos Luis Gutirrez Lian, Ranulfo Reyes Gama, Raymundo Ocaa Delgado, AlfredoMedinaGarca,AlejandroCrdobaizquierdo CENTROUNIVERSITARIOUAEMZUMPANGO Correoelectrnico:jlgutierrezl@uaemex.mx*autorparacorrespondencia RESUMEN Uno de los principales problemas que limitan la eficiencia en la productividad animal es el marcado defecto de la estacionalidad en la produccin de forrajes principalmentepararumiantes,estorepercuteenunabajadepeso,unalargueen eltiempoalmercadoytrastornosenlaproduccindelecheyreproduccinanimal. Por tal razn en el Centro Universitario UAEM Zumpango, a travs de la LicenciaturadeIngenieroAgrnomoenProduccin,sehavenidotrabajandocon Paulowniaelongata desde el 2003 ala fecha, conlaintencin de demostrar que es una especie viable, apesar de no ser originara de Mxico, seha encontrado quelahojatienenunvaloralimenticiosimilaraldelaalfalfa,porloquesepuede utilizar como complemento en la dieta de animales rumiantes. Se puede mencionarquedeunrbolde8a10aosdeedadseobtienen100kgdehojas frescas,aproximadamente30kgdehojassecasconunvalorproteicode20%y unadigestibilidadde60%.Estosresultadossehanlogradoalrealizarlosanlisis bromatolgicosenloslaboratoriosdelaFESCUAUTITLANdelaUNAMdesdeel 2003 ala fecha sehanrealizado cuadros de comparacin conlos forrajes dela regincomoloalfalfa,avena,rastrojoysehaencontradoquePaulowniaelongata es altamente significativa y para asegurar la alimentacin de los animales (rumiantes), por lo que podemos concluir que si es considerada como un abastecedordealimentoenetapascriticas,porsucontenidonutricional(protena cruda y digestibilidad) que es ms alto que el de otros forrajes, entonces tendremosunabuenaalternativaparaobteneralimentodecalidad. Palabrasclave:Paulownia,forrajes,rumiantes,valor,alimento.

405

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 27) Examen de fertilidad de toros en el GGAVATT El guila en QuintanaRoo ExaminationoffertilityofbullsintheGGAVATT ElAguila inQuintanaRoo

MARIA DEL CARMEN ZAVALETA CORDOVA, Edgar Enrique Sosa Rubio, EduardoCabrera,JorgeGonzlezJohnsonTorres INIFAPCAMPOEXPERIMENTALCHETUMAL Correoelectrnico:zavaleta.maria@inifap.gob.mx*autorparacorrespondencia

RESUMEN Elobjetivodelpresentetrabajofuerealizarelexamendefertilidadqueconstadel examenfsico,sanitarioycapacidaddeservicio(CS),deestaformadeterminarlos aptos o no para permanecer en las Unidades de Produccin Pecuaria UPP, las variablesamedirenelexamenfsicofueron,Edad,Raza,CircunferenciaEscrotal (CE), Tono Testicular (TT), Epiddimo (Epi) y Condicin Corporal (CC), en el examensanitarioserealizpruebadeBrucelosis(BR)yTuberculosis(TB).Delas 30 UPP se evaluaron 33 sementales, se obtuvo que la edad promedio es de 44 meses,10sondelarazasSuizo(S),6Cebu(C),6cruzasdeSuizoBrahaman,3, Hostein, 3 HolteinCebu, 2 CebuGyr (CGyr) , 1 SuizoHoltein (SH) y 2 Suizo Cebu,elpromediodelaCE,fuede35cm, enTTseobtuvoque26seclasifican con1/1,1conunTT1/2y6de2/2,encuantoaEpi,33silopresentandeforma correctay1no,encuantoaCCseobservoque13tienenunaCCde3deigual formaparalaCC4,mientrasque4sementalestuvieronunaCCde5ysolo3de 2.Encuantoalexamensanitariosolo1sementaldiopositivoaBryfuedesechado deinmediato,encuantoalaCS,seobtuvoque27tuvieronunacalificacinbueno (B),3demuybueno(MB),y3deMalo(M).Losdatosobtenidospermitieronemitir undictamensobrelostorosquedebieronserretiradosdelasUPP,siendoestos3 deltotal. Palabrasclave:Fertilidaddetoros,GGAVATT,capacitacin.

406

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ28) Utilizacindebiofertilizantesparalaproduccindeleguminosas tropicalesforrajeras Utilizationofbiofertilizantesforproductionofleguminoustropicalforrage


1* 1 Edgar Enrique Sosa Rubio , Mara del Carmen Zavaleta Crdova , Eduardo 1 CabreraTorres 1

InstitutoNacionaldeInvestigacionesAgrcolasForestalesyPecuarias,Centrode Investigacin Regional Sureste. INIFAPCIRSE. Campo Experimental Chetumal. C.P.779000.CarreteraChetumalBacalarKm.3.5. Email:sosa.edgar@hotmail.com.*Autorparacorrespondencia

RESUMEN Elpresentetrabajoserealizconelobjetivodeevaluarabonosorgnicosparala produccin sustentable de leguminosas forrajeras tropicales, que eviten la utilizacindefertilizantesinorgnicos,disminuyendoloscostosdeproduccinyel deteriorodelrecursonatural.ElestudiosellevoacaboenelCampoExperimental ChetumaldelINIFAPenQuintanaRoo,ylaprimerapartedeltrabajoserealizoa nivel de laboratorio para el aislamiento, purificacin, caracterizacin y conservacindelascepas,obtenidasdemuestrasdesuelosyracesatravsde disolucionesysiembrasen mediodecultivo.Paralaspruebasdeinvernaderoy camposeutilizaroncincoleguminosasforrajerastropicalesdeimportanciaparala regin, a estas se les aplicaron diferentes combinaciones de biofertilizantes utilizandoundiseodebloquesalazarcontresrepeticionesalascualesseles aplicounanlisisdevarianzaycontrastesortogonales(pruebaderangomltiple para tratamientos de tipo cualitativo). El efecto de los biofertilizantes sobre las leguminosas en estudio se midi por la productividad en MS y altura de las plantas, observando que las plantas de Clitoria ternatea (Clitoria) fueron las ms altas en produccin en MS (p0.05) en comparacin con el tratamiento fertilizacin inorgnica con 5.8 y 5.4 t ha1 respectivamente. En las plantas de

Mucunapruriens(Mucuna)seobtuvieronvaloresenlostratamientosdefertilizado
inorgnico e inoculados de 5.2 y 5.4 t de MS ha1 respectivamente, y en los mismostratamientosconlasplantasdeCentrosemamacrocarpum(Centrocema)

407

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

se observaron valores de 1.2 y 2.3 t de MS ha1, siendo esta la que menor respuesta presento ante el biofertilizante. En la variable de altura las plantas, Clitoria presento mejor respuesta a los tratamientos de fertilizacin inorgnica e inoculacin (p0.05) con las cepas aisladas obteniendo valores de 56 y 58 cm respectivamente Mucuna fue la segunda especie de valores ms altos, obteniendoparalosmismostratamientosvaloresde50y49cmyparalasplantas deCentrosemaseobservaronvaloresde35y23cm.

408

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 29) Evaluacin de la produccin de miel en colmenas con alimentacinartificial EvaluationofhoneyproductioninhiveswithartificialFeeding

MaraFlixSalinasVzquez,RaymundoAvilaBentez

BENEMERITA UNIVERSIDAD AUTONOMA DE PUEBLA, FACULTAD DE MEDICINAVETERINARIAYZOOTECNIA,BUAP.C.P75483 Correoelectrnico:mielosa05@yohoo.com*autorparacorrespondencia RESUMEN La alimentacin artificial estimulante permite aumentar la postura de la reina, incrementadepoblacinadulta,incrementalaproduccindemiel.Crespo(2007) laalimentacinconsisteendarproductosenergticosyproteicos.Esteban(2008) menciona que el jarabe de azcar estimula el nmero de abejas recolectoras de polen,DeAraujoyEchazarreta(2001)aseguranqueelsuplementodepolenlogra desarrollar cras y prolongarla vida delas abejas adultas. El objetivo del trabajo fue evaluar la produccin de miel de colmenas con alimentacin artificial. Se trabaj un total de 52 colmenas, (n=52), control (n=20) y con apoyo nutricional (n=32), este consisti en jarabe de azcar y agua (1:1), se dio 2 litros por semana.Ademssediotortasdepolen.Sealiment11semanas,determinando elpuntocrtico,cuandoacabanconsusreservas,estocoincideconlatemporada de lluviasimpidiendo elpecoreo, antes dela gran floracin (importante continuar conalimentacin).Encontramosplantasapcolas(n=19)sobresaliendoespecies deacahualduranteoctubre,noviembreydiciembre.Laproduccinobtenidafue de 29.41kg/colmena superior a colmenas control que fue de 6.489 kg. La alimentacin tuvo una significancia P (< 0.05). Se concluye que alimentar a las coloniasenelmomentoyformaadecuada,aumentalaproductividad. Palabrasclaves:Alimentacin,abejas,azcar,miel.

409

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 30) Las competencias docentes del profesor de educacin superior veterinariaenelcontextoactual. Theteachingskillsinveterinaryhighereducationinthecurrentcontext OlmedoPrezGerardo,AjaGuardiolaSantiago,GarcsMercadoNora Facultad de Ciencias Biolgicas y Agropecuarias. Tuxpan, Ver. Universidad Veracruzana. Correoelectrnico:golmedoperez@gmail.com*Autorparacorrespondencia

RESUMEN En el contexto actual, es necesario apoyar a los estudiantes para generar habilidades para "aprender a aprender" y promover su desarrollo cognitivo y personal para construir su propio conocimiento, observndose una necesidad de actualizacindelashabilidadesdocentesparacumplircondichometido.Cules sonlascompetenciasdocentesdelprofesorenelcontextoactual?Elobjetivode este trabajo es identificar, las competencias que debe reunir un profesor en el sistema educativo moderno. Material y mtodos. Se realiz una investigacin documental relacionada con las propuestas de distintos autores acerca de las competencias docentes que debe poseer un profesor. Se localizaron las fuentes deinformacin,seaplicaronlasfichasdetrabajocomoinstrumentoderecoleccin de registros, se sistematiz y analiz la informacin, comparando, clasificando y relacionandolaspropuestasdemayorsimilitud,finalmenteseintegrunalistade lasprincipalescompetencias.Resultados.Lascompetenciasquedebeintegrarel dominioconceptual,procedimentalyticodelosprofesoresson:a).Organizasu formacincontinua.b).Dominayestructuralossaberesparafacilitarexperiencias de aprendizaje significativo. d). Planifica los procesos de enseanza y de aprendizaje atendiendo al enfoque por competencias. e). Lleva a la prctica procesos de enseanza y de aprendizaje de manera efectiva. f). Evala los procesosdeenseanzaydeaprendizajeconunenfoqueformativo.g).Construye ambientesparaelaprendizajeautnomoycolaborativo.h).Generaambientesque facilitanla formacin integral delos estudiantes. i). Participa en los proyectos de mejora continua de su escuela y apoya la gestin institucional. j). Favorecer el

410

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

ejercicio de respuesta a los dilemas ticos de la profesin. Conclusiones. Se cuentaconpropuestasdelperfilprofesionalintegradoporcompetenciasdocentes que deben estar en dominio de un profesor para ejercer eficientemente en el sistemaeducativoactual. Palabrasclave:Competencias,docente,veterinaria.

411

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 31) Efecto del clembuterol sobre la motilidad del espermatozoide de larata Effectofclembuterolonthemotilitysperminrat

HernndezG1,SnchezG1,LpezM1,SnchezA1,AjuechG1,CaicedoR2, Lab. de Histofisiologa, Escuela de Biologa, Benemrita Universidad AutnomadePuebla. Correoelectrnico:uquiroz@yahoo.com.mx*Autorparacorrespondencia

RESUMEN La administracin de agonistas betaadrenrgicos como el clembuterol se ha utilizado ilegalmente como aditivo alimenticio para incrementar el desarrollo de masamuscularenbovinosyporcinos.Enelcerdocausaalteracionesdelepitelio seminfero, sinembargo no existen suficientes estudios que muestren efectos de este betaagonista sobre la espermatognesis. Por lo que el propsito de este trabajo es estudiar los efectos de la administracin de clembuterol sobre la motilidadylaviabilidaddelespermatozoidedelarataadulta.Paraello,ungrupo deratasmachosde30dasdeedaddelacepaSpragueDawleyselesaliment diariamente con alimento Harlan (grupo control) y otro grupo mezclado con clembuterolenunadosisde5mg/kg/dadealimentohastaeldadesusacrificio. Losanimalesfueronsacrificadosalos90dasdeedad.Alaautopsiasedisecaron losepiddimosyseprocedialaobtencindelosespermatozoidesdelacoladel epiddimo y conducto deferente. Se evalu la motilidad del espermatozoide en progresiva rpida, lenta, in situ o inmvil y se obtuvieron los porcentajes de acuerdoaloobservadoencadaunadelasmuestras.Laviabilidadespermticase realiz por medio de una tincin fluorescente con diacetato de fluoresceina ms yoduro de propidio. Nuestros resultados mostraron que la administracin de clembuterol no modific el nmero total de espermatozoides, sin embargo disminuy la viabilidad (37.8% vs 66.3%). La motilidad progresiva rpida disminuy significativamente en el grupo tratado con clembuterol (39.7% vs. 70.3%) mientras que la progresivalenta aument (33.8%vs. 19.1%)as como la

412

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

motilidad in situ (11.7% vs 4.9%) as como el porcentaje de espermatozoides inmviles(11.5%vs5.6%).Estosresultadosnospermitensugerirqueenlaratael clembuterolinhibelaviabilidaddelespermatozoideylaadquisicindelamovilidad progresiva.

413

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 32) Suplementacin energtico proteica en dietas de ovinos como correctoresenlacalidaddelacanal. Proteinenergysupplementationindietsofsheepcorrectorsinthequalityof thechannel

AMALIA CABRERA NUEZ, PABLO ELORZA MARTINEZ, Sergio Omar Nieto Rosaliano, Iliana Del Carmen Daniel Renteria, Miguel ngel Lammoglia Villagomez,SawRaheeVelazquezJimenez

FACULTADDECIENCIASBIOLOGICASYAGROPECUARIAS. Correoelectrnico:amacabrera@uv.mx*autorparacorrespondencia

RESUMEN Elobjetivodeestetrabajofueevaluarelefectodelasuplementacinenergtico proteica, en borregos de la cruza Dorper/Katahdin, sobre la ganancia de peso y calidad de la canal, bajo un sistema de estabulacin, teniendo como base alimenticioelforrajeverdedecorte.Seemplearonochentaovinosmachosenteros Dorper/Katahdin de 20 kg de peso, que fueron asignados, bajo un diseo completamente aleatorio en cuatro tratamientos experimentales T1: Sorgo forrajeroadlibitum(Testigo)Sorgoforrajeroadlibitum+613,0g/ddesuplemento T3: sorgo forrajero ad libitum + 617,0 g/d de suplemento, T4: Sorgo forrajero ad libitum + 620,0 g/d de suplemento. La composicin del suplemento se bas en 28% de maz molido, 28% sorgo molido, 15% melaza ,13% pasta de soya, 8% alfalfa verde, 5% de cebada, 3% de minerales, con un 15% de protena cruda y 70% de NDT. El sorgo forrajero (Sorghum vulgare) ofrecido tuvo un 6,13% de protenacruda.Sellevaronregistrosdiariosdeconsumoypesajescada15das. El suplemento se suministr diariamente a las 7:00 am durante 90 das. El consumototaldemateriasecafuede606,9823,0922,5934,3g/animalparalos tratamientosT1,T2,T3yT4,respectivamenteyelpromediodegananciadiaria(p = 0,05) fue 253,0 273,0 274,0 275,0 g/animal, respectivamente. La evaluacin paralacalidaddelacanalfuede2,3,3y4conrendimientosdelacanalcaliente de 43,56 52,30 53,30 y 54,01% para los tratamientos T1, T2, T3 y T4,

414

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

respectivamente.Losresultadosindicanquelasuplementacinpromoviunmejor comportamientoproductivoyrendimientodelacanalenlosborregos. Palabrasclave:Suplementacin,gananciadepeso,canal,ovinos.

415

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ33)Mtodosalternativosparaincrementarlagerminacinensemillas deLeucaenaleucocephala AlternativemethodstogerminationincreaseINLeucaenaleucocephalaseed


1 2* 2 ConradoMarianoFrancisco ,RubnDaroGarzaCedillo ,JaimeFloresToms , 2 2 FlorE.OrtzChirez yEloyVargasValero 1 UATU.A.M. de Ciencias, Educacin y Humanidades , INIFAPCIRNECampo 2 ExperimentalRoBravo .Km61Carr.MatamorosReynosaCP88900AP172Ro Bravo,Tam.Tel:(899)9341045 Correoelectrnico:garza.ruben@inifap.gob.mx*Autorparacorrespondencia RESUMEN

El objetivo del estudio fue evaluar diferentes mtodos de escarificacin para incrementar la germinacin en semilla de Leucaena leucocephala. Se evaluaron 10 tratamientos (Testigo, agua a 85C/7 min, HNO3 a 850 ppm/10 seg, H2SO4 a
o 140ppm/30seg,lijaN 50/7min,BiozymeTS/7min,aguaa85C/7min+Biozyme o TS, HNO3 a 85%/10 seg+Biozyme TS, H2SO4 al 98%+Biozyme TS y lija N 50/7

min+Biozyme TS), bajo un diseo completamente al azar con 4 repeticiones, utilizando200semillasportratamientolascualesfueroncolocadasenpapelcomo sustrato y puestas en una cmara germinadora a 25C de temperatura. Las variables evaluadas fueron porcentaje de germinacin, longitud de plntula y radcula, semillas duras y muertas. Los datos obtenidos fueron analizados con ANDEVAycomparacindemediasconTukey(P<0.05).Losresultadosmostraron un efecto significativo (P<0.05) entre mtodos de escarificacin. Los mayores valores de germinacin fueron obtenidos con lija (60.5%) respecto al testigo (27%).Lamejorlongituddeplntulaseobtuvoconlija(9.4cm)ymenorconHNO3 (1.5 cm). La mayor longitud de radcula se obtuvo con lija (9.3 cm) y menor con HNO3 (2.1 cm). El tratamiento con lija present menor porcentaje de semillas duras(21.5%)queelHNO3 (73%).ElH2SO4+BiozymeTSpresentmenornmero de semillas muertas (16.0%) en comparacin con agua a 85C (38%). La escarificacin mecnica con lija es un mtodo econmico y prctico que incrementalagerminacindesemilladeLeucaenaen34%. Palabrasclave: Leucaena,germinacin,mtodos,escarificacin.

416

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ35)AspectosaConsiderarenunLaboratoriodeFertilizacinInVitro AspectstobeConsiderinaLaboratoryofInVitroFertilization

LpezDaminEP.*,JimnezSeverianoH. CENID Fisiologa y Mejoramiento Animal INIFAP. Km. 1 carretera a Coln CP 76280, Ajuchitln Coln Qro. Tel.(419) 292 00 36 Fax (419) 29200 33, Email: Lopez.eva@inifap.gob.mx.*autorparacorrespondencia RESUMEN

La fertilizacin in vitro (FIV) es una tcnica empleada en la mayora de las especies animales de inters zootcnico y en la especie humana. Cuando la tcnicasevaestandarizarporprimeravezenellaboratorioexistenvariosdetalles quenoseconocenynormalmentesonomitidosenlosartculossinembargo,el conocimientodeestospequeosdetalles,puedenhacerladiferenciaentreelxito ofracasoeneldesarrollodelatcnica.Elobjetivodelpresentetrabajo,essealar algunos aspectos de suma importancia, que deben ser considerados en la FIV. Dentrodeestosaspectosseencuentralacalidaddelaire,laesterilidaddelcuarto decultivoylarutinadelimpiezadiaria.Laimportanciadelacalidaddelaire,radica en la existencia de compuestos orgnicos voltiles en ste, y a su vez en la incubadorayaqueel95%delaireestomadodelmedioambientedellaboratorio, afectando el desarrollo embrionario (Worrilow et al., 2001), debido a que el metabolismodelasclulasembrionariasincorporacompuestosorgnicosvoltiles por medios pasivos y/o activos causando la muerte, pudiendo llegar a obtener porcentajesdepreezde0%.Loscontaminantesmscomunesencontradosenla incubadora son: hidrocarburos (generados por la zona urbana), molculas inorgnicas (N2O, SO2, CO), aldehdos, bencenos y fenoles derivados de materiales presentes en las instalaciones y CO2 de la incubadora (grado medicinal), estireno proveniente de las cajas petri y contaminantes provenientes de pesticidas o aerosoles que contengan butano o isobutano como propulsor. Inclusive los lquidos usados para la limpieza, contienen metales pesados

417

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

resultando ser los ms agresivos (Cohen et al., 1997), por lo tanto es recomendable usar agua oxigenada al 3%, no tener reactivos en el cuarto de cultivo, no usar fragancias cuando se trabaje con ovocitos y/o embriones. El proceso de esterilizacin del cuarto de cultivo se lleva a cabo por medio de luz ultravioleta(UV),conunespectroqueoscilaentrelos100a400nm,sinembargo con 100 a 280 nm el efecto germicida es efectivo aunado a esto, la calidad del aire y la temperatura afectan la desinfeccin, con respecto a este ltimo factor, 20C es lo ideal para un buen desempeo de la lmpara, a temperaturas ms bajas las ondas UV tienden a fluctuar poniendo en duda el efecto germicida (Izquierdoetal., 2009). Se recomienda realizar peridicamente muestreos delas superficies de trabajo dentro del cuarto de cultivo, de la incubadora, y de la campana de flujo laminar, para detectar y corregir posibles contaminaciones que puedan afectarlosresultados. La rutina delimpieza del cuarto de cultivo, consta en realizar cambio de agua estril de la incubadora semanalmente, para evitar crecimiento de microorganismos. Antes y despus de trabajar, se deben limpiar las superficies conalcoholal 70% yaguaoxigenada,prenderlalmpara UV. En caso de derramar alguna sustancia mientras se estn manejando ovocitos embriones, debe limpiarse de inmediato evitando usar alcohol esperar 20 minutos despus del uso del alcohol para exponer los gametos (Elder y Dale 2003). La campana de flujo laminar debe estar encendida siempre que se est trabajandoparaquecirculeelaire.Esrecomendableenjuagarlascajaspetricon medio, antes de ser usados ya que pueden contener partculas indeseables. Revisar el pH y osmolaridad de los medios (7.2 a 7.5 y 275 a 305 mOsm, respectivamente).Enelcasodelaceitemineral,debesertratadocomounreactivo fotosensible, ya que puede tornarse embriotxico s se expone por un tiempo prolongado(4hrs)alaluzsolar(ProvoyHerr,1998).Porlotanto,paraobtener buenos resultados en la produccin de embriones, no slo es importante el dominiodelosprocesosdemaduracindeovocitos,fertilizacinycultivo,sinoque tambindebemantenerseunambienteadecuadoenelcuartodecultivo,equipos ymaterialesutilizados,puesdelocontrario,podranpresentarsefallasimportantes enlaproduccin,tantoencalidadcomoencantidad.

418

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 36) Valoracin Nutrimental de Dos Gramneas en Pastoreo en un ClimaTrpicoHmedo NutritionalEvaluationofTwoGrazingPasturesinaWetTropicalClimate MLen*,ACabrerayMALammoglia

FacultaddeCienciasBiolgicasyAgropecuarias,UniversidadVeracruzana,Poza RicaTuxpan RESUMEN Elobjetivodeesteestudiofueevaluarelvalornutrimental,numeroygrosordelas hojas de lasgramneas insurgentes(BrachiariaBrizantha marandubM)yMG5

(Brachiaria brizantha MG5 MG5) establecidas en dos parcelas de 9 x 2 m,


mantenindose con riego por aspersin cada ocho das. El estudio se realiz de febrero a julio del 2011 en el Municipio de Tecolutla, Veracruz. Los cortes se realizaron a una altura de 15 cm del suelo durante los das 21, 50 y 70 de crecimiento. Se determin el contenido de protena cruda (CP) en base fresca y seca por medio del anlisis qumico proximal y se determin manualmente el nmero y grosor de las hojas. La CP del pasto bM a los 21, 50 y 70 das de rebrotefuede21.64%,23.23%y20.61%,respectivamenteydelpastoMG5fuede 18.33%,24.83%y23.23%,respectivamente.ElcontenidodeCPfuesimilar(P= .10)entreelpastobM(21.20%)yelMG5(23.42%).Ambospastospresentaronun nmerosimilardehojasalos21,50y70dasderebrote(bM21.02.0,37.5 2.5, 61.0 6.2 y MG5 21.5 1.5, 36.8 2.0, 62.5 5.0, respectivamente). El grosordelashojasfuesimilar(P=.10)entrelospastosalos21,50y70dasde rebrote(bM1.751.2,1.20.5,1.60.3yMG51.50.5,1.40.3,1.50.3, respectivamente). En conclusin, los pastos insurgentes (Brachiaria Brizantha

marandu)yMG5(BrachiariabrizanthaMG5)tuvieronuncontenidodeprotena
cruda, nmero y grosor de hojas similar a los 21, 50 y 70 das de rebrote bajo estascondicionestropicales. PalabrasClave:Gramneas,ValorNutrimental,Pastoreo,Trpico,bromatolgico.

419

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

(CMVZ 37)Fertilidad en Vacas con Influencia Gentica Bos Indicus X Bos

Taurus

en el Norte del Trpico Veracruzano Sincronizadas para ser

InseminadasArtificialmenteaTiempoFijo Fertility in Cows with Genetic Influence of Bos indicus x Bos taurus in NorthernVeracruzSynchronizedtobeArtificiallyInseminatedatFixedTime
1 1 1 1 RAVzquez*,ICDaniel ,MAAlarcon ,ACabrera yMALammoglia 1

FacultaddeCienciasBiolgicasyAgropecuarias,UniversidadVeracruzana,Poza RicaTuxpan RESUMEN Elobjetivodeestainvestigacinfueevaluarlafertilidadenvacastpicasdepiede cra del norte del trpico veracruzano con influencia Bos taurus x Bos indicus inseminadas artificialmente a tiempo fijo (IATF) utilizando un innovador protocolo desincronizacin.ElestudioserealizdeEneroaMayodel2011.Lasvacasse pastorearon en un sistema rotativo de insurgentes (Brachiaria brizantha cv. Marand). Cuando las cras de las vacas tuvieron un promedio de edad de 120 das(40150)ylasnovillonasunpesode350kgseevalulacondicincorporal utilizandolaescala de 1 al9 (1 =emaciaday 9 =obesa) y fueron IATF (primer parto n = 35 novillonas n = 15 y vacas adultas n = 60). Cuatro tcnicos inseminaronlasvacasyseutilizaron3torosdiferentes.SeutilizolapruebadeJi cuadrada para determinar diferencia de fertilidad entre los grupos. La condicin corporaldelasunidadesexperimentalesfuede5.5.5.Noexistierondiferencias (P = .10) de fertilidad entre los 4 tcnicos inseminadores o los toros utilizados. Tampoco hubo diferencia (P = .10) entre novillonas, primparas y multparas. La fertilidad a un solo servicio en este estudio fue del 65%. En conclusin, el protocolodeIATFutilizadoenvacasynovillonastpicasdepiedecradeltrpico delNortedeVeracruzconunacondicincorporalmayora5enlaescalade1a9 ybajocondicionesdepastoreofavorablestuvounaexcelentefertilidad(65%)aun soloservicio. Palabrasclave:IATF,inseminacinartificial,trpico.

420

4CongresoInternacionalBiolgicoAgropecuario SimposioMedicinaVeterinariayZootecnia ISBN:9786070044489

Este ejemplar se termin de editar el 18 de octubre de 2011 en la Facultad de Ciencias Biolgicas y Agropecuarias CampusTuxpan. Tiraje:800ejempla

421