Está en la página 1de 258

C

UNIVERSIDAD DE LAS PALMAS DE GRAN CANARIA


Departamento de Psicología y Sociología

Tesis Doctoral

ACT I T UDES DE LOS EST UDIA NT ES


ACTITUDES DE ARIO
UNI VER SIT LOS ESTUDIANTES
S HACIA EL CUNIVERSITARIOS
EN T R O Y L OS
PR OFES ORES
HACIA EL CENTRO Y LOS PROFESORES

José Luís Tabares Santos

Las Palmas de Gran Canaria

2015
Departamento de Psicología y Sociología
TESIS DOCTORAL

ACTITUDES DE LOS ESTUDIANTES UNIVERSITARIOS HACIA EL


CENTRO Y LOS PROFESORES

Investigación presentada para la obtención del Grado de Doctor


a través del Programa de Doctorado Formación del Profesorado
del Departamento de Psicología y Sociología de la Universidad
de Las Palmas de Gran Canaria

AUTOR

José Luis Tabares Santos

DIRECTOR

José Manuel Izquierdo Ramírez

Las Palmas de Gran Canaria

Noviembre, 2015
A Mary Carmen

A mis padres

Al profesor Dr. José Manuel Izquierdo Ramírez por haber aceptado la dirección de este
trabajo, dedicación incondicional, y por su amistad e insistencia sin la cual no hubiese
podido llevar a cabo este trabajo.

A todos aquellos que me han apoyado en el desarrollo de este trabajo.

Finalmente, el agradecimiento más profundo para mi familia por el cariño y confianza


que me han brindado.

INTRODUCCIÓN I

PARTE I: JUSTIFICACIÓN TEÓRICA

Capítulo 1 LAS ACTITUDES: ESTRATEGIAS SOCIO AFECTIVAS EN EL 1


APRENDIZAJE
Introducción 3
1 Naturaleza de las actitudes 5
2 Modelos actitudinales 8
3 Componentes de la actitud 12
4 Características de las actitudes 15
5 Características básicas del sistema de actitudes 17
6 Función de las actitudes 19
7 Formación de las actitudes 21
8 Teorías y estrategias del cambio de actitudes 25
9 Medición de actitudes 36
10 Actitudes y aprendizaje 41

Capítulo 2 ACTITUDES, VALORES Y COMPORTAMIENTO 47

Introducción 49
1 Antecedentes teóricos 49
2 La interrelación de los valores con las estructuras cognitivas 54
3 La conexión entre los modelos expectativa-valor y los valores 55
4 La consistencia entre actitudes y valores 57
5 El estudio de las actitudes desde la perspectiva de los valores 59

Capítulo 3 EL ESTUDIO DE LAS ACTITUDES EN LA EDUCACIÓN SUPERIOR 67

Introducción 69
1 Actitudes y expectativas desde la perspectiva psicosocial educativa 71
2 Actitudes y expectativas desde la perspectiva de la calidad de
73
servicio
3 Actitudes y expectativas desde modelos mixtos de la calidad de
servicio
y enfoque socioeducativo 75
4 Actitudes y expectativas desde el ambiente académico 77
5 Conductas y actitudes relacionadas con creencias de autoeficacia
y locus de control 80

I
Capítulo 4 LA EVALUACIÓN DEL APRENDIZAJE 85

Introducción 87
1 La evaluación en psicología social 88
2 Evaluación en educación 90
3 Evaluación de las actitudes que intervienen en la dinámica del
95
centro
4 Evaluación de las actitudes de los estudiantes hacia el profesor 98
5 Cuestionario de actitudes académicas (CAA_FU) como recurso de
101
evaluación y diagnóstico

PARTE II: DISEÑO EMPÍRICO

Capítulo 5 DISEÑO METODOLÓGICO DE LA INVESTIGACIÓN DE ACTITUDES 109


Introducción 111
1 Objetivos 112
2 Variables objeto de estudio 114
3 Hipótesis 115
4 Método 116
5 Muestra 116
6 Diseño de las técnicas de investigación 122
Capítulo 6 ANÁLISIS DE RESULTADOS 127
Introducción 129
1 Análisis del modelo de investigación por medio de PLS 130
2 Análisis de las actitudes investigadas en la educación superior 147
Capítulo 7 DISCUSIÓN Y CONCLUSIONES 187
1 Discusión 189
2 Conclusiones 197

BIBLIOGRAFÍA 199
ANEXOS 225
A Instrucciones de aplicación del CAA_FU) 227
B Cuestionario de Actitudes Académicas, Forma Universitaria 228
C Datos de identificación de los estudiantes 231
D Análisis de correlación del CAA_FU 232
E Análisis Factorial del CAA_FU 234

II
ÍNDICE DE TABLAS
PAGINA
Tabla 1 Distribución de participantes según centro formativo 117
Tabla 2 Distribución de participantes según curso y centro formativo 117
Tabla 3 Distribución de participantes según modalidad de enseñanza 117
Tabla 4 Distribución según nivel y año académico. FCC Educación 118
Tabla 5 Distribución según nivel y año académico. ETULPGC 118
Tabla 6 Distribución según nivel y año académico. FCCAFD 119
Tabla 7 Nomenclatura de las variables latentes 132
Tabla 8 Relaciones previstas en el modelo 134
Tabla 9 Correlaciones simples de cada indicador con su constructo 136
Tabla 10 Propiedades de los constructos 138
Tabla 11 Las AVE y las correlaciones entre los constructos 140
Tabla 12 Tabla de correlaciones cruzadas 141
Tabla 13 Efectos directos, indirectos y totales, varianza explicada y test de la Q2 para las variables endógenas 144
Tabla 14 Test de GoF 145
Tabla 15 Contraste de Hipótesis 145
Tabla 16 Descriptivos. Actitudes hacia el centro según centro formativo 148
Tabla 17 Actitudes hacia el centro según centro. Estadísticos de contraste 149
Tabla 18 Comparación FCC Educación-ET ULPGC en las actitudes hacia el centro. Estadísticos de contraste 150
Tabla 19 Comparación FCC Educación-FCCAFD en las actitudes hacia el centro. Estadísticos de contraste 150
Tabla 20 Comparación ET ULPGC- FCCAFD en las actitudes hacia el centro. Estadísticos de contraste 150
Tabla 21 Actitudes hacia el profesor según centro. Estadísticos de contraste 151
Tabla 22 Comparación FCC Educación - ET_ULPGC en las actitudes hacia el profesor. Estadísticos de contraste 152
Tabla 23 Comparación FCC Educación- FCCAFD en las actitudes hacia el profesor. Estadísticos de contraste 152
Tabla 24 Comparación FCCAFD - ET_ULPGC en las actitudes hacia el profesor. Estadísticos de contraste. 152
Tabla 25 Descriptivos. Actitudes hacia el profesor según centro formativo 153
Tabla 26 Actitudes hacia el centro según modalidad de enseñanza. Estadísticos de contraste 155
Tabla 27 Descriptivos. Actitudes hacia el centro según modalidad de enseñanza 156
Tabla 28 Actitudes hacia el profesor según modalidad de enseñanza. Estadísticos de contraste 157
Tabla 29 Descriptivos Actitudes hacia el profesor según modalidad de enseñanza 159
Tabla 30 Actitudes hacia el centro según género. Modalidad presencial. Estadísticos de contraste 161
Tabla 31 Actitudes hacia el profesor según género EP. Estadísticos de contraste 162
Tabla 32 Descriptivos. Actitudes hacia el centro según género en enseñanza presencial 164
Tabla 33 Descriptivos. Actitudes hacia el profesor según género en enseñanza presencial 165
Tabla 34 Actitudes hacia el centro según sexo en enseñanza a distancia. Estadísticos de contraste 166
Tabla 35 Actitudes hacia el profesor según sexo en enseñanza a distancia. Estadísticos de contraste 166
Tabla 36 Descriptivos. Actitudes hacia el centro según género en enseñanza a distancia 167
Tabla 37 Descriptivos. Actitudes hacia el profesor según género en enseñanza a distancia 168
Tabla 38 Descriptivos. Actitudes hacia el centro según modalidad de enseñanza en alumnos de primer curso 171
Tabla 39 Actitudes hacia el centro según modalidad de enseñanza en alumnos de 1º nivel. Estadísticos de contraste 172
Tabla 40 Descriptivos. Actitudes hacia el centro según modalidad de enseñanza en alumnos de primer curso 173
Tabla 41 Actitudes hacia el profesor según modalidad de enseñanza en alumnos de primer curso. Estadísticos de contraste 174
Tabla 42 Actitudes hacia el centro según sexo en alumnos de primer curso 176
Tabla 43 Actitudes hacia el centro según sexo en alumnos de primer curso. Estadísticos de contraste 177
Tabla 44 Actitudes hacia el profesor según sexo en alumnos de primer curso 178
Tabla 45 Actitudes hacia el profesor según sexo en alumnos de primer curso. Estadísticos de contraste 179
Tabla 46 Comparativa de medias respecto a ámbito nacional, canario y de la ULPGC 181
Tabla 47 Baremo Actitudes hacia el centro, hacia el profesor y globales en FCC Educación 183
Tabla 48 Baremos. Actitudes hacia el centro, el profesor y globales en ET_ULPGC 183
Tabla 49 Baremo. Actitudes hacia el centro, el profesor y globales en FCCAFD 184
Tabla 50 Estadísticos de los elementos CAA-FU Global 184
Tabla 51 Relaciones de cada elemento con el CAA-FU Global 185
Tabla 52 Correlaciones entre actitud hacia el centro y hacia el profesor 232
Tabla 53 Correlaciones entre matices socio-afectivos 233
Tabla 54 Kaiser -Meyer-Olkin y prueba de esfericidad de Barlett 235

III
ÍNDICE DE FIGURAS PAGINA
Figura 1 La teoría de la conducta planificada (adaptada de Ajzen, 1991} 42
Figura 2 Modelo teórico de las relaciones entre los tipos motivacionales (adaptado de Schwartz, 2001) 61
Figura 3 Elementos asociados a las Estrategias Socio-afectivas hacia el Centro,
según Izquierdo. Nota: adaptado de Izquierdo, 2004. Tesis Doctoral no publicada 103
Figura 4 Elementos asociados a las Estrategias Socio-afectivas hacia el Profesor
Según Izquierdo. Nota: adaptado de Izquierdo (2004).Tesis Doctoral no publicada 104
Figura 5 Estructura del Cuestionario de Actitudes Académicas (CAA-FU), según Martin Nota: Adaptado de Martín (2003). 105
Figura 6 Sexo según centro formativo. 118
Figura 7 Distribución de la edad según centro formativo. 119
Figura 8 Distribución según edad y sexo en Enseñanza presencial. 120
Figura 9 Distribución según edad y sexo en Enseñanza a distancia. 120
Figura 10 Distribución según sexo y edad. FCC. Educación. 121
Figura 11 Distribución según sexo y edad. ETULPGC. 121
Figura 12 Distribución según sexo y edad. FCCAFD 121
Figura 13 Modelo de Análisis de PLS. Elaboración propia a partir de Barclay et al., 1995. 131
Figura 14 Creación de variables latentes. 134
Figura 15 Modelo de medida. 142
Figura 16 Modelo estructural. 146
Figura 17 Distribución de las actitudes hacia el centro según centro. 149
Figura 18 Comparativa de medias de los matices implicados en la actitud hacia el centro según centro. 151
Figura 19 Distribución de las actitudes hacia el profesor según centro. 154
Figura 20 Comparativa de medias de los matices implicados en la actitud hacia el profesor según centro. 154
Figura 21 Comparativa media de actitudes hacia el centro y hacia el profesor según centro. 154
Figura 22 Distribución de las actitudes globales según centro. 155
Figura 23 Distribución de las actitudes hacia el centro según modalidad de enseñanza. 157
Figura 24 Comparativa de medias de matices socio-afectivos de las actitudes hacia el centro según modalidad de enseñanza. 157
Figura 25 Distribución de las actitudes hacia el profesor según modalidad de enseñanza. 158
Figura 26 Comparativa de medias de los matices socio-afectivos implicados en la actitud hacia el profesor según modalidad de enseñanza. 160
Figura 27 Comparativa actitudes hacia el centro y hacia el profesor según modalidad de enseñanza. 160
Figura 28 Distribución de las actitudes globales según modalidad de enseñanza. 160
Figura 29 Comparativa según sexo en los matices implicados en la actitud hacia el profesor 162
Figura 30 Comparativa actitudes hacia el centro y el profesor según sexo en modalidad presencial 162
Figura 31 Distribución de las actitudes hacia el profesor según sexo en enseñanza presencial 163
Figura 32 Distribución de las actitudes hacia el centro según sexo en enseñanza presencial 163
Figura 33 Distribución de las actitudes globales según sexo en enseñanza presencial 163
Figura 34 Comparativa de matices implicados en actitud hacia el profesor según sexo en enseñanza a distancia 169
Figura 35 Comparativa actitudes hacia el centro y hacia el profesor según sexo en enseñanza a distancia 169
Figura 36 Distribución de las actitudes hacia el profesor según sexo en enseñanza a distancia. 169
Figura 37 Distribución de las actitudes hacia el centro según sexo en enseñanza a distancia. 170
Figura 38 Distribución de las actitudes globales según sexo en enseñanza a distancia 170
Figura 39 Distribución de las actitudes hacia el centro según modalidad de enseñanza en alumnos de primer curso. 172
Figura 40 Comparativa de matices socio-afectivos hacia el centro según modalidad de enseñanza en alumnos de primer curso 172
Figura 41 Actitudes hacia el profesor según modalidad de enseñanza en alumnos de primer curso. 174
Figura 42 Comparativo matices socio- afectivos implicados en la actitud hacia el profesor según modalidad de enseñanza en alumnos de primer curso. 174
Figura 43 Comparativo actitudes hacia el centro y hacia el profesor según modalidad de enseñanza 175
Figura 44 Distribución de actitudes globales según modalidad de enseñanza en alumnos de primer curso 175
Figura 45 Distribución de actitudes hacia el centro según sexo en el alumnado de primer curso. 177
Figura 46 Comparativo de matices socio-afectivos implicados en la actitudhacia el centro según sexo en alumnos de primer curso. 177
Figura 47 Distribución de actitudes hacia el profesor según sexo en alumnos de primer curso. 179
Figura 48 Comparativa matices socio-afectivos implicados en las actitudes hacia el centro según sexo en alumnos de primer curso 180
Figura 49 Comparativa actitudes hacia el centro y hacia el profesor según sexo en alumnos de primer curso. 180
Figura 50 Distribución de las actitudes globales según sexo en alumnos de primer curso. 180
Figura 51 Comparativa de medias (nacional, canaria, y medias extraídas a partir de la investigación. 182
Figura 52 Gráfico de sedimentación. 236

V
ABREVIATURAS
ALFA S Cuestionario de Hábitos y Actitudes Escolares, Forma S
CAA-FU Cuestionario de Actitudes Académicas Forma Universitaria
CES Classroom Enviroment Scale
COP Colegio Oficial de Psicólogos
CPA Cuestionario de Percepciones Académicas
CSEQ College Students Expectation Questionnaire
EaD Enseñanza a distancia
EFPPA Federación Europea de Asociaciones Profesionales de Psicólogos
ELPO Expectations Led Planned Organisation
EP Enseñanza Presencial
ET_ULPGC Enseñanza de Teleformación de la Universidad de Las Palmas de Gran Canaria
FCC Educación Facultad de Ciencias de la Educación
FCCAFD. Facultad de Ciencias de la Actividad Fisica y el Deporte
IPQ Instructions Preferent Questionnaire
ITC Comisión Internacional de Tests
PLS Partial Least Squares
QVA Cuestionario de Vivencias Académicas
SERVQUAL Múltiple-Ítem Scale For Measuring Customer Perceptions of Service Quality
TA teoría de autorregulación
TAP/TPB Teoría de la acción planificada
TAR /TRA Teoría de la acción razonada
USET Cuestionario University Students' Expectations of Teaching

VII
INTRODUCCION

La presente investigación analiza aspectos considerados importantes en las relaciones


establecidas en contextos universitarios de aprendizaje, hablamos de las actitudes que
los estudiantes generan ante diferentes situaciones y personas. Actitudes hacia el centro
de estudios donde han decidido realizar su formación universitaria y disposiciones
psicosociales hacia los agentes implicados en dicho proceso, los profesores.

Revisamos las investigaciones relacionadas con la formación académica, desde


diferentes perspectivas, tomando como referencia los principales modelos teóricos de la
Psicología Social, la Sociología de la Educación y la Psicología de la Educación, en las
orientaciones paradigmáticas que se han ido desarrollando a lo largo del tiempo y en las
emergentes.

Hablamos de nuevas formas de aprender, autónoma y autorregulada, donde centros y


profesores deben adaptarse a nuevos tiempos, donde el estudiante tiene a su alcance una
gran cantidad de recursos en red que le sirven para compatibilizar la formación
académica con cualquier actividad profesional o lúdica. Por ello consideramos necesario
desplazar todo el protagonismo del centro y de los profesores a actividades relacionadas
con la mediación social y la orientación educativa. Bajo esta nueva forma de hacer, las
actitudes juegan un papel destacado y esta es razón suficiente para tener la curiosidad de
su investigación.

Si al centro nos referimos, debemos saber qué reacciones presentan los estudiantes
universitarios hacia las normas y sistemas de regulación interna definidos, el interés y
motivación por la participación activa en el mismo, tanto académica como social,
aceptación de los sistemas de enseñanza y por supuesto las formas y criterios de
evaluación de los aprendizajes realizados.

Si de los profesores se trata, es muy importante conocer la forma en la que los


estudiantes universitarios perciben a sus profesores. Personas con los que pueden
mantener un nivel de comprensión y comunicación fluida; habilidad de liderazgo del
profesor y los estilos que normalmente utiliza (autoritario, democrático, paternalista,
dejar hacer, etc.) nivel de exigencia en tareas y actividades propuestas y especialmente
estilos y criterios de evaluación que aplica a los estudiantes. A fin de cuentas serán los
profesores los que habilitarán a los estudiantes como profesionales de la titulación que
están realizando.

IX
Esta investigación pretende medir y evaluar el grado de importancia y cumplimiento de
estas variables psicosociales en estudiantes universitarios de Grado, en la modalidad de
Enseñanza Presencial (EP) y Enseñanza a Distancia (EaD) en la ULPGC.

En resumen, en nuestro empeño de conocer más y mejor las entrañas de la educación y


formación, sabemos por las investigaciones revisadas, la importancia que tienen las
variables emotivas y afectivas en el proceso; dentro de ellas conocemos que actitudes y
valores juegan un papel destacado; razón por la cual hemos apostado por investigar
estas dimensiones del ser humano en el contexto natural de la formación universitaria.
La finalidad última de la presente investigación es, una vez se analicen los resultados,
llegar a conclusiones que orienten las acciones y ejecuciones pertinentes para el diseño
de estrategias de afrontamiento que den respuesta a las nuevas necesidades en contextos
de aprendizaje universitario.

El proceso de investigación se ha organizado secuencialmente en una primera fase de


fundamentación teórica a partir de las investigaciones de la Psicología Social, la
Sociología de la Educación, y Psicología de la Educación, respecto a las actitudes de
los estudiantes universitarios hacia el centro y hacia el profesor como figuras
articuladoras del proceso académico de la enseñanza superior.

En el Capítulo 1 se analizan las actitudes en relación de las estrategias socio afectivas de


los estudiantes, expresados a través de las variables que influyen sustancialmente en el
proceso de aprendizaje. Según los distintos modelos teóricos examinamos la relación
entre actitud y acción, y su vinculación con el objeto de conocimiento de los distintos
procesos de aprendizaje. Para establecer las bases teóricas de los paradigmas en los que
sustenta la presente investigación, se describen los distintos aspectos que componen el
proceso actitudinal: su naturaleza, componentes, características, función, cambio, y
evaluación. A partir de ahí, estudiamos las teorías actitudinales aplicadas al aprendizaje
centrándonos en los diferentes modelos de actitudes basadas en la expectativa-valor.

Posteriormente nos centramos en la conexión jerárquica entre valor-actitud-conducta


reflejada en el capítulo 2, en el que se estudia los aspectos cognitivos y normativos de
los valores y su expresión a través de las actitudes. Con ello, se pretende mostrar la
conexión entre ambos conceptos y su complejidad al incorporar distintas variables
situacionales y personales, e integrarlas en una explicación más consistente del
comportamiento individual y social.
X
En Capítulo 3 damos cuenta de las investigaciones que se están desarrollando en el
ámbito universitario a escala internacional, y que de alguna manera nos proporciona un
marco de referencia sobre el alcance de las investigaciones sobre actitudes expresadas a
través de expectativas, percepciones de la experiencia académica, y clima social en el
que se desenvuelve el aprendizaje. En cierta manera, dicha exposición avala el camino
emprendido respecto al objeto de investigación elegido.

La evaluación actitudinal se presenta en el Capítulo 4 mediante la descripción de las


variables que son objeto central de nuestra investigación, plasmada en el Cuestionario
de Actitudes Académicas aplicado al ámbito universitario (CAA-FU).

En el Capítulo 5 está destinado a justificar el diseño metodológico de investigación


desplegado en función de los objetivos programados, y a describir los distintos
componentes del proceso de investigación formado por el marco de hipótesis de
investigación, los instrumentos técnicos utilizados durante el proceso de recogida de
información y el análisis de los datos.

En el Capítulo 6 se muestran los resultados obtenidos en la investigación, realizando los


análisis pertinentes de aquellas variables que son relevantes para el estudio, y para
diseñar futuras hipótesis de trabajo y nuevas respuestas dentro de las líneas de
investigación en la que nos situamos. Se desarrolla bajo una doble perspectiva, por una
parte se realiza un estudio confirmatorio de los modelos teóricos que sustentan el hilo
conductor de la presente investigación, utilizando para ello el Análisis de
Ecuaciones Estructurales sobre las puntuaciones obtenidas en los matices o escalas
actitudinales utilizadas en el Cuestionario de Actitudes Académicas (CAA-FU). Por
otra, se lleva a cabo las comparaciones de las puntuaciones entre las modalidades
de enseñanza presencial y a distancia según los matices estudiados, así como
diferencias en las puntuaciones según el género o tipo de centro.

El Capítulo 7 es el cierre de la investigación, con un análisis y reflexión sobre los


hallazgos y limitaciones relevantes de la investigación para llegar a la exposición de las
conclusiones a las que se ha llegado.

Finalmente, en los Anexos se registran los datos que se consideran importantes para una
adecuada comprensión de la información contenida en la presente Tesis, y que no se han
incluido en el cuerpo del trabajo, dadas las características de la información relativa al
Cuestionario utilizado.

XI

/$6$&7,78'(6
Capítulo 1
(675$7(*,$662&,2
$)(&7,9$6(1(/
$35(1',=$-(
&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

,1752'8&&,21

/RV DSUHQGL]DMHV UHTXLHUHQ GHO HVWXGLDQWH FLHUWDV FDSDFLGDGHV PRWLYDFLyQ


FRQRFLPLHQWRV \ HVWUDWHJLDV HGXFDWLYDV 3HUR SDUD UHDOL]DU XQ ySWLPR DSUHQGL]DMH HV
QHFHVDULR VDEHU FyPR KDFHUOR \D TXH ODV HVWUDWHJLDV GH HQVHxDQ]D \ DSUHQGL]DMH QR
SXHGHQ TXHGDU UHGXFLGDV DO VLPSOH DQiOLVLV GH GHWHUPLQDGRV UHFXUVRV FRJQLWLYRV
IDFLOLWDGRUHV VLHQGR SUHFLVR UHFXUULU D ORV DVSHFWRV DFWLWXGLQDOHV TXH VRQ ORV TXH HQ
~OWLPD LQVWDQFLD FRQGLFLRQDQ OD SXHVWD HQ PDUFKD GH GLFKDV HVWUDWHJLDV 3DUD HOOR HV
QHFHVDULR FRQRFHU FRPR VH DFWLYDQ ODV DFWLWXGHV TXH IDYRUHFHQ FRPSRUWDPLHQWRV
DGHFXDGRVDODHVWUDWHJLDGHDSUHQGL]DMH

'HVGH ORV LQLFLRV FRPR GLVFLSOLQD OD 3VLFRORJtD 6RFLDO KD LGR HODERUDQGR GLIHUHQWHV
KLSyWHVLV \ FRQVWUXFWRV WHyULFRV HQWHQGLHQGR FRPR WDO HO SURFHVR R HQWLGDG TXH
 VXSRQHPRV H[LVWH D~Q FXDQGR QR VHD GLUHFWDPHQWH REVHUYDEOH QL FXDQWLILFDEOH
GHVWLQDGRDFRPSUHQGHU\PHGLUDVSHFWRVGHOFRPSRUWDPLHQWRKXPDQR

/D LQYHVWLJDFLyQ GH DFWLWXGHV KD WUDQVFXUULGR SRU VXFHVLYDV IDVHV GH LQYHVWLJDFLyQ TXH
KDQGDGROXJDUDXQPD\RUFRQRFLPLHQWRGHOFRQVWUXFWR(OSULPHURFRUUHVSRQGLHQWHD
ORV DxRV WUHLQWD VH FHQWUD HQ OD HYDOXDFLyQ GH ODV DFWLWXGHV HO VHJXQGR FRPSUHQGLGR
HQWUHORVDxRVFLQFXHQWD\VHVHQWDDEDUFDOD PD\RU SDUWH GH ODVWHRUtDVGHOFDPELRGH
DFWLWXGHV HO WHUFHUR HVWi WRGDYtD HQ FXUVR \ VH FHQWUD HQ ORV VLVWHPDV DFWLWXGLQDOHV
0F*XLUH   DQDOL]DGRV GHQWUR GH HVWUXFWXUDV FRJQLWLYDV LQGLYLGXDOHV \ VRFLDOHV
VHJ~QYDULDGDVSHUVSHFWLYDVUHODFLRQDGDVFRQODFRJQLFLyQVRFLDO

(O HVWXGLR GH ODV DFWLWXGHV KD VLGR XQ FRQFHSWR GH JUDQ LPSRUWDQFLD SDUD ODV WHRUtDV H
LQYHVWLJDFLRQHVHQ3VLFRORJtD6RFLDO &RPRDILUPDQ%ULxRO)DOFHV\%HFHUUD 
S /DDILUPDFLyQGH*:$OOSRUW  VHJ~QODFXDO³HOFRQFHSWRGHDFWLWXGHV
SUREDEOHPHQWHHOPiVGLVWLQWLYRHLQGLVSHQVDEOHGHOD3VLFRORJtDVRFLDO´ S SDUHFH
VHJXLU YLJHQWH KR\ HQ GtD D MX]JDU SRU HO LQJHQWH Q~PHUR GH SXEOLFDFLRQHV FLHQWtILFDV
TXH WLHQHQ FRPR REMHWLYR SULQFLSDO HO IHQyPHQR DFWLWXGLQDO SRU HMHPSOR $OEDUUDFtQ
-RQKVRQ\=DQQD(DJO\\&KDLNHQ)D]LR\2OVRQ+DGGRFN\0DLR
0DLR\2OVRQ HQWHQGHPRVSRUWDQWRTXHHVYiOLGDGLFKDDILUPDFLyQHQHO
PRPHQWRDFWXDO 3HWW\:HJHQHU\)DEULJDU 

$ VX YH] ODV DFWLWXGHV KDQ WHQLGR DSRUWDFLRQHV VLJQLILFDWLYDV HQ ODV LQYHVWLJDFLRQHV
VREUHDVSHFWRVUHODFLRQDGRVFRQODHGXFDFLyQ\HODSUHQGL]DMH )LVKEHLQ\$M]HQ 

3

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

OD 3VLFRORJtD GH OD 3HUVRQDOLGDG 5RNHDFK   'HVGH HVWD RULHQWDFLyQ HO HVWXGLR GH ODV
DFWLWXGHVQRVSHUPLWHSRUXQODGRSUHGHFLUODFRQGXFWDGHORVLQGLYLGXRV\WHQHUXQDLPDJHQ
HVWDEOHGHOPXQGR\SRURWURGHVHQWUDxDU ODV GLVWLQWDVVLWXDFLRQHVDODVTXHHOVXMHWR GHEH
HQIUHQWDUVH

$FWXDOPHQWH VH FRQVLGHUD TXH ODV DFWLWXGHV VRQ XQ FRPSRQHQWH IXQGDPHQWDO GH ODV
HVWUXFWXUDVFRJQLWLYDVTXHHVWiQLQWHJUDGDVHQODSHUVRQDOLGDGGHFDGDLQGLYLGXRVLHQGR
HVHQFLDO FRQRFHUODV D QLYHO FRQFHSWXDO SDUD SRGHU ORFDOL]DUODV HQ FDGD VXMHWR \ TXH
GHVGH HVH PLVPR FRQRFLPLHQWR SRGHU LQWHUYHQLU GH IRUPD SRVLWLYD < DGHPiV
UHTXLHUHQVHUHVSHFLILFDGDVHQXQVLVWHPDPiVDPSOLRHQHOTXHLQWHUYLHQHQODVLWXDFLyQ
VRFLDOHLQGLYLGXDO\FDUDFWHUtVWLFDVGHODSHUVRQDOLGDG

6H SDUWH GH OD FRQVLGHUDFLyQ GH TXH QR EDVWD FRQ GLVHxDU HVWUDWHJLDV SDUD GHVDUUROODU
VRODPHQWH FDSDFLGDGHV SURFHVRV FRJQLWLYRV  VLQR TXH FRPR \D KHPRV DSXQWDGR HV

QHFHVDULR GDU XQD WRQDOLGDG HPRWLYRDIHFWLYD D ODV PLVPDV 'HVGH HVWD RULHQWDFLyQ
LQWURGXFLPRV ODV DFWLWXGHV HQ ODV DFWLYLGDGHV GH DSUHQGL]DMH \ ODV FRQVLGHUDPRV
HVWUDWHJLDV VRFLRDIHFWLYDVGHaOaaenseñanzaayDSUHQGL]DMHGHPDQHUDTXHDKRUDODHVWUDWHJLD
FRQVWDUi GH GHVWUH]DV FRQWHQLGRV PpWRGRV \ DFWLWXGHV \ VH RULHQWDUiQ KDFLD HO
GHVDUUROORGHODVFDSDFLGDGHV\ORVYDORUHV SURFHVRVFRJQLWLYRV\DIHFWLYRV 

/RV YDORUHV VH GHVDUUROODQ D WUDYpV GH OD FDGHQD MHUiUTXLFD YDORUHV DFWLWXGHV \ FRQGXFWD
H[SUHViQGRVH HQ GLIHUHQWHV FRQWH[WRV HGXFDWLYRV \ UHODFLRQDOHV HQWUH ORV TXH LQFOXLPRV
FRQWHQLGRVQRUPDVLPLWDFLyQGHPRGHORVFOLPDGHODFODVHH[SHFWDWLYDVGHOSURIHVRUHWFSHUR
VREUH WRGR SRU PHGLR GH DFWLYLGDGHV HQWHQGLGDV FRPR HVWUDWHJLDV GHO SURFHVR GH HQVHxDQ]D \
DSUHQGL]DMHHQHOTXHHOGHVDUUROORGHODFRJQLFLyQ\GHODDIHFWLYLGDGMXHJDQXQSDSHOFODYH

$Vt SXHV FRQVLGHUDGDV ODV DFWLWXGHV FRPR HVWUDWHJLDV VRFLRDIHFWLYDV HQ HO SURFHVR GH
HQVHxDQ]D DSUHQGL]DMH OD RULHQWDFLyQ SUHVHQWH LQYHVWLJD HO SDSHO HVWUDWpJLFR TXH
FXPSOHQ SDUD SURPRYHU XQ DSUHQGL]DMH PiV VLJQLILFDWLYR SDUD HO DOXPQR PHGLDQWH OD
SURPRFLyQGHDFWLWXGHVSRVLWLYDVKDFLDHOFHQWURHOSURIHVRU\ODDFWLYLGDGHGXFDWLYD

/D LQYHVWLJDFLyQ HQ HO GRPLQLR GH OD HQVHxDQ]D D\XGD D HQWHQGHU FyPR VRQ ODV
DFWLWXGHV HQ UHODFLyQ D ORV SURFHVRV GH HQVHxDQ]D \ DSUHQGL]DMH HQ HO PDUFR GH OD
HGXFDFLyQVXSHULRUFyPRVHIRUPDQ\VHPDQWLHQHQFyPR VRQODVDFWLWXGHVUHIHULGDVD
OD SDUWLFLSDFLyQ \ D ODV DFWLYLGDGHV HGXFDWLYDV HVSHFtILFDV \ FyPR SRGHPRV GLYXOJDU
HVWDVDFWLWXGHV\DTXHVRQLPSRUWDQWHVSDUDGHVDUUROODUFRPSHWHQFLDVLQWHULQGLYLGXDOHV

4

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

TXHPHMRUHQODVSRWHQFLDOLGDGHVGHODOXPQDGRVREUHVXSURSLRDSUHQGL]DMHHQEHQHILFLR
SURSLR\GHODVRFLHGDG

/DVIRUPDVDIHFWLYDVTXHDFRPSDxDQDOSURFHVRGHHQVHxDQ]D\DSUHQGL]DMHVRQHOPRGR
SULQFLSDOSDUDGHVDUUROODUHVWRVSURFHVRVVLHQGRSRUWDQWRODPHWRGRORJtDTXHVXVWHQWD
ORV DSUHQGL]DMHV VLJQLILFDWLYRV GHO HVWXGLDQWH SDUD JDQDU HQ PRWLYDFLyQ PD\RU
DXWRQRPtD\UHVSRQVDELOLGDGVREUHVXSURSLRDSUHQGL]DMH(VHQODXQLGDGHQWUHSURFHVRV
FRJQLWLYRV\ DIHFWLYRVGRQGHVHDUWLFXODQFDSDFLGDGHV\DFWLWXGHV\GRWDQGHVHQWLGRD
ODVFDSDFLGDGHV\YDORUHVGHVDUUROODGRVSRUPHGLRGHFRQWHQLGRV\PpWRGRV

1XHVWUR LQWHUpV HVWi FHQWUDGR HQ ODV DFWLWXGHV UHVSHFWR GHO SURFHVR GH HQVHxDQ]D \ VX
DSUHQGL]DMHSDUDORFXDOHVQHFHVDULR VHxDODUODVOtQHDVIXQGDPHQWDOHVGHODVDFWLWXGHV
HQJHQHUDOFRPRVRQVXQDWXUDOH]DHO SURFHVRGHIRUPDFLyQODSRVLELOLGDGGHFDPELR
GH ODV PLVPDV LQWHUYHQFLyQ  \ OD HYDOXDFLyQ SDUD GH HVWD IRUPD SRGHU OOHJDU D

FRQFOXVLRQHVFRQVLVWHQWHVFXDQGRVHUHILHUDQ DVLWXDFLRQHVHGXFDWLYDVFRQFUHWDV

 1$785$/(=$'(/$6$&7,78'(6

(O HVWXGLR GH ODV DFWLWXGHV HV XQ iUHD GH FRQIOXHQFLD LQWHUGLVFLSOLQDULD HQ ODV FLHQFLDV
VRFLDOHVHVSHFtILFDPHQWHHQOD6RFLRORJtD\3VLFRORJtD

/D LQWURGXFFLyQ GHO WpUPLQR DFWLWXG DSDUHFH SRU SULPHUD YH] HQ ORV ³3ULQFLSLRV´ GH
6SHQFHU HQ  TXH VRVWHQtD TXH HQ OD PHQWH GHO LQGLYLGXR H[LVWtDQ SDWURQHV
GLVSRVLFLRQDOHV TXH LQIOXtDQ HQ VX SHUFHSFLyQ GH ODV VLWXDFLRQHV $OJR PiV WDUGH HV
XWLOL]DGR VHJ~Q .DKOH   SRU 'DUZLQ (NPDQ \ 3URGJHU   HQ VX OLEUR
e[SUHVVLRQ RI WKH HPRWLRQV LQ PHQ DQG DQLPDOV SXEOLFDGR HQ “... la actitud
implica respuestas motoras estereotipadas asociadas a la expresión de una emoción y
hacen referencia a la postura de todo el cuerpo” (p.81).

$OOSRUW  VHxDODXQRULJHQGHOFRQFHSWRFRQODSVLFRORJtDH[SHULPHQWDOGHOD~OWLPD


SDUWH GHO VLJOR ;,; TXH XWLOL]DEDQ FLHUWRV SUHFXUVRUHV GH OD DFWLWXG FRPR GLVSRVLFLyQ
PXVFXODUDFWLWXGGHWDUHDDFWLWXGHVPHQWDOHV\PRWRUDV\WHQGHQFLDVGHWHUPLQDQWHV(O
TXH WDO FRQWHQLGR VHD FUHtGR R GHVHDGR\ODSHFXOLDUDFWLWXGSVLFROyJLFDTXHVHDGRSWD
KDFHTXH“... lleguemos a creer todas las verdades acerca de las partes del mundo que
nos rodea si estamos colocados en una posición adecuada como para aprender”.
'HQQHWWS 

5

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

3RVWHULRUPHQWH HO FRQFHSWR GH DFWLWXG HV UHFRJLGR SRU OD WUDGLFLyQ SVLFRDQDOtWLFD
SDVDQGRSRU~OWLPRDOD6RFLRORJtD(QHOFDPSRGHOD6RFLRORJtDDSDUHFHSRUSULPHUD
YH] HQ OD REUD GH 7KRPDV \ =QDQLHFNL   VREUH HO FDPSHVLQR SRODFR HQ $PpULFD
FRQFHSWXDOL]iQGRODFRPRWHQGHQFLDVVXEMHWLYDVDDFWXDU

(VWDV SULPHUDV GHILQLFLRQHV HO PDUFR WHyULFR FRQFHSWXDO GH ODV DFWLWXGHV DSXQWDQ D
FDUDFWHUL]DUODV FRPR LQGLYLGXDOHV \ PHQWDOHV \ DGROHFHQ GH ORV GHVDUUROORV DQDOtWLFRV
SRVWHULRUHV TXH LQWHJUDUDQ GHQWUR GHO FRQFHSWR GH DFWLWXG ODV UHDOLGDGHV VRFLDOHV
SUHVHQWHVHQODHVWUXFWXUDVRFLDO

'HQWUR GH HVWD SHUVSHFWLYD LQGLYLGXDO ODV FRQFHSWXDOL]DFLRQHV GH %RHNDHUWV 
PDWL]DQTXHFXDQGRVHKDEODGHODVDFWLWXGHVFRPRHVWDGRPHQWDOVHHVWiQUHILULHQGRD
HVWDGRV DIHFWLYRV R HPRFLRQDOHV DGDSWDWLYRV TXH VH GHVDUUROODUtDQ SDUD UHVWDEOHFHU HO
HTXLOLEULRDQWHVLWXDFLRQHVGHULHVJRTXHDIHFWDQDOELHQHVWDUSHUVRQDO(VWDSRVLFLyQHV

ODTXHHQJHQHUDOVHFRPSDUWHHQHOiPELWRGHODSVLFRORJtDVRFLDOVLJXLHQGRODWHRUtDGH
)LVKEHLQ\$M]HQ  

$Vt GH HVWD IRUPD SRU VX FDUiFWHUGLVWLQWLYRHPRFLRQDO \DGDSWDWLYRODV DFWLWXGHVVRQ


HVWDGRV PHQWDOHV LQWHQFLRQDOHV TXH UHTXLHUHQ FRPSURPLVR \ GHIHQVD SRU SDUWH GHO
LQGLYLGXR \ ~QLFDPHQWH VRQ GHVFULELEOHV FRPR DFWLWXGHV SVLFROyJLFDV KDFLD XQ
FRQWHQLGRSURSRVLFLRQDO

(Q HVWH VHQWLGR ODV DFWLWXGHV VRQ UDVJRV TXH SUHGLVSRQHQ DO LQGLYLGXR KDFLD FLHUWDV
DFFLRQHVSHURKD\WHQHUHQFXHQWDORVGLVWLQWRVQLYHOHVFRQFHSWXDOHVTXHLQIOX\HQHQODV
SUHGLVSRVLFLRQHV JOREDOHV GH OD DFFLyQ TXH SHUPLWLUiQ H[SOLFDU HO FRPSRUWDPLHQWR
UHODFLRQDGRFRQODVDFWLWXGHV

(QODE~VTXHGDGHODH[SOLFDFLyQGHODVDFWLWXGHVDGHPiVGHODSHUVRQDOLGDGKD\TXH
WHQHU HQ FXHQWD OD GLQiPLFD GH ODV HVWUXFWXUDV HGXFDWLYDV HQ VXV GLVWLQWRV QLYHOHV GH
HVSHFLILFLGDG ODV FRQGLFLRQHV HVSHFtILFDV GH ODV VLWXDFLRQHV HQ ODV TXH RSHUD HO
LQGLYLGXR \ OD SRVLFLyQ TXH RFXSD HQ ODV PLVPDV DVt FRPR ODV IXQFLRQHV TXH ODV
DFWLWXGHV SXHGHQ GHVHPSHxDU SDUD HO LQGLYLGXR PLVPR 1R VH SXHGH HVWDEOHFHU XQD
UHODFLyQOLQHDOHQWUHDFWLWXGHV\FRQGXFWDSXHVHOFDPSRFRQFHSWXDOGHODVDFWLWXGHVHVWi
PHGLDWL]DGRSRUORVHOHPHQWRVFRQFHSWXDOHVUHVHxDGRV

7DPELpQ HV FRQYHQLHQWH GLIHUHQFLDU HQWUH DFWLWXGHV FUHHQFLDV \ YDORUHV &DGD XQR GH
HVWRVFRQFHSWRVVXSRQHIRUPDVGLIHUHQWHVGHHVWDGRPHQWDO\FDGDXQRGHHOORVWLHQHVXV

6

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

SURSLDV IRUPDV GH UHVSXHVWD D ORV REMHWRV R VLWXDFLRQHV VRFLDOHV /RV YDORUHV VRQ PiV
FHQWUDOHV\UHVLVWHQWHVDFXDOTXLHUFDPELRWHQLHQGRXQDGLPHQVLyQSUHVFULSWLYDEDVDGD
HQ OD FUHHQFLD GH TXH HO REMHWR VREUH HO TXH VH IRFDOL]DQ HV GHVHDEOH PDV DOOi GH OD
SURSLDSRVLFLyQGHODSHUVRQDVREUHREMHWRV\VLWXDFLRQHV

'HLJXDOIRUPDODVDFWLWXGHVVHGLVWLQJXHQGHODVFRJQLFLRQHVRFUHHQFLDVSRUVXFDUiFWHU
HYDOXDWLYRRSUHVHQFLDGHODIHFWRHQODSHUVRQDVREUHODVFXHVWLRQHVDODVTXHVHUHILHUH

/DVDFWLWXGHVVHGLIHUHQFLDQGHODVKDELOLGDGHVRDSWLWXGHVQRVRORSRUODSUHVHQFLDGHXQ
FRPSRQHQWHDIHFWLYRVLQRSRUTXHODPHUDSUHVHQFLDGHOREMHWRRVLWXDFLyQGHODDFWLWXG
HV VXILFLHQWH SDUD GHVHQFDGHQDU OD UHVSXHVWD SUHSDUDGD OD FXDO QR UHTXLHUH XQD
PRWLYDFLyQDGLFLRQDO

/D FDSDFLGDG GH XQ VXMHWR SDUD GDU FXHQWD GH VXV DFFLRQHV PDUFD OD IURQWHUD HQWUH
 DFWLWXG \ KiELWR HO KiELWR HV XQD DFFLyQ DXWRPiWLFD \ VH H[SUHVD HQ OD SUiFWLFD
FRWLGLDQD 

6LHQGR HO FRQFHSWR GH DFWLWXG XQR GH ORV PiV GLVWLQWLYRV H LQGLVSHQVDEOHV GH OD
SVLFRORJtD VRFLDO WDPELpQ KD JHQHUDGR XQ JUDQ GHEDWH HQ WRUQR D OD YDULHGDG GH
GHILQLFLRQHV \ VX UHOHYDQFLD FRPR LQVWUXPHQWR GH DQiOLVLV GH XQD UHDOLGDG SVLFRVRFLDO
TXHVHSUHVHQWDDPELJXD\GLItFLOGHHVWXGLDU1RREVWDQWH\DSHVDUGHHVWDGLYHUVLGDG
ODPD\RUtDGHODVGHILQLFLRQHVSXHGHQDJUXSDUVHHQWUHVJUXSRV

8QSULPHUJUXSRTXHODFRQFLEHQHQWpUPLQRVGHHYDOXDFLyQ(DJO\\&KDLNHQ  OD


GHILQHQ FRPR “una tendencia psicológica que se expresa por la evaluación de una
particular entidad con algún grado favorable o desfavorable…” S 

/RV TXH OD FRQFLEHQ FRPR XQ DIHFWR DVt SDUD *UHHQZDOG   OD DFWLWXG HV"… el
afecto asociado con un objeto mental” S 

2WURJUXSRGHWHyULFRVHQWUHORVTXHGHVWDFD.UXJODQVNL  GHILQHQODDFWLWXGFRPR


“… un especial tipo de conocimiento, especialmente conocimientos cuyo contenido es
evaluativo o afectivo” S 

2 ELHQ WHyULFRV FRPR 7ULDQGLV   TXH FRQVLGHUDQ ODV DFWLWXGHV FRPR
SUHGLVSRVLFLRQHV FRQGXFWXDOHV ³… el estado de una persona que predispone a una
respuesta favorable o desfavorable en relación a un objeto, persona, o idea” S 

7

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

< SRU ~OWLPR OD SRVLFLyQ PiV H[WHQGLGD HVWi IRUPDGD SRU WHyULFRV FRPR %UHFNOHU
 (DJO\\&KDLNHQ  0F*XLUH  \5RVHQEHUJ\+RYODQG  TXH
GHVGHODRULHQWDFLyQFRJQLWLYDSURSRQHQXQHVTXHPDEDVDGRHQWUHVFRPSRQHQWHV

x$IHFWLYRHPRWLYR5HIHULGRDORVVHQWLPLHQWRVVXEMHWLYRV\DODVUHVSXHVWDV
SVLFRILVLROyJLFDVTXHDFRPSDxDQDODDFWLWXG
x&RJQLWLYR+DFHUHIHUHQFLDDODVFUHHQFLDV\RSLQLRQHVDWUDYpVGHODVTXHODDFWLWXG
VHPDQLILHVWDQRWHQLHQGRSRUTXpVHUFRQVLVWHQWHV
x'H$FFLyQH[SUHVLyQ6HUHILHUHDOSURFHVRItVLFR\PHQWDOTXHSUHSDUDDOLQGLYLGXR
SDUDDFWXDUGHXQDGHWHUPLQDGDIRUPD

 02'(/2$&7,78',1$/(6

 /DSHUVSHFWLYDWULSDUWLWDGHDFWLWXGHVKDVLGRODPiVLQIOX\HQWHGHVGHHOFRPLHQ]RGHOD
LQYHVWLJDFLyQGHDFWLWXGHVDVXPLHQGRHQDOJXQRVFDVRVTXHODVDFWLWXGHVQHFHVDULDPHQWH
WLHQHQ FRPSRQHQWHV DIHFWLYRV FRJQLWLYRV \ FRQGXFWXDOHV \ HQ RWURV IRFDOL]DQGR HVWRV
GRPLQLRVFRPRFRUUHODWRVGHDFWLWXGHV2OVRQ\=DQQD  

$XWRUHV FRPR =DQQD \ 5HPSHO   GHVGH XQD SRVLFLyQ FRJQLWLYD DGPLWHQ TXH ODV
DFWLWXGHVSXHGHQHVWDUIXQGDPHQWDGDV R GHVDUUROODUVHGHVGHORVSURFHVRVGHLQIRUPDFLyQ
GH FDUiFWHU DIHFWLYR FRQGLFLRQDPLHQWR  FRJQLWLYR FRQRFLPLHQWRV EDVDGRV HQ
HYDOXDFLRQHV RFRQGXFWXDO SHUFHSFLyQGHDFFLRQHVSULRULWDULDV 2ELHQFRPRDILUPDQ
(DJO\\&KDLNHQ  ODVDFWLWXGHVSXHGHQJHQHUDUUHVSXHVWDVDIHFWLYDV JXVWRSRUXQ
REMHWR  FRJQLWLYDV DWULEXFLRQHV SDUD DOFDQ]DU ORV REMHWLYRV  FRQGXFWXDOHV DFFLRQHV
PDQLILHVWDVKDFLDHOREMHWLYR 

$FWXDOPHQWH VH KDQ UHQRYDGR ODV SHUVSHFWLYDV WHyULFDV VREUH ODV DFWLWXGHV HQ OD TXH
DSDUHFHQ QXHYDV GHILQLFLRQHV HQ HO Q~PHUR HVSHFLDO TXH OOHYD SRU WtWXOR :KDWV DQ
$WWLWXGH"HQODUHYLVWD6RFLDO&RJQLWLRQ   HQODVTXHGLVWLQJXHQODVDFWLWXGHV
FRPR HQWLGDGHV HVWDEOHV DOPDFHQDGDV HQ OD PHPRULD )D]LR  3HWW\ %ULxRO \
&'H0DUHH  9LVVHU \ 0LUDELOH   IUHQWH D XQD YLVLyQ GH ODV DFWLWXGHV
GHILQLGDVFRPRYDORUDFLRQHVPiVWHPSRUDOHVFRQVWUXLGDVVREUHODLQIRUPDFLyQH[LVWHQWH
HQXQPRPHQWRGHWHUPLQDGR &RQUH\\6PLWK*DZURQVNL\%RGHQKDVHQ 

6HJ~Q 3HWW\ HW DO   ORV DYDQFHV DOFDQ]DGRV GHOLQHDQ FXDWUR SHUVSHFWLYDV GH
LQYHVWLJDFLyQ TXH SRVWXODQ LQWHUUHODFLRQHV HVSHFtILFDV HQWUH ORV GLVWLQWRV FRPSRQHQWHV

8

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

DFWLWXGLQDOHV SDUD OOHJDU D PRGHORV GH PD\RU FRPSOHMLGDG HQ OD H[SOLFDFLyQ GH ODV
DFWLWXGHVTXHREUDQVREUHXQDYDULHGDGGHFRQWH[WRVVLWXDFLRQDOHV

0RGHORVXQLWDULRV

(VWH HQIRTXH FRQVLGHUD TXH ODV DFWLWXGHV HVWiQ DVRFLDGDV HQ OD PHPRULD D XQ DIHFWR
VREUHXQREMHWRGHWHUPLQDGR(OPiVFRQRFLGRHVHOPRGHOR02'(SURSXHVWRSRU)D]LR
  HQ OD TXH DTXHOODV VLWXDFLRQHV REMHWRV  HQ ODV TXH HO LQGLYLGXR WLHQH XQD
H[SHULHQFLD GLUHFWD \ QR PHGLDWL]DGD GDQ OXJDU D DFWLWXGHV DFFHVLEOHV VLHQGR PiV
HVWDEOHV\UHVLVWHQWHV\VHDFWLYDUDQFRQPD\RUUDSLGH]\FRQILDQ]D

(O PRGHOR SDUWH GH XQD DFWLYDFLyQ DXWRPiWLFD GH OD DFWLWXG HQ HO LQGLYLGXR \
UHFKD]DUi DTXHOOR TXH YD\D HQ FRQWUD GHO DIHFWR HVWDEOHFLGR SRU OD H[SHULHQFLD GHO
VXMHWR 3RU RWUD SDUWH HO LQGLYLGXR DFXGLUi DO DQiOLVLV GH OD LQIRUPDFLyQ FXDQGR QR
 VHD SRVLEOH HVWDEOHFHU OD DFWLYDFLyQ DXWRPiWLFD HQ DTXHOODV VLWXDFLRQHV HQ ODV TXH
FDUHFHGHH[SHULHQFLD

0RGHORVGXDOHV

/D SHUVSHFWLYD GXDO FRQVLGHUD TXH ORV LQGLYLGXRV SXHGHQ WHQHU VLPXOWiQHDPHQWH XQD
DFWLWXG LPSOtFLWD LQFRQVFLHQWH DXWRPiWLFD  \ XQD DFWLWXG H[SOtFLWD FRQVFLHQWH
DXWRPiWLFD VREUHXQREMHWR\PRVWUDUHQFDGDXQDGHHOODVXQDIHFWRGLIHUHQWHDOREMHWR

6HJ~Q :LOVRQ /LQGVH\ \ 6FKRROHU   ODV DFWLWXGHV LPSOtFLWDV \ H[SOtFLWDV WLHQHQ
GLIHUHQWHV UHSUHVHQWDFLRQHV PHQWDOHV \ SXHGHQ PRVWUDU YDORUDFLRQHV GLIHUHQWHV GDGR
TXH VH IRUPDQ HQ SURFHVRV FRJQLWLYRV GLVWLQWRV \ QR HQWUDUtDQ HQ FRQIOLFWR SRUTXH VH
DFWLYDQ HQ FRQWH[WRV GLIHUHQWHV /DV DFWLWXGHV LPSOtFLWDV VH IRUPDQ PHGLDQWH
DSUHQGL]DMHV SRU FRQGLFLRQDPLHQWR FOiVLFR \ JXtDQ ODV FRQGXFWDV HQ VLWXDFLRQHV
HVSRQWiQHDVPLHQWUDVTXHODVDFWLWXGHVH[SOtFLWDVUHVXOWDQGHXQSURFHVRGHDSUHQGL]DMH
UHIOH[LYRGHODVLWXDFLyQ\VXVFRQVHFXHQFLDV

0RGHORVGHSURFHVR

3DUD6FKZDUW]\%RKQHU  HVWHHQIRTXHSRVWXODTXHODVDFWLWXGHVVHIRUPDQHQFDGD


VLWXDFLyQ HVSHFtILFD HQ IXQFLyQ GH ORV VHQWLPLHQWRV FUHHQFLDV \ FRQGXFWDV PiV
GHVWDFDGDV 5HSUHVHQWD XQD SHUVSHFWLYD FRQVWUXFWLYLVWD PHGLDQWH OD FXDO D SDUWLU GH
GLIHUHQWHVFRQWH[WRVVLWXDFLRQDOHVVHSURGXFHXQDSHUFHSFLyQGLVWLQWDGHODLQIRUPDFLyQ
\ XQD FRQGXFWD GLIHUHQWH LQIOXLGD SRU OD HYDOXDFLyQ GH OD VLWXDFLyQ *DZURQVNL \

9

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

%RGHQKDVHQ   SURSRQHQ DO UHVSHFWR HO PRGHOR GH HYDOXDFLyQ DVRFLDWLYR
SURSRVLFLRQDO $3(  HQ HO TXH GHILQHQ ODV DFWLWXGHV FRPR XQ FRQVWUXFWR TXH VH IRUPD
SRUODSUHVHQFLDGHDIHFWRV\FUHHQFLDVTXHVHUYLUiQSDUDH[SUHVDUXQDYDORUDFLyQGHOD
VLWXDFLyQ \ TXH SRVWHULRUPHQWH HVWDUi VRPHWLGD D OD FRQVLVWHQFLD FRQ RWUDV FUHHQFLDV
H[LVWHQWHV

0RGHORVPHWDFRJQLWLYR

(O PRGHOR PHWDFRJQLWLYR SURSXHVWR SRU 3HWW\ HW DO   FRQVLGHUD TXH ODV
DFWLWXGHVSHUPDQHFHQHQQXHVWUDPHPRULDFRQ XQD IXHU]D FRQVLGHUDEOHHQODTXH VH
UHJLVWUDWDQWRXQDHYDOXDFLyQSRVLWLYDFRPRQHJDWLYDKDFLDHOREMHWRGHSHQGLHQGROD
UHFXSHUDFLyQGHXQDGHWHUPLQDGDDFWLWXGGHODFDSDFLGDGGHOVXMHWRGHRSLQDUVREUH
VXVYDORUDFLRQHV

 (Q HVWDV YDORUDFLRQHV GHO VXMHWR SXHGHQ LQIOXLU IDFWRUHV FRQWH[WXDOHV TXH HYRTXHQ
H[SHULHQFLDV SRVLWLYDV R QHJDWLYDV GHWHUPLQDQGR GH HVWD PDQHUD HO FRPSRUWDPLHQWR
DFWLWXGLQDO GHO VXMHWR 'H OD PLVPD PDQHUD HQ VLWXDFLRQHV HQ ODV TXH HO VXMHWR DFHSWD
YDORUHVDFWLWXGLQDOHVDQWDJyQLFRVHOLQGLYLGXRUHFXSHUD\DFHSWDODDFWLWXGHQIXQFLyQGH
OD YDORUDFLyQ VREUH VX H[SHULHQFLD PiV UHFLHQWH HIHFWR GH UHFHQFLD  R ELHQ HOLJLHQGR
FRQWH[WRVHQORVTXHVXYLQFXODFLyQVHDPiVIDYRUDEOH

(Q VtQWHVLV OD WHRUtD GH ORV WUHV FRPSRQHQWHV RIUHFH XQ PDUFR KHXUtVWLFR GH
LQWHUSUHWDFLyQ GH ORV DQWHFHGHQWHV \ FRQVHFXHQWHV GH ODV DFWLWXGHV FX\D FRQVLVWHQFLD \
FRUUHODFLyQHVXQDFXHVWLyQHPStULFDHQODTXHKDGHEDVDUVHHOHVWXGLRGHODVDFWLWXGHV
VREUHXQGRPLQLRHVSHFtILFR

&RQ HO iQLPR GH VLQWHWL]DU SRGHPRV GHILQLU ODV DFWLWXGHV FRPR VHJ~Q DILUPDQ &ROO
3R]R 6DUDELD \ 9DOOV   FRPR ³'LVSRVLFLRQHV DGTXLULGDV \ UHODWLYDPHQWH
GXUDGHUDVGHHYDOXDUGHXQPRGRGHWHUPLQDGRXQREMHWRSHUVRQDRVLWXDFLyQ\DDFWXDU
HQ FRQVRQDQFLD FRQ GLFKD HYDOXDFLyQ´ S  \ WLHQH XQ FDUiFWHU PXOWLGLPHQVLRQDO
IXQFLRQDO \ H[SUHVLYR GH OD SHUVRQDOLGDG GHO LQGLYLGXR ³$ SDUWLU GH FUHHQFLDV
VHQWLPLHQWRV\DFFLRQHVTXHQRVD\XGDQDGRPLQDUQXHVWURHQWRUQR\H[SUHVDUQXHVWUD
LGHQWLGDG´ S 

7RGDVHVWDVSHUVSHFWLYDVWHyULFDVSRQHQ GHUHOLHYH TXHODV DFWLWXGHVWLHQHQXQ FDUiFWHU


FRPSOHMR HV GHFLU PXOWLGLPHQVLRQDO $Vt OD DFWLWXG VH GHILQH FRPR XQ FRQVWUXFWR

10

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

WHyULFRKLSRWpWLFRTXHDJUXSDGLYHUVRVDVSHFWRVDSDUWLUGHORVFXDOHVVHSXHGHDQDOL]DU
ODDFFLyQ

(O PDUFR FRQFHSWXDO UHIOHMD OD GLPHQVLyQ VRFLDO GH ODV DFWLWXGHV TXH VH PDQLILHVWD HQ
GLVWLQWRV DVSHFWRV <D VHD SRUTXH PXFKDV GH HOODV VH GLULJHQ D REMHWRV TXH WLHQHQ XQ
YDORUVRFLDOR ELHQSRUTXHVRQDSUHQGLGDVHQORVSURFHVRVGHLQWHUDFFLyQVRFLDOR ELHQ
VH FRQIRUPDQ HQ WRUQR D IDFWRUHV GH JUXSRV \ VLWXDFLRQHV VRFLDOHV HQ EDVH D TXH
H[SUHVDQODVFUHHQFLDV\PRGRGHHYDOXDFLyQGHORVPLVPRVLQGHSHQGLHQWHPHQWHGHTXH
GLFKDV DFWLWXGHV VH FRUUHVSRQGDQ FRQ ORV PLHPEURV LQGLYLGXDOHV GH WDOHV JUXSRV R
VLWXDFLRQHV

$XQTXHGHVGHODSHUVSHFWLYDWHyULFDORVJUXSRVVRQPHQRVYLVLEOHVTXHORVLQGLYLGXRV
GHVGHHOSODQRPHWRGROyJLFRORVFXHVWLRQDULRVDQDOL]DGRVHQGLIHUHQWHVLQYHVWLJDFLRQHV
SHUPLWHQ KDEODU GH XQD DFWLWXG JHQHUDO GHSHQGLHQWH GH XQD ~QLFD HVWUXFWXUD PHQWDO GH

DFHSWDFLyQRUHFKD]RGHGHWHUPLQDGDVDFFLRQHVUHODFLRQDGDVFRQODVVLWXDFLRQHVVRFLDOHV
HQ ORV TXH ORV VXMHWRV VH GHVHQYXHOYHQ HO FHQWUR GH HQVHxDQ]D HO FRQWH[WR ORV
SURIHVRUHVODDXWRFRQILDQ]DHWF 

(VWDDFWLWXGJHQHUDOHVWDUtDFRQILJXUDGDSRUXQFRQMXQWRGHFRQRFLPLHQWRVVHQWLPLHQWRV
\ DFFLRQHV FRQVLGHUDGDV SRVLWLYDV HQ ODV VLWXDFLRQHV VRFLDOHV TXH OD PHQWH GLULJH \
YDORUDGHDOJXQDPDQHUDSDUDFRPSUHQGHUHOPXQGRHQHOTXHVHYLYHSURWHJHUHOSURSLR
FRQFHSWR GH Vt PLVPR D\XGDU D DGDSWDUVH \ SRVLELOLWDU OD H[SUHVLyQ GH ODV SURSLDV
WHQGHQFLDVFRQIRUPDQGRDVtODSURSLDYLVLyQLQGHSHQGLHQWHGHVXUHODFLyQFRQHOPHGLR
DPELHQWHHQJHQHUDO\HOFRQWH[WRHQVHxDQ]DHQSDUWLFXODU

/D HYDOXDFLyQGHORTXHHOLQGLYLGXRSLHQVHRVLHQWD\FRPROHJXVWDUtDFRPSRUWDUVHOH
OOHYD D HVWDU LPSOLFDGR HQ HO REMHWR GH VX DFWLWXG \ SRU WDQWR VXV LQWHQFLRQHV
FRQGXFWXDOHV VH OOHYDUDQ D FDER (O FRPSRUWDPLHQWR GHO LQGLYLGXR SUHVHQWD XQD GREOH
SHUVSHFWLYDSRUXQODGRHVWiGHWHUPLQDGRSRUORTXHODJHQWHOHJXVWDUtDKDFHU\SRUHO
RWURHVWiLQIOXHQFLDGRSRUODVLWXDFLyQVRFLDOGHORTXHFUHHTXHGHEHUtDKDFHU QRUPDV
VRFLDOHV SRUORTXHKDKHFKRJHQHUDOPHQWH FRVWXPEUH \SRUODVFRQVHFXHQFLDVTXHVH
HVSHUDQGHVXFRPSRUWDPLHQWR6LSRUHMHPSORPDQWHQHPRVXQDDFWLWXGSRVLWLYDKDFLD
HOFHQWURGHHQVHxDQ]DGHEHUtDPRVDVLVWLUDVLGXDPHQWH\DQLPDUDORVGHPiVDKDFHUOR
PLVPRSRUHOFRQWUDULRVLQXHVWUDDFWLWXGHVQHJDWLYDGHVDQLPDUHPRVDORVGHPiV\OD
FDSDFLGDGUHFHSWLYDHVWDUiEDMRPtQLPRV

11

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

'HVGH HVWH HQIRTXH DGRSWDGR FRQVLGHUDPRV OD DFWLWXG FRPR XQD SUHGLVSRVLFLyQ
DSUHQGLGDSDUDUHVSRQGHUSRVLWLYDRQHJDWLYDPHQWHKDFLDSHUVRQDVREMHWRV\VLWXDFLRQHV
VRFLDOHVTXHSXHGHYDULDUHQLQWHQVLGDG\HV UHOHYDQWHSDUDODDFFLyQSRUTXHDIHFWDDOD
PDQHUDGHSHQVDUFUHHU\DFWXDUHQODVGLIHUHQWHVVLWXDFLRQHVHGXFDWLYDV

 &20321(17(6'(/$$&7,78'

/DV DFWLWXGHV FRPR HVWDGRV GH GLVSRVLFLyQ VH GHVDUUROODQ D SDUWLU GH H[SHULHQFLDV
PRWLYDFLRQDOHVGLVWLQWDV(VGHFLUHQFDGDXQDGHODVGHILQLFLRQHVDQWHULRUHVVHKDGH
WHQHUHQFXHQWDHOFRPSRQHQWHPRWLYDFLRQDO GHDFWLYDFLyQ\RULHQWDFLyQGHODDFFLyQ 
SDUDTXHSRGDPRVKDEODUGHDFWLWXG

'HQWURGHHVWHPDUFRFRQFHSWXDOGHUHIHUHQFLDXQDDFWLWXGLPSOLFDWDQWRHOFRPSRQHQWH

 DIHFWLYR FRPR XQD WHQGHQFLD D OD DFFLyQ HQ OD TXH VXUJHQ GH IRUPD UHODFLRQDGD \
VLPXOWiQHDGRVFODVHVGHFRPSRQHQWHVFRJQLWLYR\HYDOXDWLYR

6LJXLHQGR OD IRUPXODFLyQ GH .DW] \ 6FRQODQG   .UHFK &UXFKILHOG \ %DOODFKH\
 \ (DJO\\&KDLNHQ  ODHYDOXDFLyQFDUDFWHUtVWLFDGHODVDFWLWXGHVVHH[SUHVD
GH GLVWLQWDVIRUPDVDSDUWLUGHORVWUHVFRPSRQHQWHVEiVLFRVLQWHUUHODFLRQDGRV HQWUHVt
FRQVWLWX\HQGR WUHV YtDV GH UHVSXHVWD HQ XQ ~QLFR HVWDGR LQWHUQR TXH UHIOHMDQ OD
FRPSOHMLGDG LQWHUQD GH GLFKR HVWDGR \ UHYHODQ DO PLVPR WLHPSR OD UHDOLGDG OD
IRUPDFLyQ\HOFDPELRGHDFWLWXGHV

$~Q HVWDQGR GH DFXHUGR ORV LQYHVWLJDGRUHV HQ HO FDUiFWHU PXOWLGLPHQVLRQDO GH ODV
DFWLWXGHVVLQHPEDUJRKD\GLVFUHSDQFLDVHQFXDQWRDOSHVRRLQIOXHQFLDTXHSXHGDWHQHU
FDGD FRPSRQHQWH HQ XQD DFFLyQ UHDO \ SHUPLWLU SUHGHFLU GH DOJXQD PDQHUD OD DFFLyQ
IXWXUDGHOVXMHWR1RTXHGDFODURODRUJDQL]DFLyQ\HVWDELOLGDGDFWLWXGLQDOHVGHFLUFyPR
VRQODVYDULDFLRQHVTXHVHGDQHQWUHHOORV\VLH[LVWHDOJ~QWLSRGHUHODFLyQMHUiUTXLFD
FXHVWLyQTXHVLJXHVLHQGRHOLQWHUpVGHORVLQYHVWLJDGRUHV

&RQRFLPLHQWRV\FUHHQFLDV

(VWH LQGLFD TXH ODV DFWLWXGHV HVWiQ UHODFLRQDGDV GLUHFWDPHQWH FRQ ORV SHQVDPLHQWRV R
FUHHQFLDVGHVDUUROODGRVVREUHHOREMHWRGHDFWLWXG

/DV FUHHQFLDV H[SUHVDQ GH IRUPD HVWDEOH \ RUJDQL]DGD ORV SHQVDPLHQWRV \ ODV LGHDV
DFHUFD GH XQ REMHWR SHUVRQD R FRVD  R VLWXDFLyQ /DV DVRFLDFLRQHV TXH VH GDQ HQWUH

12

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

REMHWRVLWXDFLyQ\DWULEXWRV\HOJUDGRGHUHOHYDQFLDTXHVHGDQDODVPLVPDVGDQOXJDU
D XQD HYDOXDFLyQ PHGLDQWH XQ MXLFLR GH YDORU SRVLWLYR R QHJDWLYR VREUH DOJR \ ODV
IRUPDVGHUHVSRQGHUDQWHHOPLVPR LQWHUDFFLyQFRQHOFRPSRQHQWHUHDFWLYR 

(V GHFLU OD RUJDQL]DFLyQ HVWDEOH GH FUHHQFLDV QR FRQVLVWH HQ IRUPXODU OD YHUDFLGDG R
FHUWH]D \ WDPSRFR HQ OLPLWDUVH D XQD VLPSOH UHSUHVHQWDFLyQ SHUFHSWLYD GHO ³REMHWR´
SXHVWR TXH OD FRJQLFLyQ HV XQD HYDOXDFLyQ TXH FRQOOHYD DFHSWDFLyQ R UHFKD]R GHO
LQGLYLGXR KDFLD HO REMHWR R OD DFFLyQ -XVWDPHQWH HQ HVWH SXQWR HV GRQGH VH FHQWUD OD
WHRUtDGHODDFFLyQUD]RQDGDGH)LVKEHLQ\$M]HQ  \ODWHRUtDGHODDFFLyQSODQHDGD
GH$M]HQ  DOUHODFLRQDUODVFUHHQFLDVFRQODVDFWLWXGHV\HQ~OWLPDLQVWDQFLDFRQOD
FRQGXFWD

< HV HQ HVWH PDUFR GRQGH HV SUHFLVR WHQHU HQ FXHQWD TXH KD\ FRJQLFLRQHV TXH HVWiQ
IXHUDGHODUHDOLGDG\ DOJXQDVSXHGHGDUVHGHPRGRFRQVFLHQWH, donde HOFRPSRQHQWHFRJQLWLYR

UHIOHMD ODV FUHHQFLDV R OD LQIRUPDFLyQ VREUH HO REMHWR GH OD DFWLWXG \ HV OR TXH XQD
SHUVRQDFUHHRORTXHVDEHVREUHXQREMHWRGHDFWLWXG7DQWRVLVHIXQGDPHQWD FRPRVL QR VL
VH FUHH TXH OD LQIRUPDFLyQ HV FRUUHFWD \ JXDUGD FRQVLVWHQFLD SDUD HO LQGLYLGXR
SDVDUiDIRUPDUSDUWHGHOFRPSRQHQWHFRJQLWLYRGHODVDFWLWXGHV1XHVWUDVH[SHULHQFLDV
GLUHFWDVHLQGLUHFWDVDWUDYpVGHODVHWDSDVGHOGHVDUUROORQRVSURSRUFLRQDQDSUHQGL]DMHV
EDVDGRV HQ FULWHULRV PHGLDQWH ORV FXDOHV IRUPDPRV QXHVWUDV DFWLWXGHV \
FRPSRUWDPLHQWRV

6HQWLPLHQWRV\SUHIHUHQFLDV

+DFHQUHIHUHQFLDDOSURFHVRDIHFWLYRTXHLQIOX\HHQODVHYDOXDFLRQHVTXHGHVDUUROODPRV
D FHUFD GH XQ REMHWR GHDFWLWXG DVRFLDQGR HPRFLRQHV D SHUVRQDV REMHWR R VLWXDFLRQHV
UHODWLYDPHQWH DO PDUJHQ GH ODV FUHHQFLDV TXH SRVHDPRV VREUH HO REMHWR HYDOXDGR (O
FRPSRQHQWH DIHFWLYR IDYRUHFH HO PDQWHQLPLHQWR GH GHWHUPLQDGDV DFWLWXGHV \ D\XGD D
GHWHUPLQDUODGLUHFFLyQGHSUHGLVSRVLFLyQSDUDODDFFLyQ

+D\ DXWRUHV TXH VLW~DQ HO Q~FOHR GH ODV DFWLWXGHV HQ HVWD WHQGHQFLD SRVWXODQGR OD
H[LVWHQFLDGHXQDFODUDUHODFLyQHLQIOXMRHQWUHORVFRPSRQHQWHVDIHFWLYR\FRJQLWLYR/D
YDULDELOLGDG GHO FRPSRQHQWH FRJQRVFLWLYR SURYRFDUi \ H[SUHVDUi VHQWLPLHQWRV GH
DJUDGRGHVDJUDGR SODFHUGRORU IHOLFLGDG DOHJUtD WULVWH]D WHPRU PLHGR DQVLHGDG
RGLRUHSXJQDQFLDGHVSUHFLRHWF 3DVWRU 

13

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

/D LQIOXHQFLD GH ORV DIHFWRV HQ OD IRUPDFLyQ GH DFWLWXGHV VH JHQHUDQ D SDUWLU GH ORV
SURFHVRV GH DSUHQGL]DMHV GLYHUVRV UHDOL]DGRV HQ GLVWLQWRV FRQWH[WRV \D VHD PHGLDQWH
FRQGLFLRQDPLHQWRVGHHVWtPXORVFRQGLFLRQDGRVFRPRUHILHUH(DJO\\&KDLNHQ  R
ELHQ SURSRUFLRQDQGR HVWtPXORV LQFRQGLFLRQDGRV VHJ~Q .URVQLFN %HW] -XVVLQ \ /\QQ
 RELHQFRPRSODQWHDQ%ULxRO3HWW\\7RPDOD  SRUHOHIHFWRFDXVDGRSRU
OD PHUD H[SRVLFLyQ VLHPSUH TXH VHD DVRFLDGR GH IRUPD SRVLWLYD VH IDYRUHFHUi OD
SUHIHUHQFLDKDFLDXQHVWtPXOR

$FFLRQHVEDVDGDVHQLQIRUPDFLyQFRQGXFWXDO

+D\ LQYHVWLJDFLRQHV TXH VRVWLHQHQ TXH OD IRUPD HQ TXH QRV FRPSRUWDPRV DIHFWD D
QXHVWUDV DFWLWXGHV D SDUWLU GH OR FXDO FRQVLGHUDQ TXH HO FRPSRUWDPLHQWR SXHGH VHU OD
EDVHSDUDGHVDUUROODUQXHVWUDVHYDOXDFLRQHVVREUHGLIHUHQWHVREMHWRVGHDFWLWXG

 +D\ SHUVRQDV TXH VH FRPSRUWDQ GH IRUPD LQFRQVLVWHQWH FRQ VX IRUPD GH SHQVDU
SURGXFLHQGR XQ HVWDGR DYHUVLYR GH PDOHVWDU TXH )HVWLQJHU   OR GHQRPLQy
GLVRQDQFLD FRJQLWLYD OR FXDO OOHYD DO LQGLYLGXR D EXVFDU HVWUDWHJLDV SDUD UHGXFLU R
HOLPLQDUHVHHVWDGRGHiQLPRQHJDWLYR&RQHOORHVWDWHRUtDGHPRVWUyTXHORVLQFHQWLYRV
H[WHUQRVDOPRGLILFDUODVFRQGXFWDVSRGtDQVHUFRQWUDSURGXFHQWHV

'HPDQHUDTXHODREVHUYDFLyQGHQXHVWUDVSURSLDVFRQGXFWDVSXHGHQOOHYDUDLQIOXLUHQ
ODDFWLWXGFXDQGRODSURSLDFRQGXFWDVLUYHFRPRFULWHULRSDUDEXVFDUYDORUDFLRQHVPiV
IDYRUDEOHVHQWUHYDULDVRSFLRQHVFRPRVRVWLHQHQ%ULxRO'HOD&RUWH\%HFHUUD  R
VHJ~Q %Hm   SDUD HYDOXDU \ PHMRUDU QXHVWUD DXWRSHUFHSFLyQRELHQFRPR
PXHVWUDQ %ULxRO \ 3HWW\   FXDQGR OD REVHUYDFLyQ GH OD FRQGXFWD VLUYH 
SDUD H[SOLFDU FRPR HQ RFDVLRQHV VH OD XWLOL]D FRPR LQGLFDGRU GH OD YDOLGH] GH
QXHVWURV SURSLRVSHQVDPLHQWRV

'H XQD SDUWH OD SUHGLVSRVLFLyQ D UHVSRQGHU DSXQWD D TXH H[LVWHQ SDWURQHV UHJXODUHV \
JHQHUDOHV GH FRQGXFWD HQ OD REVHUYDFLyQ TXH VRQ FRQVLVWHQWH HQ XQ LQGLYLGXR 'H RWUD HO
FRPSRQHQWHGHODDFFLyQVHSUR\HFWDKDFLDHOREMHWRGHODDFWLWXGIDFLOLWDQGRODSUHGLVSRVLFLyQ
GHODVFRQGXFWDVTXHXQDSHUVRQDVHJXLUiDQWHXQGHWHUPLQDGRREMHWRRVLWXDFLyQ

/D LQIOXHQFLD GH OD FRQGXFWD HQ OD DFWLWXG HV VLJQLILFDWLYD FXDQGR HO LQGLYLGXR WLHQH
H[SHULHQFLDFRQHOREMHWRGHDFWLWXGSXHVODDFWLWXGVHDSUHQGHPHMRUHVPiVHVWDEOH\
PiV SUHGHFLEOH UHVSHFWR DO FRPSRUWDPLHQWR /RV FRQRFLPLHQWRV TXH XQ VXMHWR WHQJD
VREUHXQIHQyPHQRFRQFUHWRYLHQHQLQIOXLGRVWDQWRSRUVXVVHQWLPLHQWRVFRPRSRUVXV

14

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

WHQGHQFLDV UHDFWLYDV SHUR LJXDOPHQWH ORV VHQWLPLHQWRV \ WHQGHQFLDV UHDFWLYDV VRQ


PRGLILFDGRVSRUORVFRQRFLPLHQWRVKDELGRVVREUHHOIHQyPHQRFRQFUHWRGHOTXHVHWUDWH

$XQTXH PXFKRV WHyULFRV GHILHQGHQ OD H[LVWHQFLD GH XQ ~QLFR FRPSRQHQWH DIHFWLYR
YLVLyQ XQLGLPHQVLRQDO  GLQDPL]DGRU \ RULHQWDGRU GH OD DFFLyQD OD YH]  UHFRQRFHQ OD
LPSRUWDQFLD GH ODV FUHHQFLDV \ GH ODV DFFLRQHV YLVLyQ PXOWLGLPHQVLRQDO  HQ OD
IRUPDFLyQGHDFWLWXGHV 3HWW\\ &DFLRSSR 3RUORWDQWRODDFFLyQGLUHFWDHVWDUtD
PHGLDGDSRUDVSHFWRVLQWHQFLRQDOHVHQORVTXHVHH[SUHVDQORVFRPSOHMRVFDPLQRVTXH
UHODFLRQDQODVFUHHQFLDVDFWLWXGHV\DFFLRQHV

)RUPXODGR GH HVWD PDQHUD HO FRPSRQHQWH FRQGXFWXDO FRQVLJXH XQD GHILQLFLyQ PiV
DMXVWDGDGHOFRQRFLPLHQWRGHODVDFWLWXGHVSDUDSUHGHFLUODDFFLyQGHOVXMHWR\HVWDEOHFHU
ODVFRQGLFLRQHVHQODVTXHVHSRGUtDLQWHUYHQLUFRQVWUXFWLYDPHQWHHQVXFRPSRUWDPLHQWR
(Q GHILQLWLYD GHILQLPRV FRQFHSWXDOPHQWH ODV DFWLWXGHV FRPR HVWUXFWXUDV SVtTXLFDV

GXUDGHUDV GH YDORUDFLyQ SRVLWLYD R QHJDWLYD FRPSRQHQWH FRJQRVFLWLYR  GH
PDQLIHVWDFLyQ GH VHQWLPLHQWRV FRQFUHWRV \ SUHIHUHQFLDV FRPSRQHQWH DIHFWLYR  \ GH
DFFLRQHV PDQLILHVWDV \ GHFODUDFLRQHV GH LQWHQFLRQHV HQ SUR R HQ FRQWUD FRPSRQHQWH
UHDFWLYR GHGHWHUPLQDGRVIHQyPHQRV\VLWXDFLRQHV

 &$5$&7(5Ë67,&$6'(/$6$&7,78'(6

/D FDSDFLGDG SUHGLFWLYD GH OD DFWLWXG UHVSHFWR D OD DFFLyQ GH XQ VXMHWR FRQFUHWR
GHSHQGHUiGHODUHOHYDQFLDFRQFHSWXDO\FRPSOHMLGDGPHWRGROyJLFDFRQTXHVRQWUDWDGRV
ORV HOHPHQWRV FRJQLWLYRV DIHFWLYRV R FRQGXFWXDOHV SDUD DVt SRGHU VXSHUDU ODV
GLVFUHSDQFLDV H[SXHVWDV SRU 3LHUH   \ SRU :LFNHU   TXLHQHV FUHHQ SRGHU
GHPRVWUDUTXHQRKD\UHODFLyQGLUHFWDHQWUHDFWLWXG\DFFLyQ\TXHSRUWDQWRGHVGHODV
DFWLWXGHVQRHVSRVLEOHSUHGHFLUODDFFLyQ

3RUXQDSDUWHHVSUHFLVRDQDOL]DUODVFDUDFWHUtVWLFDVGHFDGDXQRGHORVFRPSRQHQWHVGH
OD DFWLWXGFXDQGRDSDUWLUGHXQDUHDOLGDGSVLFROyJLFDODVWUDQVIRUPDPRVHQUHDOLGDGHV
ItVLFDVVLHQGRFRQVLGHUDGDFRPRXQFRQWLQXRSVtTXLFRTXHWLHQHXQFRPLHQ]R\XQILQDO
SDVDQGRGHXQRDRWURSRUPHGLRGHYDULDFLRQHVGHJUDGR(QHVWHFRQWLQXRUHVDOWDQWUHV
FDUDFWHUtVWLFDVSULPDULDVGLUHFFLyQLQWHQVLGDG\GLPHQVLyQ

15

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

'HRWUDSDUWHHVSUHFLVRDQDOL]DUODFRQVLVWHQFLDGHOVLVWHPDGHDFWLWXGHVHQUHODFLyQDOD
SUHGLFFLyQDFWLWXGFRQGXFWDSXHVODHILFDFLDSUHGLFWRUDGHSHQGHUiGHOJUDGRHQTXHORV
FRPSRQHQWHVFRJQLWLYRVDIHFWLYRV\FRQGXFWXDOHVWiQFRUUHODFLRQDGRVHQWUHVt

3RU ~OWLPR DO KLOR GH ODV SUREOHPiWLFDV SODQWHDGDV VH SODQWHD OD FXHVWLyQ GH OD
FRKHUHQFLDHQODHVWUXFWXUDGHORVVLVWHPDVGHDFWLWXGHVJUXSRVGHDFWLWXGHVUHODFLRQDGDV
FRQXQFRQMXQWRGHREMHWRVVRFLDOHVUHODFLRQDGRVHQWUHVtTXHVHFRQVWLWX\HQHQXQWRGR
LQWHJUDGRHLQWHUFRQHFWDGR

&RPR\DKHPRVLQGLFDGRODDFWLWXGHVXQFRQVWUXFWRKLSRWpWLFR SRUWDQWR KDGHVHUGHILQLGD\


DQDOL]DGDSRUODVSURSLHGDGHVTXHVHOHDVLJQDQ'HVGHHVWDSHUVSHFWLYDHQWHQGHPRVTXHODV
FDUDFWHUtVWLFDV PiV GHVWDFDGDV GH ORV FRPSRQHQWHV DFWLWXGLQDOHV KDFHQ UHIHUHQFLD WUHV
FRPSRQHQWHV IXQGDPHQWDOHV FRJQLWLYR DIHFWLYR \ GH DFFLyQ 1XHVWUD LQWHQFLyQ
FRQVLGHUDPRVTXHGHEHQVHUDQDOL]DGDVODVFDUDFWHUtVWLFDVGHGLFKRVFRPSRQHQWHV

'LUHFFLyQRYDOHQFLD

(VODHVSHFLILFDFLyQGHODFDQWLGDGGHSRVLWLYLGDGRQHJDWLYLGDGGHXQDDFWLWXGHVSHFtILFD
PHGLGD SRU HO JUDGR GH DIHFWR TXHGHVSLHUWDHOREMHWRGHODDFWLWXGODSRVLFLyQPiV R
PHQRV IDYRUDEOH GHO FRPSRQHQWH FRJQLWLYR \ OR GHFLGLGR R QR TXH HVWp HO VXMHWR D
GHVSOHJDUODDFWLWXG(VWRVHWUDGXFHHQTXHHOREMHWLYREiVLFRGHWRGRFXHVWLRQDULRGH
DFWLWXGHVVHUiHOGHFXDQWLILFDUODVYDOHQFLDVGHODVDFWLWXGHVTXHH[SORUH

0XOWLSOLFLGDGHLQWHQVLGDG

6H WUDWD GH OD YDULHGDG GH HOHPHQWRV WDQWR HQ Q~PHUR FRPR HQ FODVHV HQ ORV TXH VH
EDVDQFDGDXQRGHORVFRPSRQHQWHVLQWHQWDQGRUHVROYHUODFXHVWLyQGHODLQGLIHUHQFLDD
ODFXHVWLyQSODQWHDGD\VHUHILHUHDODIXHU]DGHDWUDFFLyQRUHFKD]RKDFLDHOREMHWRSDUD
HOORVHSUHVHQWDUiXQDHVFDODGHWLSR/LNHUW

(Q OD PXOWLSOLFLGDG VH WUDWD GH LQGDJDU VL VH HVWi DQWH XQD DFWLWXG VLPSOH R DQWH XQD
DFWLWXGP~OWLSOHHQEDVHDODYDULHGDGGHHOHPHQWRVTXHVHGDQHQORVFRPSRQHQWHVGHOD
DFWLWXG (O FRPSRQHQWH FRJQRVFLWLYR FRPSUHQGH HO HVSDFLR UHFRUULGR HQWUH HO
FRQRFLPLHQWRPtQLPRGHOREMHWRGHTXHVHWUDWHKDVWDVXFRQRFLPLHQWRH[KDXVWLYR3RU
VX SDUWH HO FRPSRQHQWH DIHFWLYR FRPSUHQGH HO HVSDFLR TXH YD GHVGH OD UHODWLYDPHQWH
DOWD LQGLIHUHQFLD UHVSHFWR GHO REMHWR R VLWXDFLyQ FRQVLGHUDGD KDVWD XQD PLQXFLRVD
GLIHUHQFLDFLyQHPRWLYD

16

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

3RU ~OWLPR HO FRPSRQHQWH GH DFFLyQ DEDUFD LJXDOPHQWH XQD H[WHQVD JDPD GH IRUPDV
H[SUHVLYDVGHDFFLyQFRQVXVPDWLFHVFRQFUHWRV\HVSHFtILFRV

'LPHQVLyQGHODDFWLWXG

3HUPLWH FRQRFHU VL VH WUDWD GH XQ REMHWR FRPSOHMR TXH QRHVWi ELHQ GHILQLGR $Vt XQD
DFWLWXG SXHGH VHU XQLGLPHQVLRQDO VL DEDUFD XQ VROR GRPLQLR GH OD DFWLYLGDG  R
PXOWLGLPHQVLRQDO VLLQFOX\HYDULRV 

 )XHU]DGHODDFWLWXG

+DEODPRVGHODFDSDFLGDGGHXQDDFWLWXGSDUDVHUUHODWLYDPHQWH HVWDEOH\UHVLVWHQWH HQ HO
WLHPSR \ FRQ FDSDFLGDG SDUD SUHGHFLU OD FRQGXFWD GH ODV SHUVRQDV 3HWW\ \ .URVQLFN

   6HJ~Q %ULxRO HW DO   ³Las actitudes, denominadas fuertes, tienen mayor
probabilidad de producir estos resultados que aquellas a las que se conocen como
actitudes débiles. Se han identificado distintos indicadores objetivos y subjetivos de la
fuerza de una actitud. Los indicadores objetivos más estudiados son extremosidad,
accesibilidad, ambivalencia, estabilidad, resistencia, potencial predictivo sobre la
conducta y grado de conocimiento asociado con el objeto de actitud. Los indicadores
subjetivos tienen que ver, en la mayoría de los casos, con la estimación subjetiva o la
percepción que las personas tienen de los indicadores objetivos´ S 

$Vt SXHV OD GLUHFFLyQ LQWHQVLGDG GLPHQVLyQ \ IXHU]D QRV OOHYD D HQWHQGHU HVWH
FRQVWUXFWRSVLFRVRFLDOGHPDQHUDPiVSUHFLVDSDUDSRGHUH[SOLFDUFRQPD\RUVHJXULGDG
FDGD XQR GH ORV FRPSRQHQWHV GH OD DFWLWXG HVSHFLDOPHQWH HO GH DFFLyQ TXH HV HQ
UHDOLGDGHO UHVXOWDGRGHORVGRVDQWHULRUHV\HOTXHSRGHPRVREVHUYDUSDUDSRGHUDFWXDU
HQFRQVHFXHQFLDHLQIRUPDUDORVVXMHWRVGHHVWDVGLPHQVLRQHVWDQLPSRUWDQWHVHQWRGDV
\FDGDXQDGHODVDFWLYLGDGHVTXHOOHYDQDFDER

 &$5$&7(5Ë67,&$6%È6,&$6'(/6,67(0$'($&7,78'(6

&RQVLVWHQFLD

3DUD OOHJDU D FRPSUHQGHU OD QDWXUDOH]D GH ODV DFWLWXGHV GHEHPRV DQDOL]DU HO
FRQRFLPLHQWR GHO VLVWHPD DO TXH FDGD DFWLWXG SHUWHQHFH GHELGR D OD SHUPDQHQWH

17

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

LQWHUDFFLyQ HQWUH ODV DFWLWXGHV 3DUD .UHFK HW DO   XQD DFWLWXG HV YiOLGD FXDQGR
HYDOXDPRV OD UHODFLyQ HVSHFtILFD TXH JXDUGDQ HQWUH Vt ORV WUHV FRPSRQHQWHV EiVLFRV
UHVSHFWR D VX GLUHFFLyQ YDOHQFLD \ GLPHQVLyQ $ HVWH SURFHVR VH OH GHQRPLQD
FRQVLVWHQFLDGHOVLVWHPDGHDFWLWXGHVHVGHFLUODWHQGHQFLDGHODVSHUVRQDVDRUJDQL]DU
ODVDFWLWXGHVHQHVWUXFWXUDVLQWHUQDVFRKHUHQWHV

/RVWLSRVGHFRQVLVWHQFLDVSXHGHQVHUP~OWLSOHVHQIXQFLyQGHODH[LVWHQFLDGHORVWUHV
FRPSRQHQWHV DFWLWXGLQDOHV VLHQGR SRU WDQWR FRPSOHMR LGHQWLILFDU ODV H[SUHVLRQHV
DFWLWXGLQDOHV GH ORV VXMHWRV HQ UHODFLyQ D ORV HVWDGRV LQWHUQRV TXH OD VXVFLWDQ (LVHU
 

/D QRFLyQ GH FRQVLVWHQFLD HQ ODV DFWLWXGHV DGTXLHUH LPSRUWDQFLD FHQWUDO GDGR TXH ODV
DFWLWXGHV VH H[SUHVDQ \ GH HVWD IRUPD LQGXFLPRV OD GHILQLFLyQ GH ODV DFWLWXGHV FRPR
FRQVLVWHQWHV R LQFRQVLVWHQWHV HVWDEOHV R LQHVWDEOHV SUHGLFWRUDV R QR GH OD DFFLyQ HV

GHFLUHOPRGRHQTXHVHDQDOL]DVLODDFWLWXGFXPSOHFRQODIXQFLyQGHRULHQWDFLyQGHO
VXMHWRHQVXPXQGRVRFLDO

/DFRQVLVWHQFLDGHOLQGLYLGXRHQWUHVXDFWLWXG\HOFRPSRUWDPLHQWRH[SUHVDGRKD\TXH
DQDOL]DUOD LQWURGXFLHQGR IDFWRUHV TXH SXHGHQ DIHFWDU D GLFKD UHODFLyQ (VWRV IDFWRUHV
SXHGHQ VHU IDFWRUHV VLWXDFLRQDOHV UDVJRV GH SHUVRQDOLGDG \ OD LQIOXHQFLD GH RWUDV
DFWLWXGHVRFRQFHSWRVUHODFLRQDGRVFRQHOODV $OYLUD 

'HSHQGLHQGRGHOJUDGRGHHVWUXFWXUDFLyQGHODVVLWXDFLRQHVHOLQGLYLGXRGDUiUHVSXHVWDV
PXOWLIDFpWLFDV H[SUHVDGDV HQ ODV FRJQLFLRQHV \ ODV HYDOXDFLRQHV TXH KDFHQ GH ODV
PLVPDV /DV LQFRQVLVWHQFLDV GHULYDGDV GH OD SHUWHQHQFLD GHO LQGLYLGXR HQ VXV GLVWLQWDV
IRUPDVGHYLGDJUXSDOSXHGHQUHIOHMDUODLPSRUWDQFLDTXHWLHQHSDUDpOODDFHSWDFLyQROD
FRRSHUDFLyQHQORVJUXSRVVRFLDOHVPiVTXHODFRQVLVWHQFLDDFWLWXGLQDO

 *UDGRGHFRKHUHQFLDGHODVDFWLWXGHV

3RU VX SDUWH HV SUHFLVR WHQHU HQ FXHQWD OD HVWUXFWXUD HQWUH HO VLVWHPD GH DFWLWXGHV HV
GHFLU OD LQWHUDFFLyQ HQWUH VLVWHPDV \D TXH OD LQWHUDFFLyQ QR VH UHGXFH D ODV DFWLWXGHV
GHQWURGHXQVLVWHPD VXMHWR VLQRWDPELpQDODLQWHUUHODFLyQHQWUHVLVWHPDV JUXSRV /R
FXDOFRQOOHYDDHVWXGLDUHOJUDGRGHFRKHUHQFLDTXHPDQWLHQHHOVXMHWRHQHVWHFRQMXQWR
GHVLVWHPDVGHDFWLWXGHV\HOPRGRHQTXHODSHUVRQDOLGDGGHOVXMHWRODLQWHJUDFRPRXQ
WRGR

18

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

/DV WHRUtDV TXH HVWXGLDQ OD FRKHUHQFLD DFWLWXGLQDO SRVWXODQ TXH FXDQGR HO VLVWHPD GH
DFWLWXGHV TXH PDQWLHQH XQ VXMHWR SURGXFH FRPSRUWDPLHQWRV TXH VH H[SUHVDQ GH PRGR
LQFRKHUHQWHHOLQGLYLGXRVHDGDSWDUiUHVWDXUDQGRHOVLVWHPDGHFRKHUHQFLD HVGHFLUVH WUDWDUá
GH SDVDU D RWUR HVWDGR GH PD\RU FRKHUHQFLD HQ HO TXH VH DGRSWDUi XQD DFWLWXG
FRQVHFXHQWHFRQVXVDQWHULRUHVH[SHULHQFLDV

([LVWHQ YDULDV WHRUtDV VREUH OD FRKHUHQFLD DFWLWXGLQDO EDVDGDV HQ HO pULQFLSLR GH
FRQJUXHQFLDHQWUHFRQRFLPLHQWRV\HYDOXDFLyQGHOREMHWR 2VJRRG6XFL \7DQQHQEDXP
  WHRUtD HQ OD GLVRQDQFLD FRJQLWLYD HQWUH HOHPHQWRV GH FRQRFLPLHQWR \ DFFLyQ
)HVWLQJHU \RWUDVWHRUtDVHQODVTXHHOpQIDVLVSULQFLSDOHVWDUiHQODFRKHUHQFLD
HQWUHHVWUXFWXUDVFRJQLWLYDV\DIHFWLYDV 5RVHQEHUJ 

(ODQiOLVLVGHOJUDGRGHFRKHUHQFLDGHOFRQMXQWRGHVLVWHPDVGHDFWLWXGHVHVUHYHODGRUGH
ODDFFLyQ\ODVWHQVLRQHVTXHIRUPDQSDUWHGHODSHUVRQDOLGDGGHXQVXMHWRSHURWDPELpQ

KD\ TXH WHQHU HQ FXHQWD TXH HQ OD GLQiPLFD GH ODV DFWLWXGHV LQWHUYLHQHQ IDFWRUHV
SHUVRQDOHV FRPR HO DXWRFRQFHSWR OD DXWRHVWLPD ODV UHODFLRQHV FRQ ORV GHPiV \ ODV
GLIHUHQWHV VLWXDFLRQHV TXH PRGXODQ OD YDOLGH] JHQHUDO GH ODV WHRUtDV GH OD FRKHUHQFLD
DFWLWXGLQDO 9DQGHU 

(OSULQFLSLRGHODFRKHUHQFLDDSHVDUGHVHUXQIDFWRULPSRUWDQWHHQODGLQiPLFDGHODV
DFWLWXGHVHOLQGLYLGXRSXHGHFRQIRUPDUDFWLWXGHVLQGLYLGXDOHVPiVLQIOXHQFLDGRSRUVXV
UHVSRQVDELOLGDGHV KDFLD HO SDSHO TXH GHVHPSHxD TXH UHVSHFWR D ODV QRUPDV R
H[SHFWDWLYDV TXH ORV GHPiV VLHQWHQ KDFLD pO WROHUDQGR GH HVWD PDQHUD ODV SRVLEOHV
LQFRKHUHQFLDV HQ UHODFLyQ KDFLD ORV RWURV 2 SRU HMHPSOR Vt HO LQGLYLGXR VH VLHQWH
DWUDtGRSRUORQXHYR\ORFRPSOHMRWHQGUiPD\RUWROHUDQFLDKDFLDODDPELJHGDG

 )81&,Ï1'(/$6$&7,78'(6

(Q UHODFLyQ D OD LPSRUWDQFLD GH ODV DFWLWXGHV SDUD SUHGHFLU \ PRGLILFDU FRQGXFWDV
VRFLDOHV GLYHUVRV DXWRUHV UHSUHVHQWDQWHV GH OD SHUVSHFWLYD IXQFLRQDO KDQ VHxDODGR OD
UHOHYDQFLDGHODVIXQFLRQHVTXHFXPSOHQODVDFWLWXGHVHQUHODFLyQDOGHVDUUROORVRFLDO\
SHUVRQDOGHORVLQGLYLGXRV

(VWHHQIRTXHWLHQHXQDSHUVSHFWLYDIXQFLRQDORPRWLYDFLRQDOSRUTXHHVWiFHQWUDGRHQOD
HVWUXFWXUD\GLQiPLFDGHODSHUVRQDOLGDGSDUWLFXODUPHQWHHQHOVLVWHPDPRWLYDFLRQDOGH
ODSHUVRQDOLGDGDOSRQHUHOpQIDVLVHQODVUHODFLRQHVHQWUHODVDFWLWXGHV\ORVGLIHUHQWHV

19

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

PRWLYRV GHO LQGLYLGXR /DV DFWLWXGHV KDQ GH VHU H[SOLFDGDV SRU ODV QHFHVLGDGHV TXH
WLHQHQ ODV SHUVRQDV \ VX FRQVLJXLHQWH VDWLVIDFFLyQ < GDGR TXH ORV SURFHVRV
PRWLYDFLRQDOHV WLHQHQ VX SURSLR GLQDPLVPR ODV DFWLWXGHV WHQGUiQ TXH DGHFXDUVH D ORV
PLVPRV

(OHQIRTXHPiVVLVWHPiWLFRVREUHHOSDSHOGHODVDFWLWXGHVHQODHFRQRPtDUHJXODGRUDGH
OD SHUVRQDOLGDG HV HO GH .DW]   HO FXDO SURSRQH FXDWUR WLSRV GH IXQFLRQHV
DWULEXLEOHVDODVDFWLWXGHVHQUHODFLyQDODSHUVRQDOLGDGGHOLQGLYLGXR

)XQFLyQGHIHQVLYD

(VWi UHSUHVHQWDGD SRU DTXHOODV DFWLWXGHV TXH WLHQGHQ D SURWHJHU HQ HO LQGLYLGXR FLHUWD
LPDJHQVREUHVtPLVPRRVREUHODUHDOLGDG6RQDFWLWXGHVTXHGDQVLJQLILFDGRDOVHOI\D
VXV UHODFLRQHV FRQ HO PHGLR DPELHQWH R SURSRUFLRQDQ SURWHFFLyQ DO \R GH LPSXOVRV
 LQDFHSWDEOHVTXHSURGXFHQDQVLHGDG

(VWRV VHQWLPLHQWRV R FRQGXFWDV DELHUWDV VRQ GHVYLDGRV D SDUWLU GH ORV PHFDQLVPRV GH
GHIHQVD TXH QRV SHUPLWHQ UHVWDEOHFHU HO HTXLOLEULR 8QRV VHUtDQ ORV PHFDQLVPRV GH
SUR\HFFLyQTXHWLHQGHQD LPSXWDUDSHUVRQDVRDOJUXSRQXHVWUDVDFWLWXGHVQHJDWLYDV3RU
HMHPSOR PHGLDQWH OD SUR\HFFLyQ VH WLHQGH D LPSXWDU DO SURIHVRU DFWLWXGHV QHJDWLYDV
FXDQGRHODOXPQRQRSXHGHFRQVHJXLUXQDFRPXQLFDFLyQFHUFDQDFRQpO2WURVVHUtDQORV
PHFDQLVPRVGHUDFLRQDOL]DFLyQXQDDFWLWXGSRVLWLYDGHQWURGHODFODVHSRGUtDSURWHJHUDO
HVWXGLDQWHGHORVVHQWLPLHQWRVQHJDWLYRVKDFLDVtPLVPRRKDFLDODFODVH

)XQFLyQLQVWUXPHQWDODGDSWDWLYD\XWLOLWDULD

/DV DFWLWXGHV VH IRUPDQ FRQ REMHWRV HVSHFtILFRV R SHUVRQDV TXH VDWLVIDFHQ ODV
QHFHVLGDGHV HVSHFtILFDV GHO VXMHWR LQWHQWDQGR PD[LPL]DU ODV UHFRPSHQVDV \
PLQLPL]DQGRORVFDVWLJRVSURFHGHQWHVGHODPELHQWHVRFLDO7LHQHQSRUWDQWRXQFDUiFWHU
HYDOXDWRULR IDYRUDEOH D ORV TXH VDWLVIDFHQ VXV QHFHVLGDGHV \ GHVIDYRUDEOH D ORV VH
DVRFLDQFRQODIUXVWUDFLyQGHQHFHVLGDGHV3RUHMHPSORHQORVPRGHORVGHLPLWDFLyQVH
DGRSWDQDFWLWXGHVVHPHMDQWHVDODVGHXQDSHUVRQDKDFLDODTXHVHVLHQWHVLPSDWtDSXHGH
UHVXOWDUIXQFLRQDOSDUDFRQVHJXLUDFHUFDPLHQWR

)XQFLyQGHH[SUHVLyQGHYDORUHV

5HVSRQGHQDODQHFHVLGDGGHPDQLIHVWDUHOLQGLYLGXRVXVYDORUHVPiVUHOHYDQWHVVREUHHO
PXQGR\VREUHVtPLVPRVDTXHOORVTXHHVWiQOLJDGRVDVXSURSLDLGHQWLGDGSHUVRQDO/DV

20

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

DFWLWXGHVFRPR IRUPD PHGLDGRUD TXH SHUPLWHDO LQGLYLGXR H[SUHVDU YDORUHV DQXQFLD OD
LPDJHQ GH Vt PLVPR R TXH TXLHUH DOFDQ]DU DXWRFRQFHSWR \ DXWRHVWLPD  \ D VX YH]
FRQILUPDVRFLDOPHQWHODYDOLGH]GHWDOHVFRQFHSWRV

)XQFLyQFRJQLWLYD

+D\DFWLWXGHVTXHSURSRUFLRQDQDOLQGLYLGXRXQDYLVLyQRUJDQL]DGDGHVXPXQGRORFXDO
SHUPLWHTXHHOLQGLYLGXRSXHGDGDUVHQWLGRDOPXQGRTXHOHURGHD\RUGHQDUORVGDWRVGH
ODH[SHULHQFLD/DVDFWLWXGHVGHVHPSHxDQODIXQFLyQGHFDWHJRUL]DUODLQIRUPDFLyQTXH
UHFLEH\OHD\XGDDVLPSOLILFDUODFRPSOHMLGDGGHORVHVWtPXORVSURYHQLHQWHVGHOH[WHULRU
SURSRUFLRQDQGRFLHUWRJUDGRGHSUHGHFLELOLGDGFRQVLVWHQFLD\HVWDELOLGDG

7DPELpQODVSHUVRQDVSXHGHQFRQRFHUODVDFWLWXGHVGHODVSHUVRQDVFRQTXHLQWHUDFW~DQ
\SRUWDQWRSXHGHQDQWLFLSDUODFRQGXFWDORFXDOOHSHUPLWHFLHUWDVHJXULGDGHVWDELOLGDG
 \SHUFHSFLyQVREUHVXFRPSRUWDPLHQWRHQODVVLWXDFLRQHVHLQWHUDFFLyQFRQODVSHUVRQDV
/DV DFWLWXGHV VH FRQYLHUWHQ HQ JXtDV GH OR TXH VH SXHGH HVSHUDU GH XQD GHWHUPLQDGD
VLWXDFLyQ

(O HQIRTXH IXQFLRQDO HV XQ HVTXHPD LQWHUSUHWDWLYR PiV DPSOLR TXH HO PHUDPHQWH
FRJQRVFLWLYR \ SHUPLWH DGHQWUDUVH HQ OD HVWUXFWXUD \ IXQFLRQDPLHQWR GH OD
SHUVRQDOLGDGGHOSDSHOGHWHUPLQDQWHGHODVIXQFLRQHVSVLFROyJLFDVGHODVDFWLWXGHV
IXQGDPHQWDOPHQWH GH FDUiFWHU PRWLYDFLRQDO (VWDV IXQFLRQHV PHQFLRQDGDV QR VRQ
H[FOXVLYDV\FDEHPHQFLRQDUDTXHOODVDFWLWXGHVTXHUHTXHULUtDQXQDH[SOLFDFLyQPiV
VRFLRSVLFROyJLFD FRPR ODV IXQFLRQHV LGHROyJLFDV R GH VHSDUDFLyQ HQWUH JUXSRV
FRPR H[SUHVLyQ GH OD GHSHQGHQFLD GH OD LQWHUDFFLyQ HQWUH JUXSRV R LQVWLWXFLRQHV
0RUDOHV 

 )250$&,Ï1'(/$6$&7,78'(6

(Q JHQHUDO ODV WHRUtDV VREUH ODV DFWLWXGHV FRLQFLGHQ HQ TXH ODV DFWLWXGHV VH IRUPDQ \
DGTXLHUHQ HQ VLWXDFLRQHV HVSHFtILFDV GHQWUR GH XQ FRQWH[WR VRFLDO /DV DFWLWXGHV VH
DGTXLHUHQ SRUTXH FXEUHQ XQD DPSOLD YDULHGDG GH IXQFLRQHV SDUD OD SHUVRQDOLGDG GHO
LQGLYLGXR\ODVDSUHQGHPRVHQPDUFRVLQWHUDFWLYRV\VLWXDFLRQDOHV

7ULDQGLV   EXVFD XQD H[SOLFDFLyQ D SDUWLU GH FyPR ODV SHUVRQDV GHVDUUROODQ ORV
GLIHUHQWHV FRPSRQHQWHV HQ OD IRUPDFLyQ GH ODV DFWLWXGHV /DV SHUVRQDV GHVDUUROODQ HO

21

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

DSUHQGL]DMH FRJQLWLYR LQWHJUDQGR FRQFHSWRV \ FDWHJRUtDV SDUD LQWHUSUHWDU XQ DPELHQWH


FRPSOHMR SRU LQIOXHQFLD R WUDQVPLVLyQ FXOWXUDO R SRU H[SHULHQFLD GLUHFWD (O
FRPSRQHQWH DIHFWLYR VH IRUPDUtD D SDUWLU GH ORV SURFHVRV GH FRQGLFLRQDPLHQWR
SVLFROyJLFR\GHVGHHOFRPSRQHQWHFRQGXFWXDOVRQORVSURFHVRVGHVRFLDOL]DFLyQ\GH
LGHQWLILFDFLyQORVGHWHUPLQDQWHVHQODIRUPDFLyQGHSDXWDVGHFRQGXFWD'HPDQHUDTXH
ODWUD\HFWRULDGHDSUHQGL]DMHHVWiLQIOXLGDSRUIDFWRUHVGHWHUPLQDQWHVHQODVLWXDFLyQGH
LQWHUDFFLyQVRFLDO\SURFHVRVSVLFROyJLFRVGHFRQGLFLRQDPLHQWR

/RV IDFWRUHV GHWHUPLQDQWHV HQ HO GHVDUUROOR GH ODV DFWLWXGHV .UHFK HW DO  
SURSRQHQ TXH SDUD SUHGHFLU \ FRQWURODUODFRQGXFWDGHXQVXMHWR HV QHFHVDULR VDEHU
WDPELpQ FyPR VH GHVDUUROODQ \ FDPELDQ ODV DFWLWXGHV OR FXDO SHUPLWH FRQRFHU ODV
IXHU]DVTXHLQIOX\HQHQODIRUPDFLyQGHODVDFWLWXGHV/DVIXHU]DVGHWHUPLQDQWHVGHO
GHVDUUROOR VRQ QHFHVLGDGHV SHUVRQDOHV D VDWLVIDFHU FDUDFWHUtVWLFDV \ JUDGR GH

LQIRUPDFLyQ TXH UHFLEH FDUDFWHUtVWLFDV GHO JUXSR GH SHUWHQHQFLD \ OD SHUVRQDOLGDG
GHFDGDVXMHWR

3URFHVRGHVDWLVIDFFLyQGHODVQHFHVLGDGHV

/RV LQGLYLGXRV WUDWDQ GH VDWLVIDFHU VXV QHFHVLGDGHV GHVDUUROODQGR DFWLWXGHV


IDYRUDEOHV KDFLD ORV REMHWRV \ SHUVRQDV HQWHQGLGDV FRPR PHGLRV \ REMHWLYRV HQ Vt
PLVPRRGHVIDYRUDEOHVKDFLDDTXHOORVRWURVREMHWRVTXHEORTXHDQODVDWLVIDFFLyQGH
ODQHFHVLGDG

(QHVWHVHQWLGRWLHQHQXQYDORULQVWUXPHQWDORIXQFLRQDOHQHOVHQWLGRGHTXHXQDDFWLWXG
GHVDUUROODGD puede VHUYLU SDUD VDWLVIDFHU YDULRV ILQHV D OD YH](VGHFLUDSRUWDQXQ
VLJQLILFDGRLQGLYLGXDO\VLUYHQSDUDDOFDQ]DURWURVREMHWLYRV

5HODFLyQHQWUHODVDFWLWXGHV\ODLQIRUPDFLyQUHFLELGD

/DVDFWLWXGHVUHFLEHQODLQIOXHQFLDPRGHODGRUDGHODLQIRUPDFLyQDODTXHVHH[SRQHXQ
LQGLYLGXR/DLQIRUPDFLyQUHFLELGDHVVHOHFFLRQDGDHLQWHJUDGDHQFRQVRQDQFLDFRQRWUDV
DFWLWXGHV SUHYLDPHQWH H[LVWHQWHV HQ HO VXMHWR VLHQGR OD FRQJUXHQFLD XQ IDFWRU
GHWHUPLQDQWHHQODIRUPDFLyQGHODDFWLWXG

(QVLWXDFLRQHVTXHVHUHFLEHQGDWRVLQFRPSOHWRVHLQFRQVLVWHQWHVFRQORVKHFKRVSXHGHQ
GDU RULJHQ D DFWLWXGHV FDSDFHV GH GLVWRUVLRQDU OD UHDOLGDG DFHSWDQGR OD LQFRQJUXHQFLD
FRQ DFWLWXGHV \D SUHYLDPHQWH FRQIRUPDGDV 7DO HV OD LPSRUWDQFLD GH OD LQIRUPDFLyQ

22

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

UHFLELGDHQODIRUPDFLyQGHODDFWLWXGTXHFXDQGRSHUFLEHODIDOWDGHGDWRVHYLGHQWHVHQ
OD LQIRUPDFLyQ UHFLELGD HO VXMHWR VH YH IRU]DGR D IRUPXODUVH XQD DFWLWXG 7LHQH XQ
FRPSRQHQWHPRGXODGRUSHURWDPELpQ XQFDUiFWHUGHIXHU]DGHWHUPLQDWLYDHQODDFWLWXG
\GHDKtODLPSRUWDQFLDGHODFDOLGDGGHODLQIRUPDFLyQUHFLELGDHQSURFHVRGHIRUPDFLyQ
GHDFWLWXGHV

)RUPDFLyQGHODVDFWLWXGHVGHOVXMHWRHQIXQFLyQGHVX SHUWHQHQFLDDXQJUXSR

/DVDFWLWXGHVVHGHVDUUROODQDWUDYpVGHOSURFHVRGHVDWLVIDFFLyQGHQHFHVLGDGHVGHQWUR
GHXQDPSOLRSURFHVRGHVRFLDOL]DFLyQHQODTXHLQWHUYLHQHQORVDJHQWHVGHVRFLDOL]DFLyQ
SDGUHV DPLJRV HWF  \ PHGLDQWH PHFDQLVPRV GH VRFLDOL]DFLyQ TXH WUDQVFXUUHQ SRU
LQIOXHQFLDV H[WHUQDV FRQ HO HPSOHR GH UHFRPSHQVDV \ FDVWLJRV SURFHVRV GH
LQWHULRUL]DFLyQ HQ HO GHVDUUROOR HYROXWLYR GH OD SHUVRQD R SRU OD SUHVLyQ GHO JUXSR GH
LJXDOHV

3DUD .UHFK HW DO   PXFKDV DFWLWXGHV VH IRUPDQ HQ ORV JUXSRV FODVH VRFLDO
IDPLOLD FUHHQFLDV UHOLJLRVDV SURIHVLyQ WLSR GH GHSRUWH HWF  D ORV TXH HO VXMHWR VH
DGKLHUH/DVDFWLWXGHVWLHQGHQDUHIOHMDUODVFUHHQFLDVYDORUHV\QRUPDVGHHVWRVJUXSRV
/DYLGDJUXSDOVHVXVWHQWDHQODQHFHVLGDGGHFRPSDUWLUH[SHULHQFLDVQRUPDVFUHHQFLDV
VREUH FLHUWRV REMHWRV SHUVRQDV \ KHFKRV OR FXDO OHV GD FLHUWD XQLIRUPLGDG HQ ODV
DFWLWXGHV 'H KHFKR ODV GLIHUHQFLDV HQWUH JUXSRV VH GHEHQ D TXH FRPSDUWHQ GLVWLQWDV
FUHHQFLDVTXHUHVSRQGHQDODVQHFHVLGDGHVGHFDGDJUXSR

6LQHPEDUJRHOLQGLYLGXRGHVDUUROODVXVDFWLWXGHVEDMRODLQIOXHQFLDFRPSOHMD\GHFLVLYD
GHJUXSRVSULPDULRVDORVTXHSHUWHQHFHHOLQGLYLGXR\ORVJUXSRVGHUHIHUHQFLDFRQORV
TXHVHLGHQWLILFD/DSHUWHQHQFLDGHOLQGLYLGXRDYDULRVJUXSRVSULPDULRVSRGUiJHQHUDU
DFWLWXGHVLQFRQJUXHQWHVGHELGRDODVLQIOXHQFLDVJUXSDOHVGLYHUJHQWHVVLELHQQRVHWUDWD
GH LQIOXHQFLD GLUHFWD VLQR GH XQ SHUILO FRPSOHMR GH LQIOXHQFLDV HQWUH ORV DJHQWHV
VRFLDOL]DGRUHV\HOLQGLYLGXR

(QODH[SOLFDFLyQGHODVLQIOXHQFLDVVREUHODVDFWLWXGHVKD\TXHWHQHUHQFXHQWDTXHOD
SHUWHQHQFLDGHOVXMHWRDOJUXSRPRGHODODVDFWLWXGHVSHURVRORHQFXDQWRHOLQGLYLGXRVH
LGHQWLILFD FRQ HO JUXSR HV GHFLU FXDQGR OR XWLOL]D FRPR JUXSR GH UHIHUHQFLD (Q HVWH
VHQWLGR ORV SURFHVRV GH LGHQWLILFDFLyQ MXQWR D OD VDWLVIDFFLyQ GH QHFHVLGDGHV MXHJD XQ
SDSHOVHOHFWLYR\PHGLDGRUHQWUHODVGLYHUVDVDFWLWXGHVSURFHGHQWHVGHGLVWLQWDVIXHQWHV
JUXSDOHVTXHSXHGHQVHUFRQJUXHQWHVRLQFRQJUXHQWHVHQWUHVt

23

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

/DSHUVRQDOLGDGGHOVXMHWR

2WUDIXHQWHGHGLYHUJHQFLDHQODIRUPDFLyQGHDFWLWXGHVHVODH[LVWHQFLDGHGLIHUHQFLDV
HQODSHUVRQDOLGDGFXHVWLyQTXHVHKDHVWXGLDGRHQQXPHURVDVLQYHVWLJDFLRQHV

/RVHVWXGLRVVHKDQFHQWUDGRHQGHVFXEULUFLHUWRVSHUILOHVGHSHUVRQDOLGDGUHODFLRQDGRV
FRQ ODV DFWLWXGHV GH ORV LQGLYLGXRV $OJXQRV DXWRUHV PXHVWUDQ TXH HO SHUILO GH
SHUVRQDOLGDGHVWiUHODFLRQDGDFRQHOJUDGRGHFRQJUXHQFLDGHOVLVWHPDGHDFWLWXGHVTXH
WLHQHXQLQGLYLGXRFRQUHVSHFWRDGLVWLQWDViUHDVGHOPHGLRVRFLDOHVGHFLUDFHSWDFRPR
SURSLDVHOFRQMXQWRGHDFWLWXGHVTXHVHLQWHJUDQFRQVXSHUVRQDOLGDG $GRUQR /D
SHUVRQDOLGDGHVXQDLQVWDQFLDHQODTXHVHYHQPHGLDGDVODVLQIOXHQFLDVVLWXDFLRQDOHV

$GRUQR FRLQFLGH FRQ RWURV DXWRUHV HQ TXH OD SHUVRQDOLGDG GH XQ LQGLYLGXR SXHGH QR
HVWDU LQWHJUDGD FRQWHQLHQGR WDQWR FRQWUDGLFFLRQHV FRPR FRQVLVWHQFLDV SHUR TXH HVWiQ
 RUJDQL]DGDV HQ IRUPDV SVLFROyJLFDPHQWH VLJQLILFDWLYDV DGRSWDQGR DFWLWXGHV TXH HVWiQ
HQ FRQIOLFWR HQWUH Vt SRU LQIOXHQFLDV GH IDFWRUHV VLWXDFLRQDOHV FRPR OD DGVFULSFLyQ D
JUXSRV HQ GHILQLWLYD SRUTXH REHGH]FD D SUR\HFFLRQHV \ UHSUHVLRQHV TXH UHIOHMDQ
SXOVLRQHVFRQWUDGLFWRULDV +\PDQ\6KHDWVOH\ 

3URFHVRGHDSUHQGL]DMHHQODIRUPDFLyQGHDFWLWXGHV

2WUD IRUPD GH H[SOLFDU OD IRUPDFLyQ GH DFWLWXGHV HQ VX FRPSRQHQWH HPRFLRQDO HV D
WUDYpVGHORVPRGHORVGHFRQGLFLRQDPLHQWRFOiVLFRVHJ~QHOFXDOVHDGRSWDQDFWLWXGHV
SRUTXH HOHVWtPXORHVWiDVRFLDGRFRQXQDFRQWHFLPLHQWRTXHSURGXFHXQDGHWHUPLQDGD
UHVSXHVWD DFWLWXG \DOVXUJLUGHQXHYRHOHVWLPXORSRGUiSURYRFDUHVDPLVPDUHVSXHVWD
=DQQD 

/D3VLFRORJtD&RQGXFWLVWDH[SOLFDODIRUPDFLyQGHODVDFWLWXGHV\VXGHVDUUROORPHGLDQWH
VX WHRUtD GHO ³FRQGLFLRQDPLHQWR FOiVLFR´ SDUD HO FRPSRQHQWH HPRWLYR \D TXH HO
LQGLYLGXRDVRFLDHOREMHWRGHODDFWLWXG (& DXQ(,GDGR\GDUiFRPRUHVXOWDGRXQDV
GHWHUPLQDGDVSDXWDVGHLQFOLQDFLyQDODDFFLyQ DFWLWXG TXHSRGUiQVHUIDYRUHFHGRUDVX
REVWDFXOL]DQWHVGHODDFFLyQ =DQQD 

/RV WHyULFRV GHO UHIXHU]R H[SOLFDQ OD IRUPDFLyQ GH DFWLWXGHV D SDUWLU GHO FRPSRQHQWH
UHDFWLYRRFRQGXFWXDOEDVDGRHQODVFRQVHFXHQFLDVSRVLWLYDVRQHJDWLYDVGHODUHVSXHVWD
HVGHFLUODVUHFRPSHQVDVTXHUHFLEHDFDPELRFRPRDODEDQ]DDSUREDFLyQDFHSWDFLyQ
DIHFWRUHSURFKHUHSUREDFLyQLQGLIHUHQFLDHQWUHRWUDV 3DVWRU 

24

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

2WURPRGHORVHUtDHOGHODSUHQGL]DMHYLFDULRTXHSRQHHVSHFLDOpQIDVLVHQODREVHUYDFLyQ
HLPLWDFLyQ %DQGXUD \ :DOWHUV GHXQPRGHORTXHFXPSOHXQSDSHOVLJQLILFDWLYR
HQ OD IRUPDFLyQ GH DFWLWXGHV $GHPiV GHO UHIXHU]R OD LPLWDFLyQ GHO PRGHOR HVWi
PHGLDWL]DGDSRUGLIHUHQWHVIDFWRUHVFRPRODUHODFLyQDIHFWLYDHQWUHHOPRGHOR\HOVXMHWR
HOHVWDWXVGHOPRGHORODVHPHMDQ]DHQWUHDPERV

(Q UHVXPHQ HO PDUFR WHyULFR VHxDOD OD LPSRUWDQFLD GHO SDSHO GHO DSUHQGL]DMH HQ OD
IRUPDFLyQ GH ODV DFWLWXGHV HQ ORV TXH ORV UHIXHU]RV GH ORV IDFWRUHV GH OD LQWHUDFFLyQ
VRFLDOGHFDUiFWHUJUXSDOVHLQFRUSRUDQDGHPiVGHORVSURFHVRVGHLQWHULRUL]DFLyQGHOD
SHUVRQDHQFXDQWRDODGLVSRVLFLyQDVDWLVIDFHUODVQHFHVLGDGHVSXOVLRQDOHVGHOLQGLYLGXR

 7(25Ë$6<(675$7(*,$662%5((/&$0%,2'(/$6$&7,78'(6

 /DV DFWLWXGHV DSUHQGLGDV VH IRUPDQ GHVDSDUHFHQ \ VH WUDQVIRUPDQ HQ HO GHYHQLU GH OD
DFFLyQKXPDQDORFXDOVXSRQHSUHVWDUDWHQFLyQDORVSURFHVRVGHDGTXLVLFLyQ\FDPELR
GHDFWLWXGHV

(VWRV SURFHVRV FRQOOHYDQ D FRQVLGHUDU XQ GREOH DVSHFWR SRU XQD SDUWH HO VXMHWR KD GH
PDQWHQHU XQDV HVWUXFWXUDV DUPRQLRVDV \ FRQVLVWHQWHV HQWUH ORV FRPSRQHQWHV
FRJQRVFLWLYRDIHFWLYR\GHDFFLyQ\ODWHQGHQFLDDODDFFLyQ\ORVSRVLEOHVFDPELRVHQ
HO VLVWHPD GH DFWLWXGHV < SRU RWUD ODV WHQGHQFLDV GH DFFLyQ GHO VXMHWR YLHQH
GHWHUPLQDGDQRVyORSRUODVDFWLWXGHVVLQRWDPELpQSRUIDFWRUHVH[WHUQRVGHOFRQWH[WR
5RVHQEHUJ 

/D LQIOXHQFLD GH ORV IDFWRUHV VLWXDFLRQDOHV \ FRQWH[WXDOHV HQ ODV SDXWDV FRQGXFWXDOHV
FRQOOHYDUtDFDPELRVGHDFWLWXGFRQGLVWLQWRDOFDQFH\QDWXUDOH]D

&RPR VHxDOD .HOPDQ   SDUDTXH XQ PpWRGR GH FDPELR GH DFWLWXGHV WHQJDp[LWR
GHEHUi FRQVLGHUDU ORV SURFHVRV GH LQWHUDFFLyQ VRFLDO WHQLHQGR HQ FXHQWD ODV EDVHV
PRWLYDFLRQDOHVGHOLQGLYLGXRSDUDRULHQWDUVHHQUHODFLyQDODQHFHVLGDGTXHVDWLVIDFH\
ODIXHQWHGHSRGHUGHODJHQWHGHLQIOXHQFLD\HOPRGRGHFUHDUODUHVSXHVWDLQGXFLGD(Q
HODQiOLVLVGHOSDSHOMXJDGRSRUODLQIOXHQFLDVRFLDOHQHOSURFHVRGH FDPELRGHDFWLWXG
.HOPDQ  KDGLIHUHQFLDGRWUHVWLSRVGHLQIOXHQFLD

25

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

9 &RQVHQWLPLHQWR6HRULJLQDHQODVSUHVLRQHVKDFLDODFRQIRUPLGDG5HSUHVHQWDXQ
FDPELRGHDFWLWXGVXSHUILFLDO\DSDUHQWHVLQTXHVLJQLILTXHFDPELRUHDOHLPSOLFD
XQDFXHUGRPDQLILHVWRHQHOLQGLYLGXRSHURQRFDPELRFRJQLWLYR
9 ,GHQWLILFDFLyQ6HGHULYDGHOHVWDEOHFLPLHQWRGHQRUPDVHQORVJUXSRVSULPDULRV
SHTXHxRV(VWRLPSOLFDXQFDPELRHQHOFDPSRSVLFROyJLFRGHODSHUVRQDVREUH
ODEDVHGHODPRGHODFLyQ
9 ,QWHUQDOL]DFLyQ3URYLHQHGHFRPXQLFDFLRQHVSHUVXDVLYDVSURFHGHQWHVGHIXHQWHV
GLJQDVGHFRQILDQ]D\FRQOOHYDXQFDPELRIXQGDPHQWDOHQXQYDORU

(OFDPELRGHDFWLWXGHVKD\TXHFRQVLGHUDUORGHVGHHOODGRGHORVIDFWRUHVGHWHUPLQDQWHV
HQORVIHQyPHQRVGHUHVLVWHQFLDDOFDPELR SXHVVLHPSUHUHVXOWDUiPiVIDFWLEOHFXDQWR
PiV VH DFHUTXH DO SHUtRGR GH OD IRUPDFLyQ LQLFLDO GH ODV PLVPDV \D TXH XQD YH] VH
KD\DQ GHVDUUROODGR FRQVLVWHQWHPHQWH SDVDUiQ D IRUPDU SDUWH GH OD FRQILJXUDFLyQ GH OD

SHUVRQDOLGDGGHFDGDVXMHWR

7DPELpQFDEHFRQVLGHUDUODVGLIHUHQWHVIXHQWHVGHLQIOXHQFLDHQHOFDPELRGHDFWLWXGFRQ
GLVWLQWDVLPSOLFDFLRQHVWHyULFDV\SUiFWLFDVORFXDOQRVOOHYDDODFRQFOXVLyQGHTXHODV
DFWLWXGHV QR VH GHVDUUROODQ QL VH FDPELDQ VREUH OD EDVH GH XQ SULQFLSLR ~QLFR \
XQLIRUPH $OJXQDV WHRUtDV LQFLGLUiQHQ HVWUDWHJLDV VREUH HOFRPSRQHQWH FRJQLWLYR SDUD
FDPELDUOR GDQGR QXHYD LQIRUPDFLyQ PHGLDQWH GHVHTXLOLEULR FRJQRVFLWLYR 2WUDV
PHGLDQWH HO UHIXHU]R TXH DFW~D VREUH HO FRPSRQHQWH DIHFWLYR SXGLHQGR FDPELDU OD
SRVLELOLGDG GH DGTXLULU QXHYDV H[SHULHQFLDV \ RWUDV D SDUWLU GH ODV LGHQWLILFDFLRQHV
VRFLDOHVTXHDFW~DQVREUHHOFRPSRQHQWHFRQGXFWXDOTXHSXHGHPRGLILFDUVHDWUDYpVGHO
XVRGHFRQVHFXHQFLDVSRVLWLYDVRQHJDWLYDV

'H PDQHUD TXH KD\ GLVWLQWDV DSUR[LPDFLRQHV WHyULFDV \ HVWUDWpJLFDV SDUD H[SOLFDU ORV
SURFHVRVGHFDPELRGHDFWLWXGHVHQIRFDGDVFDGDXQDGHHOODVDWUDWDUGLIHUHQWHVDVSHFWRV
GHO FDPELR GH DFWLWXGHV 6LHQGR DPSOLD OD OLWHUDWXUD H[LVWHQWH VREUH HO FDPELR GH
DFWLWXGHVHVWDVVHSXHGHQLQWHJUDUHQODVSHUVSHFWLYDVGHODSUHQGL]DMH\ODVWHRUtDVGHOD
FRQVLVWHQFLD

7HRUtDFRQGXFWLVWD\HOFDPELRGHDFWLWXGHV

/DV WHRUtDVGHO FRQGLFLRQDPLHQWR FOiVLFR FRPR ODV GHOFRQGLFLRQDPLHQWR RSHUDQWHKDQ


SURSRUFLRQDGRXQDLQWHUSUHWDFLyQGHOFDPELRGHDFWLWXGDSDUWLUGHOHVTXHPDHVWtPXOR
UHVSXHVWD

26

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

/D DFWLWXG HV XQD UHVSXHVWD FRQGLFLRQDGD KDFLD DOJ~Q REMHWR GHO HQWRUQR VLHQGR OD
UHVSXHVWDREVHUYDEOHGHWHUPLQDQWHHQODIRUPDFLyQGHODDFWLWXGGHPRGRTXHHOVXMHWR
LQFRUSRUDUi OD FRQGXFWD DVRFLDGD FRQ H[SHULHQFLDV SRVLWLYDV ( LQYHUVDPHQWH  ODV
DFWLWXGHV TXH QR VRQ UHIRU]DGDV VRQ ODV TXH LUiQ H[WLQJXLpQGRVH SURJUHVLYDPHQWH (Q
HVWH VHQWLGR ORV PRGHORV GH HVWtPXORUHVSXHVWD D ORV TXH OD SHUVRQD VH YHD H[SXHVWD
HMHUFHUiQODDWUDFFLyQLPLWDWLYDTXHFRPSRUWHQ /RWW\/RWW\6WDDWV 

3RUWDQWRODVHVWUDWHJLDVTXHXWLOL]DODSHUVSHFWLYDFRQGXFWLVWDSDUDODFRQVHFXFLyQGHO
FDPELR GH DFWLWXGHV VRQ ODV WpFQLFDV GH PRGLILFDFLyQ GH FRQGXFWD 3URJUDPDV GH
0RGLILFDFLyQ GH &RQGXFWD  /DV DSOLFDFLRQHV GH HVWDV WpFQLFDV UHTXLHUHQ GH XQD
LQYHVWLJDFLyQDGHFXDGDVREUHORVTXHVHTXLHUHFDPELDUHVGHFLUTXHSDUDSURGXFLUXQ
FDPELRGHDFWLWXGHVQHFHVDULRFRQRFHUODELRJUDItDGHOVXMHWRHQFXDQWRDORVUHIXHU]RV
UHFLELGR\DTXHORVLQFHQWLYRVDUHFLELUGHEHQWHQHUPD\RUYDORUTXHHORULJLQDO

7HRUtD&RJQLWLYDGHO&DPELRGH$FWLWXGHV

'HQWURGHODSHUVSHFWLYDDFHUFDGHOFDPELRGHDFWLWXGHV\FUHHQFLDVSDUDLQFUHPHQWDUOD
DFFLyQFDEHGHVWDFDUODVVLJXLHQWHVWHRUtDV\HVWUDWHJLDVGHOFDPELRGHDFWLWXGHVGHOD
FRPXQLFDFLyQSHUVXDVLYD +RYODQG-DQLV\.HOO\ \VREUHODGLVRQDQFLDFRJQLWLYD
)HVWLQJHU   6HJ~Q ORV DXWRUHV GHO GHQRPLQDGR 0RGHOR GHO DSUHQGL]DMH GHO
PHQVDMHHOSURFHVRSVLFROyJLFRIXQGDPHQWDODWUDYpVGHOFXDOWLHQHOXJDUHOFDPELRGH
DFWLWXGHVHODSUHQGL]DMH

/DFRPXQLFDFLyQSHUVXDVLYD

/D FRPXQLFDFLyQ SHUVXDVLYD HV HO SURFHVR GLULJLGR D XQ LPSDFWR SRWHQFLDO GH OD
FRQGXFWDGHORVVXMHWRVPHGLDQWHHOUHIXHU]RRFDPELRGHDFWLWXGHV/RVLQLFLDGRUHVGH
HVWD SHUVSHFWLYD +RYODQG HW DO   LQVSLUDGD HQ HO PRGHOR GH DSUHQGL]DMH GHO
PHQVDMHPLHPEURVGHOGHQRPLQDGR3URJUDPDGH&DPELRGH$FWLWXG\&RPXQLFDFLyQ
GH <DOH FHQWUDURQ VX DWHQFLyQ VREUH ODV FDUDFWHUtVWLFDV GH OD IXHQWH GH PHQVDMH GHO
PHQVDMHWUDQVPLWLGR\GHODDXGLHQFLD UHFHSWRU \HQSURFHVRGHFDPELRGHDFWLWXGDVt
FRPRODVUHODFLRQHVTXHH[LVWHQHQWUHHVWDVLQVWDQFLDV3DUDHVWRVDXWRUHVHOPRGRHQTXH
VH RUJDQL]D \ SUHVHQWD XQD FRPXQLFDFLyQ HV GHFLVLYD SDUD ORJUDU TXH OD JHQWH SUHVWH
DWHQFLyQODFRPSUHQGDQODDFHSWHQ\ODUHWHQJDQ

$XQTXHVXRULJHQPHWRGROyJLFRHVWiHQODWHRUtDGHOUHIXHU]R\DSUHQGL]DMHODWHRUtDKD
GHULYDGR KDFLD VXSXHVWRV FRJQLWLYLVWDV HQ OD TXH OD SHUVXDVLyQ R FDPELR GH DFWLWXGHV

27

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

GHSHQGHVLJQLILFDWLYDPHQWHGHFyPRHOUHFHSWRULQWHUSUHWD\UHVSRQGHDORVHOHPHQWRVGH
ODVLWXDFLyQIRUPDGRSRUODIXHQWHGHHPLVLyQHOPHQVDMH\HOFRQWH[WRGHODUHFHSFLyQ

8QR GH ORVIDFWRUHV PiV UHOHYDQWHV SDUD HVWRV DXWRUHV HV HO SDSHO GHVHPSHxDGR SRU HO
FRPXQLFDGRU OD IXHQWH  HQ HO FDPELRGHDFWLWXGGHOUHFHSWRUGHOD FRPXQLFDFLyQ /RV
H[SHULPHQWRVOOHYDGRVDFDERSRUORVDXWRUHVGHOUHIXHU]RFRQILUPDQODLPSRUWDQFLDGH
XQDWHRUtDGHODLQFLWDFLyQEDVDGDHQORVHVWtPXORVSURSRUFLRQDGRVSRUODFUHGLELOLGDG\
FRPSHWHQFLD GHO FRPXQLFDGRU SHUR VHJ~Q $VFK   HQ HVWRV FDVRV VH UHJLVWUDQ XQ
FDPELR HQ HO REMHWR GH MXLFLR HQ OXJDU GH XQ FDPELR GH MXLFLR VREUH HO REMHWR 3RU
HMHPSORHOHIHFWRGHXQDFRPXQLFDFLyQLPSDUWLGDSRUXQUHQRPEUDGRSURIHVRUFRQXQD
REUD LPSRUWDQWH IRUPDQ XQ WRGR XQD *HVWDOW  HV GLIHUHQWH TXH OD GH XQ SURIHVRU \ VX
REUDVLQSUHVWLJLR(QGHILQLWLYDODSUHVHQFLDGHGRVFRQMXQWRVGLIHUHQWHVVHUtDREMHWRGH
MXLFLRV \ HIHFWRV GLIHUHQWHV VREUH ODV SHUVRQDV TXH OR SHUFLEHQ (Q GHILQLWLYD OD

H[SOLFDFLyQGHOFDPELRGHDFWLWXGHVH[LVWHGLYHUVLGDGGH SRVLFLRQHVWHyULFDVTXHSRQHQ
HOpQIDVLVHQGLVWLQWDVIDFWRUHVFRPRVRQODIXHQWHHOPHQVDMH\ORVUHODFLRQDGRVFRQHO
UHFHSWRU MXQWR D ORV IDFWRUHV TXH IDYRUHFHQ OD DFWLYLGDG FRJQLWLYD GHO VXMHWR HQ HO
DIURQWDPLHQWR GH ODV LQFRQVLVWHQFLDV GHVDJUDGDEOHV PHGLDQWH PHFDQLVPRV GHIHQVLYRV
0RQWPROOLQ 

/DIXHQWHGHSHUVXDVLyQ/DVSULQFLSDOHVFDUDFWHUtVWLFDVTXHLQIOX\HQHQODHIHFWLYLGDG
GH FXDOTXLHU FRPXQLFDGRU VRQ OD FUHGLELOLGDG EDVDGD HQ KDELOLGDG \ FRQILDQ]D HO
DWUDFWLYRTXHHMHUFHFRPRSHUVRQDVLJQLILFDWLYD HQHOFRQWH[WRHQVHxDQ]DHVWHSDSHOOR
GHVHPSHxDQHOSURIHVRU\ORVFRPSDxHURVGHJUXSR \HOSRGHUGHLQIOXHQFLD

5DYHQ   KD GHILQLGR HO SRGHU VRFLDO FRPR XQD LQIOXHQFLD VRFLDO SRWHQFLDO TXH VH
HMHUFHXWLOL]DQGRORVVLJXLHQWHVUHFXUVRV

x ,QIRUPDFLyQ &XDQGR HO HVWXGLDQWH PRGLILFD VX FRQGXFWD R DFWLWXG UHRUJDQL]DQGR


VXVFRJQLFLRQHVDOVHULQIOXHQFLDGRSRUHOFRQWHQLGRGHLQIRUPDFLyQSURSRUFLRQDGR
SRUHOSURIHVRU\QRHQYLUWXGGHDOJXQDFDUDFWHUtVWLFDDVRFLDGDDOSURIHVRU
x &RHUFLWLYR &DSDFLGDG GHO SURIHVRU GH HMHUFHU LQIOXHQFLD VREUH HO HVWXGLDQWH HQ
YLUWXG GH OD SHUFHSFLyQ GHO HVWXGLDQWH GH SRVLEOHV FDVWLJRV FXDQGR QR REHGHFH
UHDOL]DUODVWDUHDVRQRVHPXHVWUDSDUWLFLSDWLYRHQODDFWLYLGDG
x 5HFRPSHQVD&XDQGRHOSURIHVRUHVFDSD]GHHMHUFHUXQDLQIOXHQFLDVREUHHODOXPQR
HQ EDVH D OD SRVLELOLGDG GH UHFRPSHQVDU DO DOXPQR \ FXDQGR pVWH OD UHFRQRFH R

28

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

SHUFLEH TXH HO SURIHVRU SXHGH UHFRPSHQVDUOH VL VXV DFWLWXGHV VRQ DGHFXDGDV FRQ
UHVSHFWRDORVFRPSDxHURVRHOHTXLSR
x 5HIHUHQWH,GHQWLILFDFLyQFRQHOSURIHVRUFRPRUHIHUHQFLD SRVLWLYDRQHJDWLYD HQ
ODVTXHHODOXPQRDGDSWDVXVDFWLWXGHV\FRPSRUWDPLHQWRVDPRGHORVTXHFRQVLGHUD
VLJQLILFDWLYRV
x ([SHUWR R SHULFLD &XDQGR HO HVWXGLDQWH SHUFLEH \ UHFRQRFH TXH HO SURIHVRU SRVHH
XQD VHULH GH FRQRFLPLHQWRV \ DFWLWXGHV TXH HO HVWXGLDQWH GHEH GHVDUUROODU \
DSUHQGHU
x /HJtWLPR(VWiEDVDGRHQODDFHSWDFLyQSRUSDUWHGHOUHFHSWRUGH ODVQRUPDVLQWHUQDV
\ YDORUHV GHO FHQWUR \ HO SURIHVRU TXH OH RULHQWDQ R SUHVLRQDQ SDUD TXH WHQJD
DFWLWXGHV DGDSWDWLYDV 6H WUDWD GH OD DFHSWDFLyQ SRU SDUWH GHO HVWXGLDQWH GH OD
SRVLFLyQ GHDXWRULGDG \UROHVUHFRQRFLGRV TXH REVWHQWD HO SURIHVRU SDUDSUHVFULELU
 FRPSRUWDPLHQWRVDGHFXDGRVHQHODOXPQR

3RURWUDSDUWHDQWHODVSUHVFULSFLRQHVGHOSRGHUOHJtWLPRODFRQIRUPLGDGGHOHVWXGLDQWH
SXHGH VHU FRQGXFWXDO SHUR QR QHFHVDULDPHQWH DFWLWXGLQDO HV GHFLU SRGUi DGRSWDU XQD
FRQGXFWDDFRUGHFRQODVQRUPDV\YDORUHVVLQTXHH[LVWDFRQJUXHQFLDFRQVXVDFWLWXGHV

'HDFXHUGRFRQPXFKRVDXWRUHVODIXHQWHPiVLPSRUWDQWHSDUDHOFDPELRGHDFWLWXGHV
VRQODVSURSLFLDGDVSRUVLWXDFLRQHVHQODVTXHVHSURGXFHQFRPSRUWDPLHQWRVFRQWUDULRV
DODVDFWLWXGHVLQWHUQDOL]DGDV

(Q JHQHUDO HO SURIHVRU FRPR FRPXQLFDGRU R SRWHQFLDO WUDQVPLVRU GH PHQVDMHV
DFWLWXGLQDOHV \ YDORUDWLYRV SXHGH GLVSRQHU GH SRWHQFLDOHV UHFXUVRV LQVWLWXFLRQDOHV \
SHUVRQDOHV HQ VX LQWHQWR GHOLEHUDGR GH LQIOXLU HQ HO FDPELR GH DFWLWXGHV \
FRPSRUWDPLHQWRVGHORVDOXPQRV$VtFXDQWRPiVHVWtPXORVHLPSRUWDQFLDVHOHGpDODV
FDSDFLGDGHV GH LQIOXHQFLD GHO SURIHVRU HQ FXDQWR D SHULFLD DWUDFFLyQ  UHFRPSHQVDV \
SRGHU FRHUFLWLYR PD\RUHV SRVLELOLGDGHV H[LVWHQ GH ORJUDU XQ FDPELR GH DFWLWXG HQ ORV
HVWXGLDQWHV

&RQWH[WRGHOFHQWURFRPRIDFWRUGHLQIOXHQFLD (QODFRPXQLFDFLyQLQWHUYLHQHYDULRV
IDFWRUHVHQWUHORVFXDOHVFDEHGHVWDFDUODVLWXDFLyQFRPRIDFWRUTXHSXHGHFRQGLFLRQDUOD
PRWLYDFLyQ\FDSDFLGDGGHSURFHVDPLHQWRGHOUHFHSWRU/DVUHDFFLRQHVGHRWUDVSHUVRQDV
DQWHXQPHQVDMHSHUVXDVLYRSXHGHFRQGLFLRQDUODUHVSXHVWDGHDFHSWDFLyQRUHFKD]RGHO
UHFHSWRU /D LQWHUDFFLyQ JUXSDO IDYRUHFH OD VLPLOLWXG GH DFWLWXGHV \ ORV SURFHVRV GH

29

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

DWUDFFLyQHLGHQWLILFDFLyQGHQWURGHOJUXSRVLHQGRXQDIXHQWHLPSRUWDQWHDPRVWUDUXQD
GLVSRVLFLyQ PiV SRVLWLYD KDFLD XQD LQWHUDFFLyQ FRRSHUDWLYD HQWUH Vt FRPXQLFDFLyQ
DPLVWDG\FRRSHUDFLyQHVWiQtQWLPDPHQWHUHODFLRQDGDV (VWDHVODSULQFLSDOUD]yQSRUOD
TXH VH VXHOH XWLOL]DU DO JUXSR FRPR IXHQWH GH SHUVXDVLyQ SDUD HO FDPELR GH DFWLWXGHV
$VtMXQWRDOSURIHVRUKD\TXHFRQVLGHUDUDORVFRPSDxHURVFRPRIXHQWHGHLQIOXHQFLD

/D SHUVRQDOLGDG GHO UHFHSWRU /DV FDUDFWHUtVWLFDV \ DWULEXWRV GH ODV SHUVRQDV SXHGHQ
WHQHU XQ HIHFWR GLVWLQWR HQ FDGD XQR GH ORV SURFHVRV GH LQIRUPDFLyQ (V GHFLU ODV
FDUDFWHUtVWLFDV LQGLYLGXDOHV TXH KDFHQ DO VXMHWR VHD PiV R PHQRV VXVFHSWLEOH GH VHU
LQIOXLGR \ VX VLWXDFLyQ FDUD D FDUD FRQ ORV DJHQWHV GH SHUVXDVLyQ /RV LQGLYLGXRV
PRVWUDUiQ WHQGHQFLDV WHQGHUiQ D UHFKD]DU R DFHSWDU FRPXQLFDFLRQHV SHUVXDVLYDV TXH
GHSHQGHUiQ GH IDFWRUHV SHUVRQDOHV TXH LQWHUYLHQHQ HO SURFHVR GH LQIRUPDFLyQ 3DUHFH
FRPSUREDGDODH[LVWHQFLDGHXQDUHODFLyQGLUHFWDHQWUHHOQLYHOGHLQWHOLJHQFLDHOJUDGR

GHOUDVJRJHQHUDOGHSHUVXDVLYLGDGHOVHQWLPLHQWRGHDXWRHVWLPD\HOHVWLORFRJQRVFLWLYR
GHOVXMHWR\ODYDULDELOLGDGGHODVDFWLWXGHV

(OPHQVDMHSHUVXDVLYR &XDQGRODLQIRUPDFLyQSHUFLELGDHVUHOHYDQWHSDUDHOUHFHSWRU
DXPHQWDODPRWLYDFLyQGHOUHFHSWRUHQODHODERUDFLyQGHODLQIRUPDFLyQDXPHQWDQGRGH
HVWD PDQHUD OD SHUVXDVLyQ GHO PHQVDMH /RV IDFWRUHV TXH IDYRUHFHQ OD FDSDFLGDG GH
SHUVXDVLyQGHOPHQVDMHVRQ

1RYHGDG \ XWLOLGDG &XDQWR PiV QXHYRV X RULJLQDOHV VHDQ ORV DUJXPHQWRV PD\RU
SRWHQFLDO SHUVXDVLYR WHQGUi VREUH OD DXGLHQFLD HVWXGLDQWHV  HV GHFLU HO SRWHQFLDO GH
QRYHGDGGLQDPL]DHOSURFHVRPHGLDGRUDFWLWXGLQDOGHOVXMHWRKDFLDODDFHSWDFLyQGHORV
REMHWLYRV GH HQVHxDQ]D SXHV OD LQIRUPDFLyQ QRYHGRVD \ GH XWLOLGDG GH FDUD D XQ
REMHWLYRDWUDHODDWHQFLyQGHOUHFHSWRUKDFLDHOPHQVDMHSHUVXDVLYR

$SHODFLyQDOWHPRU(OWHPRU FRPRPHQVDMHSHUVXDVLYRHVXWLOL]DGRFRPRKHUUDPLHQWD
SDUDSUHVLRQDUDOHVWXGLDQWHDTXHDFHSWHODVQRUPDVYDORUHVFUHHQFLDV\DFWLWXGHVGHO
JUXSR DO TXH SHUWHQHFH 3DUD 9DQGHU =DQGHQ   OD PD\RU HILFDFLD SHUVXDVLYD VH
DOFDQ]D FXDQGR VH FRQVLGHUD TXH OD UHVSXHVWD HPRFLRQDO SURYRFDGD SRU OD DPHQD]D
FRQWHQJDUHFRPHQGDFLRQHVSDUDUHGXFLUHVHWHPRUHVGHFLUSDUDKDFHUIUHQWHDOSHOLJUR
-XQWRDHOOR6HFRUG\%DFNPDQ  KDEUtDTXHLQFOXLUHOIDFWRUWLHPSRKDFLpQGROHV
FRPSUHQGHUSDUDHQPHQGDUFRPSRUWDPLHQWRV\DFWLWXGHVLQFRUUHFWRV

30

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

,PSOLFDFLyQ SHUVRQDO /D SHUVXDVLYLGDG GH XQ PHQVDMH HV PD\RU FXDQGR VH DFWLYDQ \
UHFRQRFHQWDUHDVGHDSRUWDFLyQSHUVRQDOGHODOXPQRSRUTXHDVtHOHVWXGLDQWHDGTXLULUi
XQDDFWLWXGSDUWLFLSDFLyQ\HODERUDFLyQPiVHVWDEOH\TXHGHHVWHPRGRVHLQFRUSRUHGH
IRUPDPiVFRKHUHQWHHQVXFRPSRUWDPLHQWRIXWXUR

 7HRUtDGHODGLVRQDQFLDFRJQLWLYD

/D WHRUtD )HVWLQJHU   KD WHQLGR XQ JUDQ LQFLGHQFLD SRU HO JUDQ Q~PHUR GH
LQYHVWLJDFLRQHV\GLVFXVLRQHVUHDOL]DGDVHQWRUQRDODIRUPDFLyQ\FDPELRGHDFWLWXGHV
'H DFXHUGR FRQ ORV SULQFLSLRV GH OD 'LVRQDQFLD &RJQLWLYD HO FDPELR GH DFWLWXG VH
SURGXFH FXDQGR HO VXMHWR QR HV FDSD] GH PDQWHQHU GLVFUHSDQFLDV HQWUH RSLQLRQHV \
SHQVDPLHQWRV R ELHQ HQWUH VX IRUPD GH SHQVDU VXV DFWLWXGHV \ VX FRQGXFWD (VWD
GLVRQDQFLD SURYRFDUi PDOHVWDU \ OD LQWHQWDUi UHVROYHUOD PHGLDQWH FDPELRV HQ VX
HVWUXFWXUDFRJQLWLYDRHQVXVSDXWDVFRQGXFWXDOHVUHVWDEOHFLHQGRODFRQVLVWHQFLD

$FHSWDU OD GLVRQDQFLD HV DOJR TXH QR HV IiFLO SXHV ODV SHUVRQDV QRUPDOPHQWH OOHYDQ
HVWUDWHJLDVUDFLRQDOL]DGRUDVWUDWDQGRGHUHVLVWLUVHDLGHDVFRQWUDGLFWRULDVRGLVWRUVLRQDUOD
LQIRUPDFLyQSDUDPDQWHQHUODVFUHHQFLDVKDFLHQGRTXHVXFRQGXFWDVHMXVWLILTXHDQWHORV
GHPiVRDQWHVtPLVPR

/DVQXPHURVDVLQYHVWLJDFLRQHVOOHYDGDVDFDERVREUHODGLVRQDQFLDFRJQLWLYDKDSRGLGR
HVWDEOHFHUODVFRQGLFLRQHVSDUDTXHODGLVRQDQFLDWXYLHUDXQHIHFWRUHFRQRFLEOHSRUORV
LQGLYLGXRVHVGHFLUXQFDPELRGHDFWLWXG

9 &RQFUHFLyQ GH ODV FRQVHFXHQFLDV QHJDWLYDV /D SHUVRQD HV FRQVFLHQWH GH ODV
FRQVHFXHQFLDV DYHUVLYDV R QHJDWLYDV GH VX FRPSRUWDPLHQWR R TXH OH LPSLGH
DOFDQ]DUDOJRGHLQWHUpVSDUDHOOD &RRSHU\%UHKP 
9 $WULEXFLyQ GH OD UHVSRQVDELOLGDG SHUVRQDO /D GLVRQDQFLD VH DFWLYD FXDQGR OD
SHUVRQD VH FRQVLGHUD UHVSRQVDEOH GH OD DFFLyQ \ VH VLHQWH OLEUH SDUD GHFLGLU OD
UHDOL]DFLyQ GH OD DFFLyQ GLVFUHSDQWH FRQ OD DFWLWXG /LQGHU &RRSHU \ -RQHV
 
9 ([SHULPHQWDFLyQ GHO HIHFWR SURGXFLGR /D GLVFUHSDQFLD HQWUH OD FRQGXFWD
UHDOL]DGD \ XQD DFWLWXG GLVRQDQWH SURGXFH H[FLWDFLyQ ILVLROyJLFD GHVDJUDGDEOH
/RVFK\&DFLRSSR 

31

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

9 $WULEXFLyQGHODH[FLWDFLyQDODDFFLyQ$ODLQFRQJUXHQFLDSURGXFLGDHQWUHVXV
DFWLWXGHV\VXVDFFLRQHVFHQWUDQGRODDWHQFLyQHQGLFKDLQFRQJUXHQFLD /RVFK\
&DFLRSSR 
9 'LVRQDQFLDHQWUHDFFLyQ\DFWLWXG7LHQH TXHKDEHUPDOHVWDUSVLFROyJLFRFRQOD
DFWLWXGSDUDTXHVHDFWLYHODGLVRQDQFLD\UHFRQRFHUTXHDOJRWLHQHTXHFDPELDU
9 'LVRQDQFLDUHGXFLGDDWUDYpVGHOFDPELRGHDFWLWXG6yORFXDQGRODVDFWLWXGHVVH
HQIUHQWDQFRQODVDFFLRQHVVHHOLPLQDILQDOPHQWHODGLVRQDQFLD .HOPDQ 

 'LQiPLFDGHOFDPELRGHDFWLWXGHVHQHOFRQWH[WRGHODDFFLyQ

/D DSRUWDFLyQ GHO PRGHOR GH .HOPDQ   VREUH HO FDPELR GH DFWLWXGHV HQ
UHIHUHQFLD D ORV SURFHVRV GH LQWHUDFFLyQ VRFLDO SXHGH VHU DSURSLDGR HQ HO FRQWH[WR
HQVHxDQ]D SRUTXH UHODFLRQD GLQiPLFDPHQWH ORV WUHV SURFHVRV GH LQIOXHQFLD VRFLDO
VXPLVLyQ LGHQWLILFDFLyQ H LQWHULRUL]DFLyQ  FRQ ODV IXHQWHV GH SRGHU GHO DJHQWH

GHLQIOXHQFLD\HOPRGRHQTXHHODJHQWHFRQVLJXHLQGXFLUXQDUHVSXHVWDHQHODFWRU lD
SUHSRWHQFLD GH UHVSXHVWD LQGXFLGD /DV DSOLFDFLRQHV VREUH ORV
HVWXGLDQWHV\ODVLQWHUUHODFLRQHVP~OWLSOHVFRQVXVLJXDOHVHOJUXSRSURIHVRUOD

VLWXDFLyQ\FRQWH[WR HGXFDWLYR

6HJ~Q.HOPDQ  HOFDPELRGHDFWLWXGHVVHDFWLYDFXDQGRXQLQGLYLGXRVHHQIUHQWD


DXQDGLVFUHSDQFLDHQWUHVXDFWLWXG\DOJ~QHOHPHQWRGHODUHDOLGDG \DVHDLQIRUPDFLyQ
QXHYDRXQDDFWLWXGGLIHUHQWHHQSHUVRQDVTXHVRQLPSRUWDQWHVSDUDpO RFXDQGRVLHQWH
LQFRQJUXHQFLDV HQWUH OD DFWLWXG \ OD FRQGXFWD (VWDV GLVFUHSDQFLDV IDYRUHFHGRUDV
GHO FDPELR GH DFWLWXG VH DFWLYDQ FXDQGR VH H[SUHVDQ D WUDYpV GHO FDUiFWHU
S~EOLFR GH ODV DFFLRQHV \ OD LPSOLFDFLyQ SHUVRQDO GH ORV LQGLYLGXRV (QWUH
WDOHV GLVFUHSDQFLDV FDEH GHVWDFDUODVVLJXLHQWHV

9 &XDQGRHOHVWXGLDQWHUHFLEHLQIRUPDFLyQ\FRQRFLPLHQWRVQXHYRVHVGHFLUQXHYRV
FRQWHQLGRVGHDSUHQGL]DMH
9 (Q VLWXDFLRQHV HQ TXH ORV HVWXGLDQWHV HVWiQ EDMR OD LQIOXHQFLD GH SHUVRQDV
VLJQLILFDWLYDV SURIHVRUJUXSRGHLJXDOHV LQIOXHQFLDVFHUFDQDV\OHMDQDV
9 (QFRQWHxWR\VLWXDFLRQHVTXHSURSRUFLRQDQHOPDUFRGHDFFLyQHGXFDWLYDSDUDTXH

ORV HVWXGLDQWHV SXHGDQ UHIOH[LRQDU VREUH VXV DFWLWXGHV \ FRQGXFWDV (VWD ~OWLPD
GLVFUHSDQFLD DFWLWXGLQDO HV XQD IXHQWH UHOHYDQWH HQ HO FDPELR GH DFWLWXGHV \D TXH
HVWDVYDUtDQHQHOWUDQVFXUVRGHODDFFLyQHGXFDWLYD

32

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

 2WURVIDFWRUHVGHLQIOXHQFLDHQHOFDPELRGHDFWLWXGHV

6HJ~Q .UHFK HW DO   XQD YH] IRUPDGDV ODV DFWLWXGHV HVWiQ VRPHWLGDV D XQD
YDULDELOLGDG R FDPELR TXH GHSHQGHUiGHIDFWRUHVFRPRODVFDUDFWHUtVWLFDVGHODDFWLWXG
SUHH[LVWHQWHV GH OD SHUVRQDOLGDG GHO VXMHWR GH OD LQIRUPDFLyQ TXH VH OHV SURSRUFLRQH
SRUVXVDILOLDFLRQHVDORVJUXSRVTXHSHUWHQHFHQ\GHODLQWHQVLGDGFRQODTXHVHKD\D
LQFRUSRUDGR OD DFWLWXG GH OD IXQFLyQ TXH WDO DFWLWXG FXPSOD \ GH ODV WpFQLFDV TXH VH
HPSOHHQSDUDRSHUDUGLFKRFDPELR

 /RVJUXSRVSULPDULRV\VXLQFLGHQFLDHQHOFDPELRGHDFWLWXGHV

&XDQGR VH WUDWD GH DFWLWXGHV TXH VXSRQHQ XQ VRSRUWH VRFLDO LQWHUQR UHVXOWDQ PX\
GLItFLOHVGHFDPELDUVLHOVXMHWRTXHODVSRVHHYDORUDLQWHQVDPHQWHVXSHUWHQHQFLDDGLFKR
iPELWRVRFLDOHQRUGHQDFRQVHUYDUVXHVWDWXV
 /DV DFWLWXGHV GH XQ LQGLYLGXR FDPELDQ FXDQGR SDVD D XQ QXHYR JUXSR R FDPELD VXV

UHODFLRQHVVRFLDOHV FDPELDGHFHQWUR DGRSWDQGRODVQRUPDVFHQWUDOHVGHOJUXSR(VWD


GLUHFFLyQ HVWi UHODFLRQDGD FRQ HO JUDGR GH OLEHUWDG TXH VH WHQJD GHQWUR GHO JUXSR HO
JUDGRGHFRQWUROTXHWHQJDHOJUXSR

/DVFDUDFWHUtVWLFDVGHOLQGLYLGXRLQIOX\HHQODHILFDFLDGHODDILOLDFLyQDOJUXSRSXHVOD
LQVHJXULGDGDFHQW~DODQHFHVLGDGGHDSUREDFLyQWDPELpQODLPSRUWDQFLDGDGDDOGHVHR
GHSHUWHQHFHUDOJUXSR\ODDFHSWDFLyQGHOLQGLYLGXRVREUHODVQRUPDVTXHSUHVFULEHHO
JUXSR

 /DLQIRUPDFLyQDGLFLRQDO\HOFDPELRGHDFWLWXGHV

(O FDPELR GH DFWLWXGHV LQGXFLGR SRU OD DSDULFLyQ GH XQD LQIRUPDFLyQ FRPSOHPHQWDULD
GHSHQGHUiGHWUHVFDUDFWHUtVWLFDVGHODVLWXDFLyQHQTXHVHSURGXFHODFRPXQLFDFLyQ8Q
SULPHU IDFWRU D FRQVLGHUDU HQ OD HILFDFLD VREUH HO FDPELR GH DFWLWXGHV HV TXH HO
FRPXQLFDQWH GHEH SRVHHU FUHGLELOLGDG \ FXDOLGDGHV DWUDFWLYDV \DJUDGDEOHV DGHPiV GH
VHU FRQVLGHUDGRFRPRSHUWHQHFLHQWH DO ³JUXSR´GH ORV TXHUHFLEHQODLQIRUPDFLyQ3RU
RWURODGRHOFDPELRVHGDFRQPD\RUHILFDFLDFXDQGRODLQIRUPDFLyQVHGDHQJUXSRTXH
D XQ LQGLYLGXR VLHPSUH \ FXDQGR OD PD\RUtD GHO JUXSR DSR\H OD SRVLFLyQ GHO HPLVRU
&RQWUDULDPHQWH VL HO JUXSR VH RSRQH DO FRQWHQLGR HV PiV HILFD] VL VH UHDOL]D
LQGLYLGXDOPHQWH < SRU ~OWLPR ORV PHQVDMHV ³GLUHFWRV´ VRQ PiV HILFDFHV TXH ORV

33

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

UHDOL]DGRVDWUDYpVGHORVPHGLRVGHFRPXQLFDFLyQVLELHQpVWRVLQIOX\HQHQORVOtGHUHV
VRFLDOHVTXHGLIXQGHQ\FRQWULEX\HQDODIRUPDFLyQGHRSLQLyQS~EOLFD

/D HILFDFLD HQ HO FDPELR GH DFWLWXGHV WDPELpQ GHSHQGH GH OD IRUPD \ FRQWHQLGR GHO
PHQVDMHHVGHFLUHQHOTXp\FyPRVHSURGXFHODLQIRUPDFLyQ$VtGHSHQGHUiGHOYDORU
LQVWUXPHQWDOTXHVHOHGpDODLQIRUPDFLyQHVGHFLUDODLPSRUWDQFLDYDORUDWLYDTXHGDQ
ORVLQGLYLGXRVDORVILQHVRFRQVHFXHQFLDVHVSHUDGDVSDUDTXHpVWRVFDPELHQVXDFWLWXG
KDFLD HO REMHWR R VLWXDFLyQ $GHPiV OD QDWXUDOH]D GH ORV FDPELRV QR VRQ OLQHDOHV VLQR
FXUYLOtQHDVHVGHFLUQRUHVSRQGHQDXQSDWUyQVLVWHPiWLFRSXHVQRVHQFRQWUDPRVDQWHXQ
HIHFWR WHFKR HQ ORV H[WUHPRV GH ODV RULHQWDFLRQHV DFWLWXGLQDOHV $TXHOORV TXH GH
DQWHPDQR PXHVWUDQ XQD DFWLWXG PX\ IDYRUDEOH R GHVIDYRUDEOH DSHQDV FDPELDQ 3RU
~OWLPR HO JUDGR GH LPSOLFDFLyQ GH ORV LQGLYLGXRV DIHFWD D OD GLUHFFLyQ GHO FDPELR GH
DFWLWXG SURSXHVWD FXDQGR H[LVWH XQD GLVFUHSDQFLD PDUFDGD HQWUH HO FRPXQLFDQWH \ HO

VXMHWR\DTXHHOLQGLYLGXRVHUHVLVWLUiDOFDPELR

 ,QWHQVLGDG\FDPELRGHXQDDFWLWXG

3DUD DOJXQRV DXWRUHV HO FDPELR GH ODV DFWLWXGHV HVWi HQ UHODFLyQ GLUHFWD FRQ HO
FRQWH[WR GH OD DFFLyQ SXHV ODV DFWLWXGHV H[SHULPHQWDQ FDPELRV D WUDYpV GH ODV
H[SHULHQFLDVDFXPXODGDVDORODUJRGHOWLHPSR\GHVLWXDFLRQHVGLIHUHQWHV$ORODUJR
GHO FLFOR YLWDO XQD SHUVRQD RFXSD GLVWLQWRV UROHV H LQWHUDFFLRQD FRQ SHUVRQDV GH
HVWDWXV GLIHUHQWHV HQ FRQWH[WRV VRFLDOHV GLQiPLFRV TXH FRQWULEX\HQ D OD
GLVFRQWLQXLGDGGHORVUROHV

7RGRV HVWRV IDFWRUHV LQIOX\HQ \ SUHVLRQDQ D ORV VXMHWRV SDUD TXH PRGLILTXHQ VXV
DFWLWXGHV\YDORUHV\FDPELHQRDMXVWHQVXVDFFLRQHVDODVQXHYDVVLWXDFLRQHVHQODVTXH
VHYHQLPSOLFDGRV/DVDFWLWXGHVVRQSRUWDQWR

³« UHDOLGDGHV GLQiPLFDV \ FDPELDQWHV VRPHWLGDV D XQ FRQWLQXR SURFHVR GH


DSUHQGL]DMHLQWHQFLRQDORLQFLGHQWDOTXHWLHQHOXJDUHQODDFFLyQ´ &ROOHWDO,p.171 

/DLPSRUWDQFLDGHOFRQWH[WRHGXFDWLYRHQ HOFDPELRGHDFWLWXGHVUHIXHU]DHOLQWHUpVTXH
GHEHPRV SUHVWDU D HVWD FXHVWLyQ \D TXH FRQRFLpQGRODV SRGHPRV LQWHUYHQLU SDUD
SRWHQFLDU R FRUUHJLU FRQYHQLHQWHPHQWH ODV PLVPDV SRU VX LQIOXHQFLD HQ HO SURFHVR GH
HQVHxDQ]D\DSUHQGL]DMH

34

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

(QGHILQLWLYDSDUDLQWURGXFLUHOFDPELRGHDFWLWXGHVHGXFDWLYDVHVQHFHVDULRUHDOL]DUODV
QHFHVDULDV IDVHV GHO SURFHVR SVLFROyJLFR FRQVLVWHQWH HQ LGHQWLILFDU PHGLU HYDOXDU
GLDJQRVWLFDULQIRUPDUHLQWHUYHQLUELHQPHGLDQWHHOHQWUHQDPLHQWRDGHFXDGRGHQWURGHO
SURFHVRGHHQVHxDQ]D\DSUHQGL]DMHRELHQPHGLDQWHHOFDPELRLQWHQFLRQDODORODUJR
GHODYLGDHGXFDWLYDGHODVDFWLWXGHVFRQVLGHUDGDVLQDGHFXDGDVSDUDHOUHQGLPLHQWR\HO
p[LWR

 0(',&,Ï1'(/$6$&7,78'(6

'HVGH HO SXQWR GH YLVWD PHWRGROyJLFR ODV DFWLWXGHV VRQ FRQVWUXFWRV KLSRWpWLFRV  TXH
VXUJHQGHXQPDUFRWHyULFRTXHODVGHILQHFRPRXQHVWDGRLQWHUQRGHOVXMHWRTXHHVWi
RULHQWDQGR \ determinando VX FRQGXFWD (VWR TXLHUH GHFLU TXH QR HV XQ SURFHVR
REVHUYDEOH \ VH LQILHUH VX H[LVWHQFLD  D SDUWLU GH YDULDEOHV LQGLUHFWDV SDODEUDV \

DFFLRQHV TXHVXSRQHPRVTXHHVWiQHQUHODFLyQFRQODDFWLWXGDPHGLU

$SHVDUGHODGLILFXOWDGHVSDUDPHGLUDFWLWXGHVVHKDQGHVDUUROODGRWpFQLFDVGHPHGLFLyQ
D SDUWLU GH OD GpFDGD GH  $GRUQR   FRQ OD DSOLFDFLyQ GH  OD HVFDOD GH
DXWRULWDULVPR R ³(VFDOD )´ PHGLDQWH HO SURFHGLPLHQWR GH DXWRLQIRUPHV (VWD WpFQLFD
FRQRFLGD FRPR HVFDOD GH DFWLWXGHVUDVJRV HVWi EDVDGD HQ UHSXHVWDV TXH VXHOHQ HVWDU
UHODFLRQDGDV FRQ RWURV LQWHJUDQWHV GHO PXQGR VRFLDO GHO VXMHWR \ H[SUHVDQ XQ PRGR
FDUDFWHUtVWLFR GH UHDFFLRQDU IUHQWH D ORV GHPiV 3RVWHULRUPHQWH VH KDQ GHVDUUROODGR
HVFDODV VLPLODUHV VREUH UDVJRV GH SHUVRQDOLGDG GH GLYHUVR RUGHQ HQWUH ODV FXDOHV FDEH
FLWDU ORV UHODWLYRV DO GRJPDWLVPR OD ULJLGH] R OD HPSDWtD (Q HO PLVPR VHQWLGR ODV
DSRUWDFLRQHVH[LWRVDVGHOD3VLFRPHWUtDHQHOFDPSRGHOGHVDUUROORGHLQVWUXPHQWRVGH
HYDOXDFLyQ FRPR ORV LQYHQWDULRV GH SHUVRQDOLGDG \ ODV DSWLWXGHV KDQ FRQWULEXLGR D OD
HODERUDFLyQ GH UREXVWDV WpFQLFDV PHWRGROyJLFDV GH PHGLFLyQ GH DFWLWXGHV FRPR
LQVWUXPHQWRVSDUDVXHYDOXDFLyQ

/DPD\RUtDGHODVLQYHVWLJDFLRQHVVREUHODVDFWLWXGHVHQODHQVHxDQ]DVXSHULRUKDQGDGR
HVFDVD FHQWUDOLGDG DO PDQHMR GH OD DFWLWXG FRPR HVWUDWHJLD GH DXWRUUHJXODFLyQ GHO
DSUHQGL]DMHHQVHxDQ]D$~QWHQLHQGRHQFXHQWDTXHODVLQYHVWLJDFLRQHVGHODVDFWLWXGHV
HGXFDWLYDV FRQWLHQHQ PXFKRV GH ORV FRQFHSWRV \ PHWRGRORJtD HQFRQWUDGDV HQ OD
LQYHVWLJDFLyQ GH ODV HVWUDWHJLDV FRJQLWLYDV GH ORV HVWXGLDQWHV XQLYHUVLWDULRV ORV
LQVWUXPHQWRVDSURSLDGRVSDUDVXGLDJQyVWLFR\HYDOXDFLyQHVWiQHQXQDHWDSDLQFLSLHQWH

35

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

/D PHGLFLyQ GH DFWLWXGHV YD PiV DOOi GH OD GHVFULSFLyQ UHDOL]DQGR OD HYDOXDFLyQ HQ
WpUPLQRVGHGLUHFFLyQHLQWHQVLGDG,SHUPLWLHQGRUHDOL]DUFRPSDUDFLRQHVHQWUHLQGLYLGXRV
\JUXSRV&RQODGLUHFFLyQVHPLGHHOFRPSRQHQWHFRJQLWLYR\FRQODLQWHQVLGDGVHPLGH OD
YDOHQFLD \HOFRPSRQHQWHDIHFWLYRDVRFLDGRDODDFWLWXG

/DPD\RUSDUWHGHORVPpWRGRVGHPHGLGDGHDFWLWXGVHEDVDQHQPHGLFLRQHVGHHVFDODV
TXH PLGHQ LQGLUHFWDPHQWH OD DFWLWXG D SDUWLU GH RSLQLRQHV \ DXWRGHVFULSFLRQHV GH ORV
VXMHWRVDFHUFDGHODVDFWLWXGHVXWLOL]DQGRFXHVWLRQDULRVFRPRLQVWUXPHQWRGHUHFRJLGD
GHODVPDQLIHVWDFLRQHVVXEMHWLYDVDFHUFDGHODSURSLDFRQGXFWD

2WUDVSURFHGLPLHQWRVGHPHGLGDGLUHFWDGHODDFWLWXGVRQREVHUYDFLRQHVGHODUHDFFLyQ
GHOLQGLYLGXRRODLQWHUSUHWDFLyQGHHVWtPXORVSDUFLDOPHQWHHVWUXFWXUDGRVODREVHUYDFLyQ
GH FRQGXFWDV HQ VLWXDFLRQHV ODERUDOHV UHDOL]DFLyQ WDUHDV REMHWLYDV FX\D HMHFXFLyQ
SUHVXSRQHGHWHUPLQDGDVDFWLWXGHV\UHVSXHVWDVSVLFRILVLROyJLFDVDGHWHUPLQDGRVREMHWRV

GHFRQGXFWDRDVXVUHSUHVHQWDFLRQHVWDOHVFRPRULWPRFDUGLDFRGLODWDFLyQGHODSXSLOD
HWF

 0HGLGDVGLUHFWDVGHODVDFWLWXGHV(VFDODV

8QDHVFDODGHDFWLWXGHVWiIRUPDGDSRUXQFRQMXQWRGHtWHPVySURSRVLFLRQHVPHGLDQWH
ORVFXDOHVHOLQGLYLGXRH[SUHVDVXJUDGRGHDFXHUGRRGHVDFXHUGR/DUHVSXHVWDGHFDGD
SURSRVLFLyQ LQGLFD GLUHFFLyQ H LQWHQVLGDG \ HVWiQ UHODFLRQDGRV FRQ HQWLGDGHV VRFLDOHV
SHUVRQD \ DFWLYLGDGHV VLHQGR OD VXPD GH ODV UHVSXHVWDV REWHQLGDV XQ SXQWDMH TXH
GHVLJQD OD DFWLWXG GH OD SHUVRQD (O SXQWDMH UHSUHVHQWD XQ tQGLFH FX\D PDJQLWXG HVWi
UHODFLRQDGD FRQ XQ UHFRUULGR TXH YD GHVGH GH XQD YDORUDFLyQ WRWDOPHQWH QHJDWLYD
SDVDQGRSRUXQSXQWRQHXWUDOKDVWDXQDYDORUDFLyQWRWDOPHQWHSRVLWLYD

([LVWHQ GLVWLQWRV WLSRV GH HVFDODV TXH SXHGHQ VHU FODVLILFDGDV HQ IXQFLyQ GHO QLYHO GH
PHGLGDVHJ~QHOPRGHORQXPpULFRDTXHUHVSRQGHQFRQTXHSHUPLWHQREWHQHUODPHGLGD
/RVPHWRGyORJRVGLVWLQJXHQFXDWURQLYHOHVVHJ~QHOQLYHOGHPHQRUDPD\RUSUHFLVLyQ
GH OD PHGLFLyQ (VFDODV QRPLQDOHV HQ ODV TXH ORV Q~PHURV VRQ FDWHJRUtDV GH
FODVLILFDFLyQHVFDODVRUGLQDOHVHQHOTXHORVtQGLFHVH[SUHVDQ~QLFDPHQWHRUGHQSHURQR
FDQWLGDG \ PDJQLWXG HVFDODV GH LQWHUYDOR TXH LQGLFDQ ODV GLVWDQFLDV LJXDOHV HQWUH
LQWHUYDORV FRQWLJXRV VLQ XQ SXQWR FHUR TXH LQGLTXH DXVHQFLD GHO UDVJR \ HVFDODV GH
UD]yQVRQHVFDODVGHLQWHUYDORFRQXQSXQWRFHUR$XQTXHHVWDFODVLILFDFLyQHVODPiV

36

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

H[WHQGLGDVHVXHOHSUHVFLQGLUGHODVHVFDODVQRPLQDOHV\DTXHVLQRUGHQQRKD\PHGLFLyQ
HVWDGtVWLFD

(VFDODGHLQWHUYDORVDSDUHQWHPHQWHLJXDOHVGH7KXUVWRQH

/DFDUDFWHUtVWLFDPiVUHOHYDQWHHVTXHORVtWHPVWLHQHQXQYDORUTXHLQGLFDVXSRVLFLyQ
HQ HO FRQWLQXR IDYRUDEOHGHVIDYRUDEOH DEDUFDQGR HO FRQMXQWR GHORV tWHPV HO FRQWLQXR
GHOUDVJRDFWLWXGLQDODPHGLU

(O SURFHGLPLHQWR HPSOHDGR FRQVLVWH HQ REWHQHU XQ EDnFR GH tWHPV DOUHGHGRU GH
 RSLQLRQHV DFWLWXGLQDOHV  TXH UHFRJHQ HQ FRQWLQXR DFWLWXGLQDO SDUD VRPHWHUORV D
XQD HYDOXDFLyQXWLOL]DQGRDOUHGHGRUGHMXHFHVRPiVPHGLDQWHXQDSXQWXDFLyQTXHYD
GHVGH Pi[LPRDFXHUGRFRQODSUHJXQWDRtWHP KDVWD Pi[LPRGHVDFXHUGR /DV
SUHJXQWDVVHDJUXSDQHQIXQFLyQGHODVSXQWXDFLRQHVTXHOHVKDQDVLJQDGRORVMXHFHV
 VLHQGRODPHGLDRODPHGLDQDGHODVSXQWXDFLRQHVRWRUJDGDVDFDGDtWHPVHOYDORUTXH
WHQGUi HQ OD HVFDOD < SRU ~OWLPR VH VHOHFFLRQDQ ORV tWHPV UHFKD]DQGR DTXHOORV
TXH VHDQDPELJXRVRLUUHOHYDQWHVHQODYDULDQ]DLQWHUMXLFLR

6H XWLOL]D SRFR HQ OD LQYHVWLJDFLyQ VRFLDO SRUTXH FRQVWUXLU XQD HVFDOD GH 7KXUVWRQH
FRQVXPH PXFKR WLHPSR \ HV FRVWRVD \D TXH UHTXLHUH HO HVIXHU]R GH HQFRQWUDU XQD
PXHVWUDVGHMXHFHVH[SHUWRVSDUDXQiUHDSDUWLFXODUGHODDFWLWXGQRHVWDUHDIiFLO
'HVGHHOSXQWRGHYLVWDPHWRGROyJLFRVXSULQFLSDOGHIHFWRHVTXHORVH[SHUWRV MXHFHV 
SXHGHQVHVJDUODPHGLFLyQDSRUWDQGRRSLQLRQHVSURSLDV\SHUFLELHQGRTXHODVFDWHJRUtDV
HVWiQDGHVLJXDOGLVWDQFLDORFXDOFRQWUDGLFHORVVXSXHVWRVGHODPHGLFLyQ

(VFDODGH/LNHUW

/D HVFDOD GH /LNHUW HV OD PiV VHQFLOOD \ GHELGR D HOOR HV OD TXH WLHQH PD\RU GLIXVLyQ
HQWUHORVPpWRGRVGHLQYHVWLJDFLyQDFWLWXGLQDO&RQVLVWHHQODHODERUDFLyQGHXQDVHULH
GH HQXQFLDGRV FODVLILFDGRV HQ XQD HVFDOD GH FLQFR SXQWRV IXHUWHPHQWHGH DFXHUGR GH
DFXHUGR LQGHFLVR HQ GHVDFXHUGR IXHUWHPHQWH HQ GHVDFXHUGR  DFHUFD GHO REMHWR
DFWLWXGLQDO /LNHUW 5$   6H SDUWH GHO VXSXHVWR GH TXH OD VXPD GH XQD VHULH GH
UHVSXHVWDV REWHQLGD HQ FDGD XQR GH ORV tWHPV SUHVHQWDGRV H[SUHVDQ HO PLVPR UDVJR R
GLPHQVLyQTXHVLW~DHOVXMHWRHQODDFWLWXGPHGLGD&RPRODDQWHULRUHVFDODHQWUDxDXQD
PHGLFLyQXQLGLPHQVLRQDO

37

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

6X VHQFLOOH] GHULYD GH TXH ODV IUDVHV VHUiQ FODVLILFDGDV VHJ~Q ODV DFWLWXGHV H[SUHVDGDV
SRUXQDPXHVWUDGHLQGLYLGXRVHYLWDQGRHOMXLFLRGHORVH[SHUWRV

/DVHOHFFLyQGHORVtWHPVVHUHDOL]DHQEDVHDODFRUUHODFLyQTXHPDQWLHQHFDGDtWHPFRQ
OD SXQWXDFLyQ WRWDO GH tWHPV VDWLVIDFLHQGR HO FULWHULR GH FRQVLVWHQFLD LQWHUQD /DV
FRUUHODFLRQHVLQWHUtWHPGHEHQVHUSRVLWLYDV\ODYDULDQ]DFRPSDUWLGDSRUWRGRVHOORVVH
LGHQWLILFDFRQHOUDVJRREMHWRGHODPHGLFLyQ(VWRVDQiOLVLVGHYDOLGH]QRVLQIRUPDUiQ
GH OD DGHFXDFLyQ GH ORV tWHPV SDUD PHGLU HO UDVJR TXH LQWHUHVD HOLPLQDQGR DTXHOORV
tWHPVTXHQRVHDMXVWDQDOREMHWLYRGHPHGLUHOUDVJRSODQWHDGR

 'LIHUHQFLDOVHPiQWLFR

'HVDUUROODGRSRU2VJRRG HWDO  SDUDDQDOL]DUHQGLIHUHQWHVGLPHQVLRQHVRUDVJRV


ODV DFWLWXGHV TXH XQ VXMHWR WLHQH DQWH FXDOTXLHU VLWXDFLyQ VLHQGR SRU WDQWR XQD HVFDOD
 PXOWLGLPHQVLRQDO (Q HVWD WpFQLFD VH XWLOL]D XQD VHULH GH DGMHWLYRV ELSRODUHV SRVLWLYR
QHJDWLYREXHQRPDORHWF HQXQFRQWLQXRJUDGXDOGHVLHWHYDORUDFLRQHV DO 

/DV GLFRWRPtDV GHO SHUILO GH SRODULGDG PLGHQ SUHIHUHQWHPHQWH WUHV GLPHQVLRQHV OD
HYDOXDFLyQ SRWHQFLD \ DFWLYLGDG /RV SURFHGLPLHQWRV GH HYDOXDFLyQ GHO GLIHUHQFLDO
VHPiQWLFR VH HPSOHDQ SDUD LQGLYLGXRV R JUXSRV H[WUD\HQGR ODV SXQWXDFLRQHV PHGLDV
DOFDQ]DGDV HQ FDGD XQR GH ORV DGMHWLYRV XWLOL]DGRV HQ OD HVFDOD DVt FRPR ODV
SXQWXDFLRQHVREWHQLGDVHQFDGDXQDGHODVGLPHQVLRQHV

0HGLGDVGLUHFWDV

7pFQLFDVSVLFRILVLROyJLFDV

$OJXQDV LQYHVWLJDFLRQHV KDQ EXVFDGR PHGLFLRQHV REMHWLYDV GH OD DFWLWXG D SDUWLU GHO
KHFKR GH TXH ODV UHDFFLRQHV HPRFLRQDOHV VH FRPELQDQ FRQ UHDFFLRQHV ILVLROyJLFDV OR
FXDO SHUPLWLUtD TXH HO SURFHVR GH PHGLFLyQ IXHUD LQGHSHQGLHQWH GH OD YDULDELOLGDG GHO
VXMHWR

$OJXQRV GH ORV LQGLFDGRUHV REMHWLYRV HPSOHDGRV KDQ VLGR OD UHVSXHVWD SVLFRJDOYiQLFD
*65  \ OD GLODWDFLyQ SXSLODU EDVDGDV HQ OD REWHQFLyQ GH UHVSXHVWDV ILVROyJLFDV TXH
FDPELDQ FXDQGR ODV SHUVRQDV HVWiQ HPRFLRQDOPHQWH DFWLYDGDV 8QD OLPLWDFLyQ
LPSRUWDQWH GH HVWRV LQGLFDGRUHV SVLFRILVLROyJLFRV HV TXH pVWDV PHGLGDV DSUHFLDQ OD
LQWHQVLGDGGHODVUHDFFLRQHVHPRFLRQDOHVSHURQRODGLUHFFLyQGHODDFWLWXGUD]yQSRUOD
FXDOHVWDWpFQLFDHQODDFWXDOLGDGDSHQDVVHHPSOHDHQHVWHWLSRGHSUXHEDV

38

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

&DFLRSSR\3HWW\  DSOLFDURQXQDQXHYDWpFQLFDGHHOHFWURPLRJUDItDIDFLDO (0*) 


TXHPHGtDODDFWLYLGDGHOpFWULFDGHORVP~VFXORVFRPRUHDFFLRQHVSRVLWLYDVRQHJDWLYDV
DFWLWXGLQDOHVGHOVXMHWRHQXQFRQWH[WRGHFRPXQLFDFLyQSHUVXDVLYD&RQFOX\HURQTXHOD
WpFQLFD GHO (0*)  HV VHQVLEOH D ODV UHDFFLRQHV SRVLWLYDV VRQULVD  R QHJDWLYDV
FRQWUDFFLyQ GHO HQWUHFHMR  GH XQ VHQWLPLHQWR R HPRFLyQ UHVSHFWR D ORV PHQVDMHV
SHUVXDVLYRVTXHUHFLEtDQORVVXMHWRVHQXQFRQWH[WRH[SHULPHQWDO

([LVWHQGXGDVGHTXHODWpFQLFDGHO (0*) SXGLHVHHYDOXDUFRQULJRUODLQWHQVLGDGGH


XQD UHDFFLyQ HPRFLRQDO 6H XWLOL]DQ SRFR ODV PHGLGDV ILVLROyJLFDV GHELGR D OD
LQVHQVLELOLGDG GH OD PD\RUtD GH ORV LQVWUXPHQWRV KDFLD DOJXQD GH ODV FXDOLGDGHV GH OD
UHVSXHVWD DFWLWXGLQDO 7DPELpQ UHVXOWD FRPSOHMR DSOLFDU HVWRV LQVWUXPHQWRV HQ XQ
HQWRUQRGHWUDEDMRGHFDPSRHQORVTXHVHUHTXLHUHHQWRUQRFRQWURODGR\GHVXMHWRVPX\
FRODERUDGRUHV

&XHVWLRQDULRV

8QDGHODVIRUPDVGHUHDOL]DUODHYDOXDFLyQGHODVDFWLWXGHVHVPHGLDQWHSURFHGLPLHQWRV
LQGLUHFWRV D WUDYpV GH DXWRLQIRUPHV HVWUXFWXUDGRV HQ HO TXH VH UHFRSLODQ R  LQWHJUDQ
SUHJXQWDVVHFXHQFLDOL]DGDVUHFRJLGDVHQXQFXHVWLRQDULRRLQYHQWDULR+DELWXDOPHQWHVH
HPSOHDQSDUDHYDOXDUDVSHFWRVGLYHUVRV\DVHDSDUDHVWXGLDUODSHUVRQDOLGDGRHODQiOLVLV
GHUHSHUWRULRVFRQGXFWXDOHV\FRQVWUXFWRVPRWLYDFLRQDOHV

/RV FXHVWLRQDULRV R LQYHQWDULRV FRQOOHYDQ XQ IRUPXODULR GH SUHJXQWDV R DVHYHUDFLRQHV


VREUH ODV FXDOHV HO VXMHWR GHEH UHVSRQGHU D ODV DOWHUQDWLYDV SODQWHDGDV HQ PRGR
GLFRWyPLFR VLQRYHUGDGHURIDOVR RELHQH[SUHVDQGRVXFRQIRUPLGDGVHJ~QXQDHVFDOD
RUGLQDORGHLQWHUYDORVHOLJLHQGRXRUGHQDQGRODVUHVSXHVWDVVHJ~QODVSUHIHUHQFLDVGHO
VXMHWRSXGLHQGRUHVSRQGHUVHWDQWRGHPDQHUDQRPLQDOFRPRRUGLQDO

/RV FXHVWLRQDULRV VH RUJDQL]DQ HQ WRUQR D SUHJXQWDV FRQ UHSXHVWDV GLFRWyPLFDV R
QRPLQDOHV ORV LQYHQWDULRV FRQ UHVSXHVWDV QRPLQDOHV X RUGLQDOHV PLHQWUDV TXH HQ ODV
HVFDODVODUHVSXHVWDHVRUGLQDORGHLQWHUYDOR QDGDSRFRUHJXODUEDVWDQWHPXFKR (Q
WRGRVORVIRUPDWRVVHOHVVXHOHDVLJQDUXQFyGLJRQXPpULFRDFDGDXQDGHODVRSFLRQHV
SDUDIDFLOLWDUHOFiOFXORFRUUHVSRQGLHQWH

(Q RSLQLyQ GH )HUQiQGH] %DOOHVWHURV   ODV FDUDFWHUtVWLFDV SULQFLSDOHV HV TXH VRQ
HVWUXFWXUDGRV HQ OD VHFXHQFLD SUHJXQWDVUHVSXHVWDV VREUH FRQGXFWDV HVSHFtILFDV

39

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

HVWDEOHFLGDV GH DQWHPDQR \ UHODFLRQDGDV FRQ VXFHVRV TXH RFXUUHQ KDELWXDOPHQWH \


UHSUHVHQWDGRVYHUEDOPHQWHVREUHDVSHFWRVGHODYLGDUHDOGHORVLQGLYLGXRV

0HWRGROyJLFDPHQWH OD FDOLGDG GH ORV DXWRLQIRUPHV GHEHQ EDVDUVH HQ FULWHULR V GH
IRUPXODFLyQ\GLVHxRGHODVSUHJXQWDVHVWUXFWXUDGDVTXHDIHFWDQWDQWRDODLQWHUYHQFLyQ
GHlLQYHVWLJDGRUFRPRDOVXMHWRGHODLQYHVWLJDFLyQGHOWDOPRGRTXHVHSXHGDJDUDQWL]DU
ODYDOLGH]GHORVREMHWLYRVDPHGLU\ODILDELOLGDGHQODFRQVLVWHQFLDGHODVUHSXHVWDV
REWHQLGDV

8QDGHODVIXHQWHVH[WHUQDVDFRQWURODUHVODLQIOXHQFLDVHVJDGDGHIDFWRUHVTXHVHGDQ
FRQ LQGHSHQGHQFLD GHO FRQWHQLGR GH ODV SUHJXQWDVUHVSXHVWDV \ TXH GH DOJXQD IRUPD
SXHGDQ FRPSURPHWHU D ORV REMHWLYRV TXH VH SUHWHQGHQ PHGLU 6L ELHQ HO GLVHxR GHO
FXHVWLRQDULRGHEHHYLWDUTXHODVSUHJXQWDVQRGHIRUPHQRFRQGLFLRQHQODVUHVSXHVWDVHQ
OD SUiFWLFD VH HQFXHQWUDQ IDFWRUHV GH GLVWRUVLyQ GH UHVSXHVWDV HQ HO VXMHWR SRU IDOWD GH

VLQFHULGDGGDUXQDLPDJHQGHVtPLVPRVRFLDOPHQWHGHVHDEOHDVHQWLPLHQWRDUHVSRQGHU
DILUPDWLYDPHQWH\ODWHQGHQFLDDH[SUHVDUYDORUHVFHQWUDOHVRH[WUHPRV

2WUDIXHQWHGHGLVWRUVLyQIUHFXHQWHHQODREWHQFLyQGHLQIRUPDFLyQYHQGUtDGDGDSRUOD
LQIOXHQFLD GHO LQYHVWLJDGRU TXH EXVFD FRUURERUDU LGHDV SUHFRQFHELGDV D PRGR GH
SURIHFtD DXWRFXPSOLGD R ELHQ HQ OD IDOWD GH SUHFLVLyQ GH ORV FRQWHQLGRV GH ODV
SUHJXQWDV TXH SXGLHUDQ HYLWDU LQWHUIHUHQFLDV HQ OD FRPSUHQVLyQ GHO FXHVWLRQDULR SRU
SDUWH GHO VXMHWR )HUQiQGH] %DOOHVWHURV   SURSRQH ORV VLJXLHQWHV FULWHULRV SDUD
HYLWDUVHVJRVTXHGLVWRUVLRQHQHQODLQIRUPDFLyQUHFLELGD\GHHVWDIRUPDJDUDQWL]DUOD
FDOLGDGGHORVDXWRLQIRUPHV

9 ,QIRUPDU VREUH ORV HYHQWRV DFWXDOHV FRQFXUUHQWHV R DO PHQRV HVWDU OR PiV
SUy[LPRVSRVLEOHDORVSURSLRVHYHQWRV
9 /RVLQYHVWLJDGRUHVGHEHQLQWHUIHULUORPHQRVSRVLEOHVREUHORVGDWRV
9 /DV FXHVWLRQHV GHEHQ HVWDU SODQWHDGDV GH IRUPD HVSHFtILFD \ OD LQIRUPDFLyQ
VROLFLWDGDGHEHUiVHUDFFHVLEOH\GHEDMRQLYHOGHHODERUDFLyQ
9 /RVVXMHWRVHYDOXDGRVGHEHQHVWDUPRWLYDGRVSDUDGDUODLQIRUPDFLyQH[DFWD

 &ULWHULRVSDUDODFRQVWUXFFLyQGHHVFDODV\FXHVWLRQDULRVGHDFWLWXGHV

/D PHGLFLyQ GH ODV HVFDODV GH DFWLWXGHV PHGLDQWH SUHJXQWDV R UHDFWLYRV KDQ GH
HODERUDUVH WHQLHQGR HQ FXHQWD XQD VHULH GH FULWHULRV HQ UHODFLyQ D ORV REMHWLYRV GH OD

40

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

LQYHVWLJDFLyQ HV GHFLU TXH UHIOHMH FRUUHFWDPHQWH ODV LGHDV GHO LQYHVWLJDGRU \ GHO
HQWUHYLVWDGRDWUDYpVGHODQiOLVLVGHORVGDWRV

$Vt SXHV HO LQVWUXPHQWR GH PHGLGD GH ODV DFWLWXGHV KD GHDGHFXDUVH DORV FULWHULRV GH
ILDELOLGDG\YDOLGH]SDUDDOFDQ]DUUHVXOWDGRVULJXURVRVHQODYHULILFDFLyQGHODVKLSyWHVLV
GH LQYHVWLJDFLyQ /D ILDELOLGDG QRV PLGH HO JUDGR GH FRQVLVWHQFLD GH XQD PHGLGD \ OD
YDOLGH]PLGHODDSWLWXGSDUDPHGLUORTXHVHVXSRQHTXHGHEHPHGLU

/D FRQVLVWHQFLD GH OD ILDELOLGDG HV OD FDSDFLGDG GH GDU UHVXOWDGRV VLPLODUHV FXDQGR HO
LQVWUXPHQWRGHPHGLGDHVDSOLFDGRHQVXFHVLYDVRFDVLRQHVHQVLWXDFLRQHVLGpQWLFDV/R
FXDO LPSOLFDTXHODFRQVLVWHQFLDSXHGH FRPSOLFDUVH HQHOFXUVRGHOWLHPSRSXHVHQHO
FRUWRSOD]RVLVHDSOLFDDORVPLVPRVVXMHWRVSXHGHQUHFRUGDUODVUHVSXHVWDVDQWHULRUHV\
VLVHKDFHDODUJRSOD]RODVDFWLWXGHVSXHGHQFDPELDU

 (O VHJXQGR UHTXLVLWR HV TXH OD UHVSXHVWD D FDGD SURSRVLFLyQ R tWHP GHEH LQGLFDU
GLUHFFLyQ\JUDGRHVGHFLUHVTXHGHEHQUHFRJHUORVGLIHUHQWHVJUDGRVGHDFWLWXG IUHQWH DO
UHDFWLYR 3RU OR JHQHUDO ODV HVFDODV HVWiQ FRQVWUXLGDV SRU YDULDV SURSRVLFLRQHV
UHVSHFWR D ODV FXDOHV XQD SHUVRQD SXHGH FRQFRUGDU R GLVFUHSDU D OR ODUJR GH XQD
GLPHQVLyQ FRQ YDULRV SXQWRV GHVGHODVTXHHVWiQPX\ D IDYRUKDVWDODVTXHHVWiQPX\
HQFRQWUDSDVDQGRSRUODVVLWXDFLRQHVLQWHUPHGLDV 'HHVWDIRUPDVHHYLWDHOSRVLEOH
VHVJRHQHOTXHODVDFWLWXGHVUHFRJLGDVUHSUHVHQWHQVyORDORVTXHHVWiQPX\DIDYRUR
PX\HQFRQWUDGHOUHDFWLYR

3RU ~OWLPR HO PRGHOR LPSOLFD TXH XQD HVFDOD HVWp FRQVWUXLGD SDUD PHGLU XQD ~QLFD
DFWLWXG VL ELHQ GHEH WHQHU OD VXILFLHQWH FDSDFLGDG SDUD SRGHU GLVFULPLQDU GHELHQGR
UHSUHVHQWDU DO FRQMXQWR GH ODV SRVLFLRQHV TXH XQ LQGLYLGXR SXHGD VXVWHQWDU HYLWDQGR
SRU RWUD SDUWH OD FRQIXVLyQ GH GRV FXHVWLRQHV GLVWLQWDV HQ XQ PLVPR tWHP 0RUDOHV
 

 $&7,78'(6<$35(1',=$-(

(QHOSODQRHGXFDWLYRHVLPSRUWDQWHFRQRFHUHOSRVLFLRQDPLHQWRGHORVLQGLYLGXRVDQWH
OD UHDOLGDG PHGLDQWH HO DQiOLVLV DFWLWXGLQDO GH ODV LQWHQFLRQHV \ FRQGXFWDV GH
DSUHQGL]DMHVHQUHODFLyQDOFRQWH[WRsHGXFDWLYR(QIXQFLyQGHOFRQRFLPLHQWRHVSHFtILFR
GH ODV DFWLWXGHVHQFRQWH[WRHGXFDWLYRVVHDEUHODSRVLELOLGDGGHHVWDEOHFHUSURSXHVWDV
SDUDPHMRUDUODDFFLyQHGXFDWLYD

41

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

&RPRLQVWUXPHQWRGHDQiOLVLVODVDFWLWXGHV WLHQHQTXHWHQHUODFDSDFLGDGGHSUHGHFLUOD
FRQGXFWDHQFRQWH[WRVHGXFDWLYRV\ORVHVWXGLRVVHxDODQTXHHVWRHVSRVLEOHVyORFXDQGR
VH PLGHQ FRQGXFWDV HVSHFtILFDV HQ VLWXDFLRQHV HGXFDWLYDV FRQFUHWDV )LVKEHLQ \ $M]HQ
  SURSXVLHURQ XQ PRGHOR GH ODV FDXVDV GH ODV FRQGXFWDV HVSHFtILFDV GHQRPLQDGR
WHRUtDGHODDFFLyQUD]RQDGD 75$ SDUWLHQGRGHOVXSXHVWRGHTXHODFDXVDLQPHGLDWDGH
XQDFRQGXFWDHVSHFtILFDHVODLQWHQFLyQGHOLQGLYLGXRGHUHDOL]DURQRHODFWR

$OPLVPRWLHPSRSODQWHDURQODKLSyWHVLVGHTXHODVLQWHQFLRQHVVHEDVDQHQXQSULPHUIDFWRU
EDVDGRHQODVFUHHQFLDVTXHWLHQHHOLQGLYLGXRDFHUFDGHODVFRQVHFXHQFLDVGHODVFRQGXFWDV
\GHODSHUFHSFLyQGHODVQRUPDVVXEMHWLYDVUHIHULGDVDODSUHVLyQVRFLDOTXHFRQGLFLRQDD
DFWXDU GH FLHUWD PDQHUD /D WHRUtD GH OD DFFLyQ UD]RQDGD SODQWHD TXH ODV DFFLRQHV GH
LQGLYLGXRHQXQDVVLWXDFLRQHVHGXFDWLYDVSDUWLFXODUHVVHGHWHUPLQDGHIRUPDFRQMXQWDSRUOD
HYDOXDFLyQGHODVFRQGXFWDVSRVLEOHV\ODSUHVLyQVRFLDOTXHVLHQWHDOUHVSHFWR

3RVWHULRUPHQWH 6FKLIWHU \ $M]HQ   HODERUDURQ XQ QXHYR PRGHOR GHQRPLQDGR
WHRUtDGHOFRPSRUWDPLHQWRSUHYLVWR 73% TXHLQWURGXFHXQDQXHYDYDULDEOHEDVDGDHQHO
FRQWURO SHUFLELGR R H[SHFWDWLYD TXH OD SHUVRQD WLHQH GH OD H[LVWHQFLD GH GHWHUPLQDGRV
IDFWRUHV TXH GLILFXOWDQ OD UHDOL]DFLyQ GH OD FRQGXFWD GH PDQHUD TXH OD SHUFHSFLyQ GH
PD\RUHV REVWiFXORV GLVPLQX\H OD UHODFLyQ HQWUH DFWLWXG \ FRQGXFWD /DV FUHHQFLDV
SHUVRQDOHV EDVDGDV HQ H[SHFWDWLYDV D FHUFD GH ODV FRQGXFWDV DVRFLDGDV DO REMHWR GH
DFWLWXGUHSUHVHQWDQSUHGLFFLRQHVFRQVLVWHQWHV

Actitudes
hacia la

Norma
Intención Conducta
Subjetiva

Control
percibido
de la

Figura 1.>ĂƚĞŽƌşĂĚĞůĂĐŽŶĚƵĐƚĂƉůĂŶŝĨŝĐĂĚĂ;ĂĚĂƉƚĂĚĂĚĞũnjĞŶ͕ϭϵϵϭͿ

42

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

/DLPSRUWDQFLDGHOFRQFHSWRGHSHUFHSFLyQGHFRQWUROFRLQFLGHFRQRWURVWHyULFRVFRPR
7ULDQGLV   HQ VX PRGHOR GH FRQGXFWD LQWHUSHUVRQDO HQ HO TXH UHFRQRFH HO SDSHO
FODYH MXJDGR SRU ORV IDFWRUHV VRFLDOHV QRUPDV VXEMHWLYDV  \ SHUVRQDOHV HPRFLRQHV
DXWRFRQFHSWR  HQ OD IRUPDFLyQ GH LQWHQFLRQHV DVt FRPR ODV H[SHULHQFLDV SDVDGDV \
DFWXDOHV LQIOX\HQGR LJXDOPHQWH HQ ODV DFWLWXGHV VREUH HO REMHWR SHUVRQD R JUXSR GH
UHIHUHQFLD 3RU RWUD SDUWH HO FRQWURO SHUFLELGR GH OD FRQGXFWD HV XQD QRFLyQ
FRQFHSWXDOPHQWH UHODFLRQDGD FRQ HO WpUPLQR GH DXWRHILFDFLD GH %DQGXUD \ :DOWHUV
  GHILQLGR FRPR OD FUHHQFLD GH ODV SHUVRQDV HQ VXV FDSDFLGDGHV SDUD DOFDQ]DU
QLYHOHVGHp[LWRHQVXVUHDOL]DFLRQHV

(QLQYHVWLJDFLRQHVSRVWHULRUHV*RGLQ\.RN  \$M]HQ  KDQFRQVLGHUDGRTXH


HO PRGHOR HVWi DELHUWR D QXHYDV YDULDEOHV SUHGLFWRUDV R YDULDEOHV DFWLWXGLQDOHV
HVSHFtILFDVTXHSXGLHUDQPHMRUDUODSUHGLFFLyQGHODDFFLyQHQORVGLVWLQWRVGRPLQLRVHQ

TXHVHDSOLFDHOPRGHOR

2WUDVFDUDFWHUtVWLFDVTXHVHSXHGHQDxDGLUDOPRGHORVRQDTXHOODVVLWXDFLRQHVHQODVTXH
ODV DFWLWXGHV HVWDEOHFLGDV SXHGHQ GLULJLU OD DFFLyQ GH XQ PRGR GLUHFWR \ HVSRQWiQHR
GDQGRXQVHVJRDODVSHUFHSFLRQHV\SURGXFLHQGRTXHODLQIRUPDFLyQFRQJUXHQWHFRQOD
DFWLWXGVREUHREMHWRVSHUVRQDV\VLWXDFLRQHVVHDPiVREYLD\ODDFFLyQFRQJUXHQWHFRQ
OD DFWLWXG PiV SUREDEOH $Vt )D]]LR   GLVWLQJXH HQWUH HIHFWRV GHOLEHUDWLYRV \
DXWRPiWLFRV GH OD DFWLWXG VREUH OD FRQGXFWD 3RU RWUD SDUWH (DJO\ \ &KDLNHQ  
SDUWHQGHOPRGHORGHDFWLWXG\FRQGXFWDPXWXDPHQWHLQWHUUHODFLRQDGRSURSRQLHQGRTXH
ODVDFWLWXGHV KDFLDOD FRQGXFWDLQIOX\HQ HQ ODV LQWHQFLRQHVSDUDDFWXDU \ D VX YH] ODV
LQWHQFLRQHVGHVHQFDGHQDQPHFDQLVPRVTXHSRVLELOLWDQTXHODDFFLyQVHDPiVFRQJUXHQWH
FRQODDFWLWXG

$Vt OD SUHGLFFLyQ UHVXOWD LJXDOPHQWH D VHU PiV IXHUWH VL VH FRQVLGHUDQ IDFWRUHV
VLWXDFLRQDOHV\VXVFDUDFWHUtVWLFDVHQHOPDUFRGHHQWRUQRVGHHQVHxDQ]D\DSUHQGL]DMH
FRQ DFWLYLGDGHV FRODERUDWLYDV \ VLJQLILFDWLYDV 7RGR HOOR UHGXQGDUi HQ SURPRYHU
DFWLWXGHV IDYRUDEOHV D OD SRWHQFLDFLyQ GH OD LQWHQFLRQDOLGDG GHO DOXPQR GLULJLGD D
HVWDEOHFHUP~OWLSOHVUHODFLRQHVHQWUHORVQXHYRVDSUHQGL]DMHV\ORTXH\DVHFRQRFH (Q
HVWH VHQWLGR &ROO 0DXUL \ 2QUXELD   SODQWHDn TXH FXDQGR OD LQWHQFLRQDOLGDG
HVHVFDVDVHWLHQGHDORPHPRUtVWLFR\FXDQGRODLQWHQFLRQDOLGDGHVDOWDHVFRJHHOFDPLQR

43

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

GHO FRQRFLPLHQWR PXOWLUUHODFLRQDO PiV LQYROXFUDGR FRQ OD PRWLYDFLyQ \ PHMRUHV


UHVXOWDGRVDFDGpPLFRVGHODOXPQR

7DPELpQ ODV DFFLRQHV HGXFDWLYDV SXHGHQ VHU DSUHQGLGDV D WUDYpV GH PRGHORV \ GHO
UHIXHU]R VRFLDO %UHGHPLHU \ 6KLHOG   HQ HO TXH HO DPELHQWH GH HQVHxDQ]D
SURSRUFLRQDXQDVLWXDFLyQGRQGHORVHVWiQGDUHVSXHGHQVHUDSUHQGLGRV

&RQHFWDFRQORVDQWHULRUHVPRGHORVGHLQIOXHQFLDUHFtSURFDHQWUHDFWLWXG\FRQGXFWDHO
SODQWHDPLHQWR GH .HOPDQ   VREUH OD GLVFUHSDQFLD DFWLWXGLQDO UHIHULGD D OD DFFLyQ
GHOVXMHWR\VXLQIOXHQFLDHQHOFDPELRGHDFWLWXGHV'HVGHHVWDSHUVSHFWLYDODDFFLyQVH
HQWLHQGH FRPR XQD FRQGXFWD H[SOtFLWD H LQWHQFLRQDO TXH SURGXFH DOJ~Q FDPELR HQ OD
SHUVRQD ODV TXH SURYRFDQ FDPELRV VLJQLILFDWLYRV HQ ODV DFWLWXGHV VRQ ODV DFFLRQHV
LPSRUWDQWHV FRPR OD SDUWLFLSDFLyQ DFWLYD SRU VXV FRQVHFXHQFLDV GH H[SUHVLyQ S~EOLFD
LPSOLFDFLyQSHUVRQDO\FRQVHFXHQFLDVHQODYLGDUHDO

(OHQIRTXHGH.HOPDQ  VREUHODFRQVLVWHQFLD\FDPELRGHDFWLWXGHVHVXQPRGHOR
DGHFXDGR SDUD HO DQiOLVLV GH ORV FRQWH[WRV HGXFDWLYRV SRU OD LQIOXHQFLD GH  OD DFFLyQ
HGXFDWLYDFRPRHOHPHQWRGHWHUPLQDQWHHQODIRUPDFLyQ\FDPELRGHDFWLWXGHV

$GHPiV GH OD FRQGXFWD PDQLILHVWD \ YLVLEOH SDUD WRGRV ORV PLHPEURV GH XQ JUXSR OD
SXHVWDHQSUiFWLFDGHXQDDFWLYLGDGHGXFDWLYDH[SUHVDFRQVHFXHQFLDVFXDQGRDFWXDPRV
KDEODPRV\H[SUHVDPRVRSLQLRQHVRVHQWLPLHQWRVFXDQGRKDFHPRVFRPXQLFDFLRQHVQR
YHUEDOHV FRPR JHVWRV FRQ HO FXHUSR R HO URVWUR \ VLQ GXGD FXDQGR SHUPDQHFHPRV
LQPyYLOHVHQXQDVLWXDFLyQHQODTXHSRGUtDHVSHUDUVHXQDUHDFFLyQSRUQXHVWUDSDUWH

6LJXLHQGRHOPRGHOR.HOPDQ  KD\TXHFRQVLGHUDUYDULRVIDFWRUHVTXHLQWHUYLHQHQ


HQODDFFLyQFRQWH[WXDOL]DGDTXHLQIOX\HQHQHOFDPELRGHDFWLWXGHVGHOLQGLYLGXR

(OFDUiFWHUS~EOLFR GHODVDFFLRQHVRH[SUHVLRQHVYHUEDOHVWLHQHFRQVHFXHQFLDVSDUDHO
LQGLYLGXR FXDQGR ODV H[SOLFLWD HQ IRUPD GH RSLQLyQ R GH DFFLyQ 3DUD HO HVWXGLDQWH HO
JUXSRUHSUHVHQWDODHQWUDGDDXQD UHDOLGDGS~EOLFD\FRPSDUWLGDGRQGHYDDVHUHYDOXDGR
SRU HO SURIHVRU \ ORV FRPSDxHURV WDQWR GHQWUR FRPR IXHUD GHO FRQWH[WR HQVHxDQ]D \
DSUHQGL]DMH/DLQFRUSRUDFLyQDXQJUXSRLPSOLFDXQVDOWRDXQDPELHQWHHQHOTXHORV
YtQFXORVGHUHODFLyQVHGHILQHQSRUODDIHFWLYLGDGDOFRQWH[WRHQVHxDQ]DGRQGHORTXH
PiV VH YDORUD HV HO UHQGLPLHQWR \ HO ORJUR \ QR ROYLGHPRV TXH ORV ORJURV HQ OD
HQVHxDQ]DKD\TXHGHPRVWUDUORV

44

&$3Ë78/2 (675$7(*,$662&,2$)(&7,9$6(1(/$35(1',=$-(

/DSDUWLFLSDFLyQGHOHVWXGLDQWHHQODVWDUHDV\DFWLYLGDGHVLQGLYLGXDOHV\JUXSDOHVVHUi
XQ IDFWRU GHWHUPLQDQWH GH OD DFFLyQ GHO VXMHWR \D TXH DFWLYD VXV FDSDFLGDGHV
LQWHOHFWXDOHV \ HPRFLRQDOHV 3RU VXSXHVWR TXH VLHPSUH KDEUi IRUPDV GH HYLWDU
GHWHUPLQDGDV DFFLRQHV \ WDUHDV DGXFLHQGR GLVWLQWDV FDXVDV SHUR HO GLVWDQFLDPLHQWR QR
UHSRUWDQ VLQR HYDOXDFLRQHV \ DFWLWXGHV QHJDWLYDV /D LQYROXFUDFLyQ HQ DFWLYLGDGHV
WHyULFDV\SUiFWLFDVHVEiVLFDPHQWHXQKHFKRTXHLPSOLFDDFWLYLGDGGHXQWLSRXRWUR\HO
FDPELR GH DFWLWXGHV UHVXOWD VHQFLOOR \ JUDWLILFDQWH SDUD DTXHOORV HVWXGLDQWHV TXH
PDQWLHQHQXQDGLVSRVLFLyQGHPD\RULPSOLFDFLyQFRQODVDFWLYLGDGHVHQXQHQWRUQRGH
HQVHxDQ]D\DSUHQGL]DMH

(Q ODV LQYHVWLJDFLRQHV H[SHULPHQWDOHV UHDOL]DGDV VREUH PHMRUDV HQ HO SURFHVR GH
DSUHQGL]DMH HQ OD HQVHxDQ]D XQLYHUVLWDULD PHGLDQWH WUDEDMR FRODERUDWLYR \ DFWLYLGDGHV
HTXLOLEUDGDV HQWH WHRUtD \ SUiFWLFD VH KD SRGLGR FRQVWDWDU TXH ORV HVWXGLDQWHV TXH

GHGLFDQPXFKRWLHPSRDVXJUXSROOHJDQDVHQWLUVHLPSOLFDGRVHQHODPELHQWHHQVHxDQ]D
\ DSUHQGL]DMH HQ HO TXH VH HVWDEOHFHQ UHODFLRQHV GH DPLVWDG VH DSUHQGH HO
IXQFLRQDPLHQWR XQ FOLPD GH WUDEDMR HTXLSR IDYRUDEOH \ DXPHQWD OD PRWLYDFLyQ OD
VDWLVIDFFLyQSRUUHSHWLUHQQXHYDVPDWHULDV\ODVFDOLILFDFLRQHVDOFDQ]DGDV\PHMRUDUORV
DSUHQGL]DMHVVLJQLILFDWLYRV &ROOHWDO 

)LQDOPHQWH ORV SRVWXODGRV WHyULFRV TXH VHxDODQ ODV LQYHVWLJDFLRQHV VREUH IRUPDFLyQ \
FDPELR GH DFWLWXGHV LQGLFDQ TXH HO LQWHUpV GHO SURIHVRU HQ OD IRUPDFLyQ GH ORV
HVWXGLDQWHV XQLYHUVLWDULRV GHEH RULHQWDUVH SURJUHVLYDPHQWH KDFLD HO REMHWLYR GH TXH HO
VXMHWR VH LPSOLTXH FDGD YH] PiV HQ HO JUXSR SURPRYLHQGR OD DXWRQRPtD HQ HO
DSUHQGL]DMH \ HO WUDEDMR FRODERUDWLYR FRPR PLHPEUR GH XQ JUXSR DO TXH WLHQH PXFKR
TXH DSRUWDU < SRU RWUD SDUWH FRQFLHQFLDU DO HVWXGLDQWH PHGLDQWH HO GHVDUUROOR GH
DFWLWXGHVSRVLWLYDVGHTXHODVDFWLYLGDGHVTXHVHOOHYDQDFDERSRUHODOXPQR\HOJUXSR
UHTXLHUHQGHVXSDUWLFLSDFLyQSDUDTXHIXQFLRQHDGHFXDGDPHQWH\UHSRUWHHOPi[LPRGH
EHQHILFLRVSDUDWRGRV

(O FRPSRQHQWH VRFLRDIHFWLYR GH ODV HVWUDWHJLDV HGXFDWLYDV UHVXOWD LPSUHVFLQGLEOH SDUD
H[SORUDU ODV DFWLWXGHV UHVSHFWR D OD WDUHD FRQFUHWD TXH QRV LQWHUHVH HQ QXHVWUR FDVR OD
DFWLYLGDGHGXFDWLYDGHOVXMHWR\HOQLYHOGHGHVWUH]DDOFDQ]DGRPHGLDQWHHODSUHQGL]DMH

/DVDFWLWXGHVHVWiQGLUHFWDPHQWHUHODFLRQDGDVFRQHOSURFHVRGHDSUHQGL]DMHGHPDQHUD
TXH ODV DFWLWXGHV TXH PDQWLHQHQ ORV HVWXGLDQWHV KDFLD HO JUXSR HO SURIHVRU ODV

45

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

DFWLYLGDGHV TXH VH UHDOL]DQ \ KDFLD OD HQVHxDQ]D HQ VX FRQMXQWR VRQ IDFWRUHV TXH
LQIOX\HQVXVWDQFLDOPHQWHHQHOSURFHVRGHHQVHxDQ]D\DSUHQGL]DMH\PHGLDQWHORVTXH
SRGHPRVGHVFXEULUODUHODFLyQDFWLWXGDFFLyQ/DVDFWLWXGHVVHHQVDPEODQDSDUWLUGHWUHV
WLSRV GH LQIRUPDFLyQ FUHHQFLDV VREUH ODV FDUDFWHUtVWLFDV SRVLWLYDV R QHJDWLYDV GH ORV
REMHWRV VHQWLPLHQWRV \ HPRFLRQHV VREUH ORV REMHWRV H LQIRUPDFLyQ VREUH DFFLRQHV
SDVDGDV \ SUHVHQWHV KDFLD HO REMHWR 8QD YH] TXH OD DFWLWXG KD VLGR GHVDUUROODGD VH
YLQFXODtQWLPDPHQWHDOFRQRFLPLHQWRVREUHHOREMHWR

(O FRQRFLPLHQWR GHO DOXPQR EDVDGR HQ ORV FRQRFLPLHQWRV SUHYLRV TXH WUDH GH VX
LWLQHUDULRHGXFDWLYRVXVFDUDFWHUtVWLFDVSULPDULDV\ODVFRKHUHQFLDV TXHJXDUGHQHQWUHVt
ODFRQVWHODFLyQGHDFWLWXGHVTXHSRVHDQRVDSRUWDUiQORVDVSHFWRVTXHH[SOLFDQVXQLYHO
GH FRPSHWHQFLD /R FXDO SHUPLWLUi LQWHUYHQLU HILFD]PHQWH HQ HO ³UHQGLPLHQWR´ GH XQ
GHWHUPLQDGRVXMHWR\HGXFDUSDUDFDPELDUVXVHVWUDWHJLDVGHDSUHQGL]DMH

&RQRFLHQGR ODV DFWLWXGHV GH XQ VXMHWR KDFLD HO SURFHVR GH HQVHxDQ]D \ DSUHQGL]DMH
GHQWURGHOFRQWH[WRHQTXHVHGHVHQYXHOYHHVWDUHPRVPiVFHUFDGHSRGHUHVWDEOHFHUOD
H[SOLFDFLyQGHVXUHQGLPLHQWRSXHVWRTXHFRQRFHUHPRVHOFRQMXQWRGHQHFHVLGDGHVTXH
WLHQH\TXHKDGHVDWLVIDFHUHOJUDGR\FDUDFWHUtVWLFDVGHODLQIRUPDFLyQTXHSUHFLVD\HO
FRQWH[WRGHSHUVRQDOLGDGTXHOHVXVWHQWD

'HVGHODSHUVSHFWLYDGHODLQYHVWLJDFLyQLQWHUHVDFRQRFHUODVDFWLWXGHVGHORVHVWXGLDQWHV
KDFLD HO DSUHQGL]DMH FRQFUHWDPHQWH FyPR VH IRUPDQ \ FyPR VH SXHGHQ FDPELDU
(YLGHQWHPHQWHODVDFWLWXGHV QR SXHGHQ FRQVLGHUDUVH FRPR DOJRLQDPRYLEOH HO FDPELR
HV SRVLEOH D~Q FXDQGR VHD HQ XQ VHQWLGR ³LQFRQJUXHQWH´ \ VLHPSUH UHODFLRQDGR FRQ OD
SHUVRQDOLGDGGHOVXMHWRGHOTXHVHWUDWHGHODPRWLYDFLyQTXHVHDFDSD]GHFUHDU\GHODV
HVWUDWHJLDV \ WpFQLFDV GH DIURQWDPLHQWR TXH VH HPSOHHQ HQ HO HPSHxR 6RODPHQWH DVt
SRGUHPRVLQWHUYHQLUFRQp[LWRHQODWDUHDGHPHGLDFLyQRULHQWDFLyQ\DSR\R

(QODSUHVHQWHLQYHVWLJDFLyQODVDFWLWXGHVDQDOL]DGDVKDFHQUHIHUHQFLDDOSURIHVRUFRPR
YDULDEOH\DOFHQWURHGXFDWLYRFRPRFRQWH[WRGRQGHVHGHVDUUROODODDFWLYLGDGHGXFDWLYD
&RQRFLHQGR HVWDV DFWLWXGHV HVWDUHPRV HQ GLVSRVLFLyQ GH DQDOL]DU HO QLYHO GH HQHUJtD
SVLFROyJLFD\ODLQWHQFLyQ\GLUHFFLyQGHODPLVPDHQFDGDXQRGHORVHVWXGLDQWHV\GH
ORV JUXSRV FRUUHVSRQGLHQWHV SDUD SURSRUFLRQDU OD LQIRUPDFLyQ RSRUWXQD D FDGD XQR GH
ORVVXMHWRVLPSOLFDGRVHQODDFFLyQHGXFDWLYD

46

$&7,78'(69$/25(6 ĂƉşƚƵůŽϮ
<&203257$0,(172



&$3Ë78/2 $&7,78'(69$/25(6<&203257$0,(172

,1752'8&&,Ï1

(Q ODV LQYHVWLJDFLRQHV SVLFRVRFLDOHV UHFLHQWHV ORV DQiOLVLV VREUH OD UHODFLyQ HQWUH
YDORUHVDFWLWXGHV\FRQGXFWDWLHQHQFRPRSUHFHGHQWHVORVPRGHORVGHH[SHFWDWLYDYDORU
HQ ORV TXH VH LQWURGXFHQ DVSHFWRV QRUPDWLYRV TXH LQIOX\HQ HQ OD LQWHQFLyQ R QR GH
DFWXDU

5RNHDFK   \ 6FKZDU]W   GLHURQ XQ SDVR LPSRUWDQWH DO UHODFLRQDU ORV
YDORUHV HQ OD H[SOLFDFLyQ GHO FRPSRUWDPLHQWR H LQWURGXFLU ORVDVSHFWRV QRUPDWLYRV
GHOVHOI5RNHDFK  GHVWDFyODUHODFLyQHQWUHYDORUHVDFWLWXGHV\FRQGXFWDVDO
FRQVLGHUDU D ORV YDORUHV HO FRPSRQHQWH FHQWUDO TXH FRQHFWD SHULIpULFDPHQWH FRQ ODV
DFWLWXGHV\FRQGXFWD6FKZDU]W  DOGHILQLUXQDWHRUtDVLVWpPLFDGHORVYDORUHV
UHODFLRQDQGLQiPLFDPHQWHYDORUHVPRWLYDFLRQDOHVTXHVHRUJDQL]DQHQXQDOyJLFDGH
 FRPSDWLELOLGDG \ FRQWUDGLFFLyQ HVWDEOHFLHQGR FRQILJXUDFLRQHV GH YDORUHV

GLIHUHQFLDGDV  TXH H[SOLFDUtDQ ORV FRPSRUWDPLHQWRV GH FDGD FRQWH[WR HVSHFtILFR


(VWR OH SHUPLWLUi HQ DOJXQRV GH VXV WUDEDMRV FRQHFWDU OD FDGHQD MHUiUTXLFD YDORUHV
QRUPDVFRPSRUWDPLHQWRVSDUDH[SOLFDUFRQGXFWDVDOWUXLVWDV 6FKZDUW] 

3RVWHULRUPHQWH KDQ WHQLGR OXJDU PXFKDV LQYHVWLJDFLRQHV UHODFLRQDGDV FRQ OD FDGHQD
MHUiUTXLFDHQODTXHVHKDQLQWHJUDGRORVPRGHORVGHH[SHFWDWLYDYDORU5RNHDFK  
\6FKZDU]W  GDQGROXJDUDPRGHORVGHLQWHJUDFLyQTXHVHKDQDSOLFDGRHQ
GLVWLQWRViPELWRVFRPRORVPRGHORVGH.ULVWDQVHQ\+RWWH  6WHUQ'LHW].DORI
\*XDJQDQR  0DLR\2OVRQ  /RVUHVXOWDGRVGHHVWRVHVWXGLRVVHxDODQOD
LPSRUWDQFLD GH ORV YDORUHV HQ OD IRUPDFLyQ GH ODV DFWLWXGHV D WUDYpV GHO PHQFLRQDGR
PRGHORMHUiUTXLFRYDORUHV±DFWLWXG±FRQGXFWD

 $17(&('(17(67(Ï5,&26

/RVYDORUHVKDQVLGRHOFHQWURGHLQWHUpVHQODVFLHQFLDVVRFLDOHVHQGLVFLSOLQDVFRPROD
SVLFRORJtD VRFLDO DQWURSRORJtD VRFLRORJtD HWF WHQLHQGR XQ WUDWDPLHQWR FRQFHSWXDO
DPSOLR TXH KD VXVFLWDGR XQ FRPSOHMR GHEDWH GDGR TXH HV GLItFLO HQFRQWUDU XQD VROD
GHILQLFLyQ GHVFULSWLYD TXH SXHGD KDFHU MXVWLFLD D WRGD OD JDPD \ GLYHUVLGDG GH
IHQyPHQRVLGHQWLILFDEOHVUHODFLRQDGRVFRQORVYDORUHV :LOOLDPV 

49

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

1RVHQFRQWUDPRVFRQGHILQLFLRQHVUHVWULFWLYDVFRPRODGH.OXFNKRKQ  

"La satisfacción de los impulsos de acuerdo con toda la serie de objetivos


jerárquicos y duraderos de la personalidad, de la exigencia de orden por parte
tanto de la personalidad como el sistema sociocultural y con la necesidad de
respetar los intereses de los demás y del grupo en su conjunto de la vida social"
(p.399).

)UHQWH D HVWD YHUVLyQ PX\ VRFLDOL]DGD TXH SDUHFH GHVFDUWDU FLHUWRV YDORUHV FRPR ORV
SXUDPHQWH KHGRQLVWDV QRV HQFRQWUDPRV FRQ GHILQLFLRQHV PX\ DPSOLDV FRPR ODV GH
3HHSHU  HQODTXHGHILQHHOYDORUFRPRWRGROREXHQRRPDORHVGHFLUWRPDFRPR
UHIHUHQFLDWRGRORTXHLQWHUHVDDXQVHUKXPDQR

(QODVFLHQFLDVVRFLDOHVVHHPSH]yDKDFHUXQXVRFUHFLHQWHGHOFRQFHSWRGHYDORUHVD
 SDUWLU GH 7KRPDV \ =QDQLHFN\   DXQTXH VX LQIOXHQFLD QR VH KL]R VHQWLU KDVWD OD
GpFDGDGH

(O GHVSHJXH GH OD FRQVWUXFFLyQ GH XQD WHRUtD FLHQWtILFD GH ORV YDORUHV VH LQLFLy FRQ
$OOSRUW \ 9HUQRQ   D SDUWLU GH XQD WLSRORJtD GH FRQGXFWDV RULHQWDWLYDV TXH OHV
OOHYR D HVWDEOHFHU PRGHORV GH KRPEUH 7RPDQGR FRPR EDVH HVWD FODVLILFDFLyQ
SRVWHULRUPHQWHGHVDUUROODURQODWHRUtDGHORVYDORUHVFRPRLQWHUHVHVSHUVRQDOHVPHGLDQWH
HO FXHVWLRQDULR 6WXG\ RI 9DOXHV $OOSRUW 9HUQRQ \ /LQG]H\   XWLOL]DQGR HVFDODV
TXHUHIOHMDEDQWLSRVLGHDOHVFRQIRUPDGRVSRUYDORUHVHLQWHUHVHVTXHFRQVWLWXtDQPRGRV
SUHIHUHQFLDOHVGHORVLQGLYLGXRVSDUDRULHQWDUVHHQHOPXQGR(VWRVHVWXGLRVVHPLQDOHV
FRQHFWDQ FRQ WUDEDMRV DFWXDOHV TXH SRQHQ HO DFHQWR HQ ORV YDORUHV FRPR IXHU]D
PRWLYDFLRQDOFHQWUDOHQODGLQiPLFDGHODFRQGXFWD\HQODFRQILJXUDFLyQXQLILFDGDGHOD
SHUVRQDOLGDG

3RVWHULRUPHQWHVXUJHQWHRUtDVTXHSURIXQGL]DQHQHODVSHFWRPRWLYDFLRQDOLQGLYLGXDOH
LQWHUDFFLRQDO GH ORV YDORUHV /D SVLFRORJtD KXPDQLVWD SDUWLHQGR GH SRVWXODGRV
D[LROyJLFRV\VXEMHWLYRVGHILQHHOFRQFHSWRGHYDORUFRPRQHFHVLGDGHVHVWDEOHFLGDVHQ
ODQDWXUDOH]DKXPDQDTXHVRQGHILQLWRULDVSDUDHODXWRFXPSOLPLHQWRGHODVFDSDFLGDGHV
\ODDXWRUUHDOL]DFLyQGHOSURSLRVtPLVPR0DVORZ  HQWLHQGHORVYDORUHVFRPRXQ
IHQyPHQR GH FDUiFWHU PRWLYDFLRQDO H LQGLYLGXDO TXH LPSXOVD DO VXMHWR KXPDQR D
GHVDUUROODUDOPi[LPRVXVSRWHQFLDOLGDGHVVLHQGRHOSDSHOGHODVFRQGLFLRQHVVRFLDOHV\
FXOWXUDOHV FUHDU XQD VLWXDFLyQ TXH SHUPLWD R QR TXH XQD SHUVRQD DOFDQFH HO Pi[LPR

50

&$3Ë78/2 $&7,78'(69$/25(6<&203257$0,(172

YDORUHQXQDMHUDUTXtDTXHVHLQLFLDHQODVDWLVIDFFLyQGHQHFHVLGDGHV\YDORUHVEiVLFRV
KDVWD DOFDQ]DU YDORUHV VXSHULRUHV GH DXWRUUHDOL]DFLyQ KXPDQD $VLPLVPR *ROGVWHLQ
  PDQWLHQH XQD FRQFHSFLyQ LQWHUDFFLRQLVWD GH ORV YDORUHV HQ HO TXH OD
DXWRUUHDOL]DFLyQ VXSRQH XQD SHUIHFWD DUPRQtD \ DGHFXDFLyQ HQWUH ODV FDSDFLGDGHV GHO
KRPEUH\ODVH[LJHQFLDVGHOPXQGR

(VWDVSRVLFLRQHVWHyULFDVFRQVLGHUDQTXHORVYDORUHVSDUWHQGHXQDFRQFHSFLyQKROtVWLFD
GHODQDWXUDOH]DKXPDQDTXHWUDQVFLHQGHODUHDOLGDGDWUDYpVGHODH[SHULHQFLDLQWHUQD
RULHQWDQGR D OD FRQGXFWD KXPDQD GH IRUPD SURSRVLWLYD HQ OD E~VTXHGD GH
DXWRUUHDOL]DFLyQ EDMR FLHUWD LQIOXHQFLD GH ORV IDFWRUHV VRFLDOHV VLQ TXH VHDQ HO
IXQGDPHQWRGHORVPLVPRV

'HVGHXQDSHUVSHFWLYDREMHWLYLVWDKDQVXUJLGRPRGHORVQDWXUDOLVWDVVREUHODFRQFHSFLyQ
GHO YDORU EDVDGR HQ TXH HO YDORU SUHIHUHQFLDO FHQWUDO \ GHILQLWRULR GH OD H[LVWHQFLD

KXPDQD HV OD VXSHUYLYHQFLD ,QLFLDOPHQWH WXYR XQD RULHQWDFLyQ HYROXFLRQLVWD VLHQGR
UHLQWHUSUHWDGDSRUORVWHyULFRVDFWXDOHVFRPRXQSUREOHPDGHODFDOLGDGGHYLGD0ROHV
 FRQVWUX\HXQDWLSRORJtDRFDWHJRUtDVGHFDOLGDGGHYLGDEDVDGDHQODMHUDUTXtDGH
QHFHVLGDGHVGH0DVORZ  DSDUWLUGHODVFXDOHVPLGHLQGLFDGRUHVGHQHFHVLGDGHV
WUDWDQGRGHH[SOLFDUORVIDFWRUHVPHGLRDPELHQWDOItVLFR\VRFLDO(VWRVHVWXGLRVSRVWXODQ
XQDGHILQLFLyQFRQGXFWXDO\UHDFWLYDGHORVVLVWHPDVRULHQWDWLYRVGHOLQGLYLGXRVREUHHO
PHGLRDPELHQWH

/RVYDORUHVSDUWHQGHUHDOLGDGHVHPStULFDV\FRQGLFLRQHVDPELHQWDOHV3HOHFKDQR  
VRVWLHQHTXHHVWDPRVDQWHXQPRGHORHQWUHUHIXHU]R\YDORUHVGHULYDGRVGHSURFHVRVGH
DSUHQGL]DMH 'H HVWD PDQHUD ORV YDORUHV VRQ WUDWDGRV GHVGH XQD SHUVSHFWLYD GH OD
SVLFRORJtD GHO UHIXHU]R FRPR FRPSOHMRV SURFHVRV FRJQLWLYRV \ GH DSUHQGL]DMH TXH
HMHUFHQFRQWUROGLUHFFLRQDOGHFRQGXFWDVHVSHFtILFDVEDMRFRQGLFLRQHVDPELHQWDOHV

'HQWURGHHVWHHVSHFWURQDWXUDOLVWDFDEHFRQVLGHUDUODVWHRUtDVTXHLQWHQWDQIXQGDPHQWDU
GLPHQVLRQHVELROyJLFDV\JHQpWLFDVHQHOSURFHVRGHDGTXLVLFLyQGHVLVWHPDVGHYDORUHV
(\VHQFN\:LOVRQ  IRUPXODnXQDWHRUtDELRVRFLDOGHORVYDORUHVVRVWHQLHQGRXQD
LQWHUGHSHQGHQFLD GH IDFWRUHV JHQpWLFRV YDULDEOHV GH SHUVRQDOLGDG \ FRQGLFLRQHV
DPELHQWDOHV SDUD H[SOLFDU ODV GLIHUHQFLDV LQGLYLGXDOHV HQFRQWUDGDV HQ VXV DFWLWXGHV \
YDORUHV

51

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

(Q ODV ~OWLPDV GpFDGDV VH KDQ GHVDUUROODGR ODV WHRUtDV GH ORV YDORUHV FRPR PDUFRV
FRJQLWLYRV SDUD H[SOLFDU HO FRPSRUWDPLHQWR KXPDQR 5RNHDFK   HQ VX GHILQLFLyQ
GHORVYDORUHVKDFHLQFDSLpHQORVFRPSRQHQWHVDIHFWLYRV\FRJQLWLYRVSRUHOKHFKRGH
TXHWHKDFHQVHQWLUELHQRPDO\ORVFRQVLGHUDPRGRVGHFRQGXFWDFRPRKRQHVWLGDG\
HVWDGR ILQDO GH H[LVWHQFLD FRPR YDORUHV LQVWUXPHQWDOHV R ILQDOHV $VLPLVPR GHILQH
FRPSRQHQWHVQRUPDWLYRVTXHSHUPLWHQHYDOXDUODVFRQGXFWDVSURSLDV\GHORVGHPiV\
FRPSRQHQWHVPRWLYDFLRQDOHVGHODOXFKDSRUDOFDQ]DUORV

$GHPiV D SDUWLU GH VX WHRUtD GHVDUUROOy HO SULPHU LQVWUXPHQWR VLVWHPiWLFR SDUD
PHGLU ORV YDORUHV VLHQGR IXHQWH GH LQVSLUDFLyQ SDUD ORV GHVDUUROORV HPStULFRV
SRVWHULRUHV0XFKRVWUDEDMRVSRVWHULRUHVVHFHQWUDURQHQHVWXGLDUHPStULFDPHQWHOD
UHODFLyQ HQWUH ODV HVWUXFWXUDV VRFLDO IDPLOLDU \ RFXSDFLRQDO FRQ OD WUDQVPLVLyQ
GLIHUHQFLDOGHYDORUHV0DFFOHOODQG  HVWXGLRODUHODFLyQHQWUHODVHVWUXFWXUDV

RFXSDFLRQDOHV \ HO PRWLYR GH ORJUR PLHQWUDV TXH .KRQ \ 6FKRROHU  
DQDOL]DURQ OD VRFLDOL]DFLyQ IDPLOLDU \ RFXSDFLRQDO VHJ~Q ORV YDORUHV GH
FRQIRUPLGDGHLQGHSHQGHQFLD

5RNHDFK  DOSRVWXODUHOYDORUFRPRXQDFUHHQFLDGHFDUiFWHUSUHVFULSWLYRVLWXyOD


WHRUtD GH ORV YDORUHV D QLYHO GH UHSUHVHQWDFLRQHV VLPEyOLFDV LQWHJUDGDV SRU SURFHVRV
FRJQLWLYRV\PRWLYDFLRQDOHVGHRUGHQDFLyQLQWHUSUHWDFLyQ\RULHQWDFLyQDQWHODUHDOLGDG
VRFLDO8QDFRQVHFXHQFLDVLJQLILFDWLYDGHHVWDWHRUtDHVTXHDOVLWXDUORVYDORUHVGHQWUR
GHO PDUFR GHO VLVWHPD GH UHSUHVHQWDFLRQHV WLHQHQ LQHYLWDEOHPHQWH UHODFLyQ FRQ RWUDV
HVWUXFWXUDV GH FRQRFLPLHQWR 6H LQLFLDQ OtQHDV GH LQYHVWLJDFLyQ TXH UHODFLRQDQ \
GHOLPLWDQ ODV GLIHUHQWHV HVWUXFWXUDV GH FRQRFLPLHQWR FDWHJRUL]DFLyQ FUHHQFLDV
DFWLWXGHVYDORUHVHWF6LELHQHVWDOtQHDGHLQYHVWLJDFLyQDFHUFDGHODLQWHUUHODFLyQGH
ORV SURFHVRV FRJQLWLYRV VLJXHQ HQWHQGLHQGR ORV YDORUHV FRPR HVWUXFWXUDV GH
FRQRFLPLHQWRLQGLYLGXDO

/RV GHVDUUROORV KDVWD HO PRPHQWR DFWXDO KDQ WUDWDGR GH VXSHUDU HVWRV SODQWHDPLHQWRV
LQGLYLGXDOLVWDVGHORVYDORUHVWDQWRHQODSHUVSHFWLYDD[LROyJLFDFRPRSVLFROyJLFD/RV
QXHYRV HQIRTXHV DGRSWDQ XQD SHUVSHFWLYD SVLFRVRFLDO EDVDGR HQ XQ SODQWHDPLHQWR
LQWHUDFFLRQLVWD GH ORV YDORUHV RULHQWDGR D H[SOLFDU ODV UHODFLRQHV HQWH OD FXOWXUD OD
VLWXDFLyQVRFLDO\ODSHUVRQD

52

&$3Ë78/2 $&7,78'(69$/25(6<&203257$0,(172

'HVGH HVWD DSUR[LPDFLyQ 6FKZDUW]   FRQVLGHUD TXH ORV YDORUHV VRQ PHWDV
GHVHDEOHV\WUDQVLWXDFLRQDOHVTXHYDUtDQHQLPSRUWDQFLD\TXHVLUYHQFRPRSULQFLSLRV
GHYLGDGHXQDSHUVRQDRGHRWUDHQWLGDGVRFLDO S (QHVWDGHILQLFLyQVHSRQHGH
PDQLILHVWR TXH ORV YDORUHV VLUYHQ D DOJXQD HQWLGDG VRFLDO \ TXH SXHGHQ DGTXLULUVH D
WUDYpVGHODVRFLDOL]DFLyQHQYDORUHVGHOJUXSRGRPLQDQWH FXDQGRXQDSHUVRQDHPLJUDD
XQSDtVHQHOTXHVHYDORUDPXFKRHOUHFRQRFLPLHQWRVRFLDO\DFDEDLQWHUQDOL]iQGROR y
ELHQDWUDYpVGHODSURSLDH[SHULHQFLDGHDSUHQGL]DMHHVGHFLUPHGLDQWHORTXHVHHQVHxD
HQORVFHQWURVHGXFDWLYRV

$QLYHOFXOWXUDOORVYDORUHVVHXWLOL]DQSDUDFDUDFWHUL]DUDODVVRFLHGDGHVFRPRXQWRGR\
UHSUHVHQWDQ ORV FULWHULRV FRPXQHV HPSOHDGRV HQ OD WRPD GH GHFLVLRQHV TXH H[SUHVDQ
SULRULGDGHVHFRQyPLFDVVRFLDOHV\SROtWLFDV$SDUWLUGHDKtVHDQDOL]DQODVGLIHUHQFLDV
HQORVYDORUHVFROHFWLYRVGHGLVWLQWDVVRFLHGDGHV\ODVUHODFLRQHVHQWUHHVWRVYDORUHV\

VXVDQWHFHGHQWHVRFRQVHFXHQWHVLQVWLWXFLRQDOHV(QHOQLYHOLQGLYLGXDOODWHRUtDGHORV
YDORUHV VLUYHQ SDUD FDUDFWHUL]DU ODV SULRULGDGHV TXH RULHQWDQ D ODV SHUVRQDV ODV EDVHV
PRWLYDFLRQDOHVHQTXHVXVWHQWDQORVYDORUHV\H[SOLFDUODVGLIHUHQFLDVLQWHULQGLYLGXDOHV
(VWRV HVWXGLRV DQDOL]DQ HO LPSDFWR TXH ORV YDORUHV WLHQHQ VREUH ODV DFWLWXGHV \ HO
FRPSRUWDPLHQWRGHORVLQGLYLGXRV\JUXSRVTXpFRQVHFXHQFLDVWLHQHQORVYDORUHVHQOD
DGRSFLyQ GH GHFLVLRQHV \ FRQ ODV DFWLWXGHV TXH H[SUHVDPRV D WUDYpV GH ORV FRQIOLFWRV
H[SHULPHQWDGRVHQODWRPDGHGHFLVLRQHV 7HWORFN 

/DV GLVWLQWDV WHRUtDV GH ORV YDORUHV H[SXHVWDV VXSRQH XQD UHFRQFHSWXDOL]DFLyQ GH ODV
WHRUtDV GH ORV YDORUHV LQLFLDGD HQ OD D[LRORJtD VREUH OD EDVH GH XQ PDUFR FRQFHSWXDO
FRP~QHQTXHORVYDORUHVVRQGHILQLGRVFRPRUHIHUHQFLDVSUHIHUHQFLDOHVSDUDRULHQWDUVH
HQ HO PXQGR VLHQGR HVWRV FRQFHSWXDOL]DFLRQHV GHILQLGDV XQDV YHFHV FRPR DIHFWLYR
HPRFLRQDOHVRFRPRFRJQLWLYRVRELHQTXHVHHQWLHQGDFRPRXQSURGXFWRLQGLYLGXDOR
FROHFWLYR < HQ OD PHGLGD TXH H[SOLFDQ HO FRPSRUWDPLHQWR LQGLYLGXDO FRPR FROHFWLYR
WDPELpQ HVWiQ RULHQWDQGR OD DFFLyQ VRFLDO < SRU ~OWLPR OD FRQVLGHUDFLyQ GH TXH ORV
YDORUHV IRUPDQ SDUWH GH ODV GLIHUHQWHV HVWUXFWXUDV GH FRQRFLPLHQWR HQ ODV TXH VH
LQWHUUHODFLRQDFRQODVDFWLWXGHV\VLVWHPDVGHFUHHQFLDVHQWUHRWUDVLQVWDQFLDVGHOSURFHVR
FRJQLWLYR

53

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

 /$ ,17(55(/$&,Ï1 '( /26 9$/25(6 &21 /$6 (6758&785$6


&2*1,7,9$6

/DV WHRUtDV DFWXDOHV DO HVWDEOHFHU XQD FODUD GLIHUHQFLDFLyQ HQWUH GLVWLQWDV HVWUXFWXUDV
FRJQLWLYDVKDQGDGRPD\RUDPSOLWXG\SURIXQGLGDGDODVLQYHVWLJDFLRQHVVREUHHOSDSHO
TXH pVWDV WLHQHQ HQ OD H[SOLFDFLyQ GHO FRPSRUWDPLHQWR KXPDQR 6L ELHQ DXWRUHV FRPR
6FKZDUW]  GDQDORVYDORUHVXQFDUiFWHUGHDFWLWXGJHQHUDOL]DGDH[LVWHXQDPSOLR
FRQVHQVR HQ TXH ORV YDORUHV WLHQHQ XQ FDUiFWHU PiV DEVWUDFWR TXH FXDOTXLHU RWUD
HVWUXFWXUDFRJQLWLYD

6LJXLHQGRHVWD OtQHD GH LQYHVWLJDFLyQ ODV DFWLWXGHV YHQGUtDQ DVHUXQDUHSUHVHQWDFLyQ


FRJQLWLYDGHQLYHOLQIHULRUTXHDJUXSDGDVHQGLIHUHQWHVQ~FOHRVGDUtDQOXJDUDXQDHVWUXFWXUD
VXSHULRUTXHVRQ ORV YDORUHV +ROODQGHU  $Vt XQYDORUSXHGHLPSOLFDUR LQGXFLU
GLYHUVDVDFWLWXGHVSRUHMHPSORODOLEHUWDGSXHGHOOHYDUDGLIHUHQWHVDFWLWXGHV HQOD
HGXFDFLyQHOWUDEDMRRHQODUHODFLRQHVLQWHUSHUVRQDOHV,QYHUVDPHQWHXQDDFWLWXGSXHGH
HVWDULPSOLFDGDHQGLYHUVRVYDORUHVSRUHMHmSORXQDDFWLWXGGHD\XGDUDOPDUJLQDGRVRFLDO
SXHGHVHUH[SUHVDGDSRUHOVHQWLGRGHODUHVSRQVDELOLGDGGH PHMRUDUOD VRFLHGDGPLHQWUDV
TXHRWURWDOYH]H[SUHVHORPLVPRLPSXOVDGRSRUVHQWLPLHQWRVGH VXSHULRULGDG

/DV DFWLWXGHV \ YDORUHV WLHQHQ HQ FRP~Q OD IXQFLyQ UHJXODGRUD GH OD FRQGXFWD \
RULHQWDFLyQGHOFRPSRUWDPLHQWR\DPERVFRQFHSWRVSXHGHQHQWHQGHUVHFRPRPRGRGH
HYDOXDU\MX]JDUHOHQWRUQRVRFLDO6LQHPEDUJRVHGLIHUHQFLDQGHODVDFWLWXGHVHQTXH
ORVYDORUHVGHXQDSHUVRQDVRQPHQRV\PiVUHVLVWHQWHVDOFDPELRRFXSDQXQSRVLFLyQ
PiVFHQWUDOHQHOVLVWHPDFRJQLWLYR\VRQPDUFRVGHUHIHUHQFLDSDUDODDFWXDFLyQPiV
DGHFXDGD\SUHIHULEOHDQWHXQIHQyPHQRVRFLDO *DU]yQ 

2WURVDXWRUHVFRPR$OOSRUW9HUQRQ\/LQG]H\  KDQUHFLELGRFUtWLFDVSRUTXHVXV


HVWXGLRV VREUH ORV YDORUHV SXHGHQ HTXLSDUDUVH D XQ WHVW GH LQWHUHVHV YRFDFLRQDOHV
$FWXDOPHQWHKD\DFXHUGRHQFRQVLGHUDUODQHFHVLGDGGHGLIHUHQFLDUDPERVFRQFHSWRV\D
TXHORVYDORUHVVRQPDUFRVSUHIHUHQFLDOHVGHDFWXDFLyQ\ORVLQWHUHVHVVRQGHFLVLRQHVGH
SUHIHUHQFLDVKDFLDXQREMHWRGHWHUPLQDGR

7DPELpQ VH KD SODQWHDGR HQ DOJXQDV LQYHVWLJDFLRQHV OD HTXLYDOHQFLD HQWUH QRUPDV \
YDORUHV SRUTXH DPEDV WLHQHQ XQD GLPHQVLyQ SUHVFULSWLYD GH FRPSRUWDPLHQWR 6LQ
HPEDUJR DXWRUHV FRPR *DU]yQ \ *DUFpV   VRVWLHQHQ TXH ODV QRUPDV VRFLDOHV

54
&$3Ë78/2 $&7,78'(69$/25(6<&203257$0,(172

PRUDOHV HWF«  WLHQHQ XQ FDUiFWHU LQVWLWXFLRQDO TXH VH HPSOHDQ FRPR PHGLRV R
LQVWUXPHQWRV SDUD DOFDQ]DU GHWHUPLQDGDV PHWDV PLHQWUDV TXH ORV YDORUHV VRQ PRGRV
LQWHUSUHWDWLYRV\GHDWULEXFLyQGHVLJQLILFDGRDGLFKDVQRUPDVVRFLDOHV\FXOWXUDOHV

$VLPLVPR FXDQGR FRQFHELPRV ORV YDORUHV FRPR FRPSRQHQWHV GH OD SHUVRQDOLGDG VH
SXHGHQFRQIXQGLUFRQHOHQWUDPDGRGHQHFHVLGDGHVRORVGHVHRVHQODDFFLyQGHOVXMHWR
(Q HVWH VHQWLGR OD WHRUtD D FHUFD GH ODV QHFHVLGDGHV VHFXQGDULDV GHVHRV  GH 0DVORZ
  H[SUHVDGDV FRPR GHVHRV GH WUDQVFHQGHU OD UHDOLGDG SUHVHQWDED FDUDFWHUtVWLFDV
VLPLODUHV SDUD YDORUHV \ QHFHVLGDGHV (Q WpUPLQRV JHQHUDOHV VH SXHGHQ HVWDEOHFHU
GLVWLQFLRQHVFODUDVHQWUHGLFKRVFRQFHSWRVSXHVVLELHQORVGHVHRVVRQDQKHORVRDSHWLWRV
RULHQWDGRV KDFLD GHWHUPLQDGRV REMHWRV R HVWDGRV ORV YDORUHV WLHQHQ HQWUH RWUDV
IXQFLRQHVODGHWUDQVIRUPDUHVDVQHFHVLGDGHVVHFXQGDULDVDXQOHQJXDMHFRJQLWLYRTXH
VHD VRFLDOPHQWH DFHSWDEOH (V GHFLU ORV SURSLRV YDORUHV SXHGHQ VHU XQD IXHQWH GH

QHFHVLGDGHV \ GHVHRV FRPR SRU HMHPSOR FXDQGR HO LQGLYLGXR DFWLYD HO YDORU GH OD
UHVSRQVDELOLGDGDOWUDWDUGHDOHMDUHOUHPRUGLPLHQWRSRUQRKDEHUFXPSOLGRFRQHOGHEHU

-XQWR D ODV VHxDODGDV FDUDFWHUtVWLFDV GLIHUHQFLDOHV TXH DSRUWDQ ORV YDORUHV UHVSHFWR D
RWUDV HVWUXFWXUDV FRJQLWLYDV KDQ GH DxDGLUVH RWUDV QR PHQRV LPSRUWDQWHV FRPR HO
FDUiFWHU FRQWH[WXDO \ GLQiPLFR GH ORV YDORUHV UHVSHFWR D HQIRTXHV HVWiWLFRV VREUH OD
SHUVRQDOLGDG \ HO FRPSRUWDPLHQWR KXPDQR < SRU RWUR SDUWH DO SDVDU GH VHU
FRQVLGHUDGR ORV YDORUHV XQ IHQyPHQR VXEMHWLYR D HQWHQGHUVH FRPR XQD HVWUXFWXUD
FRPSOHMDGHFRQRFLPLHQWRSDUDOHODPHQWHVHWUDQVLWDEDGHVGHORVDQiOLVLVDLVODGRVKDFLD
ORV HVWXGLRV GH YDORUHV IXQFLRQDOPHQWH LQWHUFRQHFWDGRV FRQ ODV HVWUXFWXUDV FRJQLWLYDV
TXHIRUPDQSDUWHGHOFRQRFLPLHQWRKXPDQR

 /$ &21(;,Ï1 (175( /26 02'(/26 (;3(&7$7,9$9$/25 < /26


9$/25(6

/D WHRUtD IXQFLRQDO GH ODV DFWLWXGHV GH .DW]   \ VXV SRVWHULRUHV GHVDUUROORV KDQ
HVWDEOHFLGROD FRQH[LyQHQWUH YDORUHV \ DFWLWXGHV D SDUWLU GHO DQiOLVLV GH ODV IX Q FLRQ HV
TXH GHVHPSHxDQ ODV DFWLWXGHV SDUD ORV LQGLYLGXRV (QWUH RWUDV IXQFLRQHV GHVWDFD
ODIXQFLyQH[SUHVLYDGHDTXHOODVDFWLWXGHVTXHVLUYHQSDUDH[SUHVDUYDORUHVFHQWUDOHVTXH
UHDILUPDQ DVSHFWRV LPSRUWDQWHV GHO DXWR FRQFHSWR FRPR IDFHWD GH la LGHQWLGDG GHO
LQGLYLGXR 'H PDQHUD TXH ODV SHUVRQDV TXH WHQJDQ OD GHPRFUDFLD FRPR YDORU
FHQWUDO
55

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

WHQGUiQ DFWLWXGHV QHJDWLYDV KDFLD ORV HVWLORV DXWRULWDULRV \ PRVWUDUiQ DFWLWXGHV


IDYRUDEOHVDFRQVXOWDU\WHQHUHQFXHQWDODVRSLQLRQHVGHORVGHPiV$VtPLVPRDOJXQDV
H[SUHVLRQHV GH YDORU KDQ VLGR LQWURGXFLGDV FRPR YDULDEOHV DQWHFHGHQWH MXQWR D ODV
DFWLWXGHVHQODGHWHUPLQDFLyQGHODFRQGXFWDHQORVPRGHORVGHH[SHFWDWLYDYDORU

(QHIHFWRODVWHRUtDVGHH[SHFWDWLYDYDORUDOUHODFLRQDUODVDFWLWXGHVFRQRWUDVYDULDEOHV
FRPR DQWHFHGHQWHV GLUHFWRV H LQGLUHFWRV GHO FRPSRUWDPLHQWR LQWURGXFHQ XQ PRGHOR
H[SOLFDWLYRHQODFDGHQDDFWLWXGQRUPDVVRFLDOHV\SHUVRQDOHVLQWHQFLyQFRQGXFWDTXH
KDSHUPLWLGRHOGHVDUUROORGHXQDDPSOLDYDULHGDGGHSRVWHULRUHVPRGHORVTXHUHODFLRQDQ
ODV DFWLWXGHV FRQ ORV YDORUHV DO LQWURGXFLU QXHYDV YDULDEOHV UHODFLRQDGRV FRQ pVWRV
~OWLPRV

$Vt D ORV PRGHORV FOiVLFRV GH OD WHRUtD GH OD DFFLyQ UD]RQDGD 7$5  \ OD WHRUtD GH OD
DFFLyQ SODQLILFDGD 7$3  VH KDQ DxDGLGR QXHYDV YDULDEOHV FRPR HO DXWRFRQFHSWR ODV

LGHQWLGDGHV JUXSDOHV ODV QRUPDV GH JUXSRV R OD DFWLYDFLyQ GH QRUPDV SHUVRQDOHV
GHILQLGDV FRPR XQ GHEHU PRUDO TXH UHODFLRQDQ ODV DFWLWXGHV FRQ ORV YDORUHV
5HFLHQWHPHQWH VH KD DQDOL]DGR HO SDSHO SUHGLFWLYR GH ORV YDORUHV FRPR DQWHFHGHQWH
LQPHGLDWR GH ODV QRUPDV .ULVWLDQVHQ\+RWWH ORFXDOVXSRQHXQDYDQFHHQODV
LQYHVWLJDFLRQHVTXHLQWHJUDQDFWLWXGHV\YDORUHVFRPRDQWHFHGHQWHVGHOFRPSRUWDPLHQWR
KXPDQR

8QR GH ORV QXHYRV PRGHORV DFWLWXGLQDOHV TXH LQWURGXFH GH IRUPD VHPLQDO FRQH[LRQHV
HQWUHDFWLWXG\YDORUHVODWHRUtDGHDXWRUUHJXODFLyQ 7$ GH%DJR]]L  TXHDxDGH
HO DVSHFWR PRWLYDFLRQDO GH OD LQWHQFLyQ HQ FX\R PRGHOR GHQRPLQD GHVHR \ TXH WLHQH
XQD LQIOXHQFLD GLUHFWD H LQGLUHFWD VREUH OD QRUPD VXEMHWLYD $OJXQRV LQYHVWLJDGRUHV
FRPR/HRQH3HUXJLQL\(UFRODQL  KDQH[SXHVWRPHMRUDVSUHGLFWLYDVGHODWHRUtD
GH OD DXWRUUHJXODFLyQ 7$  UHVSHFWR D ORV PRGHORV FOiVLFRV GHELGR DO SDSHO GH ORV
SURFHVRVPRWLYDFLRQDOHVHQODIRUPDFLyQHLQWHQFLyQ\HOVXEVLJXLHQWHFRPSRUWDPLHQWR

(Q HO LQWHQWR GH PHMRUDU OD H[SOLFDFLyQ GH OD YDULDQ]D DFWLWXGLQDO UHVSHFWR DO
FRPSRUWDPLHQWR RWURVDXWRUHVKDQLQWURGXFLGRQXHYDVYDULDEOHVFRPRHODXWRFRQFHSWR
%LGGOH %DQN \ 6ODYLQJV   HQFRQWUDURQ TXH HO URO GHO HVWXGLDQWH MXQWR D ODV
DFWLWXGHV \ ODV QRUPDV, LQIOXtD LQGLUHFWDPHQWH HQ HO FRPSRUWDPLHQWR DQWH HO HVWXGLR
D WUDYpV GH SHUPDQHFHU HQ HO FHQWUR /D LPSRUWDQFLD GH OD LGHQWLGDGGHOVHOIHQOD
H[SOLFDFLyQGHODFRQGXFWDHGXFDWLYDHVUHOHYDQWHSRUVXLQFLGHQFLDHQORVFRPSRQHQWHV

56

&$3Ë78/2 $&7,78'(69$/25(6<&203257$0,(172

GHODYDULDEOHGHFRQWUROGHODFRQGXFWD3RUXQDSDUWHODSHUFHSFLyQGHOFRQWUROGHOD
FRQGXFWDHVODDXWRHILFDFLDGHOHVWXGLDQWHHQWHQGLGDFRPRFRPSHWHQFLDRKDELOLGDGSDUD
UHDOL]DU GHWHUPLQDGRV FRPSRUWDPLHQWRV \ SRU RWUD OD FDSDFLGDG GH VXSHUDU ODV
OLPLWDFLRQHVTXHHOFRQWH[WRHGXFDWLYRSRQHDODVUHDOL]DFLRQHVGHOHVWXGLDQWH

2WUDVLQYHVWLJDFLRQHVUHODFLRQDQODVDFWLWXGHV\ODQRUPDSHUVRQDOHQWHQGLGDFRPRXQ
GHEHUPRUDOHVGHFLUORTXHODSHUVRQDFUHHHQXQPRPHQWRGDGR6FKZDUW]\+RZDUG
  FRQFOX\HURQ HQ VXV LQYHVWLJDFLRQHV TXH HO FRPSRUWDPLHQWR DOWUXLVWD HV PiV
SUREDEOH FXDQGR OD SHUVRQD HV FRQVFLHQWH GH ODV FRQVHFXHQFLDV GDxLQDV GH VX SRVLEOH
LQDFFLyQ KDFLD ORV GHPiV \ VH VLHQWD UHVSRQVDEOH GH ODV FRQVHFXHQFLDV D WUDYpV GH OD
QRUPD LQWHULRUL]DGD (VWD LQYHVWLJDFLyQ SRVWXOD TXH ORV YDORUHV DFW~DQ LQGLUHFWDPHQWH
VREUHHOFRPSRUWDPLHQWRKXPDQRDWUDYpVGHODDFWLYDFLyQGHODQRUPDSHUVRQDOFRPR
REOLJDFLyQPRUDOGHUHVSRQVDELOLGDGDQWHODDFFLyQ

'HVGH HVWD SHUVSHFWLYD LQYHVWLJDGRUD VH KD UHDOL]DGR HVWXGLRV UHODFLRQDGRV FRQ OD
DFWLYDFLyQ GH OD QRUPD DO FRPSRUWDPLHQWR IDYRUDEOH EXVFDGR EDVDGR HQ TXH
GHWHUPLQDGRV YDORUHV DFWLYDUiQ ODV QRUPDV SHUVRQDOHV \ VHUiQ ORV UHVSRQVDEOHV GH
PRWLYDUODUHDOL]DFLyQGHFRPSRUWDPLHQWRV(QLQYHVWLJDFLRQHVVREUHHOULHVJRGHVDOXG
HQ HVWXGLDQWHV XQLYHUVLWDULRV OOHYDGD D FDER SRU 0DUWtQH]6iQFKH] \ 5RV   VH
HQFRQWUy TXH DTXHOORV TXH GDEDQ PiV LPSRUWDQFLD D ORV YDORUHV KHGRQLVWDV PHQRV
SUHFDXFLRQHV WRPDEDQ HQ ODV UHODFLRQHV VH[XDOHV \ SRU WDQWR DFWXDEDQ VHJ~Q QRUPDV
SHUVRQDOHVRSXHVWDVDWRPDUSUHFDXFLRQHV

,QWURGXFLUODDFWLYDFLyQGHODQRUPDSHUVRQDOHQODWHRUtDGHODH[SHFWDWLYDYDORUVXSRQH
VLWXDUODLQWHULRUL]DFLyQGHODREOLJDFLyQPRUDOFRPRPRWLYDGRUGHODDFFLyQ\HQXQD
GLPHQVLyQGLVWLQWDDOGHODQRUPDVXEMHWLYDHQWHQGLGDFRPRODSUHVLyQVRFLDODDFWXDU

 /$&216,67(1&,$(175($&7,78'(6<9$/25(6

'HO HVWXGLR GH ORV YDORUHV \ VX LQIOXHQFLD HQ ORV FRPSRUWDPLHQWRV GH OD YLGD GH ODV
SHUVRQDV KDQ VXUJLGR PXFKDV LQYHVWLJDFLRQHV PRWLYDGDV SRU LGHQWLILFDU OD UHODFLyQ GH
ORVYDORUHVFRQRWURVFRQVWUXFWRVHQWUHORVFXDOHVFDEHGHVWDFDUHOFRQVWUXFWRGHDFWLWXG

3DUD5RNHDFK  ORVYDORUHVVRQFUHHQFLDVMHUDUTXL]DGDVGXUDGHUDVTXHHVSHFLILFDQ


XQPRGRGHFRQGXFWDRHVWDGRILQDOSHUVRQDOPHQWHSUHIHULEOHUHVSHFWRDRWURTXHJXtDQ
QXHVWUDV DFWLWXGHV \ FRPSRUWDPLHQWRV 3DUD HVWH DXWRU HO FRPSRQHQWH FHQWUDO HV OD

57

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

SHUVRQDOLGDG HQ OD TXH WRPDQ UHOHYDQFLD HO DXWRFRQFHSWR PLHQWUDV TXHODV DFWLWXGHV\
FRQGXFWDVVRQPiVSHULIpULFDV

+D\ RWURV DXWRUHV FRPR :LOOLDPV   TXH UHFRQRFHQ TXH ORV YDORUHV HVWiQ
UHODFLRQDGRV GLUHFWDPHQWH FRQ OD FRQGXFWD \ QR FRQ HO FRQVWUXFWR GH DFWLWXG 6LQ
HPEDUJR SDUD +RPHU \ .KDOH   VRQ PXFKRV ORV HVWXGLRV TXH KDQ SUHVHQWDGR
FRQVLVWHQWHVHYLGHQFLDVGHODVFRUUHODFLRQDOHVHQWUHYDORUHVDFWLWXG\FRQGXFWDVLHQGR
SUREOHPiWLFR SDUD HO SURSLR :LOOLDPV   DYDODU VX SRVLFLyQ HQ EDVH D ODV IXHUWHV
GLVFUHSDQFLDV HQ ORV UHVXOWDGRV REWHQLGRV HQ PXFKDV LQYHVWLJDFLRQHV TXH UHODFLRQDQ
GLUHFWDPHQWHYDORUHV\FRQGXFWD

(OPRGHORGHOTXHSDUWH+RPHU\.KDOH  FRQVLVWHHQFRQVLGHUDUTXHORVYDORUHV\


DFWLWXGHV WLHQHQ HQ FRP~Q TXH VRQ FRJQLFLRQHV VRFLDOHV HQ GLVWLQWRV JUDGRV GH
DEVWUDFFLyQTXHSHUPLWHQDOLQGLYLGXRDGDSWDUVHDOHQWRUQR/RVYDORUHVVRQSURWRWLSRV

RULHQWDGRV TXH SHUPLWHQ DO LQGLYLGXR DGDSWDUVH D OD VLWXDFLyQ \ D SDUWLU GH ORV FXDOHV
IOX\HQDQLYHOHVGHDEVWUDFFLyQLQWHUPHGLRVODVDFWLWXGHVTXHHVSHFLILFDQODVFRQGXFWDV
/DVHFXHQFLDHVWDEOHFLGDODGHQRPLQDQMHUDUTXtDGHYDORUDFWLWXGFRQGXFWD

3DUD FRQWUDVWDU HVWH PRGHOR UHDOL]DURQ XQD LQYHVWLJDFLyQ FX\RV UHVXOWDGRV PRVWUDEDQ
TXHORVYDORUHV OLVWDGRGHYDORUHV /29 H[WUDtGRGH5RNHDFK  FRUUHODFLRQDEDQ
IXHUWHPHQWHFRQODVDFWLWXGHVHVSHFtILFDVKDFLDODQXWULFLyQQDWXUDO\HQPHQRUPHGLGD
VH DVRFLDEDQ FRQ ODV FRQGXFWDV GH FRPSUD $O PLVPR WLHPSR FRPSUREDURQ TXH ODV
DFWLWXGHV KDFLD OD FRPLGD QDWXUDO LQIOXHQFLDEDQ VLJQLILFDWLYDPHQWH ODV FRQGXFWDV GH
FRPSUD(VGHFLUORVYDORUHVLQWHUQRV DXWRUUHDOL]DFLyQGLYHUVLyQ\DOHJUtDHQODYLGD
VHQWLGR GHO ORJUR \ DXWRUHVSHWR  HVWDEDQ IXHUWHPHQWH UHODFLRQDGRV FRQ DFWLWXGHV
IDYRUDEOHVKDFLDHOFRQVXPRGHFRPLGDQDWXUDO\ORVTXHSXQWXDEDQHQYDORUHVH[WHUQRV
VHQWLGRGHSHUWHQHQFLDVHUUHVSHWDGRVHJXULGDG PRVWUDEDQGHIRUPDPX\VLJQLILFDWLYD
DFWLWXGHVGHVIDYRUDEOHVKDFLDHOPLVPR

'HRWURODGRODVLQYHVWLJDFLRQHVKDQGHVYHODGRTXHODVUHODFLRQHVHQWUHYDORU\DFWLWXG VRQ
FRQVLVWHQWHV FXDQGR ODV DFWLWXGHV DQDOL]DGDV VRQ IXQFLRQHV GH H[SUHVLyQ GH YDORU
0DLR\2OVRQ (VGHFLULQGLYLGXRVFRQGHWHUPLQDGDVDFWLWXGHVGHH[SUHVLyQGH
YDORU GHEHUtD FRUUHVSRQGHU FRQ HO YDORU GH UHIHUHQFLD FRQVLGHUDGR LPSRUWDQWH 3RU
HMHPSORODDFWLWXGKDFLDODSURKLELFLyQGHIXPDUHVWiUHODFLRQDGDFRQODPD\RURPHQRU
 LPSRUWDQFLDTXHOHRWRUJXHDODOLEHUWDGGHORVQRIXPDGRUHV

58

&$3Ë78/2 $&7,78'(69$/25(6<&203257$0,(172

6Q\GHU\'H%RQR  HVWXGLDURQODUHODFLyQHQWUHDFWLWXGHVIXQFLRQDOHVH[SUHVDGDVD


WUDYpVGHOUDVJRGHDXWRYLJLODQFLD\VXUHODFLyQFRQORVYDORUHV6HJ~QHVWRVDXWRUHVODV
SHUVRQDVFRQXQUDVJREDMRHQDXWRYLJLODQFLDRULHQWDQVXFRPSRUWDPLHQWREDViQGRVHHQ
VXV YDORUHV VHQWLPLHQWRV \ DFWLWXGHV SRUTXH ODV SHUVRQDV FRQ DXWRYLJLODQFLD EDMD
WLHQGHQ D PDQWHQHU DFWLWXGHV H[SUHVLYDV GH YDORUHV 0LHQWUDV TXH ODV SHUVRQDV FRQ
UDVJRV DOWRV HQ YLJLODQFLD GHO \R \ SRU WDQWR SUHRFXSDGRV SRU OD DFHSWDFLyQ GH ORV
GHPiVVXHOHQDGDSWDUVXFRPSRUWDPLHQWRDODVLWXDFLyQLQWHUSHUVRQDOSRUTXHWLHQGHQD
PDQLIHVWDUIXQFLRQHVGHDGDSWDFLyQVRFLDORXQDIXQFLyQXWLOLWDULD.ULVWLDQVHQ\=DQQD
  FRQVLGHUDQ TXH OD FRQVLVWHQFLD HQWUH YDORUHV \ DFWLWXGHV HVWD PRGHUDGD SRU OD
LQIOXHQFLDGHORVUDVJRVGHSHUVRQDOLGDGGHDXWRYLJLODQFLDSRUORTXHODXWLOL]DFLyQGH
ORV YDORUHV FRPR MXVWLILFDFLyQ GH VXV DFWLWXGHV FRQILUPD OD HYLGHQFLD GHO HIHFWR GH
MXVWLILFDFLyQGHYDORUHVTXHVRVWLHQHODWHRUtDGH(LVHU  

 (/ (678',2 '( /$6 $&7,78'(6 '(6'( /$ 3(563(&7,9$ '( /26
9$/25(6

+D\ GRV DXWRUHV TXH HQ VXV HVWXGLRV KDQ SXHVWR pQIDVLV HQ HO GHVWDFDGR SDSHO GH ORV
YDORUHVSHUVRQDOHVFRPR PRWLYDGRUHVGHOFRPSRUWDPLHQWRKXPDQR(O SULPHUDXWRUHV
5RNHDFK   TXH GHVDUUROOD HO HVWXGLR GH ORV YDORUHV DUWLFXOiQGRORV HQ WRUQR D ODV
DFWLWXGHV (Q VHJXQGR OXJDU 6FKZDUW]   SUHVHQWD XQD WHRUtD LQWHJUDGD VREUH OD
HVWUXFWXUDGHORVYDORUHVTXHSXHGHUHODFLRQDUVHFRQFRPSRUWDPLHQWRVWDQWRSHUVRQDOHV
FRPR VRFLDOHV /RV PRGHORV WHyULFRV UHODFLRQDGRV FRQ ORV YDORUHV WHUPLQDOHV H
LQVWUXPHQWDOHV 5RNHDFK   \ YDORUHV XQLYHUVDOHV 6FKZDUW]    VH H[DPLQDQ
HQ HVWD LQYHVWLJDFLyQ SRUTXH VRQ HO RULJHQ GH HVWXGLRV TXH KDQ SHUPLWLGR DQDOL]DU HO
SHVR GH ORV YDORUHV HQ OD IRUPDFLyQ GH DFWLWXGHV H[SORUDQGR OD DGHFXDFLyQ GH ORV
PRGHORVMHUiUTXLFRVYDORUDFWLWXGFRQGXFWD

/DFRQWULEXFLyQGH5RFNHDFK

)XH HO SULPHU DXWRU TXH GHILQLy ORV YDORUHV FRPR FUHHQFLDV WUDQVLWXDFLRQDOHV TXH VH
HQFXHQWUDQ RUGHQDGRV SRU VX LPSRUWDQFLD SDUD ODV SHUVRQDV \ TXH JXtDQ QXHVWUDV
DFWLWXGHV\FRPSRUWDPLHQWRV3RURWUDSDUWHVXDSRUWDFLyQPHWRGROyJLFDIXHLQHVWLPDEOH
SRUVHUHOSULPHURTXHGHVDUUROOyXQDQiOLVLVVLVWHPiWLFRGHORVYDORUHVUHODFLRQDGRVFRQ
PHGLRV\ILQHV\VXVFHSWLEOHVGHPHGLFLyQHPStULFD

59

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

&RQVLGHUD ORV YDORUHV FRPR IXHU]DV PRWLYDFLRQDOHV TXH RFXSDQ XQ OXJDU FHQWUDO HQ OD
GLQiPLFDGHODFRQGXFWD\HQODFRQILJXUDFLyQGHODSHUVRQDOLGDG(QHVWHOtQHDHOVHOI
VHHQFXHQWUDLQWHJUDGRGHYDORUHVTXHMXHJDQXQSDSHOFHQWUDOSRUODIXQFLyQGHPRWLYDU
HLPSXOVDUDORVLQGLYLGXRVDFRPSRUWDUVHGHDFXHUGRFRQORVYDORUHVTXHVRVWLHQHQ\
SRU HO GHVHPSHxR GH RWUDV IXQFLRQHV FRPR ODV DIHFWLYDV H[SUHVDGDV HQ HO SURFHVR GH
HYDOXDFLyQODVFRJQLWLYDVVREUHORGHVHDEOH\ODVFRQGXFWXDOHVFRPRJXtDGHODDFFLyQ
5RNHDFK 

/DSHUVRQDOLGDGHVWiLQWHJUDGDSRUYDORUHVUHODFLRQDGRVFRQPHGLRV\ILQHVWHQLHQGROD
WUDQVJUHVLyQ GH YDORUHV FRQVHFXHQFLDV SHUVRQDOHV 8QRV ORV GHQRPLQD YDORUHV
WHUPLQDOHVUHIHULGRVDPHWDVRHVWDGRVILQDOHVDORVTXHXQDSHUVRQDGHVHDUtDOOHJDU\
RWURV ORV OODPD YDORUHV LQVWUXPHQWDOHV HQWHQGLGRV FRPR PRGRV GH FRQGXFWD SDUD
DOFDQ]DUODVPHWDVGHVHDGDV/RVLQVWUXPHQWDOHVORVGLVWLQJXHHQGRVWLSRV'HXQODGR

ORV YDORUHV PRUDOHV TXH VH FRUUHVSRQGHQ FRQ XQ FRPSRUWDPLHQWR EDVDGR HQ
VHQWLPLHQWRV SHUVRQDOHV \ FX\D WUDQVJUHVLyQ SRGUtD VXVFLWDU VHQWLPLHQWRV GH FXOSD R
UHPRUGLPLHQWRV\GHRWURYDORUHVGHFRPSHWHQFLDRDXWRUUHDOL]DFLyQFRQXQFRQWHQLGR
PiV GLULJLGR D OR SHUVRQDO TXH KDFLD OR LQWHUSHUVRQDO \ FX\D WUDQVJUHVLyQ VXVFLWD
VHQWLPLHQWRVGHLQDGHFXDFLyQRGHYHUJHQ]D

6HJ~Q5RNHDFK  ODVDFWLWXGHVTXHVHDFWLYDQDQWHXQREMHWRGHDFWLWXGDFWLYDUtDQD


VX YH] D XQ FRQMXQWR GH YDORUHV LQVWUXPHQWDOHV \ WHUPLQDOHV FRQ ORV TXH HVWiQ
IXQFLRQDOPHQWH FRQHFWDGDV 'DGR TXH 5RNHDFK   VRVWLHQH OD FHQWUDOLGDG GH ORV
YDORUHVSDUDHOFRQFHSWRGHDXWRHVWLPD\DXWRFRQFHSWRGHODSHUVRQDFXDQGRVHSODQWHD
XQD LQFRQJUXHQFLD HQWUH YDORUHV \ DFWLWXGHV R FRQGXFWDV VRQ HVWDV ~OWLPDV ODV TXH VH
PRGLILFDUtDQSDUDUHVWDEOHFHUODFRKHUHQFLDFRQORVYDORUHV\QRDOFRQWUDULR$SDUWLUGH
HVWD SUHPLVD HO DXWRU GHVDUUROOy OD WpFQLFD GH OD DXWRFRQIURQWDFLyQ TXH FRQVLVWH
EiVLFDPHQWH HQ LQGXFLU D ODV SHUVRQDV D GHWHUPLQDGRV FDPELRV HQ VXV YDORUHV \
FRPSRUWDPLHQWRVFRQWUDVWDQGRVXVYDORUHVFRQORVGHXQJUXSRGHUHIHUHQFLDSRVLWLYR

/DWHRUtDGHODHVWUXFWXUD\HOFRQWHQLGRXQLYHUVDOGHORVYDORUHVKXPDQRV

/D WHRUtD GH 6FKZDUW]   SDUWHGHXQ PRGHORLQWHJUDGRGHOVLVWHPDGHYDORUHVHV


GHFLUTXHODVFRQGXFWDVHVWDUiQPiVUHODFLRQDGDVFRQXQWLSRGHYDORUHVPRWLYDFLRQDOHV

60

&$3Ë78/2 $&7,78'(69$/25(6<&203257$0,(172

TXHFRQRWURV(ODVSHFWRPiVLPSRUWDQWHGHOVLVWHPDGHYDORUHVHVTXHVHRUJDQL]DQHQ
WLSRVPRWLYDFLRQDOHVTXHSXHGHQUHSUHVHQWDUVHJUiILFDPHQWHDWUDYpVGHXQDHVWUXFWXUD
FLUFXODUTXHUHIOHMDODUHODFLyQGLQiPLFDTXHVHHVWDEOHFHHQWUHHOORV

(VWRVLJQLILFDTXHFXDQGRVHGHWHUPLQDHOYDORUTXHHVWiDVRFLDGRSRVLWLYDPHQWHDXQD
FRQGXFWDHOUHVWRGHYDORUHVGHODHVWUXFWXUDFLUFXODUWHQGUiPD\RURPHQRUUHODFLyQFRQ
HVD FRQGXFWD D SDUWLU GH OD ORFDOL]DFLyQ GHO YDORU HQ GLFKD HVWUXFWXUD /RV WLSRV GH
YDORUHVFRPSDWLEOHVVHHQFXHQWUDQSUy[LPRVDORODUJRGHOFtUFXOR\ORVLQFRPSDWLEOHV
SDUWHQGHOFHQWURHQGLUHFFLRQHVRSXHVWDV

$87275$6&(1'(1&,$

$3(5785$ 8QLYHUVDOLVPR %HQHYROHQFLD &216(59$&,Ï1


$/&$0%,2

7UDGLFLyQ
$XWRGLUHFFLyQ
&RQIRUPLGDG

(VWLPXODFLyQ
6HJXULGDG

+HGRQLVPR

/RJURV 3RGHU

$87235202&,Ï1

)LJXUDModelo teórico de las relaciones Hntre los tipos motivacionales (adaptado de


Schwartz, 2001)

8QDIRUPDGHH[SUHVDUHVWDFRQILJXUDFLyQDWUDYpVGHXQHMHPSORVHUtDLPDJLQDUXQD
SHUVRQDTXHYDORUDHOUHFRQRFLPLHQWRVRFLDOHVGHFLUPXHVWUDODWHQGHQFLDDJDQDUVHHO
UHVSHWR\ODDSUREDFLyQGHORVGHPiV(VWDFRQGXFWDVHDVRFLDFRQHOYDORUTXHSHUWHQHFH
DODPRWLYDFLyQGH3RGHU\VLJXLHQGRHORUGHQFLUFXODUGHODHVWUXFWXUDGHYDORUHVHVWD
FRQGXFWD WDPELpQ HVWi UHODFLRQDGD FRQ YDORUHV GH /RJUR (O 3RGHU HVWDUtD UHODFLRQDGR
QHJDWLYDPHQWHFRQORVYDORUHV8QLYHUVDOLVPR\%HQHYROHQFLD\VRQLQFRPSDWLEOHVFRQ
ORVYDORUHV3RGHU\/RJURVDOHVWDUVLWXDGRHQOXJDUHVRSXHVWRV

61

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

(VWRV YDORUHV VH HVWUXFWXUDQ HQ GRV GLPHQVLRQHV ELSRODUHV GH RUGHQ VXSHULRU (O HMH
,QGLYLGXDOLVPR&ROHFWLYLVPR TXH HVWi FRQIRUPDGR SRU ORV YDORUHV $XWRSURPRFLyQ
FRPSXHVWR SRU /RJUR \ 3RGHU  YHUVXV $XWRWUDVFHQGHQFLD 8QLYHUVDOLVPR \
%HQHYROHQFLD  (O RWUR HMH HV GH $SHUWXUD DO FDPELR $XWRGLUHFFLyQ (VWLPXODFLyQ \
+HGRQLVPR YHUVXV&RQVHUYDFLyQ 7UDGLFLyQ6HJXULGDG\&RQIRUPLGDG 

(VWD WHRUtD KD GDGR OXJDU D WUDEDMRV GH GLVWLQWR WLSR TXH FRQVLGHUDQ ORV YDORUHV
LQGLYLGXDOHV \ FROHFWLYRV FRPR YDULDEOHV LQGHSHQGLHQWHV HV GHFLU TXH VLUYHQ SDUD
H[SOLFDU ORV FRPSRUWDPLHQWRV GH ODV SHUVRQDV R ODV VRFLHGDGHV (Q JHQHUDO VH KDQ
GHVDUUROODGRWHRUtDVTXHWUDWDURQGHHQFRQWUDUGLPHQVLRQHVFRPXQHVSULQFLSDOPHQWHHQ
OD GLPHQVLyQ LQGLYLGXDOLVPRFROHFWLYLVPR TXH SHUPLWLHUDQ FRPSDUDU ODV VLWXDFLRQHV \
ODVSHUVRQDVGDQGROXJDUDWHRUtDVWUDQVFXOWXUDOHVVREUHODHVWUXFWXUDGHYDORUHVWDQWRD
QLYHOSHUVRQDOFRPRFXOWXUDO

$VtSXHVHOQ~FOHRFHQWUDOGHHVWDWHRUtDFRQVLVWHHQHVWDEOHFHUODVSULRULGDGHVHQORV
YDORUHVFRQVLGHUDGDVFRPRXQSUHGLFWRUVLJQLILFDWLYRGHODFRQGXFWDVRFLDO\HQILMDUOD
LPSRUWDQFLDUHODWLYDGHXQYDORUUHVSHFWRDRWURVLQFRQVLGHUDUHOSDSHOGHODVDFWLWXGHV

3RURWUDSDUWHODFRQILJXUDFLyQVLVWpPLFDUHIOHMDTXHHQPXFKDVVLWXDFLRQHVVRFLDOHVQRV
PXHVWUDQUHDOLGDGHVFRQIOLFWLYDVTXHREOLJDQDHVFRJHUHQWUHPHWDVFRQWUDSXHVWDV\TXH
ODV SULRULGDGHV FXOWXUDOHV FUHDQ FRQWLQJHQFLDV GH UHIXHU]R VRFLDO \ HVWUXFWXUDQ OD
H[SHULHQFLDGHWDOPRGRTXHDOJXQRVYDORUHVVHQRVSUHVHQWDQFRPRFRPSDWLEOHV\RWURV
FRQWUDGLFWRULRV

(OPRGHORLQWHJUDWLYRYDORUDFWLWXGGH.ULVWLDQVHQ\+RWWH

5HFLHQWHPHQWH .ULVWLDQVHQ \ +RWWH   KDQ HODERUDGR XQ PRGHOR TXH LQWHJUD ORV
PRGHORV GH OD H[SHFWDWLYDYDORU OD WHRUtD GH ORV YDORUHV LQVWUXPHQWDOHV \ ILQDOHV GH
5RNHDFK   \ OD WHRUtD GH OD HVWUXFWXUD \ FRQWHQLGR XQLYHUVDO GH ORV YDORUHV
KXPDQRV 6FKZDUW]   UHODWLYRV D VL ODV SHUVRQDV VRQ FRKHUHQWHV R QR FRQ ORV
YDORUHVDFWLWXGHV\FRPSRUWDPLHQWRV

3DUD DQDOL]DU ODV UHODFLRQHV TXH VH GDQ HQWUH YDORUHV DFWLWXGHV \ FRPSRUWDPLHQWRV HV
QHFHVDULR FRQVLGHUDU GRV IDFWRUHV TXH VRQ PHGLDGRUHV HQ OD SRVLEOH FRQVLVWHQFLD R
LQFRQVLVWHQFLD HQWUH GLFKRV HOHPHQWRV (O SULPHU DVSHFWR HV TXH HO LQGLYLGXR HVWi
LQIOXHQFLDGR SRU XQ FRQWH[WR VRFLDO HQ OD TXH SXHGH H[LVWLU XQD FXOWXUD PiV
LQGLYLGXDOLVWD R PiV FROHFWLYLVWD TXH GD OXJDU D LQGLYLGXRV FRQ LGHQWLGDGHV

62
&$3Ë78/2 $&7,78'(69$/25(6<&203257$0,(172

LQGHSHQGLHQWHV R LQWHUGHSHQGLHQWHV GH ORV GHPiV (O VHJXQGR HV TXH HQ GLFKD
LQWHUUHODFLyQ HV QHFHVDULR DQDOL]DU OD LPSRUWDQFLD GH QXHYRV GHVDUUROORV GH OD QRUPD
VRFLDOODRULHQWDFLyQPRUDOKDFLDODMXVWLFLD\HOFXLGDGRGHORVGHPiV\HOGHVDUUROOR
PRUDOGHOLQGLYLGXR

(O PRGHOR GH .ULVWLDQVHQ \ +RWWH   FRQVLVWH HQ DPSOLDU HO PRGHOR GH OD DFFLyQ
UD]RQDGDGH)LVKEHLQ\$M]HQ  LQWHJUDQGRGHXQDSDUWHODUHODFLyQHQWUHHOVHOI
UD]RQDPLHQWRPRUDO\RULHQWDFLyQPRUDO\GHODRWUDYDORUHVDFWLWXGHV\FRQGXFWD

/RVDXWRUHVSDUWHQGHOGHVDUUROORPRUDOGH.KROEHUJ  HQODTXHH[LVWHQWUHVHWDSDV


GHUD]RQDPLHQWRTXHH[SHULPHQWDQORVLQGLYLGXRVVREUHHOFRPSRUWDPLHQWRPRUDO(QOD
HWDSDSUHFRQYHQFLRQDOHOQLxRVHSUHRFXSDGHIRUPDHJRtVWDSRUODREHGLHQFLDSRUHYLWDU
HOFDVWLJR\SRUODDXWRVDWLVIDFFLyQ(QODHWDSDFRQYHQFLRQDOUHIHULGDDORVDGROHVFHQWHV
\ OD PD\RUtD GH ORV DGXOWRV HO UD]RQDPLHQWR PRUDO VH IRFDOL]D HQ HO GHVHR GH VHU

DFHSWDGR\GHOFXPSOLPLHQWRGHODVUHJODVFRQYHQFLRQHV\UROHVVRFLDOHV<HQODHWDSD
SRVWFRQYHQFLRQDO ODV SHUVRQDV VH SUHRFXSDQ SRU FULWHULRV SHUVRQDOHV \ GH YDORUHV TXH
HOODVKDQGHILQLGRLQGHSHQGLHQWHPHQWHGHTXHFRLQFLGDQRQRFRQORVGHODVRFLHGDGRGH
ILJXUDVGHDXWRULGDG&RPSDUDQGRORVWLSRVGHYDORUHVGHVFXEUHTXHORVLQGLYLGXRVTXH
PXHVWUDQ XQ UD]RQDPLHQWR SRVWFRQYHQFLRQDO VRQ ORV TXH HVWiQ HQ PD\RU PHGLGD GH
DFXHUGRDVXVYDORUHVLQWHUQDOL]DGRV

3RURWURODGRHOPRGHORLQFRUSRUDGRVIRUPDVGHRULHQWDFLyQPRUDO/DRULHQWDFLyQPRUDO
GHODMXVWLFLD .KROEHUJ LPSOLFDODH[LVWHQFLDGHXQLQGLYLGXRPRUDODXWyQRPR TXH
GHWHUPLQD HO FULWHULR TXH VH KD GH VHJXLU D WUDYpV GH FRQVLGHUDFLRQHV UDFLRQDOHV H
LPSDUFLDOHVVREUHGHUHFKRV\REOLJDFLRQHV/DRWUDIRUPDPRUDOHVODRULHQWDFLyQKDFLDHO
FXLGDGRGHORVGHPiV *LOOLJDQ EDVDGDHQODUHVSRQVDELOLGDG \HQ ODV UHODFLRQHV
/DRULHQWDFLyQKDFLDORVFXLGDGRVHVWiOLJDGRVDVLWXDFLRQHVFRQFUHWDVEDVDGDVHQOD
H[SHULHQFLDGLDULD\HQORVSUREOHPDVSHUFLELGRVGHODVSHUVRQDV

6HJ~Q .ULVWLDQVHQ \ +RWWH   FRPELQDQGR OD UHODFLyQ HQWUH IRUPDV \ GHVDUUROORV
PRUDOHVVHGHWHUPLQDQUHODFLRQHVGLIHUHQWHVHQWUHYDORUHVDFWLWXGHV\FRPSRUWDPLHQWRV
/DV SHUVRQDV RULHQWDGDV KDFLD ORV FXLGDGRV HVWiQ PiV DIHFWDGDV SRU HO FRQWH[WR GH
SHUVRQDVLPSOLFDGDVHQGLOHPDVPRUDOHVLQIOX\HQGRPX\VHQVLEOHPHQWHHQODVDFWLWXGHV
\ HQ HO FRPSRUWDPLHQWR GH ODV PLVPDV (Q HVWH FDVR ODV SHUVRQDV PRVWUDUiQ SRFD
FRQVLVWHQFLD HQWUH VXV YDORUHV HVWDEOHV WUDQVLWXDFLRQDOHV \ VXV DFWLWXGHV \

63

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

FRPSRUWDPLHQWRV GHWHUPLQDGR SRU ODV VLWXDFLRQHV 3RU FRQWUD ODV SHUVRQDV FRQ XQD
RULHQWDFLyQ PRUDO KDFLD OD MXVWLFLD TXH VH LPSOLFDQ HQ XQ UD]RQDPLHQWR
SRVWFRQYHQFLRQDOHVSUREDEOHTXHH[SUHVHQDFWLWXGHV\FRPSRUWDPLHQWRVTXHGHULYHQGH
VXVYDORUHV2ELHQODVSHUVRQDVGHRULHQWDFLyQKDFLDODMXVWLFLDFRQUD]RQDPLHQWRPRUDO
FRQYHQFLRQDOHVPiVSUREDEOHTXHVLJDQODVQRUPDVVRFLDOHV\TXHSRUWDQWRH[SUHVHQ
ODVDFWLWXGHV\FRPSRUWDPLHQWRVEDVDGRVHQODSHUFHSFLyQGHHVWDVQRUPDV

/RVDXWRUHVSDUWHQGHODFRQVLGHUDFLyQGHOVHOIHQUHODFLyQFRQORVYDORUHVEDViQGRVHHQ
ORVGDWRVDSRUWDGRVSRU6FKZDUW]  HQXQDLQYHVWLJDFLyQUHDOL]DGDHQYHLQWHSDtVHV
6HHQFRQWUyTXHHODXWRFRQFHSWRHVWDEDORFDOL]DGRHQHOFHQWURGHOVLVWHPDGHYDORUHVHV
GHFLU HO SXQWR GRQGH WRGRV ORV WLSRV GH YDORUHV FRQYHUJtDQ 3URIXQGL]DQGR HQ HVWD
FXHVWLyQSRVWXODQODVLQIOXHQFLDVGHOVHOIVREUHODFRQVLVWHQFLDHQWUHYDORUHVDFWLWXGHV\
FRQGXFWDVWRPDQGRFRPRUHIHUHQFLDODGLVWLQFLyQGH0DUNXV\.LWD\DPD  GHTXH

ODV SHUVRQDV HVWiQ FXOWXUDOPHQWH VRFLDOL]DGDV FRPR SHUVRQD LQGHSHQGLHQWH R FRPR
SHUVRQD LQWHUGHSHQGLHQWH GH ORV GHPiV (Q ODV VRFLHGDGHV RFFLGHQWDOHV HO FRQFHSWR GH
SHUVRQD SURSXHVWR HV HO PDQWHQHU LQGHSHQGHQFLD GH ORV GHPiV H[SUHVDQGR VXV
FXDOLGDGHV GLVWLQWLYDV \ PDQLIHVWDQGR XQ PD\RU FRQRFLPLHQWR GH Vt PLVPR (Q ODV
FXOWXUDV DVLiWLFDV HO FRQFHSWR GH SHUVRQD GHULYD GH ODV UHODFLRQHV HQWUH SHUVRQDV \
PXHVWUDQXQFRQRFLPLHQWRPiVHODERUDGRGHORVGHPiV$OFRPSDUDUORVGRVHVTXHPDV
GH VHOI 0DUNXV \ .LWD\DPD   FRQFOX\HQ TXH ODV SHUVRQDV FRQ VHOI
LQWHUUHODFLRQDGRV VH DGDSWDUiQ PiV DO FRQWH[WR \ SRU WDQWR PDQLIHVWDUiQ PHQRU
FRQVLVWHQFLDHQWUHVXVYDORUHVDFWLWXGHV\FRPSRUWDPLHQWRVTXHODVSHUVRQDVFRQXQVHOI
LQGHSHQGLHQWHGDGDVDPDQLIHVWDUXQDLGHQWLGDGGLVWLQWLYDDQWHORVGHPiV

/D SURSXHVWD GHO PRGHOR GH LQWHUUHODFLyQ YDORUHV DFWLWXGHV \ FRPSRUWDPLHQWR GH
.ULVWLDQVHQ\+RWWH  SDUWHGHODVDFWLWXGHVQRUPDVVRFLDOHV\QRUPDVSHUVRQDOHV
LQFRUSRUDQGR WUHV WLSRV GH QRUPDV VRFLDOHV (O SULPHU WLSR VRQ ODV QRUPDV SHUVRQDOHV
UHOHYDQWHV TXH GHULYDQ GH ODV H[SHFWDWLYDV TXH WLHQHQ ORV RWURV VLJQLILFDWLYRV FRPR OD
IDPLOLD\ORVDPLJRV(OVHJXQGRVRQODVQRUPDVVRFLDOHVUHOHYDQWHVTXHVHxDODQFRPR
ODV SHUVRQDV GHEHUtDQ UHVSRQGHU HQ XQD VLWXDFLyQ < HQ WHUFHU OXJDU ODV QRUPDV
FRQWH[WXDOPHQWH UHOHYDQWHV EDVDGDV HQ OD SHUFHSFLyQ GH ODV UHODFLRQHV H[SHFWDWLYDV \
QHFHVLGDGHVGHODVSHUVRQDVLPSOLFDGDVHQXQGLOHPDPRUDO

64
&$3Ë78/2 $&7,78'(69$/25(6<&203257$0,(172

&RPR H[WHQVLyQ GHO PRGHOR GH )LVKEHLQ \ $M]HQ   .ULVWLDQVHQ \ +RWWH  
SURSRQHQ XQ PRGHOR EDVDGR HQ WUHV SRVLEOHV FDGHQDV GH UHODFLRQHV HQWUH YDORUHV
DFWLWXGHV \ FRQGXFWD PHGLDGDV SRU ODV LQWHUUHODFLRQHV HQWUH HO VHOI HO UD]RQDPLHQWR
PRUDO\ODRULHQWDFLyQPRUDO

(Q HO SULPHU HVTXHPD GH LQWHUUHODFLRQHV ODV SHUVRQDV FRQ XQ HVTXHPD GH VHOI
LQGHSHQGLHQWH \ UD]RQDPLHQWR GH MXVWLFLD SRVWFRQYHQFLRQDO XVDUtDQ ORV YDORUHV SDUD
JXLDU VXV QRUPDV SHUVRQDOHV \ HVWDV RULHQWDUtDQ VXV DFWLWXGHV 7DQWR ODV QRUPDV
SHUVRQDOHVFRPRODVDFWLWXGHVGHWHUPLQDUtDQODLQWHQFLyQ\HOFRPSRUWDPLHQWR1LQJXQD
GH ODV WUHV QRUPDV VRFLHWDOHV LQGLFDGDV DxDGLUtD QDGD D OD FRQVLVWHQFLD HQWUH YDORUHV
DFWLWXGHV \ FRQGXFWD (O VHJXQGR HVTXHPD FRUUHVSRQGHUtD D SHUVRQDV FRQ VHOI
LQGHSHQGLHQWH \ UD]RQDPLHQWR GH MXVWLFLD FRQYHQFLRQDO UHVSRQGHUtDQ FRQ QRUPDV
SHUVRQDOHVUHOHYDQWHV\QRUPDVVRFLHWDOHVTXHGHWHUPLQDUtDQVXVLQWHQFLRQHVPRUDOHV\

VXFRPSRUWDPLHQWR\DVHDGLUHFWDPHQWHRLQGLUHFWDPHQWHDWUDYpVGHVXLPSDFWRHQODV
QRUPDV SHUVRQDOHV \ HQ ODV DFWLWXGHV (Q FRQVHFXHQFLD QR FDEUtD HVSHUDU UHODFLyQ QL
GLUHFWD QL LQGLUHFWD HQWUH VXV YDORUHV VXV DFWLWXGHV \ VX FRPSRUWDPLHQWR (O WHUFHU
FDPLQR GH LQWHUDFFLRQHV VHUtD FXDQGR ODV SHUVRQDV WLHQHQ XQ VHOI LQWHUGHSHQGLHQWH \
UD]RQDPLHQWR PRUDO GH FXLGDGR D ORV GHPiV WRPDQ FRPR UHIHUHQFLD ODV QRUPDV GH
FRQWH[WRTXHLQIOXLUtDQGLUHFWDPHQWHHQHOFRPSRUWDPLHQWRHLQGLUHFWDPHQWHDWUDYpVGH
VX UHODFLyQ FRQ ODV QRUPDV SHUVRQDOHV \ ODV DFWLWXGHV (Q HVWH FDVR ORV YDORUHV QR
WHQGUtDQQLQJ~QHIHFWRHQODH[SOLFDFLyQGHOFRPSRUWDPLHQWR

(QUHVXPHQSRGHPRVGHFLUTXHODVDFWLWXGHVVHGLIHUHQFLDQGHORVYDORUHVHQHOVHQWLGR
GHTXHHVWRVVRQPiVHVWDEOHV\FHQWUDOHVTXHODVDFWLWXGHV(VWRSHUPLWHHQWHQGHUTXH
ORV YDORUHV FRQVWLWX\HQ XQ SUR\HFWR LGHDO FRPSDUWLGR TXH GD VHQWLGR \ RULHQWD OD
IRUPDFLyQGHDFWLWXGHVHQODDFWLYLGDGDFDGpPLFDFRPRRSFLRQHVSHUVRQDOHVDGTXLULGDV
OLEUH\UHIOH[LYDPHQWH(VWDSHUVSHFWLYDDEUHODVSXHUWDVSDUDWUDEDMDUFRQMXQWDPHQWHFRQ
ORVYDORUHVDOWLHPSRFRQYHQLHQWHPHQWHGLIHUHQFLDGRVGHODVDFWLWXGHVHLQWURGXFLUHQOD
SODQLILFDFLyQDFDGpPLFD\HOWUDEDMRGLGiFWLFRHVSDFLRVSDUDHOGHVDUUROOR\HYDOXDFLyQ
GHYDORUHV\DFWLWXGHVQHFHVDULRVSDUDHOGHVDUUROORDFDGpPLFR\SHUVRQDOGHOHVWXGLDQWH
\ODLQWHJUDFLyQVRFLDOHQODVLQVWLWXFLRQHVXQLYHUVLWDULDV

65

(/(678',2'(/$6
$&7,78'(6(1/$ Capítulo 3
('8&$&,Ï1683(5,25
&$3Ë78/2 (/(678',2'(/$6$&7,78'(6(1/$('8&$&,Ï1683(5,25

,1752'8&&,Ï1

/RVFDPELRVH[SHULPHQWDGRVHQOD(QVHxDQ]D6XSHULRUKDQSURGXFLGRXQJUDQLQWHUpVHQ
OD LQYHVWLJDFLyQ FLHQWtILFD SRU ORV WHPDV UHODFLRQDGRV FRQ OD DGDSWDFLyQ GH ORV
XQLYHUVLWDULRVDOFRQWH[WRHGXFDWLYR

(QJHQHUDOODWUDQVLFLyQDOD(GXFDFLyQ6XSHULRUHVXQSURFHVRFRPSOHMRTXHLPSOLFDD
ORVHVWXGLDQWHVDIURQWDUGHVDItRVHQORViPELWRVHPRFLRQDODFDGpPLFRHLQVWLWXFLRQDO6L
ELHQ OD FDOLGDG GH HVWH SURFHVR WLHQH TXH YHU FRQ OD PD\RU DWHQFLyQ D ORV SURJUDPDV
FXUULFXODUHVDORVSURFHVRVGHHQVHxDQ]DDSUHQGL]DMH\HYDOXDFLyQGHFRQRFLPLHQWRVOD
IRUPDFLyQSHGDJyJLFDGHVXVGRFHQWHV\ODFDOLGDGGHYLGDHQORVFDPSXVORFLHUWRHV
TXH OD PD\RUtD GH OD LQYHVWLJDFLyQ OOHYDGD D FDER KD ROYLGDGR ORV HOHPHQWRV
UHODFLRQDGRV FRQ OD FDOLGDG GH OD H[SHULHQFLD HGXFDWLYD )UDVHU  6WUDQJHV \
%DQQLJ <HVHVWHHOIRFRHVFRJLGRSRUODSUHVHQWHLQYHVWLJDFLyQSDUDDERUGDUHO

HVWXGLRGHODVDFWLWXGHVGHORVHVWXGLDQWHVXQLYHUVLWDULRVKDFLDODHGXFDFLyQTXHUHFLEHQ
D WUDYpV GH OD SHUFHSFLyQ TXH WLHQHQ GH OD H[SHULHQFLD HGXFDWLYD FRQ ORV FHQWURV GH
HQVHxDQ]D\ORTXHVXFHGHHQHODXOD

$XQTXH VH KD GDGR LPSRUWDQFLD D OD LQIOXHQFLD GH ORV FRQWH[WRV XQLYHUVLWDULRV HQ HO
FRPSRUWDPLHQWR GH ORV HVWXGLDQWHV OD GHILQLFLyQ \ RSHUDFLRQDOL]DFLyQ GH HVWRV
SUREOHPDV KD VLGR GLItFLO $VWLQ   /D HYDOXDFLyQ GHO FRQWH[WR HGXFDWLYR DEDUFD
WDQWRDVSHFWRVItVLFRV\RUJDQL]DWLYRVFRPRODVLQWHUDFFLRQHVIRUPDOHVHLQIRUPDOHVTXH
ORVHVWXGLDQWHVHVWDEOHFHQFRQGLIHUHQWHVHOHPHQWRVGHODFRPXQLGDGDFDGpPLFDGHQWUR\
IXHUDGHODXOD

$ QLYHO LQWHUQDFLRQDO ORV HVWXGLRV GH LQYHVWLJDFLyQ VREUH ODV LQWHUDFFLRQHV GHO
HVWXGLDQWH GHQWUR GHO FRQWH[WR HGXFDWLYR VH EDVDQ HQ HO DQiOLVLV GH ODV SHUFHSFLRQHV
H[SHFWDWLYDVDFWLWXGHV\RULHQWDFLRQHVYDORUDWLYDVTXHPXHVWUDQVREUHORVHOHPHQWRVTXH
DIHFWDQ D VX GHVDUUROOR SHUVRQDO \ DFDGpPLFR 3RU WDQWR VH HYDO~D OD H[SHULHQFLD
HGXFDWLYD GHO DOXPQR GHVGH XQD DSUR[LPDFLyQ PHWRGROyJLFD TXH DEDUFD GLVWLQWRV
FRPSRQHQWHV\REMHWRVDFWLWXGLQDOHVDUWLFXODGRVHQWRUQRDORVSURFHVRVGHHQVHxDQ]D
DSUHQGL]DMHUHFLELGRVHQHODXOD\ORVFHQWURV

(Q UHODFLyQ FRQ OD DFWLYLGDG DFDGpPLFD PXFKRV DXWRUHV KDQ WUDWDGR HO LPSDFWR GH
DGDSWDFLyQHLQWHJUDFLyQ GHOHVWXGLDQWHHQODXQLYHUVLGDGDSDUWLUGHGLVWLQWDVYDULDEOHV
PRGHUDGRUDV GH FDUiFWHU SHUVRQDO FRPR HO QLYHO GH FRQRFLPLHQWRV \ DSWLWXGHV

69

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

FRJQLWLYDV $OPHLGD \ *XLVDQGH   VXV QLYHOHV GH PRWLYDFLyQ \ SUR\HFWRV


YRFDFLRQDOHV 'HDxR*DUFtD6HxRUiQ \6HS~OYHGD \DVXDXWRQRPtD\ELHQHVWDU
SVLFROyJLFR 6DODQRYD0DUWtQH]%UHVy /ORUHQV \ *UDX   6L ELHQ DXWRUHVFRPR
3DVFDUHOOD \ 7HUHQ]LQL   VHxDODQ HQWUH RWUDV YDULDEOHV OD LPSRUWDQFLD TXH HQ HO
HVWXGLDQWHWLHQHQORVLQWHUHVHVH[SHFWDWLYDVDXWRHVWLPD\HVWUDWHJLDVDGHVDUUROODU

'HOFRQMXQWRDPSOLRGHYDULDEOHVSHUVRQDOHVTXHWUDWDQORVLQYHVWLJDGRUHVGHVWDFDPRV
ORV GLYHUVRV HVWXGLRV UHODWLYRV D ODV H[SHFWDWLYDV GH ORV HVWXGLDQWHV SRU OD LPSRUWDQFLD
TXH WLHQH HVWH FRQVWUXFWR HQ OD DGDSWDFLyQ DO FRQWH[WR XQLYHUVLWDULR &ROH .HQQHG\ \
%HQ$YLH DOWLHPSRTXHFRQHFWDFRQODSUHVHQWHLQYHVWLJDFLyQVREUHODVDFWLWXGHV
GHORVXQLYHUVLWDULRVHQUHODFLyQDODVWHRUtDVH[SHFWDWLYDYDORU

6HJ~Q 2OVRQ 5RHVH \ =DQQD   HQ ORV QXHYRV HQWRUQRV GH DSUHQGL]DMH ORV
HVWXGLDQWHVVHIRUPDQH[SHFWDWLYDV\FRQVWUX\HQLGHDVDFHUFDGHORTXHVHUi\VHVDEH

TXHODVH[SHFWDWLYDVLQIOX\HQVXEVHFXHQWHPHQWHHQODVSHUFHSFLRQHV(VLPSRUWDQWHSDUD
ODHGXFDFLyQSRUTXHVHKDGHPRVWUDGRTXHODVSHUFHSFLRQHVGHORVHVWXGLDQWHVVREUHXQ
HQWRUQR GH DSUHQGL]DMH VRQ GH FHQWUDO UHOHYDQFLD SRU ORV HIHFWRV R LPSDFWRV TXH WLHQH
VREUHHODSUHQGL]DMH (QWZLVWOH(QWZLVWOH\7DLW 

(Q OD DFWXDOLGDG HO LQWHUpV HVWi FHQWUDGR HQ ODV H[SHFWDWLYDV TXH WLHQH HO DOXPQDGR
XQLYHUVLWDULRGHVGHHOFRPLHQ]R\GXUDQWHVXVHVWXGLRV(QHVWHFDPSRH[LVWHQGRVOtQHDV
GH LQYHVWLJDFLyQ GLIHUHQFLDGDV XQD WLHQH SRU REMHWLYR HVWXGLDU ODV H[SHFWDWLYDV GHO
DOXPQDGRFRQODLQWHQFLyQGHFRQRFHUTXpHVSHUDQGHODXQLYHUVLGDGHQJHQHUDO\ODRWUD
SHUVLJXHHVWXGLDUODVH[SHFWDWLYDVGHORVHVWXGLDQWHVVREUHFRPSRQHQWHVHVSHFtILFRVGHO
SURFHVRHQVHxDQ]DDSUHQGL]DMH

'HRWUDSDUWHORVHVWXGLRVVREUHODVH[SHFWDWLYDVGHODOXPQRHVWiQHQIRFDQGRHOSURFHVR
GHHQVHxDQ]D\DSUHQGL]DMHFRQXQDPD\RUDPSOLWXG\FRPSOHMLGDGDOHVWDEOHFHUFRPR
REMHWLYRUHDOL]DUHVWXGLRVYDORUDWLYRVGHODVLWXDFLyQDFWXDO\QRGHODHVSHUDGDRELHQ
UHODFLRQDUDPEoVREMHWLYRVHQXQPLVPRHVWXGLR7DPELpQVXUJHQHVWXGLRVSDUDHYDOXDU
ODV SHUFHSFLRQHV GH DVSHFWRV FRQFUHWRV \ DFWXDOHV GHO SURFHVR HGXFDWLYR FRPR
PHWRGRORJtDV DPELHQWH DFDGpPLFR SURIHVRUHV \ SURIHVRUDV HWF IUHQWH D HQIRTXHV
JHQHUDOLVWDVGHHYDOXDFLyQGHH[SHFWDWLYDVGHOSURFHVRGHDSUHQGL]DMH

/DV LQYHVWLJDFLRQHV VREUH ODV H[SHFWDWLYDV GHO HVWXGLDQWH KDQ HVWDGR FHQWUDGDV
WUDGLFLRQDOPHQWH HQ HO FDPSR GH OD HQVHxDQ]DDSUHQGL]DMH DXQTXH UHFLHQWHPHQWH KDQ

70

&$3Ë78/2 (/(678',2'(/$6$&7,78'(6(1/$('8&$&,Ï1683(5,25

VXUJLGRQXHYRVHQIRTXHVTXHWRPDQFRPRUHIHUHQFLDHOPXQGRHPSUHVDULDORFRPHUFLDO
GDQGROXJDUDODLQFRUSRUDFLyQGHODSHUVSHFWLYDGHODFDOLGDGGHVHUYLFLRHQHOHVWXGLR
GHODVH[SHFWDWLYDVHQHGXFDFLyQ

/R FXDO KD GDGR OXJDU D XQD WLSRORJtD GH HVWXGLRV GH ODV H[SHFWDWLYDV GH ORV
XQLYHUVLWDULRVVREUHHOSURFHVRGHHQVHxDQ]D\DSUHQGL]DMHGHWHUPLQDGDSRUHOiPELWR
GH JHQHUDO R HVSHFtILFR TXH VH GHVHD HVWXGLDU \ HO WLSR GH WHRUtDV HVFRJLGR \D
VHDQWHRUtDVGHODSVLFRORJtD\ODHGXFDFLyQODWHRUtDGHFDOLGDGGHVHUYLFLRRXQHQIRTXH
FRPELQDGRGHDPEDV

 $&7,78'(6 < (;3(&7$7,9$6 '(6'( /$ 3(563(&7,9$ 36,&262&,$/


('('8&$7,9$

/DVH[SHFWDWLYDVUHSUHVHQWDQDTXHOORTXHORVHVWXGLDQWHVHVSHUDQUHDOL]DU\FRQFUHWDUHQ

VXYLGDDFDGpPLFDDEDUFDQGRORVDVSHFWRVDFDGpPLFR\GHLQWHJUDFLyQVRFLDO7UDGXFHQ
XQ PDUFR DFWLWXGLQDO H[SUHVDGR SRU ODV RULHQWDFLRQHV FRJQLWLYDV \ PRWLYDFLRQDOHV
UHDOL]DGDVHQFRQWH[WRVGHDSUHQGL]DMHVTXHLQIOX\HQHQHOQLYHOGHLPSOLFDFLyQGHORV
HVWXGLDQWHVGH(QVHxDQ]D6XSHULRUUHVSHFWRDVXYLGDacadémica\HQHOPRGRGHDIURQWDU
ORVGHVDItRVDFDGpPLFRV\VRFLDOHVSUHVHQWHVHQHVDH[SHULHQFLD +RZDUG.XK
*RQ\HD \ :LOOLDPV   $Vt DOJXQRV DXWRUHV GHVWDFDQ TXH OD FRPSUHVLyQ GH
ODV YLYHQFLDV \ H[SHFWDWLYDV GH ORV HVWXGLDQWHV VREUH OD UHDOL]DFLyQ DFDGpPLFD \ OD
LQWHUDFFLyQ VRFLDO 7LQWR   \ GH ODV WDUHDV UHODFLRQDGDV FRQ HO GHVDUUROOR GHO
DOXPQR XQLYHUVLWDULR 3DVFDUHOOD \ 7HUHQ]LQL   SHUPLWH H[SOLFDU ORV SURFHVRV
GH DGDSWDFLyQDOFRQWH[WRGHOD(QVHxDQ]D6XSHULRU

/DVLQYHVWLJDFLRQHVVREUHH[SHFWDWLYDVHVWiQUHIHULGDVDGLYHUVRVGRPLQLRVGHORVFXDOHV
DOJXQRV VRQ FRLQFLGHQWHV FRQ QXHVWUD LQYHVWLJDFLyQ FRPR ORV UHIHULGRV DO SURFHVR \
UHVXOWDGRVGHODSUHQGL]DMHODUHODFLyQFRQORVSURIHVRUHVODVUHODFLRQHVFRQORVLJXDOHV
\ ODV RSFLRQHV YRFDFLRQDOHV \ SURIHVLRQDOHV (VWXGLRV FRPR HO GH %UD[WRQ 9HVSHU \
+RVVOHU   FRQFOX\HURQ OD H[LVWHQFLD GH UHODFLyQ HQWUH ODV H[SHFWDWLYDV GH ORV
HVWXGLDQWHVGHSULPHUDxR\VXSHUVLVWHQFLDHQOD(QVHxDQ]D6XSHULRU\UHYHODURQTXHHO
JUDGR GH FXPSOLPLHQWR GH ODV H[SHFWDWLYDV SDUD HO GHVDUUROOR DFDGpPLFR H LQWHOHFWXDO
HVWDFRUUHODFLRQDGRSRVLWLYDPHQWHFRQHOQLYHOGHLQWHJUDFLyQDFDGpPLFDGHOHVWXGLDQWH
XQLYHUVLWDULR

71

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

&RQFUHWDQGR VREUH HVWD FXHVWLyQ ORV UHVXOWDGRV GHlos LQYHVWLJDGRUHV ,JXH %DULDQL \
0LODQHVL   UHYHODQ TXH OD UHODFLyQ HQWUH H[SHFWDWLYDV \ H[SHULHQFLD DFDGpPLFD
DIHFWDQ DO QLYHO GH FRPSURPLVR \ HVIXHU]R FRJQLWLYR LQFLGLHQGR VREUH
ODFDOLGDGGHODMXVWHHOQLYHOGHDSUHQGL]DMHGHVDUUROORSVLFRVRFLDO\SHUVLVWHQFLDDFDGpPLFD
7DOHV DVt TXH OD GLVFUHSDQFLD HQWUH H[SHFWDWLYDV LQLFLDOHV \ OD H[SHULHQFLD
UHDOGHORVHVWXGLDQWHV GH OD(QVHxDQ]D6XSHULRUVHFRQYLHUWHHQHOHYDGRVQLYHOHVGHLQVDWLVIDFFLyQ
FRQ OD YLGD DFDGpPLFD \ OD LQVWLWXFLyQ GH HQVHxDQ]D SUREOHPDV GH LQWHJUDFLyQ
DFDGpPLFD \ VRFLDO DVt FRPR SHRUHV UHVXOWDGRV JOREDOHV HQ VX UHQGLPLHQWR %DNHU
0DF1HLO\6LU\N%UD[WRQHWDO+RZDUG 

(QVtQWHVLVQXPHURVRVHVWXGLRVHPStULFRVFRPRORVUHDOL]DGRVSRU%DNHUHWDO  
%DNHU\6FKXOW]  'DUODVWRQ-RQHVHWDO  -DFNVRQHWDO  3DQFHUHW
DO   \ 6PLWK \ :HUWOLHE   FRQFOX\HQ HQ VXEUD\DU HO LPSRUWDQWH SDSHO

PRGHUDGRUGHODVH[SHFWDWLYDVDFDGpPLFDVUHVSHFWRDOp[LWRDFDGpPLFR\ODDGDSWDFLyQD
ODEQVHxDQ]D6XSHULRU

6REUH HVWD SHUVSHFWLYD GHVWDFDQ DOJXQRV HVWXGLRV SRU OD DSOLFDFLyQ GH LQYHQWDULRV TXH
UHODFLRQDQ H[SHFWDWLYDV FRQ UHVXOWDGRV DFDGpPLFRV \ EDVDGDV HQ PRGHORV
PRWLYDFLRQDOHV (O FXHVWLRQDULR GHQRPLQDGR College Students Expectation
Questionnaire CSEQ 3DFH \ .KX   DSOLFDGR D  HVWXGLDQWHV TXH FXUVDEDQ
HVWXGLRV HQ IDFXOWDGHV \ XQLYHUVLGDGHV GXUDQWH ORV DxRV  D  UHYHOy TXH ORV
DQWHFHGHQWHV SHUVRQDOHV ODV FDUDFWHUtVWLFDV SHUVRQDOHV \ ODV H[SHFWDWLYDV VREUH OD
XQLYHUVLGDG H[SOLFDEDQ ORV QLYHOHV HVSHUDGRV GH OD FDSDFLGDG GH LQWHUDFFLyQ GHO
HVWXGLDQWH

'HDxR 'LQL] $OPHLGD $OIRQVR &RVWD *DUFtD6HxRUiQ \ 7HOODGR   HVWXGLDURQ


ODV H[SHFWDWLYDV GH HVWXGLDQWHV GH SULPHU DxR HQ XQD XQLYHUVLGDG HVSDxROD \ RWUD
SRUWXJXHVDDSOLFDQGRHO&XHVWLRQDULRGH3HUFHSFLRQHV$FDGpPLFDV &3$ TXHWUDGXFH
ODVFUHHQFLDV\DFWLWXGHVTXHSUHVHQWDQFXDQGRDFFHGHQDOD(QVHxDQ]D6XSHULRUFyPR
VH LQYROXFUDQ \ HVSHUDQ TXH HO FRQWH[WR XQLYHUVLWDULR VDWLVIDJD VXV GHVHRV \
QHFHVLGDGHV (Q OD PHGLFLyQ GH ODV GLIHUHQWHV H[SHFWDWLYDV FRQWHQLGDV HQ HO &3$ VH
XWLOL]DURQtWHPVGLVWULEXLGRVHQVLHWHGLPHQVLRQHVTXHVHDSOLFDURQDXQDPXHVWUDGH
GHHVWXGLDQWHVGHSULPHUDxRGHOD8QLYHUVLGDGGH0LQKR\OD8QLYHUVLGDGGH9LJR

72

&$3Ë78/2 (/(678',2'(/$6$&7,78'(6(1/$('8&$&,Ï1683(5,25

0HGLDQWHXQPRGHORGHHFXDFLRQHVHVWUXFWXUDOHVDSOLFDGRDO&3$VHFRPSUREyTXHHO
DMXVWH GH ODV H[SHFWDWLYDV FRQ ODV H[SHULHQFLDV TXH VH SURGXFHQ HQ OD YLGD DFDGpPLFD
IDYRUHFHQ HO PRGR GH DGDSWDFLyQ D OD (QVHxDQ]D 6XSHULRU $VLPLVPR HO PRGHOR
FRQILUPy TXH ODV H[SHFWDWLYDV IDYRUHFHQ OD UHDOL]DFLyQ DFDGpPLFD \ OD LQWHJUDFLyQ
VRFLDOSXHVHODQiOLVLVIDFWRULDOFRQILUPDWRULR $)& FRPSUREyXQEXHQDMXVWHHPStULFR
GHODVGLPHQVLRQHVGHO&$3DJUXSDGDVHQHOFRPSRQHQWHUHDOL]DFLyQDFDGpPLFD\HQHO
FRPSRQHQWH LQWHJUDFLyQ VRFLDO (O FRPSRQHQWH GH UHDOL]DFLyQ DFDGpPLFD IRUPDGR SRU
ODV GLPHQVLRQHV Formación para el empleo/carrera UHIHULGD D ODV RSRUWXQLGDGHV SDUD
DFFHGHU DO PXQGR SURIHVLRQDO Movilidad estudiantil UHODFLRQDGD FRQ OD DFWLWXG SDUD
SDUWLFLSDU HQ SURJUDPDV GH LQWHUFDPELR \ Calidad de formación UHIHULGD D VHQWLUVH
GHVDILDGR D SURIXQGL]DU HQ ORV FRQRFLPLHQWRV (O FRPSRQHQWH GH LQWHJUDFLyQ VRFLDO
PHGLGRVSRUODVGLPHQVLRQHVInteracción social UHODFLRQDGRFRQODYROXQWDGGHWHQHU
 QXHYRVFRQRFLPLHQWRV Desarrollo personal y social UHODFLRQDGDFRQPHMRUDSHUVRQDO D
WUDYpV GH ODV H[SHULHQFLDV DFDGpPLFDV Implicación política y ciudadana UHVSRQGH DO
GHVHR GH SDUWLFLSDU HQ OD YLGD SROtWLFD VRFLDO \ HFRQyPLFD GHO SDtV \ Presión Social
UHFRJHORVGHVHRVGHUHVSRQGHUDODVH[SHFWDWLYDVGHRWUR\SDUWLFLSDUHQODVDFWLYLGDGHV
GHHVWXGLR

 $&7,78'(6 < (;3(&7$7,9$6 '(6'( /$ 3(563(&7,9$ '( /$


&$&$/,'$''(6(59,&,2

(QHOiPELWRLQWHUQDFLRQDO\QDFLRQDOEDMRODLQIOXHQFLDGHODVSUiFWLFDVHPSUHVDULDOHV
DSOLFDGDV D OD JHVWLyQ GH ORV VHUYLFLRV VH KDQ GHVDUUROODGR QXPHURVDV LQYHVWLJDFLRQHV
VREUH ODV H[SHFWDWLYDV GHO DOXPQDGR HQ (GXFDFLyQ 6XSHULRU DSOLFDQGR OD WHRUtD GH
FDOLGDGGHVHUYLFLRVDOPXQGRGHODHGXFDFLyQXQLYHUVLWDULD

(VWDWHRUtDSRVWXODODLPSRUWDQFLDTXHODVH[SHFWDWLYDVSRVHHQHQODVDWLVIDFFLyQGHORV
FOLHQWHVRFRQVXPLGRUHV\EDViQGRVHHQHO0RGHOR&RQFHSWXDOGHODV([SHFWDWLYDVGHO
6HUYLFLR GHO &OLHQWH FRQFOX\HQ TXH ODV H[SHFWDWLYDV HVWiQ UHODFLRQDGDV FRQ OD
VDWLVIDFFLyQSRVWHULRUHQODFDOLGDGGHOVHUYLFLR\SURSRQHQTXHHVWXGLDU\FRQVLGHUDUODV
H[SHFWDWLYDV GH ORV FOLHQWHV D\XGDQ D JDUDQWL]DU GLFKD FDOLGDG =HLWKDPO %HUU\ \
3DUDVXUDPDQ 

73

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

(VWH PRGHOR SRVWXOD TXH ODV H[SHFWDWLYDV VH IRUPDQ GHVGH IXHUD \ SDUD PHMRUDU OD
HGXFDFLyQ \ WRPDQGR OR TXH HO DOXPQDGR SUHILHUH R GHVHD OR TXH VH GHQRPLQD FRPR
H[SHFWDWLYDVLGHDOHV 6DQGHU6WHYHQVRQ .LQJ\&RDWHV  3RURWUDSDUWHHOPRGHOR
FRQVLGHUDTXHHOSURIHVRUDGRWLHQHXQSDSHOJHVWRU\DOXPQRGHSURGXFWRUVLHQGRDPERV
FRSDUWtFLSHV GHO SURFHVR GH DSUHQGL]DMH 5RGUtJXH]   OR FXDO UHIXHU]D OD
LPSRUWDQFLDGHWRPDUHQFXHQWDODVSHUFHSFLRQHVH[SHFWDWLYDV\RSLQLRQHVGHODOXPQDGR
GXUDQWHWRGRSURFHVRGHHQVHxDQ]DDSUHQGL]DMH

/RV LQYHVWLJDGRUHV TXH XWLOL]DQ OD WHRUtD GH OD FDOLGDG GHO VHUYLFLR SDUD HVWXGLDU ODV
H[SHFWDWLYDVGHORVXQLYHUVLWDULRVHPSOHDQODWpFQLFDGHODHVFDODGHQRPLQDGD0~OWLSOH
ËWHP 6FDOH IRU 0HDVXULQJ &XVWRPHU 3HUFHSWLRQV RI 6HUYLFH 4XDOLW\ 6(5948$/ 
3DUDVXPDQ=HLWKDPO\%HUU\ 6HFRPSRQHGHGRVVHFFLRQHVGHtWHPVFDGD
XQD XQD SDUD PHGLU ODV H[SHFWDWLYDV GHO VHUYLFLR \ RWUD SDUD ODV SHUFHSFLRQHV UHDOHV

VREUHpVWH

%DViQGRVH HQ OD WHRUtD GH OD FDOLGDG +LOO   UHDOL]y XQ HVWXGLR H[SORUDWRULR
ORQJLWXGLQDO GH ODV H[SHFWDWLYDV \ SHUFHSFLRQHV TXH ORV HVWXGLDQWHV SRVHHQ GH ORV
GLIHUHQWHV VHUYLFLRV XQLYHUVLWDULRV HQ ORV TXH VH LQFOXtDQ IDFWRUHV DFDGpPLFRV FRPR OD
FDOLGDG GH OD HQVHxDQ]D HO FRQWHQLGR GHO FXUVR ORV PpWRGRV GH HQVHxDQ]D \ HO
IHHGEDFN. /RV UHVXOWDGRV REWHQLGRV UHYHODQ OD HVWDELOLGDG GH ODV H[SHFWDWLYDV GH ORV
HVWXGLDQWHVDWUDYpVGHOWLHPSR VREUHWRGR HQORVIDFWRUHVDFDGpPLFRV DUJXPHQWDQGR
TXHpVWDVSUREDEOHPHQWHVHIRUPDQDQWHVGHOOHJDUDODXQLYHUVLGDG6REUHHVWDFXHVWLyQ
/LFDWD \ 0D[KDP   LQYHVWLJDURQ OD LQIOXHQFLD GH ODV LQWHQFLRQHV VREUH ODV
H[SHFWDWLYDV \ DO HQFRQWUDU TXH KDEtD GLIHUHQFLDV VLJQLILFDWLYDV VREUH OD LQIOXHQFLD GH
ODV LQWHQFLRQHV VREUH ODV H[SHFWDWLYDV TXH VH DxDGtDQ D ODV H[SHFWDWLYDV GHO DOXPQR
FRQFOX\HURQ TXH OD H[SHULHQFLD XQLYHUVLWDULD LQIOX\H HQ WDOHV H[SHFWDWLYDV /R FXDO
UHGXQGDUtD HQ OD QHFHVLGDG GH ORJUDU PD\RU DFXHUGR HQ FRQFUHWDU OD QDWXUDOH]D GH OD
LQIOXHQFLD GH HWDSDV DQWHULRUHV \ FRPR VH FRQFUHWD OD HVWDELOLGDG GH ODV H[SHFWDWLYDV
GXUDQWHORVDxRVGHIRUPDFLyQXQLYHUVLWDULD

2WURHVWXGLRUHDOL]DGRSRU'DUODVWRQ-RQHVHWDO  HQXQDXQLYHUVLGDGDXVWUDOLDQD


HPSOHDQGR HO FXHVWLRQDULR 6(5948$/ FRQFOX\y TXH QR KD\ GLIHUHQFLDV FODUDV HQWUH
ODVH[SHFWDWLYDVGHODOXPQDGR\VXVH[SHULHQFLDVUHDOHVVXJLULHQGRTXHHVWDVGLIHUHQFLDV
VHGHEHQDTXHORVHVWXGLDQWHVSRVHHQXQDYLVLyQQRUHDOLVWDRTXHLPSLGHQHOGHVDUUROOR

74

&$3Ë78/2 (/(678',2'(/$6$&7,78'(6(1/$('8&$&,Ï1683(5,25

DGHFXDGRGHORVDSUHQGL]DMHV7DOHVREMHFLRQHVGHEHUVHUUHVXHOWDVVHJ~Q6DQGHUHWDO
 HQHVWDEOHFHUSURJUDPDVSDUDGLULJLU\PRGLILFDUODVH[SHFWDWLYDVQRUHDOLVWDVR
LQDSURSLDGDVGHODHQVHxDQ]DXQLYHUVLWDULD\XWLOL]DUODVFRPRLQIRUPDFLyQYDOLRVDSDUD
TXHHOWUDEDMRHGXFDWLYRVHDHILFD]\JUDWRSDUDORVHVWXGLDQWHV

(Q HO PDUFR GH ODV LQYHVWLJDFLRQHV GH FDOLGDG GH VHUYLFLR UHDOL]DGDV SRU ODV
uQLYHUVLGDGHVHVSDxRODV2UWL]HWDO  UHDOL]DURQXQHVWXGLRHQOD8QLYHUVLGDGGH
OD5LRjDSDUDGHILQLUVXFDOLGDGDWUDYpVGHODLGHQWLILFDFLyQGH OR TXH SHUFLEHQ VXV
HVWXGLDQWHV \ GH ODV H[SHFWDWLYDV TXH WLHQHQ /RV UHVXOWDGRV KDOODGRV PXHVWUDQ OD
LPSRUWDQFLD SHUFLELGD SRU ORV HVWXGLDQWHV VREUH ODV FXDOLGDGHV GHO SURIHVRUDGR \
ODV FRPSHWHQFLDV PHQWDOHV GH UHODFLyQ VLHQGR FRP~Q D WRGRV ORV FHQWURV
XQLYHUVLWDULRV HQFXHVWDGRV 5HVSHFWR D ODV FXDOLGDGHV GHO SURIHVRU ORV HVWXGLDQWHV
GDQPXFKDLPSRUWDQFLDDTXHHOSURIHVRUDGRKDJDTXHHOFRQWHQLGRGHODDVLJQDWXUDVHD

HVWLPXODQWHSUHSDUHELHQODVFODVHVPRWLYHXWLOLFHPpWRGRVGHHQVHxDQ]DTXHH[LJHQDO
HVWXGLDQWHSHQVDUSRUVtPLVPRHQWUHRWURV$OPLVPRWLHPSRVHFRQVLGHUDLPSUHVFLQGLEOH
TXHOD IRUPDFLyQ UHFLELGD HQ OD 8QLYHUVLGDG D\XGH DO HVWXGLDQWH D PHMRUDU VX
FDSDFLGDGGHKDEODUHQS~EOLFRVXFDSDFLGDGGHWRPDGHGHFLVLRQHVVXFDSDFLGDGGH
UHODFLyQFRQHO HQWRUQRRVXDGDSWDELOLGDGDOPHUFDGRODERUDO

 $&7,78'(6 < (;3(&7$7,9$6 '(6'( 02'(/26 0,;726 '(


&$&$/,'$''(6(59,&,2<(1)248(36,&2('8&$7,92

(VWD OtQHD GH LQYHVWLJDFLyQ OLGHUDGD SRU LQYHVWLJDGRUHV EULWiQLFRV VH FHQWUy HQ ORV
HVWXGLRV GH ODV H[SHFWDWLYDV GH XQLYHUVLWDULRV GHVGH HO iPELWR GH OD SVLFRORJtD \ OD
HGXFDFLyQ(OPDUFRWHyULFRGHVXVLQYHVWLJDFLRQHVVHFDUDFWHUL]DSRUODLQWHUDFFLyQGH
ODV WHRUtDV GHO SURFHVDPLHQWR GH OD LQIRUPDFLyQ OD SURIHFtD GH DXWRFXPSOLPLHQWR \ OD
WHRUtDGHODFDOLGDGGHOVHUYLFLR 6DQGHUHWDO 

$SOLFDURQ HO FXHVWLRQDULR 8QLYHUVLW\ 6WXGHQWV¶ ([SHFWDWLRQV RI 7HDFKLQJ 86(7  HQ
GLVWLQWRV FHQWURV XQLYHUVLWDULRV UHIHULGRV D H[SHFWDWLYDV VREUH PpWRGRV GH HQVHxDQ]D
HYDOXDFLyQ DFDGpPLFD \ FXDOLGDGHV GHO SURIHVRUDGR $O DQDOL]DU ORV PpWRGRV GH
HQVHxDQ]DORVUHVXOWDGRVPRVWUDURQTXHORVPpWRGRVIUHFXHQWHPHQWHPiVHVSHUDGRVSRU
ORVSDUWLFLSDQWHVGHWRGRVORVFHQWURVIXHURQODOHFFLyQPDJLVWUDO\ODOHFFLyQLQWHUDFWLYD
\ HO PpWRGR PiV GHVHDGR IXH OD OHFFLyQ LQWHUDFWLYD VXJLULHQGR ORV LQYHVWLJDGRUHV TXH

75

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

HVWRV GDWRV GHPRVWUDUtDQ OD SUHIHUHQFLD GHO DOXPQDGR SRU VLWXDFLRQHV JXLDGDV SRU HO
SURIHVRUDGRFRQXQDSDUWLFLSDFLyQDFWLYDGHODOXPQDGR

(QUHODFLyQDODHYDOXDFLyQVHREVHUYDURQGLIHUHQFLDsVHJ~QGLVWLQWRVFHQWURVUHVSHFWRD
OD HOHFFLyQ GH H[iPHQHV IUHQWH D ORV WUDEDMRV GXUDQWH HO FXUVR DVt FRPR HO WLSR GH
WUDEDMR SUHIHULGR < UHVSHFWR D ODV FXDOLGDGHV GHO SURIHVRUDGR HOHJLGDV IXHURQ
KDELOLGDGHV GH HQVHxDQ]D DFFHVLELOLGDG R DIDELOLGDG FRQRFLPLHQWR HQWXVLDVPR \
RUJDQL]DFLyQ (VWD LQYHVWLJDFLyQ FRQFOX\H OD LPSRUWDQFLD GH WRPDU HQ FXHQWD HVWDV
H[SHFWDWLYDVGHHQVHxDQ]DSDUDHOGLVHxRGHOFXUVR 6DQGHUHWDO $SDUWLUGHHVWD
\ RWUD LQYHVWLJDFLRQHV GLVHxDURQ XQ SURJUDPD GH HQVHxDQ]DDSUHQGL]DMH GHQRPLQDGR
([SHFWDWLRQV/HG3ODQQHG2UJDQLVDWLRQ (/32 TXHSDUWLHQGRGHOFRQRFLPLHQWRGHODV
H[SHFWDWLYDVGHORVHVWXGLDQWHVHOSURIHVRUDGRWRPDVHHQFXHQWDODVH[SHFWDWLYDVGHORV
DOXPQRV DQWHV GH FRPHQ]DU HO FXUVR \ QHJRFLH FRQ HOORV ORV PpWRGRV GH HQVHxDQ]D

DSUHQGL]DMH 'HQWUR GH HVWH JUXSR GH LQYHVWLJDFLyQ .HRJK \ 6WHYHQVRQ  
LQYHVWLJDURQODVH[SHFWDWLYDVTXHORVHVWXGLDQWHVWLHQHQDOFRPHQ]DUVXHGXFDFLyQ

/D LQYHVWLJDFLyQ FRPSDUDGD HQWUH H[SHFWDWLYDV GH HVWXGLDQWHV XQLYHUVLWDULRV GH 5HLQR
8QLGR \ (VSDxD XWLOL]DQGR OD PHWRGRORJtD 86(7 PRVWUy TXH SDUD ORV HVWXGLDQWHV
HVSDxROHV ORV WLSRV GH HQVHxDQ]D PiV GHVHDGRV VRQ OD HQVHxDQ]D FHQWUDGD HQ HO
DOXPQDGR \ OD LQWHUDFWLYD \ HO WLSR GH HQVHxDQ]D TXH HOORV HVSHUDEDQ IXHURQ OD
HQVHxDQ]DLQWHUDFWLYD\ODFODVHPDJLVWUDO(VWD~OWLPDDGHPiVGHVHUXQPpWRGRPX\
HVSHUDGR HV HO PiV UHFKD]DGR SRU HVWRV XQLYHUVLWDULRV (Q FXDQWR D ORV PpWRGRV GH
HYDOXDFLyQHOWUDEDMRGLDULRHVHOHJLGRFRPRHOPiVHIHFWLYR 'HOD)XHQWHHWDO 

'HOD)XHQWHHWDO  KDQHQFRQWUDGRTXHODVSUHIHUHQFLDVRH[SHFWDWLYDV GH ORV


HVWXGLDQWHV GLILHUHQ HQ OD JUDQ PD\RUtD GH ORV tWHPV VHJ~Q OD QDFLRQDOLGDG
XQLYHUVLGDG\VHJ~QODWLWXODFLyQ GHWUHV\FLQFRDxRV 6HJ~QWLWXODFLyQVHHQFXHQWUDQ
PiVGLIHUHQFLDVVLJQLILFDWLYDVHQODHQVHxDQ]DGHVHDGD\ODVSUHIHUHQFLDVGHHYDOXDFLyQ
TXH HQ HO UHVWR &XDQGR VH FRQVLGHUDQ OD XQLYHUVLGDG \ OD QDFLRQDOLGDG ODV GLIHUHQFLDV
VRQ DOJR VLJQLILFDWLYDV HQ FXDQWR D ORV PpWRGRV GH HQVHxDQ]D GHVHDGRV \ ODV
SUHIHUHQFLDV GH ODV FXDOLGDGHV GHO SURIHVRUDGR < SRFR VLJQLILFDWLYD HQ UHODFLyQ D OD
YDULDEOHFXUVR SULPHURRFXDUWR 

2WUR WLSR GH HVWXGLRV VH KDQ HQIRFDGR D HVWXGLDU OD LQIOXHQFLD GHO SHUILO VRFLDO GH ORV
HVWXGLDQWHV VREUH ODV H[SHFWDWLYDV HQ GLYHUVRV DVSHFWRV GH OD HQVHxDQ]D XQLYHUVLWDULD

76

&$3Ë78/2 (/(678',2'(/$6$&7,78'(6(1/$('8&$&,Ï1683(5,25

FRPR SRU HMHPSOR PHWRGRORJtD GH HYDOXDFLyQ FDUDFWHUtVWLFDV \ URO GHO SURIHVRUDGR
HWFpWHUD

0F'RZHOO \ 0F'RZHOO   FRPSUREaron HQ VXV HVWXGLRV TXH HO VH[R FRPR
YDULDEOHLQIOX\HHQHOWLSRGHH[SHFWDWLYDVTXHSRVHHHODOXPQDGRVREUHHOSURIHVRUDGR
(QWRGDV ODV GLPHQVLRQHV ODV PXMHUHV HVSHUDEDQ PiV TXH ORV KRPEUHV \ HQ OD
GLPHQVLyQ GH DPDELOLGDG ODV DOXPQDV GHVWDFDQ PiV TXH ORV DOXPQRV /R TXH PiV
GHVWDFDQ ODV DOXPQDV GH OR TXH HVSHUDQ GHO SURIHVRU HV TXH VHD DWHQWR VH GLULMD
FRQ PD\RU VHQVLELOLGDG VH LQWHUHVH SRU HO DOXPQDGR \ HVWDEOH]FD UHODFLRQHV
LQWHUSHUVRQDOHV PiV FHUFDQDVFRQORVHVWXGLDQWHV

3RU VX SDUWH OR TXH PiV HVSHUDQ ORV DOXPQRV GHO SURIHVRU HV TXH WHQJD XQ HVWLOR
FRPXQLFDWLYR PiV HVSHFWDFXODU VHU FULWLFDGRV QHJDWLYDPHQWH HQ FODVH \ TXH ORV
GRFHQWHVVHDQLPSHUVRQDOHV\GLVWDQWHV

6PLWK   WDPELpQ HQFRQWUDURQ GLIHUHQFLDV HQ ODV H[SHFWDWLYDV GH ORV HVWXGLDQWHV
VHJ~QVXVH[R/RVUHVXOWDGRVUHIOHMDEDQTXHODVDOXPQDVPDQLIHVWDEDQPiVVHQVLELOLGDG
D ODV FDUDFWHUtVWLFDV SHUVRQDOHV GHO SURIHVRUDGR \ TXH ORV DOXPQRV SUHVHQWDEDQ PiV
VHQVLELOLGDGDOFRQRFLPLHQWR\DOVHQWLGRGHOKXPRUGHOSURIHVRUDGR

5HVSHFWR D ODV HYDOXDFLRQHV GH OR TXH HVSHUDEDQ ORV HVWXGLDQWHV GHO SURIHVRUDGR
&KRQNR7DQQHU\'DYLV  GHVWDFDQODVFXDOLGDGHVGHTXHVHDLQWHUHVDQWHD\XGHDO
DOXPQDGRTXHFRPXQLTXHELHQ\IDFLOLGDGSDUDKDEODUPLHQWUDVSXQW~DQPX\EDMRORV
DVSHFWRVUHODFLRQDGRVFRQHOLQWHUpVSRUTXHHODOXPQDGRDSUHQGD\HOFRQRFLPLHQWR(O
WLSR GH HYDOXDFLyQ DFDGpPLFD SUHIHULGD SRU ORV DOXPQRV VRQ WUDEDMRV R SUR\HFWRV HQ
JUXSRH[iPHQHVGHUHVSXHVWDVP~OWLSOHV\SUHJXQWDVFRUWDV

 $&7,78'(6<(;3(&7$7,9$6'(6'((/$0%,(17($&$'e0,&2

2WUDV OtQHDV GH LQYHVWLJDFLyQ KDQ VLGR ORV HVWXGLRV SVLFRVRFLDOHV GH SHUFHSFLyQ GH ORV
DOXPQRV VREUH OD FDOLGDG GHO FOLPD VRFLDO GRPLQDQWHV HQ HO DXOD \ VX LQIOXHQFLD HQ OD
FDOLGDGGHVXDGDSWDFLyQ\ODFDOLGDGGHVXVH[SHULHQFLDVDFDGpPLFDV

(O FOLPD SVLFRVRFLDO GH ORV HQWRUQRV HGXFDWLYRV HVWi UHODFLRQDGR FRQ ODV GLPHQVLRQHV
UHODFLRQDOHVIXQFLRQDOHV\RUJDQL]DWLYDV 0RRV  TXHVRQSHUFLELGDV\FRQVWUXLGDV
SRU ORV HVWXGLDQWHV /R FXDO UHTXLHUH TXH ORV DQiOLVLV VH FHQWUHQ HQ OD SHUVSHFWLYD GH

77

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

FyPRORVHVWXGLDQWHVSHUFLEHQORVFRQWH[WRVVDELHQGRTXHHVWDVSHUFHSFLRQHVLQIOX\HQ
HQFyPRORVHVWXGLDQWHVVHVLHQWHQ\VHFRPSRUWDQHQORVGLIHUHQWHVFRQWH[WRV $VWLQ
0RRV\7ULFNHWW74 

6HJ~Q&DEUHUD\FRODERUDGRUHV  ODH[SHULHQFLDHQFODVHVHUHFRQRFHFRPRXQRGH


ORVIDFWRUHVTXHPiVLQIOXHQFLDWLHQHHQHOGHVDUUROORFRJQLWLYRPRWLYDFLRQDO\DIHFWLYR
GHORVHVWXGLDQWHV3DUD7LQWR  HODXODXQLYHUVLWDULDHVHOFHQWURTXHHVWUXFWXUDOD
DFWLYLGDG HGXFDFLRQDO \ ORV HQFXHQWURV HQ HO DXOD HV HO OXJDU GRQGH VH SURGXFH OD
H[SHULHQFLD HGXFDWLYD (O DXOD HV HO OXJDU GRQGH HVWXGLDQWHV \ SURIHVRUHV VH UH~QHQ \
GRQGH VH H[SHULPHQWD HO DSUHQGL]DMH \ VH UHDOL]D OD LQWHJUDFLyQ DFDGpPLFD 3RU HOOR
VXJLHUH HO XVR GH SUiFWLFDV  GH HQVHxDQ]D TXH HQIDWLFHQ HO DSUHQGL]DMH FRODERUDWLYR
SDUD IDYRUHFHU OD LQWHJUDFLyQ DFDGpPLFD GH ORV HVWXGLDQWHV \ IRUPDFLyQ GH UHGHV GH
DSR\RVRFLDOPiVDPSOLDVLQWHJUDGDVHQODVHVWUXFWXUDVVRFLDOHVGHOD8QLYHUVLGDG

/RVHQIRTXHVEDVDGRVHQHOFOLPDVRFLDOGHODXODSURSRQHQHOXVRGHHVWUDWHJLDVDFWLYDV
GH HQVHxDQ]D GDGR TXH IRPHQWDQ OD SDUWLFLSDFLyQ HQ HO SURFHVR GH DSUHQGL]DMH \
EHQHILFLDQ HO GHVDUUROOR FRJQLWLYR \ UHQGLPLHQWR DFDGpPLFR GHO HVWXGLDQWH $QD\D
 

7DPELpQODSHUFHSFLyQTXHWLHQHQORVDOXPQRVGHODVFXDOLGDGHVGHOSURIHVRUHQFXDQWR
RUJDQL]DFLyQ SUHSDUDFLyQ \ FDOLGDG GH H[SRVLFLyQ VRQ GLPHQVLRQHV TXH HVWiQ
YLQFXODGDVDODPRWLYDFLyQ\UHQGLPLHQWRDFDGpPLFRGHORVHVWXGLDQWHV %UD[WRQHWDO
  /D DFFLyQ GHO SURIHVRU HQ HO DXOD WDPELpQ LQFLGH HQ OD VDWLVIDFFLyQ GH OD
H[SHULHQFLDXQLYHUVLWDULDGHODOXPQR *UDKDP \*LVL \DTXHHOHVWXGLDQWHSXHGD
GHVDUUROODU SUR\HFWRV YRFDFLRQDOHV PiV FRQVLVWHQWHV &DEUHUD &ROEHUN \ 7HUHQ]LQL
 

2WUDGLPHQVLyQVLJQLILFDWLYDHVODUHIHULGDDORVDVSHFWRVUHODFLRQDOHVGHORVDPELHQWHV
HGXFDWLYRVTXHDEDUFDQHOFRPSRQHQWHUHODFLRQDODIHFWLYRHQWUHSURIHVRUHV\DOXPQRV\
GH RWUD ORV FRPSRQHQWHV IXQFLRQDO \ RUJDQL]DWLYR GH OD DFWLYLGDG GRFHQWH &RQ
HVWLPXODUODSDUWLFLSDFLyQGHODOXPQR\ODEXHQDFRPXQLFDFLyQHQWUHSURIHVRU\DOXPQR
VH IDYRUHFH HO ELHQHVWDU SVLFROyJLFR \ GHVDUUROOR SHUVRQDO GHO HVWXGLDQWH /DV
FRPSRQHQWHVIXQFLRQDOHV\RUJDQL]DWLYDVHVWiQPiVVLJQLILFDWLYDPHQWHUHODFLRQDGDVFRQ
HO GHVDUUROOR FRJQLWLYR \ UHQGLPLHQWR GH ORV DOXPQRV \ VRQ DTXHOODV FXHVWLRQHV

78

&$3Ë78/2 (/(678',2'(/$6$&7,78'(6(1/$('8&$&,Ï1683(5,25

QRUPDWLYDV TXH HVWiQ UHODFLRQDGDV FRQ HO RUGHQ \ OD RUJDQL]DFLyQ OD FRPSHWLFLyQ
FODULGDGGHUHJODV\RULHQWDFLyQKDFLDODWDUHD &KLFNHULQJ\*UDPVRQ 

/DV LQYHVWLJDFLRQHV TXH VH KDQ UHDOL]DGR VREUH HO FOLPD VRFLDO GHO DXOD XWLOL]DQ HO
Classroom Enviroment Scale &(6  0RRV \ 7ULFNHWW   DSOLFDGD D HVWXGLDQWHV
XQLYHUVLWDULRV (VWD KHUUDPLHQWD HVWi HQIRFDGD SDUD HO DQiOLVLV GH ODV SHUFHSFLRQHV HQ
EDVH D  tWHPV HQ XQD HVFDOD GLFRWyPLFD GH YHUGDGHUR R IDOVR GLVWULEXLGDV HQ QXHYH
VXEHVFDODV RUJDQL]DGDV HQ WRUQR D WUHV GLPHQVLRQHV /D GLPHQVLyQ UHODFLRQDO TXH
FRPSUHQGHODVVXEHVFDODVGHSDUWLFLSDFLyQDILOLDFLyQ\DSR\RGHOSURIHVRUODGLPHQVLyQ
GHVDUUROOR SHUVRQDO R GH RULHQWDFLyQ KDFLD REMHWLYRV IRUPDGD SRU ODV VXEHVFDODV
RULHQWDFLyQ SDUD ODV WDUHDV \ FRPSHWLFLyQ \ OD GLPHQVLyQ PDQWHQLPLHQWRFDPELR GHO
VLVWHPDTXHFRPSUHQGHODVVXEHVFDODVRUGHQ\RUJDQL]DFLyQ FODULGDGGHQRUPDVFRQWURO
GHOSURIHVRUHLQQRYDFLyQ

6RDUHV$OPHLGD\*XLVDQGH  UHDOL]DURQXQDLQYHVWLJDFLyQHQODTXHUHODFLRQDURQ
ODVSHUFHSFLRQHVGHOFOLPDVRFLDO FRQORVUHVXOWDGRVGHDGDSWDFLyQDFDGpPLFDXWLOL]DQGR
ODHVFDOD&(6\Cuestionario de Vivencias Académicas 49$ TXHHYDO~DODDGDSWDFLyQ
DFDGpPLFD PHGLDQWH  VXEHVFDODV TXH UHFRJHQ SHUFHSFLRQHVYLYHQFLDV SHUVRQDOHV
SHUFHSFLRQHVYLYHQFLDV FXUULFXODUHV \ SHUFHSFLRQHVYLYHQFLDV LQVWLWXFLRQDOHV UHODFLRQDGDV
FRQODDGDSWDFLyQDFDGpPLFDGHORVHVWXGLDQWHV

/RVUHVXOWDGRVDOFDQ]DGRVPRVWUDURQTXHODSHUFHSFLyQGHODHVFDODUHODFLRQDOFRQVXV
FRPSDxHURV DIHFWy VLJQLILFDWLYDPHQWH D WRGDV ODV GLPHQVLRQHV GH DGDSWDFLyQ
DFDGpPLFDVUHIOHMDGDVHQHO49$(QHOPLVPRVHQWLGRODVSHUFHSFLRQHVPiVSRVLWLYDV
HQUHODFLyQDODSR\RGHOSURIHVRUVHDVRFLDURQFRQPHMRUHVUHVXOWDGRVGHORVDOXPQRVHQ
ODVVXEHVFDODVGHO49$UHODFLRQDGDVFRQODVGLPHQVLRQHVFXUULFXODUHVHLQVWLWXFLRQDOHV

(QORVUHVXOWDGRVWDPELpQPRVWUDURQGLIHUHQFLDVGHJpQHURVREUHHOFOLPDGRPLQDQWHHQ
HO DXOD \ SHUFHSFLyQ GH DSR\R VRFLDO /DV DOXPQDV PRVWUDURQ SHUFHSFLRQHV PiV
SRVLWLYDV HQ ODV VXEHVFDODV GH DSR\R DO SURIHVRU FRPSHWLFLyQ \ RUGHQ \ RUJDQL]DFLyQ
3RURWUDSDUWHODVPXMHUHVPRVWUDEDQUHVXOWDGRVPiVEDMRV HQODDGDSWDFLyQDFDGpPLFD
\PiVSRVLWLYDVHQODRUJDQL]DFLyQ\JHVWLyQGHOWLHPSR

(QVtQWHVLVORVSURFHVRVGHH[SHFWDWLYDYDORUTXHHVWiQHQODEDVHGHFRPSRUWDPLHQWR
DFWLWXGLQDO KDQ VLGR UHIOHMDGRV HQ ORV DSDUWDGRV DQWHULRUHV VHJ~Q GLVWLQWRV PRGHORV GH
LQYHVWLJDFLyQ &RQVLGHUDPRV ODV H[SHFWDWLYDV FRPR KLSyWHVLV TXH JXtDQ D ODV SHUVRQDV

79

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

HQ OD VHOHFFLyQ GH VXV DFFLRQHV HQ XQ FRQWH[WR GDGR (QWHQGHPRV TXH UHVXOWDGRV
DFFLRQHV\H[SHFWDWLYDVVRQKLSyWHVLVRUHJODVHYHQWXDOHVTXHSXHGHQTXHGDUUHSUHVHQWDGDV
SRUUD]RQDPLHQWRGHOWLSR³6L BBBBHQWRQFHVBBBBB´

/DV H[SHFWDWLYDV VRQ UHODFLRQHV HVWDEOHFLGDV HQWUH DOWHUQDWLYDV GH DFFLyQ \ UHVXOWDGRV
SUREDEOHV DQWLFLSDGRV SDUD XQD DFFLyQ SDUWLFXODU SRVLEOH HQ VLWXDFLRQHV SDUWLFXODUHV
SUHVHQWHV

/DV H[SHFWDWLYDV FRPELQDQ ORV UHTXHULPLHQWRV GH OD VLWXDFLyQ FRQ OD SHUFHSFLyQ GH OD
KDELOLGDG GHO VXMHWR SDUD SUHGHFLU HO p[LWR IUDFDVR R UHQGLPLHQWR HQ HO HPSOHR GH OD
DFFLyQ8QDVSHFWRHVSHFLDOGHODVH[SHFWDWLYDVHVODDXWRFRQILDQ]DHQODVSRVLELOLGDGHV
\ODDXWRHILFDFLD HQODHMHFXFLyQGHILQLGDFRPRODFRQYLFFLyQGHOVXMHWRHQTXHSXHGH
UHDOL]DU OD DFFLyQ UHTXHULGD SDUD XQD VLWXDFLyQ GHWHUPLQDGD %DQGXUD   /D
DXWRHILFDFLDVHHYDO~DSUHJXQWDQGRDODSHUVRQDHOJUDGRGHFRQILDQ]DTXHWLHQHDOKDFHU
XQD WDUHD GHWHUPLQDGD GHVFULWD FRQ GHWDOOH /DV SHUFHSFLRQHV GH OD SURSLD HILFDFLD
MXHJDQXQLPSRUWDQWHSDSHOJXLDQGR\GLULJLHQGRODSURSLDFRQGXFWD

$VtHQWHQGHPRVODVH[SHFWDWLYDV FRPRYDULDEOHVSHUVRQDOHVFHQWUDOHVTXHGHSHQGHQGH
HVWtPXORV FRQFUHWRV \ FRQWH[WRV SDUWLFXODUHV QR VH SXHGHQ VHSDUDU GH VX FHUFDQD
LQWHUDFFLyQ FRQ FRQGLFLRQHV VLWXDFLRQDOHV (VDV VXEMHWLYDV KLSyWHVLV VREUH ODV
FRQVHFXHQFLDV GH ORV UHVXOWDGRV \ FRPSHWHQFLDV SHUVRQDOHV SXHGHQ VHUYLU FRPR ~WLOHV
SUHGLFWRUHVGHHMHFXFLRQHVSUHVHQWHV\IXWXUDV

(QFRQFOXVLyQODVH[SHFWDWLYDVJXtDQDO VXMHWRHQODVHOHFFLyQGHODVDFFLRQHV HQWUHODV


PXFKDVTXHSXHGHQSUDFWLFDUHQXQDVLWXDFLyQFXDOTXLHUDOXHJRSDUDSURGXFLUODDFFLyQ
SDUWLFXODU HQ XQD VLWXDFLyQ GHWHUPLQDGD HV LQGLVSHQVDEOH DWHQGHU D ODV H[SHFWDWLYDV
HVSHFtILFDVGHOVXMHWRUHVSHFWRDODVFRQVHFXHQFLDVHQVXKLVWRULDSHUVRQDO TXHUHDOL]yHQ
VLWXDFLRQHVVLPLODUHVR WUDQVIHULUDRWUDVQXHYDV<HVWRHVYiOLGRWDQWRSDUDHVWXGLDQWHV
FRPRSDUDSURIHVRUHVHQHOFRQWH[WRXQLYHUVLWDULR

 &21'8&7$6 < $&7,78'(6 5(/$&,21$'$6 &21 &5((1&,$6 '(


$872(),&$&,$</2&86'(&21752/
$

8QDVSHFWRHVSHFLDOGHODVH[SHFWDWLYDVHVODDXWRHILFDFLDGHILQLGDFRPRODFRQYLFFLyQ
GHOVXMHWRHQTXHSXHGHUHDOL]DUODFRQGXFWDUHTXHULGDSDUDXQDVLWXDFLyQGHWHUPLQDGD
%DQGXUD1978 6LELHQODVSHUFHSFLRQHVGHODDXWRHILFDFLDGLULJHQODSURSLDFRQGXFWD

80
&$3Ë78/2 (/(678',2'(/$6$&7,78'(6(1/$('8&$&,Ï1683(5,25

ODVH[SHFWDWLYDVFRPRYDULDEOHVSHUVRQDOHVFHQWUDOHVGHSHQGHQGHHVWtPXORVHVSHFtILFRV
\FRQWH[WRVSDUWLFXODUHVQRVHSXHGHQVHSDUDUGHVXFHUFDQDLQWHUDFFLyQFRQFRQGLFLRQHV
VLWXDFLRQDOHV6HJ~Q%DQGXUD 2 ODDXWRHILFDFLDDWLHQGHDGRPLQLRVHVSHFtILFRV\
DVtVHHQWLHQGHODDXWRHILFDFLDDFDGpPLFDUHIHULGDDHMHFXFLRQHVDFDGpPLFDV

%DQGXUD   DGYLHUWH TXH KD\ FXDWUR IXHQWHV GH DXWRHILFDFLDTXH VRQ IXHQWHV GH
LQIOXHQFLD HQ OD FRPSHWHQFLD SHUVRQDO /D SULPHUD ODV FUHHQFLDV GH DXWRHILFDFLD
SXHGHQVHUPHMRUDGDVDWUDYpVGHORJURVSHUVRQDOHVVLHQGRDWULEXtGDVLQWHUQDPHQWH
8QD VHJXQGD IXHQWH HV OD H[SHULHQFLD YLFDULD SRU HMHPSOR FXDQGR VH WRPD FRPR
PRGHOR XQD ILJXUD UHIHUHQWH TXH SRU FRPSDUDFLyQ SXHGH PHMRUDU ODV FUHHQFLDV GH
DXWRHILFDFLD/DWHUFHUDHVODSURGXFLGDSRUODH[SHULHQFLDVLPEyOLFDDWUDYpVGHOD
SHUVXDVLyQ YHUEDO GH RWURV SRU HMHPSOR FXDQGR HO SURIHVRU FDOPD D XQD HVWXGLDQWH
GLFLpQGRTXHFRQItDHQTXHVXSHUDUiHOH[DPHQGHELGRDVXFRPSHWHQFLDDFDGpPLFD

/D ~OWLPD IXHQWH HV OD DJLWDFLyQ HPRFLRQDO TXH ODV SHUVRQDV H[SHULPHQWDQ SRU
HMHPSOR PRVWUDQGR DQVLHGDG DQWH XQD VLWXDFLyQ DPHQD]DQWH \ DQWH OD TXH VH VLHQWH
LQFDSD] GH GRPLQDU OD VLWXDFLyQ 3RU WDQWR DOJXQDV GH HVWDV IXHQWHV GH LQIOXHQFLDV
TXHHVWiQSUHVHQWHVHQODIRUPDFLyQGHH[SHFWDWLYDVGHDXWRHILFDFLDVHSURGXFHQ HQ
XQFRQWH[WRDFDGpPLFRGHLQWHUDFFLyQVRFLDO\VHUHODFLRQDQFRQODH[SUHVLyQGHODV
DFWLWXGHV

$Vt'XUQGHOO\+DDJ  HQFRQWUDURQTXHORVHVWXGLDQWHVSRVHHQXQDDXWRHILFDFLDHQ


HO PDQHMR GH ORV RUGHQDGRUHV PiV HOHYDGD TXH OD GH VXV FRPSDxHUDV DGHPiV GH XQD
PHQRUDQVLHGDG\DFWLWXGHVPiVIDYRUDEOHVKDFLDORVRUGHQDGRUHV(QHOPLVPRVHQWLGR
RWUDV LQYHVWLJDFLRQHV KDQ FRQVWDWDGR TXH OD YDULDEOH JpQHUR WLHQH LQIOXHQFLD VREUH OD
DXWRHILFDFLDDFDGpPLFDHQHVWXGLDQWHVXQLYHUVLWDULRVTXHDVXYH]WLHQHHIHFWRVVREUHODV
H[SHFWDWLYDVGHUHVXOWDGR

'HPDQHUDTXHODVH[SHFWDWLYDVJXtDQDODOXPQRHQODVHOHFFLyQGHODVFRQGXFWDVHQWUH
ODVPXFKDVTXHSXHGHQSUDFWLFDUHQXQDVLWXDFLyQDFDGpPLFDGLYHUVD\SRUWDQWRSDUD
SURGXFLUODFRQGXFWDSDUWLFXODUHQXQDVLWXDFLyQGHWHUPLQDGDHVLQGLVSHQVDEOHDWHQGHUD
ODV H[SHFWDWLYDV HVSHFtILFDV GHO DOXPQR UHVSHFWR D ODV FRQVHFXHQFLDV GH ODV GLYHUVDV
FRQGXFWDVTXHSXHGHSUDFWLFDUHQXQDVLWXDFLyQDFDGpPLFDGLYHUVD

/D LQIOXHQFLD GH ODV H[SHFWDWLYDV VREUH OD FRQGXFWD GHSHQGH GH IDFWRUHV ELRJUiILFRV \
VLWXDFLRQDOHV8QSULPHUFRQGLFLRQDQWHGHODFRQGXFWDVRQODVH[SHULHQFLDVSUHYLDVTXH

81

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

WHQJDHOVXMHWRHQVLWXDFLRQHVSDUHFLGDVDXQTXHUHVXOWHQPRGXODGDVSRUODLQIRUPDFLyQ
DGLFLRQDO TXH SURSRUFLRQD OD VLWXDFLyQ FRQFUHWD HQ TXH WLHQH OXJDU OD FRQGXFWD TXH
JHQHUD H[SHFWDWLYDV HVSHFtILFDV GH OD VLWXDFLyQ &XDQGR OD VLWXDFLyQ HV DOWDPHQWH
HVSHFtILFD R LQIUHFXHQWH OD FRQGXFWD YHQGUi GHWHUPLQDGD HQ PD\RU PHGLGD SRU ODV
H[SHFWDWLYDVHVSHFtILFDVHVWUHFKDPHQWHYLQFXODGDVDWDOVLWXDFLyQ

(O VHJXQGR FRQGLFLRQDQWH DOXGH D ODV UHODFLRQHV HVWtPXORVFRQVHFXHQFLDV D SDUWLU


GHOFRQMXQWRHVWLPXODUTXHFRQILJXUDODVLWXDFLyQODFRQGXFWDHVPRGXODGDSRUODV
SRVLEOHV FRQVHFXHQFLDV \ IHQyPHQRV TXH VHxDODQ GHWHUPLQDGRV HVWtPXORV
HVSHFtILFDPHQWH VLJQLILFDWLYRV SUHVHQWHV HQ OD VLWXDFLyQ /RV UHVXOWDGRV HVSHUDGRV
GHSHQGHQ GH PXOWLWXG GH FRQGLFLRQHV HVWLPXODGRUDV FRPR ODV FRQVHFXHQFLDV
HVSHUDGDVGHODVFRQGXFWDVVRFLDOHVGHORVGHPiVHQFRQWH[WRVSDUWLFXODUHV(OVXMHWR
DQWLFLSD ORV DFRQWHFLPLHQWRV TXH VHxDODQ WDOHV HVWtPXORV FX\R YDORU SUHGLFWLYR
GHSHQGH EiVLFDPHQWH GH OD SDUWLFXODU KLVWRULD GH DSUHQGL]DMH GHO LQGLYLGXR \ GHO
VLJQLILFDGRTXHpVWHOHRWRUJD

/RV FRQVWUXFWRV ORFXV GH FRQWURO \ DXWRHILFDFLD KDQ VLGR HVWXGLDGRV FRPR SUHGLFWRUHV
GHOUHQGLPLHQWRGHORVHVWXGLDQWHVXQLYHUVLWDULRV(OORFXVGHFRQWUROHVXQFRQMXQWRGH
FUHHQFLDVRH[SHFWDWLYDVJHQHUDOL]DGDVGHXQVXMHWRVREUHHOPRGRHQTXHVXVFRQGXFWDV
\ ORV UHVXOWDGRV GH ODV PLVPDV HVWiQ LQWHUUHODFLRQDGRV SRU ODV IXHU]DV TXH
FRQVLGHUDUHVSRQVDEOHVGHORTXHVXFHGHVLHQGRODDWULEXFLyQGHRULJHQLQWHUQRRH[WHUQR

'HVGH VX FRQFHSFLyQ RULJLQDO HO FRQVWUXFWR GH ORFXV GH FRQWURO KD SDVDGR SRU XQ
SURFHVR GH HYROXFLyQ WHyULFD VLHQGR FRQVLGHUDGR XQ  FRQVWUXFWR FRQFHELGR
RULJLQDOPHQWH HQ XQD HVFDOD ELGLPHQVLRQDO HQWUH H[WHUQDOLGDG FRQWUD LQWHUQDOLGDG SDUD
SRVWHULRUPHQWH HQWHQGHUVH HQ WpUPLQRV PXOWLGLPHQVLRQDOHV \ TXHGDU VXEGLYLGLGD OD
GLPHQVLyQH[WHUQDHQGRVVXEGLPHQVLRQHVDVDEHUVXHUWH\SHUVRQDVFRQSRGHU

'HQWURGHHVWDHYROXFLyQHOFRQVWUXFWRWRPDXQFDUiFWHUGLQiPLFRTXHSXHGHFDPELDU
HQHOPLVPRLQGLYLGXRVHJ~QHOFRQWH[WRRVLWXDFLyQ(VWDYHUVDWLOLGDGGHOFRQFHSWRKD
GDGR SLH DO GLVHxR GH XQ FRQMXQWR GH LQYHVWLJDFLRQHV HQ GLYHUVRV iPELWRV VLHQGR HO
UHQGLPLHQWRHVWXGLDQWLOHQODHGXFDFLyQXQLYHUVLWDULDXQRGHHOORV

82
&$3Ë78/2 (/(678',2'(/$6$&7,78'(6(1/$('8&$&,Ï1683(5,25

3RUVXSDUWH9LVGyPH/R]DQR\/XFLDQR   HQVXUHYLVLyQWHyULFDGHOFRQVWUXFWR


VHxDODQ TXH HO ORFXV GH FRQWURO HQ VX HYROXFLyQ KD SDVDGR D VHU DVRFLDGR \ HQ
RFDVLRQHVYLVWRFRPRXQVXEFRPSRQHQWHGHXQDDPSOLDJDPDGHFRQFHSWRV\WHRUtDVGH
OD FRQGXFWD 'H KHFKR HVWRV DXWRUHV KDEODQ GH XQD ³IDPLOLD´ GH WHRUtDV DVRFLDGDV DO
ORFXVGHFRQWUROHQWUHODVFXDOHVHVWiQODDXWRUUHJXODFLyQODDXWRHILFDFLDWHRUtDVGHOD
H[SHFWDWLYDYDORU\ODWHRUtDGHODVDWULEXFLRQHVFDXVDOHV4XLHQHVLQYHVWLJDQHQHOiUHD
KDQSURSXHVWRTXHHOORFXVGHFRQWUROQRHVXQDYDULDEOHRFDUDFWHUtVWLFDILMDVLQRTXH
SRGUtD HVWDU LQIOXHQFLDGD SRU YDULDEOHV FRQWH[WXDOHV R VLWXDFLRQDOHV HV GHFLU WLHQH XQ
FDUiFWHUGLQiPLFR %DQGXUD 

&DEHGHVWDFDUORVHVWXGLRVTXHHVWDEOHFHQXQDUHODFLyQLQGLUHFWDHQODTXHVHDQDOL]DHO
HIHFWRGHOORFXVGHFRQWUROVREUHRWUDYDULDEOHRJUXSRGHYDULDEOHV\DVHDXQFRQVWUXFWR
DFWLWXGLQDO R FRQGXFWDV HVSHFtILFDV TXH D VX YH] LQFLGHQ VREUH HO UHQGLPLHQWR
DFDGpPLFR (Q HVWH JUXSR VH HQFXHQWUDQ ORV DXWRUHV %RGLOO \ 5REHUWV   *DUFtD
5RV\3pUH]*RQ]iOH]  +VLHK\'Z\HU  ,úLN  \.UHQQHWDO  

*DUFtD5RV \ 3pUH]*RQ]iOH]   HVWXGLDURQ HO HIHFWR GH YDULDV GLIHUHQFLDV


LQGLYLGXDOHVVREUHODVSUHIHUHQFLDVSRUHVWUDWHJLDVGHHYDOXDFLyQGHHVWXGLDQWHV
GHHGXFDFLyQGHOD8QLYHUVLGDGGH9DOHQFLD(VSDxD(QHVWHFDVRHOVXSXHVWRGHOD

UHODFLyQ LQGLUHFWD HVWDEOHFH TXH DO H[LVWLU FRQVLVWHQFLD HQWUH ODV SUHIHUHQFLDV SRU
FLHUWDV HVWUDWHJLDV GH HYDOXDFLyQ R SHGDJyJLFDV GHO HVWXGLDQWDGR \ ODV SUiFWLFDV
LPSOHPHQWDGDV HQ HO HQWRUQR HGXFDWLYR VH SXHGH IDYRUHFHU HO DSUHQGL]DMH \
SRWHQFLDU HO UHQGLPLHQWR DFDGpPLFR $ VX YH] ORV DXWRUHV SURSRQHQ TXH YDULDEOHV
FRPRORVHVWLORVGHDSUHQGL]DMHHOQLYHODFDGpPLFR GHUHFLHQWHLQJUHVRSUy[LPRVD
ILQDOL]DU \ODVRULHQWDFLRQHVPRWLYDFLRQDOHVGHODOXPQDGRSXHGHQLQFLGLUVREUHVXV
SUHIHUHQFLDV SRU PpWRGRV HYDOXDWLYRV FRQYHQFLRQDOHV H[iPHQHV \ WDUHDV HYDOXDGDV
SRU HO SURIHVRU  R SRU PpWRGRV HYDOXDWLYRV QR FRQYHQFLRQDOHV SRUWDIROLRV
HYDOXDFLRQHV KHXUtVWLFDV HWF  (Q HVWH HVWXGLR HO ORFXV GH FRQWURO IXH FRQWHPSODGR
FRPRXQDGLPHQVLyQGHODVRULHQWDFLRQHVPRWLYDFLRQDOHVGHORVSDUWLFLSDQWHV

(QWUH ODV YDULDEOHV FRQ HIHFWR VREUH HO ORFXV GH FRQWURO VH HQFXHQWUD VH[R iUHD GH
HVWXGLR DxRV GH HVWXGLR JUXSR pWQLFR \ WHRUtDV LPSOtFLWDV GH LQWHOLJHQFLD (O VH[R HV
XQDGHODVYDULDEOHVFX\RHIHFWRVREUHORFXVGHFRQWUROHVIUHFXHQWHPHQWHHVWXGLDGRXQD
UHODFLyQ TXH VH FRQVLGHUy HQ FXDWUR GH ODV LQYHVWLJDFLRQHV (Q ORVWUHVHVWXGLRVTXH

83

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

FLWDPRVDFRQWLQXDFLyQVHHQFRQWUDURQGLIHUHQFLDVVLJQLILFDWLYDVHQWUHHOORFXVGHFRQWURO
GH KRPEUHV \ PXMHUHV SHUR ORV UHVXOWDGRV GLILHUHQ (Q HO HVWXGLR GH +DLGHU \ 1DHHP
  ORV KRPEUHV WHQtDQ PiV IUHFXHQWHPHQWH XQ ORFXV GH FRQWURO LQWHUQR PLHQWUDV
TXH HQ ODV PXMHUHV HO ORFXV GH FRQWURO WLHQGH D VHU H[WHUQR 6LPLODUPHQWH HQ
*KDVHP]DGHK\6DDGDW  VHHQFRQWUyTXHODVPXMHUHVWHQtDQSXQWDMHVPiVDOWRVHQ
ODGLPHQVLyQGHH[WHUQDOLGDGGHODHVFDODHQFRPSDUDFLyQDORVKRPEUHV3RURWUDSDUWH
0NXPER\$PDQL   HQFRQWUDURQORFRQWUDULRHQVXFRQWH[WRODVPXMHUHVWHQGtDQ
PiVDODLQWHUQDOLGDG\ORVKRPEUHVDODH[WHUQDOLGDG3RU~OWLPRHQHOHVWXGLRGH%RGLOO
\5REHUWV  QRKXERFRUUHODFLyQVLJQLILFDWLYDHQWUHVH[R\ORFXVGHFRQWURO

'H ORV HVWXGLRV LQWHUQDFLRQDOHV VH FRQILUPD OD WHQGHQFLD GH XQD UHODFLyQ SUHGLFWLYD
HQWUH ORFXV GH FRQWURO \ UHQGLPLHQWR DFDGpPLFR GH PDQHUD GLUHFWD ORFXV GH FRQWURO
LQWHUQR FRPR SUHGLFWRU GH p[LWR \ ORFXV GH FRQWURO H[WHUQR FRPR SUHGLFWRU GH EDMR
UHQGLPLHQWR  'H PDQHUD LQGLUHFWD HO ORFXV GH FRQWURO IXH SUHGLFWLYR GHO HVIXHU]R
DFDGpPLFR OD SUHIHUHQFLD SRU PpWRGRV HYDOXDWLYRV FRQYHQFLRQDOHV ODV H[SHFWDWLYDV
YRFDFLRQDOHV GH UHVXOWDGRV \ FRQ HO FRQMXQWR GH DXWRHVWLPD DXWRHILFDFLD JHQHUDO \
HVWDELOLGDGHPRFLRQDOWRGDVYDULDEOHVTXHDVXYH]SRGUtDQLQFLGLUSRVLWLYDPHQWHVREUH
HOUHQGLPLHQWRDFDGpPLFR6LQHPEDUJRQRVHHQFRQWUyUHODFLyQHQWUHORFXVGHFRQWURO \
GHVHPSHxR GH SUXHEDV GH FRPSUHQVLyQ OHFWRUD QL WDPSRFR FRQ OD PDQHUD HQ TXH HO
HVWXGLDQWDGR SURFHVD \ UHDFFLRQD D GLIHUHQWHV WLSRV GH UHWURDOLPHQWDFLyQ GH VX
GHVHPSHxR

84
/$(9$/8$&,Ï1'(/ Capítulo 4
$35(1',=$-(
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

,1752'8&&,Ï1

'DGDODPXOWLSOLFLGDGGHIDFWRUHVTXHLQFLGHQHQODDFFLyQHGXFDWLYD\ODFRPSOHMLGDGGH
ODVHVWUDWHJLDVGHHYDOXDFLyQTXHSXHGHQVHUXWLOL]DGDVSDUDGLVSRQHUGHXQDLQIRUPDFLyQ
JOREDO GHO HVWXGLDQWH FRQRFHU FDGD XQD GH ODV YDULDEOHV TXH LQWHUYLHQHQ HQ VX
SUHSDUDFLyQHVXQDWDUHDTXHVRORSXHGHVHUDIURQWDGDSRUXQHTXLSRPXOWLGLVFLSOLQDU

/D LQYHVWLJDFLyQ HQ 3VLFRORJtD 6RFLDO SRVHH XQD ODUJD WUDGLFLyQ HQ HO HVWXGLR GH OD
LQIOXHQFLD GH YDULDEOHV SVLFRVRFLDOHV HQ HO UHQGLPLHQWR DFDGpPLFR \ VDEHPRV TXH ORV
GLVWLQWRVHOHPHQWRVTXHLQWHUYLHQHQHQODDFFLyQGHORVHVWXGLDQWHVHVWiQHVWUHFKDPHQWH
UHODFLRQDGRVHQWUHVtHVGHFLUQRSRGHPRVFRQVLGHUDUDOVXMHWRGHODSUiFWLFDHGXFDWLYD
FRPRXQHQWHDLVODGRQLVXVDFFLRQHVFRPRVLPSOHVDVRFLDFLRQHVGHJHVWRVDFDGpPLFRV
DVt SXHV VH WUDWD GH XQ FDPSR GH DFFLyQ FRPSOHMR GHOLPLWDGR SRU XQ FRQMXQWR GH
 IDFWRUHV LQWHUGHSHQGLHQWHV TXH FRQVWLWX\HQ \ IRUPDQ SDUWH GH ODV DFFLRQHV TXH ORV
HVWXGLDQWHV OOHYDQ D FDER SRU OR TXH GHEHPRV FRQRFHU ODV YDULDEOHV TXH HVWiQ
UHODFLRQDGDV HQWUH Vt SDUD H[SOLFDU SRU TXp HQ XQ PRPHQWR SUHFLVR ORV HVWXGLDQWHV
UHDOL]DQFRQPD\RURPHQRUHILFDFLDVXDFWLYLGDGHGXFDWLYD

/DFDXVDGHXQDGHWHUPLQDGDDFFLyQHVWiHQODUHODFLyQTXHVHSURGXFHHQWUHODDFFLyQGH
XQRUJDQLVPR\ODLQIOXHQFLDGHOFRQWH[WRGRQGHVHOOHYDDFDER&DGDDFFLyQHGXFDWLYD
TXHGD GHILQLGD FXDQGR VH LGHQWLILFDQ ORV HOHPHQWRV DQWHFHGHQWHV \ FRQVHFXHQWHV SHUR
HVWRV QR SXHGHQ H[SOLFDU SRU Vt PLVPRV OD JOREDOLGDG GH GLFKD DFFLyQ SRU OR TXH
WDPELpQKDEUiTXHFRQVLGHUDUODDXWRELRJUDItDSHUVRQDOH[SHFWDWLYDVFDUDFWHUtVWLFDVGH
ODVFLUFXQVWDQFLDVItVLFDV\VRFLDOHV\ODVYDULDEOHV WHPSRUDOHVRSHUPDQHQWHVSURSLDVGHO
VXMHWR

/RV UDVJRV GLVWLQWLYRV GH OD DFWLYLGDG DFDGpPLFD KDFHQ UHIHUHQFLD D XQ VXMHWR DJHQWH
SUHVHQFLD GH UHSUHVHQWDFLRQHV \ SURFHVRV GH HODERUDFLyQ RULHQWDFLyQ KDFLD XQD PHWD
LQWHQFLRQDO R LQFLGHQWDO  QHFHVLGDG GH RUJDQL]DFLyQ HVWUDWHJLDV \ WiFWLFDV  QLYHO GH
KDELOLGDG WpFQLFD GHO VXMHWR DWHQFLRQDO R DXWRPiWLFR  FRQFLHQFLD GH GLFKDV YDULDEOHV
FRQVFLHQWHRVLQFRQFLHQFLD \WRPDGHGHFLVLyQDGHFXDGD H[SOtFLWDRLPSOtFLWD 

(Q OD DFWLYLGDG DFDGpPLFD ORV H[SHUWRV VH UHILHUHQ D ODV GLIHUHQFLDV REVHUYDGDV HQ ORV
HVWXGLDQWHVUHVSHFWRDODVWHQGHQFLDVGHDFFLyQVHxDODQGRODH[LVWHQFLD GH VXMHWRVFRQ
SUHGLVSRVLFLyQ KDFLD DFFLRQHV GH DWDTXH IUHQWH D RWURV TXH WLHQGHQ D DGRSWDU DFFLRQHV
GHIHQVLYDV (VWDV WHQGHQFLDV VRQ ORV GHQRPLQDGRV estilos académicos \ GHVGH HVWD

87

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

SHUVSHFWLYD UHVXOWD LQWHUHVDQWH HVWXGLDU OD H[LVWHQFLD GH UHODFLRQHV HQWUH GLPHQVLRQHV
SHUVRQDOHV TXH SHUPLWDQ SUHGHFLU ODV WHQGHQFLDV GH ORV HVWXGLDQWHV SRVLELOLWDQGR DO
SURIHVRUSODQLILFDUORVDSUHQGL]DMHV GHIRUPDHVSHFtILFDHQFDGDFDVRFRQORTXHSRGUtDQ
SRWHQFLDUVH ODV WHQGHQFLDV QDWXUDOHV GH XQ VXMHWR FRQ HO ILQ GH DSURYHFKDU WDOHV
GLVSRVLFLRQHVHQEHQHILFLRGHVXUHQGLPLHQWRDXQTXHSDUDHOORVHDQHFHVDULRVHOHFFLRQDU
XQ FRQVWUXFWR SHUVRQDO TXH SXHGD H[SOLFDU \ SUHGHFLU ODV WHQGHQFLDV FDUDFWHUtVWLFDV GH
FDGDHVWXGLDQWH

+HFKDV HVWDV DFODUDFLRQHV \ WHQLHQGR HQ FXHQWD ODV OLPLWDFLRQHV GH OD SUHVHQWH
LQYHVWLJDFLyQ SUHVHQWDPRV ODV HVWUDWHJLDV GH HYDOXDFLyQ TXH VH KDQ GHVDUUROODGR SDUD
GLDJQRVWLFDU ODV$FWLWXGHV KDFLD OD (QVHxDQ]D 8QLYHUVLWDULD GHVGH P~OWLSOHV SXQWRV GH
YLVWD \ SODQWHDPLHQWRV QR VLHPSUH FRLQFLGHQWHV LQFLGLHQGR HVSHFLDOPHQWH HQ ODV
HVWUDWHJLDV GH DSUHQGL]DMH QHFHVDULDV SDUD HO GHVDUUROOR GH KDELOLGDGHV \ GHVWUH]DV
HGXFDWLYDVORVLQVWUXPHQWRVPiVGHVWDFDGRVTXHVHHVWiQXWLOL]DQGRSDUDILQDOL]DUFRQ
XQD SURSXHVWD GH OD DGDSWDFLyQ GHO FXHVWLRQDULR GH HYDOXDFLyQ \ GLDJQyVWLFR GH ODV
HVWUDWHJLDVFRJQLWLYDV\VRFLRDIHFWLYDVREMHWRGHHVWD7HVLV'RFWRUDO

 /$(9$/8$&,Ï1(136,&2/2*Ë$62&,$/

/DHYDOXDFLyQSVLFRVRFLDOLPSOLFDXQSURFHVRGHWRPDGHGHFLVLRQHVTXHLQFOX\HYDULDV
WDUHDVRSHUDFLRQHV\DFFLRQHVTXHUHTXLHUHQGHXQFRQRFLPLHQWRSVLFRVRFLDOSURIXQGR\
GH XQDV EXHQDV KDELOLGDGHV SURIHVLRQDOHV SDUD SRGHU UHVSRQGHU D ODV GHPDQGDV GH OD
VLWXDFLyQ R GH ODV SHUVRQDV (VWH SURFHVR SXHGH DO PHQRV KDVWD FLHUWR SXQWR VHU
HVWDQGDUL]DGR\JXLDGRSRUXQFXHUSRGHSDVRVEiVLFRVHVWDEOHFLGRV\DFHSWDGRVSRUOD
FRPXQLGDGFLHQWtILFD\SURIHVLRQDO

/D HYDOXDFLyQ HVWD HQ HO RULJHQ PLVPR GH ODV &LHQFLDV 6RFLDOHV WUDGLFLRQDOPHQWH OD
SLVFRORJtD FRQFHEtD OD HYDOXDFLyQ FRPR XQ FRQMXQWR GH UHJODV SDUD PHGLU UDVJRV
SVLFROyJLFRV 1XQQDOO\    (Q HO FDPSR GH OD SVLFRORJtD VRFLDO FRPHQ]y FRQ OD
HODERUDFLyQde OD HVFDOD GH DXWRULWDULVPR $GRUQR   IRUPDGDV SRU XQ FRQMXQWR GH
UDVJRV TXH LQGLFDQ XQ PRGR GH UHDFFLRQDU DQWH ORV GHPiV 3RVWHULRUPHQWH VXUJLHURQ
HVWXGLRVTXHVHJXtDQHOHQIRTXHFOiVLFRGHLQYHQWDULRVGHODSHUVRQDOLGDGSDUDHVWXGLDU
FXHVWLRQHVFRPRHOGRJPDWLVPR PHGLDQWHHVFDODVUHYHODGRUDVGHODSHUVRQDOLGDGHQODV TXH
VH SHGtD DO VXMHWR TXH GHVFULELHUD VX SURSLD FRQGXFWD VHJ~Q OD FRQFRUGDQFLD R
GLVFUHSDQFLD UHVSHFWR D XQ FRQMXQWR GH SURSRVLFLRQHV 0iV UHFLHQWHPHQWH FRQ HO

88
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

GHVDUUROOR GH ORV PpWRGRV GH HYDOXDFLyQ VH KDQ HPSOHDGR HVFDODV SDUD PHGLU OD
SHUFHSFLyQGHORVRWURVDILQGHFRPSDUDUODVGLIHUHQFLDVLQGLYLGXDOHV

'H PDQHUD TXH SDXODWLQDPHQWH VH KD SURGXFLGR XQ FDPSR GH FRQYHUJHQFLD HQWUH OD
GLVWLQWDVGLVFLSOLQDVFRPR3VLFRORJtD3HGDJRJtD\OD3VLFRORJtD6RFLDOHQWUHRWUDVHQHO
HVWXGLR GH ORV SURFHVRV GH GLDJQyVWLFR HYDOXDFLyQ \ YDORUDFLyQ PHGLDQWH GLVWLQWDV
PHWRGRORJtDV REVHUYDFLyQWDUHDVH[SHULPHQWDOHVGHODERUDWRULRHWF 

$FWXDOPHQWH ODV GLVWLQWDV GLVFLSOLQDV HVWiQ DPSOLDQGR HO REMHWR GH OD HYDOXDFLyQ D
FRQWH[WRV SURJUDPDV H LQWHUYHQFLRQHV 7DO HV HO FDVR GH OD HYDOXDFLyQ SVLFROyJLFD DO
DGRSWDU XQD YLVyQ PiV DELHUWD H LQWHJUDGRUD FX\R REMHWLYR FRQVLVWH HQ DQDOL]DU HO
SURFHVR GH GLDJQyVWLFR PHGLGDV GH SUHYHQFLyQ RULHQWDFLyQ \ FRQVHMR DQiOLVLV GH OD
HILFDFLD GH OD PHGLGDV GH DFWXDFLyQ \ FRPXQLFDFLyQ GH OD LQIRUPDFLyQ GLDJQyVWLFD
REWHQLGD\GHWUDWDPLHQWRDODSHUVRQDRLQVWLWXFLyQTXHKD\DVROLFLWDGRHODVHVRUDPLHQWR

)RUQV$EDG$PDGRU.LFKQHU\5RLJ 

6LJXLHQGR D ,]TXLHUGR   ODV FDUDFWHUtVWLFDV GH OD HYDOXDFLyQ VH FRQFUHWD HQ WUHV
DVSHFWRV

 (OSURFHVRGHHYDOXDFLyQLPSOLFDXQSURFHVRGHtoma de decisiones

"… El juicio resultante (del proceso de evaluación) se utiliza para tomar decisiones.
Decisiones destinadas a solucionar problemas prácticos importantes". 0DORQH\ \
:DUG 

 (OSURFHVRGHHYDOXDFLyQLPSOLFDsolución de problemas

«/DHYDOXDFLyQSVLFRVRFLDOHVXQSURFHVRPHGLDQWHHOTXHVHUHVSRQGHQSUHJXQWDV\
VHVROXFLRQDQSUREOHPDV 0DORQH\\:DUG 

 (OSURFHVRGHHYDOXDFLyQUHTXLHUHODgeneración y comprobación de hipótesis

"… Consiste en las hipótesis que el científico aplicado piensa que mejor explican los
datos de que dispone, hipótesis que, si se posee el tiempo suficiente y los medios
adecuados, serían las primeras en comprobarse" (6KDSLUR 

'HDFXHUGRFRQ%HUPDQ 9 ORVSDVRVEiVLFRVGHOSURFHVRGHHYDOXDFLyQVHRULHQWDQ


KDFLDHODQiOLVLVGHOFDVRRVLWXDFLyQODRUJDQL]DFLyQHLQIRUPDFLyQGHORVUHVXOWDGRVOD
SODQLILFDFLyQ GH OD LQWHUYHQFLyQ OD YDORUDFLyQ \ HO VHJXLPLHQWR \ FDGD X Q D G H HVWDV

89

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

IDVHV SRVHH XQ Q~PHUR GLVWLQWR GH SDVRV \ VH HQFXHQWUD RUJDQL]DGD UDFLRQDO \
VHFXHQFLDOPHQWH

(Q HO FDVR GH OD SUHVHQWH LQYHVWLJDFLyQ TXHGD MXVWLILFDGD OD HODERUDFLyQ GH XQ
LQVWUXPHQWR GH HYDOXDFLyQ \ GLDJQyVWLFR TXH UHVSHWH ODV FDUDFWHUtVWLFDV \ ORV SDVRV
DQWHULRUHVFRQEDVHHQODVUHFRPHQGDFLRQHVGH3HOHFKDQR  FLWDGRSRU,]TXLHUGR
S 

'esde aquí animamos a los investigadores españoles a que generen sus propios
instrumentos; y por otro lado, a la búsqueda de tradiciones de pensamientos más
propia de nuestra tradición teórica y cultural con el fin de ofrecer una Psicología
Social mejor y de mejor aplicación para resolver problemas que existen en nuestro
entorno físico y social. Esta especificación no quiere decir que sea de menor
calidad ni con menores garantías metodológicas que las que se utilizan en otros
entornos. Lo que pide es que sean relevantes y con la misma calidad metodológica
posible. Cuando hemos puesto en práctica estas ideas los resultados han sido
mejores con instrumentos generados desde nuestro propio contexto que con otros
importados. Y pensamos que los usuarios tienen derecho a recibir los mejores
servicios posibles”.

(VWDVFRQVLGHUDFLRQHVSUHYLDVGHEHUtDQPDUFDUODVSDXWDVGHODHYDOXDFLyQHQ3VLFRORJtD
6RFLDOVLORTXHVHSUHWHQGHKDFHUHVXQWUDEDMRULJXURVRDFRUGHFRQODVLQYHVWLJDFLRQHV
TXH DFWXDOPHQWH VH HVWiQ OOHYDQGR D FDER SRU SDUWH GH OD European Assosiation of
Psychological Assessment ($3$  SDUD TXH OD PXOWLGLVFLSOLQDULHGDG ELHQ HQWHQGLGD
HPSLHFHSULPHURHQWUHODVGLIHUHQWHViUHDVGHOD3VLFRORJtD6RFLDO\GHVSXpVHQWUHODV
GLIHUHQWHV&LHQFLDVGHOD(GXFDFLyQ

 (9$/8$&,Ï1(1('8&$&,Ï1

(O SURSLR FRQFHSWR GH HYDOXDFLyQ WDO \ FRPR DSXQWD ,]TXLHUGR   UHVXOWD
LQFXHVWLRQDEOHHQODDFWXDOLGDG\VXDGHFXDGDUHDOL]DFLyQDSRUWDJDUDQWtD\REMHWLYLGDG
DO SURIHVLRQDO SHUR WDPELpQ KD VLGR REMHWR GH FUtWLFDV SRU HO XVR H[FHVLYR GH
LQVWUXPHQWRVTXHQRVLHPSUHVHKDYLVWRHQFRUUHVSRQGHQFLDFRQHODGHFXDGRGHVDUUROOR
FRQFHSWXDO\PHWRGROyJLFR

90
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

'HKHFKRH[LVWHQGLVWLQWDVOtQHDVGHLQYHVWLJDFLyQSDUDFRQRFHUODVDFWLWXGHVH[SUHVDGDV
DWUDYpVGHH[SHFWDWLYDVH[SHULHQFLDVSHUFLELGDV\QHFHVLGDGHVH[SUHVDGDVTXHSHUPLWHQ
DYDQ]DU R UHWURFHGHU HQ ORV UHVXOWDGRV REWHQLGRV SRU HO HVWXGLDQWH HQ VX GLPHQVLyQ
SHUVRQDO FXUULFXODU H LQVWLWXFLRQDO D SDUWLU GH VXV SURSLDV H[SHULHQFLDV 1R REVWDQWH \
VLHPSUH TXH VH GHQ ODV JDUDQWtDV PHWRGROyJLFDV WDO \ FyPR KHPRV YLVWR HQ FDStWXORV
DQWHULRUHV KD\ XQD WHQGHQFLD D FRPELQDU  LQYHQWDULRV GH GLVWLQWR WLSR DSOLFDGRV VREUH
ORVPLVPRVVXMHWRVFRQHOREMHWLYRGHDOFDQ]DUPD\RUSURIXQGLGDGH[SOLFDWLYD

'HVDUUROORGHODHYDOXDFLyQHQHGXFDFLyQ

/D LQYHVWLJDFLyQ HQ 3VLFRORJtD 6RFLDO KD HVWDGR LQWHUHVDGD GHVGH VXV RUtJHQHV HQ ODV
YDULDEOHV TXH LQIOX\HQ \ FRQGLFLRQDQ OD DFFLyQ KXPDQD \ HQ HVWH VHQWLGR KDQ VLGR
QXPHURVRVORVFRQVWUXFWRVLGHQWLILFDGRVFRPRGHWHUPLQDQWHVGHODHMHFXFLyQGHODEXHQD
FDOLGDG HGXFDWLYD HQ WpUPLQRV GH HVIXHU]RV FRJQLWLYRV SDUWLFLSDFLyQ HQ HO SURFHVR GH

DSUHQGL]DMH\UHQGLPLHQWRDFDGpPLFR

/RVWHyULFRVHLQYHVWLJDGRUHVFUHHQTXHGHWHUPLQDGDVKDELOLGDGHVSVLFRVRFLDOHVSXHGHQ
IRUPDUSDUWHGHODSUHQGL]DMHFRPRDSXQWDQ2UWL]6DOPHUyQ\5RGUtJXH] S VL
ELHQ HQ XQ SULQFLSLR  VX SXHVWD HQ PDUFKD HV FRQWURODGD DO KDFHUVH HO HVWXGLDQWH
H[SHUWRHQVXXVRHVWDVVHDXWRPDWL]DQSHUPLWLHQGRPHMRUDUVXFDSDFLGDGHVWUDWpJLFDDO
VHUFDSD]GHPRYLOL]DUKDELOLGDGHV\UHFXUVRVFRJQLWLYRVFRQIDFLOLGDG\GHVWUH]D!!

(Q EDVH D OD LPSRUWDQFLD GH ODV YDULDEOHV SVLFRVRFLDOHV HQ ORVSURFHVRV GH IRUPDFLyQ
DSUHQGL]DMHODSVLFRORJtDVRFLDOKDGHVDUUROODGRPRGHORVEDVDGRVHQODLGHQWLILFDFLyQ
HYDOXDFLyQ H LQWHUYHQFLyQ GH FDUDFWHUtVWLFDV \ KDELOLGDGHV R IDFWRUHV SVLFRVRFLDOHV
UHODFLRQDGRV FRQ HO UHQGLPLHQWR DFDGpPLFR MXQWR D OD QHFHVLGDG GH FRQVWUXLU \
GHVDUUROODUKHUUDPLHQWDVYiOLGDV\ILDEOHVTXHSHUPLWDQWUDEDMDUGHIRUPDRUGHQDGDFODUD
\VLVWHPiWLFD

/RVDUJXPHQWRVKDVWDDTXtH[SXHVWRVMXVWLILFDQFRQYHQLHQWHPHQWHHOHPSOHRGHOWpUPLQR
evaluación psicosocial en educación TXHGDQGR HVWDEOHFLGD OD QHFHVLGDG GH DPSOLDU HO
REMHWR GH HVWXGLR DEDUFDQGR FRQWH[WRV HVSHFtILFRV HYDOXDFLyQ GHO DPELHQWH 
WUDWDPLHQWRVHLQWHUYHQFLRQHV HYDOXDFLyQGHSURJUDPDV 

3RUWDQWRODHYDOXDFLyQWLHQHTXHGHILQLU GHIRUPDFODUDFRQFLVD\RSHUDWLYDDTXHOORTXH
VHGHVHDHYDOXDU(QODDFWXDOLGDGODHYDOXDFLyQHQ3VLFRVRFLRORJtDKDFHUHIHUHQFLDDXQ
FRQFHSWR TXH HQJORED OD DSOLFDFLyQ GH WHVWV \ HO GLDJQyVWLFR FRUUHVSRQGLHQWH VL ELHQ

91

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

DPERVFRQFHSWRVKDQSDVDGRDIRUPDUSDUWHGHREMHWLYRVGHHYDOXDFLyQPiVDPSOLRVH
LQWHJUDGRV FRQ HO HQWRUQR HGXFDWLYR H LQVWLWXFLRQDO /D DSOLFDFLyQ GH WHVWV FRQVWLWX\H
~QLFDPHQWH XQD KHUUDPLHQWD TXH IRUPD SDUWH GHO SURFHVR GH UHFRJLGD GH LQIRUPDFLyQ
SDUD UHDOL]DU OD HYDOXDFLyQ SVLFROyJLFD TXH HV OD TXH ILMD OD WRPD GH GHFLVLRQHV FRQ
UHVSHFWRDORVLQVWUXPHQWRVDXWLOL]DUODIRUPXODFLyQGHKLSyWHVLV\VXFRQWUDVWDFLyQFRQ
HOILQGHDOFDQ]DUXQRVREMHWLYRVSUHHVWDEOHFLGRVORFXDOH[LJHGHOHYDOXDGRUXQDVHULH
GHFRQRFLPLHQWRVWHyULFRVTXHHQSULQFLSLRYDQPiVDOOiGHODDSOLFDFLyQGHWHVWV

3RU ORTXHUHVSHFWDDOGLDJQyVWLFRSVLFRVRFLDOVHKDGHLQWHJUDUGHQWURGHODVGHPDQGDV
GH HYDOXDFLyQ TXH VH DPSOtDQ GH XQD SHUVRQD FRQFUHWD D XQ JUXSR XQ DPELHQWH XQ
SURJUDPD R XQ WUDWDPLHQWR $Vt SXHV SRGHPRV HQWHQGHU OD HYDOXDFLyQ HQ
SVLFRVRFLRORJtD FRPR HO HVWXGLR FLHQWtILFR D WUDYpV GH GLIHUHQWHV SURFHGLPLHQWRV GH
UHFRJLGD GH LQIRUPDFLyQ GH ODV DFWLYLGDGHV \ FDUDFWHUtVWLFDV SVLFRVRFLDOHV GH XQD
SHUVRQDRFHQWURHGXFDWLYRFRQHOILQGHDOFDQ]DUORVREMHWLYRVSURSXHVWRV

$Vt )HUQiQGH]%DOOHVWHURV   SXQWXDOL]D TXH HO SURFHVR GH HYDOXDFLyQ YLHQH
GHWHUPLQDGRSRUHOREMHWLYRGHODHYDOXDFLyQREOLJDQGRDFDPELDUODVPHWRGRORJtDVGH
LQYHVWLJDFLyQ 6L HO REMHWLYR HV HO GLDJQyVWLFR OD RULHQWDFLyQ R OD VHOHFFLyQ OD
YHULILFDFLyQGHODVKLSyWHVLVIRUPXODGDVVHUHDOL]DUiPHGLDQWHWpFQLFDVFRUUHODFLRQDOHV
PLHQWUDV TXH VL HO REMHWLYR HV HO WUDWDPLHQWR OD PHWRGRORJtD FRUUHODFLRQDO GHEHUi VHU
FRPSOHPHQWDGDFRQSURFHGLPLHQWRVH[SHULPHQWDOHV

(QUHVXPHQ\SDUDIUDVHDQGRD,]TXLHUGR S OD HYDOXDFLyQWLHQHTXHFRQVLVWLU


HQ XQ SURFHVR ULJXURVR \ SUHFLVR \ WRGDV ODV FRQFOXVLRQHV TXH VH VDTXHQ GH OD PLVPD
KDEUiQ GH VHU SODVPDGDV HQ XQ LQIRUPH SDUD TXH HVWXGLDQWH \ SURIHVRU WHQJDQ XQD
SHUVSHFWLYD JOREDO GH OD VLWXDFLyQ \ XQD LQIRUPDFLyQ GHWDOODGD TXH UHIOHMH HO HVWDGR
DFWXDO\ODVSRVLEOHVHVWUDWHJLDVGHDIURQWDPLHQWR

,QVWUXPHQWRVGHHYDOXDFLyQ

/DHOHFFLyQGHOLQVWUXPHQWRGHHYDOXDFLyQHVXQDSDUWHVHQVLEOHGHQWURGHOSURFHVRGH
LQYHVWLJDFLyQ SRU OR TXH UHTXLHUH GDUOH OD LPSRUWDQFLD TXH WLHQH (Q HO FDVR GH OD
(GXFDFLyQ ORV LQVWUXPHQWRV TXH PiV VH KDQ XWLOL]DGR ±SULQFLSDOPHQWH SRU VX IiFLO
DSOLFDFLyQ±KDQVLGRORVFRUUHVSRQGLHQWHVDOLQGLFDGRUFRJQLWLYRFRQHOILQGHDQDOL]DU
GH IRUPD HVSHFtILFD DOJXQDV FDUDFWHUtVWLFDV LQGLYLGXDOHV ILMDFLyQ GH PHWDV DWULEXFLyQ

92
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

FDXVDO H[SHFWDWLYDV GH p[LWR FRQWURO GHO HVWUpV HWF que LQWHUDFW~DQ FRQ IDFWRUHV
VLWXDFLRQDOHVSURSLRVGHFDGDFRQWH[WRHGXFDWLYR

/RVHVWXGLRVUHDOL]DGRVGHVGHHOPDUFRDFWLWXGLQDOWLHQHQGLYHUVDVRULHQWDFLRQHVVHJ~QOD
WHPiWLFDHOHJLGD\HODVSHFWRFRJQLWLYRDIHFWLYRVHOHFFLRQDGRDGRSWDQGRHQVXPD\RUtD
OD IRUPDGHHVFDODVDFWLWXGLQDOHVFRPR LQVWUXPHQWRGHLQYHVWLJDFLyQ 8QD SDUWH GHORV
HVWXGLRV VH GLULJHQ D HVWXGLDU ODV H[SHFWDWLYDV GH ORV HVWXGLDQWHV HQ WpUPLQRV GH JXtD
SDUDPHMRUDUHOSURFHVRGHHQVHxDQ]DDSUHQGL]DMH\ODVDWLVIDFFLyQGHORVVHUYLFLRVFRQ
OD FRPXQLGDG DGRSWDQGR XQ HQIRTXH GHVGH HO iPELWR GH OD SVLFRORJtD VRFLDO \ OD
HGXFDFLyQRGHVGHHOSDUDGLJPDGHFDOLGDGGHVHUYLFLRGHRULHQWDFLyQHPSUHVDULDO

$VtODVLQYHVWLJDFLRQHVDFDGpPLFDVXWLOL]DQLQVWUXPHQWRVSDUDHYDOXDUODVH[SHFWDWLYDV
VREUH OD HQVHxDQ]D R HO SURIHVRUDGR FRQWUDVWiQGRODV FRQ ODV HYDOXDFLRQHV GH ODV
SHUFHSFLRQHV GH VXV SURIHVRUHV DFWXDOHV 2WUDV LQYHVWLJDFLRQHV XWLOL]DQ FRPR VRSRUWH

WpFQLFR HVFDODV GH SUHIHUHQFLDV VREUH ORV GLVWLQWRV DVSHFWRV GHO SURFHVR HQVHxDQ]D
DSUHQGL]DMH SXGLHQGR GLVWLQJXLU ODV GLIHUHQFLDV SHUFHSWLYDV TXH VH HVWDEOHFHQ VHJ~Q
JpQHUR\WLWXODFLRQHV<SRU~OWLPRH[LVWHQLQYHVWLJDFLRQHVTXHFRQVWUX\HQHVFDODVSDUD
LGHQWLILFDUORVFOLPDVVRFLDOHVGHLQWHUDFFLyQTXHVHSURGXFHQHQ HO DXOD \GHQWURGHO
FRQWH[WR XQLYHUVLWDULR FRQWUDVWiQGRORs FRQ OD FDOLGDG GH OD H[SHULHQFLD HGXFDWLYD
GHOalumno

$QWH OD LPSRVLELOLGDG GH UHODFLRQDU GH XQ PRGR H[KDXVWLYR \ PtQLPDPHQWH FRPSOHWR
ORV LQVWUXPHQWRV GH HYDOXDFLyQ \ GLDJQyVWLFR H[LVWHQWHV HQ SVLFRORJtD VRFLDO GH OD
HGXFDFLyQ D FRQWLQXDFLyQ VH KDFH XQD EUHYH H[SRVLFLyQ GH DOJXQRV FRQVLGHUDGRV GH
LQWHUpVGHDFXHUGRDVXILDELOLGDGYDOLGH]\UHODFLyQFRQQXHVWUDLQYHVWLJDFLyQ

9 Classroom Enviroment Scale (CES, Moos y Trickett, 1974): $QiOLVLV GH ODV
SHUFHSFLRQHV GH XQLYHUVLWDULRV VREUH DVSHFWRV UHODFLRQDOHV SHUVRQDOHV R GH
RULHQWDFLyQDREMHWLYRV\GHQRUPDVHLQQRYDFLyQ

9 College Students Expectation Questionnaire (CSEQ) (Pace y Kuh, 1998):


$SOLFDGR DO FRQRFLPLHQWR GH ORV DQWHFHGHQWHV FDUDFWHUtVWLFDV  SHUVRQDOHV
H[SHFWDWLYDVVREUHODXQLYHUVLGDG\FDSDFLGDGGHLQWHUDFFLyQGHOHVWXGLDQWH

9 Múltiple-Ítem Scale For Measuring Customer Perceptions of Service Quality


(SERVQUAL): &RQVWUXLGD SRU 3DUDVXPDQ HW DO   SDUD HO HVWXGLR GH OD
FDOLGDG GHO VHUYLFLR 6H FRPSRQH GH GRV VHFFLRQHV GH  tWHPV FDGD XQD XQD

93

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

SDUDPHGLUODVH[SHFWDWLYDVGHOVHUYLFLR\RWUDSDUDODVSHUFHSFLRQHVUHDOHVVREUH
pVWH $ SHVDU GH QR VHU HVSHFtILFR SDUD HO iPELWR HGXFDWLYR GLIHUHQWHV DXWRUHV
KDQ XWLOL]DGR HVWH LQVWUXPHQWR <DQKRQJ \ .D\H   \ 5LGGLQJV 6LGKX \
3RNDULHU  KDQUHDOL]DGRDOJXQDVDGDSWDFLRQHVGHHVWDHVFDODDOFRQWH[WRGH
OD HQVHxDQ]D XQLYHUVLWDULD TXH LQFOX\HQ XQD SDUWH GHVWLQDGD DO SHUVRQDO GH
DGPLQLVWUDFLyQ

9 Cuestionario de Percepciones Académicas (CPA) Deaño et al., (2015):


&UHHQFLDV DFWLWXGHV LPSOLFDFLyQ H[SHFWDWLYDV FXDQGR DFFHGHQ D OD (QVHxDQ]D
6XSHULRU

9 University Students’ Expectations of Teaching (USET), diseñado por Sander et


al., (2000): 3DUDHVWXGLDUODVH[SHFWDWLYDVVREUHGLIHUHQWHVDVSHFWRVGHODHQVHxDQ]D
WDOHV FRPR PpWRGRV GH HQVHxDQ]D PpWRGRV GH HYDOXDFLyQ \ FXDOLGDGHV GHO
SURIHVRUDGR(VWHFXHVWLRQDULRKDVLGRDGDSWDGRDOFDVWHOODQR\YDOLGDGRSRU'HOD
)XHQWH1LHYDV\5LXV  
9 Instructions Preferent Questionnaire (IPQ), construido por Hativa y Birenbaum
(2000) FRQ OD LQWHQFLyQ GH HVWXGLDU ODV SUHIHUHQFLDV R H[SHFWDWLYDV GH ORV
HVWXGLDQWHVUHVSHFWRDORVPpWRGRVGHHQVHxDQ]D

9 Inventario de Hábitos de Estudio (Pozar, 2002): 6X REMHWLYR HV HYDOXDU KiELWRV
DFWLWXGHV\FRQGLFLRQHVFRQORVTXHVHHQIUHQWDHOHVWXGLDQWHDODKRUDGHHVWXGLDU

7RGRV ORV LQVWUXPHQWRV GHVFULWRV VH RULHQWDQ KDFLD OD HYDOXDFLyQ GH KDELOLGDGHV
SVLFRVRFLDOHVGLUHFWDPHQWHUHODFLRQDGDVFRQODHMHFXFLyQDFDGpPLFDFX\RVDVSHFWRV
VH DSUR[LPDQ D QXHVWUD OtQHD GH LQYHVWLJDFLyQ PHGLDQWH OD HYDOXDFLyQ GH DFWLWXGHV
KDFLD OD SUiFWLFD DFDGpPLFD GHVGH HO SXQWR GH YLVWD GH ORV HVWXGLDQWHV GH OD
(QVHxDQ]D6XSHULRU

'HVGHQXHVWURSXQWRGHYLVWDVHHVWiGDQGRLPSRUWDQFLDWDQWRDODVHVWUDWHJLDVFRPRD
ODVDFWLWXGHVFRQVLGHUDGDVFRPRIDFWRUHVUHODFLRQDGRVFRQHOUHQGLPLHQWRDFDGpPLFR\
TXH SXHGHQ FRPSOHWDU HO DQiOLVLV GH RWUDV YDULDEOHV SVLFRVRFLDOHV GH ORV HVWXGLDQWHV \
SURIHVRUHV VLQ ROYLGDU ODV KDELOLGDGHV HGXFDWLYDV TXH WDQWR XQRV FRPR RWURV KDQ
GHVDUUROODGRFRQODSUiFWLFD\ODH[SHULHQFLD

5HVSHWDPRV ODV GLUHFWULFHV GH XWLOL]DFLyQ GH HVWRV WHVWV \ FXHVWLRQDULRV TXH KDQ VLGR
HODERUDGDV RULJLQDOPHQWH SRU OD Comisión Internacional de Tests ,7&  OD &RPLVLyQ

94
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

(XURSHD VREUH 7HVWV GH OD Federación Europea de Asociaciones Profesionales de


Psicólogos ()33$ \OD&RPLVLyQGH7HVWV GHOColegio Oficial de Psicólogos &23 

6LJXLHQGR ODV LQGLFDFLRQHV GH %DODJXp   FRQVLGHUDPRV QHFHVDULR KDFHU ODV
VLJXLHQWHVSUHFLVLRQHVSDUDHOXVRDGHFXDGRGHGLFKDVSUXHEDV

 8WLOL]DUORVFXHVWLRQDULRVFRQUHOHYDQFLDSDUDODVLWXDFLyQHGXFDWLYD

 'DUORVUHVXOWDGRVORPiVUiSLGRSRVLEOH

 8WLOL]DU ORV UHVXOWDGRV ~QLFDPHQWH FRPR KLSyWHVLV GH WUDEDMR \ QR FRPR
GHILQLFLRQHVUHDOHVGHOHVWXGLDQWH

3DUD TXH ODLQWHUSUHWDFLyQGHODVSXQWXDFLRQHV VHD FRUUHFWD GHEHUHPRV WHQHU HQ FXHQWD


ORV GDWRV REWHQLGRV HQ XQD PXHVWUD R JUXSR QRUPDWLYR GH VXV PLVPDV FDUDFWHUtVWLFDV
DVSHFWRHVWHTXHDPHQXGRVXHOHROYLGDUVHSRUORTXHVHVXHOHQFRPHWHUJUDYHVHUURUHV

GH LQWHUSUHWDFLyQ HV GHFLU ORV UHVXOWDGRV SDUD TXH WHQJDQ VHQWLGR \ QR OOHYHQ D
FRQFOXVLRQHVHUUyQHDVKDQGHVHUFRPSDUDGRVFRQHOJUXSRGHUHIHUHQFLDDSURSLDGR\HQ
HOFRQWH[WRDGHFXDGR

3RU~OWLPRHVLPSRUWDQWHXWLOL]DUODLQIRUPDFLyQTXHQRVSURSRUFLRQDQORVLQVWUXPHQWRV
GH GLDJQyVWLFR \ HYDOXDFLyQ SVLFRVRFLDO FRPR SDVR LQWHUPHGLR TXH QRV OOHYH D OD
SODQLILFDFLyQ GH HVWUDWHJLDV GH DIURQWDPLHQWR DGHFXDGDV SXHV QR WHQGUtD VHQWLGR TXH
VRORODXWLOL]iUDPRVFRPRVLPSOHGHVFULSFLyQGHORVUHVXOWDGRVREWHQLGRV\ODSRVWHULRU
HQWUHJDGHOLQIRUPHFRUUHVSRQGLHQWHDORVHVWXGLDQWHV\RSURIHVRUHV

(9$/8$&,Ï1 '( /$6 $&7,78'(6 48( ,17(59,(1(1 (1 /$


',',1È0,&$'(/&(1752

(V VDELGR TXH HQ ORV JUXSRV GHVDUUROODQ UROHV IRUPDOHV H LQIRUPDOHV SRU OR TXH HO
LQWHUpVGHOSURIHVRUGHEHUiFHQWUDUVHHQFRQVHJXLUTXHORVDOXPQRVHVWpQVDWLVIHFKRVFRQ
HOORV\KDJDQORSRVLEOHSDUDSRQHUORVHQSUiFWLFD(OREMHWLYRHVFRQVHJXLUODFRKHVLyQ
HQWHQGLGD FRPR XQ SURFHVR GH WUDQVIRUPDFLyQ PXWXD TXH FRQWULEX\H DO GHVDUUROOR GHO
FOLPD VRFLDO DO PDQWHQLPLHQWR OD FRPXQLFDFLyQ \ OD FRQIRUPLGDG UHIOHMDGR HQ OD
WHQGHQFLD GHO JUXSR SDUD SHUPDQHFHU XQLGR \ FRQVHJXLU ODV PHWDV SURSXHVWDV OR
TXH 0RRV  FRQFHSWXDOL]y FRPRFOLPDSVLFRVRFLDOGHORVHQWRUQRV
HGXFDWLYRV\ TXH KD VLGR DPSOLDPHQWH LQYHVWLJDGR HQ 3VLFRORJtD 6RFLDO y DVXPLGR

95

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

SURJUHVLYDPHQWH FRPR XQD PHGLGD GH FDOLGDG GHO HQWRUQR HGXFDWLYR HQ OD (QVHxDQ]D
6XSHULRU &DEUHUDHWDO 

1XHVWURLQWHUpVDTXtUHVLGHEiVLFDPHQWHHQGHVFXEULUODVSHUFHSFLRQHVVXEMHWLYDVGH
ORVVXMHWRVLPSOLFDGRVHQODDFWLYLGDGDFDGpPLFD\VXFRQVLGHUDFLyQHQUHODFLyQDO
WLSR GH DPELHQWH DFDGpPLFR \D TXH FRQWULEX\H D OD LGHQWLILFDFLyQ GH ODV YDULDEOHV
TXH IRPHQWDQ HO UHQGLPLHQWR HVSHFLDOPHQWH VL VH FRPSOHPHQWDQ FRQ XQ HVWXGLR
PiV GHWDOODGR GH OD SHUVRQDOLGDG GH ORV HVWXGLDQWHV $QDOL]DQGR OD YDORUDFLyQ
FRJQLWLYD\DIHFWLYDTXHHOHVWXGLDQWHKDFHGHVXJUXSRUHVSHFWRDODDFHSWDFLyQGHO
UpJLPHQGHGLVFLSOLQDODPRWLYDFLyQSRUODDFWLYLGDGTXHUHDOL]DQORVVLVWHPDVGH
DSUHQGL]DMHV HVWDEOHFLGRV OD YDORUDFLyQ GH ORV UHVXOWDGRV \ ORV FULWHULRV GH
HYDOXDFLyQXWLOL]DGRVODVDFWLWXGHVGHORVHVWXGLDQWHVUHODWLYDVDOIXQFLRQDPLHQWR\
DOFOLPDVRFLDOGHOJUXSR SRGUiQSURSRUFLRQDUQRVGDWRVLPSRUWDQWHVSDUDRULHQWDUOD
LQWHUYHQFLyQ

 $FHSWDFLyQGHOUpJLPHQGLVFLSOLQDU

/DGLVFLSOLQDHVHOPHGLRSDUDTXHORVPLHPEURVGHXQFHQWURVHDGDSWHQDVXHVWUXFWXUD
HLQWHULRULFHQODVQRUPDVSRUODVTXHVHULJH\FRQHOOD VHSHUVLJXHHOFRQRFLPLHQWRGH
ORV FRPSRUWDPLHQWRV DFHSWDGRV R UHFKD]DGRV SRU HO JUXSR 'HVWDFD OD QHFHVLGDG GH
DQDOL]DU ORV IDFWRUHV WDQWR LQWHUSHUVRQDOHV FRPR LQWUDSHUVRQDOHV TXH LQWHUYLHQHQ HQ HO
FRQWH[WRHGXFDWLYRGHOFHQWURSDUDORJUDUXQFOLPDDGHFXDGRQRHQYDQRHOSURFHVRGH
HQVHxDQ]DDSUHQGL]DMHWLHQHXQDVQRUPDVELHQGHILQLGDVTXHWRGRVORVHVWXGLDQWHVGHEHQ
UHVSHWDU

0HGLDQWH OD XWLOL]DFLyQ GH HVWUDWHJLDV FRJQLWLYDV \ PHWDFRJQLWLYDV DVt FRPR GHO
DGLHVWUDPLHQWRHQWpFQLFDVGHUHFRQRFLPLHQWR\FRPXQLFDFLyQGHDFWLWXGHVHOHVWXGLDQWH
GHEH WRPDU FRQFLHQFLD GH VX FRPSRUWDPLHQWR H LQWHQWDU DMXVWDUOR D OD GLQiPLFD GHO
JUXSR \ D OD QRUPDWLYD HVWDEOHFLGD *RW]HQV   3RU QXHVWUD SDUWH GHVHDPRV
FRQRFHU\DQDOL]DU ODRSLQLyQTXHOHPHUHFHDFDGDHVWXGLDQWHHOSURFHGLPLHQWRGHFyPR
VHOOHYDQDFDERODVDFWLYLGDGHVHQODFODVHWDQWRHQORVDFWLYLGDGHVGHDSUHQGL]DMHFRPR
HQ ODV HYDOXDFLRQHV ORV VLVWHPDV GH FRQWURO GH JUXSR DSOLFDGRV ODV SODQLILFDFLRQHV
HVWDEOHFLGDVORVFRQWHQLGRVGHODVFODVHV\ODVQRUPDVDFXPSOLUHOJUDGRGHOLEHUWDGGH
HOHFFLyQODVRSRUWXQLGDGHVTXHVHOHVGDODUHVSXHVWDDODVQHFHVLGDGHVLQGLYLGXDOHV\HO
QLYHOGHSDUWLFLSDFLyQGHOJUXSR

96
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

 1LYHOGHPRWLYDFLyQKDFLDODDFWLYLGDGHGXFDWLYD

(VWDUPRWLYDGRVLJQLILFDWHQHUXQREMHWLYR\KDFHUODVFRVDVGHODPHMRUPDQHUDSRVLEOH
SDUDFRQVHJXLUOR(OSURIHVRUGHEHGLVSRQHUGHORVUHFXUVRVDGHFXDGRVTXHOHD\XGHQD
TXHVXVHVWXGLDQWHVFRQVLJDQVXVREMHWLYRV\KDGHVDEHUDSOLFDUORVSDUDDFWLYDUDFDGD
DOXPQRGHODIRUPDDGHFXDGDSDUDTXHLQIOX\DHQVXUHQGLPLHQWRVHWUDWDHQGHILQLWLYD
GHVDEHUPRWLYDU/DVLQYHVWLJDFLRQHVHQHVWDYDULDEOHVHRULHQWDQKDFLDHODQiOLVLVGHORV
PRWLYRVGHPDQWHQLPLHQWRFDPELRRDEDQGRQRHQODVGLIHUHQWHViUHDVGHFRQRFLPLHQWR
0DUUHUR 

1XHVWUR REMHWLYR HV HYDOXDU HO LQWHUpV FRQ HO TXH VH UHDOL]D OD DFWLYLGDG DFDGpPLFD
UHVSHFWRDRWUDVGLPHQVLRQHVGHODYLGDGHOHVWXGLDQWHFyPRSDUWLFLSDHQODVDFWLYLGDGHV
SDUDPDQWHQHUVHHQIRUPDDVLVWHQFLDDODVFODVHVPRGXODFLyQGHOQLYHOGHDFWLYDFLyQ\
HOJUDGRGHVDWLVIDFFLyQTXHREWLHQH

 *UDGRGHDFHSWDFLyQGHORVVLVWHPDVGHDSUHQGL]DMH

(VHOMXLFLRTXHOHPHUHFHDFDGDHVWXGLDQWHODIRUPDGHOOHYDUDFDERORVDSUHQGL]DMHV\
ODV DFWLYLGDGHV TXH VH KDFHQ HQ HOORV 6H WUDWD GH OD DFHSWDFLyQ GH ORV PpWRGRV GH
DSUHQGL]DMH XWLOL]DGRV VL VRQ R QR IXQFLRQDOHV \ VL UHVXOWDQ ~WLOHV SDUD DOFDQ]DU ORV
REMHWLYRVSURSXHVWRVHQHOFHQWUR

/D FRQVLGHUDFLyQ GH OD XWLOLGDG SUHVHQWH \ IXWXUD GH ODV DFWLYLGDGHV TXH HO HVWXGLDQWH
OOHYD D FDER HQ HO FHQWUR OD RSLQLyQ TXH OH PHUHFH ORV VLVWHPDV GH DSUHQGL]DMH TXH
UHDOL]D HO SURIHVRU HO HVIXHU]R TXH VXSRQH ODV WDUHDV GH DSUHQGL]DMH \ HO VDFULILFLR
FRUUHVSRQGLHQWH OD FRPSDWLELOLGDG GH OD SDUWLFLSDFLyQ H[WUDFXUULFXODU FRQ OD
SDUWLFLSDFLyQHQFODVH\ODIXQFLRQDOLGDGGHODVWDUHDVTXHUHDOL]DQGHFDUDDOIXWXURVRQ
FXHVWLRQHVGHLQWHUpVTXHQRVOOHYDQDHQWHQGHUODVDFWLWXGHVTXHVHHVWiQGHVDUUROODQGR
HQORVHVWXGLDQWHVDORODUJRGHVXH[SHULHQFLDHGXFDWLYD

$SUREDFLyQGHORVUHVXOWDGRVDOFDQ]DGRVHQHOFHQWUR

/DVDFWLWXGHVTXHVHGHVDUUROODQHQHOHQWRUQRHGXFDWLYRMXHJDQXQSDSHOLPSRUWDQWHHQ
OD DXWRFRQILDQ]D LQGLYLGXDO \ GH JUXSR $FHSWDU ORV UHVXOWDGRV REWHQLGRV \ FRQVLGHUDU
TXHH[LVWHREMHWLYLGDGHQODHYDOXDFLyQGHOUHQGLPLHQWR\HQHOQLYHOGHKDELOLGDGGHVXV
FRPSRQHQWHVHVXQDYDORUDFLyQVXEMHWLYDTXHWDQWRHVWXGLDQWHVFRPRSURIHVRUHVKDFHQ
GHOUHQGLPLHQWRGHOJUXSR\GHWRGRVVXVFRPSRQHQWHV

97

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

/RV HVWLORV GH DSUHQGL]DMH TXH VH DSOLFDQ OD DFHSWDFLyQ GH ODV QRUPDV OD PRWLYDFLyQ
DFWLYDGHOJUXSR\ODHYDOXDFLyQTXHVHKDFHGHOPLVPRVRQYDULDEOHVGHODGLQiPLFDGHO
JUXSRTXHGHEHPRVHMHUFLWDUVLGHVHDPRVDOFDQ]DUODFRKHVLyQSRUORTXHQXHVWURLQWHUpV
VHFHQWUDUiHQHOFRQRFLPLHQWRGHODVDFWLWXGHVTXHGHVDUUROODQORVHVWXGLDQWHVUHVSHFWRD
ODLQIOXHQFLDTXHWLHQHODYDORUDFLyQGHORVUHVXOWDGRVODFRQVLGHUDFLyQGHORVFULWHULRV
XWLOL]DGRVSDUDYDORUDUHOQLYHOGHKDELOLGDGGHORVFRPSRQHQWHVGHOJUXSRODLQIOXHQFLD
GHOHVWDGRGHiQLPRGHOSURIHVRUDOD KRUDGHYDORUDUDVXVSXSLORVHOUHFRQRFLPLHQWRR
QRGHODVSRWHQFLDOLGDGHVHGXFDWLYDVODDFHSWDFLyQGHOUROTXHGHVHPSHxDHQHOFHQWUR
FRQ UHODFLyQ DO UHQGLPLHQWR DFDGpPLFR \ VX UHSHUFXVLyQ HQ OD DFHSWDFLyQ GH ORV
UHVXOWDGRVGHOVLVWHPDHGXFDWLYRGHOFHQWUR

 (9$/8$&,Ï1 '( /$6 $&7,78'(6 '( /26 (678',$17(6 +$&,$ (/


35352)(625

/DV H[SHFWDWLYDV JHQHUDGDV D SDUWLU GH VLWXDFLRQHV \ H[SHULHQFLDV SURGXFLGDV HQ ORV
DSUHQGL]DMHV WLHQGHQ D VHU WUDQVIHULGDV D ORV HVWXGLDQWHV \ PXFKRV VLHQWHQ TXH QR VH
FXHQWDFRQHOORVTXHQRVHFUHHHQVXVSRVLELOLGDGHVRTXHVHOHVHVWiFDVWLJDQGR4XHHO
SURIHVRUQRGpLPSRUWDQFLDDFLHUWRVFRPSRUWDPLHQWRVSURSLRVQRVHGHEHDXQDDFWLWXG
QHJDWLYDVLQRDVXLJQRUDQFLDDFHUFDGHODGLQiPLFDGHOHVWXGLDQWHFRPRVHUKXPDQR\
GHOHTXLSRFRPRJUXSRGHDFWLYLGDG

6LQ HPEDUJR DXQTXH VX IRUPD GH DFWXDU HV EDVWDQWH FRPSOHMD \ HVWi VXMHWD D
GHWHUPLQDGRV FRQGLFLRQDQWHV FXDQGR ODV H[SHFWDWLYDV HVWiQ FODUDPHQWH GHILQLGDV
VLUYHQ GH PDUFR GH UHIHUHQFLD SDUD OD DXWRFRQILDQ]D GHO HVWXGLDQWH \ SXHGHQ
D\XGDUOH D FRPSUHQGHU OD H[LVWHQFLD GH XQ PDUFR VRFLDO FRQ FX\DV UHVWULFFLRQHV \
GHPDQGDVWLHQHTXHDSUHQGHUDFRQYLYLU$VtSXHVHOSURIHVRUGHEHUiVHUFDSD]GH
WUDQVPLWLU HO UHFRQRFLPLHQWR RSRUWXQR TXH Gp FDOLGDG D OD LQWHUDFFLyQ HVWXGLDQWH±
SURIHVRU

(Q HVWD GLPHQVLyQ DFWLWXGLQDO GHO HVWXGLDQWH KDFLD HO SURIHVRU SRGHPRV HYDOXDU OD
PDQHUD GH LPSRQHU VX DXWRULGDG HO QLYHO GH H[LJHQFLD TXH LPSRQH HO JUDGR GH
DFHSWDFLyQTXHWLHQHQVXVFULWHULRVGHYDORUDFLyQVXFDSDFLGDGGHFRPSUHQVLyQHWFHV
GHFLUSRGUHPRVFRQRFHUODVSHUFHSFLRQHVVXEMHWLYDVGHORVHVWXGLDQWHVFRQUHVSHFWRDOD
GLQiPLFDGHODUHODFLyQHVWDEOHFLGD

98
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

&DSDFLGDGGHFRPXQLFDFLyQ

7DQWR HO p[LWR FRPR HO IUDFDVR HQ HO UHQGLPLHQWR GHSHQGHQ HQ JUDQ PHGLGD GH ODV
WpFQLFDV GH FRPXQLFDFLyQ XWLOL]DGDV SDUD TXH WRGRV \ FDGD XQR GH ORV HOHPHQWRV
WUDQVPLWLGRVSRUHOSURIHVRUVHDQSUHFLVRV\FODUDPHQWHFRPSUHQGLGRV

3RU WUDQVPLVLyQ GH FRQRFLPLHQWRV QR GHEH HQWHQGHUVH ~QLFDPHQWH HO KHFKR GH
YHUEDOL]DU LQIRUPDU R LQVWUXLU DFHUFD GH WDO R FXDO WDUHD R SUáFWLFD DFDGpPLFD (O
SURIHVRU UHVSRQVDEOH GHEH VHU XQ FRPXQLFDGRU FDSD] GH DGDSWDUVH DO QLYHO GH
FRPSUHQVLyQ \ FRQRFLPLHQWRV GHO JUXSR DO TXH VH GLULJH GHVSHUWDQG R V X LQWHUpV \
PDQWHQLHQGRVLHPSUHDOWRHOQLYHOGHDWHQFLyQEXVFDQGRTXHWRGRHOOR UHGXQGHHQXQD
PRWLYDFLyQLQWUtQVHFDSRUSDUWHGHOJUXSR'HQDGDVHUYLUiVHUXQH[FHOHQWHSURIHVRUVLQ
ODFDSDFLGDGGHFRQHFWDUFRQORVHVWXGLDQWHVHYLWDUODVLQWHUIHUHQFLDVTXHVHSURGX]FDQ\
HOLPLQDUWRGRORTXHLPSLGDXQDFRPXQLFDFLyQHIHFWLYD

/RV PDWLFHV GLIHUHQFLDOHV REMHWR GH DQiOLVLV HQ HVWH DSDUWDGR KDFHQ UHIHUHQFLD DO
UHFRQRFLPLHQWR GH ODV QHFHVLGDGHV \ H[SHFWDWLYDV GH ORV HVWXGLDQWHV SRU SDUWH GH ORV
SURIHVRUHV DO QLYHO GH FRQILDQ]D H[LVWHQWH D OD SUHRFXSDFLyQ SRU ODV FXHVWLRQHV
SHUVRQDOHVGHVXVDOXPQRVDOJUDGRGHVLJQLILFDFLyQGHODVLQVWUXFFLRQHVTXHHPLWHQD
OD FRQVLGHUDFLyQ GHO QLYHO GH KDELOLGDG ORV PHGLRV XWLOL]DGRVSDUD TXH ORV HVWXGLDQWHV
FRPSUHQGDQODVWDUHDVDUHDOL]DUHWF

$FHSWDFLyQGHOOLGHUD]JR

%DViQGRQRV HQ HO modelo de efectividad directiva )LHOGHU   VHJ~Q VX HVWLOR XQ
SURIHVRUSXHGHVHU

9 Directivo y autocrático: &HQWUDGR VRODPHQWH HQ OD WDUHD \ HO UHQGLPLHQWR GHO
HVWXGLDQWH\GHVFXLGDQGRODVUHODFLRQHVLQWHUSHUVRQDOHV

9 Gestor y democrático: /H LQWHUHVD WDQWR HO UHQGLPLHQWR FRPR OD VDWLVIDFFLyQ
SHUVRQDOGHOHVWXGLDQWHFRQORTXHWLHQGHDVHUPiVHIHFWLYR

9 $QRVRWURVQRVLQWHUHVDFRQRFHUTXpDFWLWXGHVWLHQHQORVHVWXGLDQWHVUHVSHFWRDO
HVWLOR GH GLUHFFLyQ GHO SURIHVRU VX JUDGR GH DFHSWDFLyQ \ HO UHVSHWR D ORV
HVWXGLDQWHV /DV FXHVWLRQHV DTXt HYDOXDGDV VRQ OD IOH[LELOLGDG R ULJLGH] GH ORV
SURIHVRUHVODVH[SHFWDWLYDVKDFLDORVHVWXGLDQWHVVLDFHSWDRQRVXVRSLQLRQHV\
ODYLJLODQFLDHQHOFXPSOLPLHQWRGHODVLQVWUXFFLRQHV\yUGHQHV

99

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

$FHSWDFLyQGHOQLYHOGHH[LJHQFLD

/DFDSDFLGDGSDUDFRQVLGHUDUODVLWXDFLyQ\HOFRQWH[WRDODKRUDGHHVWDEOHFHUODFDUJD
GHWUDEDMR\ODDFWLYLGDGGHVDUUROODGDSDUDFRQVHJXLUORVREMHWLYRVSURSXHVWRVIDFLOLWDQGR
ODVWDUHDVDUHDOL]DUJHQHUDDFWLWXGHVSRVLWLYDVHQORVHVWXGLDQWHVDQWHODVH[LJHQFLDVGHO
SURIHVRU

(O SURIHVRU H[LJHQWH HV DTXHO TXH WHQLHQGR HQ FXHQWD HO QLYHO GH KDELOLGDG GHO
HVWXGLDQWH \ HO QLYHO GH GLILFXOWDG GH OD WDUHD D UHDOL]DU VDEH VLWXDU VX DFWLYLGDG HQ OD
]RQDGHGHVDUUROORSRWHQFLDO \OHRULHQWDHQHOSURFHVRGHDSUHQGL]DMHSDUDTXHVXSHUH
ODV GLILFXOWDGHV \ VH FRQYLHUWD HQ DJHQWH GH VX SURSLR SURFHVR IRUPDWLYR \ QR FRPR
VLPSOHUHFHSWRUSDVLYRVRPHWLGRDFRQWLQXDVSUHVLRQHV\GHVFDOLILFDFLRQHV

/DV DFWLWXGHV TXH WLHQHQ ORV HVWXGLDQWHV KDFLD HO SURIHVRU UHVSHFWR D VX H[LJHQFLD VH
UHILHUHQ D OD FRQVLGHUDFLyQ GHO QLYHO GH WHQVLyQ HQ HO JUXSR \ HQWUH ORV HVWXGLDQWHV OD
GLVWULEXFLyQGHOWLHPSRGLVSRQLEOHSDUDUHDOL]DUODVDFWLYLGDGHVVLHYLWDODDSOLFDFLyQGH
WDUHD DxDGLGD D OD FDUJD GH DSUHQGL]DMH VL GRVLILFD ODV WDUHDV \ ODV LQVWUXFFLRQHV SDUD
HYLWDUWHQVLRQHV\VLFRQVLJXHTXHODDFWLYLGDGSURSRUFLRQHVDWLVIDFFLyQDORVHVWXGLDQWHV
PHGLDQWHXQWUDEDMRVHULR\UHVSRQVDEOH

$FHSWDFLyQGHODVYDORUDFLRQHV

(O SURIHVRU UHSUHVHQWD SDUD HO HVWXGLDQWHXQD IXHQWH GHLQIRUPDFLyQ GHSULPHUtVLPD


PDQR VREUH VX FRPSHWHQFLD \ KDELOLGDG QR HQ YDQR HV TXLHQ HQ ~OWLPD LQVWDQFLD
GHEHYDORUDUVXVDFWXDFLRQHVHGXFDWLYDV6LQHPEDUJRODDFWLWXGTXHORVHVWXGLDQWHV
GHVDUUROOHQ DQWH OD HYDOXDFLyQ GHSHQGHUi GH OD DGHFXDFLyQ H[LVWHQWH HQWUH OD GHO
SURIHVRU\ODVX\D6HJ~Q +DUWHU  HODSR\RFRQVWDQWH\SRVLWLYRGHOSURIHVRU
SURYRFD XQ HIHFWR PRGHUDGRU GH LQFUHPHQWDU OD DXWRHVWLPD \ OD PRWLYDFLyQ
LQWUtQVHFD OR FXDO KDFH TXH HO DOXPQR GHVDUUROOH OD DXWRFRQILDQ]D \ XQ DGHFXDGR
QLYHOGHDFWLYDFLyQ

/DVUHDFFLRQHVSURGXFLGDVDQWHODVHYDOXDFLRQHVTXHUHDOL]DHOSURIHVRUVRQHOUHVXOWDGR
GH XQ SURFHVR GH DWULEXFLyQ FDXVDO GH LGHQWLILFDFLyQ GH ODV DFWLWXGHV \ GH ORV
FRPSRUWDPLHQWRV\WLHQHQLQIOXHQFLDGLUHFWDVREUHODDXWRHVWLPDGHODOXPQRSRUWDQWR
GHEHUiDSR\DUVHHQVXFRQGLFLyQGHSHUVRQDH[SHUWD\VHUREMHWLYRDODKRUDGHHYDOXDU
KDFLpQGRORGHIRUPDFRQVWUXFWLYD

100
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

$TXt SUHWHQGHPRV FRQRFHU HO GHVDUUROODGR GH DFWLWXGHV D SDUWLU GH OD H[SHULHQFLD
FRPSDUWLGDHQODVHYDOXDFLRQHVTXHHOSURIHVRUKDFHGHVXVSXSLORV

&8(67,21$5,2 '( $&7,78'(6 $&$'e0,&$6 &$$)8  &202


5(5(&8562'((9$/8$&,Ï1<',$*1Ï67,&2

'H DFXHUGR FRQ ,]TXLHUGR   HQ ORV ~OWLPRV DxRV OD GLPHQVLyQ HVWUDWpJLFD KD
H[SHULPHQWDGR XQ JUDQ DYDQFH HQ HO iPELWR GH OD 3VLFRORJtD 6RFLDO (GXFDWLYD
DPSOLDQGRFRQRFLPLHQWRV\GHVDUUROODQGRYDOLRVRVUHFXUVRVWHFQROyJLFRVSDUDHOHVWXGLR
GHXQDJUDQYDULHGDGGHVLWXDFLRQHV:HLQVWHLQ  FRQVLGHUDQTXHVHKDSURGXFLGR
XQD PHMRUD HQ OD FRPSUHQVLyQ GH ORV SURFHVRV FRJQLWLYRV VH KD GHVFXELHUWR FyPR VH
GHVDUUROODQODVHVWUDWHJLDV\VXLQWHUDFFLyQFRQGLVWLQWDVVLWXDFLRQHVGHDSUHQGL]DMHVHKD
IDFLOLWDGR HO SURFHVR GH WUDQVIHUHQFLD \ VH KDQ GHVDUUROODGR PpWRGRV SDUD HYDOXDU ORV
SURFHVRVFRQGLFLRQDOHV\VXFRQWURO

/D XWLOL]DFLyQ FRQMXQWD GH ULJXURVRV DQiOLVLV H LQVWUXPHQWRV GH HYDOXDFLyQ KDQ
FRQIRUPDGR XQ iUHD GH FRQRFLPLHQWR TXH QRV SURSRUFLRQD LQIRUPDFLyQ GH JUDQ YDOtD
SDUDHOHVWXGLR\GHVDUUROORGHODVGLPHQVLRQHVHVWUDWpJLFDV

 -XVWLILFDFLyQ

0DUWtQ  UHDOL]yODDGDSWDFLyQGHOManual Survey of Study Habits and Attitudes


%URZQ \ +ROW]PDQ   \ GHO Manual Minnesota Teacher Attitude Inventory
&RRN/HHGV\&DOOLV \SXEOLFyVXCuestionario de Hábitos y Actitudes(VWH
WUDEDMR MXQWR FRQ ODV UHYLVLRQHV UHDOL]DGDV HQ OD HODERUDFLyQ WHyULFD GH ODV
HVWUDWHJLDV \ DFWLWXGHV KD VHUYLGR GH EDVH SDUD HODERUDU GHQWUR GHO iPELWR GH OD
3VLFRORJtD 6RFLDO DSOLFDGD D OD HGXFDFLyQ QXHVWUR &XHVWLRQDULR GH $FWLWXGHV
$FDGpPLFDV &$$)8  HVXQDDGDSWDFLyQGHO7HVW$OID6FX\DIXHU]DUHVLGHHQOD
FDSDFLGDGSDUDSUHGHFLUHOUHQGLPLHQWRGHXQHVWXGLDQWHIRUWDOHFLHQGRORVFULWHULRVGH
YDOLGH]H[WHUQD

(OFXHVWLRQDULR$/)$6 (Cuestionario de Hábitos y Actitudes Escolares, Forma S),


GHVDUUROODGR SRU 0DUWtQ   KD VLGR UHQRYDGR HQ  VH DSOLFD HQ VX YHUVLyQ
$/)$6 DORVHVWXGLDQWHVFRQHGDGHVDSDUWLUGHORVHQDGHODQWH/DGXUDFLyQGH
OD DSOLFDFLyQ OOHYD DSUR[LPDGDPHQWH XQRV  \  PLQXWRV VLQ OD SUHVLyQ GHO
WLHPSR \D TXH QR HV YDULDEOH GHWHUPLQDQWH DTXt OR LPSRUWDQWH HV OHHU

101

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

FRPSUHQVLYDPHQWH FDGDFXHVWLyQ\VHOHFFLRQDUODRSFLyQGHUHVSXHVWDPiVDGHFXDGD
D OD IRUPD GH VHU SHQVDU \ VHQWLU GHO VXMHWR HV GHFLU FRPR VXFHGH HQ FDGD XQR OD
VLWXDFLyQTXHVHSUHVHQWD

3UHWHQGHPRV DQDOL]DU SDUD LGHQWLILFDU ORV SXQWRV IXHUWHV \ GpELOHV GH FDGD HVWXGLDQWH
SDUD RULHQWDUOH PHMRU HQ VXV DFWLYLGDGHV GH DSUHQGL]DMH ([SORUD ODV $FWLWXGHV
3HUVRQDOHVTXHWLHQHUHVSHFWRGHOD(QVHxDQ]D\HO3URIHVRUDGRHQUHODFLyQDGRViUHDV
OD HQVHxDQ]D 5pJLPHQ 'LVFLSOLQDU 0RWLYDFLyQ DQWH HO HVWXGLR &RQWHQLGRV GH OD
(QVHxDQ]D\(YDOXDFLRQHV \HQUHODFLyQFRQHOSURIHVRUDGRVXQLYHOGH&RPSUHQVLyQ
GH$XWRULWDULVPRGH([LJHQFLD\GHVXIRUPDGHHYDOXDU

7RPDQGRFRPRUHIHUHQFLDHOGHVDUUROODGRGHP~OWLSOHVLQVWUXPHQWRVGHHYDOXDFLyQ
GH ODV HVWUDWHJLDV HQ HO iPELWR GHO DSUHQGL]DMH GHVFULWRV DOJXQRV GH HOORV HQ
FDStWXORV SUHFHGHQWHV VH KD RSWDGR SRU XWLOL]DU XQ FXHVWLRQDULR TXH WUDWH GH XQ
PRGR JOREDO ODV DFWLWXGHV KDFLD HO SURFHVR GH IRUPDFLyQDSUHQGL]DMH GDGD OD
LPSRUWDQFLD TXH OH KHPRV DWULEXLGR SDUD DOFDQ]DU XQ QLYHO GH FRPSURPLVR \
HVIXHU]R FRJQLWLYR VX LQFLGHQFLD HQ OD FDOLGDG DGDSWDFLyQ QLYHO GH DSUHQGL]DMH
GHVDUUROORSVLFRVRFLDO\SHUVLVWHQFLDDFDGpPLFD6HKDWRPDGRFRPRUHIHUHQFLDHVWH
SODQWHDPLHQWRGHELGRDODIXQFLRQDOLGDGGHORVGDWRVTXHODVHYDOXDFLRQHVKDQLGR
FRQILUPDQGR GXUDQWH ORV DxRV HQ TXH VH KD DSOLFDGR D HVWXGLRV GH DOXPQRV
XQLYHUVLWDULRV

$SDUWLUGHODVLQYHVWLJDFLRQHVRULJLQDOHV\GHOGHVDUUROORFRQFHSWXDO\PHWRGROyJLFRGH
OD 3VLFRORJtD 6RFLDO KHPRV RUJDQL]DGR HO PDWHULDO HQ GRV iUHDV UHODFLRQDGDV FRQ ODV
DFWLWXGHV VRFLRDIHFWLYDV /DV PXHVWUDV XWLOL]DGDV FRUUHVSRQGLHQWHV D ORV GLVWLQWRV
QLYHOHV GH HQVHxDQ]D IXHURQ GH  VXMHWRV GH DPERV JpQHURV \ OD IXQGDPHQWDFLyQ
HVWDGtVWLFDUHDOL]DGDSRU0DUWtQ  HQVXVLQYHVWLJDFLRQHVQRVDSRUWDGDWRVYiOLGRV
VREUHODVHVWUDWHJLDVGHORVVXMHWRVVRPHWLGRVDHVWDVSUXHEDV

/RVFRHILFLHQWHVGHILDELOLGDGFDOFXODGRVHQORVFXDWURIDFWRUHVPHGLDQWHORVPpWRGRV
GH ³ODV GRV PLWDGHV´ \ ³WHVWUHWHVW´ RVFLODURQ HQWUH  \  \ OD YDOLGH]
LQWUtQVHFDPRVWUDGDSRUHODQiOLVLVGHORVHOHPHQWRVHVHVWDGtVWLFDPHQWHSRVLWLYD(Q
FXDQWR DO DQiOLVLV IDFWRULDO ODV YDULDEOHV IRUPDQ XQ continuo GH FRYDULDFLyQ GDGR
TXH WRGRV ORV FRHILFLHQWHV GH LQWHUUHODFLyQ VRQ SRVLWLYRV \ HVWDGtVWLFDPHQWH
VLJQLILFDWLYRV D OD YH] TXH VH REVHUYD GHSHQGHQFLD HQWUH ODV YDULDEOHV FRQ XQD

102
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

UHODFLyQ SRVLWLYD \ OLQHDO HQWUH HOODV HV GHFLU H[LVWH XQD LQWHUDFFLyQ GHQWUR GH XQD
HVWUXFWXUDVLPSOHHQODTXHODFXDQWtDGHORVSHVRVGHFDGDYDULDEOHHVWDEOHFHODMHUDUTXtD
GHOVLJXLHQWHRUGHQRVFLODQGRHQWUHDSRU~OWLPRODYDOLGH]H[WUtQVHFDVH
FDOFXOyPHGLDQWHODEscala de Valoración DSOLFDGDDH[SHUWRVTXHFRQRFtDQODVLWXDFLyQ
GHORVVXMHWRVDORVTXHVHOHVDSOLFyHOLQVWUXPHQWRUHVXOWDQGRXQLQVWUXPHQWR~WLO SDUD
HVWDEOHFHU FRPSDUDFLRQHV HQWUH OR TXH FDGD VXMHWR SLHQVD GH Vt \ OR TXH RSLQDQ GH pO
TXLHQHVOHFRQRFHQGHPDQHUDPiVFHUFDQD

(Q ODV )LJXUDV VLJXLHQWHV SUHVHQWDPRV OD YDORUDFLyQ FXDOLWDWLYD HQ IXQFLyQ GH ORV
SRVLEOHV UHVXOWDGRV ELSRODUHV TXH SXHGHQ OOHJDU D DOFDQ]DU ORV VXMHWRV D TXLHQHV YD
GLULJLGRHOSUHVHQWH&XHVWLRQDULR

$&7,78'(6 +$&,$ (/ &(1752

Analiza la valoración cognitiva y afectiva que el estudiante hace del centro respecto a la aceptación del
régimen de disciplina, motivación por la actividad educativa que realiza, sistemas de aprendizaje
establecidos, resultados que obtiene y los criterios de evaluación utilizados.
38178$&,Ï1%$-$ 38178$&,Ï1$/7$
(VXQHVWXGLDQWHTXHHQHOFHQWUR
$FHSWD QHJDWLYDPHQWH OD GLVFLSOLQD DSOLFDGD $FHSWD FRQ DJUDGR OD GLVFLSOLQD HQWLHQGH TXH KD\
FRQVLGHUD TXH QR KD\ OLEHUWDG GH HOHFFLyQ QR VH OLEHUWDG SDUD KDFHU SURSXHVWDV GH IXQFLRQDPLHQWR
GDQ RSRUWXQLGDGHV HO FHQWUR QR VDWLVIDFH VXV VH GDQ RSRUWXQLGDGHV D ORV HVWXGLDQWHV \ HO FHQWUR
QHFHVLGDGHV\KD\SRFDGHPRFUDFLD VDWLVIDFHVXVQHFHVLGDGHVHGXFDWLYDV
+DFH SRFR SRU HVWDU HQ IRUPD WLHQGH DO 6DEH PDQWHQHUVH HQ IRUPD SDUWLFLSD DFWLYDPHQWH
DEVHQWLVPR QR VH HVIXHU]D QLYHO GH DFWLYDFLyQ HQ ODV DFWLYLGDGHV VH GHGLFD SOHQDPHQWH D ODV
LQDGHFXDGR \ QR GLVIUXWD FRQ OD DFWLYLGDG TXH DFWLYLGDGHV GHO FHQWUR VDEH FRQWURODU VXV HVWDGRV
UHDOL]D HPRFLRQDOHV \ GLVIUXWD FRQ ODV DFWLYLGDGHV
5HFKD]D ORV VLVWHPDV GH DSUHQGL]DMH FRQVLGHUD HGXFDWLYDVTXHUHDOL]D
SRFR ~WLO OR TXH VH KDFH \ HQWLHQGH TXH ORV $FHSWDORVVLVWHPDVGHDSUHQGL]DMHSLHQVDTXHVRQ
DSUHQGL]DMHVWLHQHQSRFDDSOLFDFLyQSUiFWLFD ~WLOHV \ WLHQHQ DSOLFDFLyQ HQ OD SUiFWLFD HGXFDWLYD
1RDFHSWDODHYDOXDFLyQTXHVHKDFHGHOFHQWURQL TXHUHDOL]DHQHOFHQWUR
GHORVHVWXGLDQWHVFRQVLGHUDTXHIDOWDREMHWLYLGDG $FHSWD ORV UHVXOWDGRV TXH REWLHQH HQ HO FHQWUR \
HQ OD HYDOXDFLyQ \ RSLQD TXH ORV UHVXOWDGRV TXH FRQVLGHUD TXH KD\ REMHWLYLGDG HQ OD IRUPD GH
REWLHQHHQHOFHQWURQRVRQSRVLWLYRV YDORUDU OD KDELOLGDG \ HO UHQGLPLHQWR GH ORV
HVWXGLDQWHVHQHOFHQWUR

)LJXUD  Elementos asociados a las Estrategias Socio-afectivas hacia el Centro, según


Izquierdo. Nota: adaptado de Izquierdo, 2004. Tesis Doctoral no publicada.

103

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

$&7,78'(6 +$&,$ (/ 352)(625


Evalúa la capacidad de comprensión que tiene el profesor, la manera en la que ejerce su autoridad, el
nivel de exigencia que impone a los estudiantes y la aceptación de los criterios de valoración que hace
de los estudiantes a la hora de competir y realizar la práctica educativa.
38178$&,Ï1%$-$ 38178$&,Ï1$/7$
(VXQHVWXGLDQWHTXHFRQVLGHUDTXHHOSURIHVRU
/HFXHVWDOOHJDUDORVHVWXGLDQWHVVHOHYHDOHMDGR (V FRPXQLFDWLYR GD FRQILDQ]D PDQLILHVWD LQWHUpV
GHOJUXSRODVLQVWUXFFLRQHVTXHGDVRQFRQIXVDV\ SRU ORV HVWXGLDQWHV UHVSHWD OD KDELOLGDG GH FDGD
QRIDFLOLWDODFRPSUHQVLyQGHODVWDUHDVHGXFDWLYDV XQR HV FODUR HQ VXV LQVWUXFFLRQHV \ IDFLOLWD OD
DUHDOL]DU FRPSUHQVLyQGHODVWDUHDVHGXFDWLYDV
3UHVXPH GH VX DXWRULGDG XWLOL]D VXV FULWHULRV 6DEHDGDSWDUVXDXWRULGDGWLHQHDSHUWXUDPHQWDOQR
WLHQGHDSRQHUHQHYLGHQFLDDORVHVWXGLDQWHV\QR ULGLFXOL]D D ORV HVWXGLDQWHV \ WLHQH HQ FXHQWD ODV
WLHQHHQFXHQWDODVRSLQLRQHVGHORVGHPiV RSLQLRQHVGHORVGHPiV
/RVHVWXGLDQWHVGHEHQDGDSWDUVHDVXVH[LJHQFLDV 6H DGDSWD D ODV VLWXDFLRQHV PRGXOD OD FDUJD GH
KD\ TXH KDFHU OR TXH pO GLFH \ QR GD IDFLOLGDGHV WUDEDMRDUHDOL]DUUHVSHWDDORVHVWXGLDQWHV\IDFLOLWD
SDUD KDFHUODVDFWLYLGDGHVHGXFDWLYDV ODVWDUHDVDUHDOL]DU
1RHVREMHWLYRHQODYDORUDFLyQGHORVHVWXGLDQWHV 9DORUDODVGLIHUHQFLDVLQGLYLGXDOHVODSDUWLFLSDFLyQ
UHVSHFWR D OD SDUWLFLSDFLyQ UHQGLPLHQWR R JUDGR GH ORV HVWXGLDQWHV HO JUDGR GH VDWLVIDFFLyQ \ HO
GHVDWLVIDFFLyQ UHQGLPLHQWR(VREMHWLYRYDORUDQGRDVXVSXSLORV

)LJXUD Elementos asociados a las Estrategias Socio-afectivas hacia el Profesor. Según


Izquierdo. Nota: adaptado de Izquierdo (2004).Tesis Doctoral no publicada.

/RVFRPSRQHQWHVGHVFULWRVHQUHODFLyQDOiPELWRGHODHGXFDFLyQVXSHULRU FRQVWLWX\HQ
XQDGHODVRULHQWDFLRQHVFUHFLHQWHVHQLQYHVWLJDFLRQHV\SXEOLFDFLRQHVHVSHFLDOL]DGDVGH
SVLFRORJtDVRFLDOGHODHGXFDFLyQWDO\FRPRKHPRVVHxDODGRDQWHULRUPHQWH

(VWDLQIRUPDFLyQQRVSHUPLWHVHxDODUTXHODVDFWLYLGDGHVTXHVHHVWiQOOHYDQGRDFDER
HQ HO XVR GH HVWUDWHJLDV SVLFRVRFLDOHV DSOLFDGDV D OD DFWLYLGDG DFDGpPLFD FRQVWLWX\HQ
DFWXDOPHQWH XQD GH ODV OtQHDV GH LQYHVWLJDFLyQ HQ SVLFRORJtD VRFLDO GH OD (GXFDFLyQ
GRQGHFLHUWRVDVSHFWRVFRJQLWLYRVVHHVWiQXWLOL]DQGRFRPRPRGXODGRUHVTXHGDQOXJDU
DOp[LWRRIUDFDVRGHODH[SHULHQFLDHGXFDWLYDHLQWHJUDFLyQDFDGpPLFDGHORVHVWXGLDQWHV
GHHGXFDFLyQVXSHULRUH[SOLFDQGRODVUD]RQHVGHDPEDVVLWXDFLRQHV

(VWUXFWXUDIRUPDOGHO&$$)8

/DYHUVLyQILQDOGHO&XHVWLRQDULRGH$FWLWXGHV$FDGpPLFDV &$$)8 HVWiFRPSXHVWD


SRU  tWHPV HQ OD )RUPD &HQWUR \  tWHPV HQ OD )RUPD 3URIHVRU GLYLGLGDV HQ 
PDWLFHVFDGDXQRGHORVFXDOHVVHFRPSRQHGHtWHPV SDUDOD)RUPD&HQWUR\tWHPV
SDUD OD )RUPD 3URIHVRU $ VX YH] HVWRV PDWLFHV VH DJUXSDQ HQ FXDWUR FDWHJRUtDV GH
HVWUDWHJLDV GRV SDUD ODV FRJQLWLYDV \ GRV SDUD ODV VRFLRDIHFWLYDV TXH HQWHQGHPRV

104
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

UHIOHMDQ XQD SDUWH LPSRUWDQWH GH ODV DFWLYLGDGHV SVLFRVRFLDOHV TXH OOHYDQ D FDER ORV
HVWXGLDQWHVWDQWRHQORVDSUHQGL]DMHVFRPRHQODVDFWLYLGDGHV )LJXUD 

1XHVWUR REMHWLYR VH RULHQWD SRU WDQWR KDFLD ³YDULDEOHV PRGXODGRUDV´ FRQWH[WXDOHV \
VLWXDFLRQDOHV TXH SXHGHQ LQIOXLU HQ OD FDOLGDG GHO DMXVWH HGXFDWLYR HQ ODV FDSDFLGDGHV
FRJQLWLYDV \ UHODFLRQDOHV \ HVSHFLDOPHQWH HQ ODV IRUPDV GH UHDFFLRQDU GH ORV
HVWXGLDQWHVDQWHODVVLWXDFLRQHVFRQODVTXHWLHQHQTXHHQIUHQWDUVH

7RGRHOORVLQROYLGDUTXHORVHVWXGLDQWHVVRQSHUVRQDVQRUPDOHVTXHUHDOL]DQP~OWLSOHV
DFWLYLGDGHV HQ FRQWH[WRV H[WUDDFDGpPLFRV GLIHUHQWHV SRU OR TXH FRUUHVSRQGH D ORV
HYDOXDGRUHVGHODHGXFDFLyQ\DOSURIHVRUFRQRFHUODVYDULDEOHVSVLFRVRFLDOHVHQMXHJR
SDUDFRODERUDUFRQORVHVWXGLDQWHVHQVXIRUPDFLyQ\GHVDUUROORGHIRUPDFRQVWUXFWLYD\
VLJQLILFDWLYD

 $FHSWDFLyQGHODGLVFLSOLQD
0RWLYDFLyQSRUODDFWLYLGDG
(/&(1752
$FHSWDFLyQGHORVVLVWHPDVGHDSUHQGL]DMH
(675$7(*,$6 $SUREDFLyQGHORVUHVXOWDGRV
62&,2$)(&7,9$6
+$&,$
+DELOLGDGGHFRPXQLFDFLyQ
(VWLORGHOLGHUD]JR
(/352)(625
1LYHOGHH[LJHQFLD
6LVWHPDVGHHYDOXDFLyQ

)LJXUD  Estructura del Cuestionario de Actitudes Académicas (CAA-FU), según Martin
Nota: Adaptado de Martín (2003).

6L ELHQ VRPRV FRQVFLHQWHV GH OD H[LVWHQFLD GH HVWXGLRV VREUH IDFWRUHV GH SHUVRQDOLGDG
PXFKR PiV DPSOLRV TXH QXHVWUD SURSXHVWD SUHVHQWHV HQ RWUDV HVWUDWHJLDV TXH DTXt QR
HVWiQLQFOXLGDVHQWHQGHPRVTXHGLFKDVHVWUDWHJLDVHVWiQPiVELHQUHODFLRQDGDVFRQODV
KDELOLGDGHVGHVGHXQDRULHQWDFLyQFRJQLWLYRDSWLWXGLQDOORFXDOQRVLQGLFDTXHDFWXDPRV
GHELGDPHQWH DO GLULJLU QXHVWUR WUDEDMR KDFLD ODV HVWUDWHJLDV FRJQLWLYDV HQ HVWXGLDQWHV \
TXHSXHGHVHUFRPSDUDGRFRQHOUHVWRGHLQYHVWLJDFLRQHVTXHKR\GtDVHHVWiQOOHYDQGRD
FDER HQ HO WHUUHQR GH ODV DFWLWXGHV DFDGpPLFDV GHVGH XQ SXQWR GH YLVWD HGXFDWLYR \
HVWUDWpJLFR'HKHFKRHVWDOtQHDGHLQYHVWLJDFLyQVHHVWiFRQILJXUDQGRFRPRXQSXQWR
GHHQFXHQWURHQODV&LHQFLDVGHOD(GXFDFLyQ

(O&XHVWLRQDULR GH$FWLWXGHV $FDGpPLFDV &$$)8 esXQFXHVWLRQDULR GLVHxDGRSDUD


HYDOXDUODVHVWUDWHJLDVGHDSUHQGL]DMH\ODVDFWLWXGHVFRQWH[WXDOHVGHORVHVWXGLDQWHVHQ
JHQHUDO \ GH PDQHUD HVSHFLDO HQ ORV TXH GHVDUUROODQ VX DFWLYLGDG HQ HO PDUFR GH OD

105

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

(GXFDFLyQ6XSHULRUGHVGHODGLPHQVLyQFRJQLWLYD\DIHFWLYDHQFXHVWLRQHVUHODWLYDVDO
FHQWUR\HOSURIHVRU

7HyULFDPHQWHVHIXQGDPHQWDHQHOModelo de hábitos y actitudes %URZQ\+ROW]PDQ


  \ HQ HO Modelo de aprendizaje autorregulado 3LQWULFK ,Smith,García y
McKeachie,1991  DPERV LQWHJUDQ IDFWRUHVTXHLQIOX\HQHQHODSUHQGL]DMH\UHVDOWDQORV
IDFWRUHVFRJQLWLYRVDIHFWLYRV\VXVUHODFLRQHVDVtFRPRODVYDULDEOHVTXHHMHUFHQLQIOXHQFLD
HQODLPSOLFDFLyQGHOHVWXGLDQWH HQHODSUHQGL]DMH\UHQGLPLHQWRDFDGpPLFR

(QUHODFLyQDODVHVWUDWHJLDVFRJQLWLYDVTXHORVHVWXGLDQWHVXWLOL]DQSDUDORJUDUXQEXHQ
DSUHQGL]DMH \ UHQGLPLHQWR VH WLHQHQ HQ FXHQWD ODV HVWUDWHJLDV VRFLRDIHFWLYDV
UHODFLRQDGDVFRQODIRUPDFLyQGHDFWLWXGHVKDFLDHOFHQWUR\KDFLDHOSURIHVRU

%DMRQXHVWUDFRQVLGHUDFLyQODQHFHVLGDGGHOFXHVWLRQDULRGHHVWUDWHJLDVDFDGpPLFDVHQ
ODGLPHQVLyQSVLFRVRFLDOVHEDVDHQHOKHFKRGHTXHORVVXMHWRVSRVHHQKDELOLGDGHVTXH
QR OOHJDQ D GHVDUUROODU SOHQDPHQWH VXV SRWHQFLDOLGDGHV GiQGRVH OD SDUDGRMD GH TXH
H[LVWHQVXMHWRVTXHWLHQHQKDELOLGDGHVVXILFLHQWHV\IUDFDVDQPLHQWUDVRWURVFRQQLYHOHV
LQIHULRUHVGHKDELOLGDGHVHGXFDWLYDVREWLHQHQXQJUDQUHQGLPLHQWRDFDGpPLFR

3RUWDQWRHOXVRGHOSUHVHQWHFXHVWLRQDULRSXHGHIDYRUHFHUXQDPHMRUFRPSUHQVLyQGHOD
DFFLyQGHORV HVWXGLDQWHVDSDUWLUGHOGLDJQyVWLFRGHDTXHOODVHVWUDWHJLDV\DFWLWXGHVTXH
FRQVLGHUDPRV WLHQHQ UHODFLyQ H[SOtFLWD H LPSOtFLWD FRQ OD FRPSHWHQFLD HGXFDWLYD VLQ
ROYLGDU TXH H[LVWHQ RWUDV YDULDEOHV LPSOLFDGDV HQ HO SURFHVR FRQ OR TXH HVWDUHPRV HQ
FRQGLFLRQHV GH LQIRUPDU \ IDFLOLWDU HO DSUHQGL]DMH HYLWDQGR GHQWUR GH OR SRVLEOH HO
IUDFDVR DFDGpPLFR &RQ HVWH LQVWUXPHQWR HO H[SHUWR HGXFDWLYR \ HO GRFHQWH SRGUtDQ
FRPSOHWDUHOFRQRFLPLHQWRGHORVDOXPQRVGHVXVDFWLWXGHVHGXFDWLYDVKDFLDHOSURFHVR
GH HQVHxDQ]D DSUHQGL]DMH GRWiQGROHV GH HVWUDWHJLDV GH DSR\R QHFHVDULDV SDUD TXH
SXHGDQ FRPSOHPHQWDU VX DFWLYLGDG FRJQLWLYD \ HQ FDVR QHFHVDULR HVWLPXODQGR HO
DSUHQGL]DMHPHGLDQWHODIRUPDFLyQGHJUXSRVGLIHUHQFLDGRVGHWUDEDMR\DFWLYLGDG\GH
ODIRUPXODFLyQGHSURQyVWLFRVGHUHQGLPLHQWRHQFDGDQLYHOHGXFDWLYR

(QGHILQLWLYDVHSUHWHQGHXQDDSUR[LPDFLyQDODXWLOL]DFLyQGHGHVWUH]DVSVLFRVRFLDOHV
HQHOFDPSRGHODHGXFDFLyQ$XQTXHWUDGLFLRQDOPHQWHORVSURJUDPDVGHDSUHQGL]DMHVH
FHQWUDEDQFDVLSRUFRPSOHWRHQORVDVSHFWRVGLUHFWDPHQWHOLJDGRVFRQODFRJQLFLyQHQOD
DFWXDOLGDGVHYDWRPDQGRFRQFLHQFLDGHODLPSRUWDQFLDGHODSUHSDUDFLyQSVLFRVRFLDO\
GHVGH OD SVLFRORJtD VRFLDO VH HVWiQ UHDOL]DQGR VLJQLILFDWLYRV DYDQFHV HQ HO

106
&$3Ë78/2 /$(9$/8$&,Ï1'(/$35(1',=$-(

HVFODUHFLPLHQWR GH ORV IDFWRUHV TXH IDYRUHFHQ HO UHQGLPLHQWR DFDGpPLFR OR TXH KD
VXSXHVWR TXH ORV SURIHVRUHV FRQVLGHUHQ GH PRGR JUDGXDO HVWRV KDOOD]JRV 6LQ
HPEDUJRD~QTXHGDFDPLQRSRUUHFRUUHUKDVWDTXHORVFRQRFLPLHQWRVSVLFRVRFLDOHV
UHODFLRQDGRV FRQ ODV HVWUDWHJLDV VRFLRFRJQLWLYDV FULVWDOLFHQ GHILQLWLYDPHQWH HQ HO
iPELWRHGXFDWLYR

(Q VtQWHVLV HO REMHWLYR JHQHUDO GH QXHVWUD LQYHVWLJDFLyQ HV UHJLVWUDU \ DQDOL]DU OD
LQIRUPDFLyQ GH PDQHUD VLVWHPiWLFD \ RUGHQDGD VREUH ODV DFWLWXGHV UHVSHFWR DO FHQWUR
HGXFDWLYR \ HO SURIHVRU LQIOX\HQWHV HQ ORV SURFHVRV \ UHVXOWDGRV GHO DSUHQGL]DMH TXH
SRVHHQ ORV HVWXGLDQWHV GH (GXFDFLyQ 6XSHULRU HQ ODV PRGDOLGDGHV SUHVHQFLDO \ D
GLVWDQFLD

/DV SRVLELOLGDGHV GHO SURFHVR GH IRUPDFLyQDSUHQGL]DMH SRGUtDQ PHMRUDU


SUHYLVLEOHPHQWH VREUH OD EDVH GHO FRQRFLPLHQWR TXH VH WLHQH GH OR TXH ORV HVWXGLDQWHV

SLHQVDQ VLHQWHQ \ KDFHQ UHVSHFWR DO QLYHO GH KDELOLGDG PHQWDO TXH WLHQHQ \ VX
GLVSRVLFLyQ D IDYRUHFHU OD FRRUGLQDFLyQ SRVLWLYD FRQ HO JUXSR HQ FODVH \ HO SURIHVRU
FRPRUHVSRQVDEOHGHVXIRUPDFLyQDFDGpPLFD\SHUVRQDO

(OORSHUPLWLUiOOHYDUDFDERHOSURQyVWLFRGHODVFRQVHFXHQFLDVSUHYLVLEOHVHQFXDQWR
DO UHQGLPLHQWR DFDGpPLFR \ ILQDOPHQWH DFWXDU GH IRUPD FRKHUHQWH PHGLDQWH OD
HODERUDFLyQ GH RSRUWXQDV HVWUDWHJLDV GH DIURQWDPLHQWR \ WpFQLFDV GH LQWHUYHQFLyQ
SDUD FDPELDU ODV DFWLWXGHV TXH LPSLGHQ DYDQ]DU HQ OD PHMRUD GH OD FDOLGDG GH ODV
DFWLYLGDGHVHGXFDWLYDVGHORVFHQWURV\HTXLSRVGRFHQWHV6HWUDWDGHDIURQWDUXQUHWR
TXH HQWUDxD DXWpQWLFDV GLILFXOWDGHV SDUD OD SLVFRORJtD VRFLDO \D TXH WDQWR ODV
HVWUDWHJLDV HGXFDWLYDV FRPR ODV DFWLWXGHV IRUPDQ SDUWH GH OD ELRJUDItD SHUVRQDO GHO
HVWXGLDQWH \ HO FDPELR GH DFWLWXGHV HV XQD WDUHD TXH UHTXLHUH GH KHUUDPLHQWDV \
UHFXUVRV HGXFDWLYRV GH DSR\R TXH FRDG\XYHQ DO GHVDUUROOR LQWHJUDO GHO HVWXGLDQWH
FRPRIXWXURGLVFHQWH\SURIHVLRQDO

6H KD UHDOL]DGR XQ HVIXHU]R GH VtQWHVLV SDUD DUWLFXODU HO HQWUDPDGR TXH VXSRQH OD
HYDOXDFLyQSVLFRVRFLDOFRPRHVWUDWHJLDGHDSR\RDODLQYHVWLJDFLyQHQ3VLFRORJtD6RFLDO
\ FHQWUiQGRQRV HQ ORV DVSHFWRV HVHQFLDOHV GH FDUD D ORV REMHWLYRV GH OD SUHVHQWH
LQYHVWLJDFLyQ

/D3VLFRORJtD6RFLDOHQVXRULHQWDFLyQGHHYDOXDFLyQVHKDFDUDFWHUL]DGRHVSHFLDOPHQWH
SRU OD LQWHQVLGDG GH ODV LQYHVWLJDFLRQHV DO UHVSHFWR \ SRU OD SUROLIHUDFLyQ GH

107

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

LQVWUXPHQWRV GH HYDOXDFLyQ \ GLDJQyVWLFR TXH VH KDQ GHVDUUROODGR SDUD HYDOXDU HO
GRPLQLR \ OD XWLOL]DFLyQ GH KDELOLGDGHV GHVWUH]DV \ HVWUDWHJLDV SVLFRVRFLDOHV HQ ORV
VXMHWRV TXH SDUWLFLSDQ HQ ODV GLIHUHQWHV DFWLYLGDGHV HGXFDWLYDV \ VXV FRQWH[WRV
FRUUHVSRQGLHQWHV

$ SDUWLU GHO HQFXDGUH PHWRGROyJLFR JHQHUDO ODV UHIHUHQFLDV PHWRGROyJLFDV VREUH HO
PDUFR WHyULFR \ ODV PHWRGRORJtDV HPSOHDGDV VH KD HVFRJLGR HQWUH OD YDULHGDG GH
LQVWUXPHQWRV WpFQLFRV GHVFULWRV DTXpO TXH PHMRU VH DGHFXD D ORV REMHWLYRV GH OD
HYDOXDFLyQ \ GH OD QHFHVLGDG GH LQIRUPDFLyQ GH OD SUHVHQWH LQYHVWLJDFLyQ $Vt HQ
QXHVWURFDVRFHQWUDPRVODDWHQFLyQHQHOFRQRFLPLHQWRHVWUDWpJLFRGHORVHVWXGLDQWHVD
WUDYpV GH OD DSOLFDFLyQ GH XQ FXHVWLRQDULR GHO WLSR DXWRLQIRUPH RULHQWDGR KDFLD ODV
HVWUDWHJLDVGHLQWHUYHQFLyQ

/RV REMHWLYRV TXH VH KDQ GHVFULWR PDUFDQ OD SDXWD GH QXHVWUD LQYHVWLJDFLyQ \ OD
LQWHQFLyQ GH QXHVWUR WUDEDMR PLHQWUDV TXH ODV YDULDEOHV REMHWR GH DQiOLVLV FHQWUDQ OD
LQYHVWLJDFLyQHQDVSHFWRVFRQFUHWRVDLQYHVWLJDU\ODVKLSyWHVLVIRUPXODGDVFRQVWLWX\HQ
XQD SULPHUD DSUR[LPDFLyQ D QXHVWURV SRVWXODGRV GH FyPR VH VXFHGHQ ORV
DFRQWHFLPLHQWRV\VHUiQFRQILUPDGDVRQRGHVSXpVGHODQiOLVLVGHORVGDWRV

'HQWURGHOSODQWHDPLHQWRGHREMHWLYRVHKLSyWHVLVVHKDGDGRFXHQWDGHORVSDVRVTXHVH
KDQOOHYDGRDFDERSDUDGHVFXEULUODVLQIOXHQFLDVPXWXDVGHODVYDULDEOHVFRQVLGHUDGDV
LPSRUWDQWHVSDUDHODGHFXDGRGHVDUUROORGHODVHVWUDWHJLDVVRFLRDIHFWLYDVTXHLQIOX\HQ
ODDFWLYLGDGDFDGpPLFD\VXDSUHQGL]DMH

/RVLQVWUXPHQWRVXWLOL]DGRVSDUDUHDOL]DUHOWUDEDMRWDQWRHQODIDVHGHDSOLFDFLyQFRPR
HQODGHSURFHVDPLHQWRGHODLQIRUPDFLyQVRQORVTXHQRUPDOPHQWHVHXWLOL]DQHQHVWH
WLSRGHLQYHVWLJDFLRQHVSVLFRVRFLDOHV$VLPLVPRHOSURFHGLPLHQWRVHJXLGRDORODUJRGH
GH OD SUHVHQWH DFWLYLGDG GHILQH FRQ FODULGDG ORV PRPHQWRV \ ODV IDVHV SRU ODV TXH KD
SDVDGR KDVWD OOHJDU DO SUHVHQWH SXQWR GH UHIOH[LyQ TXH SURSRUFLRQD OD LQIRUPDFLyQ
GHVHDGDRHQFRQWUDGDSDUDODSUR\HFFLyQIXWXUD

108
Capítulo 5
',6(f20(72'2/Ï*,&2
'(/$,19(67,*$&,Ï1'(
$&7,78'(6
&$3Ë78/2 ',6(f20(72'2/Ï*,&2'(/$,19(67,*$&,Ï1'($&7,78'(6

,1752'8&&,Ï1

6LDFHSWDPRVTXHHVQHFHVDULRXQQLYHOGHGHVDUUROORSHUVRQDO\DFDGpPLFRH[SUHVDGR
HQ DGHFXDGDV GLVSRVLFLRQHV FRJQLWLYDV \ DIHFWLYDV KDFLD HO SURFHVR GH HQVHxDQ]D
DSUHQGL]DMH H LGHQWLILFDGDV FRPR FRPSHWHQFLDV DFWLWXGLQDOHV SRGHPRV HQWHQGHU OD
QHFHVLGDG GH GLVSRQHU GH LQIRUPDFLyQ SUHFLVD SDUD VDEHU \ FRQRFHU ODV DFWLWXGHV
UHODFLRQDGDVFRQODDFWLYLGDGDFDGpPLFDTXHOOHYDQDFDERGHORVVXMHWRVTXHVRQREMHWR
GHQXHVWUDLQYHVWLJDFLyQ(QWHQGHPRVTXHGLFKDVFRPSHWHQFLDVDFWLWXGLQDOHVVRQSLH]D
IXQGDPHQWDOSDUDHODSUHQGL]DMHGHWpFQLFDV\HVWUDWHJLDVGHSHQVDPLHQWR\DFFLyQWDQWR
DQLYHOLQGLYLGXDOFRPRGHJUXSR

(Q OD SUHVHQWH LQYHVWLJDFLyQ VH HPSOHD HO &XHVWLRQDULR GH $FWLWXGHV $FDGpPLFDV
DSOLFDGR D HVWXGLDQWHV XQLYHUVLWDULRV &$$)8  GHULYDGR GHO &XHVWLRQDULR ALFA-
Versión 2011 y GHVDUUROODGR SRU 0DUWtQ   (O FXHVWLRQDULR DQDOL]D \ IDFLOLWD OD

ORFDOL]DFLyQ GH ORV SXQWRV GpELOHV TXH FDGD DOXPQR XQLYHUVLWDULR SXHGD WHQHU HQ HO
SURFHVRGHDSUHQGL]DMH([SORUDODV$FWLWXGHV3HUVRQDOHVKDFLDHO&HQWUR$FDGpPLFR\
HO3URIHVRUDGR

'H PDQHUD TXH HO REMHWLYR SULQFLSDO GH OD SUHVHQWH LQYHVWLJDFLyQ HV FRQRFHU ODV
DFWLWXGHV KDFLD HO FHQWUR DFDGpPLFR \ HO SURIHVRU FHQWUDQGR QXHVWUD DWHQFLyQ HQ
DYHULJXDU TXp VXFHGH FRQ ODV YDULDEOHV REMHWR GH HVWXGLR PHGLDQWH HO DQiOLVLV GH ODV
GLIHUHQFLDV HQWUH ODV DFWLWXGHV GH ORV HVWXGLDQWHV \ VX LQIOXHQFLD HQ HO SURFHVR GH
HQVHxDQ]DDSUHQGL]DMH 7DPELpQ EDMR HVWDV SUHPLVDV QRV GLVSRQHPRV HQ HVWD
LQYHVWLJDFLyQ D YDOLGDU XQD DGDSWDFLyQ GHO FXHVWLRQDULR &XHVWLRQDULR ALFA-Versión
2011 y GHVDUUROODGRSRU0DUWtQ  

'HVGH HO DxR  LQLFLDPRV QXHVWUD DFWLYLGDG GH UHFRSLODFLyQ GH GDWRV HQ OD
&RPXQLGDG $XWyQRPD GH &DQDULDV KDVWD HO DxR  FRQ HO REMHWR GH FRQWULEXLU DO
FRQRFLPLHQWR VLVWHPiWLFR GH ODV YDULDEOHV DFWLWXGLQDOHV GH ORV HVWXGLDQWHV KDFLD HO
&HQWUR $FDGpPLFR \ HO 3URIHVRU TXH FRQVWLWX\HQ DVSHFWRV VLJQLILFDWLYRV GHQWUR GHO
SURFHVRGHHQVHxDQ]DDSUHQGL]DMH

(Q HO SUHVHQWH FDStWXOR VH GD FXHQWD GH ORV SDVRV TXH VH KDQ UHDOL]DGR FRQ HO
LQVWUXPHQWR GH HYDOXDFLyQ DFWLWXGLQDO HPSOHDGR FX\D ILQDOLGDG HV GHVFXEULU ODV
LQIOXHQFLDV PXWXDV GH ODV YDULDEOHV FRQVLGHUDGDV LPSRUWDQWHV SDUD HO DGHFXDGR
GHVDUUROORGHODVDFWLYLGDGHVLQYROXFUDGDVHQHOSURFHVRGHHQVHxDQ]D-DSUHQGL]DMH

111

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

/RV REMHWLYRV TXH VH GHVFULEHQ PDUFDQ OD SDXWD GH OD LQYHVWLJDFLyQ \ OD LQWHQFLyQ GHO
SUHVHQWHWUDEDMRPLHQWUDVTXHODVYDULDEOHVREMHWRGHDQiOLVLVFHQWUDQODLQYHVWLJDFLyQHQ
DVSHFWRVFRQFUHWRVDLQYHVWLJDU\ODVKLSyWHVLVIRUPXODGDVFRQVWLWX\HQHOSXQWRdH SDUWLGD
TXHUHIOHMDODFUHHQFLDGHFyPRVHVXFHGHQORVDFRQWHFLPLHQWRV\TXHVHUiQFRQILUPDGDV
R QRGHVSXpVGHOSRVWHULRUDQiOLVLVGHORVGDWRV

/RVVXMHWRVSDUWLFLSDQWHVHQODLQYHVWLJDFLyQKDQTXHGDGRVXILFLHQWHPHQWHGHILQLGRV
\ VRQ ORV TXH PDUFDQ ODV SDXWDV GH ORV DQiOLVLV HVWDGtVWLFRV TXH OOHYDUHPRV D FDER
/RV LQVWUXPHQWRV XWLOL]DGRV SDUD UHDOL]DU HO WUDEDMR WDQWR HQ OD IDVH GH DSOLFDFLyQ
FRPRHQODGHSURFHVDPLHQWRGHODLQIRUPDFLyQVRQORVTXHQRUPDOPHQWHVHXWLOL]DQ
HQHVWHWLSRGHLQYHVWLJDFLRQHVVDOYRODSURJUDPDFLyQGLVHxDGDSDUDIDFLOLWDUDOJXQR
GHORVSURFHVRV

(O GLVHxR \ SRVWHULRU WUDWDPLHQWR HVWDGtVWLFR HVWXYR HQ IXQFLyQ GH ODV QHFHVLGDGHV

SURSLDVGHOWLSRGHYDULDEOHVGLVSRQLEOHV\GHOHVWXGLRGHVXLQWHUDFFLyQ

6REUHHVWDEDVHVPHWRGROyJLFDVDFRQWLQXDFLyQVHGDFXHQWDGHOSURFHGLPLHQWRVHJXLGR
DORODUJRGHODLQYHVWLJDFLyQHQODTXHVHKDQGHILQLGRFRQFODULGDGORVPRPHQWRV\ODV
GLVWLQWDV IDVHV TXH KDQ WHQLGR OXJDU KDVWD OOHJDU D OD UHIOH[LyQ TXH SURSRUFLRQD OD
LQIRUPDFLyQHQFRQWUDGDSDUDODXWLOL]DFLyQIXWXUDEXVFDQGRVLHPSUHODIXQFLRQDOLGDG\
SXHVWDHQSUiFWLFDGHORVUHVXOWDGRVDOFDQ]DGRV

 2%-(7,926

(O 3UR\HFWR GH ,QYHVWLJDFLyQ DTXt SUHVHQWDGR WLHQH FRPR REMHWLYR SULQFLSDO DSOLFDU HO
FXHVWLRQDULR GH DFWLWXGHV DFDGpPLFDV GH HYDOXDFLyQ SVLFRVRFLDO D WUDYpV GHO
HVWXGLR GHVFULSWLYRy explicativo GH DTXHOODV YDULDEOHV TXH HQ SULQFLSLR
FRQVLGHUDPRVIDFLOLWDQODLGHQWLILFDFLyQGHODVFDUDFWHUtVWLFDVGHORVHVWXGLDQWHVXQLYHUVLWDULRV
UHODFLRQDGDVFRQOD YDORUDFLyQ \ H[SHFWDWLYDV \ VX UHOHYDQFLD FRQ HO DSUHQGL]DMH HO
GHVDUUROOR GH ORV HVWXGLDQWHV\HOUHQGLPLHQWRDFDGpPLFR

'HVGHHOSXQWRGHYLVWDPHWRGROyJLFRDQDOL]DPRVODVGLIHUHQWHVVLWXDFLRQHVTXHVHKDQ
UHJLVWUDGR YDULDEOHV VRFLRGHPRJUiILFDV  UHODFLRQiQGRODV FRQ ODV YDULDEOHV REMHWR GH
QXHVWUD LQYHVWLJDFLyQ DFWLWXGHV DFDGpPLFDV  &RQ HVWD RULHQWDFLyQ ODV WDUHDV TXH QRV
SURSRQHPRVVRQORVVLJXLHQWHV

112

&$3Ë78/2 ',6(f20(72'2/Ï*,&2'(/$,19(67,*$&,Ï1'($&7,78'(6

 'HVFULELPRVYDULDEOHVDFWLWXGLQDOHVHQHVWXGLDQWHVXQLYHUVLWDULRV
 $QDOL]DUODVDFWLWXGHVDFDGpPLFDVHQFRQWH[WRVXQLYHUVLWDULRV
 (YDOXDUODVDFWLWXGHVFRQGLFLRQDOHVEiVLFDVHQODXQLYHUVLGDG
 'LVFULPLQDPRVORVHOHPHQWRVVHJ~QODVFDUDFWHUtVWLFDVGHORVVXMHWRVHYDOXDGRV
 ,GHQWLILFDPRVVLH[LVWHQGLIHUHQFLDVVLJQLILFDWLYDVHQODVYDULDEOHVGLDQD REMHWR
GH QXHVWUD LQYHVWLJDFLyQ  HQ IXQFLyQ GH ODV YDULDEOHV VRFLRGHPRJUiILFDV
UHJLVWUDGDV 
 5HIOH[LRQDPRV D OD OX] GH ORV UHVXOWDGRV ORV HOHPHQWRV PiV VLJQLILFDWLYRV
FRQWUDVWiQGRORVFRQLQYHVWLJDFLRQHVSUHYLDV a niveles descriptivos y explicativos
 5HODFLRQDPRV ORV UHVXOWDGRV FRQ HVWUDWHJLDV GH DIURQWDPLHQWR SDUD GDU
IXQFLRQDOLGDG SUiFWLFD D QXHVWUD LQYHVWLJDFLyQ SDUD PHMRUDU ODV DFWLWXGHV
DFDGpPLFDVHQODXQLYHUVLGDG

/RV REMHWLYRV DQWHULRUHV PDUFDQ GH DOJXQD PDQHUD HO GLVHxR GH ODV DFWLYLGDGHV D
UHDOL]DUHQWUHODVTXHGHVWDFDPRVODVVLJXLHQWHV

9 ,GHQWLILFDFLyQ GH ODV YDULDEOHV GHPRJUiILFDV GH ORV HVWXGLDQWHV


HYDOXDGRV3DUDHOORVHKDGLVHxDGRXQDILFKDGHGDWRVGHLGHQWLILFDFLyQ
TXH HO VXMHWR FXPSOLPHQWD HQ OD SDUWH ILQDO GHO &XHVWLRQDULR \ TXH VRQ
SRVWHULRUPHQWHFRQWUDVWDGRVFRQORVSURIHVRUHVGHOFHQWUR
9 $SOLFDFLyQGHO&XHVWLRQDULRVLJXLHQGRHOULJRUHVWDEOHFLGRSDUDHVWHWLSR
GH DFWLYLGDG \ GHVHFKDQGR WRGRV DTXHOORV TXH QR KDQ VLGR UHDOL]DGRV
VHJ~Q GLFKR SURFHGLPLHQWR HVSHFLDOPHQWH ORV TXH QR KDQ UHVSRQGLGR D
WRGDV\FDGDXQDGHODVFXHVWLRQHVSODQWHDGDVHQHOPLVPR
9 8WLOL]DU XQ SURFHGLPLHQWR LQIRUPiWLFR SDUD OOHYDU D FDER HQ SULPHU
OXJDU OD IDVH GH UHJLVWUR \ FRUUHFFLyQ GH ODV UHVSXHVWDV FRQ HO REMHWLYR
GH HYLWDU HUURUHV GHELGRV DO IDFWRU KXPDQR IDWLJD IDOWD GH
FRQFHQWUDFLyQ VHVJRV HWF  \ HQ VHJXQGR OXJDU OD WUDQVIRUPDFLyQ GH
GLFKDV UHVSXHVWDV HQ SXQWXDFLRQHV GLUHFWDV GH FDGD XQD GH ODV (VFDODV
GHO&XHVWLRQDULR
9 'LVHxR HVWDGtVWLFR DSURSLDGR SDUD GHWHUPLQDU VL H[LVWHQ GLIHUHQFLDV
VLJQLILFDWLYDVHQODVFDUDFWHUtVWLFDVDFWLWXGLQDOHVHYDOXDGDV\VLHO&$$
)RUPD XQLYHUVLWDULRV FRQVWLWX\H XQ LQVWUXPHQWR DGHFXDGR SDUD OD

113

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

HYDOXDFLyQ GH ODV PLVPDV (Q FDVR DILUPDWLYR GLVSRQHPRV GH XQD
KHUUDPLHQWD GH HYDOXDFLyQ DFWLWXGLQDO DGDSWDGR D ORV HVWXGLDQWHV
XQLYHUVLWDULRV

'HVSXpVGHOOHYDUDFDERQXHVWUDDFWLYLGDGSUHWHQGHPRVHVWDEOHFHUSXQWRVGHUHIHUHQFLD SDUD OD


LQWHUSUHWDFLyQ FXDQWLWDWLYD GH ODV FDUDFWHUtVWLFDV DFWLWXGLQDOHVconfirmar teorías
previas\UHDOL]DU FRPSDUDFLRQHV HQWUH ODV SXQWXDFLRQHV DOFDQ]DGDV PHGLDQWH HO
HVWDEOHFLPLHQWRGHEDUHPRVGHOJUXSRQRUPDWLYRFRQORVTXHSRGHUHYDOXDUORVSXQWRVIXHUWHV\
GpELOHVGHORVHVWXGLDQWHVHQODVYDULDEOHVDQDOL]DGDV$VtSXHVVHUiQORVUHVXOWDGRVDQDOL]DGRV
ODGLVFXVLyQGHORVPLVPRV\ODVFRQFOXVLRQHVGHULYDGDVORVTXHQRVSHUPLWDQKDFHUODV
SUR\HFFLRQHVSHUWLQHQWHVSDUDDOFDQ]DUODXWLOLGDGGHQXHVWUDLQYHVWLJDFLyQ\SRQHUODDO
VHUYLFLRGHODVLQVWLWXFLRQHVDFDGpPLFDVLQWHUHVDGDV \GHDTXHOORVHVWXGLDQWHV TXHHVWpQ
GLVSXHVWRVDPHMRUDUVXIRUPDFLyQSHUVRQDO\SURIHVLRQDO


 9$5,$%/(62%-(72'((678',2

$ OD KRUD GH OD DSOLFDFLyQ GHO FXHVWLRQDULR KHPRV UHJLVWUDGR XQD VHULH GH GDWRV
SHUVRQDOHV\VRFLDOHVGHORVVXMHWRV\DTXHSXHGHQVHUGHLQWHUpVDODKRUDGHOOHYDUD
FDER GHWHUPLQDGDV LQYHVWLJDFLRQHV FRQ HVWXGLDQWHV XQLYHUVLWDULRV %LHQ SRU VHU XQ
UHJLVWUR D OR ODUJR GHO WLHPSR ELHQ SRUTXH QR WRGRV ORV VXMHWRV FRQWHVWDURQ D ODV
SUHJXQWDVGHHVWHWLSRIRUPXODGDVODVYDULDEOHVGHODVTXHVtGLVSRQHPRVGDWRV\TXHVH
YDQ D FRQVLGHUDU HQ ORV DQiOLVLV SRVWHULRUHV KDFHQ UHIHUHQFLD D ODV FDUDFWHUtVWLFDV
GHPRJUiILFDVGHORVVXMHWRVHQUHODFLyQFRQ

9 6H[R
9 7LSRGHHQVHxDQ]D
9 &HQWUR
9 &XUVRDFDGpPLFR
9 3UiFWLFDGHSRUWLYD
9 'HVHDVHJXLUHVWXGLDGR

$VXPLHQGR TXHVRQFLUFXQVWDQFLDVSUHYLDVDQXHVWUDLQYHVWLJDFLyQ\TXHQRSXHGHQ
VHUPDQLSXODGDVDOJXQDVGHHOODVVHUiQFRQVLGHUDGDVFRPRLQGLFDGRUHVDFWLWXGLQDOHV
GHORVXQLYHUVLWDULRVKDFLDHOFHQWUR\KDFLDORVSURIHVRUHV3RUVXSDUWHODVYDULDEOHV
FULWHULR YLHQHQ GHWHUPLQDGDV SRU ODV HVFDODV SURSLDV GHO &XHVWLRQDULR \ VRQ

114

&$3Ë78/2 ',6(f20(72'2/Ï*,&2'(/$,19(67,*$&,Ï1'($&7,78'(6

HVWLPDGDV D SDUWLU GH OD LQIRUPDFLyQ UHJLVWUDGD WHQLHQGR HQ FXHQWD TXH ODV
SXQWXDFLRQHVGLUHFWDVFRQVHJXLGDVLQIRUPDQGHORVYDORUHVTXHFDGDHVWXGLDQWH DOFDQ]D
\ TXH VyOR VRQ VLJQLILFDWLYDV FXDQGR VH FRPSDUDQ FRQ HO JUXSR QRUPDWLYR 6H KDQ
FRQVLGHUDGR ODV VLJXLHQWHV YDULDEOHV VREUH ODV DFWLWXGHV KDFLD HO &HQWUR \ YDULDEOHV
VREUHODVDFWLWXGHVKDFLDORVSURIHVRUHV

/DVYDULDEOHVDFWLWXGLQDOHVKDFLDHO&HQWURGH(VWXGLRVVRQ

9 $FHSWDFLyQGHODGLVFLSOLQD
9 0RWLYDFLyQSRUODDFWLYLGDG
9 $FHSWDFLyQGHORVVLVWHPDVGHHQVHxDQ]D
9 $SUREDFLyQGHORVUHVXOWDGRV

/DVYDULDEOHVDFWLWXGLQDOHVKDFLDDOSURIHVRUVRQ

9 +DELOLGDGGHFRPXQLFDFLyQ
9 (VWLORGHOLGHUD]JR
9 1LYHOGHH[LJHQFLD
9 6LVWHPDVGHHYDOXDFLyQ

 +,3Ï7(6,6

(Q SULPHU OXJDU VH UHDOL]D XQContrastedel Modelo Estructural DO REMHWR GH
FRQILUPDU OD WHRUtD FRQVLVWHQWH HQ TXH OD DFHSWDFLyQ GH ORV UHVXOWDGRV DFDGpPLFRV
GHSHQGHQ GH ORV DVSHFWRV PRWLYDFLRQDOHV \ QRUPDWLYRV TXH IDFLOLWD HO &HQWUR \ HO
3URIHVRUDODOXPQR

&RQVLGHUDQGRORDQWHULRU\ODHYLGHQFLDREVHUYDGDHQODUHYLVLyQGHODOLWHUDWXUDVREUHHO
WHPDODSUHVHQWHLQYHVWLJDFLyQSODQWHDODVVLJXLHQWHVKLSyWHVLV

 1RH[LVWHQGLIHUHQFLDVHQODVDFWLWXGHVKDFLDHOFHQWURDFDGpPLFRHQWUHORV
HVWXGLDQWHVGHORVWUHVWLSRVGHFHQWURVXQLYHUVLWDULRV +2 
 1RH[LVWHQGLIHUHQFLDVHQODVDFWLWXGHVKDFLDHOSURIHVRUHQWUHORVHVWXGLDQWHVGH
GLVWLQWRWLSRGHFHQWURXQLYHUVLWDULR +2 
 1RH[LVWHQGLIHUHQFLDVHQODVDFWLWXGHVKDFLDHO&HQWUR$FDGpPLFR HQWUHORV
HVWXGLDQWHVGHOD(QVHxDQ]D3UHVHQFLDO\OD(QVHxDQ]DD'LVWDQFLD +2 

115

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

 1RH[LVWHQGLIHUHQFLDVHQODVDFWLWXGHVKDFLDHOSURIHVRUHQWUHORVHVWXGLDQWHVGH
OD(QVHxDQ]D3UHVHQFLDO\OD(QVHxDQ]DD'LVWDQFLD +2 
 1RH[LVWHQGLIHUHQFLDVVHJ~QJHQHURHQODDFWLWXGKDFLDHO&HQWUR$FDGpPLFR
HQWUH ORVHVWXGLDQWHVGHOD(QVHxDQ]D3UHVHQFLDO +2 
 1RH[LVWHQGLIHUHQFLDVVHJ~QJHQHURHQODDFWLWXGKDFLDHOSURIHVRUHQWUHORV
HVWXGLDQWHVGHOD(QVHxDQ]D3UHVHQFLDO +2 
 1RH[LVWHQGLIHUHQFLDVVHJ~QJHQHURHQODDFWLWXGKDFLDHO&HQWUR$FDGpPLFR
HQWUHORVHVWXGLDQWHVGHOD(QVHxDQ]DD'LVWDQFLD +2 
 1RH[LVWHQGLIHUHQFLDVVHJ~QJHQHURHQODDFWLWXGKDFLDHOSURIHVRUHQWUHORV
HVWXGLDQWHV GHOD(QVHxDQ]D D 'LVWDQFLD +2 

 0e72'2

(QIXQFLyQGHOJUXSRGHUHIHUHQFLDVH KDXWLOL]DGRXQGLVHxRPHWRGROyJLFRFRQFDUiFWHU
IXQGDPHQWDOPHQWH ³H[ SRVW IDFWR´ SRU PHGLR GH XQ DQiOLVLV GHVFULSWLYRy
explicativo GHO FRPSRUWDPLHQWR GH ODV YDULDEOHV DQWHULRUPHQWH GHVFULWDV 3DUD HOOR
VH XWLOL]y OD FRPELQDFLyQ GH GRV WpFQLFDV GH LQYHVWLJDFLyQ VRFLDO KDELWXDOHV HQ
HVWH WLSR GH LQYHVWLJDFLyQ D VDEHU HO &XHVWLRQDULR GH $FWLWXGHV $FDGpPLFDV
DSOLFDGRV DO FRQWH[WR XQLYHUVLWDULR &$$)8  \ HO GLVHxR GH XQD PXHVWUD
DGDSWDGDDORVILQHVGHODLQYHVWLJDFLyQ\FX\DVFDUDFWHUtVWLFDVH[SOLFDPRVD
FRQWLQXDFLyQ
 08(675$

/D PXHVWUD SURFHGH GH ORV GDWRV REWHQLGRV D WUDYpV GHO &XHVWLRQDULR GH $FWLWXGHV
$FDGpPLFDV DSOLFDGRV DO FRQWH[WR XQLYHUVLWDULR &$$)8 UHDOL]DGR HQ GLYHUVRV
DxRV GHVGHKDVWD SRUORVDOXPQRVDVGHWUHVFHQWURVGHIRUPDFLyQGHOD
8/3*& Q   /D )DFXOWDG GH &LHQFLDV GH OD (GXFDFLyQ HQ DGHODQWH )&&
(GXFDFLyQ OD(VWUXFWXUDGH7HOHIRUPDFLyQGHOD8/3*& HQDGHODQWH(78/3*&
\ OD )DFXOWDG GH &LHQFLDV GH OD $FWLYLGDG )tVLFD \ GHO 'HSRUWH HQ DGHODQWH
)&&$)' 

/D7DEODPXHVWUDODGLVWULEXFLyQGHORVSDUWLFLSDQWHVHQQXHVWUDLQYHVWLJDFLyQVHJ~QHO
FHQWURIRUPDWLYRHQHOTXHUHDOL]DQVXVHVWXGLRV

116

&$3Ë78/2 ',6(f20(72'2/Ï*,&2'(/$,19(67,*$&,Ï1'($&7,78'(6

7DEOD
Distribución de participantes según centro formativo
3RUFHQWDMH 3RUFHQWDMH
)UHFXHQFLD 3RUFHQWDMH
YiOLGR DFXPXODGR
)&&(GXFDFLyQ    
(7B8/3*&    
)&&$)'    
7RWDO   
Nota:(ODERUDFLyQ3URSLD

7DOFRPRSRGHPRVREVHUYDUHOPD\RUSRUFHQWDMHGHDOXPQRVSHUWHQHFHQDOD)&&$)'  
VLELHQODGLVWULEXFLyQGLILHUHVXVWDQFLDOPHQWHVLWHQHPRVHQFXHQWDGHIRUPDDLVODGDORVDOXPQRV
GHSULPHUFXUVRGHFDGDXQDGHODVIDFXOWDGHV\FHQWURVGHSURFHGHQFLDDVSHFWRTXHSRGHPRV
REVHUYDUHQOD7DEOD
7DEOD
Distribución de participantes según curso y centro formativo
)&&(GXFDFLyQ (78/3*& )&&$)' 7RWDO
    
3ULPHUR
6HJXQGR    
7HUFHUR    
7RWDO    
Nota:(ODERUDFLyQ3URSLD

/D VHOHFFLyQ GH ORV FHQWURV GH HVWXGLR KD SHUPLWLGR REWHQHU GDWRV GLIHUHQFLDOHV UHVSHFWR D ORV
PDWLFHV VRFLRDIHFWLYRV LPSOLFDGRV HQ ODV DFWLWXGHV KDFLD HO FHQWUR \ KDFLD HO SURIHVRU VHJ~Q
PRGDOLGDGGHHQVHxDQ]DSUHVHQFLDORDGLVWDQFLD(QOD7DEODSRGHPRVYHUTXHXQWRWDOGH
DOXPQRVDV GHQXHVWUDPXHVWUD HVWXGLDEDHQHOPRPHQWRGHUHDOL]DUHOFXHVWLRQDULRHQOD
PRGDOLGDGDGLVWDQFLDDWUDYpVGHOD(VWUXFWXUDGH7HOHIRUPDFLyQGHOD8/3*&
7DEOD
Distribución de participantes según modalidad de enseñanza
)&&(GXFDFLyQ (78/3*& )&&$)' 7RWDO

(QVHxDQ]D3UHVHQFLDO    

(QVHxDQ]DD'LVWDQFLD    


Nota:(ODERUDFLyQ3URSLD

/DV7DEODV\UHIOHMDQODGLVWULEXFLyQVHJ~QQLYHO\DxRDFDGpPLFRGHODOXPQDGRSDUWLFLSDQWH
HQQXHVWURHVWXGLRSURFHGLHQGRHOPD\RUSRUFHQWDMHGHORVGDWRVUHFDEDGRVGHODOXPQDGRTXH
FXUVD HO SULPHU DxR GH VX WLWXODFLyQ   3RGHPRV FRPSUREDU TXH FRQWDPRV FRQ GDWRV
REWHQLGRVHQWUHORVDxRV\HQHOFDVRGHOD)&&$)'\HQHOFDVRGHOD
)&&(GXFDFLyQ\HQWUHORVDxRV\SRUFXDQWRVHUHILHUHDOD(78/3*&

117

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

(Q FXDQWR D VXV FDUDFWHUtVWLFDV VRFLRGHPRJUiILFDV OD )LJXUD QRV SHUPLWH FRPSUREDU
TXHQRVHQFRQWUDPRVDQWHXQDGLVWULEXFLyQGHVLJXDOHQFXDQWRDVH[RHQFDGDXQRGHORV
FHQWURV \ HQWUH HOORV 'H HVWD IRUPD HQ QXHVWUD PXHVWUD GH OD )&& (GXFDFLyQ \ OD
(78/3*& SUHGRPLQD HO DOXPQDGR IHPHQLQR  HQ HO SULPHU FDVR \  HQ HO
VHJXQGR  PLHQWUDV TXH HQ HO )&&$)' HO PD\RU SRUFHQWDMH GH SDUWLFLSDQWHV TXH KD
UHDOL]DGRHOFXHVWLRQDULRFRUUHVSRQGHDDOXPQDGRPDVFXOLQR  

)LJXUDQžSexo según centro formativo.

7DEOD
Distribución según nivel y año académico. FCC Educación
1LYHO 7RWDO
 
 
 
 
$xR  

 
7RWDO 
Nota:(ODERUDFLyQ3URSLD

7DEOD
Distribución según nivel y año académico. ETULPGC
1LYHO
7RWDO
 
 
 
$xR
ž  
 
 
7RWDO 
$xR  
ž 7RWDO 
7RWDO 
Nota:(ODERUDFLyQ3URSLD
118

&$3Ë78/2 ',6(f20(72'2/Ï*,&2'(/$,19(67,*$&,Ï1'($&7,78'(6

7DEOD
Distribución según nivel y año académico. FCCAFD
1LYHO 7RWDO
 
 
 
 
$xR
ž  
 
 
 
7RWDO 
 
 
$xR  

 
 
7RWDO 
 
 
$xR
 

 
 7RWDO 
7RWDO 
Nota:(ODERUDFLyQ3URSLD

5HVSHFWR D OD YDULDEOH HGDG OD )LJXUD  PXHVWUD D WUDYpV GH ORV GLDJUDPDV GH FDMD OD
GLVWULEXFLyQ GH OD PXHVWUD VHJ~Q HVWD YDULDEOH /D PXHVWUD REWHQLGD GHO DOXPQDGR GH
(78/3*& DEDUFD XQ UDQJR VXSHULRU GH HGDGHV UHVSHFWR DO TXH HQFRQWUDPRV HQ OD PXHVWUD
REWHQLGDGHORVFHQWURVGHHQVHxDQ]DSUHVHQFLDO$VtHQHVWHFDVRHOGHORVSDUWLFLSDQWHV
WLHQHXQDHGDGLJXDORVXSHULRUDDxRV6LQHPEDUJRHQORVFHQWURVGHHQVHxDQ]DSUHVHQFLDO
SUHGRPLQDQORVSDUWLFLSDQWHVFRQXQDHGDGFRPSUHQGLGDHQWUHORV\ORVDxRV

)LJXUDQžDistribución de la edad según centro formativo.


119

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

(VWHDVSHFWRORSRGHPRVYHUGHXQDIRUPDPiVGHWDOODGDHQODV)LJXUDV\HQODVTXH
H[SRQHPRVODGLVWULEXFLyQVHJ~QLQWHUYDORVGHHGDG\VH[RGHODOXPQDGRSDUWLFLSDQWHHQ
HVWH HVWXGLR WRPDQGR FRPR UHIHUHQFLD OD PRGDOLGDG GH HQVHxDQ]D SUHVHQFLDO R D
GLVWDQFLD/DV)LJXUDV\SRURWUDSDUWHPXHVWUDQODPLVPDGLVWULEXFLyQVHJ~Q
FHQWURIRUPDWLYR

)LJXUDQžDistribución según edad y sexo en Enseñanza presencial.

)LJXUDQžDistribución según edad y sexo en Enseñanza a distancia.

120

&$3Ë78/2 ',6(f20(72'2/Ï*,&2'(/$,19(67,*$&,Ï1'($&7,78'(6

 )LJXUDQžDistribución
  edad.FCC.Educación.
según sexoy 

)LJXUD
 Qž Distribución según sexo y edad. ETULPGC.

)LJXUDQž'LVWULEXFLyQVHJ~QVH[R\HGDG)&&$)'

121

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

 ',6(f2 '(/$67e&1,&$6 '(,19(67,*$&,Ï1

(O LQVWUXPHQWR TXH KHPRVXWLOL]DGRSDUD ODDSOLFDFLyQ\UHJLVWURGHGDWRVGHORVVXMHWRV


REMHWR GH DQiOLVLV KD VLGR HO &XHVWLRQDULR GH $FWLWXGHV $FDGpPLFDV DSOLFDGRV
DO FRQWH[WR XQLYHUVLWDULR &$$)8  VLHQGR XQD DGDSWDFLyQ GHO &XHVWLRQDULR ALFA
5-Versión 2011 (Cuestionario de Hábitos y Actitudes Escolares), GHVDUUROODGR SRU
0DUWtQ  

(O FXHVWLRQDULR HVWi FRPSXHVWR SRU XQD VHULH GH tWHPV D ODV FXDOHV ORV VX MHWR V G HE HQ 
UHVSRQGHUVLQGHMDUQLQJXQDHQEODQFR&RQVWDGHXQDHVWUXFWXUDGHtWHPVUHSDUWLGRV
HQ  VXEHVFDODV KDFLD HO &HQWUR $FHSWDFLyQ GH OD 'LVFLSOLQD 0RWLYDFLyQ SRU OD
$FWLYLGDG$FHSWDFLyQGHORV6LVWHPDVGH)RUPDFLyQ\$SUREDFLyQGHORV5HVXOWDGRV
< RWUDV FXDWUR VXEHVFDODV KDFLD HO 3URIHVRU +DELOLGDG GH &RPXQLFDFLyQ (VWLORV GH
 /LGHUD]JR1LYHOGH([LJHQFLD\6LVWHPDGH(YDOXDFLyQ

3DUDGDUUHVSXHVWDDOFXHVWLRQDULRXWLOL]DPRVODHVFDODWLSR/tNHUWFRQDOWHUQDWLYDVGH
UHVSXHVWD TXH YD GHVGH 0XFKR 7RWDOPHQWH GH $FXHUGR  D 1DGD 7RWDOPHQWH HQ
'HVDFXHUGR  FRQ OD RSFLRQHV LQWHUPHGLDV GH %DVWDQWH 5HJXODU \ 3RFR $VLPLVPR
GHQWURGHOFXHVWLRQDULRVHUHJLVWUDURQODVYDULDEOHVVRFLRGHPRJUiILFDVGHFDGDVXMHWR

(OVLVWHPDGHDSOLFDFLyQXWLOL]DGRKDVLGRSUHVHQFLDO\DGLVWDQFLDGHPDQHUDTXHWDQWR
HQXQFDVRFRPRHQRWURORVXMHWRVVLHPSUHWHQtDQDVXGLVSRVLFLyQODVLQVWUXFFLRQHVHO
DVHVRUDPLHQWR\RULHQWDFLyQGHODSOLFDGRUSDUDDFODUDUFXDOTXLHUGXGDSODQWHDGDGXUDQWH
OD UHDOL]DFLyQ GHO FXHVWLRQDULR 3DUD HYLWDU HUURUHV XQD YH] ILQDOL]DGD OD DSOLFDFLyQ
UHYLVDPRVVLVHKDQFXPSOLGRODVLQVWUXFFLRQHV\VHKDFRQWHVWDGRGHIRUPDFRUUHFWD

&XHVWLRQDULRGH$FWLWXGHV$FDGpPLFDV &$$)8 

7DQWRSRUVXVFDUDFWHUtVWLFDVFRPRSRUORVHOHPHQWRVTXHORFRPSRQHQHO&XHVWLRQDULR
VHOHFFLRQDGR HQ QXHVWUD LQYHVWLJDFLyQ SUHWHQGH HYDOXDU GRV GLPHQVLRQHV
IXQGDPHQWDOHV

D Actitudes hacia el Centro Académico HQ FXDQWRWDO

E $FWLWXGHVKDFLDHO3URIHVRUFRQFUHWRTXHGLVSRQJDHODOXPQRXQLYHUVLWDULR

122

&$3Ë78/2 ',6(f20(72'2/Ï*,&2'(/$,19(67,*$&,Ï1'($&7,78'(6

5HVSHFWRDODVActitudes hacia el Centro Académico VHDQDOL]DQDWUDYpVGHORVFXDWUR


PDWLFHVRVXEHVFDODVVLJXLHQWHV

9 $FHSWDFLyQGHODGLVFLSOLQDHQUHODFLyQDODRSLQLyQTXHOHPHUHFHDFDGDVXMHWR
HO FyPR VH LPSDUWH OD HQVHxDQ]D HQ JHQHUDO SODQHV HVWDEOHFLGRV FRQWHQLGRV
REOLJDGRVH[iPHQHVHWF
9 0RWLYDFLyQSRUODDFWLYLGDGUHVSHFWRDOJUDGRGHLQWHUpVFRQHOTXHVHUHDOL]DOD
DFWLYLGDGGHOHVWXGLRHQFRQWUDVWHFRQRWUDVGLPHQVLRQHVGHVXYLGD
9 $FHSWDFLyQ GH ORV VLVWHPDV GH HQVHxDQ]D UHODWLYRV DO MXLFLR TXH OH PHUHFH D
FDGDVXMHWRORTXHVHHQVHxD\ODIRUPDGHWUDQVPLWLUOR
9 $SUREDFLyQGHORVUHVXOWDGRVVREUHODYDORUDFLyQTXHKDFHGHODVFDOLILFDFLRQHV
TXHUHFLEH
5HVSHFWRDODVActitudes hacia el Profesor VHDQDOL]DQDWUDYpVGHORVFXDWURPDWLFHVR
VXEHVFDODVVLJXLHQWHV
9 +DELOLGDG GH FRPXQLFDFLyQ UHVSHFWR DO QLYHO GH FRPSUHQVLyQ TXH FUHH
HMHUFLWDHOSURIHVRUHQRSLQLyQGHOHVWXGLDQWH
9 (VWLOR GH OLGHUD]JR VREUH HO JUDGR GH DXWRULWDULVPR TXH HVWLPDQ ORV
HVWXGLDQWHVTXHVHSUDFWLFD
9 1LYHOGHH[LJHQFLDTXHRSLQLyQGHORVDOXPQRVVHLPSRQHQ
9 6LVWHPDGHHYDOXDFLyQUHVSHFWRDODVFDOLILFDFLRQHVDFDGpPLFDVTXHSRQHQD
ORVDOXPQRV

&DGDXQDGHHVWDVVXEHVFDODVRPDWLFHVHVWiQUHSUHVHQWDGDSRU tWHPVFRQILJXUDQGRXQ
FXHVWLRQDULR GH  tWHPV PiV ODV SUHJXQWDV VRFLRGHPRJUiILFDV VHxDODGDV VLHQGR HO
LQVWUXPHQWRWpFQLFRXWLOL]DGRSDUDODIDVHGHUHFRJLGDGHLQIRUPDFLyQ\GDWRV

3URFHGLPLHQWRGH$SOLFDFLyQGHO&XHVWLRQDULR

)DFLOLWDPRV ODV FRQGLFLRQHV SDUD OOHYDU D FDER OD UHFRJLGD GH GDWRV PHGLDQWH
FXHVWLRQDULRHOHFWUyQLFR\ DODYH]SHUPLWLHUDJDUDQWL]DUODVXSHUYLVLyQDGHFXDGDGHORV
VXMHWRV HYDOXDGRV FRPSUREDFLyQ GH VX LGHQWLGDG UHJLVWUR GH ORV GDWRV LQGLYLGXDOHV
FRPSUHQVLyQDGHFXDGDGHODVLQVWUXFFLRQHV\DVHVRUDPLHQWRGXUDQWHODUHDOL]DFLyQ8QD
YH] FRPSOHWDGR HO FXHVWLRQDULR VH SURFHGLy D GHSXUDFLyQ GH ORV GDWRV \ SRVWHULRU
UHJLVWURHQODEDVHGHGDWRV

123

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

(QWRGRVORVFDVRVORVVXMHWRVWHQtDQDVXGLVSRVLFLyQ

9 ,QVWUXFFLRQHVGHDSOLFDFLyQ
9 &XHVWLRQDULR FRPSOHWR HQ IRUPDWR GLJLWDO TXH LQFOX\H ORV DSDUWDGRV D
FXPSOLPHQWDU

(Q HO VRSRUWH LQIRUPiWLFR FDGD VXMHWR GLVSRQtD GH XQ UHFXUVR LQIRUPiWLFR DGHFXDGR
GRQGH VH SUHVHQWDEDQ ODV LQVWUXFFLRQHV SHUWLQHQWHV SDUD FXPSOLPHQWDU ODV UHVSXHVWDV D
FHUFD GH ORV tWHPV \ GDWRV SHUVRQDOHV &XDQGR ORV VXMHWRV ILQDOL]DEDQ OD DSOLFDFLyQ
HQYLDEDQ HO ILFKHUR FRUUHVSRQGLHQWH D OD EDVH GH GDWRV TXH WHQHPRV DO HIHFWR \ VH
SURFHGtDDODFRUUHFFLyQ\SURFHVDPLHQWRGHORVGDWRVSDUDOOHYDUDFDERODHYDOXDFLyQ
FRUUHVSRQGLHQWH

(VWUDWHJLDVGH&RUUHFFLyQ\(YDOXDFLyQ

8QDYH]UHFLELGRVORVILFKHURVFXPSOLPHQWDGRVVHSURFHGHDODUHYLVLyQ\YDOLGDFLyQGH
ORV FXHVWLRQDULRV PHGLDQWH XQ VRIWZDUH GLVHxDGR SRU QRVRWURV DO TXH KHPRV OODPDGR
'LDJQyVWLFR$VLVWLGRSRU2UGHQDGRU '$2 

'HVSXpV GH LQWURGXFLU \ UHYLVDU WRGRV \ FDGD XQR GH ORV GDWRV \ ODV UHVSXHVWDV GH ORV
VXMHWRVHOPHQFLRQDGRSURJUDPDOOHYDDFDERHOUHJLVWURGHODLQIRUPDFLyQWDQWRGHODV
YDULDEOHVVRFLRGHPRJUiILFDVFRPRGHODVSXQWXDFLRQHVGHFDGDVXMHWRDFDGDXQDGHODV
FXHVWLRQHV SDUD REWHQHU DVt ODV SXQWXDFLRQHV GLUHFWDV TXH VRQ ORV GDWRV FRQ ORV TXH
OOHYDPRVDFDERODSUHVHQWHLQYHVWLJDFLyQ

/DV HVFDODV LQFOXLGDV HQ HO &XHVWLRQDULR VH HYDOXDURQ D SDUWLU GH ODV SXQWXDFLRQHV
REWHQLGDV SRU ORV VXMHWRV HQ FDGD XQD GH ODV FXHVWLRQHV DVRFLDGDV D ODV PLVPDV 6H
REWXYLHURQ SRU PHGLR GH XQD HVFDOD WLSR /LNHUW FRQ FLQFR QLYHOHV GH UHVSXHVWD 1 
1DGD 3 3RFR 5 5HJXODU %  %DVWDQWH0  0XFKR  DVLJQDQGRXQ YDORU D FDGD
UHVSXHVWD HQWUH\SXQWRVVHJ~QSURFHGD HQIXQFLyQGHOSODQWHDPLHQWR GLUHFFLyQ 
GHFDGDXQDGHODVFXHVWLRQHVSUHVHQWDGDV

3DUDHOGLVHxRHODERUDFLyQ\UHGDFFLyQILQDOGHODSUHVHQWHLQYHVWLJDFLyQVHKDXWLOL]DGR
OD VXLWH RILPiWLFD 0LFURVRIW 2IILFH  \ HO DQiOLVLV HVWDGtVWLFR GH ORV GDWRV VH KD
UHDOL]DGR FRQ HO SURJUDPD LQIRUPiWLFR 6WDWLVWLFDO 3DFNDJH IRU WKH 6RFLDO 6FLHQFHV
6366YZLQ 

124

&$3Ë78/2 ',6(f20(72'2/Ï*,&2'(/$,19(67,*$&,Ï1'($&7,78'(6

'LVHxR GHDQiOLVLVHVWDGtVWLFR

&RQVLGHUDQGR ODV FDUDFWHUtVWLFDV GH OD SUHVHQWH LQYHVWLJDFLyQ HO WLSR GH GLVHxR TXH
KHPRV UHDOL]DGR HV GHVFULSWLYR \ confirmatorio GH OD PXHVWUD GLVSRQLEOH \ HO
FULWHULR VHOHFFLRQDGR WDQWR SDUD OD LQWURGXFFLyQ GH ORV GDWRV FRPR SDUD VX
SRVWHULRUDQiOLVLVYLHQHGHWHUPLQDGRSRUODVYDULDEOHVVRFLRGHPRJUiILFDVGHVFULWDV\ORV
UHVXOWDGRVGH ODV SXQWXDFLRQHV GLUHFWDV VHPLQDOHV UHJLVWUDGDVHQODVYDULDEOHVTXH
HYDO~DHOFXHVWLRQDULR DSOLFDGRHQORVJUXSRVVHOHFFLRQDGRV

$VLPLVPR FRPSOHPHQWDULDPHQWH VH KD UHDOL]DGR XQ HVWXGLR FRQILUPDWRULR SDUD


HVWDEOHFHUODVUHODFLRQHVHQWUHORVtWHPV \ODVGLPHQVLRQHVODWHQWHV

7UDWDPLHQWR(VWDGtVWLFR

 /RV DQiOLVLV HVWDGtVWLFRV UHDOL]DGRV SDUD PHGLU ODV DFWLWXGHV GH ORV HVWXGLDQWHV
XQLYHUVLWDULRVKDQVLGRORVVLJXLHQWHV

9 (VWDGtVWLFRV GHVFULSWLYRV GH ODV YDULDEOHV GH LGHQWLILFDFLyQ \ FDUDFWHUtVWLFDV


GHODPXHVWUD
9 &RPSDUDFLyQ GH SXQWXDFLRQHV PHGLDV GHVYLDFLRQHV HVWiQGDU YDORUHV ³W´ \
ORV QLYHOHV GH VLJQLILFDFLyQ GH ODV HVFDODV GHO &$$)8 HQ ORV GLIHUHQWHV
JUXSRVGHHYDOXDGRV
9 Ecuaciones Estructurales D SDUWLU GH ORV PDWLFHV FRUUHVSRQGLHQWHV
UHVSHFWR D ODV FDUDFWHUtVWLFDV DFWLWXGLQDOHV GH ORV VXMHWRV SDUWLFLSDQWHV HQ OD
LQYHVWLJDFLyQ
9 &RHILFLHQWHV GH FRUUHODFLyQ WLSR 3HDUVRQ  HQWUH ODV GLVWLQWDV YDULDEOHV GHO
&XHVWLRQDULR
9 &RQVLVWHQFLDLQWHUQD HODOIDGH&URQEDFK GHODVYDULDEOHVHQUHODFLyQDODV
FLQFRHVFDODVRIDFWRUHV\DORVPDWLFHVTXHODVFRPSRQHQ
9 3UXHEDVGHFRQWUDVWHHVWDGtVWLFRSDUDFRQILUPDU ODYDOLGH]GHODFODVLILFDFLyQ
UHDOL]DGD  VL VH DSUHFLDQ GLIHUHQFLDV FODUDV HQWUH ORV YDORUHV PHGLRV GH ORV
JUXSRVDXQQLYHOGHVLJQLILFDFLyQGHO
9 &iOFXORGHORVEDUHPRVFRUUHVSRQGLHQWHVGHORVJUXSRVQRUPDWLYRV\HQORV
GLIHUHQWHV WLSRV GH DFWLYLGDG FRQ PD\RU tQGLFH GH UHSUHVHQWDFLyQ SDUD OD
YDORUDFLyQDGHFXDGDGHODVSXQWXDFLRQHVGLUHFWDV

125

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

$WHQGLHQGR D ODV FDUDFWHUtVWLFDV GH OD PXHVWUD \ ODV YDULDEOHV GHO FXHVWLRQDULR VH KDQ
XWLOL]DGRORVDQiOLVLVHVWDGtVWLFRVPiVFRQYHQLHQWHVEDMRODFRQGLFLyQGHOFXPSOLPLHQWR
GH ORV VXSXHVWRV PDWHPiWLFRV TXH HQ FDGD FDVR VH H[LJHQ SDUD TXH GLFKRV DQiOLVLV
SXHGDQVHUDSOLFDGRVFRUUHFWDPHQWH

3URFHGLPLHQWRGH5HFRJLGDGH,QIRUPDFLyQ
&RQODDSOLFDFLyQLQGLYLGXDOGHOFXHVWLRQDULRPHGLDQWHODVLQVWUXFFLRQHVDGHFXDGDVSDUD
VXFRUUHFWDUHDOL]DFLyQVHKDSUHWHQGLGRUHFRSLODUGDWRVVREUHXQFRQMXQWROLPLWDGRGH
tWHPV DFWLWXGLQDOHV TXH FRQVWLWX\HQ ODV UHVSXHVWDV TXH ORV VXMHWRV DSRUWDQ VREUH Vt
PLVPRV \ VREUH HO FRQWH[WR GRQGH GHVDUUROODQ VX DFWLYLGDG DFDGpPLFD PRWLYDFLRQHV
QHFHVLGDGHVH[SHFWDWLYDVLQWHUHVHVFUHHQFLDVSUHIHUHQFLDVHWF 

(QHOPDUFRGHODVDFWLYLGDGHVGRFHQWHVVHLQIRUPyGHOSURSyVLWRGHQXHVWURSUR\HFWR\
 VH SURSRUFLRQy OD IRUPDFLyQ VREUH HO PDQHMR GHO FXHVWLRQDULR HOHFWUyQLFR HQ
DSOLFDFLRQHVLQGLYLGXDOHV

126

$1È/,6,6'( Capítulo 6
5(68/7$'26
&$3Ë78/2 $1È/,6,6'(5(68/7$'26

,1752'8&&,Ï1

En el presente capítulo exponemos los resultados del análisis realizado siguiendo el


procedimiento metodológico propuesto que, consideramos, se ha ajustado de una forma
conveniente y adecuada a los objetivos empíricos planteados. Tal como ya esbozamos
en un apartado anterior, este procedimiento consta de dos tipos de análisis diferenciados
y complementarios que responden a cada uno de los dos objetivos empíricos de la
investigación. En este sentido, el estudio realizado ha permitido contrastar las hipótesis
inicialmente planteadas generando un modelo predictivo respecto a las relaciones entre
los matices socio-afectivos implicados en las actitudes hacia el centro y hacia el
profesor, y determinando diferencias significativas respecto a las puntuaciones de tales
matices y actitudes según modalidad de enseñanza, presencial o a distancia, en la que
realizan su formación los alumnos universitarios.


A continuación exponemos la secuencia en la que se mostrará la información de los


resultados. En todo caso, tratamos de que siga una sucesión lógica, acorde con el
planteamiento de la investigación realizada y que permita una lectura orientada al
contraste de hipótesis y determinación de conclusiones.

En primer lugar, expondremos el modelo de ecuaciones estructurales propuesto como


herramienta metodológica para alcanzar el primer objetivo empírico planteado. En esta
sección abordaremos los dos pasos fundamentales en el análisis de ecuaciones
estructurales: la evaluación del modelo de medida y la evaluación del modelo
estructural. Dado que en el primer paso de este análisis (evaluación del modelo de
medida) se incorpora la fiabilidad de la escala, mediante el cálculo del Alfa de
Cronbach y la fiabilidad compuesta para cada uno de los constructos (matices socio-
afectivos) planteados, consideramos abordados los aspectos relativos al análisis de
fiabilidad en este apartado. Finalmente, presentamos las hipótesis contrastadas respecto
al primer objetivo empírico de la investigación según el modelo propuesto.
En segundo lugar, realizamos la comparación entre las puntuaciones referidas a los
distintos matices socio-afectivos que integran las actitudes hacia el centro y hacia el
profesor del alumnado universitario según las siguientes variables: centro, modalidad de
enseñanza y género según modalidad de enseñanza. De forma particular,

129

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

posteriormente, realizaremos el análisis del alumnado de primer curso. A continuación,


se muestran baremos de puntuaciones referidas a la actitud hacia el centro y hacia el
profesor según centro formativo. Además del estudio comparativo, realizamos en esta
sección los análisis de correlación entre los distintos matices y actitudes estudiados, así
como un análisis de componentes principales, a partir de los matices establecidos.

Respecto al análisis de ecuaciones estructurales se ha trabajado con SmartPLS 3.0 build


M3 (Ringle, Wende y Will, 2005). El análisis descriptivo y comparativo de los
datos se ha llevado a cabo con el software estadístico IBM SPSS. En éste último
caso, dada la ausencia de normalidad en las distribuciones a comparar, se ha optado por
la prueba no paramétrica de Kruskal-Wallis en el caso de comparación de más de dos

muestras y en la de U Mann -Whitney en las comparaciones de dos muestras. El nivel de


significación estadística considerado ha sido p<0,05.


 $1È/,6,6 '(/02'(/2'(,19(67,*$&,Ï13250(',2 '(3/6

Como ya se ha adelantado en un apartado anterior, hemos elegido el método de análisis


de las ecuaciones estructurales, usando la técnica de Partial Least Squares (en adelante,
PLS) (Fornell y Cha 1994). Se trata de una técnica diseñada para reflejar las
características teóricas y empíricas de las ciencias sociales y del comportamiento, en las
que es frecuente que haya situaciones donde nos encontramos con teorías sin el apoyo
suficiente y con poca información disponible (Wold, 1979). De forma concreta, hemos
utilizado SmartPLS 3.0 build M3 (Ringle et al., 2005).

El método PLS permite la comprobación simultánea de hipótesis al mismo tiempo que


permite medidas con ítems únicos y múltiples y el uso de indicadores formativos
y reflectivos (Fornell y Bookstein 1982).

La técnica PLS se emplea de forma frecuente en los casos en los que se dispone de
muestras pequeñas (Marcoulides, Chin y Saunders, 2009). En este sentido, hay diversos
métodos que permiten estimar (Chin, 1998; Chin y Newsted, 1999) hasta qué punto el
tamaño muestral puede ser suficiente para el caso de un estudio concreto.

A este respecto, se han seguido las recomendaciones realizadas por Marcoulides y


Saunders (2006), en cuanto al uso de PLS, referentes a sustento teórico del modelo:

130

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

cribado de datos y análisis de las propiedades psicométricas de todas las variables del
modelo antes de comenzar el análisis; examen de las relaciones y efectos, así como de
los errores y estándar y del poder predictivo del modelo para garantizar su validez.

Tal como ya hemos adelantado en anteriores apartados de la presente investigación, con


objeto de asegurar la validez de la técnica PLS es necesario realizar dos pasos (Barclay,
Higgins y Thompson, 1995):

- Evaluación del modelo de medida.


- Evaluación del modelo estructural (Figura 16).

A través de la evaluación del modelo de medida se trata de analizar si los conceptos


teóricos están medidos de forma correcta a través de las variables observadas, es decir,
nos asegura que tengamos medidas válidas y fiables antes de intentar extraer
 conclusiones referentes a las relaciones existentes entre los constructos.

La evaluación del modelo de medida se realiza asegurando la validez de cada ítem; la fiabilidad
del constructo, así como la validez del constructo (de contenido, y discriminante).

En cuanto al modelo estructural, se trata de evaluar el peso y la magnitud de las


relaciones entre las distintas variables, es decir, se valida para confirmar hasta qué punto
las relaciones causales son consistentes con los datos disponibles (Real,LealyRoldan,2006).
En este sentido, el modelo estructural se realiza considerando los siguientes aspectos:

- Coeficiente de correlación múltiple al cuadrado (R2)

- Coeficientes path estandarizados β y su significación (t-estadísticos)

- Relevancia predictiva (test de Q2) y calidad del modelo (test GoF)

(YDOXDFLyQ GHO PRGHOR (YDOXDFLyQGHOPRGHOR


GH PHGLGD HVWUXFWXUDO

)LDELOLGDG Coeficiente de correlación


LQGLYLGXDOGHOtWHP múltiple al cuadrado R2

)LDELOLGDGGH OD HVFDOD: Coeficientes path estandarizados


Fiabilidad compuesta B Significación (t-estadísticos)
Alfa de Cronbach de los coeficientes path

9DOLGH]ž Relevancia predictiva test Q2


Validez de contenido
Validez discriminante Calidad del modelo test GoF
Figura nº 13. Modelo de Análisis de PLS. Elaboración propia a partir de Barclay et al., 1995.

131

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

'LDJUDPDHVWUXFWXUDO

En nuestro modelo, que sigue una estructura jerárquica, hay ocho constructos de primer
orden.

En cuanto a los indicadores utilizados para formar cada uno de los constructos de
nuestro modelo, y siguiendo el criterio dado por Chin (1998) encontramos que todos los
indicadores de nuestras variables latentes son reflectivos, ya que el incremento de uno
de los indicadores en una dirección supone que el resto deba cambiar de forma similar.

Las variables latentes y la nomenclatura utilizada se muestran en la Tabla 7.

Tabla 7
Nomenclatura de las variables latentes
AC1 Centro. Matiz 1. Aceptación de la disciplina
 Encuentro que yo estudiaría más y mejor si se diera libertad para elegir los temas que
AC1X1
me gustan e interesan.
Creo que la disciplina escolar quita libertad a los estudiantes en sus tareas de
AC1X2
aprendizaje.
Opino que los estudiantes tenemos poca libertad para seleccionar los ejercicios y
AC1X3
actividades que tenemos que hacer.
Encuentro que si me dieran mayores oportunidades en los estudios, sacaría mejor
AC1X4
provecho y rendimiento.
Opino que el sistema que se usa de disciplina en Teleformación/Presencial apenas se
AC1X5
ajusta a la realidad y necesidades de los estudiantes.
En la planificación de las actividades de aprendizaje y los temas de estudio, apenas se
AC1X6
consulta a los estudiantes.
AC2 Centro. Matiz 2. Motivación por la actividad
AC2x1 Pienso que lo mejor en este momento es dejar de estudiar y buscar un trabajo.
AC2x2 Estoy convencido que practicar deporte es tanto o más importante que estudiar.
AC2x3 Procuro faltar a mis obligaciones siempre que puedo.
Creo que es más indispensable en la vida divertirse y pasarlo bien que estudiar y
AC2x4
aprender.
AC2x5 Leer, hacer actividades y estudiar demasiado me da dolor de cabeza.
Algunas asignaturas me resultan tan aburridas que paso el tiempo dibujando,
AC2x6 escribiendo notas o soñando, en lugar de estar pendiente del contenido del tema que he
de estudiar.
AC3 Centro. Matiz 3. Aceptación de los Sistemas de Formación
Encuentro que lo que se enseña en Teleformación/Presencial sirve muy poco para
AC3x1
resolver situaciones profesionales en el futuro.
Creo que los métodos de enseñanza utilizados en Teleformación/Presencial están
AC3x2
orientados en la adquisición de una formación teórica nada más.
Estoy pensando dejar de estudiar porque comprendo que lo que estamos aprendiendo
AC3x3
sirve muy poco para el futuro profesional.
Opino que es mucho más efectivo lo que se practica en la vida que lo que me enseñan
AC3x4
mis profesores.
Encuentro que es demasiado tiempo, dinero, esfuerzo y sacrificio el que uno debe gastar
AC3x5
para obtener una formación académica.
Creo que el objetivo principal en Teleformación/Presencial debería ser enseñar a los
AC3x6
estudiantes cosas que le ayuden para su futuro profesional y para la vida.
Nota: $GDSWDGRGH,]TXLHUGR 

132

&$3Ë78/2 $1È/,6,6'(5(68/7$'26
Tabla 7
Nomenclatura de las variables latentes (Continuidad)
AC4 Centro. Matiz 4. Aprobación de los resultados
Creo que las calificaciones más altas en las actividades y exámenes se dan a los
AC4x1 estudiantes que aprenden de memoria, en lugar de aquellos que saben el porqué de las
cuestiones.
Creo que el estado de ánimo de los profesores influye a la hora de evaluar a los
AC4x2
estudiantes, tanto las actividades como los exámenes.
AC4x3 Solo pienso en sacar buenas notas en las asignaturas que me gustan y domino.
Creo que las notas que saco en las actividades y los exámenes son inferiores a las que
AC4x4
debería sacar.
Encuentro que mis calificaciones en las actividades y los exámenes reflejan menos de
AC4x5
los que realmente he aprendido y puedo hacer.
AC4x6 Únicamente me intereso por las notas de las asignaturas que me gustan.
AP1 Profesor. Matiz 1. Habilidad de comunicación
Creo que los profesores normalmente comprenden poco las necesidades, expectativas e
AP1x1
inquietudes de los estudiantes.
AP1x2 Encuentro que los estudiantes confían poco en sus profesores.
Normalmente los profesores están preocupados por sus asuntos y prestan poca atención
AP1x3
a los estudiantes.
Los profesores hacen las actividades demasiado difíciles para los estudiantes de
AP1x4
mediana capacidad.
 Los profesores cuando explican las actividades de aprendizaje o responden a preguntas
AP1x5
de los Foros o Tutorías usan palabras intencionalmente oscuras y difíciles.
Las explicaciones, proyecciones y ejemplos que proporcionan los profesores para
AP1x6
comprender lo que dice son pesadas y difíciles de entender.
AP2 Profesor. Matiz 2. Estilo de liderazgo.
Creo que los profesores son demasiado estrictos y exigentes en su relación con los
AP2x1
estudiantes de Teleformación/Presencial.
AP2x2 Encuentro que los profesores miran con desprecio a los estudiantes peores.
AP2x3 Opino que los profesores suelen tener una mente estrecha y muy difícil de convencer.
Encuentro que los profesores se divierten ridiculizando los errores o equivocaciones de
AP2x4
sus estudiantes.
Creo que a los profesores les gusta demasiado mostrar su autoridad y dejar claro que en
AP2x5
su asignatura mandan ellos.
AP2x6 Cuando el profesor ha dado una orden le molesta que se la contradigan.
AP3 Profesor. Matiz 3. Nivel de exigencia
Pienso que los profesores ponen ejercicios y pruebas en aquellos momentos que estamos
AP3x1
más estresados y faltos de tiempo.
Opino que los profesores proponen muchas actividades para cada Módulo de
AP3x2
Aprendizaje.
Estoy convencido que los profesores se dedican a la enseñanza porque disfrutan
AP3x3
haciendo sufrir a los estudiantes.
Encuentro que es casi imposible, para la mayoría de los estudiantes, hacer todas las
AP3x4
tareas y actividades que se marcan en Teleformación/Presencial.
Creo que los profesores tienden a dar mucha información y confunden a los estudiantes
AP3x5
en lugar de clarificar las dudas o preguntas.
Estoy convencido de que los profesores se divierten interiormente, haciendo a sus
AP3x6
estudiantes el tiempo de trabajo más pesado.
AP4 Profesor. Matiz 4. Sistemas de evaluación
Soy de la opinión de que los profesores piensan más en las notas que en el objetivo
AP4x1
principal de enseñar al estudiante.
Creo que la mejor forma de sacar buenas notas en las actividades y los exámenes es
AP4x2
hacer la pelota al profesor.
Encuentro que los profesores a la hora de calificar se fijan en el agradado, simpatía o
AP4x3
antipatía que le producen sus estudiantes.
Creo que los estudiantes que hacen consultas en Tutoría o mandan mensajes por los
AP4x4
Foros están tratando de hacerse los "listos" o los "buenos" ante el profesor.
En mi opinión, conseguir buenos resultados en las actividades y buenas notas en los
AP4x5
exámenes la mejor forma es estar de acuerdo con todo lo que dicen los profesores.
AP4x6 Los profesores suelen ser injustos a la hora de valorar y calificar a los estudiantes.
133

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Más detalladamente el modelo jerárquico se construyó siguiendo la siguiente


secuencia (Wetzels, Odekerken-Schröder y Van Oppen, 2009), en primer lugar, se
crearon las variables latentes (AC1, AC2, AC3, AC4, AP1, AP2, AP3, AP4) y las
relacionamos con sus indicadores de manera reflectiva y seguidamente se
establecieron las relaciones previstas entre variables latentes (Figura 14).

En la Tabla 8 se establecen las relaciones previstas en el modelo entre las distintas variables.

Tabla 8
Relaciones previstas en el modelo
AC1 ->AC3 AP1 -> AP4

AC1 ->AC4 AP2 ->AC3

AC2 ->AC3 AP2 -> AP4

 AC2 ->AC4 AP3 ->AC3

AC4 ->AC3 AP3 -> AP4

AP1 ->AC3 AP4 ->AC3


Nota: Elaboración propia

En los siguientes apartados se procede a la estimación del modelo utilizando el PLS


pathmodelling, obteniendo first-orderloadings y los parámetros estructurales. También
se ejecuta un bootstrap para obtener errores estándares y calcular los t-statistics que
permiten analizar la validez de las hipótesis.

Figura 14. Creación de variables latentes.

134

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

(YDOXDFLyQGHOPRGHORGHPHGLGD

Analizamos a continuación los atributos esenciales en la evaluación del modelo de


medida: validez y fiabilidad. Así, su estudio permite garantizar que contamos con
medidas fiables y válidas de forma previa a la determinación de conclusiones referidas a
las relaciones existentes entre los constructos

 )LDELOLGDG

La fiabilidad de una medida hace referencia al grado en que esta se halla libre de errores
aleatorios y, por tanto, proporciona resultados consistentes (Sánchez y Sarabia, 1999).

En una primera etapa, en el marco del modelo PLS (Partial Least Squares),
comprobamos la fiabilidad individual de cada ítem de la escala empleada para medir los
constructos. El objetivo es determinar si alguno de ellos no contribuye al constructo y,

por tanto, de forma posterior a su análisis, decidir si se elimina de la escala.

La fiabilidad individual del ítem es valorada analizando las cargas estandarizadas de los
indicadores con su respectivo factor. A este respecto, la regla empírica más aceptada y
difundida es la propuesta por Carmines y Zeller (1979), quienes señalan que para
aceptar un indicador como integrante de un constructo, aquel ha de poseer una carga
igual o superior a 0.707. En la medida en que las cargas son correlaciones, un nivel
como el anterior implica que más del 50% de la varianza de la variable observada es
compartida por el factor. No obstante, debemos tener en cuenta que otros investigadores
consideran que esta regla empírica no debería ser tan rígida en las etapas iniciales de
desarrollo de la escala (Barclayet al., 1995), y cargas de 0.5 y 0.6 pueden ser aceptadas
en fases iniciales del desarrollo de la escala (Chin 1998) o cuando las escalas se aplican
en distintos contextos de investigación (Barclayet al.,1995).

En la Tabla 9 se presentan estas medidas así como cada uno de los ítems utilizados.

Vemos que la gran mayoría de cargas factoriales son superiores a 0.6, cumpliendo
muchas de ellas el requisito más estricto (superiores a 0.707).

No obstante, se observa un ítem en el constructo AC1 (AC1x6); dos en el constructo


AC2 (AC2x2 yAC2x5); dos en el constructo AC3 (AC3x5 y AC3x6); uno en AC4

135

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

(AC4x5); dos en AP3 (AP3x2 y AP3x4) y una en AP4 (AP4x5) que se alejan de esta
exigencia, por lo que se ha decido eliminarlos de la escala.

Esta eliminación no supone ninguna pérdida de información pues en dichos constructos


el número de ítems después de eliminados es igual o superior a tres. Y, por otra parte,
los ítems eliminados no afectan a la validez de contenido del constructo, puesto que el
resto cubre perfectamente desde el punto de vista teórico el alcance de las variables de
estudio.

Tabla 9

Correlaciones simples de cada indicador con su constructo


Constructo Ítem Loading Constructo Ítem Loading
AC1x1 0,5669 AP1x1 0,7381
 AC1x2 0,5837 AP1x2 0,6359
AC1x3 0,6473 AP1x3 0,7454
AC1 AP1
AC1x4 0,6885 AP1x4 0,6903
AC1x5 0,6740 AP1x5 0,6965
AC1x6 0,4589 AP1x6 0,6407
AC2x1 0,5723 AP2x1 0,5517
AC2x2 0,3941 AP2x2 0,7623
AC2x3 0,6197 AP2x3 0,7849
AC2 AP2
AC2x4 0,6667 AP2x4 0,7506
AC2x5 0,4570 AP2x5 0,7860
AC2x6 0,7646 AP2x6 0,6774
AC3x1 0,7384 AP3x1 0,6411
AC3x2 0,6445 AP3x2 0,5023
AC3x3 0,6871 AP3x3 0,6143
AC3 AP3
AC3x4 0,6732 AP3x4 0,5384
AC3x5 0,5242 AP3x5 0,7268
AC3x6 0,1140 AP3x6 0,7348
AC4x1 0,5670 AP4x1 0,6973
AC4x2 0,5869 AP4x2 0,6481
AC4x3 0,6237 AP4x3 0,8091
AC4 AP4
AC4x4 0,6958 AP4x4 0,6761
AC4x5 0,5596 AP4x5 0,3940
AC4x6 0,5807 AP4x6 0,7105
Nota: Elaboración propia

136

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

 )LDELOLGDGGHODHVFDODILQDO

Iniciamos la evaluación de la escala de medida valorando la fiabilidad individual de los


constructos de primer orden, analizando su carga factorial, fiabilidad compuesta (CR),
coeficiente alfa de Cronbach y varianza media extraída (AVE) (Chin, 1998; Fornell y
Larcker, 1981) una vez eliminados los ítems que no cumplen la condición de que al
menos el 50% de la varianza del constructo se vea reflejada en el indicador.

En la Tabla 10 se muestran estas medidas, así como cada uno de los ítems utilizados.

 )LDELOLGDGLQGLYLGXDOGHOtWHP

Este análisis tiene como objetivo conocer la ponderación de cada indicador sobre el
factor correspondiente en el modelo de medida global.

Las cargas factoriales en el modelo propuesto son en gran parte superiores a 0.6 o en

cualquier caso cercanos a 0,6 indicando que, al menos, el 50% de la varianza del
constructo se ve reflejada en el indicador (Chin, 1998).

 )LDELOLGDGFRPSXHVWDRGHODHVFDOD FRQVLVWHQFLDLQWHUQD

La valoración de la fiabilidad de un constructo nos permite comprobar la consistencia


interna de todos los indicadores al medir el concepto. De esta forma, se evalúa en qué
grado las variables observadas miden la misma variable latente.

Dos indicadores, el coeficiente alfa de Cronbach y la fiabilidad compuesta


(CompositeReliability) son oportunos para la determinación de esta valoración. La CR,
tal como podemos observar, es siempre mayor que 0.7, valor que se requiere en las
etapas iniciales de la investigación.

Por tanto, los resultados muestran que cada conjunto de variables observadas es
representativo de su constructo correspondiente, ya que todos superan el valor mínimo
de fiabilidad compuesta.

Si bien en los modelos estructurales con mayor frecuencia se hace uso de la fiabilidad
compuesta, dado que esta medida utiliza las cargas de los ítems, realizamos el cálculo
del coeficiente alfa de Cronbach con objeto de confirmar la consistencia interna de los
indicadores y se observa que tres indicadores superan el valor de referencia 0,7.

137

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Tabla 10.
Propiedades de los constructos

Constructo Ítem Loading CompositeReliability CronbachAlpha

AC11 0,5358
AC12 0,5783
AC1
AC13 0,6284 0,7704 0,6625
AC14 0,6973
AC15 0,7213
AC21 0,6090
AC23 0,6411
AC2 0,7785 0,6277
AC24 0,7119
AC26 0,7682
AC3 AC31 0,7680 0,7976 0,6653
AC32 0,6409
AC33 0,7287
 AC34 0,6769
AC41 0,5389
AC42 0,6163
AC4 AC43 0,6751 0,7633 0,6130
AC44 0,6275
AC46 0,6692
AP11 0,7393
AP12 0,6386
AP13 0,7451
AP1 0,8463 0,7823
AP14 0,6882
AP15 0,6953
AP16 0,6406
AP21 0,5518
AP22 0,7637
AP23 0,7850
AP2 0,8667 0,8147
AP24 0,7521
AP25 0,7847
AP26 0,6749
AP31 0,5932
AP33 0,6628
AP3 0,7901 0,6474
AP35 0,7399
AP36 0,7819
AP41 0,7039
AP42 0,6573
AP4 AP43 0,8143 0,8384 0,7584
AP44 0,6820
AP46 0,7053
Nota: Elaboración propia
138

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

Para concluir, hay que recalcar que la fiabilidad, como indicador de la precisión de la
medida del factor, representa un criterio necesario pero no suficiente para validar la calidad
de dicha escala, dado que no señala en qué grado se está midiendo lo que se pretende medir.
Con tal fin en el siguiente apartado se aborda el análisis de la validez de la escala.

 9DOLGH]

El análisis de la validez valora en qué grado el proceso de medición está exento de error,
tanto sistemático como aleatorio (Camisón, 1999). De esta forma, pretende garantizar que la
escala mide exactamente el concepto que se pretende medir y no otros factores externos al
constructo. A este respecto, siguiendo a Sarabia (1999), debemos tener en cuenta que lo que
se evalúa con la validez no es realmente el instrumento de medida, sino una interpretación
de los datos procedente de un procedimiento específico. En este sentido, en función del
enfoque adoptado, se puede hablar de diferentes tipos de validez, ya que no existe una

medida estadística única y global que garantice el cumplimiento de este requisito.

En nuestro caso, evaluamos los siguientes aspectos de la validez de la escala: validez de


contenido (proceso seguido en la creación de la escala), y validez discriminante.

9DOLGH]GHFRQWHQLGR

La validez de contenido hace referencia al hecho de que una escala debe recoger los
diferentes aspectos que se consideran básicos en relación con el objeto de análisis
(Camisón, 1999), es decir, la validez de contenido implica que la escala debe ser
representativa del concepto que mide (Sarabia, 1999). No existe, por tanto, un criterio
objetivo al que se pueda adaptar la evaluación de la validez de la escala, siendo el
procedimiento más utilizado el de comprobar si el proceso seguido en la construcción
de la escala se adecúa a los criterios establecidos en la literatura, respecto a la
metodología utilizada y a las técnicas y coeficientes adoptados.

En nuestro caso, se ha seguido un proceso metodológico acorde con las


recomendaciones de la literatura científica en el campo académico de la enseñanza
superior. A partir de la revisión teórica efectuada en capítulos anteriores, se delimitaron
los conceptos fundamentales del análisis, y se seleccionó el modelo de investigación
que permitiera desarrollar los objetivos propuestos de acuerdo con otras investigaciones
referidas a la enseñanza superior como la de Deaño y otros (2015).

139

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

En definitiva, siguiendo a Camisón (1999), el análisis del procedimiento seguido permite


afirmar que la escala ha sido desarrollada en el marco de la metodología académica y científica,
generalmente aceptado en ciencias sociales, lo que permite confirmar su validez de contenido.

 9DOLGH]GLVFULPLQDQWH

La validez discriminante indica en qué medida el concepto que se evalúa posee


identidad propia y no es solo un reflejo de otras variables. Este aspecto de la validez de
una escala determina en qué medida un constructo difiere del resto de constructos del
modelo. De esta forma, una elevada validez discriminante implica que la medida no está
contaminada por otros conceptos (Heeler y Ray, 1972).

Con objeto de comprobar la validez discriminante, se puede comprobar que la varianza


media compartida entre un constructo y sus medidas es mayor que la varianza que este
 constructo comparte con los otros constructos del modelo. De forma equivalente, se trataría
de demostrar que las correlaciones entre los constructos son más bajas que la raíz cuadrada
de la varianza extraída media (AVE), tal como se representa en la Tabla 11.

Con objeto de garantizar la validez discriminante, hemos comparado la raíz cuadrada de las
AVE (los valores de la diagonal de la Tabla 11) con las correlaciones entre constructos (los
elementos que están fuera de la diagonal en dicha Tabla). Todos los constructos reflectivos se
relacionan en mayor medida con sus propias medidas que con otros constructos.
Tabla 11
Las AVE y las correlaciones entre los constructos
AC1 AC2 AC3 AC4 AP1 AP2 AP3 AP4
AC1 0,6360
AC2 0,3659 0,6853
AC3 0,4604 0,5795 0,7053
AC4 0,4527 0,5670 0,5129 0,6733
AP1 0,5832 0,4661 0,5288 0,6451 0,7392
AP2 0,4374 0,5898 0,5207 0,6516 0,7280 0,7589
AP3 0,4748 0,5523 0,5329 0,5930 0,7024 0,7251 0,7312
AP4 0,4463 0,5886 0,5514 0,6701 0,6821 0,7587 0,7310 0,7596
Nota. Todas las correlaciones son significativas en el nivel p <.01
Adicionalmente, se han analizado los cross-loadings y se ha comprobado que no son
significativos en relación con los loadings (Chin, 1998). Este segundo método de
comprobar la validez discriminante consiste en presentar una tabla de correlaciones
entre las puntuaciones del constructo y el resto de las medidas (Tabla 12). Las
correlaciones entre las puntuaciones de un constructo y sus propios ítems son las cargas.

140

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

Las correlaciones entre las puntuaciones de un constructo y las de los ítems


que pertenecen a otros constructos son los cross-loadings (cargas cruzadas).

Como se puede observar en la Tabla 12, ninguna medida carga más fuerte en otros constructos
que en el suyo propio por lo que se comprueba igualmente, la validez discriminante de la escala.
Tabla 12
Tabla de correlaciones cruzadas
AC1 AC2 AC3 AC4 AP1 AP2 AP3 AP4
AC11 0,5358 0,0911 0,1739 0,1268 0,2295 0,0686 0,1609 0,0727
AC12 0,5783 0,2117 0,2560 0,2011 0,2929 0,1731 0,2649 0,1743
AC13 0,6284 0,1641 0,2422 0,2297 0,3863 0,3052 0,2630 0,2740
AC14 0,6973 0,1897 0,2228 0,3088 0,3838 0,2789 0,2745 0,3063
AC15 0,7213 0,3783 0,4556 0,4245 0,4724 0,4053 0,4354 0,4185
AC21 0,2216 0,6090 0,4344 0,3207 0,2893 0,3417 0,3210 0,3295
AC23 0,2106 0,6411 0,3568 0,2935 0,2524 0,3503 0,3605 0,3727
AC24 0,2139 0,7119 0,3778 0,4216 0,2711 0,4218 0,3321 0,3927
AC26 0,3375 0,7682 0,4302 0,4791 0,4364 0,4801 0,4844 0,4975

AC31 0,3521 0,3892 0,7680 0,3690 0,3851 0,3647 0,3605 0,3756
AC32 0,4186 0,2981 0,6409 0,3147 0,3982 0,2997 0,3485 0,3039
AC33 0,2181 0,5474 0,7287 0,4146 0,3483 0,4415 0,4553 0,4793
AC34 0,3558 0,3549 0,6769 0,3333 0,3757 0,3397 0,3204 0,3676
AC41 0,3689 0,2430 0,3362 0,5389 0,4350 0,3195 0,3316 0,3770
AC42 0,3062 0,2951 0,2778 0,6163 0,4581 0,4435 0,3596 0,4377
AC43 0,2496 0,4030 0,3243 0,6751 0,3541 0,3734 0,3680 0,4000
AC44 0,3992 0,2831 0,2853 0,6275 0,4763 0,4106 0,4091 0,4011
AC46 0,1327 0,5162 0,3738 0,6692 0,3259 0,4885 0,3900 0,4795
AP11 0,4882 0,3019 0,3942 0,4834 0,7393 0,5019 0,4755 0,5088
AP12 0,3277 0,2455 0,2932 0,3836 0,6386 0,4237 0,3610 0,4057
AP13 0,4256 0,3535 0,4235 0,5038 0,7451 0,5796 0,5168 0,5435
AP14 0,4407 0,3049 0,3531 0,4549 0,6882 0,4774 0,5084 0,4354
AP15 0,3538 0,3814 0,3518 0,4516 0,6953 0,5744 0,5663 0,5021
AP16 0,3803 0,3411 0,3699 0,3876 0,6406 0,4450 0,4774 0,4167
AP21 0,3891 0,2976 0,3684 0,4074 0,5263 0,5518 0,4137 0,4137
AP22 0,3011 0,4199 0,3781 0,4842 0,5372 0,7637 0,5262 0,5961
AP23 0,3758 0,4944 0,4242 0,5081 0,6299 0,7850 0,5737 0,5873
AP24 0,2885 0,5044 0,4331 0,4907 0,5066 0,7521 0,6264 0,6264
AP25 0,3309 0,4543 0,3759 0,5257 0,5510 0,7847 0,5555 0,5702
AP26 0,2338 0,3505 0,2680 0,4000 0,4103 0,6749 0,4134 0,4605
AP31 0,4663 0,2374 0,3139 0,3739 0,5339 0,4011 0,5932 0,3974
AP33 0,1752 0,3940 0,3634 0,3395 0,3513 0,4290 0,6628 0,4668
AP35 0,4229 0,3915 0,3999 0,4488 0,6154 0,5788 0,7399 0,5411
AP36 0,2942 0,4846 0,4053 0,4815 0,4753 0,5877 0,7819 0,6087
AP41 0,4063 0,3983 0,4430 0,5158 0,5737 0,5746 0,4751 0,7039
AP42 0,2134 0,4320 0,4018 0,3761 0,3608 0,4353 0,5405 0,6573
AP43 0,3297 0,4747 0,4229 0,5329 0,5179 0,6186 0,5920 0,8143
AP44 0,2597 0,3864 0,3420 0,4383 0,4336 0,4887 0,4774 0,6820
AP46 0,3686 0,4092 0,3540 0,5162 0,5330 0,5754 0,5245 0,7053
Nota: Elaboración propia
141

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Figura 15. Modelo de medida.

(YDOXDFLyQGHOPRGHOR HVWUXFWXUDO
La siguiente fase en el análisis del modelo de investigación por medio de PLS consiste
en el análisis del modelo estructural, que permitirá el contraste de las hipótesis que
especifican las relaciones de causalidad predictivas entre los factores del modelo
propuesto.

Dos índices básicos se emplean para la interpretación del modelo interno o estructural
en el ámbito de los PLS: el coeficiente de correlación múltiple al cuadrado (R2) y los
coeficientes path estandarizados (β).

El valor de la R2 para las variables latentes dependientes indica la cantidad de varianza


del factor endógeno que es explicada por el modelo (los factores que lo predicen). Unos
valores bajos de este indicador, aún siendo estadísticamente significativos, proporcionan

142

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

muy poca información, por lo que las hipótesis que se formulan con relación a esta
variable latente tienen un nivel predictivo muy bajo.

El coeficiente path estandarizado β permite conocer en qué medida las variables


predictoras o exógenas contribuyen a la varianza explicada de las variables endógenas.
El valor de estos coeficientes, para ser considerados significativos, debería alcanzar un
mínimo de 0.2 e idealmente situarse por encima de 0.3 (Chin, 1998).

A continuación analizamos el modelo estructural. Este se muestra en la Figura 14 y en


la Tabla 15 se incluyen los valores de la varianza explicada de los constructos (R2) y los
coeficientes estandarizados (β).

Dado que el método PLS no realiza suposiciones de distribución en su estimación de


parámetros, las técnicas tradicionales basadas en parámetros para aseg uarr la
 significación y para evaluar el modelo se consideran inapropiadas (Chin, 1998). Una
consecuencia de la comparación entre los enfoques de modelos de análisis basados en la
estructura de la covarianza y el PLS es que con esta última técnica no existe un único
medio para garantizar la bondad del modelo (Hulland, 1999). Por ello, en PLS el
modelo estructural se evalúa examinando los valores de, R2 el test de la Q2 para
la relevancia predictiva y el tamaño de los coeficientes de las trayectorias (paths).
Finalmente, la estabilidad de las estimaciones se examina usando los t-estadísticos que
se obtienen por medio de un bootstrap con 500 muestras.

Además de examinar la R2, el modelo se evalúa observando la relevancia predictiva Q2


de los constructos del modelo (Geisser, 1974; Stone, 1974). Este test es una medida de
hasta qué punto los valores observados son reproducidos por el modelo y por sus
parámetros estimados (Chin, 1998). Una Q2 mayor que 0 implica que el modelo tiene
relevancia predictiva, mientras que si el valor es inferior a 0 indica que el modelo carece
de dicha relevancia predictiva.

La Tabla 13 muestra las hipótesis planteadas, los coeficientes de las trayectorias y los
valores de t observados con el nivel de significación obtenido en el test del bootstrap.
Adicionalmente, también se muestran los efectos directos y la proporción de la varianza
explicada, así como la de Q2 los constructos.

143

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Tabla 13
a

Efectos directos, indirectos y totales, varianza explicada y test de la Q2 para las variables endógenas
Efecto Coef. Varianza Efecto
Hipótesis Relación Sig. T Statistics Q2
directo Correl. explicada total
Aceptación Resultados Escolares 0,3909 0,146
AC1 ->
H1 0,2832 *** 3,5223 0,4527 0,1282 0,3054
AC4
AC2 ->
H2 0,4634 *** 5,1076 0,5670 0,2627 0,4756
AC4
Aceptación Sistemas Evaluación 0,6544 0,330
AP1 ->
H3 0,1558 ns 1,4868 0,6821 0,1063 0,1650
AP4
AP2 ->
H4 0,4102 *** 3,7808 0,7587 0,3112 0,4110
AP4
AP3 ->
H5 0,3241 ** 2,8998 0,7310 0,2370 0,3231
AP4
Aceptación del Sistema 0,3414 0,169
AC4 ->
H6 0,2603 * 2,1262 0,5129 0,1335 0,2727
 AC3
AP4 ->
H7 0,3770 ** 2,8050 0,5514 0,2079 0,3879
AC3
Nota. Nivel de significación: *** p<0.001; ** p<0,01; p<0,05; NS no significativo

Los resultados que se muestran en la Tabla 13 confirman que el modelo de medida es


adecuado y que el modelo estructural tiene una relevancia predictiva satisfactoria para
gran parte de los constructos considerados.

Respecto a la varianza explicada (R2) de la variable latente AP4 (aceptación de


los sistemas de evaluación), el modelo estructural muestra un muy buen poder predictivo,
dado que el valor obtenido es de 0.6544, es decir, que se explica un 65,44% de
la varianza de AP4. En el caso de la variable AP4 el valor de Q2 es 0.330, por tanto tiene
relevancia predictiva.

Con respecto a la varianza explicada (R2) del resto de variables latentes del modelo, el
modelo estructural muestra un poder predictivo aceptable para acepta resultados
académicos (39,09%) y aceptación del sistema (34,14%) en todos los casos con relevancia
predictiva Q2 mayor que cero.

Por último, para garantizar la calidad del modelo PLS recientemente se ha desarrollado
el test GoF, definido éste como la media geométrica de la comunalidad media y la
media de R2, para los constructos endógenos (Tenenhaus, Vinzi, Chatelin y Lauro,
2005; Wetzelset al., 2009), siendo en PLS la comunalidad medida con el AVE. En

144

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

nuestro caso (Tabla 14), y para el modelo completo obtenemos un valor de GoF de
0.465, que excede sobradamente el valor de 0.36 propuesto por Wetzelset al. (2009)
considerando la situación más desfavorable para este test.
Tabla 14
Test de GoF
AVE R Square GoF
AC3 0,497 0,341
AC4 0,394 0,391
AP4 0,511 0,654
0,467 0,462 0,465
Nota: Elaboración propia

Finalmente se analiza la intensidad de las relaciones propuestas, su significación y la dirección.

En la Tabla 15 se muestran las distintas relaciones que configuran el sistema de


 hipótesis propuesto, el efecto directo de las relaciones, la significación a partir de los t-

estadísticos y la varianza explicada.


Tabla 15
Contraste de Hipótesis
Standard Standard
Original Sample Mean T Statistics
Deviation Error
Sample (O) (M) (|O/STERR|)
(STDEV) (STERR)

AC1 ->AC3 0,07371 0,083353 0,046 0,045676 1,613764

AC1 ->AC4 0,28319 0,305431 0,08 0,080399 3,522311

AC2 ->AC3 0,120607 0,131571 0,067 0,067295 1,792197

AC2 ->AC4 0,463365 0,475595 0,091 0,09072 5,10762

AC4 ->AC3 0,260284 0,272735 0,122 0,122419 2,126172

AP1 ->AC3 0,058728 0,062769 0,047 0,047436 1,238028

AP1 -> AP4 0,155789 0,165031 0,105 0,104783 1,486767

AP2 ->AC3 0,154637 0,158564 0,07 0,070197 2,202897

AP2 -> AP4 0,410212 0,411044 0,108 0,108498 3,78082

AP3 ->AC3 0,122193 0,128488 0,067 0,066752 1,830545

AP3 -> AP4 0,324145 0,323136 0,112 0,111781 2,899829

AP4 ->AC3 0,376969 0,387922 0,134 0,134394 2,804967


Nota: Elaboración propia

145

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Aceptación 
Disciplina
AC1
3,522311

Aceptación 
Motivación e  5,10762 Resultados 
Interés Académicos
AC2 AC4
2,126172

Aceptación
del sistema
Nivel  AC3
Comunicación y 
Comprensión 1,486767 2,804967
AP1 Aceptación 
Sistemas 
3,78082 Evaluación
Grado de  AP4
Autoritarismo
AP2
2,899829

Grado de 
Exigencia
AP3

Figura 16. Modelo estructural.

Por tanto, en relación a las hipótesis propuestas en el modelo podemos concluir:

En referencia a la hipótesis sobre aceptación de resultados:

-H1. Existe una relación positiva directa entre la aceptación de disciplina y la aceptación
de resultados académicos. (β=.283, p<.001).

-H2. Existe una relación positiva directa entre motivación e interés y aceptación
de resultados académicos. (β=.4634, p<.001).

En referencia a las hipótesis sobre sistemas de evaluación:

- H4. Existe una relación positiva directa entre grado de autoritarismo y aceptación de
sistemas de evaluación (β=.410, p<.001).

-H5. Existe una relación positiva directa entre grado de exigencia y aceptación de
sistema de evaluación (β=.3241, p<.01).

146

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

En referencia a las hipótesis sobre aceptación de sistemas de enseñanza:

-H6. Existe una relación positiva directa entre aceptación de resultados académicos
y aceptacion de sistemas de enseñanza β=.2603, p<.05)

-H7. Existe una relación positiva directa entre sistemas de evaluación y aceptación
de sistemas de enseñanza. β=.3770, p<.05)

ANÁLISIS DE LAS ACTITUDES INVESTIGADAS EN LA EDUCACIÓN SUPERIOR

En este apartado realizamos un análisis de los resultados obtenidos según el centro


formativo de procedencia, modalidad de enseñanza y sexo. En último lugar, llevaremos
 a cabo un análisis diferenciado del alumnado de primer nivel. Con objeto de aportar
claridad a los datos, llevaremos a cabo en todos los casos, en primer lugar, un análisis
de los matices implicados en la actitud hacia el centro y, en segundo lugar, de los
matices socio-afectivos implicados en la actitud hacia el profesor. Por último, en cada
apartado se expondrá la comparativa de las actitudes globales según la variable de
análisis (centro formativo, modalidad de enseñanza y sexo). Nuestro objetivo es
determinar si existen diferencias estadísticamente significativas en los matices y
actitudes estudiadas según la variable analizada.

$QiOLVLVGHUHVXOWDGRVSRUYDULDEOHFHQWURIRUPDWLYR

A este respecto, compararemos las puntuaciones referidas a cada uno de los matices
socio-afectivos implicados en las actitudes hacia el profesor, hacia el centro, así como
las actitudes globales en la FCC Educación, la ET_ULPGC y la FCCAFD.

En las Tablas 16 y 25 exponemos los estadísticos descriptivos fundamentales. En


segundo lugar, mostramos, a través de diagramas de cajas, la distribución de la variable
actitud hacia el centro en función del centro formativo.

147




148
Tabla 16
Descriptivos. Actitudes hacia el centro según centro formativo

Intervalo de confianza Rango


Desv. Error Mín Máx.
Media para la media al 95% Promedio
Típica típico
Límite inf. Límite sup.
FCCEducación 17,89 3,880 ,227 17,45 18,34 8 30 968,61
Acepta_ ET_ULPGC 18,74 4,168 ,141 18,46 19,02 6 30 1122,59
Disciplina FCCAFD 19,77 3,890 ,111 19,55 19,98 7 30 1297,56
Total 19,16 4,046 ,083 19,00 19,33 6 30
FCCEducación 23,55 3,331 ,195 23,17 23,94 10 30 1320,35
Interés_ ET_ULPGC 23,53 3,991 ,135 23,26 23,79 10 30 1327,60
Motivación FCCAFD 22,41 3,217 ,092 22,23 22,59 13 30 1067,92
Total 22,96 3,575 ,073 22,82 23,10 10 30
FCCEducación 21,40 3,568 ,209 20,99 21,82 10 29 1055,42
Acepta_ ET_ULPGC 22,05 3,494 ,118 21,82 22,28 9 30 1172,28
Sistemas FCCAFD 22,36 3,374 ,096 22,17 22,55 10 30 1241,52
Total 22,13 3,454 ,071 21,99 22,27 9 30
FCCEducación 20,06 3,955 ,231 19,61 20,52 6 30 1023,31
Acepta_ ET_ULPGC 22,84 3,772 ,128 22,59 23,09 6 30 1501,85
Resultados FCCAFD 20,05 3,712 ,106 19,85 20,26 8 30 1014,93
Total 21,07 3,995 ,082 20,91 21,23 6 30
FCCEducación 82,91 11,026 ,645 81,64 84,18 51 109 1040,73
Actitudes ET_ULPGC 87,16 11,558 ,392 86,39 87,93 36 119 1310,14
Centro FCCAFD 84,60 10,807 ,309 83,99 85,20 46 116 1147,04
Total 85,33 11,207 ,229 84,88 85,78 36 119
Nota: Elaboración propia
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6
&$3Ë78/2 $1È/,6,6'(5(68/7$'26


Figura nº 17. Distribución de las actitudes hacia el centro según centro.

Tal como nos indica la prueba no paramétrica de Kruskal-Wallis (Tabla 17), las
poblaciones comparadas difieren en todos los matices socio-afectivos que componen
esta actitud y, por tanto, en la propia actitud hacia el centro.

Tabla 17

Actitudes hacia el centro según centro. Estadísticos de contraste


Acepta Interés Acepta Acepta Actitudes
Disciplina Motivación Sistemas Resultados Centro
Chi-cuadrado 68,638 84,211 18,652 275,844 44,899
Gl 2 2 2 2 2
Sig. asintót. ,000 ,000 ,000 ,000 ,000
1RWD(ODERUDFLyQSURSLD

Nota. Prueba de Kruskal-Wallis


Con objeto de determinar con más precisión este aspecto, realizamos comparaciones dos
a dos entre los centros a través de la prueba U de Mann – Whitney.

Tal como vemos hay diferencias en cuanto a los matices Acepta Disciplina;
Acepta Sistemas; Acepta Resultados, así como en las Actitudes hacia el Centro entre los
centros FCC Educación y ET_ULPGC (Tabla 18). En este sentido, debemos
recordar que estamos comparando las puntuaciones de un centro con modalidad
de enseñanza presencial y un centro con modalidad de enseñanza a distancia. No existen
diferencias significativas en el matiz Interés y Motivación.

149

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Tabla 18
Comparación FCC Educación-ET ULPGC en las actitudes hacia el centro. Estadísticos de
contraste
Acepta Interés Acepta Acepta Actitudes
Disciplina Motivación Sistemas Resultados Centro
U de Mann-Whitney 111081,5 123834,0 114516,5 76774,5 98791,5
W de Wilcoxon 153859,5 166612, 157294,5 119552,5 141569,5
Z -3,221 -,645 -2,531 -10,155 -5,692
Sig. asintót. (bilateral)
,001 ,519 ,011 ,000 ,000
Nota: Elaboración propia

En el caso de los dos centros con modalidad de enseñanza presencial,


observamos diferencias en todos los matices y también en la Actitud hacia el Centro,
excepto en el matiz Acepta Resultados de la Tabla 19.

Tabla 19
Comparación FCC Educación-FCCAFD en las actitudes hacia el centro. Estadísticos de
contraste
Acepta Interés Acepta Acepta Actitudes
Disciplina Motivación Sistemas Resultados Centro
U de Mann-Whitney 128975,0 138479,0 150889,5 178155,0 162324,0
W de Wilcoxon 171753,0 888179,0 193667,5 927855,0 205102,0
Z -7,420 -6,014 -4,155 -,082 -2,438
Sig.
asintót.(bilateral) ,000 ,000 ,000 ,935 ,015

Nota: Elaboración propia

En último lugar, hallamos diferencias entre ET_ULPGC y FCCAFD en todos los


matices socio-afectivos implicados en la actitud hacia el centro (Tabla 20).
Tabla 20
Comparación ET ULPGC- FCCAFD en las actitudes hacia el centro. Estadísticos de contraste

Acepta Interés Acepta Acepta Actitudes


Disciplina Motivación Sistemas Resultados Centro
U de Mann-Whitney 454805,5 418960,5 501479,0 314419,0 459194,5
W de Wilcoxon 833690,5 1168660,5 880364,0 1064119,0 1208894,5
Z -5,710 -8,355 -2,280 -16,034 -5,374
Sig.
asintót.(bilateral) ,000 ,000 ,023 ,000 ,000

Nota: Elaboración propia

150

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

La Figura 18 muestra diferencias de la media según distintos matices implicados


referidos a la actitud hacia el centro:


Figura nº 18. Comparativa de medias de los matices implicados en la actitud hacia el centro según centro.

A continuación realizamos el mismo análisis para las actitudes hacia el profesor,


exponiendo un resumen de los estadísticos principales y orientando su análisis a la
comparación según la variable centro. En segundo lugar, mostramos un diagrama de
cajas en el que se puede observar la distribución de las puntuaciones referidas a
actitudes hacia el profesor según centro formativo.

Tal como nos indica la prueba de Kruskal-Wallis (Tabla 21) hallamos diferencias
significativas respecto a las puntuaciones de cada uno de los matices implicados en las
actitudes hacia el profesor. En este punto, realizamos las comparaciones dos a dos con
la prueba U de Mann-Whitney.
Tabla 21
Actitudes hacia el profesor según centro. Estadísticos de contraste

Nivel Nivel Nivel Sistemas Actitudes


Comprensión Autoritarismo Exigencia Evaluación Profesor
Chi-cuadrado 84,427 458,792 42,153 349,530 209,091
Gl 2 2 2 2 2
Sig. asintót. ,000 ,000 ,000 ,000 ,000
Nota. Prueba de Kruskal-Wallis

151

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Vemos diferencias significativas en todos los matices referidos a la actitud hacia el


profesor en la FCC Educación y ET_ULPGC (Tabla 22).
Tabla 22
Comparación FCC Educación – ET_ULPGC en las actitudes hacia el profesor. Estadísticos de contraste

Nivel Nivel Nivel Sistemas Actitudes


Comprensión Autoritarismo Exigencia Evaluación Profesor
U de Mann-
94167,5 88185,5 107459,0 90162,5 89471,5
Whitney
W de Wilcoxon 136945,5 130963,5 150237,0 132940,5 132249,5
Z -6,640 -7,851 -3,955 -7,460 -7,570
Sig.asintót.
(Bilateral. ,000 ,000 ,000 ,000 ,000

Nota: Elaboración propia

Sin embargo, entre los dos centros presenciales no hallamos diferencias


 estadísticamente significativas respecto a las puntuaciones respecto a la actitud hacia el
profesor (Tabla 23). Por otra parte, sí observamos diferencias entre los centros
FCCAFD y ET_ULPGC (Tabla 24).
Tabla 23
Comparación FCC Educación- FCCAFD en las actitudes hacia el profesor. Estadísticos de contraste

Nivel
Nivel Nivel Sistemas Actitudes
Compren
Autoritarismo Exigencia Evaluación Profesor
sión
U de Mann-Whitney 169081,5 132184,5 135874,0 154765,0 170957,0
W de Wilcoxon 211859,5 881884,5 178652,0 904465,0 920657,0
Z -1,437 -6,937 -6,395 -3,573 -1,153
Sig.
asintót.Bilateral ,151 ,000 ,000 ,000 ,249

Nota: Elaboración propia

Tabla 24
Comparación FCCAFD – ET_ULPGC en las actitudes hacia el profesor. Estadísticos de
contraste.

Nivel Nivel Nivel Sistemas Actitudes


Comprensión Autoritarismo Exigencia Evaluación Profesor
U de Mann-
418544,0 242571,0 490025,5 274957,0 336979,0
Whitney
W de Wilcoxon 1168244,0 992271,0 868910,5 1024657,0 1086679,0
Z -8,380 -21,303 -3,122 -18,947 -14,339
Sig.
asintót.Bilateral ,000 ,000 ,002 ,000 ,000

Nota: Elaboración propia


152

Tabla 25

Descriptivos. Actitudes hacia el profesor según centro formativo


&$3Ë78/2

Intervalo de confianza para la


Desviación Rango
Media Error típico media al 95% Mín. Máx.
típica promedio
Límite inf. Límite sup.
FCCEducación 21,25 3,544 ,207 20,84 21,65 12 30 1048,04
Nivel_ ET_ULPGC 22,90 3,945 ,134 22,64 23,16 6 30 1362,18
Comprensión FCCAFD 21,59 3,539 ,101 21,39 21,79 7 30 1108,31
Total 22,03 3,752 ,077 21,87 22,18 6 30
FCCEducación 22,22 4,420 ,259 21,71 22,72 10 30 1219,82
Nivel_ ET_ULPGC 24,49 3,784 ,128 24,24 24,74 8 30 1571,32

Autoritarismo FCCAFD 20,28 4,304 ,123 20,04 20,52 8 30 918,67
Total 22,05 4,570 ,094 21,87 22,24 8 30
FCCEducación 22,68 3,764 ,220 22,25 23,12 12 30 978,83
Nivel_ ET_ULPGC 23,66 3,837 ,130 23,41 23,92 6 30 1167,23
Exigencia FCCAFD 24,21 3,470 ,099 24,02 24,41 11 30 1263,14
Total 23,83 3,676 ,075 23,68 23,97 6 30
FCCEducación 23,04 4,374 ,256 22,54 23,55 12 30 1149,26
Sistemas_ ET_ULPGC 25,20 3,347 ,113 24,97 25,42 6 30 1531,82
Evaluación FCCAFD 22,18 3,626 ,104 21,98 22,39 6 30 963,58
Total 23,39 3,887 ,080 23,23 23,54 6 30
Actitudes
FCCEducación 89,192 13,8330 ,8095 87,599 90,785 48,0 117,0 1091,44
Profesor
ET_ULPGC 96,248 13,1254 ,4450 95,375 97,122 28,0 119,0 1461,33
FCCAFD 88,266 12,5339 ,3583 87,563 88,969 35,0 119,0 1027,48
Total 91,290 13,4490 ,2753 90,750 91,830 28,0 119,0
Nota: Elaboración propia

153
$1È/,6,6'(5(68/7$'26
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Figura 19. Distribución de las actitudes hacia el profesor según centro.


A continuación exponemos en la Figura 20 las medias de cada uno de los matices en
cada centro de la muestra. Tal como podemos observar, las medias de las puntuaciones
obtenidas en cada uno de los matices referidos a la actitud hacia el profesor son
superiores en la ET_ULPGC.


Figura 20. Comparativa de medias de los matices implicados en la actitud hacia el profesor según centro.

De forma conjunta, podemos observar las diferencias respecto a las puntuaciones


referidas a las actitudes hacia el centro y hacia el profesor en la Figura 21:

Figura 21. Comparativa media de actitudes hacia el centro y hacia el profesor según centro.
154

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

En cuanto a las Actitudes Globales, la Figura 22 nos muestra la distribución por centros respecto a esta variable

Figura 22. Distribución de las actitudes globales según centro.

 $QiOLVLVGHUHVXOWDGRVSRUPRGDOLGDGGHHQVHxDQ]D
En este apartado analizamos los datos según la variable modalidad de enseñanza,
presencial o a distancia. En primer lugar, tal como realizamos en el apartado anterior,
 presentamos un resumen de los estadísticos descriptivos más relevantes de cada uno de
los matices y actitudes (Tablas 27 y 29), diferenciando los referidos a la actitud hacia el
centro y hacia el profesor. En segundo lugar, mostramos un diagrama de caja de cada
una de las dos actitudes estudiadas en las Figuras 23 y 25. En tercer lugar, realizamos la
prueba no paramétrica para dos muestras independientes de U de Mann-Whitney (Tabla 26),
teniendo en cuenta la variable modalidad de enseñanza. Finalmente, abordamos el
análisis de las Actitudes Globales, que integran los aspectos referidos a Actitud hacia el
Centro y hacia el profesor (Figura 27). En cada uno de los casos, podremos visualizar, a
través de un gráfico de barras la comparación entre las medias (Figuras 24 y 26).

Tal como podemos observar a través de la prueba U de Mann-Whitney, existen


diferencias significativas entre las puntuaciones referidas a los matices implicados en la
actitud hacia el centro según modalidad de enseñanza, así como en la propia Actitud
hacia el Centro (Tabla 26). La excepción la encontramos en el matiz Acepta Sistemas de
Enseñanza que, como vemos, no difiere significativamente entre una y otra modalidad.
Tabla 26
Actitudes hacia el centro según modalidad de enseñanza. Estadísticos de contraste
Acepta Interés Acepta Acepta Actitudes
Disciplina Motivación Sistemas Resultados Centro
U de Mann-Whitney 597764,0 542794,5 641002,5 391193,5 557986,0
W de Wilcoxon 976649,0 1692680,5 1019887,5 1541079,5 1707872,0
Z -3,820 -7,232 -1,144 -16,608 -6,267
Sig. asintót. (bilateral) ,000 ,000 ,253 ,000 ,000
Nota: Elaboración propia

155


156

Tabla 27
Descriptivos. Actitudes hacia el centro según modalidad de enseñanza

Intervalo de confianza
Desv. Error Rango
Media para la media al 95% Mín. Máx.
típica típico Promedio
Límite inf. Límite sup.
Presencial 19,41 3,956 ,102 19,21 19,60 7 30 1234,20
Acepta_
Disciplina Distancia 18,74 4,168 ,141 18,46 19,02 6 30 1122,59
Total 19,16 4,046 ,083 19,00 19,33 6 30
Presencial 22,63 3,269 ,084 22,47 22,80 10 30 1116,54
Interés_
Motivación Distancia 23,53 3,991 ,135 23,26 23,79 10 30 1327,60
Total 22,96 3,575 ,073 22,82 23,10 10 30
Presencial 22,18 3,432 ,088 22,01 22,35 10 30 1205,68
Acepta_
Sistemas Distancia 22,05 3,494 ,118 21,82 22,28 9 30 1172,28
Total 22,13 3,454 ,071 21,99 22,27 9 30
Presencial 20,06 3,758 ,097 19,87 20,24 6 30 1016,54
Acepta_
Resultados Distancia 22,84 3,772 ,128 22,59 23,09 6 30 1501,85
Total 21,07 3,995 ,082 20,91 21,23 6 30
Presencial 84,27 10,866 ,279 83,73 84,82 46 116 1126,56
Actitudes
Centro Distancia 87,16 11,558 ,392 86,39 87,93 36 119 1310,14
Total 85,33 11,207 ,229 84,88 85,78 36 119
Nota: Elaboración propia
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6
&$3Ë78/2 $1È/,6,6'(5(68/7$'26

Figura 23. Distribución de las actitudes hacia el centro según modalidad de enseñanza.
En la Figura 24, podemos observar la diferencia de medias según modalidad de
enseñanza en los matices referidos a Actitudes hacia el centro.

Figura 24. Comparativa de medias de matices socio-afectivos de las Actitudes hacia el Centro según modalidad de enseñanza.

A continuación exponemos el análisis referido a los matices socio-afectivos implicados


en la Actitud hacia el profesor, teniendo en cuenta la variable modalidad de enseñanza.

En la Tabla 28, que refleja los resultados de la prueba U de Mann- Whitney,


observamos que el matiz de nivel de exigencia no presenta diferencias significativas
entre una u otra modalidad de enseñanza. En cambio, el resto de matices y la Actitud
hacia el Profesor (en la que se encuentran todas integradas) sí varía.
Tabla 28
Actitudes hacia el profesor según modalidad de enseñanza. Estadísticos de contraste
Nivel Nivel Nivel Sistemas Actitudes
Compromiso Autoritarismo Exigencia Evaluación Profesor
U de Mann-
512711,5 330756,5 636606,5 365119,5 426450,5
Whitney
W de Wilcoxon 1662597,5 1480642,5 1015491,5 1515005,5 1576336,5
Z -9,089 -20,336 -1,416 -18,229 -14,389
Sig.asintót.
,000 ,000 ,157 ,000 ,000
(bilateral)
Nota: Elaboración propia

157

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

En la Figura 25 mostramos el diagrama de cajas correspondiente a las Actitudes


hacia el Profesor según modalidad de enseñanza.

Figura 25. Distribución de las actitudes hacia el profesor según modalidad de enseñanza.

158

&$3Ë78/2

Tabla 29
Descriptivos Actitudes hacia el profesor según modalidad de enseñanza

Intervalo de confianza Rango


Desv. Error Mín. Máx.
Media para la media al 95% Promedio
típica típico
Límite inf. Límite sup.
Presencial 
21,52 3,541 ,091 21,34 21,70 7 30 1096,70
Nivel_
Comprensión Distancia 22,90 3,945 ,134 22,64 23,16 6 30 1362,18
Total 22,03 3,752 ,077 21,87 22,18 6 30
Presencial 20,65 4,392 ,113 20,43 20,87 8 30 976,68
Nivel_
Autoritarismo Distancia 24,49 3,784 ,128 24,24 24,74 8 30 1571,32
Total 22,05 4,570 ,094 21,87 22,24 8 30
Presencial 23,92 3,578 ,092 23,74 24,10 11 30 1208,57
Nivel_
Exigencia Distancia 23,66 3,837 ,130 23,41 23,92 6 30 1167,23
Total 23,83 3,676 ,075 23,68 23,97 6 30
Presencial 22,35 3,795 ,097 22,16 22,54 6 30 999,34
Sistemas_
Evaluación Distancia 25,20 3,347 ,113 24,97 25,42 6 30 1531,82
Total 23,39 3,887 ,080 23,23 23,54 6 30
Presencial 88,445 12,7949 ,3286 87,800 89,089 35,0 119,0 1039,80
Actitudes
Profesor Distancia 96,248 13,1254 ,4450 95,375 97,122 28,0 119,0 1461,33
Total 91,290 13,4490 ,2753 90,750 91,830 28,0 119,0
Nota: Elaboración propia

159
$1È/,6,6'(5(68/7$'26
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

La Figura 26 nos muestra las diferencias según modalidad de enseñanza en las medias referidas
a Nivel de Comprensión; Nivel de Autoritarismo; Nivel de Exigencia y Sistemas de Evaluación.

Figura 26. Comparativa de medias de los matices socio-afectivos implicados en la actitud hacia el
profesor según modalidad de enseñanza.
La Figura 27 nos muestra a través de un gráfico de barras las diferencias entre Actitud hacia el
Centro y hacia el Profesor según modalidad de enseñanza, tal como vemos, el alumnado que

cursa sus estudios a distancia presenta unos niveles superiores a las medias de ambas
actitudes, si bien de forma particular destaca el caso de las actitudes hacia el profesor.

Figura 27. Comparativa actitudes hacia el centro y hacia el profesor según modalidad de enseñanza.
A continuación, el diagrama de cajas en la Figura 28 representa las distribuciones de las
muestras de la variable Actitudes Globales según modalidad de enseñanza.

Figura 28. Distribución de las actitudes globales según modalidad de enseñanza.

160

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

'LIHUHQFLDVVHJ~QPRGDOLGDGGHHQVHxDQ]D\VH[R

A continuación realizamos un análisis combinado, teniendo en cuenta de forma


diferencial la modalidad de enseñanza y la variable sexo. De esta forma, nos interesa
conocer si existen diferencias estadísticamente significativas entre las puntuaciones
referidas a cada uno de los matices y actitudes estudiadas en cada una de las
modalidades de enseñaza (presencial o a distancia) según esta variable.

En primer lugar, comenzamos analizando la enseñanza presencial, posteriormente,


realizaremos el análisis de la enseñanza a distancia. Las Tablas 32 y 33 muestran los
estadísticos descriptivos de los matices estudiados en la enseñanza presencial realizando
una comparativa según género. En este caso nos encontramos con una muestra n=1516
alumnos, de los que 1023 son hombres (67,5%) y 493 (32,5%) mujeres.

La prueba U de Mann–Whitney revela diferencias estadísticamente significativas según
sexo en la enseñanza presencial en las actitudes hacia el profesor, no así en las actitudes
hacia el centro. En las siguientes Tablas mostramos los resultados de esta prueba para
cada uno de los matices socio-afectivos estudiados (Tablas 30 y 31).

Tabla 30

Actitudes hacia el centro según género. Modalidad presencial. Estadísticos de contraste


Acepta Interés Acepta Acepta Actitudes
Disciplina Motivación Sistemas Resultados Centro

U de Mann- 244003,0 231099,5 251022,0 230401,5 242133,0


Whitney
W de Wilcoxon 365774,0 754875,5 372793,0 754177,5 765909,0
Z -1,026 -2,652 -,144 -2,735 -1,257
Sig. asintót.
(bilateral) ,305 ,008 ,885 ,006 ,209

Nota: Elaboración propia

161

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Tabla 31
Actitudes hacia el profesor según género EP. Estadísticos de contraste
Nivel Nivel Nivel Sistemas Actitudes
Compr. Autoritarismo Exigencia Evaluación. Profesor

U de Mann- 230317,0 203319,0 240695,5 208055,5 218479,5


Whitney
W de Wilcoxon 754093,0 727095,0 362466,5 731831,5 742255,5
Z -2,747 -6,132 -1,442 -5,543 -4,221
Sig. asintót.
(bilateral) ,006 ,000 ,149 ,000 ,000

Nota: Elaboración propia

En la Figura 29 podemos ver la comparativa entre las puntuaciones:

Figura 29. Comparativa según sexo en los matices implicados en la actitud hacia el profesor.
La Figura 30 nos muestra la comparativa de las Actitudes hacia el Centro y hacia el Profesor según
género en la enseñanza presencial.

Figura 30. Comparativa actitudes hacia el centro y el profesor según sexo en modalidad presencial.

162

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

En los diagramas de caja (Figuras 31, 32 y 33) podemos ver las distribuciones que sigue
las variables Actitudes hacia el Profesor, hacia el Centro y Globales según sexo en la
enseñanza presencial. Posteriormente, en las Tablas 32 y 33 se muestran los estadísticos descriptivos de
referencia.

 Figura 31. Distribución de las actitudes hacia el profesor según sexo en enseñanza presencial.

Figura 32. Distribución de las actitudes hacia el centro según sexo en enseñanza presencial.

Figura 33. Distribución de las actitudes globales según sexo en enseñanza presencial.

163




164
Tabla 32

Descriptivos. Actitudes hacia el centro según género en enseñanza presencial


Intervalo de confianza
Desv. Error Rango
Media para la media al 95% Mín. Máx.
Típica típico Promedio
Límite inf. Límite sup.
Masculino 19,46 3,891 ,122 19,22 19,70 7 30 766,48
Acepta_
Disciplina Femenino 19,29 4,090 ,184 18,92 19,65 7 30 741,94
Total 19,41 3,956 ,102 19,21 19,60 7 30
Masculino 22,48 3,269 ,102 22,28 22,68 10 30 737,90
Interés_
Motivación Femenino 22,95 3,250 ,146 22,66 23,23 10 30 801,24
Total 22,63 3,269 ,084 22,47 22,80 10 30
Masculino 22,18 3,429 ,107 21,97 22,39 10 30 759,62
Acepta_
Sistemas Femenino 22,17 3,443 ,155 21,87 22,48 10 30 756,17
Total 22,18 3,432 ,088 22,01 22,35 10 30
Masculino 19,85 3,768 ,118 19,62 20,09 6 30 737,22
Acepta_
Resultados Femenino 20,47 3,709 ,167 20,14 20,80 11 30 802,65
Total 20,06 3,758 ,097 19,87 20,24 6 30
Masculino 83,98 10,930 ,342 83,31 84,65 46 116 748,69
Actitudes
centro Femenino 84,88 10,717 ,483 83,93 85,83 51 114 778,86
Total 84,27 10,866 ,279 83,73 84,82 46 116
Nota: Elaboración propia
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6
&$3Ë78/2

Tabla 33
Descriptivos. Actitudes hacia el profesor según género en enseñanza presencial

Desv. Error Intervalo de confianza Mín. Máx. Rango


Media para la media al 95% Promedio
Típica típico
Límite inf. Límite sup.
Masculino 21,35 3,546 ,111 21,13 21,57 7 30 737,14
Nivel_ 
Comprensión Femenino 21,89 3,507 ,158 21,58 22,20 7 30 493
Total 21,52 3,541 ,091 21,34 21,70 7 30
Masculino 20,19 4,339 ,136 19,92 20,45 8 30 710,75
Nivel_
Autoritarismo Femenino 21,62 4,347 ,196 21,23 22,00 8 30 857,59
Total 20,65 4,392 ,113 20,43 20,87 8 30
Masculino 23,97 3,628 ,113 23,75 24,20 11 30 769,72
Nivel_
Exigencia Femenino 23,81 3,474 ,156 23,50 24,11 11 30 735,23
Total 23,92 3,578 ,092 23,74 24,10 11 30
Masculino 21,97 3,766 ,118 21,74 22,20 6 30 715,38
Sistemas_
Evaluación Femenino 23,14 3,738 ,168 22,81 23,47 6 30 847,98
Total 22,35 3,795 ,097 22,16 22,54 6 30

Masculino 87,478 12,7425 ,3984 86,696 88,260 35,0 119,0 725,57


Actitudes
Profesor Femenino 90,450 12,6825 ,5712 89,328 91,573 35,0 118,0 826,84
Total 88,445 12,7949 ,3286 87,800 89,089 35,0 119,0
Nota: Elaboración propia

165
$1È/,6,6'(5(68/7$'26
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

A continuación indagamos en las diferencias según género en la modalidad de


enseñanza a distancia. En este caso trabajamos con una muestra de n=870 alumnos, de
los que 209 son hombres (246%) y 661 son mujeres (76%).

La prueba U de Mann- Whitney (Tabla 34) nos indica que hay diferencias significativas
en las actitudes hacia el centro según sexo en esta modalidad de enseñanza y en las
actitudes hacia el profesor (Tabla 35).

Tabla 34

Actitudes hacia el centro según sexo en enseñanza a distancia. Estadísticos de contraste


Acepta Interés Acepta Acepta Actitudes
Disciplina Motivación Sistemas Resultados Centro

U de Mann- 63225,0 61010,0 62020,5 62162,5 60261,5


Whitney
 W de Wilcoxon 85170,0 82955,0 83965,5 84107,5 82206,5
Z -1,852 -2,556 -2,238 -2,190 -2,784
Sig. asintót.
(bilateral) ,064 ,011 ,025 ,029 ,005

Nota: Elaboración propia

Tabla 35
Actitudes hacia el profesor según sexo en enseñanza a distancia. Estadísticos de contraste
Nivel Nivel Nivel Sistemas Actitudes
Compr. Autoritarismo Exigencia Evaluación Profesor

U de Mann- 60781,5 59938,0 64372,5 58966,5 59916,5


Whitney
W de Wilcoxon 82726,5 81883,0 86317,5 80911,5 81861,5
Z -2,627 -2,896 -1,490 -3,210 -2,893
Sig. asintót.
(bilateral) ,009 ,004 ,136 ,001 ,004

Nota: Elaboración propia

A continuación mostramos las Tablas 36 y 37 que representan los estadísticos


descriptivos fundamentales y las Figuras en las que se realizan las comparaciones entre
matices socio-afectivos y actitudes.

166

&$3Ë78/2

Tabla 36

Descriptivos. Actitudes hacia el centro según género en enseñanza a distancia

Intervalo de confianza
Desv. Error
Media para la media al 95% Mín. Máx. Rango Promedio
típica típico
Límite inf. Límite sup.

Masculino 18,24 4,146 ,287 17,68 18,81 6 29 407,51
Acepta_
Disciplina Femenino 18,90 4,166 ,162 18,58 19,22 6 30 444,35
Total 18,74 4,168 ,141 18,46 19,02 6 30
Masculino 22,93 4,075 ,282 22,37 23,48 12 30 396,91
Interés_
Motivación Femenino 23,71 3,949 ,154 23,41 24,02 10 30 447,70
Total 23,53 3,991 ,135 23,26 23,79 10 30
Masculino 21,44 3,848 ,266 20,92 21,96 9 29 401,75
Acepta_
Femenino 22,24 3,354 ,130 21,99 22,50 9 30 446,17
Sistemas
Total 22,05 3,494 ,118 21,82 22,28 9 30
Masculino 22,28 4,023 ,278 21,73 22,83 9 30 402,43
Acepta_
Femenino 23,02 3,674 ,143 22,74 23,30 6 30 445,96
Resultados
Total 22,84 3,772 ,128 22,59 23,09 6 30
Masculino 84,89 12,357 ,855 83,21 86,58 37 110 393,33
Actitudes
Femenino 87,88 11,208 ,436 87,02 88,73 36 119 448,83
Centro
Total 87,16 11,558 ,392 86,39 87,93 36 119
Nota: Elaboración propia

167
$1È/,6,6'(5(68/7$'26



168
Tabla 37

Descriptivos. Actitudes hacia el profesor según género en enseñanza a distancia

Intervalo de confianza Rango


Desv. Error Mín. Máx.
Media para la media al 95% Promedio
típica típico
Límite inf. Límite sup.
Masculino 22,32 4,034 ,279 21,77 22,87 7 30 395,82
Nivel_
Comprensión Femenino 23,08 3,902 ,152 22,79 23,38 6 30 448,05
Total 22,90 3,945 ,134 22,64 23,16 6 30
Masculino 23,82 4,034 ,279 23,27 24,37 8 30 391,78
Nivel_
Autoritarismo Femenino 24,70 3,680 ,143 24,42 24,98 10 30 449,32
Total 24,49 3,784 ,128 24,24 24,74 8 30
Masculino 23,32 3,991 ,276 22,77 23,86 7 30 413,00
Nivel_
Exigencia Femenino 23,77 3,784 ,147 23,48 24,06 6 30 442,61
Total 23,66 3,837 ,130 23,41 23,92 6 30
Masculino 24,61 3,365 ,233 24,15 25,07 13 30 387,14
Sistemas_
Evaluación Femenino 25,38 3,323 ,129 25,13 25,64 6 30 450,79
Total 25,20 3,347 ,113 24,97 25,42 6 30
Masculino 94,057 13,6768 ,9460 92,192 95,922 35,0 119,0 391,68
Actitudes
Profesor Femenino 96,941 12,8794 ,5010 95,957 97,925 28,0 119,0 449,35
Total 96,248 13,1254 ,4450 95,375 97,122 28,0 119,0
Nota: Elaboración propia
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6
&$3Ë78/2 $1È/,6,6'(5(68/7$'26

Mostramos la comparativa de los matices socio-afectivos implicados en la actitud hacia


el profesor en la enseñanza a distancia en la Figura 34.

Figura 34. Comparativa de matices implicados en actitud hacia el profesor según sexo en enseñanza a distancia

En la Figura 35 podemos observar la diferencia entre las medias referidas a las Actitudes

 hacia el Centro y hacia el Profesor en esta modalidad de enseñanza según sexo.

Figura 35: Comparativa actitudes hacia el centro y hacia el profesor según sexo en enseñanza a distancia
.
Las Figuras 36, 37 y 38 muestran las distribuciones de las principales actitudes
estudiadas en la modalidad a distancia según sexo.

Figura 36. Distribución de las actitudes hacia el profesor según sexo en enseñanza a distancia.

169

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Figura 37. Distribución de las actitudes hacia el centro según sexo en enseñanza a distancia.

Figura 38. Distribución de las actitudes globales según sexo en enseñanza a distancia.

$QiOLVLVGH DOXPQRV GH SULPHU QLYHO

En esta sección abordaremos el análisis diferencial y aislado de los alumnos de primer


nivel, es decir, que estén cursando el primer año de estudio. Tal como vimos en el
apartado dedicado a la descripción de la muestra, este alumnado respresenta la mayor
parte del total de participantes. El estudio parcial de estos participantes afecta
fundamentalmente al centro FCCAFD, puesto que es el centro del que hemos obtenido
información de alumnado de distintos niveles, tal como ya comentamos en el apartado
correspondiente. Realizaremos nuestro análisis teniendo en cuenta la variable modalidad
de enseñanza en primer lugar, y, en segundo lugar, la variable género.

En la exposición de los resultados seguiremos las pautas establecidas anteriormente para


este capítulo. Exponemos los principales estadísticos descriptivos para cada uno de los
matices socio-afectivos implicados en las actitudes hacia el centro, tomando como
referencia la varible modalidad de enseñanza. En este sentido, debemos recordar que
solo se muestra el alumnado que cursa primer año.

170

&$3Ë78/2

Tabla 38
Descriptivos. Actitudes hacia el centro según modalidad de enseñanza en alumnos de primer curso

Intervalo de confianza
Desv. Error Rango
Media para la media al 95% Mín. Máx.
típica típico Promedio
Límite inf. Límite sup.
Presencial 19,17 4,130 ,138 18,90 19,44 7 30 900,07
Acepta_
Disciplina Distancia 18,77 4,193 ,144 18,49 19,06 6 30 852,60

Total 18,98 4,164 ,099 18,78 19,17 6 30
Presencial 22,98 3,145 ,105 22,78 23,19 10 30 824,55
Interés_
Motivación Distancia 23,49 3,988 ,137 23,22 23,76 10 30 932,47
Total 23,23 3,588 ,086 23,06 23,40 10 30
Presencial 22,29 3,360 ,112 22,07 22,51 10 30 893,94
Acepta_
Sistemas Distancia 22,10 3,499 ,120 21,86 22,33 9 30 859,09
Total 22,20 3,429 ,082 22,04 22,36 9 30
Presencial 20,17 3,840 ,128 19,92 20,43 6 30 713,18
Acepta_
Resultados Distancia 22,83 3,763 ,129 22,57 23,08 6 30 1050,25
Total 21,46 4,026 ,096 21,27 21,65 6 30
Presencial 84,62 10,781 ,359 83,91 85,32 51 111 820,50
Actitudes
Centro Distancia 87,18 11,603 ,398 86,40 87,96 36 119 936,75
Total 85,86 11,258 ,269 85,34 86,39 36 119
Nota: Elaboración propia

171
$1È/,6,6'(5(68/7$'26
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

El siguiente diagrama de caja muestra la distribución de las puntuaciones referidas a la actitud


hacia el centro del alumnado de primer año por modalidad de enseñanza (presencial o a distancia)

Figura 39. Distribución de las actitudes hacia el centro según modalidad de enseñanza en alumnos de primer curso.

Tal como podemos ver en los resultados de la prueba U de Mann-Whitney respecto a la


 comparación de dos muestras independientes, hallamos de nuevo diferencias en todos los matices
referidos a las actitudes hacia el centro excepto en el matiz Acepta Sistemas de Enseñanza.

Tabla 39
Actitudes hacia el centro según modalidad de enseñanza en alumnos de 1º nivel. Estadísticos de contraste

Acepta Interés Acepta Acepta Actitudes


Disciplina Motivación Sistemas Resultados Centro
U de Mann-Whitney 363038,0 336569,5 368567,5 236220,0 332919,5
W de Wilcoxon 726416,0 742920,5 731945,5 642571,0 739270,5
Z -1,967 -4,480 -1,447 -13,973 -4,808
Sig. asintót. (bilateral) ,049 ,000 ,148 ,000 ,000
1RWD(ODERUDFLyQSURSLD

La siguiente Figura 40 nos muestra las diferencias de las medias respecto a Acepta
Disciplina; Interés y Motivación; Acepta Sistemas y Acepta Resultados según
modalidad de enseñanza en el caso de los alumnos de primer curso.

Figura 40. Comparativa de matices socio-afectivos hacia el centro según modalidad de enseñanza en alumnos de primer curso.

172

Acontinuación, exponemos el cuadro resumen de descriptivos respecto a los matices que integran la actitud hacia el profesor según modalidad de enseñanza.
&$3Ë78/2

Tabla 40
Descriptivos. Actitudes hacia el centro según modalidad de enseñanza en alumnos de primer curso

Intervalo de confianza Rango


Desv. Error Mín. Máx.
Media para la media al 95% Promedio
Típica típico
Límite inf. Límite sup.
Presencial 21,62 3,514 ,117 21,39 21,85 10 30 790,43
Nivel_
Comprensión Distancia  22,86 3,937 ,135 22,59 23,12 6 30 968,55
Total 22,22 3,776 ,090 22,05 22,40 6 30
Presencial 20,87 4,570 ,152 20,58 21,17 8 30 681,77
Nivel_
Autoritarismo Distancia 24,48 3,805 ,130 24,22 24,73 8 30 1083,46
Total 22,62 4,583 ,109 22,41 22,84 8 30
Presencial 23,93 3,617 ,120 23,69 24,17 11 30 892,81
Nivel_
Exigencia Distancia 23,67 3,855 ,132 23,41 23,93 6 30 860,28
Total 23,80 3,736 ,089 23,63 23,98 6 30
Presencial 22,65 3,961 ,132 22,39 22,91 6 30 711,09
Sistemas_
Evaluación Distancia 25,18 3,345 ,115 24,96 25,41 6 30 1052,45
Total 23,88 3,886 ,093 23,70 24,06 6 30

Presencial 89,073 13,0143 ,4336 88,222 89,924 35,0 118,0 741,19


Actitudes
Profesor Distancia 96,185 13,1630 ,4510 95,300 97,071 28,0 119,0 1020,62
Total 92,530 13,5576 ,3238 91,895 93,165 28,0 119,0
Nota: Elaboración propia
$1È/,6,6'(5(68/7$'26

173
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

El siguiente diagrama de cajas (Figura 41) muestra la distribución de las actitudes hacia
el profesor en el alumnado de primer curso según modalidad de enseñanza.

Figura 41. Actitudes hacia el profesor según modalidad de enseñanza en alumnos de primer curso.

Realizamos la prueba no paramétrica U de Mann-Whitney, en la que, de nuevo,


observamos diferencias en los diversos matices a excepción de Nivel de Exigencia, que

no muestra diferencias significativas. Las actitudes hacia el profesor son, tal como
vemos, distintas en el alumnado de primero según la modalidad de enseñanza.
Tabla 41

Actitudes hacia el profesor según modalidad de enseñanza en alumnos de primer curso. Estadísticos de contraste
1LYHO 1LYHO 1LYHO 6LVWHPDV $FWLWXGHV
&RPSU $XWRULWDULVPR ([LJHQFLD (YDOXDFLyQ 3URIHVRU
U de Mann-
305827,0 207919,5 369580,5 234343,0 261465,0
Whitney
W de
712178,00 614270,5 732958,5 640694,0 667816,0
Wilcoxon
Z -7,386 -16,644 -1,349 -14,160 -11,555
Sig. asintót.
,000 ,000 ,177 ,000 ,000
(bilateral)
Nota: Elaboración propia

En la siguiente Figura observamos las diferencias según modalidad de enseñanza en los


matices referidos a la actitud hacia el profesor en el alumnado de primer nivel.

Figura 42. Comparativo matices socio- afectivos implicados en la actitud hacia el profesor según
modalidad de enseñanza en alumnos de primer curso.

174

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

A continuación, exponemos las diferencias respecto a la media en las Actitudes hacia el


Centro y hacia el Profesor si tenemos en cuenta la variable modalidad de enseñanza en
los alumnos de primer nivel.

Figura 43. Comparativo actitudes hacia el centro y hacia el profesor según modalidad de enseñanza.

Finalmente, exponemos en los diagramas de caja las distribuciones de la variable
Actitudes Global según modalidad de enseñanza en el caso de los alumnos de primer
curso.

Figura 44. Distribución de actitudes globales según modalidad de enseñanza en alumnos de primer curso

En segundo lugar, realizamos el análisis diferencial del alumnado de primer nivel según
la variable género. En la Tabla siguiente recopilamos los estadísticos descriptivos
fundamentales para proceder al estudio comparativo.

175




176
Tabla 42

Actitudes hacia el centro según sexo en alumnos de primer curso

Intervalo de confianza Rango


Desv. Error Mín. Máx.
Media para la media al 95% Promedio
típica típico
Límite inf. Límite sup.
Masculino 19,09 4,150 ,149 18,80 19,38 6 30 894,63
Acepta_
Disciplina Femenino 18,89 4,176 ,134 18,63 19,15 6 30 862,87
Total 18,98 4,164 ,099 18,78 19,17 6 30
Masculino 22,76 3,389 ,121 22,52 22,99 10 30 800,10
Interés_
Motivación Femenino 23,61 3,698 ,119 23,37 23,84 10 30 938,65
Total 23,23 3,588 ,086 23,06 23,40 10 30
Masculino 22,08 3,515 ,126 21,83 22,33 9 30 868,04
Acepta_
Sistemas Femenino 22,29 3,358 ,108 22,08 22,50 9 30 884,18
Total 22,20 3,429 ,082 22,04 22,36 9 30
Masculino 20,48 4,023 ,144 20,20 20,76 6 30 753,77
Acepta_
Resultados Femenino 22,25 3,855 ,124 22,01 22,49 6 30 975,79
Total 21,46 4,026 ,096 21,27 21,65 6 30
Masculino 84,41 11,267 ,403 83,62 85,20 37 111 816,11
Actitudes
Centro Femenino 87,03 11,120 ,356 86,33 87,73 36 119 925,81
Total 85,86 11,258 ,269 85,34 86,39 36 119
Nota: Elaboración propia
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6
&$3Ë78/2 $1È/,6,6'(5(68/7$'26

En el diagrama de caja (Figura 45) que exponemos a continuación podemos observar la


distribución de las puntuaciones referidas a las Actitudes hacia el Centro según la
variable sexo.

Figura 45. Distribución de actitudes hacia el centro según sexo en el alumnado de primer curso.

En este caso, observamos diferencias en Interés y Motivación, Acepta Resultados y


Actitudes hacia el Centro, pero no hallamos diferencias significativas en el matiz Acepta
Disciplina y Acepta Sistemas de Enseñanza según el variable sexo en el alumnado de

primer curso.
Tabla 43

Actitudes hacia el centro según sexo en alumnos de primer curso. Estadísticos de contraste
Acepta Interés Acepta Acepta Actitudes
Disciplina Motivación Sistemas Resultados Centro
U de Mann-Whitney 365717,0 319486,5 372484,5 283351,0 331976,5
W de Wilcoxon 839568,0 624076,5 677074,5 587941,0 636566,5
Z -1,309 -5,719 -,666 -9,151 -4,511
Sig. asintót. (bilateral) ,190 ,000 ,505 ,000 ,000
1RWD(ODERUDFLyQSURSLD

La Figura 46 muestra las diferencias en las puntuaciones medias respecto a cada uno de
los matices implicados en la actitud hacia el centro, atendiendo a la variable sexo en el
alumnado de primer curso de los distintos centros formativos que recoge la muestra.

Figura 46. Comparativo de matices socio-afectivos implicados en la actitud hacia el centro según sexo en alumnos de primer curso.

177




178
En este punto, aplicamos la variable sexo a los distintos matices implicados en las actitudes hacia el profesor de los alumnos de primer
curso. La siguiente Tabla nos muestra los descriptivos referidos a cada una de las puntuaciones atendiendo a la variable de estudio.

Tabla 44

Actitudes hacia el profesor según sexo en alumnos de primer curso

Intervalo de confianza
Desv. Error Rango
Media para la media al 95% Mín. Máx.
Típica típico promedio

Límite inf. Límite sup.


Masculino 21,65 3,604 ,129 21,40 21,91 7 30 795,80
Nivel_
Comprensión Femenino 22,68 3,850 ,123 22,44 22,92 6 30 942,09
Total 22,22 3,776 ,090 22,05 22,40 6 30
Masculino 21,17 4,682 ,168 20,84 21,50 8 30 715,93
Nivel_
Autoritarismo Femenino 23,79 4,152 ,133 23,53 24,05 8 30 1006,12
Total 22,62 4,583 ,109 22,41 22,84 8 30
Masculino 23,84 3,749 ,134 23,58 24,11 7 30 885,33
Nivel_
Exigencia Femenino 23,77 3,726 ,119 23,54 24,01 6 30 870,32
Total 23,80 3,736 ,089 23,63 23,98 6 30
Masculino 22,80 3,889 ,139 22,52 23,07 6 30 728,91
Sistemas_
Evaluación Femenino 24,75 3,661 ,117 24,52 24,98 6 30 995,72
Total 23,88 3,886 ,093 23,70 24,06 6 30
Masculino 89,464 13,2769 ,4754 88,531 90,397 35,0 119,0 754,99
Actitudes
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Profesor Femenino 94,988 13,2833 ,4258 94,152 95,823 28,0 119,0 974,81
Total 92,530 13,5576 ,3238 91,895 93,165 28,0 119,0
1RWD(ODERUDFLyQSURSLD
&$3Ë78/2 $1È/,6,6'(5(68/7$'26

La figura 47 muestra las distribuciones de las Actitudes hacia el Profesor según sexo en
el alumnado de primer curso.

Figura 47. Distribución de actitudes hacia el profesor según sexo en alumnos de primer curso.

 En la siguiente Tabla vemos que todos los matices excepto nivel de exigencia presentan
diferencias significativas. Las Actitudes hacia el Profesor son distintas si
atendemos a la variable sexo en el alumnado de primer curso.

Tabla 45

Actitudes hacia el profesor según sexo en alumnos de primer curso. Estadísticos de contraste

Nivel Nivel Nivel Sistemas Actitudes


Compromiso Autoritarismo Exigencia Evaluación Profesor
U de Mann-Whitney 316133,0 253835,0 372975,0 263956,5 284300,5
W de Wilcoxon 620723,0 558425,0 846826,0 568546,5 588890,5

Z -6,032 -11,955 -,619 -11,004 -9,039

Sig. asintót. (bilateral) ,000 ,000 ,536 ,000 ,000

1RWD(ODERUDFLyQSURSLD

La Figura 48 muestra las diferencias ya observadas en las anteriores Tablas expuestas


en cuanto a las medias de cada uno de los matices de la actitud hacia el profesor de los
alumnos de primer curso.

179

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Figura 48. Comparativa matices socio-afectivos implicados en las actitudes hacia el centro según sexo en
alumnos de primer curso

Exponemos en el gráfico de barras (Figura 49) la diferencia de medias entre Actitudes


 hacia el Centro y Actitudes hacia el Profesor según género en alumnado de primer curso.

Figura 49. Comparativa actitudes hacia el centro y hacia el profesor según sexo en alumnos de primer curso.

Finalmente, el diagrama de cajas de la Figura 50 representa la distribución de las


Actitudes Globales según género en alumnos de primer curso.

Figura 50. Distribución de las actitudes globales según sexo en alumnos de primer curso.

180

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

&RPSDUDWLYD5HVSHFWRDODV0HGLDV1DFLRQDO&DQDULD\GHOD8/3*&

En este apartado exponemos de forma comparativa las medias referidas a los matices y
actitudes estudiadas en distintos contextos. De esta forma, contamos con la media
nacional, la media canaria y la media de la ULPGC. Tal como podemos observar en la
Tabla 46 y de una forma más gráfica en la Figura 51, las medias referidas a la
modalidad a distancia obtenidas en la presente investigación se muestran superiores
respecto a las actitudes hacia el centro y hacia el profesor.

Tabla 46
Comparativa de medias respecto a ámbito nacional, canario y de la ULPGC
Media Media
Media Media Media Media
presencial distancia
nacional canaria ULPGC inv.
inv. inv.
Acepta_
20,11 20,39 19,82 19,41 18,74 19,16
Disciplina
Interés_
22,19 22,2 22,25 22,63 23,53 22,96
Motivación
Acepta_
22,12 22,01 22,53 22,18 22,05 22,13
Sistemas
Acepta_
20,01 20,3 20,07 20,06 22,84 21,07
Resultados
Nivel_
21,71 21,98 21,68 21,52 22,9 22,03
Comprensión
Nivel_
20,33 20,74 20,33 20,65 24,49 22,05
Autoritarismo
Nivel_
23,54 23,23 23,31 23,92 23,66 23,83
Exigencia
Sistemas_
22,03 22,09 22,38 22,35 25,2 23,39
Evaluación
Actitudes_
83,69 85,33 83,67 84,27 87,16 85,33
Centro
Actitudes_
87,97 88,33 88,8 88,445 96,248 91,29
Profesor
Actitudes _
172,66 173,86 173,38 172,717 183,408 176,6153
Global
1RWD(ODERUDFLyQSURSLD

181

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Actitudes _ Global

Actitudes_Profesor

Actitudes_Centro

Sistemas_Evaluación

Nivel_Exigencia

Nivel_Autoritarismo

Nivel_Comprensión

 Acepta_Resultados

Acepta_Sistemas

Interés_Motivación

Acepta_Disciplina

0 50 100 150 200

Media investigación Media distancia investigación


Media presencial investigación Media ULPGC
Media canaria Media nacional

Figura 51. Comparativa de medias (nacional, canaria, y medias extraídas a partir de la investigación.

%DUHPRV

En este apartado exponemos los baremos realizados para la actitud hacia el centro, hacia
el profesor y globales según centro de enseñanza. Mostramos, por tanto, tres Tablas que
proporcionan esta información a continuación.

182

Tabla 48
Tabla 47 Baremos. Actitudes hacia el centro, el profesor y globales en ET_ULPGC
&$3Ë78/2

Baremo Actitudes hacia el centro, hacia el profesor y globales en FCC Educación


Educación Actitudes_Centro Actitudes__Profesor Actitudes_Global Actitudes_Centro Actitudes__Profesor Actitudes_Global
N Válidos 292 292 292
N Válidos 870 870 870
Media 82,91 89,192 172,1062
Media 87,16 96,248 183,4080
Mediana 83,00 89,000 171,0000 Mediana 87,00 98,000 185,0000
Moda 87 81,0a 159,00 Moda Desviación 87 99,0 183,00
Desv. típ. 11,026  23,36103 Típica Varianza 11,558 13,1254 23,21908
Varianza 121,577 191,351 545,738 Mínimo Máximo 133,577 172,277 539,126
Mínimo 51 48,0 100,00 36 28,0 64,00
Máximo 109  117,0 222,00 119 119,0 236,00
5 65,65 65,300 135,3000 5 67,00 72,000 143,0000
10 69,00 73,000 141,3000 10 73,00 78,100 153,0000
15 72,00 75,000 148,0000 15 75,00 83,000 160,0000
20 73,00 77,000 153,0000 20 78,00 86,000 166,0000
25 75,00 79,000 156,0000 25 80,00 88,000 170,0000
30 77,00 81,000 159,0000 30 82,00 91,000 174,0000
35 78,00 83,000 160,0000 35 84,00 93,000 176,8500
40 81,00 86,000 164,0000 40 85,00 95,000 179,0000
45 82,00 87,000 167,0000 45 86,00 97,000 183,0000
50 83,00 89,000 171,0000 50 87,00 98,000 185,0000
Percentil
55 84,00 91,150 176,0000 55 89,00 99,000 188,0000
Percentil

60 86,00 93,000 180,0000 60 90,00 101,000 190,0000


65 87,00 96,450 184,0000 65 92,00 102,000 193,0000
70 88,00 98,000 187,1000 70 94,00 104,000 196,0000
75 89,75 102,000 189,0000 75 95,00 106,000 200,0000
80 93,00 103,000 193,0000 80 97,00 107,000 203,0000
85 95,00 105,000 199,0000 85 99,00 110,000 207,0000
90 98,00 106,700 204,7000 90 101,00 112,000 211,0000
95 100,35 110,000 210,0500 95 105,00 115,000 218,4500
99 109,00 114,070 218,2800 99 112,00 118,000 229,0000
1RWD(ODERUDFLyQSURSLD 1RWD(ODERUDFLyQSURSLD

183
$1È/,6,6'(5(68/7$'26
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Tabla 49

Baremo. Actitudes hacia el centro, el profesor y globales en FCCAFD


Actitudes_Centro Actitudes_Prof. Actitudes_Global
N Válidos 1224 1224 1224
Media 84,60 88,266 172,8627
Mediana 85,00 88,000 173,0000
Moda 83 84,0 164,00
Desv. típ. 10,807 12,5339 21,71120
Varianza 116,785 157,100 471,376
Mínimo 46 35,0 94,00
Máximo 116 119,0 231,00
5 67,00 67,000 138,0000
10 70,50 73,000 146,0000
15 73,00 76,000 152,0000
20 76,00 78,000 156,0000
25 78,00 80,000 159,0000
30 79,00 82,000 162,0000
35 81,00 83,000 164,0000
40 82,00 84,000 167,0000
45 83,00 86,000 170,0000
50 85,00 88,000 173,0000
Percentil
 55 86,00 90,000 175,0000
60 87,00 92,000 178,0000
65 89,00 94,000 182,0000
70 91,00 96,000 186,0000
75 92,00 97,000 189,0000
80 94,00 99,000 192,0000
85 96,00 102,000 196,0000
90 98,00 104,000 200,0000
95 102,00 108,000 206,0000
99 108,75 114,000 220,0000
1RWD(ODERUDFLyQSURSLD

)LDELOLGDG

Para el total de los ocho matices cuyos estadísticos se muestran en la Tabla 51, se ha obtenido un
valor de Alfa de Coronbach de 0,814, siendo 0,822 si nos basamos en los elementos tipificados.

Tabla 50

Estadísticos de los elementos CAA-FU Global


Desviación
Media N
estándar
Acepta la Disciplina 19,16 4,046 2386
Interés y Motivación 22,96 3,575 2386
Acepta los Sistemas 22,13 3,454 2386
Acepta Resultados 21,07 3,995 2386
Nivel de Comprensión 22,03 3,752 2386
Nivel de Autoritarismo 22,05 4,57 2386
Nivel de Exigencia 23,83 3,676 2386
Sistemas de Evaluación 23,39 3,887 2386
1RWD(ODERUDFLyQSURSLD

184

&$3Ë78/2 $1È/,6,6'(5(68/7$'26

A continuación se muestra la relación existente entre variables (Tabla 52) con y sin
eliminación de cada uno de los elementos.
Tabla 51

Relaciones de cada elemento con el CAA-FU Global


Media de la Varianza de Alfa de
Correlación Correlación
escala si se escala si Cronbach si
elementos- múltiple al
elimina el elimina el se elimina el
total corregida cuadrado
elemento elemento elemento
Acepta la Disciplina 157,45 426,687 0,528 0,361 0,882
Interés y Motivación 153,66 438,415 0,535 0,339 0,88
Acepta los Sistemas 154,48 437,683 0,565 0,402 0,877
Acepta los Resultados 155,54 403,392 0,698 0,532 0,864
Nivel de Comprensión 154,59 400,696 0,776 0,625 0,856
Nivel de Autoritarismo 154,56 383,588 0,708 0,601 0,863

 Nivel_Exigencia 152,79 416,476 0,675 0,504 0,867


Sistemas de Evaluación 153,23 401,414 0,737 0,624 0,86
1RWD(ODERUDFLyQSURSLD

185

',6&86,Ï1< Capítulo 7
&21&/86,21(6

&$3Ë78/2 ',6&86,Ï1<&21&/86,21(6

',6&86,Ï1

(Q HVWH FDStWXOR VH DFRPHWH OD UHIOH[LyQ VREUH ORV WUDEDMRV UHDOL]DGRV \ OD OtQHD GH
LQYHVWLJDFLyQ TXH ORV VXVWHQWDQ 3RU HOOR HQ HVWH DSDUWDGR HV GRQGH FULVWDOL]D OD
FRQVWUXFFLyQGHVHQWLGRTXHKHPRVHODERUDGRDORODUJRGHORVFDStWXORVDQWHULRUHV6L
ELHQHQHOFDStWXORDQWHULRUH[SXVLPRVORVUHVXOWDGRVGHORVGLVWLQWRVDQiOLVLVHVWDGtVWLFRV
OOHYDGRV FDER HQ HVWH PRPHQWR SURFHGHPRV D LQWHUSUHWDUORV \ FRPSUREDU OD
FRQJUXHQFLD FRQ OD EDVH WHyULFD HQ OD TXH QRV KHPRV DSR\DGR WUDV OD IDVH GH
LQYHVWLJDFLyQGRFXPHQWDO

(O SURFHVR GH H[SOLFDFLyQ QHFHVDULDPHQWH VH FHQWUD HQ ORV UHVXOWDGRV KDOODGRV \
UHFRJLGRV GH IRUPD GHWDOODGD HQ HO FDSLWXOR DQWHULRU \ HQ ORV DQH[RV TXH OR
FRPSOHPHQWDQ/DH[SOLFDFLyQVHEDVDHQXQDQiOLVLVGHORVKDOOD]JRVPiVFRQVLVWHQWHV
 GHODLQYHVWLJDFLyQ \WDPELpQGHODVGHELOLGDGHVHQWHQGLGDVFRPRDVSHFWRVDPHMRUDUHQ
IXWXURV WUDEDMRV VREUH HVWD OtQHD GH LQYHVWLJDFLyQ /R FXDO MXVWLILFD HO VHQWLGR \ OD
XWLOLGDG GH OD SUHVHQWH LQYHVWLJDFLyQ \ OD LPSRUWDQFLD TXH WLHQH HQ FXDQWR D OD
FRQWULEXFLyQ GH ORV HVWXGLRV TXH VH UHDOL]DQ VREUH ORV DVSHFWRV DFWLWXGLQDOHV
UHODFLRQDGRVFRQHOSURFHVRGHHQVHxDQ]DDSUHQGL]DMH

(Q EDVH D ORV DUJXPHQWRV H[SXHVWRV VH KD GLYLGLGR HO FDStWXOR GH GLVFXVLyQ \
FRQFOXVLRQHVHQYDULRVDSDUWDGRVSDUDJDQDUHQFODULGDGHQODH[SRVLFLyQGHWDOPRGR
TXH VH UHDOLFH XQ DQiOLVLV GH ORV UHVXOWDGRV SRU VHSDUDGR HYLWDQGR LQWHUIHUHQFLDV
LQQHFHVDULDV VLQ SHUGHU OD YLVLyQ GH FRQMXQWR TXH VLUYD FRPR KLOR FRQGXFWRU D QXHVWUD
LQYHVWLJDFLyQ

(Q SULPHU OXJDU H[SOLFDUHPRV ODV GLIHUHQFLDV PXHVWUDOHV SDUD FRQWLQXDU FRQ ORV GDWRV
UHIHULGRVDODFDOLGDGGHODKHUUDPLHQWDXWLOL]DGDWDOHVFRPRDQiOLVLVGHILDELOLGDGGHODV
HVFDODVSDUDGHVSXpVSUHVHQWDUORVKDOOD]JRVGHOPRGHORHVWUXFWXUDOTXHFRQILUPDQODV
FODYHVFRQFHSWXDOHVGHOPDUFRWHyULFRVREUH ODVDFWLWXGHV\VXLQIOXHQFLDHQHOGHVDUUROOR
GH ORVDSUHQGL]DMHV DFDGpPLFRV GHVDUUROOR SHUVRQDO H LQWHJUDFLyQ GHOHVWXGLDQWHHQ HO
FRQWH[WRXQLYHUVLWDULR<SRU~OWLPRVHSUHVHQWDUDQORVUHVXOWDGRVVREUHODVGLIHUHQFLDV
HQFRQWUDGDVUHVSHFWRDORVUDVJRVDFWLWXGLQDOHVKDFLDHOFHQWURDFDGpPLFR\HOSURIHVRU
\ TXH FRPR KHPRV UHIOHMDGR HQ RSLQLyQ GH PXFKRV DXWRUHV VH GDQ HQ ORV FRQWH[WRV
DFDGpPLFRVGHODHQVHxDQ]DVXSHULRU

189

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

3HUILOGHORVVXMHWRVSDUWLFLSDQWHV

&RPHQ]DPRV SRU KDFHU UHIHUHQFLD D ODV PXHVWUDV GH VXMHWRV SDUWLFLSDQWHV \ VXV
SHFXOLDULGDGHVDOREMHWRGHDQDOL]DUORVGLVWLQWRVSHUILOHVFHQWUiQGRQRVHQODVYDULDEOHV
PiVLPSRUWDQWHVSRUVXSRVLEOHLQIOXHQFLDHQORVUHVXOWDGRV

/DVPD\RUHVGLIHUHQFLDVHQWUHORVGLVWLQWRVJUXSRVODVHQFRQWUDPRVHQODYDULDEOHHGDG
'HILQLPRV HVWH KHFKR FRPR OyJLFR GDGR HO SHUILO GH ORV HVWXGLDQWHV HQ ORV GLVWLQWRV
JUXSRV

/D PRGDOLGDG GH (QVHxDQ]D D 'LVWDQFLD (78/3*&  SUHVHQWD XQD HGDG PHGLD
VLJQLILFDWLYDPHQWH PD\RU TXH OD 0RGDOLGDG 3UHVHQFLDO \D TXH SRU OD SULPHUD RSWDQ
SHUVRQDV TXH WLHQHQ RWUDV REOLJDFLRQHV KDELWXDOPHQWH SHUVRQDV TXH \D HMHUFHQ XQD
SURIHVLyQ \ D ORV TXH QR OHV HV SRVLEOH DFXGLU SUHVHQFLDOPHQWH D FODVHV $VLPLVPR
 SUHVHQWDQ XQDKHWHURJHQHLGDGPD\RU GHVYLDFLyQWtSLFD  TXHORVHVWXGLDQWHVGHOD

PRGDOLGDG3UHVHQFLDO GHVYLDFLyQWtSLFD  

(QHVWHVHQWLGRSUHFLVDPHQWHODILQDOLGDGGHQXHVWURWUDEDMRHVFRPSUREDUODVDFWLWXGHV
KDFLDHOFHQWUR\HOSURIHVRU DSDUWLUGHODVH[SHULHQFLDVHQODVUHODFLRQHVHVWDEOHFLGDVHQ
FRQWH[WRV XQLYHUVLWDULRV GH DSUHQGL]DMH D SDUWLU GH GLIHUHQWHV VLWXDFLRQHV \
FDUDFWHUtVWLFDVGHORVHVWXGLDQWHV

3DUWLPRVGHODEDVHGHTXHORVHVWXGLDQWHVQRUHFLEHQIRUPDFLyQFRPSOHPHQWDULDVREUH
QXHYDVIRUPDVGHDSUHQGHUDXWyQRPD\DXWRUUHJXODGDTXHVLUYDGHDSR\RDOGHVHPSHxR
GH VX DFWLYLGDG DFDGpPLFD (Q JHQHUDO ODV HVWUDWHJLDV TXH KDQ GHVDUUROODGR KDQ VLGR
UHDOL]DGDV SRUVXVSURSLRVPHGLRV\QHFHVLGDGHVSRUORTXHSDUHFHOyJLFRVXLQIOXHQFLD
HQ ODV GLIHUHQFLDV DFWLWXGLQDOHV HQWUH ORV HVWXGLDQWHV KDFLD DPEDV PRGDOLGDGHV GH
HQVHxDQ]D

$QiOLVLVGHOD)LDELOLGDGGHO&XHVWLRQDULRGH$FWLWXGHV$FDGpPLFDV &$$)8 

&RQ OD ILQDOLGDG GH FRPSUREDU OD ILDELOLGDG GH OD KHUUDPLHQWD XWLOL]DGD HQ QXHVWUD
LQYHVWLJDFLyQHO&$$)8VHKDQDEDUFDGRWRGRVORVQLYHOHVHQORVTXHVHKDKHFKRXVR
OD PLVPD (V GHFLU ORV GLVWLQWRV JUXSRV REMHWR GH HVWXGLR 8/3*& 7HOHIRUPDFLyQ \
83/*&3UHVHQFLDO DVtFRPRDQLYHOJOREDOLPSUHVFLQGLEOHV SDUDHVWDEOHFHUXQDEDVH
VyOLGDGHOHVWXGLR

190

&$3Ë78/2 ',6&86,Ï1<&21&/86,21(6

$Vt XQD YH] OOHYDGRV D FDER ORV SHUWLQHQWHV DQiOLVLV SRU PHGLR GHO PpWRGR $OID GH
&URPEDFK HQWHQGHPRV TXH KDELHQGR XQ YDORU GH $OID GH &URPEDFK GH  SDUD HO
FXHVWLRQDULR JOREDO GH OD PXHVWUD  SDUD HO JUXSR GH 8/3*& 7HOHIRUPDFLyQ \
SDUDHOJUXSRGH8/3*&3UHVHQFLDOVHFRQVLGHUDQHVWRVYDORUHVFRPRDFHSWDFLyQ
GHDFXHUGRFRQHOFULWHULRHVWLSXODGR3RU RWUDSDUWHDOFDOFXODUORVYDORUHVGH$OSKDGH
&URPEDFK HQ HO FDVR GH HOLPLQDFLyQ GH HOHPHQWRV VH REVHUYDQ PHMRUDV JOREDOHV HQ
WRGRVORVJUXSRV

&RPR DYDQFH VH UHVDOWD HO KHFKR GH TXH WRGRV ORV  PDWLFHV DFWLWXGLQDOHV DQDOL]DGRV
SRVHHQ XQD FDUJD HOHYDGD \ PXHVWUDQ XQD IXHUWH FRQVLVWHQFLD \ KRPRJHQLGDG HQ VXV
HOHPHQWRV\DXVHQFLDVGHHUURUHQODVPHGLFLRQHV

&RQWUDVWHGHO0RGHOR(VWUXFWXUDO

 (Q OD SUHVHQWH LQYHVWLJDFLyQ VH KD FRQWUDVWDGR XQ PRGHOR SUHGLFWLYR GH UHODFLyQ

HQWUH PDWLFHV VRFLRDIHFWLYRV LPSOLFDGRV HQ ODV DFWLWXGHV KDFLD HO FHQWUR \ HO
SURIHVRU D WUDYpV GH OD GHWHUPLQDFLyQ GH OD GLUHFFLyQ VHQWLGR H LQWHQVLGDG GH ODV
UHODFLRQHVH[LVWHQWHV

(QHOFRQWUDVWHGHOPRGHORSURSXHVWRHQODLQYHVWLJDFLyQHOPpWRGRGHDQiOLVLVXWLOL]DGR
IXHHOGHHFXDFLRQHVHVWUXFWXUDOHVSRUPHGLRGH3/6 )RUQHOODQG&KD 

/DYDOLGH]GHODWpFQLFD3/6UHVXOWyFRQWUDVWDGDHQORVUHVXOWDGRVFRQODHYDOXDFLyQGHO
PRGHOR GH PHGLGD \ SRVWHULRUPHQWH HO PRGHOR HVWUXFWXUDO VLJXLHQGR ORV FULWHULRV
HVWLSXODGRV %DUFOD\HWDO 

/D HYDOXDFLyQ GHO PRGHOR GH PHGLGD GLR FRPR UHVXOWDGR XQD DOWD ILDELOLGDG GH
FDGD tWHP \ WDPELpQ YDORUHV VDWLVIDFWRULRV HQ OD ILDELOLGDG GHO FRQVWUXFWR \ OD
YDOLGH] GHO FRQVWUXFWR

3RUVXSDUWHHOPRGHORHVWUXFWXUDOUHVXOWyVDWLVIDFWRULRWDQWRHQHOSHVR\ODPDJQLWXGGH
ODVUHODFLRQHVHQWUHODVGLVWLQWDVYDULDEOHVFRPRHQORVFRHILFLHQWHVREWHQLGRVTXHKDFHQ
UHIHUHQFLDDOFRHILFLHQWHGHFRUUHODFLyQP~OWLSOHDOFXDGUDGR R 2 ) ORVFRHILFLHQWHVSDWK
HVWDQGDUL]DGR‰\VXVLJQLILFDFLyQ WHVWDGtVWLFRV ODUHOHYDQFLD SUHGLFWLYD WHVWGH Q
 2 \
FDOLGDGGHOPRGHOR WHVW*R)  5HDOHWDO 

191

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

3DUDHYDOXDUODILDELOLGDGLQGLYLGXDOVHDQDOL]DURQODVFDUJDVIDFWRULDOHVGHFDGDtWHPVD
ODV YDULDEOHV FRQ REMHWRGH FRQRFHUVL DOJXQR GH HOORV QR FRQWULEX\H DO FRQVWUXFWR/D
JUDQPD\RUtDGHODVFDUJDVIDFWRULDOHVFXPSOHQHOUHTXLVLWR VXSHULRUHVD 

3RURWUDSDUWHHQHOPRGHORDQDOL]DGRODILDELOLGDGFRPSXHVWDUHVXOWyVHUVLHPSUHPD\RU
TXHHOYDORUPiVHVWULFWRGH\ORVFRHILFLHQWHVDOIDGH&URPEDFKVRQPD\RUHVD
TXHHVHOYDORUUHIHUHQFLD

(O DQiOLVLV GH OD YDOLGH] PRVWUy TXH OD HVFDOD PLGH H[DFWDPHQWH HO FRQFHSWR TXH VH
SUHWHQGH PHGLU \ QR RWURV IDFWRUHV H[WHUQRV DO FRQVWUXFWR 7RGRV ORV FRQVWUXFWRV
UHIOHFWLYRV PDWLFHV VHUHODFLRQDQHQPD\RUPHGLGDFRQVXVSURSLDVPHGLGDVTXHFRQ
RWURVFRQVWUXFWRV +HHOHU\5D\ \DGHPiVQLQJXQDPHGLGDFDUJDPiVIXHUWHHQ
RWURVFRQVWUXFWRVTXHHQHOVX\RSURSLRSRUORTXHVHFRPSUXHEDLJXDOPHQWHODYDOLGH]
GLVFULPLQDQWHGHODHVFDOD &KLQ 

(O DQiOLVLV GHO PRGHOR HVWUXFWXUDO HPSOHDGR HQ OD LQYHVWLJDFLyQ S RU PHG LR G H 3/6
FRQWUDVWyGHIRUPDDILUPDWLYDODVKLSyWHVLVTXHHVSHFLILFDQODVUHODFLRQHVGHFDXVDOLGDG
SUHGLFWLYDV HQWUH ORV IDFWRUHV GHO PRGHOR SURSXHVWR /D LQWHUSUHWDFLyQ GHO PRGHOR

LQWHUQR R HVWUXFWXUDO HQ HO iPELWR GH ORV 3/6 IXH DFHSWDEOH VHJ~Q ORV GRV tQGLFHV
EiVLFRVHOFRHILFLHQWHGHFRUUHODFLyQP~OWLSOH DOFXDGUDGR ( R2 ) \ORVFRHILFLHQWHVSDWK
HVWDQGDUL]DGRV ‰  $GHPiV HO PRGHOR VH HYDOXy DGHFXDGDPHQWH REVHUYDQGR OD
UHOHYDQFLDSUHGLFWLYD Q2 GHORVFRQVWUXFWRV
5HVSHFWR D OD YDULDQ]D H[SOLFDGD( R2 )GH OD YDULDEOH ODWHQWH $3 DFHSWDFLyQ GH ORV
VLVWHPDVGHHYDOXDFLyQ HOPRGHORHVWUXFWXUDOPXHVWUDXQPX\EXHQSRGHUSUHGLFWLYR
GDGRTXHVHH[SOLFDXQGHODYDULDQ]DGH$3\HOYDORUGH Q2HVSRU WDQWR
WLHQH UHOHYDQFLD SUHGLFWLYD 3RU ~OWLPR SDUD HO PRGHOR FRPSOHWR REWHQHPRV XQ
YDORU GH *R) GH  TXH H[FHGH VREUDGDPHQWH HO YDORU GH  SURSXHVWR SRU
:HW]HOVHWDO  

3RU WDQWR HQ UHODFLyQ D ODV KLSyWHVLV SURSXHVWDV HQ HO PRGHOR SRGHPRV FRQFOXLU TXH
H[LVWHXQDUHODFLyQSRVLWLYDGLUHFWDGHOD³DFHSWDFLyQGHGLVFLSOLQD´\GHOD³PRWLYDFLy
Q HLQWHUpV´FRQOD³DFHSWDFLyQGHUHVXOWDGRVacadémicos´

3RU RWUD SDUWH HQ UHODFLyQ FRQ HO ³VLVWHPD GH HYDOXDFLyQ GHO profesor´ VH FRQFOX\H
TXH H[LVWH XQD UHODFLyQ SRVLWLYD GLUHFWD HQWUH HO ³JUDGR GH DXWRULWDULVPR´ \
³JUDGRGHH[LJHQFLD´ FRQ OD ³DFHSWDFLyQGHVLVWHPDVGHHYDOXDFLyQGHOProfesor´ (Q OD

192

&$3Ë78/2 ',6&86,Ï1<&21&/86,21(6

PHGLGD HQ TXH VH UHGX]FDQ HOHPHQWRV GH ULJLGH] \ VH DGRSWHQ PDUFRV IOH[LEOHV \
UD]RQDEOHVGHDFFLyQSDUDHOHVWXGLDQWHODVH[SHFWDWLYDVVREUHORVUHVXOWDGRVDFDGpPLFRV
VHUiQ PiV SRVLWLYDV /R FXDO WLHQH FRQVHFXHQFLDV SRVLWLYDV SDUD OD DFWLYDFLyQ GH
PRWLYDFLRQHV \ UHVXOWDGRV D FRQVHJXLU SRU SDUWH GHO HVWXGLDQWH \ VX SHUVLVWHQFLDHQ HO
HQWRUQRXQLYHUVLWDULR

(QUHIHUHQFLDDODVKLSyWHVLVVREUHODDFHSWDFLyQGHOVLVWHPDGHlos sistemas GH formación


VHFRPSUXHEDTXHH[LVWHXQD UHODFLyQ SRVLWLYD GLUHFWD GH OD ³DFHSWDFLyQGHUHVXOWDGRV
académicos´ \ ³VLVWHPDV GH HYDOXDFLyQ´ FRQ HO FRQVWUXFWR ³DFHSWDFLyQ VLVWHPDV GH
formación´ (Q HOPLVPRVHQWLGRODLQWHULRUL]DFLyQGHODLQWHUDFFLyQFRQHO SURIHVRU y el
centro FXDQGR VH SHUFLEH FRQ ULJLGH] \ IDOWD GH DSHUWXUD HQ UHODFLyQ D OD
DFWLYLGDGDFDGpPLFDVHWUDGXFHHQH[SHFWDWLYDVQHJDWLYDVKDFLDORVUHVXOWDGRVHQWHQGLGRV
FRPR QRDFHSWDFLyQGH OosVLVWHPDsGHformación

(O PRGHOR UHIOHMD TXH ORV DVSHFWRV PRWLYDFLRQDOHV UHODFLRQDGRV FRQ OD LQWHUDFFLyQ
GHOHVWXGLDQWHFRQHOFHQWURDFDGpPLFR\HOSURIHVRUFRQGLFLRQDQODVH[SHFWDWLYDV\
SRU WDQWR OD DFHSWDFLyQ GH ORV UHVXOWDGRV GHO VLVWHPD DFDGpPLFR GHO FHQWUR GHO
VLVWHPD GH HYDOXDFLyQ GHO FHQWUR \ GHO VLVWHPD GH HQVHxDQ]D GHO SURIHVRU (VWH
PRGHOR FRQILUPD ORV GHVDUUROORV WHyULFRV HVWDEOHFLGRV HQ ORV FDStWXORV UHODWLYRV DO
PDUFR WHyULFR GH OD LQYHVWLJDFLyQ LQVSLUDGRV HQ ORV PRGHORV DFWLWXGLQDOHV GH
H[SHFWDWLYDYDORU

'LIHUHQFLDV$FWLWXGLQDOHVKDFLDHO&HQWUR\HO3URIHVRU

'HORVDQiOLVLVHIHFWXDGRVDFRQWLQXDFLyQH[SRQHPRVORVUHVXOWDGRVGHPD\RULQWHUpV

*pQHUR

/DV PXMHUHV SXW~DQ PiV DOWR TXH ORV KRPEUHV HQ OD DFWLWXG KDFLD HO FHQWUR HQ OD
PRGDOLGDGDGLVWDQFLDUHIOHMDQGR GLIHUHQFLDVHVWDGtVWLFDPHQWHVLJQLILFDWLYDVHQWRGRVORV
PDWLFHV FRQ VLJQLILFDFLyQ DVLQWyWLFD ELODWHUDO HQWUH  \  +2  /D
PD\RU SXQWXDFLyQ LQGLFDen las mujeres XQD DFWLWXG PiV IDYRUDEOHhacia la actividad 
DFDGpPLFD GHO FHQWUR UHVSHFWR D OR GHVHDGRsiendo los hombres menos favorables
WDQWR D QLYHO JHQHUDO FRPR HQ FDGDXQRGHORVPDWLFHV menos en la aceptación de
resultados

193

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

(QODPRGDOLGDGSUHVHQFLDOODVPXMHUHVSXQW~DQ PDVDOWRTXHORVKRPEUHVHQDFWLWXGHV
KDFLDHOFHQWURHQORVPDWLFHVGH PRWLYDFLyQ VLJQLILFDFLyQDVLQWyWLFDELODWHUDO \
HQDFHSWDFLyQGHUHVXOWDGRV VLJQLILFDFLyQDVLQWyWLFDELODWHUDO  +2 

5HVSHFWR DO SURIHVRU ODV PXMHUHV SXQW~DQ PiV DOWR TXH ORV KRPEUHV WDQWR HQ OD
PRGDOLGDG SUHVHQFLDO FRPR HQ OD PRGDOLGDG D GLVWDQFLD GH IRUPD VLJQLILFDWLYD FRQ
VLJQLILFDFLyQ DVLQWyWLFD LQIHULRU D  HQ WRGRV ORV PDWLFHV \ DFWLWXG JHQHUDO
KDFLD HO SURIHVRU H[FHSWR HO PDWL] GH DFHSWDFLyQ GH VLVWHPDV HQ HO TXH QR
KD\GLIHUHQFLDVVLJQLILFDWLYDV  +2+2  En comparación, lDVhombresPXHVWUDQ
HQVXVSHUFHSFLRQHV XQD H[SHFWDWLYD RULHQWDGD D PD\RU JUDGR GH DSHUWXUD \
PiVIDYRUDEOHVDIOH[LELOL]DUHVWRVSURFHVRVDFDGpPLFRV HQORVTXHHVWiLQYROXFUDGD
ODUHODFLyQFRQ HOSURIHVRU

'HDFXHUGRFRQODVLQYHVWLJDFLRQHVH[SXHVWDVHQHOFDStWXORHOJpQHURKDVXSXHVWRXQD

GH ODV YDULDEOHVSHUVRQDOHVPiVUHOHYDQWHV\DVRFLDGDVFRQODVGLIHUHQFLDV HQFRQWUDGDV
HQHOIXQFLRQDPLHQWRPRWLYDFLRQDO\HQDSUHQGL]DMHDFDGpPLFR

/DV GLIHUHQFLDV GH HGDG HQWUH PXMHUHV GH DPEDV PRGDOLGDGHV QR LQWHUILHUH HQ OD
LQWHUSUHWDFLyQGHORVGDWRVFRQILUPiQGRVHTXHHVWDVSRVLFLRQHVDFWLWXGLQDOHVHVWiQPiV
UHODFLRQDGDVFRQODFXOWXUDGHJpQHUR(QHVWHVHQWLGROoVhombresPXHVWUDQXQSDWUyQ
GH VRFLDOL]DFLyQ PiV VHQVLEOH KDFLD OD DSHUWXUD PRWLYDFLRQDO TXH VH SUR\HFWD HQ
XQD PD\RU H[LJHQFLD HQ FXDQWR UDFLRQDOL]DU IOH[LEOHPHQWH ORV VLVWHPDV DFDGpPLFRV
dentro de la WHQGHQFLD general en ambos sexos KDFLD XQDV PD\RUHV FRWDV GH DXWRUUHJXODFLyQ \
UHVSRQVDELOLGDG

(QVHxDQ]D3UHVHQFLDO\(QVHxDQ]DD'LVWDQFLD

/D DFWLWXG JHQHUDO KDFLD HO FHQWUR DFDGpPLFR SUHVHQWD GLIHUHQFLDV HVWDGtVWLFDV
VLJQLILFDWLYDV HQWUH ORV DOXPQRV GH OD PRGDOLGDG GH (QVHxDQ]D 3UHVHQFLDO (3  \
(QVHxDQ]DD'LVWDQFLD (D' +2 

(Q ORTXHUHVSHFWD DOFRQWH[WRDFDGpPLFR GHOFHQWUR ORVHVWXGLDQWHV GH(D' SXQW~DQ


PDVDOWRHQDFWLWXGJHQHUDOKDFLDHOFHQWUR VLJQLILFDFLyQDVLQWyWLFDELODWHUDOGH 
HQODDFHSWDFLyQGHUHVXOWDGRV VLJDVLQWyWELODWHUDO  \PRWLYDFLyQ VLJDVLQWyW
ELODWHUDO (VGHFLUORVHVWXGLDQWHVGH(P WLHQHQH[SHFWDWLYDVGHPD\RUDSHUWXUD
HQHOSURFHVRPRWLYDFLRQDOGHODSUHQGL]DMH\ODHYDOXDFLyQGHUHVXOWDGRV, respecto a los
de EaD.

194

&$3Ë78/2 ',6&86,Ï1<&21&/86,21(6

/RVDOXPQRVGHOD(3SXQW~DQPDVDOWRHQODDFHSWDFLyQ GLVFLSOLQDHQORVFHQWURV VLJ


DVLQWyWELODWHUDO \SRUWDQWRsobre esta cuestión los alumnos de EaD demanda
XQDPD\RUDSHUWXUDHQODSDUWLFLSDFLyQ GHODSUHQGL]DMH

(QUHODFLyQDOSURIHVRUORVHVWXGLDQWHVGH(D' SXQW~DQPiVDOWRTXHORVHVWXGLDQWHVGHOD
PRGDOLGDG(3HQWRGRVORVPDWLFHVUHIHULGRVDOSURIHVRUH[FHSWRHQODVSXQWXDFLRQHVGHO
QLYHO GH H[LJHQFLDV TXH VRQ VLPLODUHV HQ ORV HVWXGLDQWHV GH DPEDV PRGDOLGDGHV GH
HQVHxDQ]D +2  (Q ODV SXQWXDFLRQHV GH ORV PDWLFHV HQ TXH H[LWHQ GLIHUHQFLDV OD
VLJQLILFDFLyQDVLQWyWLFDELODWHUDOHVGH /RV HVWXGLDQWHV GH (P GHPDQGDQXQPHMRU
QLYHO GH FRPSUHQVLyQ PHQRV DXWRULWDULVPR \ PiV IOH[LELOLGDG HQ OD HYDOXDFLyQ
GHPDQGDQGRDOSURIHVRUXQDPD\RUDFWLWXGGHDSHUWXUDUHVSHFWRDOSURFHVRGHDSUHQGL]DMH

(O SHUILO GHO DOXPQR GH OD PRGDOLGDG  presencial GHPDQGD XQ DSUHQGL]DMH PiV
PRWLYDQWH \ DFWLYR GH FRUWH FRODERUDWLYR (V GHFLU DSXQWD KDFLDXQDGHPDQGDGH

DSUHQGL]DMHVPiVVLJQLILFDWLYRVTXHDXPHQWHQHOLQWHUpV\ODPRWLYDFLyQHQORVHVWXGLRVGH
HVWDPRGDOLGDGGHHQVHxDQ]DDpresencial

(QWpUPLQRVFRPSDUDWLYRVUHVSHFWRDOHVWXGLDQWHGH(D'HOHVWXGLDQWHGHODPRGDOLGDG
SUHVHQFLDOHVWiDOJRPDVRULHQWDGRDFRQVLGHUDUTXHORVFHQWURVGHQPD\RUOLEHUWDGDORV
SURFHVRVGHDSUHQGL]DMHHVGHFLUHQPD\RUSDUWLFLSFLyQHQODVDFWLYLGDGDFDGpPLFDV\
SRUHQGHGHODDXWRQRPtD\DXWRUHJXODFLyQGHODSUHQGL]DMH

&RPSDUDFLyQHQWUH&HQWURVGHOD(QVHxDQ]D3UHVHQFLDO

(Q ODV DFWLWXGHV KDFLD HO FHQWUR ORVHVWXGLDQWHVGH OD )DFXOWDG GH &LHQFLDV GH
$FWLYLGDG )tVLFD \ HO 'HSRUWH  )&&$)'  SXQW~DQ PiV DOWR TXH ORV HVWXGLDQWHV GH
OD)DFXOWDGGH &LHQFLDVGHOD(GXFDFLyQ )&&( HQODPD\RUtDGHORVPDWLFHVDFWLWXGLQDOHV
\HQODDFWLWXG JHQHUDOKDFLDHOFHQWUR H[FHSWRHQHOGHDFHSWDFLyQGH Oosresultados de la
evaluaciónGHOFHQWURTXHREWLHQHSXQWXDFLRQHVVLPLODUHVHQDPERVFHQWURV +2 Respecto a
los matices señalados, las diferencias alcanzan las diferencias asintóticas por debajo del
0,015. Los alumnos de FCCE son más proclives a flexibilizar normas, mientras que los de
FCCAFD son más intensos en la demanda de motivación.
(Q UHODFLyQ D ODV DFWLWXGHV KDFLD HO SURIHVRU ORV HVWXGLDQWHV GH OD )DFXOWDG GH
&LHQFLDVGHOD(GXFDFLyQ )&&( SXQW~DQPiVTXHORVDOXPQRVGH )&&$)' HQ
QLYHOGHDXWRULWDULVPR\HQVLVWHPDVGHHYDOXDFLyQPLHQWUDVTXHORVHVWXGLDQWHVGH
)DFXOWDGGH&LHQFLDVGHOD(GXFDFLyQ )&&$)' S~QWXDQPiVHQHOQLYHOGHH[LJHQFLD
+2  (VWDV  SXQWXDFLRQHV FRPSDUDGDV HQWUH ORV DOXPQRV GH DPERV FHQWURV DOFDQ]DQ
195

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

QLYHOHVGHVLJQLILFDFLyQDVLQWyWLFDGHORUGHQGHO\UHIOHMDQHQORVHVWXGLDQWHVGHOD )DFXOWDG
GH &LHQFLDV GH OD (GXFDFLyQ )&&( XQD DFWLWXG mas favorable hacia HO SURIHVRU, en términos
comparativos, percibiéndolo  PHQRV DXWRULWDULR \VLVWHPDVGHHYDOXDFLyQPiVDFHSWDEOHV que
lRVHVWXGLDQWHVGHOD)DFXOWDGGH &LHQFLDV GH OD $FWLYLGDG )tVLFD \ HO 'HSRUWH. Por otra
parte ,los alumnos de la FCCE son más intensos en XQD DFWLGXG GH PD\RU
IOH[LELOL]DFLyQHQORVQLYHOHVGHH[LJHQFLD

/D FRPSDUDFLyQ HQWUH ORV DOXPQRV SHUWHQHFLHQWHV D DPERV FHQWURV DSXQWD D HVWLORV
QRUPDWLYRV\PRWLYDFLRQDOHVH[SUHVDGRV HQODVDFWLWXGHVKDFLDHOFHQWUR\KDFLDHOSURIHVRU
TXHHVWDQDVRFLDGRV FRQORVSHUILOHVGHORVHVWXGLDQWHV\HOWLSRGHIRUPDFLyQTXHUHFLEHQHQ
HOFHQWUR

/RVUHVXOWDGRVREWHQLGRV MXVWLILFDQODLQYHVWLJDFLyQUHDOL]DGDWDQWRHQORTXHVHUHILHUHDOD
FRQILUPDFLyQ GHO PRGHOR WHyULFR FRPR ODV SXQWXDFLRQHV REWHQLGDV GH ORV HVWXGLDQWHV GH
DFXHUGR D VX JUXSR GH SHUWHQHQFLD 6H KD PHGLGR \ HYDOXDGR HO JUDGR GH LPSRUWDQFLD \

FXPSOLPLHQWR GH ODV YDULDEOHV SVLFRVRFLDOHV HQ HVWXGLDQWHV XQLYHUVLWDULRV GH *UDGR HQ OD
PRGDOLGDGGH(QVHxDQ]D3UHVHQFLDO (3 \(QVHxDQ]DD'LVWDQFLD (D' HQOD8/3*&

$Vt HO PRGHOR HVWUXFWXUDO FRQILUPD ODV UHODFLRQHV SRVLWLYDV HQWUH PDWLFHV
PRWLYDFLRQDOHV FRPR DQWHFHGHQWHV GH ODV H[SHFWDWLYDV R UHVXOWDGRV HVSHUDGRV /RV
HVWXGLDQWHVTXHSXQW~DQPiV bajo VRQORVTXHGHPDQGDQXQDPD\RU\PHMRUDGDSWDFLyQ
GHO SURFHVR GH HQVHxDQ]D \ DSUHQGL]DMH 7DQWR ORV PDWLFHV PRWLYDFLRQDOHV FRPR
ORV QRUPDWLYRV HVSHUDGRV PXHVWUDQ XQD UHODFLyQ FRQVLVWHQWHV HQWUH Vt DSXQWDQGR OD
QHFHVLGDGGHTXHWDQWRHOFHQWURFRPRHOSURIHVRUHVWLPXOHQDSUHQGL]DMHVVLJQLILFDWLYRV
SDUDHOHVWXGLDQWHGHQWURGHOSURFHVRGHIRUPDFLyQDSUHQGL]DMH
/RVHVWXGLDQWHVGHODPRGDOLGDGGH(QVHxDQ]DPresencial (P VRQORVTXHSXQW~DQ
PiV bajo UHIOHMDQGR ODQHFHVLGDG GH PHMRUDU ORV DVSHFWRV QRUPDWLYRV \PRWLYDFLRQDOHV
GHODSUHQGL]DMHDFDGpPLFR

(VWRV UHVXOWDGRV DYDODQ OD FXHVWLyQ GH DYDQ]DU HQ QXHYDV IRUPDV GH DSUHQGL]DMH HQ
TXH ORV DOXPQRV SXHGDQ HPSUHQGHU ODV DFWLYLGDGHV GH XQ PRGR DFWLYR \ UHODFLRQDO
HQ ORV FHQWURV \ FRQ ORV SURIHVRUHV GRQGH ODV DFWLYLGDGHV GH PHGLDFLyQ VRFLDO \
RULHQWDFLyQHGXFDWLYDMXHJDQXQSDSHOSDUDODPHMRUDGHOSURFHVRDFDGpPLFR<EDMR
HVWDV QXHYDV IRUPDV GH DSUHQGL]DMH ORV YDORUHV \ DFWLWXGHV MXHJDQ XQ SDSHO
GHVWDFDGR HQ ODV DFFLRQHV HGXFDWLYDV RULHQWDGDV D PHMRUDU ORV SURFHVRV GH
DSUHQGL]DMHHQODHGXFDFLyQVXSHULRU
196

CAPÍTULO 7 DISCUSIÓN Y CONCLUSIONES

CONCLUSIONES

Tras la exposición reflexiva, las conclusiones que podemos extraer de la presente


investigación con respecto a las actitudes de los estudiantes hacia el centro educativo y
hacia el profesor son las siguientes:

1. Disponemos de una herramienta válida y fiable para poder evaluar las Actitudes
en estudiantes universitarios.

2. Los modelos estructurales constituyen un fundamento conceptual y teórico útil


para explicar el desarrollo y aprendizaje de las Actitudes Académicas.

3. Del análisis de resultados, se desprende que existen diferencias significativas en


las variables sociodemográficas evaluadas, por sexo, modalidad de enseñanza y
centros de destino.

4. La aceptación de la disciplina y la disposición psicológica, tienen una influencia


importante en la aceptación de los resultados académicos.

5. El grado de autoritarismo y de exigencia de los profesores tienen consecuencias


en las actitudes de los estudiantes en la aceptación del sistema de evaluación.

6. El análisis estructural de la investigación realizada indica que la aceptación de los


resultados y la aceptación de los sistemas de evaluación, juegan un papel
destacado en la aceptación del sistema de enseñanza.

7. Con nuestra investigación, hemos roto el diseño estructural del cuestionario


seminal, pasando a un sistema dinámico de relaciones mutuas entre las variables
actitudinales evaluadas, en función de la situación y el contexto.

197
%,%/,2*5$)Ë$

%,%/,2*5$)Ë$

Adorno, T. W. (2009). Estudios sobre la personalidad autoritaria. En Escritos


sociológicos II (Vol. 1). Ediciones Akal.

Ajzen, I. (1991). Theory of planned behaviour. Organizational Behavior and Human


Decision Processes, 50, 179-211.

Ajzen, I. (1998). Attitudes, Personality and Behavior. Chicago, Illinois: The Dorsey
Press.

Ajzen, I. (1998). Models of human social behavior and their application to health
psychology. Psychology and Health, 13(4), 735-739.

Albarracin, D., Johnson, B. T., & Zanna, M. P. (2005). The handbook of attitudes and
attitude change. Hillsdale: L. Erlbaum.

Alfonso Gil, S., Deaño, M., Conde Rodríguez, Á., Costa, A. R., Araujo, A. M., &

Almeida, L. S. (2013). Perfiles de expectativas académicas en alumnos españoles y
portugueses de enseñanza superior. Revista Galego-Portuguesa de Psicolocía e
Educación, Vol. 21, (N.º1).

Almeida, L. S., & Guisande, M. A. (2012). Participación extracurricular, ajuste y


rendimiento académico en la Educación Superior: Un estudio con estudiantes
portugueses. Anales de Psicología, 28(3), 860.

Alvira Martín, F. (1977). La relación entre actitud y conducta. Revista Española de


Opinión Pública, 49, 33-52.

Allport, G. W., & Vernon, P. E. (1930). The field of personality. Psychological


Bulletin, 27(10), 677.

Allport, G. W. (1935). Attitudes. En Murchison, C.: A Handbook of Social Psychology.


New York: Clark Univ.

Allport, G. W., Vernon, P. E., & Lindzey, G. (1960). Study of values. Boston,
Houghton.

Anaya, G. (1996). College Experiences and Student Learning: The Influence of Active
Learning, College Environments and Cocurricular Activities. Journal of College
Student Development, 37(6), 611-22.

Asch, S, E. (1952). Psicología Social. Buenos Aires: Eudeba.

201

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Astin, A. W. (1993). What matters in college?: Four critical years revisited (Vol. 1).
San Francisco: Jossey-Bass.

Astin, A. W. (2012). Assessment for excellence: The philosophy and practice of


assessment and evaluation in higher education. Rowman & Littlefield Publishers.

Bagozzi, R. P. (1992). The self-regulation of attitudes, intentions, and behavior. Social


Psychology Quarterly, 178-204.

Baker, R. W., McNeil, O. V., & Siryk, B. (1985). Expectation and reality in freshman
adjustment to college. Journal of Counseling Psychology, 32(1), 94.

Baker, R. W., & Siryk, B. (1986). Exploratory intervention with a scale measuring
adjustment to college. Journal of Counseling Psychology, 33(1), 31.

Baker, R. W., & Schultz, K. L. (1992). Measuring Expectations about College



Adjustment. Nacada Journal, 12(2), 23-32.

Balagué, G. (1997). Preparación psicológica en deportes individuales. En Cruz, E.J.


(ed.): Psicología del deporte. Madrid: Síntesis.

Bandura, A. (1978). The self system in reciprocal determinism. American Psychologist,


33(4), 344-358.

Bandura, A. (1986). Social Foundations of Thought and Action: A Social Cognitive


Theory Nueva Jersey: Prentice-Hall.
Bandura, A. (1997). Self-Efficacy. The exercise of control. New York: Freeman.
Bandura, A. (2002). Social cognitive theory in cultural context. Journal of Applied
Psychology. An International Review, 51, 269-290.

Bandura, A. & Walters, R. H. (1983). Aprendizaje social y desarrollo de la


personalidad. Madrid: Alianza.

Barclay, D., Higgins, C., & Thompson, R. (1995). The partial least squares (PLS)
approach to causal modeling: Personal computer adoption and use as an illustration.
Technological Studies, 2 (2), 285-309.

Bem, D. I. (1972). Self-perception theory. En Berkowitz,L. (ed.), Advances in


experimental social psychology, (vol.6): 1-62. Nueva York: Academic Press.

202

%,%/,2*5$)Ë$

Berman, P. S. (1997). Case conceptualization and treatment planning: Exercises for


integrating theory with clinical practice. Thousand Oaks, California: Sage Pub.

Biddle, B. J., Bank, B. J., & Slavings, R. L. (1987). Norms, preferences, identities and
retention decisions. Social Psychology Quarterly, 322-337.

Blanco, F. J. y Latorre, Mª. J. (2010). Elaboración de un cuestionario dirigido al


profesorado universitario ante el área europea de Educación Superior. Contextos
Educativos: Revista de Educación, 13, 43-56.

Bodill, K. & Roberts, L. D. (2013). Implicit Theories of Intelligence and Academic


Locus of Control as Predictors of Studying Behavior. Learning and Individual
Differences, 27, 163-166.

Boekaerts, M. (1997). Self-regulated learning: A new concept embraced by researchers,


 policy makers, educators, teachers, and students. Learning and Instruction,
7(2), 161-186.

Braxton, J. M., Vesper, N., & Hossler, D. (1995). Expectations for college and student
persistence. Research in Higher Education, 36(5), 595-611.

Braxton, J. M., Bray, N. J., & Berger, J. B. (2000). Faculty teaching skills and their
influence on the college student departure process. Journal of College Student
Development, 41(2), 215.

Bradley, C., Kish, K. A., Krudwig, A. M., Williams, T., & Wooden, O. S. (2002).
Predicting faculty-student interaction: An analysis of new student expectations.
Journal of the Indiana University Student Personnel Association, 72-87.

Breckler, S. J. (1984). Empirical validation of affect, behavior, and cognition as distinct


components of attitude. En Journal of Personality and Social Psychology, 47(6),
1191-1205.

Bredemeier, B., & Shields, D. (1984). Divergence in moral reasoning about sport and
everyday life. Sociology of Sport Journal, 1(4), 348-357.

Briñol, P., De la Corte, L., y Becerra, A. (2001). Qué es persuasión. Madrid. Biblioteca
Nueva.

203

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Briñol, P., Falces, C., & Becerra, A. (2007). Actitudes. Psicología Social, 3, 457-490.
España: McGraw-Hill.

Briñol, P., & Petty, R. E. (2003). Overt head movements and persuasion: A self-
validation analysys. En Personality and Social Psychology, (84), 1123-1139.

Briñol, P., Petty, R. E., & Tormala, Z. L. (2006). The meaning of ease and its
malleability. En Psychological Science, (17): 154-170.

Brown, W. F., & Holtzman, W. H. (1967). Survey of study habits and attitudes:
Manual. New York: Psychological Corporation.

Byrne, M., & Flood, B. (2005). A study of accounting students' motives, expectations
and preparedness for higher education. Journal of Further and Higher
Education, 29(2), 111-124.

Cabrera, A. F., Colbeck, C. L., & Terenzini, P. T. (2001). Developing performance
indicators for assessing classroom teaching practices and student learning. Research
in Higher Education, 42(3), 327-352.

Cabrera, A. F., Crissman, J. L., Bernal, E. M., Nora, A., Terenzini, P. T., & Pascarella,
E. T. (2002). Collaborative learning: Its impact on college students' development
and diversity. Journal of College Student Development, 43(1), 20-34.
Cacioppo, J.T. y PettY, R.E (1979). Neuromuscular circuits in affect-laden information
processing. Pavlovian Journal of Biological Sciencie, 14, 177-185.
Camisón, C. (1999). Sobre cómo medir las competencias distintivas: un examen
empírico de la fiabilidad y validez de los modelos multi-item para la medición de
los activos intangibles. Seminario del Dpto. de Economía y Dirección de Empresas
de la Universidad de la Laguna.

Carmines, E.G., & Zeller, R.A. (1979). Reliability and validity assessment. Sage
University Paper Series on Quantitative Applications in the Social Sciences, (07-
017), Beverly Hills, CA: Sage Publications.

Cassidy, S. (2012). Exploring Individual Differences as Determining Factors in Student


Academic Achievement in Higher Education. Studies in Higher Education, 37(7),
793-810.

Chickering, A. W., & Gamson, Z. F. (1987). Seven principles for good practice in
undergraduate education. AAHE bulletin, 3, 7.
204

%,%/,2*5$)Ë$

Chickering, A. W., & Reisser, L. (1993). Education and Identity. The Jossey-Bass
Higher and Adult Education Series. Jossey-Bass Inc., Publishers, 350 Sansome St.,
San Francisco, CA 94104.

Chin, W. W. (1998). Issues and opinion on structure equation modeling. MIS Quarterly,
22 (1), 7-16.

Chin, W. W., & Newsted, P. R. (1999). Structural Equation Modeling analysis with
Small Samples Using Partial Least Squares. Rick Hoyle (Ed.), Statistical Strategies
for Small Sample Research, Sage Publications, 307-341.

Chonko, L. B., Tanner, J. F., & Davis, R. (2002). What are they thinking? Students'
expectations and self-assessments. Journal of Education for Business, 77(5), 271-
281.
 Cole, J. S., Kennedy, M., & BenǦAvie, M. (2009). The role of precollege data in

assessing and understanding student engagement in college. New Directions for


Institutional Research, (141), 55-69.

Coll, C., Mauri, T., & Onrubia, J. (2006). Análisis y resolución de casos-problema
mediante el aprendizaje colaborativo. En Revista de Universidad y Sociedad del
Conocimiento 3, (2), 29-41.

Coll, C., Pozo, J. I., Sarabia, B., & Valls, E. (1992). Los contenidos de la Reforma.
Madrid: Santillana.

Conrey, F. R., & Smith, E. R. (2007). Attitudes representation: Attitudes as patterns in a


distributed, connectionist representational system. Social Cognition, 25(5), 718-
735.

Cook, W. W., Leeds, C. H., & Callis, R. (1951). Minnesota Teacher Attitude Inventory.
Nueva York. Psichological Corporation.

Cooper, J., & Brehm, J. W. (1971). Prechoice awareness of relative deprivation as a


determinant of cognitive dissonance. Journal of Experimental Social
Psychology, 7(6), 571-581.

205

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Coromina, L., Caipó, A., Guia, J., & Coenders, G. (2011). Efecto de las variables
personales, actitudinales y de red social en el rendimiento académico de los
estudiantes de doctorado. Un enfoque multimétodo. Estudios sobre Educación 20,
233-253. Revista Semestral del Departamento de Educación Facultad de Filosofía y
Letras. Universidad de Navarra.

Darlaston-Jones, D., Pike, L., Cohen, L., Young, A., Haunold, S., & Drew, N. (2003).
Are they being served? Student expectations of higher education. Issues in
Educational Research.

Darwin, C., Ekman, P., & Prodger, P. (1998). The expression of the emotions in man
and animals. Oxford University Press, USA

Deaño, M., García-Señorán, M., & Sepúlveda, J. (1997). Factores de éxito en alumnos
 de último curso de carrera en la Universidad de Vigo. Caderno de Innovación i
Educación (CIE), 1, 203-238.

Deaño, M., Diniz, A. M., Almeida, L. S., Alfonso, S., Costa, A. R., García-Señorán, M.,
... y Tellado, F. (2015). Propiedades psicométricas del Cuestionario de
Percepciones Académicas para la evaluación de las expectativas de los estudiantes
de primer año en Enseñanza Superior. Anales de Psicología, 31(1), 280-289.

Deaño, M. D., Gil, S. A., Rodríguez, Á. C., Almeida, L. S., Araújo, A. M., y Costa, A.
R. (2013). Assessment of academic expectations for Higher Education in Spain and
Portugal. Trabajo presentado en Seminario Internacional "Non-traditional students in Higher
Education: Looking beyond (in) success and dropout" Universidade do Algarve, Portugal.

De la Fuente, J., Justicia, F., & Berbén, A. B. (2006). Enfoques de aprendizaje,


percepción del proceso de enseñanza-aprendizaje y rendimiento de
universitarios. Revista de Psicología y Educación. Número monográfico sobre
“Estrategias de aprendizaje, 1(2), 87-102.

De la Fuente, J., Justicia, F., Sander P., Cano, F., Martínez, J. M. y Pichardo, M. C.
(2004). Evaluación de la percepción del proceso de enseñanza-aprendizaje en los
alumnos universitarios. Trabajo presentado en el VII Congreso Europeo de
Evaluación Psicológica, Málaga, España.

206

%,%/,2*5$)Ë$

De la Fuente, J., Nievas, F., y Rius, N. (2002). Cuestionario sobre las expectativas de
enseñanza de los estudiantes universitarios. Manuscrito no publicado. Universidad
de Almería, España.

De la Fuente, J., Sander, P., Justicia, F., Cano, F., Martínez, J. M. y Pichardo, M. C.
(2004). Estudio de los procesos de enseñanza-aprendizaje en el marco del Espacio
Europeo de Educación Superior (EEES). Trabajo presentado en el VII Congreso
Internacional de Psicología y Educación, Almería, España.

Dennett, D. C. (1998). La actitud intencional, 2ª edic. Barcelona: Gedisa.

Durndell, A., & Haag, Z. (2002). Computer self-efficacy, computer anxiety, attitudes
towards the Internet and reported experience with the Internet, by gender, in an East
European sample. Computers in Human Behavior, 18(5), 521-536.
 Eagly, A. H., & Chaiken, S. (1992). The psychology of attitudes. San Diego, CA:

Harcourt Brace Jovanovich.

Eysenck, H. J., & Wilson, G. D. (1978). The psychological basis of ideology. University
Park Press.

Eiser, J. R. (1987). The expression of attitude. Springer Science & Business Media.

Eiser, J. R. (1989). Psicología Social. Madrid: Pirámide.

Entwistle, N., & Tait, H. (1990). Approaches to learning, evaluations of teaching, and
preferences for contrasting academic environments. Higher Education, 19(2), 169-
194.

Entwistle, N. J. (1991). Approaches to learning and perceptions of the learning


environment. Higher Education, 22(3), 201-204.

Erazo, O. A. (2013). Caracterización psicológica del estudiante y su rendimiento


académico. Revista Colombiana de Ciencias Sociales, 4(1), 23-41.

Fazio, R. H. (1990). Multiple processes by which attitudes guide behaviour: the MODE
model as an integrative framework. En M. Zanna (eds.), Advances in experimental
social Psychology. Mahwan, NJ: Erlbaum.

Fazio, R. H. (2007). Attitudes as object-evaluation associations of varing strength.


Social Cognition. 25(5), 603-637.

207

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Fazio, R. H. & Olson, M. (2003). Implicit measures in social cognition research: Their
meaning and uses. Annual Review of Psychology, 54, 297-327.

Fernández, N. (2012). Retención y persistencia estudiantil en instituciones de educación


superior: Una aproximación interdisciplinaria al concepto. Paradigma, 33(2), 63-
88.

Fernández Ballesteros, R. (1992). Introducción a la evaluación psicológica I y II.


Madrid: Pirámide.

Festinger, L. (1975). Teoría de la disonancia cognoscitiva. Madrid: Instituto de


Estudios Políticos.

Fiedler, F. E. (1967). A theory of leadership effectiveness. McGraw Hill.

Fishbein, M., & Ajzen, I. (1975). Belief, Attitude, Intention and Behavior. New York:

Reading Mass.

Fornell, C., & Larcker, D. F. (1981). Evaluating structural equation models with
unobservable variables and measurement error. Journal of Marketing Research, 18,
39-50.

Fornell, C., & Bookstein, F. L. (1982). Two structural models: LISREL and PLS
applied to consumer exit-voice theory. Journal of Marketing Research, 19, 440-
452.

Fornell, C. & Cha, J. (1994). Partial least squares, in Bagozzi, R.P. (Eds), Advanced
Methods of Marketing Research, Blackwell, Cambridge, MA, pp.52-78.

Forns, M., Abad, J., Amador, J.A., Kirchner,T., & Roig, F. (2002). Evaluación
psicológica. Barcelona: UOC.

Fraser, B. J. (1991). Two decades of classroom environment research. En B.J. Fraser y


H.J. Walberg (Eds), Educational enviroments: Evaluation antecendentes, and
consequences (pp. 3.27). Oxford: Pergamon.

García-Ros, R. y Pérez-González, F. (2011). Assessment Preferences of Pre-service


Teachers: Analysis According to Academic Level and Relationship with Learning
Styles and Motivational Orientation. Teaching in Higher Education, 16(6), 719-
731.

208

%,%/,2*5$)Ë$

Gargallo, B., Suárez, J., Garfella, P.R. y Fernández, A. (2011). El cuestionario


CEMEDEPU. Un instrumento para la evaluación de la metodología docente y
evaluativa de los profesores universitarios. ESE: Estudios sobre Educación, 21, 9-
40.

Garzón, A. (1985). Dimensiones del conocimiento social. Promolibro.

Garzón, A., y Garcés, J. (1989): Hacia una conceptualización del valor. Tratado de
psicología general. Creencias, actitudes y valores. Madrid: Alhambra Universidad.

Gawronski, B., & Bodenhasen, G. V. (2007). Unraveling the process underlying


evaluation: Attitudes from the perspective of the APE Model. Social Cognition, 25
(5), 687-717.

Geisser, S. (1974). A predictive approach to the random effects model. Biometrica, 61,
 101-107.

Ghasemzadeh, A., & Saadat, M. (2011). Locus of Control in Iranian University


Students and its Relationship with Academic Achievement. Procedia-Social and
Behavioral Sciences, 30, 2491-2496

Gilligan, C. (1987). Moral orientación and moral development. Kittay y D. T Meyers (Eds).
Women and moral theory (pp. 19-33). Totowa, NJ: Rowman & Littlefield.

Godin, G., & Kok, G. (1996). The theory of planned behavior: a review of its
applications to health-related behaviors. American Journal of Health Promotion,
11(2), 87-98.

Goldfinch, J., & Hughes, M. (2007). Skills, learning styles and success of first-year
undergraduates. Active Learning in Higher Education, 8(3), 259-273.

Goldstein, K. (1959). Health as value (178-188). New York: Harper.

Gómez, A. H., & López, P. M. (2014). Nuevas competencias docentes para los nuevos
tiempos de la educación. Comunicación y Pedagogía: Nuevas tecnologías
y Recursos didácticos, (273), 59-63.

Gotzens, C. (1997). La disciplina escolar.Barcelona: Hosnori-ICE de la Universidad de


Barcelona.

209

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Graham, S. W., & Gisi, S. L. (2000). The effects of instructional climate and student
affairs services on college outcomes and satisfaction. Journal of College Student
Development.

Greenwald, A.G. (1989). Why attitudes are important: Defining attitude and attitude
theory 20 years later. En Pratkanis, R. y Breckler, J. (eds.): Attitude structure and
function. The third Ohio State University volume on attitudes and persuasion.
Hillsdale, NJ: Lawrence Erlbaum Associates.

Gutiérrez García, C., Pérez Pueyo, Á., Pérez Gutiérrez, M. y Palacios Picos, A. (2011).
Percepciones de profesores y alumnos sobre la enseñanza, evaluación y desarrollo
de competencias en estudios universitarios de formación de profesorado. Cultura y
Educación, 23 (4), 499-514.

 Haddock, G., & Maio, G. (2004). Contemporary perspectives on the psychology of


attitudes. Filadelfia: Psychology Press.

Haider, I. & Naeem, M. (2013). Locus of Control in Graduation Students. International


Journal of Psychological Research, 6(1), 15- 20.
Harter, S. (1981). A new self-report scale of intrinsic versus extrinsic orientation in the
classroom: motivational and informational components. Developmental
Psychology, 17(3), 300.

Hativa, N., & Birenbaum, M. (2000). Who prefers what? Disciplinary differences in
students´ preferred approaches to teaching and learning styles. Research in Higher
Education, 41(2), 209-235.

Heeler, R. M., & Ray, M. L. (1972). Measure validation in Marketing. Journal of


Marketing Research, 9; 361-370.

Hernando, A., Aguaded, J. I. y Tirado, R. (2011). Aprendizaje colaborativo on-line a


través del Campus Andaluz Virtual. Análisis de las interacciones. En M. C. Fonseca
y M. L. Fernández (Coord.), Reflexionar sobre docencia Universitaria. (pp. 31-47).
Sevilla: Fenix Editora.

210

%,%/,2*5$)Ë$

Hill, F. M. (1995). Managing service quality in higher education: the role of the
consumer as primary consumer. Quality Assurance in Higher Education, 3 (3), 10-
21.

Hollander, E. (1967). Principles and methods of social psychology. New York: Holt.

Hollander, E. P. (2000). Principios y métodos de psicología social. Amorrortu.

Homer, P. M., & Kahle, L. R. (1988). A structural equation test of the value-attitude-
behavior hierarchy. Journal of Personality and Social Psychology, 54(4), 638.

Hovland, C.I., Janis, I. L., & Kelly, H.H. (1953). Communication and persuasion.
Psychological studies of opinion change. New Haven: Yale University Press.

Howard, J. A. (2005). Why should we care about student expectations?. Promoting


reasonable expectations: Aligning student and institutional views of the

college experience, 10-33. San Francisco,CA: Jossey-Bass.

Hsieh, P-H. & Dwyer, F. (2009). The Instructional Effect of Online Reading Strategies
and Learning Styles on Student Academic Achievement . Educational Technology
& Society, 12(2), 36-50.
Hulland, J. (1999). Use of partial least squares (PLS) in strategic management research:
A review of four recent studies. Strategic Management Journal, 20 (2), 195-204.

Hyman, H. H., & Sheatsley, P. B. (1954). The authoritarian personality: A


methodological critique. En R. Christie &M Jahoda (Eds.), Studies in the scope
and method of the authoritarian personality, 50-122, New York: Free Press.

Igue, E. A., Bariani, I. C. D., & Milanesi, P. V. B. (2008). Vivência acadêmica e


expectativas de universitários ingressantes e concluintes. Psico-USF, 13(2), 155-
164.

Işik, E. (2013). Perceived Social Support and Locus of Control as the Predictors of
Vocational Outcome Expectations. Educational Sciences: Theory & Practice,
13(3), 1426-1430.

211

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Izquierdo, J. M. (2004). La condición psicológica en el deporte de competición:


estrategias de evaluación. (Tesis doctoral no publicada).Universidad de Las Palmas
de Gran Canaria, Las Palmas G.C.

Jackson, L. M., Pancer, S., Pratt, M. W., & Hunsberger, B. E. (2000). Great
Expectations: The Relation Between Expectancies and Adjustment During the
Transition to University. Journal of Applied Social Psychology, 30(10), 2100-
2125.

Kahle, I. R. (1984). Attitudes cause behaviour: A cross-lagged panel analysis. En


Journal of Personality and Social Psychology (37), 315-321.

Katz, D. (1960). The functional approach to the study of attitudes. Public Opinion
Quarterly, 24(2), 163-204.
 Katz, D. (1984). El enfoque funcional en el estudio de las actitudes. En Estudios

Básicos de Psicología Social, 261-298. Barcelona: Hora, S.A.

Katz, D. & Stotland, E. (1959). A Preliminary Statement to a Theory of Attitude


Structure and Change. En Koch, S.: Psychology: A Study of a Sciencie. New York:
McGraw-Hill.

Kelman, H. C. (1961). Processes of opinion change. En Public Opnion Quartely (25),


57-58.

Kelman, H. C. (1978). Attitude and behaviour: a social psychological problem. En


Yinger J. M. & Cutler S. J. (eds.): Major Social Issues: a Multidisciplinary View.
Nueva York: Free.

Keogh, K. M., & Stevenson, K. (2001). Student expectations of tutor support: An


expectations led quality assurance model. En Trabajo presentado en el Congreso ICDE.
Dusseldorf.

Kerlinger, F. N. (1981). Investigación del comportamiento. México: Interamericana.

Kerlinger, F. N., & Lee (2000). Foundations of Behavioral Research. London: Holt,
Rinehart & Winston.

212

%,%/,2*5$)Ë$

Kluckhohn, C. (1951). Values and value-orientations in the theory of action: An


exploration in definition and classification quoted. En T. Parsons, EA Shils (eds.),
Toward a general theory of action (pp. 388–433).

Kohlberg, L. (1984). The psychology of moral development: The nature and validity of
moral stages (Vol. 2). Harpercollins College Div.

Kohn, M. L., & Schooler, C. (1983). Work and personality: An inquiry into the impact
of social stratification. Ablex Pub.

Krech, D., Cruchfield, R. S., & Ballachey, E. L. (1972). Psicología Social. Madrid:
Biblioteca Nueva.

Krenn, B., Wuerth, S. & Hergovich, A. (2013). Individual Differences Concerning the
Impact of Feedback Specifying the Role of Core Self-Evaluations. Studia
 Psychologica, 55(2), 95-110.

Kristiansen, C. M., & Zanna, M. P. (1988). Justifying attitudes by appealing to values:


A functional perspective. British Journal of Social Psychology, 27(3), 247-256.

Kristiansen, C. M., & Hotte, A. M. (2013). How of Value—Attitude—Behavior


Relations. In The Psychology of Values: The Ontario Symposium, (8,77).
Psychology Press.

Krosnick, J. A., Betz, A. L., Jussin, L. J., & Lynn, A. R. (1992). Subliminal
conditioning of ttitudes. Personality and Social Psychology Bulletin, 18, 152-162.

Kruglanski, A. W. (1989). Lay Epistemics and Human Knowledge: Cognitive and


Motivational Bases. New York: Plenum.

Kuh, G. D., Gonyea, R.M., & Williams, J. M. (2005). What students expect from
college and what they get. In T. E. Miller, B. E. Bender, J. H. Schuh, & Associates
(Eds.), Promoting reasonable expectations: Aligning student and institutional views
of the college experience (pp. 34–64). San Francisco, CA: Jossey Bass.

Laudadío, J. (2012). Evaluación de estilos de enseñanza en la universidad: Estudio


preliminar de las propiedades psico-métricas del Cuestionario sobre la Orientación
Docente del Profesor Universitario (CODPU). Interdisciplinaria, 29 (1), 79-93.

213

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Leone, L., Perugini, M., & Ercolani, A. P. (1999). A comparison of three models of
attitude–behavior relationships in the studying behavior domain. European Journal
of Social Psychology, 29(2Ǧ3), 161-189.

Levenson, H. (1973). Reliability and Validity of the I, P, and C Scales-A


Multidimensional View of Locus of Control. Ponencia presentada en el Symposium
on Beliefs in Locus of Control: Unidimensional or Multidimensional?, Montreal.

Licata, J. W., & Maxham, J. G. (1999). Student expectations of the university


experience: Levels and antecedent for pre-entry freshmen. Journal of Marketing for
Higher Education, 9 (1), 69-91.

 Likert, R. A. (1976). Una técnica para la medición de actitudes. CH Wainerman


(comp.), Escalas de medición en ciencias sociales. (1, 99-260).Buenos Aires:
Ediciones Nueva Visión.

Linder, D. E., Cooper, J., & Jones, E. E. (1967). Decision freedom as a determinant of
the role of incentive magnitude in attitude change”. En Journal of Personality and
Social Psychology (6), 245-254.

Losch, M. E., & Cacioppo (1990). Cognitive dissonace may enhance symoatetic tonus,
but attitudes are changed to reduce negative affect rather than arousal. En Journal
Experimental Social (26), 289-304.

Lott, A., & Lott, B. (1968). A learning theory approach to interpersonal attitudes. En
Greenwald, Brock y Ostrom (eds.): Psycological foundations of attitudes. Nueva
York: Academic Pres.

Maio, G. R., & Olson, J. M. (1995). Relations between values, attitudes, and behavioral
intentions: The moderating role of attitude function. Journal of Experimental Social
Psychology, 31(3), 266-285.

Maio, G. R., & Olson, J. M. (2000). Why we evaluate: Functions of attitudes. Mahwah:
L. Erlbaum.

214

%,%/,2*5$)Ë$

Maloney, M. P. & Ward, M. P. (1976). Psychological assessment. A conceptual


approach. Nueva York: Oxford University Press.

Maraver, P., Hernando, A. y Aguaded, I. (2013). Una experiencia formativa en el


Campus Andaluz Virtual. En E. Corbi, E. López, F. Sirignano y Sarasola J. (Coord.)
II Seminario Científico Internacional sobre formación didáctica con tecnologías
Web 2.0, (pp. 121-131). Sevilla: AFOE.

Marcoulides, G. A. & Saunders, C. (2006). PLS: A Silver Bullet?. Mis Quarterly, 30


(2), 3-9.

Marcoulides, G. A., Chin, W. W., & Saunders, C. (2009). A Critical Look At Partial
Least Squares Modeling. Mis Quarterly (33:1), 171-175.

Markus, H. R., & Kitayama, S. (1991). Culture and the self: Implications for cognition,
 emotion, and motivation. Psychological Review, 98(2), 224.

Martín Rodríguez, J. A. (2003). ALFA (Cuestionario de Hábitos y Actitudes


Escolares), Renovado 2011. Editorial Cospa. Material de Psicología y Educación.

Martin, A. J., Wilson, R., Arief, G., & Ginns, P. (2013). Academic Momentum at
University/College: Exploring the Roles of Prior Learning, Life Experience, and
Ongoing Performance in Academic Achievement Across Time. The Journal of
Higher Education, 84(5), 640-674.

Martinez-Sánchez, E., & Ros, M. (1999), Values, norms and health behaviours. En XII
General Meeting of EASP, Oxford, Inglaterra.

Martínez, M. D. C. P., Berbén, A. B. G., De la Fuente, J., & Justicia, F. J. (2007). El


estudio de las expectativas en la universidad: análisis de trabajos empíricos y
futuras líneas de investigación. Revista Electrónica de Investigación
Educativa, 9(1).

Marrero, G. (1999). Motivos, Motivación, y Deporte. Salamanca: Tesitex.

Maslow, A. H. (1959). Psychological data and value theory. New knowledge in human
values, (pp.119-136). Chicago: Gateway.

Maslow, A. (1962.): Toward a Psycolgy of being. Princenton, N.J., Van Nostrand,

215

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Maslow, A. H. (1964). Religions, values, and peak-experiences (Vol. 35). Columbus:


Ohio State University Press.

McClelland, D. C. (1961). The achieving society. Princeton, NJ: D. Van Norstrand


Company. Inc..

McDowell, E. E., & McDowell, C. E. (1986). A Study of High School Students'


Expectations of the Teaching Style of Male, Female, English and Science
Instructors. Paper presented at the Annual Meeting of the International
Communication Association (36th, Chicago, IL, May 22-26, 1986).

McGuire, W. J. (1985). Attitudes and attitude change. En Lindzey, G. y Aronson, E.


(eds.), Handbook of Social Psychology. New York: Random House.

Mkumbo, K. A. K. & Amani, J. (2012). Perceived University Students’ Attributions of


 Their Academic Success and Failure. Asian Social Science, 8(7), 247-255.

Moles, A. (1982). Dimensions axiologiques de la qualité de vie. Reunión Internacional


sobre Psicología de los Valores.

Montmollin, G. D. (1985). El cambio de actitud. Psicología social I, 117-174. En Ed.


Moscovici S. Psicología Social I. Madrid: Paidos.

Moos, R. H., & Trickett, E. J. (1974). Classroom environment scale: Manual. (2ªed.).
Palo Alto, CA: Consulting Psychologists Press.

Moos, R. H. (1979). Evaluating educational environments: Procedures, methods,


findings, and policy implications. San Francisco, CA: ]ossey-Bass.

Morales, P. (2000). Medición de actitudes en psicología y educación: construcción de


escalas y problemas metodológicos. Editado por la Universidad Pontificia de
Comillas.

Nunnally, J. C. (1978). Psychometric theory (2nd ed.). New York: McGraw-Hill.

Olsen, D., Kuh, G. D., Schilling, K. M., Schilling, K., Connolly, M., Simmons, A., &
Vesper, N. (1998). Great expectations: What first-year students say they will do
and what they actually do. En Annual meeting of the Association for the Study of
Higher Education, Miami, FL.

216

%,%/,2*5$)Ë$

Olson, J. M. & Zanna, M. P. (1993). Attitudes and attitude change. En Annual-Review-


of-Psychology (44), 117-154.

Olson, J. M., Roese, N. J., & Zanna, M. P. (1996). Social psychology: Handbook of
basic principles. London, England: Guilford Press.

Ortiz, R. F., Menorca, L. G., Losa, N. F., & Andollo, M. J. S. (2010). Calidad
universitaria: expectativas de los estudiantes recién incorporados. Revista Nacional
de Administración, 1(2), 17-30.

Ortiz Jiménez, L., Salmerón-Pérez, H., & Rodríguez Fernández, S. (2011). La


enseñanza de estrategias de aprendizaje en educación infantil. Revista Curriculum
y Formación del Profesor11ado 11(2).

Osgood, C., Suci, G., & Tannenbaum, P. (1957). The Measurement of meaning. Illinois:
 University of Illinois Press.

Pace, C. R., & Kuh, G. D. (1998). College student experiences questionnaire. Center for
Postsecondary Research and Planning, Indiana University.

Pancer, S. M., Hunsberger, B., Pratt, M. W., & Alisat, S. (2000). Cognitive complexity
of expectations and adjustment to university in the first year. Journal of Adolescent
Research, 15(1), 38-57.

Parasuraman, A., Zeithaml, V. A., & Berry, L. L. (1988). Servqual. Journal of


Retailing, 64(1), 12-40

Pascarella, E. T., & Terenzini, P. T. (2005). How college affects students: A third
decade of research. San Francisco: Jossey-Bass.

Pastor, G. (1978). Ensayos de psicología social sistemática. Salamanca: Universidad


Pontificia.

Pelechano, V. (1982). Reflexiones en torno al Valor y Refuerzo. Reunión Internacional


sobre Psicología de los Valores.

Pelechano, V. (1997). Prólogo. En Buela-Casal, G. y Sierra, J.C. (dirs.): Manual de


evaluación psicológica. Fundamentos, técnicas y aplicaciones. Madrid: Siglo XXI.

Pepper, S. C. (1958). The sources of value. University of California Press.

217

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Petty, R. E., Briñol, P., & CDeMaree, G. (2007). The Meta-Cognitive Model (MCM) of
attitudes: Implications for Attitude Measurement, Change, and Strength. Social
Cognition, 25 (5), 657-686.

Petty, R.E., & Cacioppo, J.T. (1986). Communication and Persuasion: Central and
Peripheral Routes to Attitude Change. New York: Springer Verlag,

Petty, R. E., & Krosnick, J. A. (2014). Attitude strength: Antecedents and consequences.
Psychology Press.

Petty, R. E., Wegener, D. T., & Fabrigar, L. R. (1997). Attitudes and attitude
change. Annual Review of Psychology, 48(1), 609-647.

Piere, L. (1934). Attitudes and actions. Social Forces, 13, 230-237.

Pintrich, P. R., Smith, D.A., García T, y McKeachie, W.I (1991). A manual for the
 use of the Motivated Strategies for Learning Questionnaire (MSLQ). Ann Arbor,
aaaaMI:NCRIPTAL: The University of Michigan.
Pintrich, P. R., & Schrauben, B. (1992). Students’ motivational beliefs and their
cognitive engagement in classroom academic tasks. En Dale H. (Ed);Meece,Judith L.(Ed).
Student perceptions in the classroom, 7, 149-183. Hillsdale, NJ, England: Lawrence
Erlbaum Associates, Inc, xiii, 363 pp.

Pozar, F. (2002). Manual Inventario de Hábitos de Estudio. Madrid: TEA Ediciones.

Raven, B.H. (1965). Social influence and power”. En Steiner I.D., y Fishbein M. (eds.):
Current studies in social Psycology. Nueva York: Holt,Rinehart, Winston.

Real, J. C., Leal, A., & Roldán, J. L. (2006). Information technology as a determinant of
organizational learning and technological distinctive competencies. Industrial
Marketing Management, 35 (4), 505-521.

Riddings, S., Sidhu, R., & Pokarier, C. (2000). Working effectively with international
students. Trabajo presentado en el 4th Pacific Rim First Year in Higher Education
Conference, Brisbane, Australia.

Ringle, C., Wende, S., & Will, A. (2005). Smart-PLS Version 2.0 M3.

Rodríguez, E. F. (1975). ¿Cuál es el papel del alumnado dentro del proceso de


enseñanza-aprendizaje en la universidad?. Revista de Educación, (236-241), 201-
217.

218

%,%/,2*5$)Ë$

Rokeach, M. (1968). A Theory of Organization and Change Within ValueǦAttitude


Systems1. Journal of Social Issues, 24(1), 13-33.

Rokeach, M. (1973). The nature of human values (Vol. 438). New York: Free press.

Rokeach, M. (1979). Understanding Human Values. New York: The Free Press.

Rosenberg, M. J. (1960). A Structural Study of Attitudes Dynamics. En Public Opinion


Quarterly, (24), 319-340.

Rosenberg, M. J., & Hovland, C. I. (1981). Attitude organization and change: An


analysis of consistency among attitude components. New Haven, CT: Yale Univer.
Press.

Salanova, M., Martínez, I. M., Bresó, E., Llorens, S., & Grau, R. (2005). Bienestar
psicológico en estudiantes universitarios, facilitadores y obstaculizadores del

desempeño académico. Anales de Psicología, 21, (1), 170-180.

Sánchez, M., & Sarabia, F. J. (1999). Validez y fiabilidad de las escalas. En Sarabia,
F.J. (coord..) Metodología para la investigación en marketing y dirección de
empresas pp.363-394. Madrid: Pirámide.

Sander, P., Stevenson, K., King, M., & Coates, D. (2000). University students'
expectations of teaching. Studies in Higher Education, 25(3), 309-323.

Sarabia, F.J. (1999). Metodología para la investigación en marketing y dirección de


empresas. Madrid: Pirámide.

Schifter, D. E., & Ajzen, I. (1985). Intention, perceived control, and weight loss: an
application of the theory of planned behavior. Journal of Personality and
Social Psychology, 49(3), 843.

Schwartz, S. H. (1973). Normative explanations of helping behaviour. A critique,


proposal and empirical test. Journal of Experimental Social Psychology, 9, 349-
364.

Schwartz, S. H. (1977). Normative influences on altruism. En L. Berkowitz (Ed.),


Advances in experimental social psychology, 10, 221-279. Nueva York. Academic
Press.

219

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Schwartz, S. H. (1992). Universals in the content and structure of values: Theoretical


advances and empirical tests in 20 countries. Advances in Experimental Social
Psychology, 25(1), 1-65.

Schwartz, S. H. (2001). ¿Existen aspectos universales en la estructura y contenido de los


valores humanos. Psicología social de los valores humanos. Desarrollos teóricos,
metodológicos y aplicados, 53-77. Madrid. Biblioteca Nueva.

Schwartz, S. H. (2013). Value Priorities and Behavior: Applying. In The psychology of


values: The Ontario symposium 8. Psychology Press.

Schwartz, N., & Bohner, G. (2001). The construction of attitudes. En A. Tesser y N.


Schwartz (Eds.), Blackwell handbook of social psycology: Intraindividual
processes (pp.436-457). Balden: Blackwell.
 Schwartz, S. H., & Howard, J. A. (1984). Internalized values as motivators of altruism.

In Development and maintenance of prosocial behavior (pp. 229-255). US:


Springer.

Secord, P. & Backman, C. (1964). Social Psychology. New York: McGraw-Hill.

Shapiro, M. B. (1970). Intensive assessment of the single case: An inductive-deductive


approach. En Mittler, P. (ed.): The psychological assessment of mental and physical
handicaps. Londres: Methuen.

Smith, J. S., & Wertlieb, E. C. (2005). Do first-year college students' expectations align
with their first-year experiences?. Journal of Student Affairs Research and
Practice, 42(2), 299-320.

Smith, S. W. (1994). The prototypical features of the ideal professor from the female
and male undergraduate perspective: The role of verbal and nonverbal
communication. Journal on Excellence in College Teaching, 5(2), 5-22.
Snyder, M., & DeBono, K. G. (1989). Understanding the functions of attitudes: Lessons
from personality and social behavior. En Pratkanis, Anthony R., Breckler, S.J.,
Greenwald, y Anthony G. (Eds), Attitude structure and function. The third Ohio
state University volume on attitudes and persuasion., (pp. 339-359). Hillsdale,
NJ, England: Lawrence Ebaum Associates, Inc, Xiv, 462pp.
Soares, A. P., y Almeida, L. S. (2005). Questionário de Envolvimento Académico
(QEA): Novos elementos para a sua validação. Psicología: Teoría ,Investigação,
e Páctica. (2005) 139-158. Recuperado en http://hdl.handle.net/1822/12078.
220

%,%/,2*5$)Ë$

Soares, A. P., Couñago, M. A. G., y Almeida, L. S. (2007). Autonomía y ajuste


académico: un estudio con estudiantes portugueses de primer año. International
Journal of Clinical and Health Psychology, 7(3), 753-765.

Soares, A. P., Guisande, A. M., Almeida, L. S., y Páramo, F. M. (2009). Academic


achievement in firstǦyear Portuguese college students: The role of academic
preparation and learning strategies. International Journal of Psychology, 44(3),
204-212.

Soares, A. P., Almeida, L. S., y Guisande, M. A. (2011). Ambiente académico y


adaptación a la universidad: Un estudio con estudiantes de 1º año de la Universidad
do Minho. Revista Iberoamericana de Psicología y Salud, 2(1), 99-121
www.usc.es/suips.

 Spencer, H. (1862). First Principles. New York: Burt.

Staats, A.W. (1968). Social behaviorism and human motivation: Principles of the
attitude-reinforcer-discriminative system. En Greenwald, Brock y Ostrom (eds.):
Psycological foundations of attitudes. Nueva York: Academic Pres.

Stern, P. C., Dietz, T., Kalof, L. & Guagnano, G. A. (1995). Values, Beliefs, and
proenvironmental action: Attitudes Formation toward emergent attitude objects.
Journal of Applied Social Psychology, 25 (18), 1611-1636.

Stone, M. (1974). Cross-validatory choice and assessment of statistical


predictions. Journal of the Royal Statistical Society, 36, 111-147.

Strange, C. C., & Banning, J. H. (2001). Education by Design: Creating Campus


Learning Environments That Work. The Jossey-Bass Higher and Adult
Education Series. Jossey-Bass, Inc., 989 Market St., San Francisco, CA 94103.

Tenenhaus, M., Vinzi, V. E., Chatelin, Y. M., & Lauro, C. (2005). PLS path modeling.
Computational statistics & data analysis, 48(1), 159-205. Filadelfia: Elsevier.

Tesser, A., & Schwarz, N. (Eds.). (2008). Blackwell handbook of social psychology:
Intraindividual processes. John Wiley & Sons.

Tetlock, P.E., (1986). A value pluralism model of ideogical reasoning. Journal of


Personality and Social Psycology, 50, 819-217.

221

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Thomas, K., & Znaniecki, F. (1918). The Polish Peasant in Europe and America.
Chicago: Univ. of Chicago Press.

Tinto, V. (1993). Learning college: Rethinking the causes and cures of student attrition
(2ªed.).Chicago, II: Univesrsity of Chicago. Press.

Tinto, V. (1997). Classrooms as communities: Exploring the educational character of


student persistence. Journal of Higher Education, 68(6), 599-623.

Tirado, R., Aguaded, I., y Hernando, A. (2011). Campus virtuales en universidades


andaluzas: tipologías de uso educativo, competencias docentes y apoyo
institucional. Teoría de la Educación, 23(1), 159-179.

Tirado-Morueta,R., Aguaded-Gomez, J. I., & Hernando-Gomez, Á. (2014). Adoption


of B-Learning at Universities in Spain:The Influence of Environment. Educational
 Technology Use and Design for Improved Learning Opportunities, 286.

Tirado, R., Hernando, A., y Aguaded, I. (2011). Aprendizaje cooperativo on-line a


través de foros en un contexto universitario. Estudios sobre Educación, 20, 49-71.

Tirado, R.; Hernando, A.; y Aguaded, I. (2012). Blended e-learning en Universidades de


Andalucía (España): del aprendizaje tradicional al aprendizaje centrado en el
estudiante. International Journal of Technology and Human Interaction.

Triandis, H. C. (1971). Attitude and attitude change. New York: Wiley.

Triandis, H. C. (1977). Interpersonal Behavior. Monterrey (CA): Brooks/Cole.

Triandis, H. C. (1991). Attitude and attitude change. En Ency. Hum. Biol. 1: 485-96.
San Diego CA: Academic Press.

Tumino, M., y Poitevin, E. (2014). Evaluación de la calidad de servicio universitario


desde la percepción de estudiantes y docentes: caso de estudio. REICE: Revista
Electrónica Iberoamericana sobre Calidad, Eficacia y Cambio en Educación, 12
(2), 63-84.

Vander Zanden, J. W. (1990).Manual de Psicología Social. Barcelona: Paidós.

222

%,%/,2*5$)Ë$

Visdóme-Lozano, J. C., y Luciano, C. (2006). Locus de control y autorregulación


conductual: Revisiones conceptual y experimental. International Journal of
Clinical and Health Psychology, 6(3), 729-751.

Visser, P. S., & Mirabile, R. R. (2004). Attitudes in the social context: The impact of
social network composition on individual-level attitude strength. En American
Journal of Personality and Social Psychology (87), 779-795.

Weinstein, C. E., & Mayer, R. E. (1986). The teaching of learning strategies. In M,


Wittrock (ED). Handbook of research on teaching pp (315-327). New
York: Macmillan.

Weinstein, C. E. (1988). Assessmentand training of student learning strategies. En


Schmeck, R.R. (ed.): Learning Styles and Learning Strategies. New York: Plenum
 Press.

Wetzels, M., Odekerken-Schröder, G., & Van Oppen, C. (2009). Using PLS Path
Modeling for Assessing Hierarchical Construct Models: Guidelines and Empirical
Illustration. Mis Quarterly, Vol. 33 No. 1, pp 177-195.

Wicker, A. W. (1969). Attitudes versus action. The relationship of verbal and overt
behavioral responses to attitudes objects. En Journal of Social Issues (25), 41-78.

Wilson, T. D., Lindsey, S., & Schooler, T. Y. (2000). A model of dual attitudes. En
Psychological Review, 107, 101-126.

Williams Jr, R. (1977). Concepto de valores. Enciclopedia Internacional de las Ciencias


Sociales, 10, 607-611.

Williams, R. M., & Rokeach, M. (1979). Understanding human values: Individual and
societal. New York: Free Press.

Wold, H. (1979). Model construction and evaluation when theoretical knowledge is


scarce: An example of the use of partial least squares. Genève: Cahiers du
Département D’Économétrie, Faculté des Sciences Économiques et Sociales,
Université de Genève.

223

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Yanhong, R., & Kaye, M. (1999). Measuring service quality in the context of teaching:
a study on the longitudinal nature of students’ expectations and perceptions.
Innovations in Education and Training International, 36 (2), 145-154.

Zanna, M. P. (1970). Positive and Negative Attitudinal Affect Established by Classical


Conditioning. J. Personality Soc. Psychol, 14(4), 321-28.

Zanna, M. P., & Rempel, J. K. (1988). Attitudes: A new look at an old concept. En Bar-
Tal, D. y Kruglanski, W. (eds.): The Social Psychology of Knowledge. Cambridge,
England UK: Cambridge University Press.

Zeithaml, V. A., Berry, L. L., & Parasuraman, A. (1993). The nature and determinants
of customer expectations of service. Journal of the Academy of Marketing
Science, 21(1), 1-12.


224

$1(;26
$1(;26

$1(;2$

,16758&&,21(6 3$5$ (/ &8(67,21$5,2 '( $&7,78'(6


$&$'e0,&$6)250$81,9(56,7$5,$

Este cuestionario tiene por objeto conocer determinados aspectos psicológicos


relacionados con diversas situaciones de la actividad académica y no compromete en
absoluto su situación en el curso. Solamente pretendemos reunir información sobre sus
puntos de vista para orientarle mejor en los aspectos fundamentales del estudio y la
actividad académica. Cada cuestión admite CINCO posibles contestaciones:

1 1UNCA O RARA VEZ (0 A 15% de importancia)

3 3OCAS O ALGUNAS VECES (16 A 35% de importancia)

5 5EGULAR DE VECES (36 A 65% de importancia)



% %ASTANTES VECES (66 a 85% de importancia)

00UCHAS VECES (86 A 100% de importancia)

Los porcentajes no deben ser interpretados matemáticamente, únicamente deben servir


como orientación.

Para realizar correctamente el Cuestionario deberá:

1. Leer y entender el significado de la pregunta que se le está haciendo.


2. En la +2-$ '( 5(38(67$6 deberá marcar con una ; la opción que crea
coincide más o menos con su forma de ser, pensar, sentir o actuar. La marca se
debe hacer de forma que pueda ser claramente percibida.

0HHVIXHU]RSRUPHMRUDUPLUHQGLPLHQWRacadémico

(-(03/21 Nada 3 = Poco 5= Regular % = Bastante 0 = Mucho

3. Ser sincero en sus respuestas y completar todo el Cuestionario (no hay límite de
tiempo).

Hay tantas modalidades y programas de estudio que resulta difícil poder referirnos
adecuadamente al que usted pertenece con un lenguaje específico, por eso deberá hacer
un esfuerzo para adaptar la terminología al contexto de su programa.

Gracias por su colaboración.12(6&5,%$1$'$(1(67(&8(67,21$5,2

227

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

$1(;2%

&8(67,21$5,2'($&7,78'(6$&$'e0,&$6)250$81,9(56,7$5,$

1. En la planificación de las actividades de aprendizaje y los temas de estudio,


apenas se consulta a los estudiantes.
2. Pienso que lo mejor en este momento es dejar de estudiar y buscar un trabajo.
3. Estoy convencido que practicar deporte es tanto o más importante que estudiar.
4. Procuro faltar a mis obligaciones siempre que puedo.
5. Estoy pensando dejar de estudiar porque comprendo que lo que estamos
aprendiendo sirve muy poco para el futuro profesional.
6. Encuentro que los estudiantes confían poco en sus profesores.
7. Normalmente los profesores están preocupados por sus asuntos y prestan poca
atención a los estudiantes.

8. Los profesores hacen las actividades demasiado difíciles para los estudiantes de
mediana capacidad.
9. Los profesores cuando explican las actividades de aprendizaje o responden a
preguntas de los Foros o Tutorías usan palabras intencionalmente oscuras y
difíciles.
10. Las explicaciones, proyecciones y ejemplos que proporcionan los profesores
para comprender lo que dice son pesadas y difíciles de entender.
11. Opino que los profesores proponen muchas actividades para cada Módulo de
Aprendizaje.
12. Estoy convencido que los profesores se dedican a la enseñanza porque disfrutan
haciendo sufrir a los estudiantes.
13. Cuando el profesor ha dado una orden le molesta que se la contradigan.
14. Creo que a los profesores les gusta demasiado mostrar su autoridad y dejar claro
que en su asignatura mandan ellos.
15. Encuentro que los profesores se divierten ridiculizando los errores o
equivocaciones de sus estudiantes.
16. Pienso que los profesores ponen ejercicios y pruebas en aquellos momentos que
estamos más estresados y faltos de tiempo.

228

$1(;26

17. Creo que es más indispensable en la vida divertirse y pasarlo bien que estudiar y
aprender.
18. Leer, hacer actividades y estudiar demasiado me da dolor de cabeza.
19. Algunas asignaturas me resultan tan aburridas que paso el tiempo dibujando,
escribiendo notas o soñando, en lugar de estar pendiente del contenido del tema
que he de estudiar.
20. Solo pienso en sacar buenas notas en las asignaturas que me gustan y domino.
21. Creo que las notas que saco en las actividades y los exámenes son inferiores a
las que debería sacar.
22. Encuentro que mis calificaciones en las actividades y los exámenes reflejan
menos de los que realmente he aprendido y puedo hacer.
23.Únicamente me intereso por la notas de las asignaturas que me gustan.
 24. Creo que los profesores normalmente comprenden poco las necesidades,
expectativas e inquietudes de los estudiantes.
25. Encuentro que lo que se enseña en Teleformación sirve muy poco para resolver
situaciones profesionales en el futuro.
26. Creo que los métodos de enseñanza utilizados en Teleformación están
orientados en la adquisición de una formación teórica nada más.
27. Creo que la mejor forma de sacar buenas notas en las actividades y los exámenes
es hacer la pelota al profesor.
28. Creo que los profesores tienden a dar mucha información y confunden a los
estudiantes en lugar de clarificar las dudas o preguntas.
29. Creo que los estudiantes que hacen consultas en Tutoría o mandan mensajes por
los Foros están tratando de hacerse los "listos" o los "buenos" ante el profesor.
30. Los profesores suelen ser injustos a la hora de valorar y calificar a los
estudiantes.
31. En mi opinión, conseguir buenos resultados en las actividades y buenas notas en
los exámenes la mejor forma es estar de acuerdo con todo lo que dicen los
profesores.
32. Encuentro que los profesores a la hora de calificar se fijan en el agradado,
simpatía o antipatía que le producen sus estudiantes.

229

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

33. Soy de la opinión de que los profesores piensan más en las notas que en el
objetivo principal de enseñar al estudiante.
34. Estoy convencido de que los profesores se divierten interiormente, haciendo a
sus estudiantes el tiempo de trabajo más pesado.
35. Encuentro que es casi imposible, para la mayoría de los estudiantes, hacer todas
las tareas y actividades que se marcan en Teleformación.
36. Creo que los profesores son demasiado estrictos y exigentes en su relación con
los estudiantes de Teleformación.
37. Encuentro que los profesores miran con desprecio a los estudiantes peores.
38. Opino que los profesores suelen tener una mente estrecha y muy difícil de
convencer.
39. Encuentro que yo estudiaría más y mejor si se diera libertad para elegir los temas
 que me gustan e interesan.
40. Creo que la disciplina escolar quita libertad a los estudiantes en sus tareas de
aprendizaje.
41. Opino que los estudiantes tenemos poca libertad para seleccionar los ejercicios y
actividades que tenemos que hacer.
42. Encuentro que si me dieran mayores oportunidades en los estudios, sacaría
mejor provecho y rendimiento.
43. Opino que el sistema que se usa de disciplina en Teleformación apenas se ajusta
a la realidad y necesidades de los estudiantes.
44. Opino que es mucho más efectivo lo que se practica en la vida que lo que me
enseñan mis profesores.
45. Encuentro que es demasiado tiempo, dinero, esfuerzo y sacrificio el que uno
debe gastar para obtener una formación académica.
46. Creo que el objetivo principal en Teleformación debería ser enseñar a los
estudiantes cosas que le ayuden para su futuro profesional y para la vida.
47. Creo que las calificaciones más altas en las actividades y exámenes se dan a los
estudiantes que aprenden de memoria, en lugar de aquellos que saben el porqué
de las cuestiones.
48. Creo que el estado de ánimo de los profesores influye a la hora de evaluar a los
estudiantes, tanto las actividades como los exámenes.

230

$1(;26

$1(;2&

'$726'(,1'(17,),&$&,Ï1'(/26(678',$17(6<

+2-$6'(5(638(67$6
CUESTIONARIO DE ACTITUDES ACADÉMICAS (FORMA U)
Apellidos y Nombre
Edad Sexo Estado Civil
Centro
Titulación
Asignatura
C_Académico Curso
Fecha Grupo
Experiencia Informática. ¿Cuántos años lleva manejando un PC?
Ha hecho alguna vez un curso sobre Técnicas de Estudio?
¿Cuántas horas dedica al estudio a la semana?
De estas horas ¿Cuántas dedica a la Plataforma?
Estudios previos realizados
Año en el finalizó los estudios que le han dado acceso al Grado
 ¿Trabaja actualmente?
¿En cuántos lugares ha trabajado? Ponga el número
Profesión actual
Usted es especialista en o sabe hacer muy bien
Dispone de un lugar independiente para poder estudiar
Tiene ordenador en casa
Idioma que domina
Piensa realizar estudios de Posgrado
Práctica alguna actividad deportiva
Modalidad deportiva
Escriba su E_mail

231

$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

$1(;2'

$1$/,6,6'(&255(/$&,21(6'(/&$$)8

A continuación, exponemos los resultados de la aplicación de la Correlación de Pearson


entre los distintos matices socio-afectivos estudiados, así como de las actitudes hacia el
centro y hacia el profesor. Como podemos observar en la siguiente Tabla, existe una
correlación positiva entre actitudes hacia el centro y actitudes hacia el profesor. En este
sentido, en la segunda Tabla mostrada, exponemos los coeficientes de correlación de
todos los matices. Vemos que existe una correlación positiva entre sistemas de
evaluación y nivel de autoritarismo
Tabla 52
Correlaciones entre actitud hacia el centro y hacia el profesor
Correlaciones
Actitudes_Centro Actitudes_Profesor
 Correlación de Pearson 1 ,746**
Actitudes_Centro Sig. (bilateral) ,000
N 2386 2386
Correlación de Pearson ,746** 1
Actitudes_Profesor Sig. (bilateral) ,000
N 2386 2386
Nota.La correlación es significativa al nivel 0,01 (bilateral).

232




Tabla 53.
Correlaciones entre matices socio-afectivos

Interés_
Acepta_ Acepta_ Acepta_ Nivel_ Nivel_ Nivel_ Sistemas_
Motivació
Disciplina Sistemas Resultados Comprensión Autoritarismo Exigencia Evaluación
n

Correlación de Pearson 1 ,234** ,484** ,411** ,482** ,367** ,490** ,376**


Acepta_Disciplina Sig. (bilateral) ,000 ,000 ,000 ,000 ,000 ,000 ,000
N 2386 2386 2386 2386 2386 2386 2386 2386
Correlación de Pearson ,234** 1 ,450** ,442** ,438** ,446** ,403** ,457**
Interes_Motivación Sig. (bilateral) ,000 ,000 ,000 ,000 ,000 ,000 ,000
N 2386 2386 2386 2386 2386 2386 2386 2386
Correlación de Pearson ,484** ,450** 1 ,408** ,473** ,349** ,496** ,368**
Acepta_Sistemas Sig. (bilateral) ,000 ,000 ,000 ,000 ,000 ,000 ,000
N 2386 2386 2386 2386 2386 2386 2386 2386
Correlación de Pearson ,411** ,442** ,408** 1 ,623** ,617** ,454** ,652**
Acepta_Resultados Sig. (bilateral) ,000 ,000 ,000 ,000 ,000 ,000 ,000
N 2386 2386 2386 2386 2386 2386 2386 2386
Correlación de Pearson ,482** ,438** ,473** ,623** 1 ,662** ,639** ,646**
Nivel_Comprensión Sig. (bilateral) ,000 ,000 ,000 ,000 ,000 ,000 ,000
N 2386 2386 2386 2386 2386 2386 2386 2386
Correlación de Pearson ,367** ,446** ,349** ,617** ,662** 1 ,503** ,718**
Nivel_Autoritarismo Sig. (bilateral) ,000 ,000 ,000 ,000 ,000 ,000 ,000
N 2386 2386 2386 2386 2386 2386 2386 2386
Correlación de Pearson ,490** ,403** ,496** ,454** ,639** ,503** 1 ,549**
Nivel_Exigencia Sig. (bilateral) ,000 ,000 ,000 ,000 ,000 ,000 ,000
N 2386 2386 2386 2386 2386 2386 2386 2386
Correlación de Pearson ,376** ,457** ,368** ,652** ,646** ,718** ,549** 1
Sistemas_Evaluación
Sig. (bilateral) ,000 ,000 ,000 ,000 ,000 ,000 ,000
Nota: Elaboración propia
$1(;26

233
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

$1(;2(

$1$/,6,6)$&725,$/'(/&$$)8

En los análisis realizados con la varianza obtenemos un solo componente principal que
explica el 55,673% de la varianza. Si realizamos el análisis según modalidad de
enseñanza, vemos que en la enseñanza presencial el 54,937% de la varianza es
explicado por este factor y en la enseñanza a distancia el 59,472%.

En la Tabla 53 se pueden observar los autovalores, el porcentaje de varianza que cada


factor explica y el porcentaje de varianza acumulado. Vemos que solo hay un
componente con valor propio (4,454) superior a 1, aspecto que orienta el cuestionario
hacia una estructura unidimensional, puesto que los distintos matices concluyen en un
solo componente. De esta forma, lo podemos identificar como el constructo subyacente
 que el cuestionario pretende medir. En nuestro caso, los distintos matices contribuyen a
la medida del constructo psicológico que podemos denominar matices socio-afectivos
implicados en las actitudes del alumnado hacia el profesor y hacia el centro.

El proceso seguido ha partido de la realización de la matriz de correlaciones. En


segundo lugar, comprobamos si la correlación entre las variables es lo suficientemente
relevante para justificar la factorización de la matriz de coeficientes de correlación a
través de la Prueba de esfericidad de Barlett (Tabla 54). Tal como podemos observar, en
este caso, el modelo es significativo p-valor <0,05, por lo que rechazamos la hipótesis
nula de esfericidad. Por otra parte, el valor de KMO, que permite comparar la magnitud
de los coeficientes de correlación observados con los coeficientes de correlación parcial,
presenta un valor KMO=0,891. Siendo el valor de KMO>0,5 nos encontramos con un
buen valor. Se cumple, por tanto, de forma satisfactoria las condiciones para realizar el
análisis factorial cuyo resultado ya expusimos.

En la Tabla 56 se expone la matriz de componentes. En último lugar, exponemos el


gráfico de sedimentación en el que se observa la relevancia del primer factor (Figura 53).

234




Tabla 54.
Kaiser -Meyer-Olkin y prueba de esfericidad de Barlett
KMO y prueba de Bartlett

Medida de adecuación muestral de Kaiser-Meyer-Olkin. ,891

Chi-cuadrado aproximado 9330,418


Prueba de esfericidad de
gl 28
Bartlett
Sig. ,000
Nota: Elaboración propia
Tabla 55.
Componentes principales

Autovalores iniciales Sumas de las saturaciones al cuadrado de la extracción


Componente
Total % de la varianza % acumulado Total % de la varianza % acumulado
1 4,454 55,673 55,673 4,454 55,673 55,673
2 ,920 11,500 67,173
3 ,750 9,375 76,548
4 ,516 6,448 82,996
5 ,421 5,261 88,258
6 ,361 4,517 92,775
7 ,322 4,020 96,795
8 ,256 3,205 100,000

Nota.Método de extracción: Análisis de Componentes principales


$1(;26

235
$&7,78'(6'(/26(678',$17(681,9(56,7$5,26+$&,$(/&(1752</26352)(625(6

Tablaa 56
Matriiz de componentes
Mattriz de componentesa
Componente 1
Aceepta_Disciplina ,629
Inteeres_Motivación ,636
Aceepta_Sistemas ,657
Aceepta_Resultados ,784
Nivvel_Comprensión ,847
Nivvel_Autoritarismo ,799
Nivvel_Exigencia ,764
Sisttemas_Evaluación ,817
Nota: Elaboración propia

Figura 52.Gráfico de sedimentación.

236