Está en la página 1de 36

República de Colombia

IMPRENTA
NACIONAL
DIARIO OFICIAL Fundado el 30 de abril de 1864

Año CXLVIII No. 48.475 Edición de 36 páginas s Bogotá, D. C., jueves, 28 de junio de 2012 s I S S N 0122-2112

MINISTERIO DE AMBIENTE Y DESARROLLO SOSTENIBLE

RESOLUCIONES 2.1 Objetivo de la sustracción


$SDUWLUGHODLQIRUPDFLyQVXPLQLVWUDGDSRUSDUWHGHOSHWLFLRQDULRDWUDYpVGHOHV-
RESOLUCIÓN NÚMERO 0949 DE 2012 WXGLR³6XVWUDFFLyQ7HPSRUDOGHOÈUHDGH5HVHUYD)RUHVWDOGHO5tR0DJGDOHQDSDUDHO
SURJUDPDVtVPLFR'%ORTXH900´VHVROLFLWDODVXVWUDFFLyQWHPSRUDOGHKDODV
(junio 20) FXDOHVHTXLYDOHQDORVNPGHORQJLWXGGHOSURJUDPDVtVPLFR\XQEXIIHUGHPGH
por la cual se sustrae temporalmente un área de la Reserva Forestal del Río Magdalena la Reserva Forestal del Río Magdalena, requerido para implementar el programa sísmico
establecida mediante Ley 2ª de 1959 y se toman otras determinaciones. 2D, Bloque VMM-3.
El Director de Bosques, Biodiversidad y Servicios Ecosistémicos (e), en ejercicio de la &RQEDVHHQORVGDWRVVXPLQLVWUDGRVSRUSDUWHGHOSHWLFLRQDULRODXELFDFLyQGHOSROtJRQR
función delegada por el Ministro de Ambiente y Desarrollo Sostenible mediante Resolución VROLFLWDGRSDUDVXVWUDFFLyQVHHQFXHQWUDGHQWURGHODVVLJXLHQWHVFRRUGHQDGDV
número 0053 del 24 de enero de 2012, y Coordenadas de las líneas sísmicas localizadas en el área de Reserva Forestal
CONSIDERANDO: del Río Magdalena
Antecedentes NOMBRE INICIO FIN LONGITUD
TIPO
LÍNEA ESTE NORTE ESTE NORTE (Km)
Que la Dirección de Ecosistemas, hoy Dirección de Bosques, Biodiversidad y Servicios
Ecosistémicos, mediante memorando con Radicado número 8210-E2-9029 del 7 de mar-    
zo de 2012, se pronunció con relación a la petición de los términos de referencia para la    
sustracción del área correspondiente al Bloque VMM-3, para el desarrollo de un Programa  1.359.326,88 1.038.841,51 1.359.658,74
Sísmico 2D, presentado por el representante legal de la empresa Shell Exploration and /(1$ 1.037.666,32 1.358.397,38 1.038.120,12 1.358.884,46 
Production Colombia GMBH, Sucursal Colombia. Opcional 1.035.836,52 1.356.433,41 1.036.150,95 1.356.770,90
4XHPHGLDQWHR¿FLRFRQ5DGLFDGRQ~PHUR(GHOGHPDU]RGH 1.035.272,19 1.355.827,70 1.035.510,14 1.356.083,10
el representante legal de la Sociedad Shell Exploration and Production Colombia GMBH 1.034.791,91 1.355.312,21 1.035.181,53 1.355.730,40
Sucursal Colombia presentó la solicitud de: “Sustracción Temporal sobre la Reserva Forestal 1.038.896,11 1.359.731,85 1.038.441,97 1.360.032,97
11-LENA-319 1,32
del Río Magdalena del área requerida para la ejecución del proyecto denominado “Programa 1.035.273,59 1.362.133,74 1.034.628,48 1.362.561,47
de Adquisición Sísmica 2D en el Bloque VMM-3, localizado en los municipios de San Martín, 1.036.709,94 1.352.798,92 1.036.992,43 1.353.143,86
en el departamento del Cesar, Puerto Wilches y Rionegro en el departamento de Santander. 1.036.006,43 1.351.939,92 1.036.337,14 1.352.343,72
11-LENA-300 1,73
4XHFRQHOPHQFLRQDGRR¿FLRHOXVXDULRUHPLWLyHQDUFKLYRGLJLWDOHOHVWXGLRHODERUDGR 1.034.285,69 1.349.838,84 1.034.553,48 1.350.165,83
con base en los términos de referencia para sustracción temporal establecidos mediante 1.033.920,10 1.349.392,45 1.034.138,12 1.349.658,65
la Resolución número 0918 de 2011 y el otrosí al contrato de exploración y producción 11-LENA-305 1.042.433,21 1.368.037,71 1.044.374,62 1.366.234,38 2,65
VMM-3, y en medio físico el resto de documentación prevista en el artículo 6° de la citada 1.040.441,48 1.364.050,56 1.042.250,47 1.362.734,98
Resolución número 0918 de 2011. 11-LENA-307 1.034.082,04 1.368.675,42 1.034.752,13 1.368.188,10 4,1
Que por cuanto la Sociedad Shell Exploration and Production Colombia GMBH Su- Requerida 1.039.211,15 1.364.945,31 1.040.026,61 1.364.352,27
cursal Colombia, ha dado cumplimiento a los requisitos establecidos en el artículo 6° de la 1.039.817,92 1.361.110,94 1.040.098,08 1.360.929,29
Resolución número 0918 de 2011, se procede mediante Auto número 0008 del 14 de mayo 11-LENA-309 1.034.320,42 1.364.675,48 1.034.360,59 1.364.649,44 0,42
GHDLQLFLDUHOWUiPLWHGH6XVWUDFFLyQ7HPSRUDOGHXQDVXSHU¿FLHGHKHFWiUHDV 1.034.747,26 1.364.398,73 1.034.782,14 1.364.376,11
de la Reserva Forestal del Río Magdalena establecida mediante Ley 2ª de 1959, para la 11-LENA-311 1.037.409,86 1.358.589,88 1.037.638,65 1.358.385,82 0,31
ejecución del proyecto denominado “Programa de Adquisición Sísmica 2D en el Bloque 1.034.944,22 1.355.062,83 1.035.772,58 1.354.744,24
11-LENA-313 1,41
VMM-3”, localizado en los municipios de San Martín, en el departamento del Cesar, Puerto 1.036.386,81 1.354.507,99 1.036.873,21 1.354.320,92
Wilches y Rionegro en el departamento de Santander. 11-LENA-315 1.034.200,60 1.351.279,38 1.034.512,20 1.351.222,67 0,32
I. Fundamentos Técnicos Fuente: Shell Exploration & Production Colombia GMBH, sucursal Colombia. 2011.
Que la Dirección de Bosques, Biodiversidad y Servicios Ecosistémicos en ejercicio de 2.1.1 Localización del programa sísmico
la función establecida en el numeral 3 del artículo 16 del Decreto-ley 3570 de 2011, emitió (OSUR\HFWRHVWiORFDOL]DGRJHRJUi¿FDPHQWHHQORVPXQLFLSLRVGH6DQ0DUWtQGHSDU-
concepto técnico de viabilidad, con relación a la solicitud de sustracción temporal de un WDPHQWRGH&HVDU\ORVPXQLFLSLRVGH3XHUWR:LOFKHV\5LRQHJURHQHOGHSDUWDPHQWRGH
área de la Zona de Reserva Forestal del Río Magdalena, establecida mediante Ley 2ª de 6DQWDQGHU/DVXVWUDFFLyQWHPSRUDOSDUDHO3URJUDPD6tVPLFR'900VHXELFDDO
1959, en los siguientes términos: LQWHULRUGHOD5HVHUYD)RUHVWDOGHO5tR0DJGDOHQD\FRUUHVSRQGHDKDTXHHTXLYDOHQ
DORVNPGHORQJLWXGGHOSURJUDPDVtVPLFR\XQEXIIHUGHP
“(…) 2. Descripción del proyecto
2.1.2 Importancia de la actividad considerada de utilidad pública e interés social
(O%ORTXH900VHHQFXHQWUDHQPDUFDGRGHQWURGHOSROtJRQRTXHGH¿QHOD$JHQFLD
1DFLRQDOGH+LGURFDUEXURV$1+HOFXDOIXHDVLJQDGRDOD(PSUHVD6KHOO([SORUDWLRQ  $QLYHOORFDO\UHJLRQDOODHMHFXFLyQGHO3URJUDPDEULQGDUiFRQRFLPLHQWRVUHODFLRQDGRV
FRQHOSRWHQFLDOKLGURFDUEXUtIHURH[LVWHQWHHQHO%ORTXH900ORTXHHVPX\SURSLFLR
3URGXFWLRQ&RORPELD*0%+6XFXUVDO&RORPELD
GHQWURGHORVOLQHDPLHQWRVHVWUDWpJLFRVSDUDSURPRYHUODFRPSHWLWLYLGDG\HOFUHFLPLHQWR
El desarrollo del programa sísmico, de acuerdo con el peticionario, no generará de la productividad en el país, establecidos en el Plan Nacional de Desarrollo del actual
PRGL¿FDFLRQHVHQHOSDLVDMHRJHRIRUPDVSXHVWRTXHQRUHTXLHUHFRQVWUXFFLyQGHYtDVGH gobierno.
DFFHVRHLQIUDHVWUXFWXUDVSHUPDQHQWHV/RVFDPSDPHQWRV\]RQDVGHGHVFDUJD\DWHUUL]DMH
GHHPHUJHQFLDTXHVHDGHFXHQVHUiQFRQVWUXLGRVHQiUHDVGHSDVWRVOLPSLRVRHQPDOH]D- LA IMPRENTA NACIONAL DE COLOMBIA
GRVGRQGHQRVHUHPRYHUiQHVSHFLHVYHJHWDOHVFRQ'LiPHWURDOD$OWXUDGHO3HFKR '$3 
superiores a los 10 cm. Informa que como lo dispone el Decreto número 53 de ene-
La apertura de las líneas consiste en el desbroce manual del terreno para permitir el
SDVRGHODVSHUVRQDVDORODUJRGHFDGDOtQHDVREUHODFXDOVHDEUHXQDIUDQMDDQJRVWD\VH
ro 13 de 2012, artículo 3°, del Departamento Nacional de
PDUFDODXELFDFLyQGHORVSXQWRVGHGLVSDURJHyIRQRVHKLGUyIRQRV/DOtQHDVtVPLFDTXH Planeación, a partir del 1° de junio de 2012 los contratos
VHSUR\HFWDWHQGUiXQDQFKRGHPSHURSDUDHIHFWRVGHODVXVWUDFFLyQVHVROLFLWDQP estatales no requieren publicación ante la desaparición del
FRQHOSURSyVLWRGHSHUPLWLUXQUDQJRGHPRYLOLGDGHQHOFDVRGHHQFRQWUDUDOJ~QREVWiFXOR
que requiera el alineamiento de la misma.
Diario Único de Contratación Pública”.
Edición 48.475
2 DIARIO OFICIAL Jueves, 28 de junio de 2012

/D]RQDGHHVWXGLRVHHQFXHQWUDHQODFXHQFDGHO9DOOH0HGLRGHO0DJGDOHQDODFXDO
D I A R I O OFICIAL WLHQHORVVLJXLHQWHVOtPLWHVDOVXUHVWHHOVLVWHPDGH)DOODVGH%LWXLPD\/D6DOLQDDO1RUWH
HOVLVWHPDGHIDOODVGHO(VStULWX6DQWRDO2HVWHHORQODSGHVHGLPHQWRV1HyJHQRVVREUHOD
Fundado el 30 de abril de 1864
Por el Presidente Manuel Murillo Toro 6HUUDQtDGH6DQ/XFDV\HOEDVDPHQWRGHOD&RUGLOOHUD&HQWUDODOVXUHOFLQWXUyQSOHJDGR
GH*LUDUGRW\DO1RUHVWHHOVLVWHPDGHIDOODVGH%XFDUDPDQJD6DQWD0DUWD $1+ 
Tarifa postal reducida No. 56 2.3.1.1 Estratigrafía
DIRECTOR: HERNÁN RAMÓN GONZÁLEZ PARDO (QHOiUHDGHHVWXGLRVHHQFRQWUDURQGHSyVLWRVFXDWHUQDULRVJUDYRVRV\DUHQRDUFLOORVRV
4IDO \GHSyVLWRVDUFLOORORGRVRVDVRFLDGRVDODVFLpQDJDV 4À 
Cuaternario. Corresponden a sedimentos transportados y depositados por las corrientes
MINISTERIO DEL INTERIOR SULQFLSDOHVGHORVUtRV0DJGDOHQD\/HEULMD\DGLIHUHQWHVSURFHVRVGHVHGLPHQWDFLyQFRPR
IMPRENTA NACIONAL DE COLOMBIA ODDFUHFLyQODWHUDOODDFUHFLyQYHUWLFDORORVGHSyVLWRVGHÀXMRVDYDODQFKDV(QWpUPLQRV
JHQHUDOHVVHGLVWLQJXHQGHSyVLWRVTXHFRUUHVSRQGHQDGLIHUHQWHVDPELHQWHVGHGHSyVLWR\
HERNÁN RAMÓN GONZÁLEZ PARDO SURFHVRVVHGLPHQWDULRVFRPRORVGHSyVLWRVÀXYLRODFXVWUHV 4À \OODQXUDVGHLQXQGDFLyQ
Gerente General 4IDO 
Llanuras de inundación (Qfal). Comprenden arenas y lodos de colores gris a gris
Carrera 66 No 24-09 (Av. Esperanza-Av. 68) Bogotá, D. C. Colombia
Conmutador: PBX 4578000. oscuro, ocasionales paleocanales de gravas y cantos.
'HSyVLWRVÀXYLRODFXVWUHV 4À 6HHQFXHQWUDQGLVWULEXLGRVHQWRGDHOiUHDGHKXPH-
e-mail: correspondencia@imprenta.gov.co
dales, en ella predominan lodos de color oscuro con alto contenido de materia orgánica y
DUFLOODVJULVHV\DUHQDV¿QDV
2.3.1.2 Geología Estructural
2.1.3 Programa sísmico
De acuerdo con los datos aportados por parte del peticionario, regionalmente, el sistema
La longitud total del Programa sísmico 2D, es de 170,2 km distribuidos de la siguiente
GHIRUPDWLYRHVWiUHSUHVHQWDGRSRUXQDHVWUXFWXUDWUDQVSUHVLYDGH[WUDOGHGLUHFFLyQ1(WLSR
manera:
ÀRUSRVLWLYD(VWDHVWUXFWXUDJHRPpWULFDPHQWHHVDVLPpWULFDFRQODHVWUXFWXUDSULQFLSDO
‡1XHYH  OtQHDVVtVPLFDVUHTXHULGDVFRQXQDORQJLWXGWRWDOGHNPGHODVFXDOHV XELFDGDDORHVWHGHOVLVWHPDGHQRPLQDGD)DOOD/DV%ULVDVODFXDOHVGHFDUiFWHUGH[WUDO
OtQHDVFRQXQDORQJLWXGGHNPVHHQFXHQWUDQGHQWURGHOD5HVHUYD)RUHVWDOGHO +DFLDHORULHQWHHOVLVWHPDHYROXFLRQDDHVWUXFWXUDVVLQXRVDVGHFDUiFWHUGH[WUDOTXH
Río Magdalena. IRUPDQURWDFLRQHVKRUDULDVWtSLFDVGHFL]DOODVLPSOHHQXQDQFKRDSUR[LPDGRGHNP
‡&LQFR  OtQHDVVtVPLFDVRSFLRQDOHVFRQXQDORQJLWXGWRWDOGHNPGHODVFXDOHV /DVSULQFLSDOHVIDOODVKDQVLGRGH¿QLGDVFRPR/DV%ULVDV6LPLWt\6DQ%ODVXELFDGDV
solo dos (2) líneas se traslapan con la Reserva Forestal del Río Magdalena y de estas 10,23 IXHUDGHOiUHDGHLQÀXHQFLDGHOSUHVHQWHHVWXGLR(QHOiUHDREMHWRGHVXVWUDFFLyQVHHQFXHQWUD
NPGLVFXUUHQSRUOD5HVHUYD)RUHVWDO ODIDOODGH&DxDEUDYDOFRQRULHQWDFLyQ1(TXHSUHVHQWDGHVSOD]DPLHQWRUXPERGH[WUDO
2.2 Generalidades del programa sísmico 2.3.1.3*HRPRUIRORJtDGHOÈUHDGHLQÀXHQFLD
(OPpWRGRVtVPLFRHVXQSURFHGLPLHQWRJHRItVLFREDVDGRHQODUHÀH[LyQGHRQGDVDF~V- De acuerdo con el peticionario, el área de estudio se encuentra al interior de la cuenca
WLFDVRULJLQDGDVHQIRUPDDUWL¿FLDOTXHVHGHVSOD]DQDOLQWHULRUGHODWLHUUD3DUDHOFDVR GHO9DOOH0HGLRGHO0DJGDOHQD/DVLJXLHQWHWDEODPXHVWUDODVXQLGDGHVJHRPRUIROyJLFDV
GHHVWHSUR\HFWRHOWLSRGHVtVPLFDDGHVDUUROODUVHHVHQGRVGLPHQVLRQHV ' ODFXDO H[LVWHQWHVHQHOiUHDGHLQÀXHQFLDGHOSUR\HFWR
DSRUWDLQIRUPDFLyQHQXQVRORSODQR YHUWLFDO 
8QLGDGHVJHRPRUIROyJLFDVSUHVHQWHVHQHOÈUHDGHLQÀXHQFLD
/DWRPDGHLQIRUPDFLyQVtVPLFDHQHOWHUUHQRVHUHDOL]DDORODUJRGHOtQHDVXELFDGDV
VREUHHOiUHDGHO3URJUDPD6tVPLFRGLVSXHVWDVXVXDOPHQWHHQIRUPDGHPDOODVFRPSXHV- NOMBRE SÍMBOLO DESCRIPCIÓN
WDVGHOtQHDVSHUSHQGLFXODUHVHQWUHVt(OSURSyVLWRGHWUDEDMDUVREUHXQDOtQHDHVWHQHUOD Planicie aluvial abierta, susceptible a inundaciones periódicas debido
LQIRUPDFLyQGHOVXEVXHORHQGRVGLPHQVLRQHVSURIXQGLGDG\H[WHQVLyQODWHUDO Llanura Fluviolacustre LLFL a las conexiones hidráulicas entre el río Magdalena y el río Lebrija
y las ciénagas localizadas en esta llanura.
2.2.1 Etapas de desarrollo
Paisaje de planicie aluvial, susceptible a inundaciones, donde se
Etapa preoperativa. &RUUHVSRQGHDWRGDVODVDFWLYLGDGHVSUHYLDVDODLQVWDODFLyQGHO Llanuras Aluvial LLA
depositan sedimentos por desbordamiento lateral.
SURJUDPDVtVPLFRFRPRVRQODPRYLOL]DFLyQGHHTXLSRVPDWHULDOHV\SHUVRQDOLQIRUPD-
Fuente: Hidrosuelos, 2011.
FLyQ\FRPXQLFDFLyQDFRPXQLGDGHV\DXWRULGDGHVORFDOHVFRQWUDWDFLyQ\FDSDFLWDFLyQ
GHOSHUVRQDO VROLFLWXG GHSHUPLVRV FRQORVSURSLHWDULRVGHSUHGLRVJDUDQWL]iQGROHV OD Es importante resaltar que las actividades del programa sísmico 2D en el bloque VMM3
SURWHFFLyQGHORVUHFXUVRVQDWXUDOHV\UHFRQRFLPLHQWRGHGDxRVTXHVHSXGLHUHQRFDVLRQDU QRJHQHUDUiQYDULDFLRQHVHQODVXQLGDGHVJHRPRUIROyJLFDVGHELGRDTXHQRVRQQHFHVDULRV
\ODXELFDFLyQ\DGHFXDFLyQGHORVFDPSDPHQWRVEDVH\YRODQWHV movimientos de tierras para el desarrollo del proyecto.
Etapa Operativa. 4XHLQFOX\HODHMHFXFLyQGHODVVLJXLHQWHVDFWLYLGDGHVDSHUWXUDGH Morfodinámica. (QHOiUHDREMHWRGHOSUHVHQWHHVWXGLRHVWHWLSRGHIHQyPHQRVHURVLYRV
WURFKD\WRSRJUDItDHODERUDFLyQGHODSLFDHFROyJLFDRWURFKDTXLHEUHVGHOtQHDHQFDVR VHSUHVHQWDQHQVHFWRUHVPX\SXQWXDOHVORTXHKDFHTXHVXLQFLGHQFLDVHDEDMD(OWLSRGH
GHFUXFHVFRQiUHDVUHVWULQJLGDVRSHUDWLYD\RDPELHQWDOPHQWHHVWDEOHFLPLHQWRGH]RQDV HURVLyQTXHVHSUHVHQWDHVODPLQDUODFXDOHVSURGXFLGDSRUSUHFLSLWDFLRQHVGRQGHHODJXD
GHGHVFDUJXH\]RQDVGHDWHUUL]DMHGHHPHUJHQFLDSHUIRUDFLyQFDUJDGR\WDSRQDGRGH HMHUFHXQDIXHU]DGHDUUDVWUHVREUHODVXSHU¿FLHGHOVXHORGHVSUHQGLHQGRSDUWtFXODVGH
SR]RVGHWRQDFLyQ\UHJLVWUR\PDQHMR\GLVSRVLFLyQ¿QDOGHUHVLGXRVVyOLGRV\OtTXLGRV PDWHULDOPLQHUDOFX\RWDPDxRHVYDULDEOHDFUHFHQWDGRSRUODSpUGLGDGHFREHUWXUDYHJHWDO
Etapa Posoperativa. 8QDYH]¿QDOL]DGDVODVDFWLYLGDGHVGHODHWDSDRSHUDWLYDVHUHD- Densidad de drenaje. /RV UtRV 0DJGDOHQD \ /HEULMD SUHVHQWDQ XQ WLSR GH GUHQDMH
OL]DUiODHWDSDGHGHVPDQWHODPLHQWRGHWRGRVORVHTXLSRVHLPSOHPHQWRVODOLTXLGDFLyQGHO PHiQGULFR/RVUtRVPHQRUHV\ODVTXHEUDGDVDÀXHQWHVGHORVUtRVSULQFLSDOHVSUHVHQWDQ
SHUVRQDOUHTXHULGRODUHVWDXUDFLyQ\OLPSLH]DGHWRGDVODViUHDVDIHFWDGDVSRUODVOtQHDV GUHQDMHSDUDOHORORTXHVXJLHUHSHQGLHQWHVPRGHUDGDVEDMDFREHUWXUDYHJHWDO\FRQWURO
VtVPLFDVHOSDJRGHREOLJDFLRQHVOHJDOHV\ODUHSRVLFLyQSDJRGHLQGHPQL]DFLRQHVSRU HVWUXFWXUDORWRSRJUi¿FR
GDxRVFDXVDGRVODFODXVXUDGHORVVLVWHPDVGHWUDWDPLHQWRVGHUHVLGXRV\ODHODERUDFLyQ (OVHFWRUGHFLpQDJDVSUHVHQWDXQGUHQDMHODJXQDUTXHFRUUHVSRQGHD]RQDVQRWR-
GHOLQIRUPH¿QDO WDOPHQWHGHVDUUROODGDVVHFRPSRQHGHSHTXHxRVODJRVRFLpQDJDVHVSDFLDGDVGHIRUPD
2.2.2 Técnica y método de perforación GHVRUGHQDGD6HHQFXHQWUDQHQFXHQFDVGHSODQLFLHVFHUUDGDVHQiUHDVHQODVTXHORV
/D SHUIRUDFLyQ VH KDUi FRQ WUHLQWD SHUIRUDGRUHV PRWRUL]DGRV PDQXDOHV FXDUHQWD PDWHULDOHVGHVXSHU¿FLHVRQJHQHUDOPHQWHLPSHUPHDEOHV
SHUIRUDGRUHVWLSR+DQG$XJHUGULOOV\FXDWURSHUIRUDGRUHVPHFiQLFRVGRQGHHOÀXLGRGH (QOD]RQDGHOODQXUDDOXYLDOFRUUHVSRQGLHQWHDXQiUHDGHNP2 y una longitud
SHUIRUDFLyQHVDJXDHPSHURSDUDHVWHSUR\HFWRVHFRQWHPSODHOXVRGHXQWDODGURQHXPi- GHNPVHWLHQHXQDGHQVLGDGGHGUHQDMHLJXDODNPNP2(QOD/ODQXUDÀXYLR-
WLFRHQODHWDSDGHSHUIRUDFLyQ ODFXVWUHVHWLHQHXQDGHQVLGDGGHGUHQDMHGHNPNP2, en un área total de 130 km2 y
/RVGLiPHWURVGHORVSR]RVSHUIRUDGRVHVWDUiQHQWUHORV\FPDXQDSURIXQGLGDG FRQXQDORQJLWXGGHNP(QDPEDV]RQDVORVDOWRVYDORUHVGHGHQVLGDGLQGLFDQTXH
GHDPDOWRSHGHFDUJD1RVHXVDUiQDGLWLYRVTXtPLFRVHQORVORGRVGHSHUIRUDFLyQ VHWUDWDGHXQiUHDFRQDOWDGHQVLGDGGHGUHQDMH
\DTXHVyORVHXVDUiDJXD\EHQWRQLWDUHTXHULGDHQORVVHFWRUHVGRQGHVHSUHVHQWDQFRP- Hipsometría. Representa el relieve del terreno, en general comprende unidades de
SOLFDFLRQHVFRQODVSHUIRUDFLRQHVGDGDVODVFDUDFWHUtVWLFDVGHOWHUUHQR WRSRJUDItD SODQD FRQ PtQLPDV GLIHUHQFLDV GH DOWXUDV FRQ FRWDV PHQRUHV D  PVQP \
8QDYH]DELHUWDVODVOtQHDVVtVPLFDVHLGHQWL¿FDGDVODVHVWDFLRQHVGHORVSXQWRVGH pendientes comprendidas entre los 0 a 150.
GLVSDURHQODVOtQHDVODFXDGULOODLQLFLDUiODSHUIRUDFLyQGHORVKR\RVGRQGHVHFRORFDUiQ 2.3.2 Hidrogeología regional
SHTXHxDVFDUJDVH[SORVLYDV /DFDUDFWHUL]DFLyQKLGURJHROyJLFDGHOiUHDGHLQÀXHQFLDGHO%ORTXH900VHUHDOL]y
&XDQGRVHXWLOL]DHOWDODGURKLGUiXOLFRSDUDKDFHUODSHUIRUDFLyQ\PLQLPL]DUHOFRQVXPR PHGLDQWHODUHYLVLyQGHLQIRUPDFLyQVHFXQGDULD\ODUHDOL]DFLyQGHFLQFRVRQGHRVHOpFWUL-
GHDJXDVHGHEHUiQUHDOL]DUFRQWUDSR]RVORVFXDOHVFRQVLVWHQHQODKHFKXUDGHKXHFRV FRVYHUWLFDOHVFRQXQ$%GHPHWURVTXHSHUPLWLHURQHVWDEOHFHUXQHVWLPDWLYRGHOD
GHXQDSURIXQGLGDGDSUR[LPDGDDFP3RVWHULRUDODSHUIRUDFLyQGHORUL¿FLRGRQGHVH SRWHQFLDOLGDGGHORVDFXtIHURVSUHVHQWHV
SODQWDUiODIXHQWHGHHQHUJtDHOFRQWUDSR]RGHEHUiVHUWDSDGRFRQWLQXDQGRVXFHVLYDPHQWH 3DUDOD]RQDGHHVWXGLRVHGHWHUPLQDURQWUHVXQLGDGHVGHDFXtIHURV
HOSURFHVRGXUDQWHORVUHVWDQWHVSXQWRVDSHUIRUDU (ODFXtIHUROLEUH±1LYHO$$UHSUHVHQWDGRSRUDUHQDVFRQLQWHUFDODFLRQHVSRFRIUH-
2.3 Componente físico FXHQWHVGHDUFLOODPX\VXSHU¿FLDOFRQXQDSURIXQGLGDGGHDP\XQHVSHVRUKDVWD
2.3.1 Geología Regional P(VWiDVRFLDGRDORVVHGLPHQWRVGHGHSyVLWRVDOXYLDOHV\SUHVHQWDXQDYXOQHUDELOLGDG
'HDFXHUGRFRQHOSHWLFLRQDULRHQHOiUHDGHLQÀXHQFLDGHOSUR\HFWROD]RQDGHHVWXGLR DOWDDODFRQWDPLQDFLyQ
VHORFDOL]DHOLQWHULRUGHODFXHQFDGHO9DOOHPHGLRGHO0DJGDOHQDGRQGHVHSUHVHQWDQGRV (ODFXtIHURVHPLFRQ¿QDGR±1LYHO$$FRQVWLWXLGRSRUDUHQDVLQWHUFDODGDVFRQDUFLOODV
UHJLRQHVQDWXUDOHVFRPRVRQODVHVWULEDFLRQHVRULHQWDOHVGHOD6HUUDQtDGH6DQ/XFDV\ \JUDYDVFRQXQHVSHVRUGHP\TXHUHSUHVHQWDODXQLGDGGHPD\RULQWHUpVSRUVX
el Valle del Río Magdalena. Las rocas constituyentes del área, a nivel regional, abarcan FRQWLQXLGDGOLWRORJtD\HVSHVRUDGHPiVGHVXDPSOLDH[SORWDFLyQ3UHVHQWDXQDYXOQHUD-
XQUHJLVWURGHWLHPSRJHROyJLFRFRPSUHQGLGRGHVGHHO7ULiVLFR-XUiVLFRKDVWDGHSyVLWRV ELOLGDGEDMDDODFRQWDPLQDFLyQ
LQFRQVROLGDGRVGHO&XDWHUQDULR(OVREUHVDOLHQWHUHOLHYHPRQWDxRVRFRQDOWXUDVPi[LPDV (ODFXtIHURVHPLFRQ¿QDGR±1LYHO$$5FRQVWLWXLGRSRUDUHQDVFRQLQWHUFDODFLRQHV
FHUFDQDVDORVPVQPVHGH¿QHQHQOD6HUUDQtDGH6DQ/XFDVHQWUHWDQWRORVYDOOHVGHO IUHFXHQWHVGHDUFLOODVLQXQHVSHVRUGHWHUPLQDGR\FRQSURIXQGLGDGHVPD\RUHVGHP
0DJGDOHQD\/HEULMDFRQIRUPDQOD]RQDSODQD\FHQDJRVDGRPLQDQWHFRQDOWXUDVFRP- HOFXDOSRGUtDWHQHUDOJ~QLQWHUpVKLGURJHROyJLFRDXQTXHORVQLYHOHVDUFLOORVRVGLVPLQX\HQ
prendidas entre los 50 a 100 msnm. ODSURGXFWLYLGDG3UHVHQWDXQDYXOQHUDELOLGDGEDMDDODFRQWDPLQDFLyQ
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 3
Inventarios de puntos de agua. La siguiente tabla presenta el inventario de puntos de 2.3.3.2 Suelos de Paisaje de planicie aluvial
DJXDHQHOiUHDGHLQÀXHQFLDGHOSUR\HFWR Asociación El Cántaro ECa. 6HXELFDQHQWHUUD]DVGHQLYHOPHGLRHQDOWLWXGHVHQWUHORV
Coordenadas Localización \PFOLPDFiOLGRK~PHGRUHOLHYHSODQRFRQSHQGLHQWHVPHQRUHVDO3UHGRPLQD
Pozos Observaciones
Norte Este (veredas) ODYHJHWDFLyQKHUEiFHD6XXVRHVWiUHVWULQJLGRDSRWUHURV\XQDJUDQ]RQDDFXOWLYRVGH
La comunidad cuenta con un tanque de agua altura SDOPDDIULFDQDVHHQFXHQWUDQSHTXHxRVERVTXHV\iUEROHVGLVSHUVRV
Pz01 1363007 1046172 Vereda Terraplén de 12 m, con capacidad de distribución de agua para
una población de 300 personas.
Asociación Lebrija LBaz. 6HXELFDQHQODVFXEHWDVTXHSHUPDQHFHQLQXQGDGDVSRU
PiVGHPHVHVDODxRFOLPDFiOLGRK~PHGR\DOWLWXGPHQRUDPVXUHOLHYHHVFyQFDYR
La comunidad cuenta con tanques de agua ubicados
Pz02 1359438 1039208 Vereda Salinas
en el centro de la vereda. \FRQSHQGLHQWHVPHQRUHVDO6RQVXHORVVXSHU¿FLDOHVOLPLWDGRVSRULQXQGDFLRQHV\
Cuenta con una bomba eléctrica para impulsar el DUFLOODV¿QDVTXHUHVWULQJHQHOXVRDYHJHWDFLyQGHSDQWDQR\DJDQDGHUtDHQSHULRGRVVHFRV
Pz03 1359128 1039157 Vereda Puerto Oculto
agua del pozo hacia el tanque distribuidor. Asociación Marquetalia MAax. (VWiQXELFDGRVHQDOWLWXGHVPHQRUHVDPFOLPD
Pz04 1341545 1047631 Finca El Edén
Pozo subterráneo para el consumo, riego y crianza FiOLGRK~PHGRVXUHOLHYHHVOLJHUDPHQWHFRQYH[RFRQSHQGLHQWHVPHQRUHVDOVXMHWDV
de animales (ganado). D LQXQGDFLRQHV HQ pSRFDV GH OOXYLD 6XHORV VXSHU¿FLDOHV D PRGHUDGDPHQWH SURIXQGRV
Fuente: Hidrosuelos, 2011. OLPLWDGRVSRUHOQLYHOIUHiWLFRGHGLFDGRVDODJDQDGHUtD\FXOWLYRVGHVXVEVLVWHQFLD
&ODVL¿FDFLyQKLGURJHROyJLFD/DVXQLGDGHVJHROyJLFDVVHDJUXSDQGHDFXHUGRFRQVX
Asociación Sogamoso SOax y SOay. Corresponde a las napas de desborde del río
LPSRUWDQFLDKLGURJHROyJLFDGHODVLJXLHQWHPDQHUD
0DJGDOHQDHQWUHORVDPGHDOWLWXGFOLPDFiOLGRK~PHGRVXUHOLHYHHVSODQRFRQ
‡ ,PSRUWDQFLD KLGURJHROyJLFD DOWD FRUUHVSRQGH FRQ ORV GHSyVLWRV GH OODQXUD DOXYLDO
SHQGLHQWHVPHQRUHVDOLQXQGDEOHVHQIRUPDSHULyGLFD\SURORQJDGD/DYHJHWDFLyQ
4IDO \VXOLWRORJtDDVRFLDGDFRQFDSDVGHJUDQR¿QRDJUXHVRORVFXDOHVVHFRQVWLWX\HQ
en los niveles acuíferos AA1, AA2 y AAR1. QDWXUDOVHUHSDUWHHQWUHDUEyUHD\KHUEiFHDVXXVRSULQFLSDOVRQSRWUHURV\FXOWLYRVGH
DUUR]PDt]\IUXWDOHV
‡ ,PSRUWDQFLD KLGURJHROyJLFD EDMD DJUXSD ODV XQLGDGHV ]RQD GH LQ¿OWUDFLyQ \ ]RQD
YDGRVD(VWDVURFDVSUHVHQWDQSHUPHDELOLGDGYDULDEOH\VXFODVL¿FDFLyQVHGHEHDTXHQR Asociación La Reforma LRax. Corresponde a los diques naturales del río Magdalena,
conforman sistemas acuíferos sino que corresponden con niveles no saturados. HQWUHORVDPGHDOWLWXGDQLYHOPRUIROyJLFRSUHVHQWDIDMDVGHDPSOLWXGYDULDEOH
Zonas de Recarga. /DUHFDUJDVHSUHVHQWDHQODV]RQDVSODQDVFXELHUWDVGHYHJHWD- SODQDVOLJHUDPHQWHFyQFDYDVSDUDOHODV\FRQWLJXDVDOFDXFHFRQSHQGLHQWHVPHQRUHVDO
FLyQGRQGHODSHUPHDELOLGDGGHOVXHORHVPD\RU\HQGRQGHHODJXDSUHFLSLWDGDFRQIRUPD HLQXQGDELOLGDGHQWUHORV\PHVHV/DSURIXQGLGDGHIHFWLYDHVSUHGRPLQDQWHPHQWH
HQFKDUFDPLHQWRVTXHDODSRVWUHHVFXUUHQVXSHU¿FLDOPHQWH$VLPLVPRHVWRVDFXtIHURVVH PRGHUDGD/DYHJHWDFLyQQDWXUDOHVGHWLSRKHUEiFHD\HOXVRHVSUHGRPLQDQWHPHQWHJD-
UHFDUJDQSRUODHVFRUUHQWtDGHODVSULQFLSDOHVFRUULHQWHVKtGULFDVGHO%ORTXHHVSHFLDOPHQWH QDGHURDXQTXHWDPELpQDJUtFRODHQPHQRUSURSRUFLyQ
GHORVUtRV0DJGDOHQD\/HEULMD Complejo Santa Teresa STay y STaz. $EDUFDVXHORVHTXLGLVWDQWHVHQWUHHOUtR/HEULMD\
Zonas de Descarga. (VWiFRQIRUPDGDSRUORVSR]RVGHDJXDVXEWHUUiQHDTXHVHDEDV- 0DJGDOHQDFRQDOWXUDVHQWUHORVDPVRQVXHORVGHVXSHU¿FLHSODQDEDMDVXUFDGD
WHFHQODVFRPXQLGDGHVHPSOD]DGDVHQFHUFDQtDVDOUtR/HEULMD3DUDHOiUHDGHHVWXGLROD SRUQXPHURVRVFDxRV/RVVXHORVVRQVXSHU¿FLDOHV\PX\VXSHU¿FLDOHVHQODVSDUWHVEDMDV
]RQDGHGHVFDUJDQDWXUDOVRQORVUtRV0DJGDOHQD\/HEULMD VXGUHQDMHPiVSREUHTXHLPSHUIHFWR/DIHUWLOLGDGRVFLODHQWUHYDORUHVEDMRVDPRGHUDGRV
(VLPSRUWDQWHVHxDODUTXHORVHÀXHQWHVDOVXHORTXHVRQGHVFDUJDGRVHQODV]RQDVPiV
DOWDVWLHQHQXQPHQRUULHVJRGHDOFDQ]DUHODFXtIHURGHELGRDODSURIXQGLGDGGHOQLYHO Consociación Candelaria CNay y CNaz. $EDUFDODVFXEHWDVGHGHFDQWDFLyQGHORV
IUHiWLFRHQWUHWDQWRHQODV]RQDVEDMDVHOULHVJRGHFRQWDPLQDFLyQGHHVWRVDFXtIHURVHV UtRV0DJGDOHQD\/HEULMDFRQDOWXUDVHQWUHORVDPVXFOLPDHVFiOLGRK~PHGR
PD\RU1RREVWDQWHGHDFXHUGRFRQODLQIRUPDFLyQVXPLQLVWUDGDSRUHOSHWLFLRQDULROD SUHVHQWDQVXSHU¿FLHVEDMDVUHOLHYHSODQRFyQFDYR\SHQGLHQWHVPHQRUHVGHOLQXQGDEOHV
YXOQHUDELOLGDGGHFRQWDPLQDFLyQGHORVDFXtIHURVHQHOiUHDGHVXVWUDFFLyQGHO%ORTXH SHULyGLFDPHQWHSRUGHVERUGDPLHQWRVSRUHVFRUUHQWtDGHVGHODV]RQDVDOWDV6XSURIXQGLGDG
900HVGHEDMDDGHVSUHFLDEOH HIHFWLYDHVVXSHU¿FLDOFRQXQQLYHOIUHiWLFRDOWR(OGUHQDMHQDWXUDOVHUHGXFHGHSREUHD
2.3.3 6XHORVÈUHDGHLQÀXHQFLD PX\SREUH3ULPDODYHJHWDFLyQDUEXVWLYD\KHUEiFHD\VXXVRVHOLPLWDDOSDVWRUHR
'HDFXHUGRFRQODLQIRUPDFLyQVXPLQLVWUDGDSRUSDUWHGHOSHWLFLRQDULRODVLJXLHQWH 2.3.3.3 Uso actual del suelo
WDEODKDFHODGHVFULSFLyQGHORVVXHORVSUHVHQWHVHQHOiUHDGHLQÀXHQFLDGHOSUR\HFWR En el área del Bloque VMM3 se desarrolla primordialmente la actividad agropecuaria,
PAISAJE SÍMBOLO SUELO CARACTERÍSTICAS FRQHOHVWDEOHFLPLHQWRGHODJDQDGHUtDH[WHQVLYD\ODDJULFXOWXUDGHDXWRFRQVXPRSHVHD
6XSHU¿FLHV GHQXGDWLYDV SODQDV OLJHUDPHQWH LQ- TXHHQODUHVHUYDODDSWLWXGSULRULWDULDGHOVXHORHVODIRUHVWDO'HKHFKRD~QVHSUHVHQWDQ
7\SLF(XWURSHSW clinadas, sinuosas en sentido transversal. Suelos IUDJPHQWRVGHERVTXHQDWXUDOHQiUHDVTXHWRGDYtDQRKDQVLGRVXVWLWXLGDVSRUFXOWLYRV
3,('(0217( 36DE 7\SLF7URSRUWKHQW moderadamente profundos, ligeramente ácidos, permanentes y potreros.
$HULF+DODTXHSW fertilidad media a baja, erosión ligera, pedregosidad
sectorizada y generalmente bien drenados. $FWXDOPHQWHHOiUHDVHHQFXHQWUDPX\LQWHUYHQLGDFRQXQHYLGHQWHFDPELRHQODFR-
SOax Fluvaquentic Eutro- Zonas amplias de relieve plano que a veces EHUWXUDYHJHWDORULJLQDOGRQGHODVXQLGDGHVGHFREHUWXUDHVWiQIRUPDGDVSULQFLSDOPHQWH
pept colindan con el cauce menor. Inundabilidad pe- SRUSDVWRVOLPSLRV\HQPDOH]DGRVKHUED]DOHVGHQVRVERVTXHVIUDJPHQWDGRVPRVDLFRVGH
Typic Tropaquept riódica, acumulación de materiales por desborde. pastos y áreas naturales.
SOay 3URIXQGLGDG VXSHU¿FLDO D PRGHUDGD GRPLQD HO
Vertic Tropaquept drenaje imperfecto, reacción fuertemente ácida a $SWLWXGGHXVRGHOVXHORiUHDGHLQÀXHQFLD
7URSRÀXYHQW ligeramente alcalina. (QHOiUHDGHVXVWUDFFLyQIRUHVWDOVHSUHVHQWDQFODVHVFRQHOPLVPRJUDGRGHOLPLWD-
CNay 6RQVXSHU¿FLHVEDMDVFRQUHOLHYHSODQRFyQFDYR FLRQHVSDUDXWLOL]DFLyQVRVWHQLGD/DVFODVHVVHGLYLGHQHQWLHUUDVDUDEOHV FODVHV,,\,9 
inundables periódicamente, por desbordamientos
\QRDUDEOHV FODVHV9D9,,, 
de la escorrentía desde las partes altas y principal-
Vertic Fluvaquent
CNaz mente por ascenso del nivel freático. Profundidad /DVLJXLHQWHWDEODSUHVHQWDODVFODVHVGHDSWLWXGGHXVRGHOVXHORHQHOiUHDGHLQÀXHQFLD
VXSHU¿FLDOGUHQDMHJHQHUDOSREUHDOWDFRQVLVWHQFLD del proyecto.
fertilidad baja.
Formas plano-cóncavas con encharcamientos. NOMBRE SUBCLASE $37,78''(862
Vertic Tropaquent
6XHORV PX\ VXSHU¿FLDOHV KLGURPyU¿FRV OLJH- 3RWUHURVFRQSDVWRVQDWXUDOHVRDUWL¿FLDOHVDQJOHWRQHOHIDQWHSXQWHURDGHPiV
LBaz Aeric Tropic Flu- ramente alcalinos, fertilidad baja, pobres a muy ,,K de pará y alemán, en las áreas que permanecen húmedas. Entre los cultivos
vaquent pobremente drenados. están maíz, plátano y yuca.
Clase II
Fajas amplias de relieve plano, ligeramente con- 3RWUHURVFRQSDVWRVQDWXUDOHVRDUWL¿FLDOHVURWDFLyQGHSRWUHURV&XOWLYRVGH
PLANICIE Fluvaquentic Eutro- vexo, paralelo y contiguo a los cauces de los ríos. IIsh maíz, yuca, arroz, plátano, guineo y frutales. Se recomienda el uso de variedades
ALUVIAL LRax pept Experimenta inundaciones periódicas. Profundidad mejoradas y resistentes, la rotación de cultivos.
7URSRÀXHYHQW moderada, drenaje moderado a imperfecto, reacción 3DVWRV QDWXUDOHV \ DUWL¿FLDOHV SDUD JDQDGHUtD H[WHQVLYD D VHPLLQWHQVLYD \
ligeramente alcalina y fertilidad baja a moderada. Clase III IIIh
cultivos de yuca, maíz, patilla y cítricos.
STay Áreas planas surcadas por muchos caños y diques. %RVTXHVSDVWRVQDWXUDOHV\DUWL¿FLDOHV\FXOWLYRVGHVXEVLVWHQFLDHQORVSH-
Aeric Fluvaquent, Permanente hidromorfismo, acumulación de Clase IV IVh
ríodos libres de inundación
Tropic Fluvaquent y materiales que rellenan cauces y zonas cóncavas.
STaz Pastoreo estacional sobre pasto canutillo y otras gramas naturales. Protección
Vertic Fluvaquent 3URIXQGLGDG VXSHU¿FLDO GUHQDMH SREUH UHDFFLyQ Clase V Vh
de los cauces con vegetación natural, la cual ayuda a controlar las inundaciones.
moderada a muy fuertemente ácida y fertilidad baja.
Bosques, pastos adaptados a la acidez, con prácticas de conservación para
Formas ligeramente planas, convexas y alargadas.
Clase VI VIs HYLWDUODHURVLyQIUXWDOHVFDFDRSDVWRUHRFRQWURODGR(QODVXQLGDGHVGHFOLPD
Aquic Eutropept 6XHORVVXSHU¿FLDOHVDPRGHUDGDPHQWHSURIXQGRV
MAax medio se puede plantar café con sombrío.
7URSRÀXYHQW QLYHOIUHiWLFRÀXFWXDQWHQHXWURVDDOFDOLQRVIHUWL-
lidad media e imperfectamente drenados. Unidades para bosque productor o protector. En áreas de menor pendiente
VIIes
se pueden cultivar frutales. No es recomendable la actividad agropecuaria.
Oxic Distropept 6XSHU¿FLHJHQHUDOPHQWHDPSOLDFRQRQGXODFLRQHV Clase VII
suaves. Profundidad generalmente moderada, dre- 3URWHFFLyQGHÀRUD\IDXQDVHSXHGHUHDOL]DUSHVFDFRQWURODGDFXDQGRSHU-
ECa Typic Distropept VIIh
naje desde bueno hasta imperfecto, reacción muy manecen inundadas.
Aquic Haplorthox fuertemente ácida y fertilidad muy baja. VIII VIII 3URWHFFLyQGHÀRUD\IDXQD
P Suelos Pantanosos Fuente: Estudio de suelos IGAC (1980 y 1986)
Fuente: IGAC, 1980 y 1986. 2.3.3.5&RQÀLFWRVGHXVRGHOVXHORHQHOiUHDGH,QÀXHQFLD
2.3.3.1 Suelos de Paisaje de Piedemonte (QWpUPLQRVJHQHUDOHVORVFRQÀLFWRVGHXVRTXHVHKDQLGHQWL¿FDGRHQHOiUHDKDQVLGR
Asociación Paso PSab1. (VWiQ ORFDOL]DGRV HQ ORV DEDQLFRV DOXYLDOHV FOLPD FiOLGR SURSLFLDGRVSRUODGHIRUHVWDFLyQGHiUHDVERVFRVDVFRPRFRQVHFXHQFLDGHODH[SDQVLyQGH
K~PHGR\DOWLWXGPHQRUDPVXUHOLHYHHVSODQRDLQFOLQDGR\FRQSHQGLHQWHVPHQRUHV ODIURQWHUDDJUtFROD\JDQDGHUD(VWRVVXHORVGHDSWLWXGIRUHVWDODOVHUHPSOHDGRVHQDFWL-
DOSUHVHQWDQHURVLyQOLJHUD\HVWiQGHGLFDGRVDODJDQDGHUtDH[WHQVLYD\DSHTXHxRV YLGDGHVDJUtFRODVJHQHUDQEDMDSURGXFWLYLGDG\FRPSHWLWLYLGDGGHVXVSURGXFWRVDGHPiV
FXOWLYRVGHPDt]VRUJR\DOJRGyQ GHODVDIHFWDFLRQHVDPELHQWDOHVTXHVHGHULYDQSRUVXXVRLQDSURSLDGR
Edición 48.475
4 DIARIO OFICIAL Jueves, 28 de junio de 2012

2WURWLSRGHFRQÀLFWRVHUHODFLRQDFRQODVXEXWLOL]DFLyQGHODVWLHUUDVDFWXDOPHQWHGHV- COMPONENTE ENE FEB MAR ABRI MAY JUN JUL AGO SEPT OCT NOV DIC ANUAL
WLQDGDVSDUDJDQDGHUtDTXHWLHQHQXQDYRFDFLyQDJUtFRODRFDVLRQDQGRODVXEXWLOL]DFLyQ PRECIPITACIÓN 19,3  93,3  290,7  219,2   251,7   2092
HLQH¿FLHQFLDHQHOXVRGHORVUHFXUVRV$VLPLVPRODVTXHPDVYLHQHQDIHFWDQGRiUHDVGH EVAPOTRANSPIRACIÓN    150,5 152,1   152,5   137,5  
ERVTXH\SURSLFLDQODGHVHUWL]DFLyQGHOWHUUHQRDOSURSLFLDUXQDSpUGLGDLPSRUWDQWHGHOVXHOR EXCESO 0 0 0         0 703,7
DÉFICIT    0 0 0 0 0 0 0 0  
Hidrología
Fuente: Geocol Consultores S. A.
(OiUHDGHLQÀXHQFLDIXHGH¿QLGDFRQVLGHUDQGRODUHGKLGURJUi¿FDODVIXHQWHVKtGULFDV
GHWLSROpQWLFR\OyWLFRHOiUHDGHOD5HVHUYD)RUHVWDOGHO5tR0DJGDOHQD\ODVQXHYHOtQHDV &ODVL¿FDFLyQFOLPiWLFD'DGDVODVFDUDFWHUtVWLFDVYDULDEOHVGHHOHYDFLyQSUHFLSLWDFLyQ
VtVPLFDVTXHODFRQIRUPDQ(OVLVWHPDKLGUROyJLFRHVWiGHWHUPLQDGRSRUODVXEFXHQFDGHO \JUDGRGHKXPHGDGGHELGRDODORFDOL]DFLyQGHODVHVWDFLRQHVFOLPDWROyJLFDVXWLOL]DGDV
5tR/HEULMDPLFURFXHQFDVGHO&DxR*UDQGH\&DxR9LHMR\HO&RPSOHMRFHQDJRVRODV VHWLHQHTXHHOFOLPDHQHOiUHDGHVXVWUDFFLyQGHO%ORTXH900VHJ~Q&DOGDV/DQJHV
cuales determinan la dinámica del área. HOFOLPD&iOLGR6HPLK~PHGR &VK \DTXHHVHOGHPD\RULQÀXHQFLDGHDFXHUGRFRQORV
UHVXOWDGRVGHORVDQiOLVLVGHFODVL¿FDFLyQFOLPiWLFD
Sistemas lóticos. 'HQWURGHORVVLVWHPDVOyWLFRVHVWDEOHFLGRVHQHOiUHDVHHQFXHQWUDQ %LRGLYHUVLGDGHQiUHDGHLQÀXHQFLD
&XHQFDVXSHULRUGHO5tR/HEULMD6LWXDGDHQODSDUWH1RURULHQWDOGHOGHSDUWDPHQWRGH Flora
6DQWDQGHUVXFDXFHHVPDQGULIRUPH\EUDTXLDGRHOFXDOLQWHUVHFWDODOtQHDVtVPLFD (OiUHDGHLQÀXHQFLDSDUDODVXVWUDFFLyQGHOSURJUDPDVtVPLFR900FRUUHVSRQGH
/(1$\VHHQFXHQWUDHQOD9HUHGD/D0RQWDxLWDEDMDGHOPXQLFLSLRGH3XHUWR:LOFKHV DXQ%RVTXHK~PHGRWURSLFDO %K7 GHDFXHUGRFRQODV]RQDVGHYLGDVGH+ROGULGJHFRQ
&DxR9LHMR. Es un cuerpo de agua de tipo meándrico y cuyas aguas desembocan en el Río GRVSURYLQFLDVGHKXPHGDGVHPLK~PHGRFRUUHVSRQGLHQWHD]RQDVK~PHGDVGHERVTXHV
/HEULMDVHLQWHUVHFWDFRQODVOtQHDVVtVPLFDV/(1$/(1$\/(1$ FODURV\VHPLiULGRFRUUHVSRQGLHQWHD]RQDVK~PHGDVGHHVWHSD\RVDEDQD
&DxR*UDQGH3UHVHQWDXQSDWUyQGHGUHQDMHDQDVWRPRVDGRWtSLFRGHOODQXUDVGHLQXQ- /RVELRPDVSUHVHQWHVHQHOiUHDGHLQÀXHQFLDGHODVXVWUDFFLyQWHPSRUDOGHO3URJUDPD
GDFLyQDPSOLDV6HHQFXHQWUDHQGLUHFFLyQVXURHVWHGHOEORTXHGRQGHVHLQWHUVHFWDFRQOD 6tVPLFRVRQGHGRVWLSRVORV]RQRELRPDVTXHFRUUHVSRQGHQDELRPDV]RQDOHVGHOLPLWD-
OtQHD/(1$HQOD9HUHGD0RQWDxLWDEDMD\HQODSDUWHRFFLGHQWDOHQVXFUXFHFRQ GRVSRUDPSOLRV\SHFXOLDUHVFDUDFWHUHVFOLPiWLFRVHGi¿FRV\GHYHJHWDFLyQ]RQDO\ORV
ODOtQHDV/(1$\/(1$HQOD9HUHGD&DxR*UDQGH KHOLRELRPDVTXHVRQELRPDVD]RQDOHVGRQGHORVSURFHVRVHFROyJLFRVHVWiQGLUHFWDPHQWH
LQÀXHQFLDGRVSRUODVFRQGLFLRQHVHGi¿FDVHKLGUROyJLFDVHLQGLUHFWDPHQWHSRUODVFOLPi-
Sistemas lénticos. (QHOiUHDGHVXVWUDFFLyQ7HPSRUDO900'ORVVLVWHPDVOpQWLFRV WLFDVGLVSRQHGHVXHORVFRQPDOGUHQDMHHQFKDUFDPLHQWRSHUPDQHQWHRFRQSURORQJDGR
TXHODFRQIRUPDQVRQODV&LpQDJDV&DxR*UDQGH/D)DQJXD/DUJD*UDQGH*DODSDJRV SHULRGRGHLQXQGDFLyQ
0DFKR/D/DJXQD/D&RQVXOWD\GRVVLQQLQJ~QQRPEUH (QHOiUHDGHLQÀXHQFLDGHODVXVWUDFFLyQVHHQFXHQWUDQORVVLJXLHQWHVELRPDV
'H DFXHUGR FRQ HO SHWLFLRQDULR QR VH UHDOL]DUiQ LQWHUYHQFLRQHV VREUH ORV FXHUSRV =RQRELRPDK~PHGRWURSLFDOGHO0DJGDOHQD&DULEH&XEUHHOGHOiUHDGHLQ-
GHDJXDGH¿QLGRVVREUHORVFUXFHVGHODVOtQHDVVtVPLFDVSRUORWDQWRQRVHSUHVHQWDUiQ ÀXHQFLDGHODVFXDOHVKDHVWiQUHSUHVHQWDGDVSRUFREHUWXUDVYHJHWDOHVPLHQWUDVTXH
DIHFWDFLRQHVDOUHFXUVRKtGULFRGHULYDGDVGHOSUR\HFWR ODVUHVWDQWHVKDVHHQFXHQWUDQFXELHUWDVSRUWHUULWRULRVDUWL¿FLDOHV\FXHUSRVGHDJXD
8VRV\FRQVXPRGHODVIXHQWHVKtGULFDV'HQWURGHOiUHDGHVXVWUDFFLyQVHSUHVHQWD 6XFDUDFWHUtVWLFDSULQFLSDOHVHOSUHGRPLQLRGHOFOLPDFiOLGRK~PHGR6HHQFXHQWUDVREUH
XQDDOWDGHQVLGDGGHUHFXUVRVKtGULFRVTXHVRQHPSOHDGRVSRUODSREODFLyQSDUDFRQVXPR ODXQLGDGJHRPRUIROyJLFDGHSODQLFLHVDOXYLDOHV\VHSUHVHQWDHQHOFRVWDGRRULHQWDOGHO
KXPDQRGRPpVWLFR\DFWLYLGDGHVDJURSHFXDULDV3RURWUDSDUWHVHLGHQWL¿FDODSHVFDFRPR iUHDGHLQÀXHQFLDHQFHUFDQtDVGHOUtR/HEULMDFXEULHQGRWLHUUD¿UPHHQVXPD\RUSDUWH
XQDLPSRUWDQWHDFWLYLGDGHFRQyPLFDHQOD]RQD /DVLJXLHQWHWDEODFRPSHQGLDODVFREHUWXUDVYHJHWDOHVHQHO=RQRELRPDK~PHGRWURSLFDO
2IHUWDKtGULFDVXSHU¿FLDOWRWDOPara determinar el rendimiento medio mensual mul- del Magdalena-Caribe.
WLDQXDOVHWXYRHQFXHQWDORVFDXGDOHVGHODHVWDFLyQOLPQLPpWLFDGHO,'($0(O&RQWHQWR\ ÁREA PORCEN
GRAN BIOMA BIOMA COBERTURA VEGETAL
HOiUHDGHODFXHQFDGHO9DOOH0HGLRGHO0DJGDOHQDHOFXDOSDUDHOiUHDHVGH/VNP2. KD TAJE
8QDYH]REWHQLGRVORVUHQGLPLHQWRVGHOD(VWDFLyQ(O&RQWHQWR&RUULHQWHGHO0DJGDOHQD =RQRELRPD K~- %RVTXHIUDJPHQWDGR  5,55
Gran bioma de Bos- +HUED]DOGHQVR  
VHJHQHUDORVFDXGDOHVFDUDFWHUtVWLFRVGHODVFRUULHQWHVGHLQWHUpVGHOÈUHDGHO3URJUDPD TXH +~PHGR 7UR-
medo tropical
6tVPLFR'%ORTXH900SDUDODVFXHQFDVGHOiUHDGHLQÀXHQFLDGLUHFWD 5tR/HEULMD \ pical
del Magdalena Mosaico de pastos en espacios naturales  
- Caribe
HOiUHDGLUHFWDDVXVWUDHU &DxR9LHMR  9HJHWDFLyQDFXiWLFDVREUHFXHUSRGHDJXD  
Índice de escasez. (OtQGLFHGHHVFDVH]SDUDOD]RQDFRUUHVSRQGHDXQQLYHO1RVLJQL¿- TOTAL 558,93 82.32
FDWLYRGHELGRDODFDQWLGDGGHKDELWDQWHVGHOD]RQDODFDQWLGDGGHKHFWiUHDVFXOWLYDGDV Fuente: GEOCOL CONSULTORES S. A. 2011.
\DODFDQWLGDGGHFDEH]DVGHJDQDGRSRUKHFWiUHDHQSURGXFFLyQFRQUHVSHFWRDODDOWD +HORELRPDGHO0DJGDOHQD&DULEH(VWHKHORELRPDSUHVHQWDGRVWLSRVGHFOLPDFiOL-
RIHUWDGHOUHFXUVRKtGULFR'HLJXDOIRUPDVHJ~QORVGDWRVREWHQLGRVHQFDPSROD]RQDGH GRVHFR\FiOLGRK~PHGR$EDUFDXQiUHDGHKDFRUUHVSRQGLHQWHDOGHO
VXVWUDFFLyQVHHQFXHQWUDHQHOFRPSOHMRFHQDJRVRXELFDGRSRUORVFDxRV*UDQGH9LHMR\ iUHDGHLQÀXHQFLD6HXELFDSULQFLSDOPHQWHVREUHSODQLFLHVDOXYLDOHV\FXHUSRVGHDJXD
XQVHFWRUGHOUtR/HEULMDORTXHVXJLHUHXQD]RQDDQHJDGDLQXQGDEOH\GHEDMDGHPDQGD \VHSUHVHQWDHQHOFRVWDGRRFFLGHQWDOGHOiUHDGHLQÀXHQFLDGRQGHKD\PD\RULQÀXHQFLD
KtGULFD KtGULFD HQ ODV FREHUWXUDV SRU OD SUHVHQFLD GHO UtR /HEULMD \ HO FRPSOHMR FHQDJRVR GHO
FDxR*UDQGH/DVLJXLHQWHWDEODUHSUHVHQWDODVFREHUWXUDVYHJHWDOHVHQHO+HORELRPDGHO
2.3.5 Meteorología y Clima Magdalena y Caribe.
3DUDHODQiOLVLVFOLPiWLFRGHOiUHDGHHVWXGLRVHHPSOHyODLQIRUPDFLyQPHWHRUROyJLFD ÁREA PORCEN
GHO,GHDPXWLOL]DQGRSDUDHOORODVHVWDFLRQHVXELFDGDVHQ3XHUWR:LOFKHV6DQ0DUWtQ GRAN BIOMA BIOMA COBERTURA DE LA TIERRA
KD TAJE
$JXDFKLFD6DQ3DEOR6DEDQDGH7RUUHV\*DPDUUD %RVTXHIUDJPHQWDGR  
/RVUHVXOWDGRVGHORVDQiOLVLVSDUDODFDUDFWHUL]DFLyQFOLPiWLFDGHOiUHDGHHVWXGLRVH +HUED]DOGHQVR  
SUHVHQWDQDFRQWLQXDFLyQ Gran bioma de Helobioma del Mosaico de pastos con espacios naturales 3112,75 
%RVTXH +~PHGR Magdalena y
Precipitación. 6HSXGRHVWDEOHFHUTXHHOUpJLPHQSOXYLRPpWULFRHQHOiUHDGHHVWXGLRHV 7URSLFDO Caribe Pastos limpios  9,92
ELPRGDOHVWHUpJLPHQHVWiLQÀXHQFLDGRSRUODYHUWLHQWHGHO0DJGDOHQD/DWHPSRUDGDGH 3DVWRVHQPDOH]DGRV  
OOXYLDVHQHOiUHDVHSUHVHQWDHQWUHORVPHVHVGHDEULODMXQLRFRQYDULDFLRQHVHQWUHORV 9HJHWDFLyQDFXiWLFDVREUHFXHUSRGHDJXD  
PPDPP\HQWUHORVPHVHVGHDJRVWRDQRYLHPEUHHQWUHORVPPDPP TOTAL 16783,24 78,58
DODxR(OSURPHGLRPHQVXDOHQHVWRVSHULRGRVHVGHPP/RVPHVHVGHGLFLHPEUHD Fuente: GEOCOL CONSLULTORES S. A. 2011.
PDU]R\MXOLRFRUUHVSRQGHQDOSHULRGRVHFRFRQYDULDFLRQHVHQWUHORVPPDPP 'HQWURGHODVFREHUWXUDVYHJHWDOHVDVRFLDGDVDOSURJUDPDVtVPLFRGHOiUHDGHLQÀXHQFLD
Temperatura. /DWHPSHUDWXUDPHGLDPHQVXDOPXOWLDQXDORVFLODHQWUHORV0&D0 VHHQFXHQWUDQHOKHUED]DOGHQVRFRQXQiUHDGHKDHOPRVDLFRGHSDVWRVFRQ
&(VWDVWHPSHUDWXUDVFRUUHVSRQGHQDXQFOLPDFiOLGR\VHDMXVWDDXQUpJLPHQLVRWpUPLFR HVSDFLRVQDWXUDOHV KD ORVSDVWRVOLPSLRV KD HOERVTXHIUDJPHQWDGR 
de temperaturas con un promedio de 27,50 C. KD ODYHJHWDFLyQDFXiWLFDVREUHFXHUSRGHDJXD KD \SDVWRVHQPDOH]DGRV KD 
Humedad Relativa. 3DUDHOiUHDGHHVWXGLRVHWLHQHTXHORVPHVHVPiVK~PHGRVVRQ El área objeto de sustracción corresponde a la longitud de las líneas del Programa Sís-
DEULOPD\R\MXQLRFRQXQYDORUSURPHGLRGH\GHVHSWLHPEUHDQRYLHPEUHFRQXQ mico que se traslapa con el polígono del área de la RFN del Río Magdalena, por el ancho
YDORUSURPHGLRGHHQWUHWDQWRORVPHVHVPHQRVK~PHGRVVHHQFXHQWUDQHQWUHHQHURD de la vía que es de 2 metros. La siguiente tabla indica que en el área objeto de sustracción
PDU]RMXOLR\GLFLHPEUHFRQXQSURPHGLRGH se encuentran cinco tipos de coberturas.
Brillo Solar. El brillo solar en el área de estudio, presenta un valor promedio del orden &2%(5785$ KD TOTAL
LÍNEA POR
GHKRUDVGHEULOORVRODUDODxR\ODLQVRODFLyQPHGLDPHQVXDOHQSURPHGLRHVGH Ciénaga
Herbazal Mozaico de pastos con Pastos
Río
denso espacios naturales limpios LÍNEA
KRUDV
/(1$ 0.03  0.14 0.01 0.09 0.35
Nubosidad. /DQXERVLGDGHQHOiUHDGHHVWXGLRHVDSUR[LPDGDPHQWHGH2FWDVHQ 11-LENA-304 0.07 1.13 0.39 0.20 1.78
promedio mensual.
11-LENA-305 0.22 0.31 0.53
Evaporación. &RQEDVHHQORVUHJLVWURVDQDOL]DGRVHQHOiUHDGHHVWXGLRVHWLHQHXQD 11-LENA-307 0.19 0.63 0.82
HYDSRUDFLyQPHQVXDOTXHYDUtDHQWUHPPDPPVLHQGRHQHURHOPHVFRQPD\RU 11-LENA-309 0.9 0.09
HYDSRUDFLyQ\DEULODMXQLR\VHSWLHPEUHDGLFLHPEUHORVPHVHVGHPHQRUHYDSRUDFLyQ 11-LENA-311 0.06 0.06
Vientos. 'HDFXHUGRFRQODLQIRUPDFLyQVXPLQLVWUDGDSRUHO,GHDPVHSXHGHDSUHFLDU 11-LENA-313 0.02 0.26 0.28
TXHODWHQGHQFLDGHORVYLHQWRVSURYHQLHQWHVGHODGLUHFFLyQQRURHVWHVRQORVPiVIUHFXHQWHV 11-LENA-315 0.03 0.07 0.06
FRQHOHOSURYLHQHGHORHVWHHOSURYLHQHGHOVXURHVWH\VXUHO 11-LENA-319 0.13  0.03 0.02 
proviene del noreste y del resto de direcciones no se registran velocidades de viento. Total por co
0.51 2.37 0.88 0.30 0.16 4.22
%DODQFHKtGULFR/DVLJXLHQWHWDEODUHJLVWUDHOEDODQFHKtGULFRDQXDOHQHOiUHDGH bertura
estudio, donde se establecen las entradas y salidas del sistema. Fuente: GEOCOL CONSULTORES S.A. 2011.
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 5
Con base en los datos aportados por parte del peticionario, se observa que el área ODFDUDFWHUL]DFLyQGHODHVWUXFWXUD\FRPSRVLFLyQGHHVWDFREHUWXUDVHLQYHQWDULDURQ
REMHWRGHODVXVWUDFFLyQHVGHKDFRUUHVSRQGLHQWHDOGHOD5HVHUYD)RUHVWDODO SDUFHODVODVFXDOHVVHUHDOL]DURQFRQGDWRVSURYHQLHQWHVGHODPLVPDFREHUWXUDSUHVHQWH
LQWHULRUGHOiUHDGHLQÀXHQFLDSDUDODVXVWUDFFLyQ KD /DViUHDVPiVVHQVLEOHV HQiUHDGHO3URJUDPD6tVPLFRGRQGHVtIXHSRVLEOHODFDSWXUDGHODLQIRUPDFLyQ
DVXVWUDHUVRQORVKHUED]DOHV KD \ODVFLpQDJDV KD &DEHGHFLUTXHVREUHODV /DFRPSRVLFLyQÀRUtVWLFDGHHVWDFREHUWXUDVHFDUDFWHUL]DSRUSUHVHQWDUiUHDVGHSDVWRV
FLpQDJDV VROR VH UHDOL]DUi HO UHJLVWUR FRQ KLGUyIRQRV \ QR VH VXVWUDHUi QLQJ~Q iUHD HQ DVRFLDGRVFRQUHOLFWRVGHERVTXHQDWXUDOYHJHWDFLyQDERUGHGHFXHUSRVGHDJXD\RWUDV
FREHUWXUDGHERVTXHIUDJPHQWDGR iUHDVQRLQWHUYHQLGDVRSRFRWUDQVIRUPDGDVXVXDOPHQWHVHSUHVHQWDHQ]RQDVGHFROLQDV
Herbazal Denso. &RUUHVSRQGHQDVXSHU¿FLHVFRQSUHGRPLQLRGHYHJHWDFLyQQDWXUDO EDMDVTXHGHELGRDOLPLWDQWHVGHXVRSHUPDQHFHQHQHVWDGRQDWXUDO
KHUEiFHDFRQHOHPHQWRVDUEyUHRV\DUEXVWLYRVGLVSHUVRVHQVXHORVDQHJDGRVODPD\RUSDUWH 6H UHJLVWUDURQ  LQGLYLGXRV UHSUHVHQWDGRV SRU  HVSHFLHV \  IDPLOLDV /DV WUHV
GHODxR(VWiDVRFLDGDDODVPiUJHQHVGHODVFLpQDJDVLVODVIRUPDGDVSRUPHDQGURVGHORV IDPLOLDVFRQPD\RUDEXQGDQFLDVRQOD)$%$&($(FRQLQGLYLGXRVJpQHURV\HVSH-
UtRV\DOJXQRVFDxRV/DPD\RUSDUWHGHOiUHDDVXVWUDHUVHHQFXHQWUDHQHVWDFREHUWXUD FLHVOXHJROHVLJXHODIDPLOLD&$3$5È&($(FRQLQGLYLGXRVSHUWHQHFLHQWHVDJpQHURV
FRQXQWRWDOGHKD(VWDFREHUWXUDVHHQFXHQWUDDOFRVWDGRQRURFFLGHQWDOGHOiUHDGH \HVSHFLHV\¿QDOPHQWHODIDPLOLD$1121$&($(FRQLQGLYLGXRVGLVWULEXLGRVHQ
LQÀXHQFLDSDUDODVXVWUDFFLyQGLVWULEXLGRHQODVPiUJHQHVLQXQGDEOHVGHOFRPSOHMRFHQD-
JpQHUR\HVSHFLHV
JRVRGH&DxR*UDQGH\GHPiVFLpQDJDVH[LVWHQWHVHQHOiUHD6HHQFXHQWUDSULQFLSDOPHQWH
HQOD9HUHGD&DxR*UDQGHPXQLFLSLRGH3XHUWR:LOFKHV6DQWDQGHU /DVLJXLHQWHWDEODUHJLVWUDODFRPSRVLFLyQÀRUtVWLFDHQ0RVDLFRGHSDVWRVFRQHVSDFLRV
naturales.
/DVHVSHFLHVKHUEiFHDVPiVDEXQGDQWHVVRQELMDJLOOR +HOLFRQLDVS \SDVWRJUDPDORWH
3DQLFXPHOHSKDQWLSHV FRPELQDGDVFRQHVSHFLHVDUEyUHDV\DUEXVWLYDVWDOHVFRPR\DUXPR FAMILIA NOMBRE CIENTÍFICO NOMBRE COMÚN

&HFURSLDVS PLPEUH 7HVVDULDLQWHJULIROLD \DOJXQDVHVSHFLHVGHODIDPLOLDVDOLFiFHD ,1',9,'826
(VWDFREHUWXUDDXPHQWDODLQ¿OWUDFLyQHQODV]RQDVLQXQGDEOHV\HVXQDEDUUHUDSDUD $1$&$5',$&($( 6SRQGLDVPRPELQ Hobo 2
el control de sedimentos, lo que la convierte en amortiguadora de las inundaciones ade- Xylopia aromática Pepe burro 2
$1121$&($(
PiVGHVHUKiELWDWSDUDODIDXQD\JHQHUDUFRQHFWLYLGDGHQWUHORVFXHUSRVGHDJXD\ORV ;\ORSLDSRO\DQWKD Escobillo 3
SDUFKHVGHYHJHWDFLyQ Elaeis guineensis 3DOPDDIULFDQD 3
$5(&$&($(
Pastos Limpios. Comprende las tierras ocupadas de pastos en las que se adelantan (ODHLVROHtIHUD Palma nolí 1
SUiFWLFDVGHPDQHMRFRPROLPSLH]DHQFDODPLHQWR\RIHUWLOL]DFLyQHQWUHRWURV\HOQLYHO BORAGINACEAE Cordia panamensis Cusu 3
WHFQROyJLFRXVDGRHYLWDODSUHVHQFLDRHOGHVDUUROORGHRWUDVFREHUWXUDV(QHOiUHDREMHWR CAPARÁCEAE
Cynophalla verrucosa Cotorrito 3
GHVXVWUDFFLyQVHUHJLVWUDURQJUDQGHVODWLIXQGLRVFXELHUWRVSULQFLSDOPHQWHGHSDVWRVGHO Crateva tapia Naranjuelo 3
JpQHUR%UDFKLDULD6HHQFXHQWUDHQOD9HUHGD&DxR*UDQGHHQHOPXQLFLSLRGH3XHUWR CHRYSOBALANACEAE Chrysobalanus icaco Icaco 1
:LOFKHV 6DQWDQGHU \ XQD SHTXHxD SDUWH HQ OD 9HUHGD 6DOLQDV PXQLFLSLR GH 5LRQHJUR Cassia grandis Caña fístol 2
6DQWDQGHU 3UHVHQWD SRFD GLYHUVLGDG ELROyJLFD H LQWHUUXPSH OD FRQHFWLYLGDG HQWUH ORV FABÁCEAE Inga vera Guamo macho 12
SDUFKHVGHERVTXH 3DUNLDSHQGXOD Rayo 1
Mosaico de Pastos con Espacios Naturales. 3UHVHQWDXQDFRPELQDFLyQGHJUDPtQHDVFRQ HIPERICÁCEAE Vismia baccifera Achotillo 1
SDUFKHVGHERVTXH\YHJHWDFLyQVHFXQGDULDDVRFLDGDDFXHUSRVGHDJXDSULPRUGLDOPHQWH MAGNOLIACEAE Magnolia virolinensis Platero 1
HQiUHDVDOHGDxDVDOUtR/HEULMD\HO&DxR*UDQGH6HSUHVHQWDHQODHVTXLQDVXURFFLGHQ- MALVACEAE Luehea seemannii Malagano 1
WDOGHOiUHDDVXVWUDHUHQODV9HUHGDV&DxR*UDQGH\0RQWDxLWDEDMDHQHOPXQLFLSLRGH N.N. N.N. Guarda maduro 1
3XHUWR:LOFKHV6DQWDQGHU\HQODV9HUHGDV/D&RQVXOWD\/DV6DOLQDVHQHOPXQLFLSLRGH POLYGONACEAE Triplaris americana Vara santa 2
5LRQHJUR6DQWDQGHU SAPINDÁCEAE Melicoccus bijugatus Mamón 2
(VWDFREHUWXUDSURGXFWRGHODLQWHUYHQFLyQHQVHFWRUHVSHULIpULFRVGHODViUHDVERVFR- SAPOTACEAE Pouteria sp. Caimito 1
VDVSDUDHOHVWDEOHFLPLHQWRGHiUHDVSDUDJDQDGHUtDFRUUHVSRQGHD]RQDVTXHQRIXHURQ STERCULIACEAE Guazuma ulmifolia Guásimo 2
WRWDOPHQWHLQWHUYHQLGDVSRUVXWRSRJUDItDRFRQGLFLyQHGi¿FD6XIXQFLyQHFROyJLFDHVWi URTICÁCEAE Cecropia sp. Yarumo blanco 1
principalmente dada por los espacios naturales que alberga, los cuales pueden en un mo- Fuente: GEOCOL CONSULTORES S. A., 2011.
mento ayudar a la conectividad entre las coberturas boscosas.
(QFXDQWRDODHVWUXFWXUDKRUL]RQWDOODVHVSHFLHVYHJHWDOHVPiVDEXQGDQWHVVRQHQ
Análisis de Conectividad en las Coberturas Presentes en el Área a Sustraer. La ma- VXRUGHQJXDPRPDFKR ,QJDYHUD TXHUHSUHVHQWDHOGHORVLQGLYLGXRVDUEyUHRV
\RUGLYHUVLGDGÀRUtVWLFDVHHQFXHQWUDHQORVERVTXHVDVRFLDGRVDODGLQiPLFDLQXQGDEOH SUHVHQWHV HQ ODV SDUFHODV GH PXHVWUHR FRWRUULWR &\QRSKDOOD YHUUXFRVD  FXVX &RUGLD
GHORVFXHUSRVGHDJXDGHO&DxR*UDQGH\OD&LpQDJD&DxR*UDQGHQRREVWDQWHHVWRV SDQDPHQVLV HVFRELOOR ;\ORSLDSRO\DQWKD QDUDQMXHOR &UDWHYDWDSLD SDOPDDIULFDQD
relictos boscosos son reducidos y están asociados entre sí, lo que reduce su conectividad (ODHLVJXLQHHQVLV \FDxDItVWXOD &DVVLDJUDQGLV 'HDFXHUGRFRQODFDUDFWHUL]DFLyQODV
FRPRFRUUHGRUHVELROyJLFRV(QHOiUHDVHLGHQWL¿FDQWUHVFRUUHGRUHVHFROyJLFRVDVDEHU HVSHFLHVHQVXPD\RUtDVRQPX\SRFRIUHFXHQWHVORTXHHYLGHQFLDXQDPX\DOWDYDULDELOLGDG
‡&RUUHGRUELROyJLFRGHOFRPSOHMRFHQDJRVRDVRFLDGRDOUtR/HEULMDFRQYHJHWDFLyQ HQODFRPSRVLFLyQÀRUtVWLFDSDUDHO0RVDLFRGHSDVWRVFRQHVSDFLRVQDWXUDOHV
KHUEiFHDDOHGDxDFRUUHVSRQGLHQWHDODVFREHUWXUDVGHKHUED]DOGHQVRHOFXDOVHXELFD Por otra parte, las especies que presentan un mayor grado de dominancia son en su
GHQWURGHOD5HVHUYDHQODSDUWHFHQWUDOGHOEORTXHGHH[SORUDFLyQVtVPLFDSUHVHQWDXQ
RUGHQODSDOPDDIULFDQD (ODHLVJXLQHHQVLV UD\R 3DUNLDSpQGXOD \ODFDxDItVWXOD &DVVLD
JUDQQ~PHURGHFLpQDJDVTXHHQYHUDQRVHHQFXHQWUDQVHSDUDGDVHQWUHVtSRUKHUED]DOHV
JUDQGLV $VLPLVPRODSDOPDDIULFDQDGHVGHHOSXQWRGHYLVWDGHODHVWUXFWXUDKRUL]RQWDO
GHQVRVHQLQYLHUQRORVKHUED]DOHVVHDQHJDQ\HOFRPSOHMRVHWRUQDHQXQVRORFXHUSRGH
HVODHVSHFLHPiVLPSRUWDQWHSUHVHQWDXQDGHODVPD\RUHVIUHFXHQFLDV\PD\RUGRPLQDQFLD
DJXD3HVHDHOORHOVLVWHPDKtGULFRFRQIRUPDXQFRUUHGRUELROyJLFRGHLPSRUWDQFLDSRU-
HQHOPXHVWUHRUHDOL]DGRSDUDHVWDFREHUWXUD(QRUGHQGHYDORUGHLPSRUWDQFLDOHVLJXHQ
TXHSHUPLWHODFRQWLQXLGDGGHOHFRVLVWHPDDFXiWLFR\HOKiELWDWTXHFRQIRUPDHOKHUED]DO
HOJXDPRPDFKR ,QJDYHUD \HOUD\R 3DUNLDSpQGXOD 
GHQVRGRQGHVHDOEHUJDQHVSHFLHVGHIDXQDFRPRFKLJLUR +\GURFKDHULVK\GURFKDHULV 
FKDYDUUL &KDXQD FKDYDULD  JDEDQ 0\FWHULD DPHULFDQD  UDQD SLFXGD /HSWRGDFW\OXV 'HDFXHUGRFRQHOFRH¿FLHQWHGHPH]FODVHSXHGHLQIHULUTXHSRUFDGDLQGLYLGXRV
IUDJLOLV (QWUHODVHVSHFLHVDUEyUHDV\DUEXVWLYDVVHHQFXHQWUDQVDXFHV 6DOL[VS \DUXPRV PXHVWUHDGRVHVSRVLEOHHQFRQWUDUXQDQXHYDHVSHFLHORTXHLQGLFDXQDDOWtVLPDKHWHURJH-
&HFURSLDVS \PLPEUH 7HVVDULDLQWHJULIROLD HQWUHRWUDV QHLGDGHQHOtQGLFHGHGLYHUVLGDG(QORTXHUHVSHFWDDOJUDGRGHDJUHJDFLyQGHODVHVSHFLHV
‡&RUUHGRUELROyJLFRFRQIRUPDGRSRUOD&LpQDJD*UDQGHHO&DxR*UDQGH\OD&LpQD- reportadas, se tiene que de las 21 especies, 13 tienen tendencia a dispersarse, 5 especies
JD&DxRJUDQGHFRQXQDIXHUWHGLQiPLFDLQXQGDEOHSRUVXVP~OWLSOHVDÀXHQWHVKtGULFRV DDJUXSDUVH\SUHVHQWDQXQDGLVWULEXFLyQDJUXSDGD
TXHVHXELFDDORODUJRGHOH[WUHPRRFFLGHQWDOGHOiUHDGHH[SORUDFLyQVtVPLFDGHQWURGH $ODQDOL]DUODHVWUXFWXUDGLDPpWULFDVHGHWHUPLQDTXHLQGLYLGXRV DOUHGHGRUGHO
OD5HVHUYDTXHKDVLGRSRFRLQWHUYHQLGDSRUHOKRPEUHGRQGHVHHQFXHQWUDQODVPD\RUHV  UHSRUWDGRVVHHQFXHQWUDQHQFODVHVGLDPpWULFDVHQWUHDFPGH'$3\TXHHO
iUHDVGHERVTXHIUDJPHQWDGR\XQDFRQH[LyQTXHSHUPLWHHOÀXMRGHLPSRUWDQWHVHVSHFLHV YROXPHQPiVFRQFHQWUDGRHVWiHQODFODVH9,,,FRQGLiPHWURVHQWUH\FPSRUOR
GHIDXQDWDQWRGHOHFRVLVWHPDKtGULFRFRPRSRUHOERVFRVRDGHPiVGHSUHVWDUXQVHUYLFLR cual se deduce que esta cobertura está en un estado sucesional incipiente en cuanto a las
DPELHQWDOLPSRUWDQWHFRPRUHFHSWiFXORGHODVDJXDVH[FHGHQWHVGHORVUtRV0DJGDOHQD\ FODVHVGLDPpWULFDVGHORVLQGLYLGXRVTXHODFRQIRUPDQ\DTXHODPD\RUtDGHiUEROHVWLHQHQ
/HEULMD\FRPRIXHQWHGHSHVFDSDUDORVSREODGRUHVGHOD]RQD GLiPHWURVGHOJDGRVWDPELpQVHREVHUYDTXHHOQ~PHURGHLQGLYLGXRVYDUtDGHXQDFODVH
‡&RUUHGRUELROyJLFRGHOUtR/HEULMDPDUFDHOOtPLWHRULHQWDOGHOiUHDGHLQÀXHQFLD GLDPpWULFDDRWUDVLJXLHQGRXQSDWUyQGH³-´LQYHUWLGDORTXHLQGLFDGHDFXHUGRFRQHO
LQGLUHFWD\GLUHFWDGHOD5HVHUYDGRQGHSUHGRPLQDQODVFREHUWXUDVGHKHUED]DOGHQVR SHWLFLRQDULRXQDEXHQDUHVHUYDGHiUEROHVMyYHQHV
mosaico de pastos con espacios naturales y algunos relictos de bosque que permiten su /DHVWUXFWXUDKRUL]RQWDOSHUPLWHGHWHUPLQDUTXHODPD\RUtDGHORViUEROHVUHSRUWDGRV
FRQHFWLYLGDGHFROyJLFD\VLUYHQGHDOEHUJXHDHVSHFLHVGHIDXQD\ÀRUD VXSHUDQORVPORTXHLQGLFDTXHSHVHDODSUHVHQFLDGHSHTXHxRVGLiPHWURVVXVDOWXUDV
/RVIUDJPHQWRVGHERVTXHVRQUHGXFLGRV\VHHQFXHQWUDQVHSDUDGRVHQWUHVtSRUSRWUHURV VtVXSHUDQHOHVWDGRGHHVSHFLHVGRPLQDGDVVLHQGRHQVXPD\RUSURSRUFLyQFRGRPLQDQWHV
FLpQDJDVKHUED]DOHVGHQVRVORTXHGL¿FXOWDODFRQIRUPDFLyQGHXQFRUUHGRUELROyJLFRFRQ y dominantes.
HVWDFREHUWXUD1RREVWDQWHDOXELFDUVHFHUFDD]RQDVGHDQHJDPLHQWRKDQSHUPDQHFLGR Especies amenazadas. 8QDYH]UHDOL]DGRHOLQYHQWDULRIRUHVWDO\FRQVROLGDGRHOOLVWDGR
FRQSRFDLQWHUYHQFLyQDQWUySLFDGHVDUUROOiQGRVHHQHOORVERVTXHVPDGXURVFRQiUEROHV GHHVSHFLHVHQFRQWUDGDV\UHSRUWDGDVSDUDOD]RQDGHHVWXGLRVHGHWHUPLQDURQODVHVSHFLHV
GHJUDQDOWXUD\HVSHFLHVGH]RQDVEDMDVDOJXQDVUHSRUWDGDVFRQDOJ~QJUDGRGHH[WLQFLyQ ODXUHO $QLEDSHUXWLOLV \SDOPDQROt (ODLVROHtIHUD FRPRDPHQD]DGDVGHDFXHUGRFRQ
ORTXHVXJLHUHXQDFRQVHUYDFLyQGHHVWRVERVTXHVSRUVHUUHVJXDUGRGHODÀRUD\IDXQD ODFDWHJRUtDGHDPHQD]DHVWDEOHFLGDSRUOD5HVROXFLyQQ~PHURGHSRUSDUWHGHO
para el área de la Reserva. 0$'6HOOLEURURMRGHSODQWDVGH&RORPELDGHO6,1&+,\HOOLEURURMRGHSODQWDVIDQHUy-
(OSDVWROLPSLRHVODFREHUWXUDTXHJHQHUDXQDPD\RUGLVJUHJDFLyQGHORVFRUUHGRUHV gamas de Colombia del Instituto Humboldt.
ELROyJLFRVHOFXDOWLHQHXQDJUDQH[WHQVLyQ\VHREVHUYDDORODUJRGHOEUD]RDQWLJXRGHO (OODXUHOVHHQFXHQWUDHQODFDWHJRUtD &5 ³(QSHOLJURFUtWLFR´GHDFXHUGRFRQOD
UtR/HEULMD 8,&1ORTXHVLJQL¿FDTXHHQIUHQWDXQJUDQULHVJRGHH[WLQFLyQHQHVWDGRVLOYHVWUH3RUVX
&RPSRVLFLyQÀRUtVWLFD\DQiOLVLVHVWUXFWXUDOGHO0RVDLFRGHSDVWRVFRQHVSDFLRVQD SDUWHODSDOPDQROtHVWiHQODFDWHJRUtD (1 ³(QSHOLJUR´ORTXHVLJQL¿FDXQDOWRULHVJR
turales. &RQEDVHHQODLQIRUPDFLyQVXPLQLVWUDGDSRUSDUWHGHOSHWLFLRQDULRSDUDFRQRFHU GHH[WLQFLyQRGHWHULRURSREODFLRQDOHQHVWDGRVLOYHVWUH
Edición 48.475
6 DIARIO OFICIAL Jueves, 28 de junio de 2012

Fauna 5KLQHOODPDULQD\5KLQHOODKXPEROGWL VRQORVDQ¿ELRVPiVFRPXQHVGHQWURGHOiUHDGH


 Avifauna VXVWUDFFLyQ/DIDPLOLD/HLXSHULGDHSUHVHQWyODVHVSHFLHV3OHXURGHPDEUDFK\RSV\(QJ\VWR-
PRSVSXVWXORVXVTXHVRQDQXUHVFRPXQHVDVRFLDGRVDFKDUFDVWHPSRUDOHVRSHUPDQHQWHV
6HLGHQWL¿FDURQHVSHFLHVGLVWULEXLGDVHQIDPLOLDV\yUGHQHV/DGLYHUVLGDG
de aves por línea sísmica es directamente proporcional con la cantidad de coberturas por Reptiles. (QHOiUHDGHVXVWUDFFLyQVHUHSRUWDURQHVSHFLHVGHUHSWLOHVSHUWHQHFLHQWHV
OtQHDDPD\RUQ~PHURGHFREHUWXUDVPD\RUODGLYHUVLGDGGHDYHV/DVOtQHDVFRQPD\RU DIDPLOLDVVXEyUGHQHV\yUGHQHVWD[RQyPLFRV 7HVWXGLQHV&URFRGLOLD\6TXDPDWD 
Q~PHURGHHVSHFLHV\UHJLVWURVIXHOD/HQDODFXDODWUDYLHVDWRGRHOEORTXH\HV GHHVWRVUHJLVWURVHOFRUUHVSRQGHDREVHUYDFLRQHVGLUHFWDV\HOUHSRUWDGRVSRU
SDUDOHODDOUtR/HEULMDWRFDQGRJUDQGHVSRUFLRQHVGHSOD\DV\FLpQDJDVGRQGHKDELWDQJUDQ encuestas a pobladores.
FDQWLGDGGHHVSHFLHVDFXiWLFDVGHKiELWRJUHJDULROXHJROHVLJXHODOtQHD/HQD (ORUGHQPiVGLYHUVRIXHHO6TXDPDWDFRQHVSHFLHVHOVHJXQGRRUGHQHQGLYHUVLGDG
\OD/HQDODVUHVWDQWHVOtQHDVTXHWLHQHQLQÀXHQFLDHQODVXVWUDFFLyQQRVXSHUDQ IXH7HVWXGLQHVFRQHVSHFLHV\HQWHUFHUOXJDUHORUGHQ&URFRGLOLDFRQGRVHVSHFLHV(Q
ODVHVSHFLHV FXDQWRDIDPLOLDVOD&ROXEULGDHFRQHVSHFLHV\OD7HLLGDHFRQVRQODVTXHGRPLQDURQ
Dentro de las especies de aves reportadas en el área de Reserva Forestal para el Programa HQODFRPXQLGDGGHUHSWLOHVGHOiUHDGHVXVWUDFFLyQ7RGDVODVIDPLOLDVGHWRUWXJDV\FR-
6tVPLFR900VHHQFRQWUDURQGHDFXHUGRFRQFDGDJUXSRODVVLJXLHQWHV(QHO*UXSR codrilos presentaron una sola especie.
,FRPSXHVWRSRUODOtQHD/HQDJDYLOiQ 0LOYDJRFKLPDFKLPD iJXLODVDEDQHUD Especies con algún grado de amenaza. La siguiente tabla indica las categorías de
%XWHRJDOOXVPHULGLRQDOLV FKXORVRJDOOLQD]RV WRGRVORV&DWKDUWLGRV SDORPDV WRGRV DPHQD]DDQLYHOUHJLRQDOQDFLRQDO\JOREDOGHORVUHSWLOHVUHSRUWDGRVHQHOiUHDGHLQ-
ORV&ROXPELGDH WXUSLDOHVWRFKHV DOJXQRVLFWpULGRV DOFDUDYDQHV 9DQHOOXVFKLOHQVLV  ÀXHQFLDGHOSUR\HFWR
(QHO*UXSR,,FRQIRUPDGRSRUFLQFRGHODVQXHYHOtQHDVVHWLHQHQDYHV]DQFXGDV Familia Especie
Apéndices
IUCN
Resolu
/XJDUGHQLGDFLyQ
FRPRODJDUFLWDEXH\HUD %XEXOFXVLELV ODJDU]DSDOHWD 3ODWDOHDDMDMD \HOFDUUDR $UD- CITES 2011 ción 383
PXVJXDUDXQD UDSDFHVFRPRHOiJXLODFLHQDJHUD %XVDUHOOXVQLJULFROOLV \HOFDUDFROHWD $OOLJDWRULGDH Caiman crocodilus $SpQGLFH,, LC +RMDUDVFD
5RVWKUDPXVVRFLDELOLV  Crocodylidae Crocodylus acutus $SpQGLFH, VU CR +RMDUDVFD
(QHO*UXSR,,,FRQIRUPDGDVSRUODVOtQHDV/HQD\/HQDVHHQFXHQWUDQ Podocnemididae Podocnemis lewyana $SpQGLFH,, EN EN Bancos de arena
SDWRFDUHWR 'HQGURF\JQDYLGXDWD LJXDVDFRP~Q 'HQGUF\JQDDXWXPQDOLV FRUPRUiQ 7HVWXGLQLGDH Chelonoidis carbonaria Apéndice II VU CR Hojarasca
3KDODFURFRUD[EUDVLOLDQXV FRUUHOLQRFKLFR &DOLGULVPLQXWLOOD  Teiidae Tupinambis teguixin Apéndice II Cavidades en la tierra
/DVHVSHFLHVGHO*UXSR,9VHUHSRUWDQWXUSLDOGHDJXD &U\VRPXVLFWHURFHSKDOXV YLXGLWD Iguanidae Iguana iguana Apéndice II Hojarasca
FRP~Q )OXYLFRODSLFD JDOOLWRGHFLpQDJD -DFDQDMDFDQD \FKDYDUUL &KDXQDFKDYDUUL  Boidae Boa constrictor Apéndice II Cavidades en la tierra
Boidae Corallus ortulanus Apéndice II Cavidades en la tierra
Especies con algún grado de amenaza. 'HQWURGHODVHVSHFLHVDPHQD]DGDVVHHQFXHQ-
Colubridae Clelia clelia Apéndice II Hojarasca
WUDQODSDYD 2UWDOLVJDUUXOD \HOFKDYDUUL &KDXQDFKDYDUULD ODFXDODGHPiVHVXQD
HVSHFLHHQGpPLFD Categorías Ecológicas según CITES  ,(VSHFLHVVREUHODVTXHSHVDXQPD\RUSHOLJURGHH[WLQFLyQ
VHSURKtEHVXFRPHUFLRLQWHUQDFLRQDO,,(VSHFLHVTXHHQODDFWXDOLGDGQRVHHQFXHQWUDQQHFHVDULDPHQWH
 Mamíferos HQSHOLJURGHH[WLQFLyQSHURSRGUtDQOOHJDUDVHUORDPHQRVTXHHOFRPHUFLRHVWpVXMHWRDXQDUHJODPHQWD-
(QHOiUHDGHLQÀXHQFLDVHUHSRUWDURQHVSHFLHVGHPDPtIHURVSHUWHQHFLHQWHVD FLyQ,,,(VSHFLHVTXHFXDOTXLHUDGHODVSDUWHVPDQL¿HVWHTXHVHKDOODVRPHWLGRDUHJODPHQWDFLyQGHQWUR
GHVXMXULVGLFFLyQFRQHOREMHWRGHSUHYHQLURUHVWULQJLUVXH[SORWDFLyQCategorías de las listas Rojas y
IDPLOLDV\yUGHQHV/RVyUGHQHVPiVUHSUHVHQWDWLYRVHQHOiUHDGHVXVWUDFFLyQWHPSRUDO Resolución 383 del 23 de febrero de 20103HOLJUR&UtWLFR &5 (Q3HOLJUR (1 9XOQHUDEOH 9X &DVL
GHOEORTXH900IXHURQ $PHQD]DGR 17 3UHRFXSDFLyQ0HQRU /& 'DWRV,QVX¿FLHQWHV '' 1RHYDOXDGR 1( Categorías
5RGHQWLDGRQGHVHUHJLVWUDURQHVSHFLHVODDUGLOOD 6FLXUXVJUDQDWHQVLV UDWRQHV 0XV ecológicas según la UICN1(1RHYDOXDGR'''DWRVGH¿FLHQWHV/&0HQRUSUHRFXSDFLyQ17&DVL
PXVFXOXV\5DWWXVQRUYHJLFXV SRQFKH +\GURFKDHULVK\GURFKDHULV FDUQtYRUD WLJULOORV DPHQD]DGD989XOQHUDEOH(1(QSHOLJUR&53HOLJUR&UtWLFR
QXWULDV]RUURVHWF  Fuente: GEOCOL CONSULTORES S. A., 2011
&DUQtYRUDUHSUHVHQWDHOGHORVPDPtIHURVUHJLVWUDGRV\SUHVHQWyHOPD\RUQ~PHUR  Macroinvertebrados bentónicos
GHHVSHFLHVGHQWURGHOHVWXGLRVHHQFRQWUDURQODVHVSHFLHV]RUUDSDWRQD 3URF\RQFDQ- Comunidad bentónica. (QODVHVWDFLRQHVHYDOXDGDVVHHQFRQWUDURQRUJDQLVPRVEHQWy-
FULYRUXV ]RUURSHUUR &HUGRF\RQWKRXV QXWULD /RQWUDORQJLFDXGLV WLJULOOR /HRSDUGXV QLFRVFRUUHVSRQGLHQWHVDORVSK\OXP$UWKURSRGD$QQHOLGD\0ROOXVFDVLHQGRHOSULPHURHO
SDUGDOLVDHTXDWRULDOLV  PiVUHSUHVHQWDWLYRFRQORVyUGHQHV&ROHRSWHUD'tSWHUD+HPtSWHUD2GRQDWD\7ULFKRS-
3ULPDWHVHQHOiUHDGHVXVWUDFFLyQVHHQFRQWUDURQGRVIDPLOLDV &HELGDH\$WHOLGDH \ WHUDGHODFODVH,QVHFWDDVtFRPRHORUGHQ'HFDSRGDGHODFODVH0DODFRVWUDFD(ORUGHQ
GRVHVSHFLHVHOFDULEODQFR &HEXVDOELIURQV \HOFRWXGR $ORXDWWDVHQLFXOXV +HPLSWHUDIXHHOJUXSRPiVUHSUHVHQWDWLYRHOFXDOHVWXYRUHSUHVHQWDGRSRUORVJpQHURV
/HWKRFHUXV LQGLFDGRUGHDJXDVPRGHUDGDPHQWHFRQWDPLQDGDV 3DUDSOHD LQGLFDGRUGH
6LUHQLDHQHVWHRUGHQVHUHSRUWyHOPDQDWtGHO&DULEH 7ULFKHFKXVPDQDWXV HOFXDO DJXDVOLPSLDV\SRFRFRQWDPLQDGDV 7HQDJRELD LQGLFDGRUGHDJXDVOLPSLDVDHXWUy¿FDV 
IXHUHSRUWDGRPHGLDQWHHQFXHVWDVUHDOL]DGDVHQHOiUHD 0LFURYHOLD LQGLFDGRUGHDJXDVOLPSLDVRSRFRFRQWDPLQDGDV 5KDJRYHOLD\%XHQRD
(OKiELWDWTXHUHJLVWUyHOPD\RUQ~PHURGHHVSHFLHVIXHODFREHUWXUDGHO0RVDLFRGH Comunidad perifítica. (QODVPXHVWUDVDQDOL]DGDVSDUDODLGHQWL¿FDFLyQGHORVRUJDQLVPRV
SDVWRVFRQHVSDFLRVQDWXUDOHV\%RVTXHVIUDJPHQWDGRVFRQXQSRUFHQWDMHGHOXHJR GHHVWDFRPXQLGDGVHHQFRQWUDURQLQGLYLGXRVSHUWHQHFLHQWHVDO¿WRSHUL¿WRQGLVWULEXLGRVHQ
VLJXLyHO0RVDLFRGHSDVWRVFRQHVSDFLRVQDWXUDOHVGRQGHVHUHJLVWUyHO ODVGLYLVLRQHV%DFLOODULRSK\WD&KORURSK\WD\(XJOHQRSK\FRWD/DGLYLVLyQ%DFLOODULRSK\WD
Especies con algún grado de amenaza. 'HODVHVSHFLHVGHPDPtIHURVUHJLVWUDGDVSDUD HVODPiVDEXQGDQWHFRQRUJFP2OHVLJXHQHQVXRUGHQODVHXJOHQy¿WDVFRQRUJ
HOiUHDGHVXVWUDFFLyQWHPSRUDOHOFRUUHVSRQGLHQWHDHVSHFLHVHVWiQFDWDORJDGRV cm2ODV&ORUy¿WDVFRQRUJFP2\ODVFLDQy¿WDVFRQRUJFP2.
FRQDOJ~QJUDGRGHDPHQD]DDQLYHOQDFLRQDORLQWHUQDFLRQDO\GRVHVSHFLHVFRUUHVSRQGHQ Comunidad planctónica. (O¿WRSODQFWRQVHHQFRQWUyHQODVGLYLVLRQHV%DFLOODULRSK\WD
DPDPtIHURVPLJUDWRULRVGHDFXHUGRDO3ODQ1DFLRQDOGHODVHVSHFLHVPLJUDWRULDVGH&R- &KORURSK\WD\(XJOHQRSK\FRWD3RUVXSDUWHHO]RRSODQFWRQSUHVHQWyRUJDQLVPRVGHORV
ORPELD/DVLJXLHQWHWDEODLGHQWL¿FDODVFDWHJRUtDVGHDPHQD]DDQLYHOUHJLRQDOQDFLRQDO SK\OXP3URWR]RD$UWKURSRGD1HPDWRGD\5RWLIHUD
\JOREDOGHODPDVWRIDXQDUHJLVWUDGDHQOD]RQDGHLQÀXHQFLDGHOSUR\HFWR
En síntesis, de acuerdo con los resultados obtenidos para las comunidades evaluadas,
IUCN Red Apéndices
LIBROS RESOLU VHREVHUYDTXHHQWpUPLQRVJHQHUDOHVVHSUHVHQWDXQDDOWDXQLIRUPLGDG\XQEDMRSUHGRPL-
Especie Nombre Común
List, 2011 CITES 2011
ROJOS, CIÓN 383, QLRORTXHVXJLHUHTXHORVFXHUSRVGHDJXDVXSHU¿FLDOHVDQDOL]DGRVVHHQFXHQWUDQHQXQ
2006 2010 HVWDGRPHVRWUy¿FRRPHGLDQDPHQWHFRQWDPLQDGRUHVXOWDGRVFRKHUHQWHVFRQORVDQiOLVLV
0\UPHFRSKDJD WULGDF- ¿VLFRTXtPLFRV\EDFWHULROyJLFRVTXHGHWHUPLQDURQHQJHQHUDOXQDFDOLGDGPHGLDDEXHQD
Oso Real VU II VU VU
tyla SDUDODVFRUULHQWHVKtGULFDVHYDOXDGDV
&HEXVDOELIURQV Cariblanco II
0DFUy¿WDVDFXiWLFDV(QODVHVWDFLRQHVPRQLWRUHDGDVHQHOiUHDVHUHSRUWyXQWRWDO
Alouatta seniculus Cotudo II
GHRFKRHVSHFLHVSHUWHQHFLHQWHVDODFODVH/LOLSVLGD\0DJQROLRSVLGDHQODSULPHUDVH
Lontra longicaudis Nutria DD I VU VU
HQFRQWUDURQORVyUGHQHV&RPPHOLQDOHV$OLVPDWDOHV\SRDOHVFRQXQWRWDOGHFXDWURID-
Leoncillo, León PLOLDV3RUVXSDUWHODFODVH0DJQROLSVLGDUHSRUWyORVyUGHQHV0\UWDOHV\1\PSKDHDOHV
Puma concolor II
colorado
FDGDXQDFRQXQDIDPLOLD
Leopardus pardalis ae-
quatorialis
Tigrillo I (VWRVRUJDQLVPRVHQSHULRGRVGHVHTXtDTXHGDQUHGXFLGRVDOHVSHMRGHDJXD\HQWHPSR-
Puma yagouaroundi Gato de monte II UDGDGHLQYLHUQRVXSUHVHQFLDHVPHQRVQRWRULDQRREVWDQWHKDFLDODVRULOODVGHORVVLVWHPDV
Trichechus manatus Manatí VU I EN EN
OpQWLFRVKD\DVHQWDPLHQWRGHHVWDVSODQWDVFXPSOLHQGRXQSDSHOSURWHFWRUDOHFRVLVWHPD
Categorías Ecológicas según CITES (2011). Apéndice I. Especies sobre las que pesa un mayor peligro Ictiofauna (peces)
de extinción, se prohíbe su comercio internacional. Apéndice II. Especies que en la actualidad no se en- 6HLGHQWL¿FDURQHVSHFLHVSHUWHQHFLHQWHVDORVyUGHQHV&KDUDFLIRUPHV3HUFLIRUPHV
cuentran necesariamente en peligro de extinción, pero podrían llegar a serlo a menos que el comercio esté 6LOXULIRUPHV \ 0\OLREDWLIRUPHV /D VLJXLHQWH WDEOD UHJLVWUD ORV SHFHV UHSRUWDGRV HQ ORV
VXMHWRDXQDUHJODPHQWDFLyQ$SpQGLFH,,,(VSHFLHVTXHFXDOTXLHUDGHODVSDUWHVPDQL¿HVWHTXHVHKDOOD
sometido a reglamentación dentro de su jurisdicción, con el objeto de prevenir o restringir su explotación.
cuerpos de agua monitoreados en el Bloque VMM-3.
Categorías de las listas Rojas: Peligro Crítico (CR), En Peligro (EN), Vulnerable (VU), Casi Amenazado NOMBRE
CLASE ORDEN FAMILIA ESPECIE
17 3UHRFXSDFLyQ0HQRU /& 'DWRV,QVX¿FLHQWHV '' 1R(YDOXDGR 1(  COMÚN
&DWHJRUtDVHFROyJLFDVVHJ~QOD8,&1SDUDPDPtIHURV1(1R(YDOXDGR'''DWRV'H¿FLHQWHV/& $QRVWRPLGDH Leporinus sp &RPHOyQ
0HQRU3UHRFXSDFLyQ17&DVL$PHQD]DGD989XOQHUDEOH(1(QSHOLJUR&53HOLJUR&UtWLFR 3LDUDFWXVEUDFK\SRPXV &DFKDPD
Fuente: GEOCOL CONSULTORES S. A., 2011. 6DOPLQXVDI¿QLV Dorada, picuda
&KDUDFLGDH
+HUSHWRIDXQD $Q¿ELRV\UHSWLOHV $FWLQRSWHU\JLL &KDUDFLIRUPHV &KDUD[VS &KDQJR
7ULSRUWKHXVPDJGDOHQDH $UHQFD
$Q¿ELRV3DUDHOiUHDGHLQÀXHQFLDGHODVXVWUDFFLyQWHPSRUDOVHUHJLVWUDURQHVSHFLHV
GHDQ¿ELRVSHUWHQHFLHQWHVDIDPLOLDV\XQRUGHQ/DIDPLOLD%XIRQLGDH/HLXSHULGDH\ Curimata mivartii 9L]FDLQD
Curimatidae
/HSWRGDF\OLGDHSUHVHQWDURQGRVHVSHFLHVFDGDXQD/DVHVSHFLHVGHODIDPLOLD%XIRQLGDH 3URFKLORGXVPDJGDOHQDH %RFDFKLFR
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 7
NOMBRE 2.5 Componente socioeconómico
CLASE ORDEN FAMILIA ESPECIE
COMÚN 2.5.1ÈUHDGHLQÀXHQFLD
Characiformes (U\WKULQLGDH +RSOLDVPDODEDULFXV 0RQFKROR
'HDFXHUGRFRQHOSHWLFLRQDULRHOiUHDGHLQÀXHQFLDDVXVWUDHUVHORFDOL]DHQORVOtPLWHV
Perciformes &LFKOLGDH &DTXHWDLDNUDXVLL 0RMDUUDDPDULOOD
GHSDUWDPHQWDOHVGH&HVDU\6DQWDQGHUHQWUHORVPXQLFLSLRVGH3XHUWR:LOFKHV\5tR1HJUR
$XFKHQLSWHULGDH Ageneiosus pardalis Doncella 6DQWDQGHU \6DQ0DUWtQ &HVDU GHHVWHPRGRHOiUHDGHLQÀXHQFLDVRFLRHFRQyPLFD
Doradiidae &HQWURFKLUFURFRGULOLL Matacaiman SDUDHOiUHDDVXVWUDHUWHPSRUDOPHQWHGHO3URJUDPD6tVPLFR'HQHO%ORTXH900
Loricaridae +\SRVWRPXVKRQGDH Coroncoro FRUUHVSRQGH D ODV FDEHFHUDV PXQLFLSDOHV GH 6DQ 0DUWtQ 5tR 1HJUR \ 3XHUWR :LOFKHV
Actinopterygii
Siluriformes
Pimelodus sp Nicuro SULQFLSDOPHQWHSRUODVYHQWDMDVTXHRIUHFHQHQORUHIHUHQWHDELHQHV\VHUYLFLRVTXHEULQGDQ
Pseudoplatystoma magda y que son necesarios para el desarrollo del proyecto, además porque en los procesos de
Pimelodidae Bagre rayado
leniatum JHVWLyQVRFLDO\FRQFHUWDFLyQFRPXQLWDULDHVQHFHVDULRUHFRQRFHUODVUHODFLRQHVSROtWLFR
Sorubim cuspicaudus Blanquillo DGPLQLVWUDWLYDV D QLYHO ORFDO HQ OD ]RQD TXH KDFH SDUWH OD 5HVHUYD )RUHVWDO 'H LJXDO
Pseudopimelodidae Pseudopimelodus bufonius Bagre sapo PDQHUDORVFHQWURVSREODGRVGHORVFRUUHJLPLHQWRVGH9LMDJXDO\%RFDVGHO5RVDULRHQ
Chondrichtyes Myliobatiformes Potamotrygonidae Potamotrygon magdalenae Raya 3XHUWR:LOFKHVUHFLELUiQWDPELpQORVLPSDFWRVLQGLUHFWRVSRUODDGTXLVLFLyQGHELHQHV\
* Especies reportadas solo en la entrevista. VHUYLFLRVPHQRUHVGHOD]RQD
** Especie exótica registrada solo en entrevista. 2.5.23REODFLyQDVHQWDGDHQHOiUHDGHLQÀXHQFLD
Fuente: Trabajo de campo MCS 2011 /DSREODFLyQGHOiUHDGHLQÀXHQFLDGHO3URJUDPD6tVPLFR%ORTXH900HVGHDSUR[L-
6HSXHGHHYLGHQFLDUTXHHQORVFXHUSRVGHDJXDPRQLWRUHDGRVGHQWURGHOiUHDGHLQWH- PDGDPHQWHSHUVRQDVFRQIRUPDGDVDVtKDELWDQWHVXELFDGRVHQODFDEHFHUD
UpVGHO%ORTXH900VHSUHVHQWDXQDFRPXQLGDGtFWLFDPHGLDQDPHQWHGLYHUVDGRQGHVH PXQLFLSDOGH3XHUWR:LOFKHVKDELWDQWHVHQODFDEHFHUDPXQLFLSDOGH6DQ0DUWtQ
UHSRUWDQyUGHQHVGHORVFXDOHVHO&KDUDFLIRUPHVHVHOPiVLPSRUWDQWH KDELWDQWHVVHORFDOL]DQHQODFDEHFHUDPXQLFLSDOGH5tR1HJURKDELWDQWHVVH
HQFXHQWUDQHQHOFHQWURSREODGR9LMDJXDO 6DQWDQGHU \KDELWDQWHVVHHQFXHQWUDQHQ
Especies con algún grado de amenaza. La siguiente tabla registra las características
HOFHQWURSREODGR%RFDVGHO5RVDULR 6DQWDQGHU 
EiVLFDVGHODPLJUDFLyQGHODVPiVLPSRUWDQWHVHVSHFLHVGHLFWLRIDXQDGHOiUHD\VXFDWH-
JRUtDGHDPHQD]DVHJ~QHOOLEURURMRGHSHFHVGXOFHDFXtFRODVGH&RORPELD\OD5HVROXFLyQ 3RURWUDSDUWHGHDFXHUGRFRQODLQIRUPDFLyQOHYDQWDGDHQFDPSRFRQORVUHSUHVHQ-
WDQWHVYHUHGDOHVVHFDOFXODHQSHUVRQDV
GHO0LQLVWHULRGH$PELHQWH9LYLHQGD\'HVDUUROOR7HUULWRULDO
/DVFDUDFWHUtVWLFDVSREODFLRQDOHVHQHOiUHDHVWiUHSUHVHQWDGDEiVLFDPHQWHSRUIDPLOLDV
NOMBRE CATEGORÍA de colonos campesinos y pescadores que llegaron de distintas partes del país, principalmente
ESPECIE MIGRACIÓN
COMÚN NACIONAL
GHODUHJLyQFRVWHUDFRPR6XFUH&yUGRED&HVDU\$QWLRTXLDKDFHPiVGHDxRVFRQHO
Esta especie realiza migraciones de tipo
$JHQHLRVXVSDUGDOLV Doncella corto, es decir desplazamientos de carácter EN REMHWLYRGHHVWDEOHFHUVHHQ]RQDVDSWDVSDUDHOSDVWRUHR\ORVFXOWLYRVDJUtFRODV
ORFDOPHQRUHVGHNP (VWDSREODFLyQWDPELpQVHFDUDFWHUL]DSRUHOIXHUWHDUUDLJR\XQVHQWLGRGHSHUWHQHQFLD
Leporinus sp Comelón
5HDOL]DPLJUDFLRQHVFRUWDVNP0LJUD
- FRQVXVWHUULWRULRVSDUWLFXODUPHQWHFRQORVUHFXUVRVQDWXUDOHVTXHHOPHGLROHVRIUHFH
durante los dos (2) periodos de aguas bajas. \DTXHH[LVWHODFRQFLHQFLDGHTXHGHSHQGHQGHODSURYHFKDPLHQWRTXHVHKDJDGHHVWRV
/RFDOHV\PHGLDQDV NP 0LJUD UHFXUVRV/DSHVFDWUDGLFLRQDOHVODSULQFLSDOIXHQWHGHDOLPHQWRHPSOHR\VXEVLVWHQFLD
de las ciénagas a los cauces principales y
6DPLQXVDI¿QLV Dorada
viceversa. Participa en migraciones mul-
VU TXHWLHQHQODVFRPXQLGDGHVGHHVWHVHFWRUVLQHPEDUJRHOJUDYHGHWHULRURDPELHQWDOHQ
WLHVSHFt¿FDV HVSHFLDOODGLVPLQXFLyQGHOFDXFHGHORVUtRVVXFRQWDPLQDFLyQDXQDGRFRQODVJUDQGHV
Según la opinión de la comunidad pescadora ROHDGDVLQYHUQDOHVKDQSURSLFLDGRXQDVREUHH[SORWDFLyQGHORVUHFXUVRVGLVPLQX\HQGRFRQ
es una de las primeras especies en iniciar la HOORODRIHUWDGHELHQHV\VHUYLFLRVHQHOiUHD
Trioportheus mag- migración cuando el nivel del río Magdalena
dalenae
Arenca
desciende. Sin embargo no está reportada
- 3RU RWUD SDUWH OD SREODFLyQ ÀRWDQWH HV UHSUHVHQWDWLYD FRQVLGHUDQGR HO GHVDUUROOR
en el listado de peces migradores de Usma GHDFWLYLGDGHVGHH[SORUDFLyQ\H[SORWDFLyQGHKLGURFDUEXURVSURSLFLDQGRODOOHJDGDGH
et al. (2009). IDPLOLDVPLJUDQWHVHQEXVFDGHDOWHUQDWLYDVGHWUDEDMR'HLJXDOIRUPDODSUHVHQFLDGH
Esta especie presenta un tipo de migración varias empresas agroindustriales, principalmente palmeras, contratan con periodicidad
Hoplias malabaricus Moncholo mediana y un estatus de residencia de - WUDEDMDGRUHVSDUDDFWLYLGDGHVFRPRSRGDVFRVHFKDVGHRULOODUDERQDUHQWUHRWUDVSRUOR
mígrate local.
FXDOVHSXHGHD¿UPDUTXHHQHOiUHDGHLQÀXHQFLDGLUHFWDFHUFDGHOGHODSREODFLyQ
/RFDO\GHPRYLPLHQWRVFRUWRV NP 
Curimata mivartii Vizcaina
que inician cuando el nivel del río desciende
VU es itinerante.
Principal especie migratoria del Magdalena. 2.5.33DWURQHVGHDVHQWDPLHQWRGHQWURGHOiUHDGHLQÀXHQFLDGHO3URJUDPDVtVPLFR
La primera migración río arriba ocurre '%ORTXH900
durante el primer estiaje anual (diciembre-
febrero). Cuando el agua asciende los /DV FDEHFHUDV PXQLFLSDOHV GH 6DQ 0DUWtQ 5LRQHJUR \ 3XHUWR :LOFKHV ORV FHQWURV
Prochilodus mag-
Bocachico
individuos migran aguas abajo hacia los
CR
SREODGRVGH9LMDJXDO\%RFDVGHO5RVDULRHQ6DQWDQGHUDVtFRPRORVFRUUHJLPLHQWRVGH
dalenae sistemas cenagosos. En el segundo estiaje 7RUFRURPD3LWD/LPyQ7HUUDSOpQ3XHUWR2FXOWR\&DPSR$PDOLDHQHOPXQLFLSLRGH
del año (julio-agosto) realizan una nueva
PLJUDFLyQDJXDVDUULEDTXH¿QDOL]DDOFR-
6DQ0DUWtQ &HVDU SUHVHQWDQXQSDWUyQGHDVHQWDPLHQWRQXFOHDGRFRQORFXDOVHSXHGH
mienzo de las lluvias en septiembre cuando DQDOL]DU TXH ORV FHQWURV SREODGRV TXH DOOt VH KDQ HVWDEOHFLGR KDQ DOFDQ]DGR PD\RUHV
inician de nuevo la migración aguas abajo. QLYHOHVGHRUJDQL]DFLyQVRFLDO
Migraciones locales y medianas (100-500 'HRWUDSDUWHVHWLHQHQTXHODVYHUHGDV/D6DOLQD/D&RQVXOWD/D0XVDQGD%DMD\
Piaractus brachypo- NP 0LJUDFRQ¿QHVUHSURGXFWLYRVDORV
mum
Cachama
planos inundables de acuerdo al pulso de
- &KLJXDJXDHQHOPXQLFLSLRGH5LRQHJUR\ODV9HUHGDVGH&DxR*UDQGH\0RQWDxLWD%DMDHQ
inundación de la cuenca. HOPXQLFLSLRGH3XHUWR:LOFKHVVHSUHVHQWDXQWLSRGHDVHQWDPLHQWRGLVSHUVRFDUDFWHUL]DGR
CR (reportado en SRUHOHVWDEOHFLPLHQWRGHVXVSREODGRUHVSDUDODUHDOL]DFLyQGHDFWLYLGDGHVDJURSHFXDULDV
Pseudoplatystoma
Migratoria local y de movimientos medios el libro rojo de pe- por la rentabilidad de los suelos.
Bagre rayado NP 3UHVHQWDPLJUDFLRQHVWDQWR ces dulceacuícolas
magdaleniatum
WUy¿FDVFRPRUHSURGXFWLYDV de Colombia como Grupos étnicos en el área. &RQEDVHHQHOR¿FLR2),*&3HPLWLGRSRU
P. fasciatum) HO0LQLVWHULRGHO,QWHULRU\GH-XVWLFLDHOGHMXQLRGH\HOR¿FLRGHO,QFRGHUFRQ
Migratoria local y de movimientos medios UDGLFDGR1RGHOGHQRYLHPEUHGHDOLQWHULRUGHOiUHDDVXVWUDHU
Sorubim cuspicaudus Curito NP TXHVHLQLFLDQFXDQGRHOQLYHO EN del programa sísmico 2D Bloque VMM-3, no se registra la presencia de comunidades
de las aguas comienza a descender. LQGtJHQDVQLFRQVHMRVFRPXQLWDULRVGHFRPXQLGDGHVQHJUDVSRUWDQWRQRVHUHTXLHUHOD
Pimelodus sp Barbudo
Para P. blochii durante las aguas en ascenso
- UHDOL]DFLyQGHFRQVXOWDSUHYLDHQHOiUHD(OSHWLFLRQDULRDQH[DORVR¿FLRVFRUUHVSRQGLHQWHV
se registran migraciones.
en el presente estudio.
Pueden desplazarse desde el cauce principal
Hypostomus hondae Coroncoro VU Socialización de la actividad considerada de utilidad pública e interés social. De
de los ríos a las ciénagas.
Pseudopimelodus DFXHUGRFRQORVGDWRVDSRUWDGRVSRUSDUWHGHOSHWLFLRQDULRDQH[DGRVDODSUHVHQWHVROLFLWXG
Bagre sapo No se registran migraciones. -
bufonius VHUHDOL]yODVRFLDOL]DFLyQGHOSUR\HFWRFRQODVDXWRULGDGHV\UHSUHVHQWDQWHVGHORVHQWHV
CR (reportado en WHUULWRULDOHV\FRQORVOtGHUHVGHFDGDXQDGHODVFRPXQLGDGHVGHOVHFWRUGHLQÀXHQFLDGHO
Pseudoplatystoma
Migratoria local y de movimientos medios el libro rojo de pe- iUHDGHVXVWUDFFLyQGHOD5HVHUYDGHO5tR0DJGDOHQDPHGLDQWHFRUUHVSRQGHQFLDHQYLDGD
Bagre rayado NP 3UHVHQWDPLJUDFLRQHVWDQWR ces dulceacuícolas
magdaleniatum
WUy¿FDVFRPRUHSURGXFWLYDV de Colombia como \UHXQLRQHVGHFDUiFWHULQIRUPDWLYR
P. fasciatum) Servicios ambientales de la Reserva Forestal. La Reserva Forestal del río Magdalena
Migratoria local y de movimientos medios establecida por Ley 2ª de 1959, aporta servicios ambientales imprescindibles para la so-
Sorubim cuspicaudus Curito NP TXHVHLQLFLDQFXDQGRHOQLYHO EN EUHYLYHQFLDGHODVFRPXQLGDGHVTXHDOOtKDELWDQDGHPiVSRVHHPXHVWUDVUHSUHVHQWDWLYDV
de las aguas comienza a descender.
GHOHFRVLVWHPDFXHQFDVKtGULFDVGLYHUVLGDGELROyJLFD\JUXSRVpWQLFRVSDWULPRQLRGHOD
Para P. blochii durante las aguas en ascenso
Pimelodus sp Barbudo
se registran migraciones.
- QDFLyQ$QLYHOVRFLRFXOWXUDOVHHQFXHQWUDHO5HVJXDUGR,QGtJHQD%DJXDO 6HJRYLD±$Q-
Pueden desplazarse desde el cauce principal
WLRTXLD TXHQRSHUWHQHFHDOD]RQDGHVXVWUDFFLyQTXHRFXSDHOSUHVHQWHHVWXGLR
Hypostomus hondae Coroncoro VU
de los ríos a las ciénagas 'HLJXDOPDQHUDODV&LpQDJDV&DxR*UDQGH\/D)DQJXDVRQiUHDVHVWUDWpJLFDVTXH
Pseudopimelodus
Bagre sapo No se registran migraciones. - FRQIRUPDQOD]RQDGHUHVHUYD\EULQGDQXQVHUYLFLRDPELHQWDODODEDVWHFHUDJXD\UHFXUVR
bufonius SHVTXHURGHOTXHVXEVLVWHQJUDQSDUWHGHORVKDELWDQWHVXELFDGRVHQiUHDVDOHGDxDVGHO
)XHQWH7UDEDMRGHFDPSR0&6 área a sustraer del área del programa sísmico 2D Bloque VMM-3.
Edición 48.475
8 DIARIO OFICIAL Jueves, 28 de junio de 2012

3URFHVRVSURGXFWLYRVGHOiUHDGHLQÀXHQFLD(QHOPXQLFLSLRGH6DQ0DUWtQHOVRSRUWH 2.7.1.2 Fauna


GHODHFRQRPtDHVODDFWLYLGDGDJURSHFXDULDFRQFXOWLYRVGHDUUR]VRUJRPDt]\XFDFDFDR Sin sustracción temporal. 'HDFXHUGRFRQHOWUDEDMRGHFDPSR\ODLQIRUPDFLyQVH-
HQWUHRWURVDVLPLVPRH[LVWHODH[SORWDFLyQGHSHWUyOHRHOHVWDEOHFLPLHQWRGHDJURLQGXVWULDV cundaria, el área que compone el bloque VMM-3 se encuentra representado con una alta
GHULYDGDVGHOFXOWLYRGHSDOPDDIULFDQDODJDQDGHUtDYDFXQDGHHQJRUGH\SURGXFFLyQ diversidad de especies típicas de la biota del Valle Medio del Magdalena.
OHFKHUD\ODDFWLYLGDGFRPHUFLDO
6HHQFRQWUDURQPDPtIHURVYRODGRUHVGHORUGHQ&KLURSWHUDTXHFXPSOHQLPSRUWDQWHV
En el municipio de Rionegro se desarrollan principalmente las actividades relaciona- IXQFLRQHVHQSURFHVRVGHUHJHQHUDFLyQ\SUHVHUYDFLyQGHODVGLIHUHQWHVFREHUWXUDVYHJHWDOHV
das con el sector primario de la economía, donde sobresale la agricultura, con cultivos de H[LVWHQWHVHQHOiUHDGHLQÀXHQFLD/RVFDUQtYRURVVRQXQRGHORVJUXSRVPiVGLYHUVRVHQ
DUUR]VRUJRFDFDRFDIpSOiWDQRFDxDDJXDFDWHIUXWDOHV\SDOPDDIULFDQD\ODJDQDGHUtD HOiUHD\UHSUHVHQWyHOGHORVPDPtIHURVUHSRUWDGRVHQOD]RQD
GHGREOHSURSyVLWRFRQVWLWX\pQGRVHHQODDFWLYLGDGHFRQyPLFDSULQFLSDO(QHOPXQLFLSLR
GH3XHUWR:LOFKHVODVDFWLYLGDGHVHFRQyPLFDVJLUDQHQWRUQRDODDJULFXOWXUDGRQGHVH 7DPELpQ VH SUHVHQWDURQ URHGRUHV \ SULPDWHV DVRFLDGRV D ORV ERVTXHV IUDJPHQWDGRV
GHVDUUROODQORVFXOWLYRVGHFDXFKRSDOPDDIULFDQD\DUUR]ODJDQDGHUtDSHVFD\PLQHUtD GHJUDQLPSRUWDQFLDSDUDOD5HVHUYD3RURWUDSDUWHHQHOiUHDGHVXVWUDFFLyQH[LVWHXQ
LPSRUWDQWH Q~PHUR GH HVSHFLHV DVRFLDGDV D ORV HFRVLVWHPDV GH FLpQDJDV TXH GHSHQGHQ
 Amenaza y susceptibilidad ambiental FRPSOHWDPHQWHGHORVUHFXUVRVDOOtH[LVWHQWHV
Amenazas naturales +D\TXHUHVDOWDUTXHODIDXQDGHOiUHDSUHVHQWDXQDJUDQYDULHGDGGHLQGLYLGXRVGH-
'HQWURGHOiUHDGHHVWXGLRVHHVWDEOHFLHURQFXDWURFODVHVGHDPHQD]DVQDWXUDOHVTXHVRQ ELGRDOFRPSOHMRFHQDJRVRDVRFLDGRDOD5HVHUYD)RUHVWDOSHURFRQXQDEDMDGHQVLGDG
Amenaza por Inundaciones. (QODFXDOVHFRQVLGHUDQGRV]RQDVGHDPHQD]DHQSULPHU SULQFLSDOPHQWHHQHOJUXSRGHORVPDPtIHURV(OORVHDWULEX\HDOFDPELRFOLPiWLFR\OD
OXJDUODV]RQDVFRQDPHQD]DDOWDSRULQXQGDFLyQTXHVHFRQVWLWX\HQHQODVSDUWHVPiV LQWHUYHQFLyQDQWUySLFDGRQGHHVWH~OWLPRDVSHFWRKDLQFLGLGRQHJDWLYDPHQWHFRQODFRQWD-
EDMDVGHOD]RQDGHHVWXGLRUHSUHVHQWDGDVSRUFRWDVPHQRUHVDPVQP&RUUHVSRQGH PLQDFLyQGHODVIXHQWHVKtGULFDVODGLVSRVLFLyQLQDGHFXDGDGHUHVLGXRVVyOLGRV\OtTXLGRV
JHROyJLFDPHQWHDORVGHSyVLWRVÀXYLRODFXVWUHV 4À TXHVHORFDOL]DQHQORVDOUHGHGRUHV ODUHGXFFLyQGHODYHJHWDFLyQERVFRVDTXHHVODSULQFLSDOIXHQWHGHDOLPHQWDFLyQ\UHIXJLR
GHODVFLpQDJDV\TXHVHHQFXHQWUDQLQWHUFRQHFWDGDVFRQORVUtRV0DJGDOHQD\/HEULMDORV SDUDODIDXQD\ODGLVFRQWLQXLGDGGHORVFRUUHGRUHVELROyJLFRV
FXDOHVVHGHVERUGDQHQODVpSRFDVGHOOXYLDV Con sustracción temporal. 6HHVSHUDTXHQRVHJHQHUDUiXQDOWRLPSDFWRDPELHQWDO
(QVHJXQGROXJDUVHHQFXHQWUDQODV]RQDVFRQDPHQD]DPHGLDSRULQXQGDFLyQTXH VREUHORVJUXSRVIDXQtVWLFRVUHSRUWDGRVGDGRTXHODVPHGLGDVGHPDQHMRDPELHQWDOTXH
FRUUHVSRQGHQDODViUHDVXELFDGDVHQWUHODVFRWDVPVQPODVFXDOHVVRQVXVFHSWL- VHLPSOHPHQWDUiQHQHO3URJUDPD6tVPLFRVXJLHUHQVDQFLRQHVDOSHUVRQDOTXHPDQLSXOH
EOHVGHLQXQGDFLyQSHURSRUHVWDUHQXQDFRWDPiVDOWDWLHQHQPHQRVSRVLELOLGDGHVGHVHU RFDXVHGDxRLQWHQFLRQDODDOJ~QWLSRGHHVSHFLHIDXQtVWLFD/RVHIHFWRVTXHVHSRGUtDQ
DOFDQ]DGRVSRUODVDJXDVGHGHVERUGHGHOVLVWHPDUtRVFLpQDJDV FDXVDUVREUHODIDXQDVRQHODKX\HQWDPLHQWRRGHVSOD]DPLHQWRWHPSRUDOGHODVHVSHFLHV
Amenaza por procesos erosivos. (VWRVVHSUHVHQWDQGRQGHODFRPELQDFLyQGHORVIDFWRUHV GXUDQWHODHMHFXFLyQGHODVDFWLYLGDGHVGHOSUR\HFWR
FOLPiWLFRV\WHFWyQLFRVVXPDGDVDODVSUiFWLFDVSURGXFWLYDVSURSLFLDQODJHQHUDFLyQGH &RQVLGHUDQGRODIDXQDFRQ\VLQVXVWUDFFLyQVHFRQFOX\HTXHVXDFWXDOVLWXDFLyQSR-
SURFHVRVFRPRODHURVLyQODPLQDU1RREVWDQWHGDGRTXHHOiUHDGHVXVWUDFFLyQSUHVHQWD EODFLRQDOGHVHPSHxR\SDSHOHQORVHFRVLVWHPDV\FREHUWXUDVH[LVWHQWHVHQHOiUHDGHOD
un relieve plano, no se espera que el programa sísmico acelere estos procesos. 5HVHUYD)RUHVWDOQRVHDIHFWDUiQ\DTXHODVDFWLYLGDGHVQRJHQHUDUiQLPSDFWRVVLJQL¿FDWLYRV
Amenaza sísmica. &RQEDVHHQORVUDQJRVGHDFHOHUDFLRQHVVHxDODGDVSRUHOPDSD sobre el área y la mayoría de ellos son no acumulables.
GHDPHQD]DVtVPLFDGH&RORPELDGH,QJHRPLQDVHOiUHDGHLQÀXHQFLDGLUHFWDSUHVHQWD 2.7.1.35HGKLGUROyJLFDHKLGURJHROyJLFD
YDORUHVGH$DGHDJTXHVHFRQVLGHUDLQWHUPHGLD Sin sustracción temporal. 'HDFXHUGRFRQHOSHWLFLRQDULRORVFXHUSRVGHDJXDOyWLFRV
Amenaza por licuación de arenas. 6HSUHVHQWDQHQDTXHOORVVLWLRVGRQGHHOWHUUHQRHVWi \OpQWLFRVSUHVHQWHVHQOD]RQDDSRUWDQVXVDJXDVSDUDHOGHVDUUROORGHODVDFWLYLGDGHV
FRQIRUPDGRSRUGHSyVLWRVOLPRVRV\RDUHQRVRVGHJUDQHVSHVRUSRFRFRQVROLGDGRVFRQ DQWUySLFDVGHVDUUROODGDVHQHOiUHDWDOHVFRPRODJDQDGHUtDDJULFXOWXUD\SHVFDDFWLYL-
QLYHOIUHiWLFRDSRFRVPHWURVGHSURIXQGLGDG\FHUFDQRVD]RQDVJHQHUDGRUDVGHVLVPRV GDGHVTXHHVWiQHMHUFLHQGRXQDIXHUWHSUHVLyQQHJDWLYDVREUHODVIXHQWHVKtGULFDVPi[LPH
VRPHURVGHPDJQLWXGPRGHUDGDRJUDQGH(QHOFDVRGHOiUHDGHHVWXGLRORVGHSyVLWRV FRQHOXVRGHDJURTXtPLFRVLQVHFWLFLGDV\IXQJLFLGDVTXHHOVHFWRUDJURSHFXDULRHPSOHD
GHOODQXUDDOXYLDO 4IDO \ÀXYLRODFXVWUHV 4À VHFRQVWLWX\HQHQiUHDVVXVFHSWLEOHVDOD JHQHUDQGRODFRQWDPLQDFLyQSURJUHVLYDGHHVWRVFXHUSRVGHDJXD
OLFXHIDFFLyQGHDUHQDV (QHOiUHDGHLQÀXHQFLDGLUHFWDHLQGLUHFWDDFWXDOPHQWHVHGHVDUUROODQGLIHUHQWHVDF-
&RQ EDVH HQ OR DQWHULRUPHQWH H[SXHVWR GH DFXHUGR FRQ HO SHWLFLRQDULR VH SXHGH WLYLGDGHVTXHSXHGHQOOHJDUDDIHFWDUHOHVWDGRQDWXUDOGHODVDJXDVVXEWHUUiQHDVFRPR
FRQFOXLUTXHODVDFWLYLGDGHVGHO3URJUDPD6tVPLFR'HQHO%ORTXH900QRJHQHUDUiQ ODJHQHUDFLyQGHDJXDVVHUYLGDVHVWDEOHFLPLHQWRVGHGHVDJHVLQWUDWDPLHQWRDOVXHOR
HIHFWRVTXHSRWHQFLDOLFHQODVDPHQD]DVDQWHVH[SXHVWDVGDGRTXHOD]RQDGHHVWXGLRHV LUULJDFLyQGHOVXHORFRQSURGXFWRVTXtPLFRVDUUDVWUHGHPDWHULDIHFDOSRUODJDQDGHUtD\
RQGXODGDDSODQD\QRKD\SUHVHQFLDGHSURFHVRVHURVLYRVIXHUWHVTXHVHDFUHFLHQWHQSRU arrastre de contaminantes derivados de actividades mineras.
las actividades del proyecto. Con sustracción temporal. Para las actividades a desarrollar se requerirá de agua
2.7 Análisis ambiental SULQFLSDOPHQWH SDUD HO IXQFLRQDPLHQWR GH ORV FDPSDPHQWRV EDVH \ YRODQWHV \ SDUD OD
De acuerdo con el peticionario, el área de la Reserva Forestal que se traslapa con el SHUIRUDFLyQGHORVSR]RVGRQGHVHHVWDEOHFHUiQODVFDUJDV3DUDODREWHQFLyQGHODJXDVH
3URJUDPD6tVPLFR%ORTXH'900SUHVHQWDYDULDGRVWLSRVGHFREHUWXUDVYHJHWDOHV WUDPLWDUiHOSHUPLVRUHVSHFWLYRDWUDYpVGHODV&RUSRUDFLRQHV$XWyQRPDV5HJLRQDOHVGHO
FRQXQDGLVSRVLFLyQHVSDFLDOKHWHURJpQHDDVRFLDGDVFRQODGLQiPLFDLQXQGDEOHGHORV iUHD &$6&'0%\&RUSRFHVDU 1RREVWDQWHODGHPDQGDGHHVWHUHFXUVRQRHVVLJQL¿FD-
UtRV/HEULMD\0DJGDOHQDFRPRHVHOFRPSOHMRFHQDJRVRTXHDEDUFDODPD\RUSDUWHGH WLYDQRJHQHUDUiSUHVLRQHVLPSRUWDQWHV\SRUWDQWRQRDIHFWDUiORVVHUYLFLRVTXHSUHVWDHQ
OD5HVHUYD\VXVKHUED]DOHVSUy[LPRVDGHPiVGHORVSDVWRVOLPSLRVHOPRVDLFRGHSDVWRV la comunidad como el mantenimiento de las poblaciones rurales, el riego de los cultivos,
FRQHVSDFLRVQDWXUDOHV\XQDVSHTXHxDViUHDVGHERVTXHIUDJPHQWDGR(VWRVERVTXHVVH el agua para el ganado y la pesca.
KDQVXVWLWXLGRHQVXPD\RUSDUWHSRUSDVWL]DOHVSDUDODJDQDGHUtDFRQVWLWX\pQGRVHHQOD 3RURWUDSDUWHHQORUHIHUHQWHDOLPSDFWRVREUHODVDJXDVVXEWHUUiQHDVVHFRQVLGHUD
SULQFLSDODFWLYLGDGSURGXFWLYDTXHKDFDXVDGRFDPELRVHQHOXVRGHOVXHORQRREVWDQWH PHGLDQDPHQWHVLJQL¿FDWLYRSRUORVSRVLEOHVYHUWLPLHQWRVGHDJXDVUHVLGXDOHVQRREVWDQWH
ODSUHVHQFLDGHOFRPSOHMRFHQDJRVRGHDOJXQRVUHOLFWRVGHERVTXH\HVSDFLRVQDWXUDOHV SDUDHOORVHHVWDEOHFHUiQPHGLGDVGHPDQHMRTXHPLQLPL]DUiQHOLPSDFWR\HQFDVRGH
FX\DIXQFLyQHFROyJLFD\DPELHQWDOHVLPSRUWDQWHGHVWDFDQODLPSRUWDQFLDGHFRQVHUYDU UHDOL]DUVHYHUWLPLHQWRVVREUHHOVXHORVHKDUiQFRQSUHYLRWUDWDPLHQWR
HVWDViUHDVGH5HVHUYDFRQODPHQRULQWHUYHQFLyQDQWUySLFD Interrelación de los diferentes componentes bióticos, abióticos y socioeconómicos
$FRQWLQXDFLyQVHSUHVHQWDHODQiOLVLVDPELHQWDOGHOiUHDFRQ\VLQVXVWUDFFLyQGHOD Sin sustracción temporal. Las comunidades asentadas sobre la Reserva Forestal
5HVHUYDIRUHVWDOFRQVLGHUDQGRSDUDHOORODVDFWLYLGDGHVDLPSOHPHQWDUSRUSDUWHGHOSUR- QRFHQWUDQVXVHVIXHU]RVHQHOXVRVRVWHQLEOHGHORVUHFXUVRVQDWXUDOHV\DTXHOD]RQD
grama sísmico y la sinergia con los proyectos y servicios que presta la Reserva. se encuentra muy intervenida como consecuencia del desarrollo de actividades como la
2.7.1 &RQGLFLyQGHORVHFRVLVWHPDVUHVSHFWRGHVXELRGLYHUVLGDGHQWpUPLQRVGHÀRUD H[SORWDFLyQPDGHUHUD\ODDPSOLDFLyQGHODIURQWHUDDJURSHFXDULD
fauna y su vulnerabilidad (OGRFXPHQWRGHWHUPLQDTXHORVVHUYLFLRVVRFLRDPELHQWDOHVTXHRIUHFHOD5HVHUYD)R-
2.7.1.1 Flora UHVWDOVRQODSURWHFFLyQGHOVXHORODSURGXFFLyQGHR[tJHQR\¿MDFLyQGH&22, el manteni-
Sin sustracción temporal(QHVWHtWHPHOSHWLFLRQDULRH[SRQHODVFREHUWXUDVYHJHWDOHV PLHQWRGHIDXQDVLOYHVWUHODSURGXFFLyQ$JUtFRODHOOHYDQWHGH*DQDGR\HOVRVWHQLPLHQWR
HQFRQWUDGDVHQOD]RQD\VXIUDJPHQWDFLyQSRUHOGHVDUUROORGHODVDFWLYLGDGHVTXHVHDGH- \FRQVHUYDFLyQGHODJXD
ODQWDQHQOD]RQD1RREVWDQWHVHPDQL¿HVWDTXHORVIUDJPHQWRVGHERVTXHVDFWXDOPHQWH Con sustracción temporal. 'HDFXHUGRFRQHOSHWLFLRQDULRHO3URJUDPD6tVPLFRQR
H[LVWHQWHVSRUXELFDUVHHQFHUFDQtDVD]RQDVGHDQHJDPLHQWRKDQSHUPDQHFLGRFRQSRFD JHQHUDUiDIHFWDFLyQDORVFRPSRQHQWHVVRFLRDPELHQWDOHV\HQORVFDVRVGHRFXUUHQFLDHVWRV
LQWHUYHQFLyQDQWUySLFDIDYRUHFLHQGRVXGHVDUUROORFRQVWLWX\pQGRVHHQERVTXHVPDGXURV VHUiQEDMRV'HLJXDOIRUPDVHSUHVHQWDQODVSULQFLSDOHVPHGLGDVDWHQHUHQFXHQWDHQHO
FRQHVSHFLHVUHSRUWDGDVFRQDOJ~QJUDGRGHLQWHUYHQFLyQSRUORFXDOVHLQVWDDVXFRQVHU- SURJUDPDVtVPLFRDFRUGHFRQORVOLQHDPLHQWRVQRUPDWLYRV(OHVWXGLRD¿UPDTXHHQORV
YDFLyQSRUVXUHSUHVHQWDWLYLGDGFRPRUHVJXDUGRGHÀRUD\IDXQDSDUDHOiUHDGHOD5HVHUYD FXHUSRVGHDJXD OyWLFRV\OpQWLFRV DVHQWDPLHQWRVKXPDQRVHLQIUDHVWUXFWXUDVRFLDOQR
6HUHIHUHQFLDORVWUHVFRUUHGRUHVHFROyJLFRVSUHVHQWHVHQOD]RQDORVFXDOHVVRQ VHOOHYDUiDFDERSHUIRUDFLyQQLGHWRQDFLyQGHFDUJDVVLQHPEDUJRVHUHDOL]DUiUHJLVWUR
1. El complejo cenagoso asociado al río Lebrija, correspondiente a la cobertura de 3URSXHVWDGH]RQL¿FDFLyQDPELHQWDO\GHPDQHMRGHODDFWLYLGDGSDUDHOGHVDUUROOR
herbazal denso. del proyecto
2. El corredor conformado por la ciénaga Grande, el Caño Grande y la ciénaga Caño =RQL¿FDFLyQDPELHQWDO
Grande. =RQL¿FDFLyQ$PELHQWDOGHO3URJUDPD6tVPLFR'(VWD]RQL¿FDFLyQVHREWLHQHGHOD
3. El corredor del río Lebrija. VXSHUSRVLFLyQGHORVUHVXOWDGRVGHODVGLVWLQWDVXQLGDGHVKRPRJpQHDVGHORVPHGLRVDELy-
Con sustracción temporal. (OSHWLFLRQDULRLQIRUPDTXHODLPSOHPHQWDFLyQGHOSURJUDPD WLFRVELyWLFRV\VRFLRHFRQyPLFRVTXHSHUPLWHQGH¿QLUODSRVLELOLGDGGHXVR\UHVWULFFLyQ
VtVPLFR'900QRDIHFWDUiORVVHUYLFLRVDPELHQWDOHVQLHFRVLVWpPLFRVGHOD5HVHUYD para el desarrollo del programa sísmico 2D VMM-3.
)RUHVWDO\DTXHODVDFWLYLGDGHVDGHVDUUROODUHQHOSURJUDPDQRJHQHUDUiQPRGL¿FDFLRQHV (QHOiUHDGHO3URJUDPD6tVPLFR'VHFDWDORJDQFRPRiUHDVGHPX\DOWDVHQVLEL-
SHUPDQHQWHVHQHOHQWRUQR\ORVLPSDFWRVJHQHUDGRVVRQGHEDMDVLJQL¿FDQFLDDPELHQWDO OLGDGORVFXHUSRVGHDJXDFRPRHOUtR/HEULMD\VXVDÀXHQWHVFRQODVUHVSHFWLYDVIUDQMDV
7DPELpQ VH VHxDOD TXH ORV FDPSDPHQWRV \ ]RQDV GH GHVFDUJXH VH UHDOL]DUiQ HQ ]RQDV GHSURWHFFLyQGHPORVFRPSOHMRVFHQDJRVRVGHOiUHDLQFOX\HQGRVXViUHDVGHGHV-
LQWHUYHQLGDVTXHQRWLHQHQFREHUWXUDYHJHWDOOHxRVDHQORVSDVWRVOLPSLRVTXHVHXELFDQ borde y los asentamientos nucleados de los corregimientos y veredas. Como áreas de
IXHUDGHOD5HVHUYD\SRUWDQWRQRVHUHDOL]DUiDSURYHFKDPLHQWRIRUHVWDOSDUDHOGHVDUUROOR DOWDVHQVLELOLGDGVHWLHQHXQDSHTXHxDiUHDSRUIXHUDGHOEORTXHHQOD]RQDGHLQÀXHQFLD
del programa sísmico. GLUHFWDFRQKHUED]DOHV
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 9
(QODViUHDVGHPRGHUDGDVHQVLELOLGDGHVWiQODV]RQDVGHSDVWRVPRVDLFRVGHSDVWRV (OREMHWRGHOHVWXGLR³6XVWUDFFLyQ7HPSRUDOGHOÈUHDGH5HVHUYD)RUHVWDOGHO5tR0DJ-
KHUED]DOHV\YHJHWDFLyQDFXiWLFDVREUHFXHUSRVGHDJXD\R]RQDVGHDOWRSRWHQFLDOKLGUR- GDOHQDSDUDHOSURJUDPDVtVPLFR'%ORTXH900´HVVROLFLWDUODVXVWUDFFLyQWHPSRUDO
JHROyJLFR(QODViUHDVGHEDMDVHQVLELOLGDGVHWLHQHQ]RQDVFRQFREHUWXUDVGHKHUED]DOHV GHKDODVFXDOHVHTXLYDOHQDORVNPGHORQJLWXGGHOSURJUDPDVtVPLFR\XQ
SDVWRVPRVDLFRVGHSDVWRV\]RQDVGHEDMRSRWHQFLDOKLGURJHROyJLFR EXIIHUGHPUHTXHULGRSDUDLPSOHPHQWDUHO3URJUDPD6tVPLFR'%ORTXH900(O
=RQL¿FDFLyQGHPDQHMRGHODDFWLYLGDG8QDYH]KHFKDODSURSXHVWDGH]RQL¿FDFLyQ GHVDUUROORGHHVWH3URJUDPDVHWLHQHSUR\HFWDGRSDUDVHPDQDVSRUWDOPRWLYRHQFDVR
\GHPDQHMRGHODDFWLYLGDGUHDOL]DGDSDUDHO3ODQGHPDQHMRGHO3URJUDPD6tVPLFROD GHVHUYLDEOHODVXVWUDFFLyQHVWDVHUiSRUODVGLHFLVpLV  VHPDQDVSURSXHVWDV
FXDOHVSURGXFWRGHODGHVFULSFLyQ\FDUDFWHUL]DFLyQDPELHQWDOGHORVFRPSRQHQWHVItVLFR El desarrollo del programa sísmico, de acuerdo con el peticionario, se desarrollará
ELyWLFR\VRFLRHFRQyPLFRVHREWLHQHQGLIHUHQWHVQLYHOHVGHVHQVLELOLGDGTXHLQGLFDQODV WHQLHQGRFRPRPHWRGRORJtDODVtVPLFDHQGRVGLPHQVLRQHVQRJHQHUDUiPRGL¿FDFLRQHVHQHO
]RQDVDLQWHUYHQLURGHH[FOXVLyQ SDLVDMHRJHRIRUPDVSXHVWRTXHQRUHTXLHUHFRQVWUXFFLyQGHYtDVGHDFFHVRHLQIUDHVWUXFWX-
'HQWURGHODViUHDVGHH[FOXVLyQVHHQFXHQWUDQORVDVHQWDPLHQWRVKXPDQRVLQIUDHVWUXFWXUD UDVSHUPDQHQWHV/RVFDPSDPHQWRV\]RQDVGHGHVFDUJDTXHVHDGHF~HQVHUiQFRQVWUXLGRV
VRFLDOSR]RVGHDJXDROHRGXFWROtQHDHOpFWULFDFLpQDJDV\FXHUSRVGHDJXD(QODViUHDV HQiUHDVGHSDVWRVOLPSLRVRHQPDOH]DGRVGRQGHQRVHUHPRYHUiQHVSHFLHVYHJHWDOHVFRQ
GHLQWHUYHQFLyQFRQUHVWULFFLyQVHWLHQHQORVERVTXHV\KHUED]DOHVLQIUDHVWUXFWXUDYLDO\ '$3VXSHULRUHVDORVFPODYHJHWDFLyQQRVHUiDUUDQFDGDGHOSLVRVLQRTXHVHFRUWDUi
GHVHUYLFLRV\]RQDVGHSRWHQFLDOKLGURJHROyJLFR(QODV]RQDVVXVFHSWLEOHVGHLQWHUYHQFLyQ DFPGHODUDt]SDUDIDFLOLWDUVXUHEURWH\UHYHJHWDOL]DFLyQQDWXUDO
VHWLHQHQSDVWRVFXOWLYRV\]RQDVGHEDMRSRWHQFLDOKLGURJHROyJLFR /DDGTXLVLFLyQGHODJXDQHFHVDULDWDQWRSDUDHOQRUPDOIXQFLRQDPLHQWRGHORVFDPSD-
/DVLJXLHQWHWDEODFRPSHQGLDOD]RQL¿FDFLyQGHPDQHMRDPELHQWDOGHODDFWLYLGDGSDUD PHQWRVFRPRSDUDHOIXQFLRQDPLHQWRGHWDODGURV\GHPiVDFWLYLGDGHVSURSLDVGHO3URJUD-
el área por línea. PD6tVPLFRVHUiVROLFLWDGDDODV&$6 &RUSRUDFLyQ$XWyQRPD5HJLRQDOGH6DQWDQGHU 
Línea È5($ KD % ZONIFICACIÓN DE LA ACTIVIDAD &'0% &RUSRUDFLyQ$XWyQRPD5HJLRQDOSDUDOD'HIHQVDGHOD0HVHWDGH%XFDUDPDQJD 
/(1$ 0,20  \&RUSRFHVDUDWUDYpVGHFRQFHVLRQHVGHDJXDHQSXQWRVGH¿QLGRV
/(1$ 0,19 17,75 /D]RQDGHOSUHVHQWHHVWXGLRVHORFDOL]DDOLQWHULRUGHODFXHQFDGHO9DOOHPHGLRGHO
/(1$ 0,30  Magdalena, donde se presentan dos regiones naturales como son las estribaciones orien-
/(1$ 0,27 25,09
WDOHVGHOD6HUUDQtDGH6DQ/XFDV\HO9DOOHGHO5tR0DJGDOHQD/DVURFDVFRQVWLWX\HQWHV
Área de exclusión (1,09 Ha – 25,94%) GHOiUHDDQLYHOUHJLRQDODEDUFDQXQUHJLVWURGHWLHPSRJHROyJLFRFRPSUHQGLGRGHVGHHO
/(1$ 0,02 
7ULiVLFR-XUiVLFRKDVWDGHSyVLWRVLQFRQVROLGDGRVGHO&XDWHUQDULR
/(1$ 0,02 
/DVSULQFLSDOHVIDOODVKDQVLGRGH¿QLGDVFRPR/DV%ULVDV6LPLWt\6DQ%ODVXELFDGDV
/(1$ 0,05 
IXHUDGHOiUHDGHLQÀXHQFLDGHOSUHVHQWHHVWXGLR(QHOiUHDREMHWRGHVXVWUDFFLyQVHHQFXHQWUD
/(1$ 0,03 
ODIDOODGH&DxDEUDYDOFRQRULHQWDFLyQ1(TXHSUHVHQWDGHVSOD]DPLHQWRUXPERGH[WUDO
/(1$ 0,01 5,07
Respecto al uso actual del suelo, en el área del Bloque VMM3 se desarrolla primor-
/(1$ 0,13  Intervención con restricción (0,27 Ha – 6,49%)
GLDOPHQWHODDFWLYLGDGDJURSHFXDULDFRQHOHVWDEOHFLPLHQWRGHODJDQDGHUtDH[WHQVLYD\
/(1$ 0,01 3,59 la agricultura de autoconsumo, pese a que en la Reserva la aptitud prioritaria del suelo
/(1$ 0,12  HVODIRUHVWDO
/(1$ 0,11  Susceptibles de intervención (2,85 Ha – 67,57%)
$FWXDOPHQWHHOiUHDVHHQFXHQWUDPX\LQWHUYHQLGDFRQXQHYLGHQWHFDPELRHQODFR-
/(1$  51,23 EHUWXUDYHJHWDORULJLQDOGRQGHODVXQLGDGHVGHFREHUWXUDHVWiQIRUPDGDVSULQFLSDOPHQWH
/(1$ 0,23 8,05 SRUSDVWRVOLPSLRV\HQPDOH]DGRVKHUED]DOHVGHQVRVERVTXHVIUDJPHQWDGRVPRVDLFRVGH
11-LENA-307 0,54 18,99 pastos y áreas naturales.
11-LENA-309 0,07 2,35
Susceptibles de intervención (2,85 Ha – 67,57%) /RVFRQÀLFWRVGHXVRGHOVXHORLGHQWL¿FDGRVHQHOiUHDREMHWRGHODVXVWUDFFLyQVRQ
11-LENA-311 0,06 2,16 FDXVDGRVSRUODGHIRUHVWDFLyQGHiUHDVERVFRVDVFRPRFRQVHFXHQFLDGHODH[SDQVLyQGH
11-LENA-313 0,26 9,03 ODIURQWHUDDJUtFROD\JDQDGHUD
11-LENA-315 0,01 0,41 (QHOFDStWXORGHKLGURORJtDHOVLVWHPDKLGUROyJLFRHQHOÈUHDGHLQÀXHQFLDGHO3UR\HFWR
11-LENA-319 0,11 3,84 HVWiGHWHUPLQDGRSRUODVXEFXHQFDGHO5tR/HEULMDPLFURFXHQFDVGHO&DxR*UDQGH\&DxR
Fuente: GEOCOL CONSULTORES S. A., 2011. 9LHMR\HO&RPSOHMRFHQDJRVRODVFXDOHVGHWHUPLQDQODGLQiPLFDGHOiUHD
2.9 Restauración ecológica por sustracción 'HQWURGHORVVLVWHPDVOyWLFRVVHHQFXHQWUDODFXHQFDVXSHULRUGHO5tR/HEULMD&DxR
/DVPHGLGDVGHUHVWDXUDFLyQHVWiQHQIRFDGDVHQODUHJHQHUDFLyQYHJHWDOGHOVRWRERV- YLHMR\&DxRJUDQGH3RURWUDSDUWHORVVLVWHPDVOpQWLFRVTXHFRQIRUPDQHOiUHDVRQODV
TXHSRUWUDWDUVHGHOSULQFLSDOFRPSRQHQWHELyWLFRTXHVHDIHFWDUiFRQODVDFWLYLGDGHVGHO &LpQDJDV&DxR*UDQGH/D)DQJXD/DUJD*UDQGH*DOiSDJRV0DFKR/D/DJXQD/D
programa sísmico. Consulta.
3DUDHOORVHSURSRQHXQDPHWRGRORJtDGHUHJHQHUDFLyQQDWXUDODVLVWLGDVREUHODVOtQHDV /DHMHFXFLyQGHO3URJUDPD6tVPLFR'%ORTXH900QRUHDOL]DUiLQWHUYHQFLRQHV
VtVPLFDVTXHDWUDYLHVDQFREHUWXUDVGHERVTXHSRUPHGLRGHODUHFROHFFLyQGHORVUHVLGXRV VREUHORVFXHUSRVGHDJXDGH¿QLGRVVREUHORVFUXFHVGHOtQHDVVtVPLFDVSRUWDQWRQRKDEUi
YHJHWDOHVTXHSXHGDQLQWHUIHULUFRQODJHUPLQDFLyQGHODVVHPLOODV\HOOLEUHHVSDFLRSDUD DIHFWDFLRQHVDOUHFXUVRKtGULFRGHULYDGDVGHOSUR\HFWR
HOFUHFLPLHQWRHQHOVXHORSDUDORFXDOVHFRUWDUiQHQVHJPHQWRVSHTXHxRVODVUDPDVFRQ $OLQWHULRUGHOiUHDGHVXVWUDFFLyQVHSUHVHQWDXQDDOWDGHQVLGDGGHUHFXUVRVKtGULFRV
grandes grosores y alturas que no puedan ser amarradas y otras ramas serán recolectadas TXHVRQHPSOHDGRVSRUODSREODFLyQSDUDFRQVXPRKXPDQRGRPpVWLFR\DFWLYLGDGHVDJUR-
y usadas para el cierre de los accesos. SHFXDULDV3RURWUDSDUWHVHLGHQWL¿FDODSHVFDFRPRXQDLPSRUWDQWHDFWLYLGDGHFRQyPLFD
(Q ORV OXJDUHV GRQGH VH REVHUYHQ VHPLOODV HVWDV VHUiQ SODQWDGDV SDUD IDYRUHFHU OD HQOD]RQD
UHJHQHUDFLyQ QDWXUDO 3RU FRQVLJXLHQWH VH WRPDUiQ ODV VHPLOODV SDUD OD UHJHQHUDFLyQ
natural, del mismo lugar que atraviesa la línea sísmica. (OiUHDGHLQÀXHQFLDSDUDODVXVWUDFFLyQGHOSURJUDPDVtVPLFR900FRUUHVSRQGH
DXQ%RVTXHK~PHGRWURSLFDO %K7 GHDFXHUGRFRQODV]RQDVGHYLGDVGH+ROGULGJHFRQ
El peticionario presenta una propuesta para rehabilitación, restauración y restitución GRVSURYLQFLDVGHKXPHGDGVHPLK~PHGRFRUUHVSRQGLHQWHD]RQDVK~PHGDVGHERVTXHV
por sustracción desarrollando las siguientes actividades: FODURV\VHPLiULGRFRUUHVSRQGLHQWHD]RQDVK~PHGDVGHHVWHSD\RVDEDQD
‡'HVPDQWHODPLHQWR\DEDQGRQR
'HQWURGHODVFREHUWXUDVYHJHWDOHVDVRFLDGDVDO3URJUDPD6tVPLFRGHOiUHDGHLQÀXHQFLD
Para ello la empresa organizará y programará unas cuadrillas de trabajo que se en- VHHQFXHQWUDQHOKHUED]DOGHQVRFRQXQiUHDGHKDHO0RVDLFRGHSDVWRVFRQ
cargarán de recorrer todas las líneas y los accesos utilizados, reacondicionar y limpiar la HVSDFLRVQDWXUDOHV KD ORVSDVWRVOLPSLRV KD HOERVTXHIUDJPHQWDGR 
IUDQMDLQWHUYHQLGDSDUDYHUL¿FDUHOWDSRQDGRGHWRGRVORVSR]RVODUHFROHFFLyQGHWRGDVODV KD ODYHJHWDFLyQDFXiWLFDVREUHFXHUSRGHDJXD KD \SDVWRVHQPDOH]DGRV KD 
banderolas plásticas, cintas de señalización, letreros informativos, pasos y adecuaciones en
cruces y alambres de fulminantes y demás elementos de la labor que hayan sido dejados en (QHOtWHPFRUUHVSRQGLHQWHDFRPSRVLFLyQÀRUtVWLFDSDUDODFREHUWXUD0RVDLFRGHSDVWRV
las coberturas por las labores de apertura de trochas y adecuación de zonas de campamentos. FRQHVSDFLRVQDWXUDOHVVHLGHQWL¿FDURQLQGLYLGXRVUHSUHVHQWDGRVSRUHVSHFLHV\
Finalizadas las labores de cierre de pozos y recolección de material ajeno al entorno natural IDPLOLDV/DVWUHVIDPLOLDVFRQPD\RUDEXQGDQFLDVRQOD)$%$&($(FRQLQGLYLGXRV
en las líneas sísmicas, se clausurarán sus accesos. Los sitios intervenidos serán limpiados JpQHURV\HVSHFLHVOXHJROHVLJXHODIDPLOLD&$3$5È&($(FRQLQGLYLGXRVSHUWHQH-
y readecuados ambientalmente en su totalidad. FLHQWHVDJpQHURV\HVSHFLHV\¿QDOPHQWHODIDPLOLD$1121$&($(FRQLQGLYLGXRV
‡5HVWDXUDFLyQ GLVWULEXLGRVHQJpQHUR\HVSHFLHV1RREVWDQWHVHHQFRQWUyTXHXQDHVSHFLHUHSRUWDGD
FRPR*XDUGD0DGXURQRVHHQFXHQWUDGHELGDPHQWHLGHQWL¿FDGDHQHOHVWXGLR
Se llevará a cabo en aquellas áreas donde se presente pérdida de la cobertura vegetal
SRUODDSHUWXUDGHWURFKDV\DGHFXDFLyQGHFDPSDPHQWRVYRODQWHVSDUDHOORVHSURSRQH 'HDFXHUGRFRQHOFRH¿FLHQWHGHPH]FODVHSXHGHLQIHULUTXHSRUFDGDGRVLQGLYLGXRV
una metodología de regeneración natural asistida sobre las líneas sísmicas que atraviesan PXHVWUHDGRVHVSRVLEOHHQFRQWUDUXQDQXHYDHVSHFLHORTXHLQGLFDXQDDOWtVLPDKHWHURJH-
coberturas de bosque o los relictos de vegetación secundaria dentro de los mosaicos de neidad en el índice de diversidad.
pastos con espacios naturales. (QOD]RQDGHHVWXGLRVHGHWHUPLQDURQODVHVSHFLHVODXUHO $QLEDSHUXWLOLV \SDOPDQROt
Cabe resaltar que la fuente de las semillas empleadas la regeneración natural será obtenida (ODLVROHtIHUD FRPRDPHQD]DGDVGHDFXHUGRFRQODFDWHJRUtDGHDPHQD]DHVWDEOHFLGDSRU
de los árboles de la misma área, garantizando que no se causen daños a los árboles mayores OD5HVROXFLyQQ~PHURGHSRUSDUWHGHO0$'6HOOLEURURMRGHSODQWDVGH&RORPELD
GHFPGH'$3DVHJXUDQGRODSHUPDQHQFLD\IUXFWL¿FDFLyQGHORViUEROHVVHPLOOHURVTXH GHO6,1&+,\HOOLEURURMRGHSODQWDVIDQHUyJDPDVGH&RORPELDGHO,QVWLWXWR+XPEROGW
SURYHHUiQGHODIXHQWHJHQpWLFDSDUDODUHJHQHUDFLyQQDWXUDO3RU~OWLPRVHOHVQRWL¿FDUiD
(OODXUHOVHHQFXHQWUDHQODFDWHJRUtD &5 ³(QSHOLJURFUtWLFR´GHDFXHUGRFRQOD
las Juntas de Acción Comunal (JAC), autoridades locales y ambientales y demás actores,
el proceso de abandono, desmantelamiento y restauración de las áreas intervenidas durante 8,&1ORTXHVLJQL¿FDTXHHQIUHQWDXQJUDQULHVJRGHH[WLQFLyQHQHVWDGRVLOYHVWUH3RUVX
la ejecución de las actividades del programa sísmico. SDUWHODSDOPDQROtHVWiHQODFDWHJRUtD (1 ³(QSHOLJUR´ORTXHVLJQL¿FDXQDOWRULHVJR
GHH[WLQFLyQRGHWHULRURSREODFLRQDOHQHVWDGRVLOYHVWUH
3. Consideraciones
3.1 Consideraciones técnicas (QHOtWHPGHIDXQDVHLGHQWL¿FDURQHVSHFLHVGHDYHVGLVWULEXLGDVHQIDPLOLDV
(O%ORTXH900VHHQFXHQWUDHQPDUFDGRGHQWURGHOSROtJRQRTXHGH¿QHOD$JHQFLD \yUGHQHV
1DFLRQDOGH+LGURFDUEXURV$1+ODFXDOIXHDVLJQDGDDOD(PSUHVD6KHOO([SORUDWLRQ  'HQWURGHODVHVSHFLHVGHDYHVDPHQD]DGDVVHHQFXHQWUDQHOFKDYDUUL &KDXQDFKD-
3URGXFWLRQ&RORPELD*0%+6XFXUVDO&RORPELD YDUULD ODFXDODGHPiVHVXQDHVSHFLHHQGpPLFD\ODSDYD 2UWDOLVJDUUXOD 
Edición 48.475
10 DIARIO OFICIAL Jueves, 28 de junio de 2012

(QHOiUHDGHLQÀXHQFLDWDPELpQVHUHSRUWDURQHVSHFLHVGHPDPtIHURVSHUWHQHFLHQWHV 6HSHUIRUDUiQORVSR]RVFRQXQDSURIXQGLGDGHQWUHDPDOWRSHGHFDUJD\FRQ
DIDPLOLDV\yUGHQHV'HHVWDVHVSHFLHVHORVRUHDO 0\UPHFRSKDJDWULGDFW\OD  XQGLiPHWURHQWUH\FHQWtPHWURV1RVHXWLOL]DUiDGLWLYRVTXtPLFRVHQORVORGRVGH
FDULEODQFR &HEXV DOELIURQV  FRWXGR $ORXDWWD VHQLFXOXV  QXWULD /RQWUD ORQJLFDXGLV  SHUIRUDFLyQ\VRORVHHPSOHDUiDJXD\EHQWRQLWD DUFLOODLQHUWH 3DUDHVWDDFWLYLGDGHOSH-
OHRQFLOOR 3XPD FRQFRORU  WLJULOOR /HRSDUGXV SDUGDOLV DHTXDWRULDOLV  JDWR GH PRQWH WLFLRQDULRGHEHUiUHJLUVHSRUORVSDUiPHWURVDPELHQWDOHVHVSHFL¿FDQGRODGLVWDQFLDPtQLPD
3XPD\DJRXDURXGL \HOPDQDWt 7ULFKHFKXVPDQDWXV HVWiQFDWDORJDGDVFRQDOJ~QJUDGR SDUDODSHUIRUDFLyQGHSR]RVHVWDEOHFLGRVHQOD*XtDEiVLFDDPELHQWDOSDUDSURJUDPDV
GHDPHQD]DDQLYHOQDFLRQDORLQWHUQDFLRQDO GHH[SORUDFLyQVtVPLFDWHUUHVWUHGHO0LQLVWHULRGHO0HGLR$PELHQWH
5HVSHFWRDOOLVWDGRGHUHSWLOHVSDUDHOiUHDGHOSUR\HFWRVHWLHQHQUHSRUWDGDVHVSHFLHV En concordancia con lo estipulado por el peticionario, no se deberán cortar los ár-
FRQDOJ~QJUDGRGHDPHQD]DDQLYHOUHJLRQDOQDFLRQDO\JOREDO EROHVFRQXQ'LiPHWURDOD$OWXUDGHO3HFKR '$3 LJXDORPD\RUDFPODYHJHWDFLyQ
6HHYLGHQFLDTXHHQORVFXHUSRVGHDJXDPRQLWRUHDGRVGHQWURGHOiUHDGHLQWHUpVGHO QRVHUiDUUDQFDGDGHOSLVRVLQRFRUWDGDDFPGHODUDt]ORFXDOIDFLOLWDUiVXUHEURWH\
Bloque VMM-3, se presenta una comunidad íctica medianamente diversa donde se reportan UHYHJHWDOL]DFLyQQDWXUDO
yUGHQHVGHORVFXDOHVHO&KDUDFLIRUPHVHVHOPiVLPSRUWDQWH (Q FDVR GH UHTXHULUVH SRU SDUWH GH OD HPSUHVD DOJ~Q WLSR GH DSURYHFKDPLHQWR \R
&RQEDVHHQHO2¿FLR2),*&3HPLWLGRSRUHO0LQLVWHULRGHO,QWHULRU\ XVRGHORVUHFXUVRVQDWXUDOHVSUHVHQWHVHQOD]RQDODHPSUHVDGHEHUiVROLFLWDUDQWHOD
GH-XVWLFLDHOGHMXQLRGH\HOR¿FLRGHO,QFRGHUFRQ5DGLFDGRQ~PHUR DXWRULGDGDPELHQWDOFRPSHWHQWHGHOiUHDGHVXMXULVGLFFLyQORVUHVSHFWLYRVSHUPLVRV\
del 25 de noviembre de 2011, al interior del área a sustraer del programa sísmico 2D Bloque DXWRUL]DFLRQHVTXHVHVROLFLWHQ
900QRVHUHJLVWUDODSUHVHQFLDGHFRPXQLGDGHVLQGtJHQDVQLFRQVHMRVFRPXQLWDULRVGH 6LVHOOHJDUDDUHTXHULUSRUSDUWHGHODHPSUHVDSDUDHOGHVDUUROORGHVXSUR\HFWROD
FRPXQLGDGHVQHJUDVSRUWDQWRQRVHUHTXLHUHODUHDOL]DFLyQGHFRQVXOWDSUHYLDHQHOiUHD DIHFWDFLyQGHHVSHFLHVYHGDGDVODVROLFLWXGGHOOHYDQWDPLHQWRGHODYHGDGHEHUiWUDPLWDUVH
3DUDHOiUHDGHH[SORUDFLyQGHO3URJUDPD6tVPLFRVHKDQGH¿QLGRFXDWURWLSRVGH ante la autoridad ambiental respectiva, antes de iniciar las actividades del proyecto.
DPHQD]DGHRULJHQQDWXUDOFRPRVRQDPHQD]DVSRULQXQGDFLRQHVSRUSURFHVRVHURVLYRV /DHPSUHVDGHEHUiLPSOHPHQWDUODVPHGLGDVGHPLWLJDFLyQ\PDQHMRQHFHVDULDVTXH
VtVPLFDV\SRUOLFXDFLyQGHDUHQDV VHUHTXLHUDQHVWDEOHFHUSDUDODSURWHFFLyQGHODVHVSHFLHVGHÀRUD\IDXQDYXOQHUDEOHVTXH
6HSXHGHFRQFOXLUTXHODVDFWLYLGDGHVGHOSURJUDPDVtVPLFR'HQHO%ORTXH900 VHSXHGDQYHUDIHFWDGDVHQHOÈUHDGHOSUR\HFWRSDUDHOGHVDUUROORGHO3URJUDPD6tVPLFR
QRJHQHUDUiQHIHFWRVTXHSRWHQFLDOLFHQODVDPHQD]DVDQWHVH[SXHVWDVGDGRTXHOD]RQD 2D Bloque VMM-3.
GHHVWXGLRHVRQGXODGDDSODQD\QRKD\SUHVHQFLDGHSURFHVRVHURVLYRVIXHUWHVTXHVH Las actividades del programa sísmico 2D Bloque VMM-3, deberán respetar las rondas
acrecienten por las actividades del proyecto. GHSURWHFFLyQKtGULFDODFXDOQRSRGUiVHULQIHULRUDPHWURVDODGR\ODGRGHOFDXFH\
/DLPSOHPHQWDFLyQGHOSURJUDPDVtVPLFR'%ORTXH900QRDIHFWDUiORVVHUYLFLRV HQORVFDVRVHQTXHVHLGHQWL¿TXHQQDFLPLHQWRVGHDJXD\RPDQDQWLDOHVVHGHEHUiDFWXDU
DPELHQWDOHVQLHFRVLVWpPLFRVGHOD5HVHUYD)RUHVWDO\DTXHODVDFWLYLGDGHVDGHVDUUROODU GHFRQIRUPLGDGFRQODQRUPDWLYLGDGDPELHQWDOYLJHQWH
HQHOSURJUDPDQRJHQHUDUiQPRGL¿FDFLRQHVSHUPDQHQWHVHQHOHQWRUQR\ORVLPSDFWRV 8QDYH]QRWL¿FDGR\HMHFXWRULDGRHODFWRDGPLQLVWUDWLYRSRUHOFXDOVHDGRSWDHOSUH-
JHQHUDGRVVRQGHEDMDVLJQL¿FDQFLDDPELHQWDO VHQWHFRQFHSWRWpFQLFRVHUiQHFHVDULRSUHVHQWDUHQXQWpUPLQRQRPD\RUDWUHV  PHVHV
(O3URJUDPDGH5HVWDXUDFLyQ(FROyJLFDTXHLQFOX\HODVREUDVGHUHKDELOLWDFLyQUHVWDX- DOD'LUHFFLyQGH%RVTXHV%LRGLYHUVLGDG\6HUYLFLRV(FRVLVWpPLFRVSDUDVXHYDOXDFLyQ
UDFLyQ\UHVWLWXFLyQSRUVXVWUDFFLyQSUHWHQGHLPSOHPHQWDUPHWRGRORJtDVGHUHJHQHUDFLyQ \DSUREDFLyQODVPHGLGDVSURSXHVWDVSDUDODUHVWDXUDFLyQHFROyJLFDGHOiUHDVXVWUDtGD
QDWXUDODVLVWLGDTXHSHUPLWDQODUHVWLWXFLyQGHODVFREHUWXUDVYHJHWDOHVTXHSXGLHUDQYHUVH WHPSRUDOPHQWHXQDYH]¿QDOLFHQODVDFWLYLGDGHVGHOSUR\HFWR3DUDODLPSOHPHQWDFLyQGH
ODVHVSHFLHVYHJHWDOHVGHQWURGHO3URJUDPDGH5HVWDXUDFLyQVHSURSDJDUiQHVSHFLHVQDWLYDV
DIHFWDGDVSRUHOHVWDEOHFLPLHQWRGHO3URJUDPD6tVPLFR'%ORTXH900
H[LVWHQWHVGHQWURGHOiUHDGHLQÀXHQFLD
 Concepto
Estas medidas deberán garantizar el mantenimiento y seguimiento de las obras de res-
(VYLDEOHODVXVWUDFFLyQWHPSRUDOGHKHFWiUHDVGHOD5HVHUYD)RUHVWDOGHO5tR tauración ecológica, por lo menos durante un período de un (1) año contados a partir de la
0DJGDOHQDHVWDEOHFLGDSRU/H\GHSDUDHO3URJUDPD6tVPLFR'%ORTXH900 siembra de las especies vegetales seleccionadas”.
SRUXQWpUPLQRGHGLHFLVpLV  VHPDQDVFRPRWLHPSRGHGXUDFLyQGHOSUR\HFWR
II. Fundamentos Jurídicos
/DVFRRUGHQDGDVSDUDODXELFDFLyQGHODVOtQHDVVtVPLFDVGHOSURJUDPDVtVPLFR'
Que a través del artículo 1° de la Ley 2ª de 1959 y el Decreto número 111 de 1959, se
Bloque VMM-3 son:
establecieron con carácter de “Zonas Forestales Protectoras” y “Bosques de Interés General”,
TIPO
NOMBRE INICIO FIN
LONGITUD (km) ODViUHDVGHUHVHUYDIRUHVWDOQDFLRQDOGHO3DFt¿FR&HQWUDOGHO5tR0DJGDOHQDGHOD6LHUUD
LÍNEA ESTE NORTE ESTE NORTE Nevada de Santa Marta, de la Serranía de los Motilones, del Cocuy y de la Amazonía, para el
    desarrollo de la economía forestal y la protección de los suelos, las aguas y la vida silvestre.
1.038.974,16 1.359.801,11 1.039.634,05 1.360.509,39
Que el literal c) del artículo 1° de la Ley 2ª de 1959 dispuso:
1.038.532,32 1.359.326,88 1.038.841,51 1.359.658,74
/(1$ 1.037.666,32 1.358.397,38 1.038.120,12 1.358.884,46 
³F =RQDGH5HVHUYD)RUHVWDOGHO5tR0DJGDOHQDFRPSUHQGLGDGHQWURGHORVVLJXLHQWHV
Opcional 1.035.836,52 1.356.433,41 1.036.150,95 1.356.770,90
límites generales:
1.035.272,19 1.355.827,70 1.035.510,14 1.356.083,10 3DUWLHQGRGHODFRQÀXHQFLDGHO5tR1HJURFRQHO5tR0DJGDOHQDDJXDVDEDMRGHHVWH
1.034.791,91 1.355.312,21 1.035.181,53 1.355.730,40 ~OWLPRKDVWDVXFRQÀXHQFLDFRQHO5tR&DxR5HJOD\VLJXLHQGRHVWHUtR\VXVXEVLGLDULR
1.038.896,11 1.359.731,85 1.038.441,97 1.360.032,97 HO5tR/D+RQGDKDVWDHQFRQWUDUHOGLYRUFLRGHDJXDVGHHVWHUtRFRQHO5tR1HFKtGHDOOt
11-LENA-319 1,32 KDFLDHO1RUWHKDVWDHQFRQWUDUHOGLYRUFLRGHDJXDVGHO5tR1HFKtFRQORVDÀXHQWHVGHO5tR
1.035.273,59 1.362.133,74 1.034.628,48 1.362.561,47
1.036.709,94 1.352.798,92 1.036.992,43 1.353.143,86 0DJGDOHQD\SRUDOOtKDVWDODFDEHFHUDGHOD4XHEUDGD-XQFDOVLJXLHQGRHVWDTXHEUDGD
1.036.006,43 1.351.939,92 1.036.337,14 1.352.343,72 KDVWDVXFRQÀXHQFLDFRQHO5tR0DJGDOHQD\EDMDQGRSRUpVWDKDVWD*DPDUUDGHDOOt
11-LENA-300 1,73 DO(VWHKDVWDODFDUUHWHUD2FDxD3XHEORQXHYRVHVLJXHOXHJRSRUHOGLYRUFLRGHDJXDV
1.034.285,69 1.349.838,84 1.034.553,48 1.350.165,83
1.033.920,10 1.349.392,45 1.034.138,12 1.349.658,65 GHOD&RUGLOOHUDGHODV-XULVGLFFLRQHVKDVWDHO3iUDPRGH&DFKXD\ODFDEHFHUDGHO5tR
11-LENA-305 1.042.433,21 1.368.037,71 1.044.374,62 1.366.234,38 2,65 3HVFDGRSRUHVWHUtRDEDMRKDVWDVXFRQÀXHQFLDFRQHO5tR/HEULMD\GHDOOtHQXQDOtQHD
1.040.441,48 1.364.050,56 1.042.250,47 1.362.734,98 UHFWDKDFLDHO6XUKDVWDODFDUUHWHUDHQWUH9pOH]\3XHUWR2OD\D\GHDOOtXQDOtQHDUHFWD
11-LENA-307 1.034.082,04 1.368.675,42 1.034.752,13 1.368.188,10 4,1 KDVWDODFRQÀXHQFLDGHO5tR1HJURFRQHO5tR0DJGDOHQDSXQWRGHSDUWLGD´
Requerida 1.039.211,15 1.364.945,31 1.040.026,61 1.364.352,27 Que conforme a los artículos 206 y 207 del Decreto-ley 2811 de 1974, se denomina área
1.039.817,92 1.361.110,94 1.040.098,08 1.360.929,29 de reserva forestal la zona de propiedad pública o privada reservada para destinarla exclu-
11-LENA-309 1.034.320,42 1.364.675,48 1.034.360,59 1.364.649,44 0,42 sivamente al establecimiento o mantenimiento y utilización racional de áreas forestales, las
1.034.747,26 1.364.398,73 1.034.782,14 1.364.376,11 cuales sólo podrán destinarse al aprovechamiento racional permanente de los bosques que en
11-LENA-311 1.037.409,86 1.358.589,88 1.037.638,65 1.358.385,82 0,31 ella existan o se establezcan, garantizando la recuperación y supervivencia de los mismos.
1.034.944,22 1.355.062,83 1.035.772,58 1.354.744,24 Que el artículo 210 del Decreto-ley 2811 de 1974 señala que “6LHQiUHDGHUHVHUYD
11-LENA-313 1,41
1.036.386,81 1.354.507,99 1.036.873,21 1.354.320,92 IRUHVWDOSRUUD]RQHVGHXWLOLGDGS~EOLFDRLQWHUpVVRFLDOHVQHFHVDULRUHDOL]DUDFWLYLGDGHV
11-LENA-315 1.034.200,60 1.351.279,38 1.034.512,20 1.351.222,67 0,32 HFRQyPLFDVTXHLPSOLTXHQUHPRFLyQGHERVTXHVRFDPELRHQHOXVRGHORVVXHORVRFXDO-
3DUDHOGHVDUUROORGHO3URJUDPD6tVPLFR'%ORTXH900VHGHEHUiQLPSOHPHQWDU TXLHUDRWUDDFWLYLGDGGLVWLQWDGHODSURYHFKDPLHQWRUDFLRQDOGHORVERVTXHVOD]RQDDIHFWDGD
las actividades establecidas dentro del cronograma de actividades establecido por parte deberá, debidamente delimitada, ser previamente sustraída de la reserva”.
de la empresa. Cualquier otra actividad adicional que requiera ser implementada para el Que mediante la Resolución número 918 de 2011, este Ministerio estableció los re-
GHVDUUROORGHO3URJUDPD\TXHDIHFWHOD5HVHUYD)RUHVWDOGHEHUiVHUQRWL¿FDGDRSRUWX- quisitos y el procedimiento para la sustracción de las áreas de reserva forestal nacional y
QDPHQWHSDUDVXUHVSHFWLYRDMXVWHSRUSDUWHGHOD'LUHFFLyQGH%RVTXHV%LRGLYHUVLGDG\ regional, para el desarrollo de actividades consideradas de utilidad pública e interés social.
6HUYLFLRV(FRVLVWpPLFRV
Que el inciso 2° del artículo 204 de la Ley 1450 de 2011 estableció que “…en los casos
/RVFDPSDPHQWRV\]RQDVGHFDUJD\GHVFDUJDTXHVHLPSOHPHQWDUiQSDUDHOGHVDUUROOR HQTXHSURFHGDODVXVWUDFFLyQGHODViUHDVGHUHVHUYDIRUHVWDOVHDHVWDWHPSRUDORGH¿QLWLYD
GHOSURJUDPDVtVPLFRGHEHUiQVHUHVWDEOHFLGRVHQiUHDVTXHVHHQFXHQWUHQIXHUDGHOD ODDXWRULGDGDPELHQWDOFRPSHWHQWHLPSRQGUiDOLQWHUHVDGRHQODVXVWUDFFLyQODVPHGLGDV
Reserva Forestal del Río Magdalena. GHFRPSHQVDFLyQUHVWDXUDFLyQ\UHFXSHUDFLyQDTXHKD\DOXJDUVLQSHUMXLFLRGHODVTXH
(QFDVRGHUHTXHULUVHODPRGL¿FDFLyQGHODVDFWLYLGDGHVUHODFLRQDGDVHQHO3URJUDPD sean impuestas en virtud del desarrollo de la actividad que se pretenda desarrollar en el
6tVPLFR'EORTXH900\TXHLPSOLTXHLQWHUYHQFLyQGHiUHDVGLIHUHQWHVDODVVHxDODGDV iUHDVXVWUDtGD3DUDHOFDVRGHODVXVWUDFFLyQWHPSRUDOODVFRPSHQVDFLRQHVVHHVWDEOHFHUiQ
HQHOSUHVHQWHFRQFHSWRGHEHUiQVHUREMHWRGHQXHYDVROLFLWXGGHVXVWUDFFLyQWHPSRUDO GHDFXHUGRFRQHOiUHDDIHFWDGD´
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 11
Que el numeral 14 del artículo 2° del Decreto-ley 3570 de 2011, señaló a este Ministerio Artículo 5°. La Empresa Shell Exploration and Production Colombia Caño sur
la función de: GMBH, sucursal Colombia presentará en un término no mayor a tres (3) meses a la
³5HVHUYDU\DOLQGHUDUODViUHDVTXHLQWHJUDQHO6LVWHPDGH3DUTXHV1DFLRQDOHV Dirección de Bosques, Biodiversidad y Servicios Ecosistémicos para su evaluación y
1DWXUDOHVGHFODUDUUHVHUYDUDOLQGHUDUUHDOLQGHUDUVXVWUDHULQWHJUDURUHFDWHJRUL]DUODV aprobación, las medidas propuestas para la restauración ecológica, del área sustraida
iUHDVGHUHVHUYDIRUHVWDOQDFLRQDOHVUHJODPHQWDUVXXVR\IXQFLRQDPLHQWR « ´ WHPSRUDOPHQWHXQDYH]¿QDOLFHQODVDFWLYLGDGHVGHOSUR\HFWR3DUDODLPSOHPHQWDFLyQ
de las especies vegetales dentro del Programa de Restauración, se propagarán especies
Que mediante Resolución número 0053 del 24 de enero de 2012, el Ministro de Am-
QDWLYDVH[LVWHQWHVGHQWURGHOiUHDGHLQÀXHQFLD(VWDVPHGLGDVGHEHUiQJDUDQWL]DUHO
biente y Desarrollo Sostenible, delegó en el Director de Bosques, Biodiversidad y Servicios
mantenimiento y seguimiento de las obras de restauración ecológica, por lo menos
Ecosistémicos la función de: ³6XVFULELU ORV DFWRV DGPLQLVWUDWLYRV UHODFLRQDGRV FRQ ODV
durante un período de un (1) año contados a partir de la siembra de las especies vege-
VXVWUDFFLRQHVGHUHVHUYDVIRUHVWDOHVGHFDUiFWHUQDFLRQDO´
tales seleccionadas.
Que mediante Resolución número 0791 del 8 de junio de 2012, se encargó de las funciones $UWtFXORƒ/DPRGL¿FDFLyQGHODVDFWLYLGDGHVUHODFLRQDGDVHQHOSURJUDPDVtVPL-
de Director Técnico, Código 0100, Grado 22, de la Dirección de Bosques, Biodiversidad co y que implique la intervención de áreas adicionales a las señaladas en el presente
y Servicios Ecosistémicos a Luis Francisco Camargo Fajardo. acto administrativo, como es el caso de requerir abrir accesos viales adicionales a los
Que en mérito de lo expuesto, H[LVWHQWHVSDUDDGHODQWDUODVDFWLYLGDGHVUHODFLRQDGDVHOPHMRUDPLHQWR\UHFWL¿FDFLyQ
RESUELVE: de vías existentes, la ubicación de nuevos campamentos e infraestructura, entre otras,
Artículo 1°. Efectuar sustracción temporal de 4,22 hectáreas del área de la Reserva deberán ser objeto de nueva solicitud de sustracción.
Forestal del Río Magdalena establecida por Ley 2ª de 1959 para el Programa Sísmico 2D Artículo 7°. La Empresa Shell Exploration and Production Colombia Caño sur GMBH,
Bloque VMM-3, localizado en los municipios de San Martín, en el departamento del Cesar, sucursal Colombia, deberá presentar un informe, antes del vencimiento del término de
Puerto Wilches y Rionegro en el departamento de Santander, por solicitud de la empresa Shell ODSUHVHQWHVXVWUDFFLyQWHPSRUDOVREUHORVDYDQFHVGHOSUR\HFWRGHH[SORUDFLyQD¿Q
Exploration and Production Colombia Caño sur GMBH, sucursal Colombia, por el término de realizar el seguimiento respectivo.
de dieciséis (16) semanas, contadas a partir de la ejecutoria del presente acto administrativo. Artículo 8°. Una vez la Empresa Shell Exploration and Production Colombia Caño
Las coordenadas del área que se sustraen para el desarrollo del “Programa Sísmico 2D VXU *0%+ VXFXUVDO &RORPELD GH¿QD OD YLDELOLGDG GHO SUR\HFWRHQ HO FDVR GH TXH
Bloque VMM-3”, son las siguientes: UHTXLHUDSDVDUDODHWDSDGHH[SORWDFLyQGHEHUiVROLFLWDUODVXVWUDFFLyQGH¿QLWLYDGHO
área de la Zona de Reserva Forestal del Río Magdalena.
NOMBRE INICIO FIN LONGITUD
TIPO Parágrafo 1°. De no ser viable el proyecto, en los puntos de exploración sustraídos
LÍNEA ESTE NORTE ESTE NORTE (km)
1.043.546,38 1.364.708,59 1.039.839,44 1.360.729,83 temporalmente, se debe realizar la correspondiente restauración ecológica del área para
1.038.974,16 1.359.801,11 1.039.634,05 1.360.509,39 ser reincorporada esta a la Zona de Reserva Forestal del Río Magdalena.
1.038.532,32 1.359.326,88 1.038.841,51 1.359.658,74 Parágrafo 2°. Vencido el término de otorgado para la sustracción temporal que se
11-LENA-304 1.037.666,32 1.358.397,38 1.038.120,12 1.358.884,46 8,91 autoriza mediante el presente acto administrativo sin que se realicen o adelanten las
Opcional 1.035.836,52 1.356.433,41 1.036.150,95 1.356.770,90 actividades para las cuales se autoriza, dicha área recobrará su condición y será rein-
1.035.272,19 1.355.827,70 1.035.510,14 1.356.083,10 corporada esta a la Zona de Reserva Forestal del Río Magdalena.
1.034.791,91 1.355.312,21 1.035.181,53 1.355.730,40 $UWtFXORƒ1RWL¿FDUHOFRQWHQLGRGHOSUHVHQWHDFWRDGPLQLVWUDWLYRDOUHSUHVHQWDQWH
1.038.896,11 1.359.731,85 1.038.441,97 1.360.032,97 legal de la Empresa Shell Exploration and Production Colombia Caño sur GMBH,
11-LENA-319 1,32
1.035.273,59 1.362.133,74 1.034.628,48 1.362.561,47 sucursal Colombia o a su apoderado debidamente constituido.
1.036.709,94 1.352.798,92 1.036.992,43 1.353.143,86 Artículo 10. Comunicar el contenido del presente acto administrativo a la Corpora-
1.036.006,43 1.351.939,92 1.036.337,14 1.352.343,72 ción Autónoma Regional del Cesar, Corpocesar, a la Corporación Autónoma Regional
11-LENA-300 1,73
1.034.285,69 1.349.838,84 1.034.553,48 1.350.165,83 de Santander, CAS, a la Corporación Autónoma Regional para la Defensa de la Meseta
1.033.920,10 1.349.392,45 1.034.138,12 1.349.658,65 de Bucaramanga, CDMB, y a la Procuraduría Delegada para Asuntos Ambientales y
11-LENA-305 1.042.433,21 1.368.037,71 1.044.374,62 1.366.234,38 2,65 Agrarios.
1.040.441,48 1.364.050,56 1.042.250,47 1.362.734,98
$UWtFXOR3XEOLFDUHOSUHVHQWHDFWRDGPLQLVWUDWLYRHQOD*DFHWD2¿FLDO$PELHQWDO
Requerida 11-LENA-307 1.034.082,04 1.368.675,42 1.034.752,13 1.368.188,10 4,1
del Ministerio de Ambiente y Desarrollo Sostenible y en el 'LDULR2¿FLDO.
1.039.211,15 1.364.945,31 1.040.026,61 1.364.352,27
1.039.817,92 1.361.110,94 1.040.098,08 1.360.929,29 Artículo 12. Contra el presente acto administrativo procede el recurso de reposición
11-LENA-309 1.034.320,42 1.364.675,48 1.034.360,59 1.364.649,44 0,42 de conformidad con los artículos 50 y s.s. del Código Contencioso Administrativo.
1.034.747,26 1.364.398,73 1.034.782,14 1.364.376,11 Notifíquese, comuníquese, publíquese y cúmplase.
11-LENA-311 1.037.409,86 1.358.589,88 1.037.638,65 1.358.385,82 0,31 Dada en Bogotá, D. C., a 20 de junio de 2012.
11-LENA-313 1.034.944,22 1.355.062,83 1.035.772,58 1.354.744,24 1,41
El Director de Bosques, Biodiversidad y Servicios Ecosistémicos (e),
Artículo 2°. Las actividades del programa sísmico deberán respetar la ronda de pro-
/XLV)UDQFLVFR&DPDUJR)DMDUGR
tección hídrica, la cual no podrá ser inferior a 100 metros de lado y lado del cauce, en los
FDVRVGRQGHVHLGHQWL¿TXHQQDFLPLHQWRVGHDJXD\PDQDQWLDOHVGHFRQIRUPLGDGFRQOD (C. F.).
normatividad ambiental vigente.
Se perforarán los pozos con una profundidad entre 3 a 12 m al tope de carga y con RESOLUCIÓN NÚMERO 0955 DE 2012
un diámetro entre 10 y 15 centímetros. No se utilizará aditivos químicos en los lodos de (junio 21)
perforación y solo se empleará agua y bentonita (arcilla inerte). Para esta actividad el peti- por la cual se adopta el Formato con su respectivo instructivo para el Registro
FLRQDULRGHEHUiUHJLUVHSRUORVSDUiPHWURVDPELHQWDOHVHVSHFL¿FDQGRODGLVWDQFLDPtQLPD de Usuarios del Recurso Hídrico.
para la perforación de pozos, establecidos en la Guía básica ambiental para programas de El Ministro de Ambiente y Desarrollo Sostenible, en uso de sus facultades legales y en
exploración sísmica terrestre de este Ministerio. especial la conferida en el artículo 3° del Decreto 0303 de 2012,
Para el desarrollo del Programa Sísmico 2D, Bloque VMM-3, sólo se deberán implementar CONSIDERANDO:
las actividades establecidas dentro del cronograma de actividades establecido. Cualquier Que el artículo 2° del Decreto 0303 de 2012 por el cual se reglamenta parcialmente el
otra actividad adicional que requiera ser implementada para el desarrollo del Programa y DUWtFXORGHO'HFUHWROH\GHHQUHODFLyQFRQHO5HJLVWURGH8VXDULRVGHO5HFXUVR
TXHDIHFWHOD5HVHUYD)RUHVWDOGHEHUiVHUQRWL¿FDGDRSRUWXQDPHQWHSDUDVXUHVSHFWLYRDMXVWH Hídrico y se dictan otras disposiciones, dispuso que corresponde a la autoridad competente
por parte de la Dirección de Bosques, Biodiversidad y Servicios Ecosistémicos. diligenciar bajo su responsabilidad el formato a que hace referencia el artículo 3º del men-
Artículo 3°. Se deberán implementar las medidas de mitigación y manejo necesarias que cionado decreto, que incluye la inscripción de las concesiones de agua y autorizaciones de
VHUHTXLHUDQHVWDEOHFHUSDUDODSURWHFFLyQGHODVHVSHFLHVGHÀRUD\IDXQDYXOQHUDEOHVTXH vertimiento, esta última la cual a su vez comprende los permisos de vertimiento, los planes
se puedan ver afectadas en el Área del proyecto para el desarrollo del Programa Sísmico de cumplimiento y los planes de saneamiento y manejo de vertimientos.
2D Bloque VMM-3. Que el artículo 3° del Decreto 0303 de 2012 estableció que el Ministerio de Ambiente
Artículo 4°. La Empresa Shell Exploration and Production Colombia Caño sur GMBH, y Desarrollo Sostenible adoptará el formato con su respectivo instructivo, para el Registro
sucursal Colombia, deberá solicitar ante la Autoridad Ambiental competente, los respectivos de Usuarios del Recurso Hídrico que será utilizado por la autoridad ambiental competente.
permisos de uso, aprovechamiento y afectación de los recursos naturales que requiera dentro Que en mérito de lo expuesto,
de las actividades propuestas para el proyecto denominado “Programa Sísmico 2D Bloque RESUELVE:
VMM-3”. No se deberán cortar los árboles con un Diámetro a la Altura del Pecho (DAP) Artículo 1°. 2EMHWR Adoptar el formato para el Registro de Usuarios del Recurso Hídrico
igual o mayor a 10 cm, la vegetación no será arrancada del piso sino cortada a 20 cm de la para concesiones de agua y autorizaciones de vertimiento, junto con su instructivo, el cual
raíz, lo cual facilitará su rebrote y revegetalización natural. forma parte integral de la presente resolución.
Parágrafo. Si dentro del área sustraida, es necesario hacer aprovechamiento de especies Artículo 2°. ÈPELWRGH$SOLFDFLyQ Corresponde a la autoridad Ambiental competente
vedadas, se deberá solicitar, antes del inicio de actividades, el levantamiento de la veda ante diligenciar bajo su responsabilidad el formato para el Registro de Usuarios del Recurso
ODDXWRULGDGDPELHQWDOUHVSHFWLYDD¿QGHGHWHUPLQDUVXSHUWLQHQFLD Hídrico, que se adopta por medio de la presente resolución.
Edición 48.475
12 DIARIO OFICIAL Jueves, 28 de junio de 2012

3DUiJUDIR 3DUD WDO ¿Q OD LQIRUPDFLyQ UHTXHULGD HQ HO IRUPDWR VH GLOLJHQFLDUi D III. INFORMACIÓN DE LA CAPTACIÓN EN LA FUENTE
través del aplicativo de captura vía web desarrollado para el Registro de Usuarios del Tipo Captación
Recurso Hídrico –RURH, por parte del Instituto de Hidrología, Meteorología y Estudios Toma Lateral Toma de sumergida Captación Mixta Flotante con elevación mecánica
Ambientales– Ideam. Toma de Rejilla Presa de derivación Cámara de toma directa Movil con elevación mecánica

Artículo 3°. Del Registro. El formato incluye la inscripción de las concesiones de Muelle de Toma Otra captación. Cuál? Estado: Bueno Regular Malo

agua y autorizaciones de vertimiento, esta última la cual a su vez comprende los permi- Características Captación
sos de vertimiento, los planes de cumplimiento y los planes de saneamiento y manejo Capacidad de Diseño de la captación:

de vertimientos. Coordenadas Geográficas de la captación


Características Sistema de Abastecimiento
Artículo 4°. Contenido del Formato para el Registro de Usuarios del Recurso Hídrico. Latitud Longitud Altura
(m.s.n.m)
En el formato se diligenciará la siguiente información: Aducción Planta potabilización ° ´ , " ° ´ , "
,
,,GHQWL¿FDFLyQGHOXVXDULR\HOSUHGLR Desarenador Servidumbre: Continuidad Servicio:
Tanque Almacenamiento
II. Información sobre la fuente de abastecimiento, Conducción Red distribución
Observaciones:

III. Información sobre la captación en la fuente, IV. INFORMACIÓN DEL USO / APROVECHAMIENTO DEL RECURSO HÍDRICO
IV. Información sobre el uso y aprovechamiento del recurso hídrico, No. Personas permanentes: No. Personas transitorias: Días/mes:
Abastecimiento doméstico:
V. Información legal de la Concesión,
Tipo: Número:
VI. Información de la fuente receptora del vertimiento, Tipo: Número:
Abastecimiento de abrevaderos:
VII. Información del vertimiento, Tipo: Número:

Tipo: Número:
VIII. Información legal de las autorizaciones de vertimientos.
Tipo: Área (Has):
Artículo 5°. Manual para el Registro de Usuarios del Recurso Hídrico. Para el fun- Acuicultura y pesca:
Tipo: Área (Has):
cionamiento y manejo del aplicativo de captura, procesamiento y reporte del Registro Cultivo: Área (Has):
de Usuarios del Recurso Hídrico, las autoridades ambientales competentes se apoyarán Cultivo: Área (Has):
en el manual del usuario, el cual se encontrará disponible en el sitio web del Instituto Cultivo: Área (Has):
de Hidrología, Meteorología y Estudios Ambientales - Ideam, a partir de la publicación Cultivo: Área (Has):
Riego y Silvicultura:
de la presente. Pastos: Área (Has):

Artículo 6°. Vigencia. La presente resolución rige a partir de la fecha de su publicación. Bosques: Área (Has):

Publíquese y cúmplase. Otros: Área (Has):

Tipo de Riego predominante Gravedad Goteo Microaspersión Aspersión Otro: Cuál?


Dada en Bogotá D. C., a los 21 de junio de 2012.
Uso industrial Características:
El Ministro (E) de Ambiente y Desarrollo Sostenible,
Explotación minera y Tratamiento de minerales Características:
$QtEDO)HUQiQGH]GH6RWR&DPDFKR Explotación petrolera Características:
ANEXO NÚMERO 1 Generación Térmica o nuclear de electricidad Características:

FORMATO PARA EL REGISTRO DE USUARIOS DEL RECURSO HÍDRICO Generación Hidroeléctrica Características:

Generación Cinética Directa Características:

Ministerio de Ambiente y Desarrollo Sostenible Características:


Corporación Autónoma Regional Inyección para generación geotérmica
República de Colombia
o Autoridad Ambiental Flotación de Maderas Características:
nis t e rio de A m bie nt e - D ire c c ió n G e s t ió n Int e gra l de l R e c urs o H
Transporte de Minerales y Sustancias Tóxicas Características:
FORMATO DE REGISTRO DE USUARIOS DEL RECURSO HÍDRICO
Recreación y deportes Características:
I. IDENTIFICACION DEL USUARIO Y EL PREDIO
Usos medicinales Características:
Usuario Predio
Persona Natural Persona Jurídica Nombre Predio: Area (Has): Otros usos minerales Características:

Pública Privada Demanda Hídrica (Asociado a módulos de consumo) en l/s


Nombre del usuario: N° Documento: Dirección del Predio: Clasificación Suelo:
U so / Abastecimiento de
A p r o vechamient o
Abastecimiento doméstico: Acuicultura y pesca: Riego y Silvicultura:
abrevaderos
Tipo documento de identificación usuario Departamento: Código DANE: Corregimiento:
l/s
C.C. NIT CE de:
Representante legal: N° Documento: Municipio: Có digo DA NE: Vereda: U so / Explotación minera y Generación Térmica o nuclear
A p r o vechamient o Uso industrial: Explotación petrolera:
Tratamiento de minerales de electricidad:

Tipo documento identificación representante legal Cédula Catastral: l/s

C.C. NIT CE de: U so / Inyección para generación


A p r o vechamient o Generación Hidroeléctrica: Generación Cinética Directa Flotación de Maderas:
Dirección domicilio: Teléfono(s): geotérmica:
Tenencia (Tipo)

Dirección correspondencia: Teléfono(s): l/s


Propietario Arrendatario Comodato Poseedor
U so / Transporte de Minerales y Usos medicinales:
Coordenadas Geográficas del Predio A p r o vechamient o Recreación y deportes Otros usos minerales:
Sustancias Tóxicas:
Latitud: Longitud: Altura (m.s.n.m.):
l/s
° ´ , " ° ´ , "
. ,
Descripción acceso al Predio: Observaciones generales:
Total Uso/aprovechamiento l/s

II. INFORMACIÓN DE LA FUENTE DE ABASTECIMIENTO


Fuente Superficial
Río Quebrada Arroyo Caño Canal Lago Laguna Ciénaga Pantano

Embalse Estero Jagüey Otra Cuál?:


Nombre de la Fuente: Descripción de la Fuente: Oferta hídrica total: Oferta hídrica disponible: V. INFORMACIÓN LEGAL DE LA CONCESIÓN
N° Expediente N° Resolución que asigna Caudal: Fecha: (día / mes / año) Término:
Fuente Subterránea
/ / Años
Pozo Aljibe Manantial Galería Otro
N° Resolución por la cual se aprueban planos: Fecha (día / mes / año): Fecha de Notificación (día / mes / año):
Provincia Hidrogeológica: Identificación Plancha 1:25.000 ó 1:50.000: Consecutivo:
/ / / /
Unidad hidrogeológica de que capta: Nombre del Acuífero: Observaciones: Caudal explotable:
N° Resolución por la cual se aprueban obras: Fecha: (día / mes / año) Vigencia Concesión:
/ / Desde: / / Hasta: / /
Aguas Lluvias
Observaciones: Oferta estimada: Caudal Otorgado (l/s): Observaciones:

Aguas Minerales y Termales


Observaciones: Caudal explotable:
Modificación: N° Acto Administrativo relacionado: Fecha: (día / mes / año) Observaciones:
Aguas Servidas / /
Observaciones: Oferta:
Renovación: N° Acto Administrativo relacionado: Fecha: (día / mes / año) Observaciones:
Departamento: Código DANE: Municipio: Código DANE: Corregimiento: Vereda:
/ /

Subzona
Nombre:
Nivel subsiguiente de Nombre: Traspaso: N° Acto Administrativo relacionado: Fecha: (día / mes / año) Observaciones:
Hidrográfica: Código: Subzona Hidrográfica: Código: / /
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 13
VI. INFORMACIÓN DE LA FUENTE RECEPTORA DEL VERTIMIENTO ANEXO NÚMERO 2
Cuerpo Receptor INSTRUCTIVO DE DILIGENCIAMIENTO DEL FORMATO
Río Quebrada Arroyo Caño Canal Lago Laguna Ciénaga Pantano
PARA EL REGISTRO DE USUARIOS DEL RECURSO HÍDRICO
Embalse Jagüey Estero Mar Suelo Otra Cuál:
INFORMACIÓN DEL REGISTRO DE USUARIOS DEL RECURSO HÍDRICO
Nombre de la Fuente Receptora: Tramo/Sector de la Fuente Receptora:
Para el diligenciamiento del Formato del Registro de Usuarios del Recurso Hídrico,
Descripción de la Fuente Receptora:
se debe considerar que la información requerida se encuentra estructurada a través de los
Departamento: Código DANE: Municipio: Código DANE: Corregimiento: Vereda: siguientes módulos:
Subzona
Nombre:
Nivel subsiguiente de Nombre: L ,GHQWL¿FDFLyQGHO8VXDULR\3UHGLR
Hidrográfica: Subzona Hidrográfica:
Código: Código: ii) Información de la fuente de abastecimiento
Objetivos de Calidad Cuerpo Receptor Uso/Destinación Agua Cuerpo Receptor:
iii) Información de la captación en la fuente
OD DBO5 DQO Nitrógeno Total Fósforo Total
Unidad mg/L mg/L mg/L mg/L
iv) Información del uso y demanda del recurso hídrico
v) Información legal de la Concesión
pH SST Grasas y Aceites Coliformes Fecales SAAM Otro
Unidades mg/L mg/L NMP/100ml mg/L Unidad
vi) Información de la fuente receptora de vertimientos
vii) Información del Vertimiento
Meta Global de Reducción de Carga Contaminante
viii) Información legal de las Autorizaciones de Vertimientos
Quinquenio: DBO5 (Toneladas / 5 años) SST (Toneladas / 5 años)
Desde: Hasta: INFORMACIÓN DEL MÓDULO DE IDENTIFICACIÓN DEL USUARIO Y
Características Cuerpo Receptor PREDIO
Características* cuerpo receptor aguas arriba del vertimiento El módulo relaciona la información correspondiente a los propietarios y predios que
OD DBO5 DQO Nitrógeno Total Fósforo Total hacen uso y/o donde se aprovecha el recurso hídrico.
Unidad mg/L mg/L mg/L mg/L
I. IDENTIFICACION DEL USUARIO Y EL PREDIO
pH SST Grasas y Aceites Coliformes Fecales SAAM Usuario Predio
Unidades mg/L mg/L NMP/100ml mg/L
Persona Natural Persona Jurídica Nombre Predio: Area (Has):
Pública Privada
Temperatura Material flotante Otros: *De conformidad con los criterios de calidad para la Caudal (l/s):
Nombre del usuario: N° Documento: Dirección del Predio: Clasificación Suelo:
°C P resencia/A usencia destinación del Recurso (Decreto 1594 de 1984, Capítulo IV; o la
norma que lo modifique o sustituya).
Tipo documento de identificación usuario Departamento: Código DANE: Corregimiento:
Características* cuerpo receptor aguas abajo del vertimiento C.C. NIT CE de:
OD DBO5 DQO Nitrógeno Total Fósforo Total Representante legal: N° Documento: Municipio: Có digo DA NE: Vereda:
Unidad mg/L mg/L mg/L mg/L

Tipo documento identificación representante legal Cédula Catastral:


pH SST Grasas y Aceites Coliformes Fecales SAAM
C.C. NIT CE de:
Unidades mg/L mg/L NMP/100ml mg/L
Dirección domicilio: Teléfono(s): Tenencia (Tipo)

Temperatura Material flotante Otros: *De conformidad con los criterios de calidad para la Caudal (l/s): Dirección correspondencia: Teléfono(s): Propietario Arrendatario Comodato Poseedor
°C P resencia/A usencia destinación del Recurso (Decreto 1594 de 1984, Capítulo IV; o la
norma que lo modifique o sustituya). Coordenadas Geográficas del Predio
Latitud: Longitud: Altura (m.s.n.m.):
° ´ , " ° ´ , "
. ,
VII. INFORMACIÓN DEL VERTIMIENTO Descripción acceso al Predio:
Características del vertimiento:
Nombre de la Fuente de abastecimiento asociada:

Residual doméstico Residual Industrial Municipal/ESP Otro Cuál:


Tipo de Flujo: Continuo Irregular Periódica Regular Periódica Irregular Es necesario georreferenciar a través del registro de la latitud y la longitud correspon-
Caudal (l/s): Tiempo descarga (h/día): Frecuencia (días/mes):
diente el predio asociado al usuario del recurso hídrico y/o al aprovechamiento del mismo.
Descripción punto(s) de descarga(s): Dichas coordenadas se registrarán en términos de grados, minutos y segundos, según el
Sistema de Tratamiento Coordenadas Geográficas punto(s)de descarga(s) sistema MAGNA-SIRGAS, de conformidad con lo establecido en la Resolución del Instituto
Planta de tratamiento: Si No Latitud Longitud A ltura (m.s.n.m) *HRJUi¿FR$JXVWtQ&RGD]]LQ~PHURGH
Pretratamiento Primario ° ´ , " ° ´ , " , INFORMACIÓN DE LA FUENTE DE ABASTECIMIENTO
A ltura (m.s.n.m)
Latitud Longitud
Secundario Terciario
(OPyGXORSUHWHQGHLGHQWL¿FDUGHWDOODGDPHQWHHOWLSRGHVLVWHPDKtGULFRXWLOL]DGRSDUD
Otro: ° ´ , " ° ´ , "
Cual?: ,
abastecimiento en función del aprovechamiento del recurso. Se discrimina sistemas de
Caracterízación del vertimiento**
DJXDVVXSHU¿FLDOHVVXEWHUUiQHDVPDULQDVHLQFOXVROOXYLDV
pH Temperatura Material flotante Grasas y Aceites SST SSED DBO5
Unidades °C P resencia/A usencia mg/L mg/L mg/L mg/L El tipo de fuente de abastecimiento debe seleccionarse desde las opciones. La fuente
de abastecimiento donde se hace la captación.
DQO SAAM Coliformes Fecales Nitrógeno Total Fósforo Total
mg/L mg/L NMP/100ml mg/L mg/L II. INFORMACIÓN DE LA FUENTE DE ABASTECIMIENTO
Fuente Superficial
Otros:**De conformidad con las normas de vertimiento establecidas en el Decreto 1594 de 1984 (Capítulo VI), o la norma que lo modifique o sustituya.
Río Quebrada Arroyo Caño Canal Lago Laguna Ciénaga Pantano

Embalse Estero Jagüey Otra Cuál?:


VIII. INFORMACIÓN LEGAL DE LAS AUTORIZACIONES DE VERTIMIENTOS
Nombre de la Fuente: Descripción de la Fuente: Oferta hídrica total: Oferta hídrica disponible:
N° Acto administrativo por el cual se inicia el trámite para resolver la solicitud del Fecha (día / mes / año): N° de Expediente:
Permiso de vertimiento:
/ /
Fuente Subterránea
N° Acto administrativo por el cual se solicita Fecha (día / mes / año): N° Acto administrativo por el Fecha (día / mes / año):
presentación del Plan de Cumplimiento: cual se aprueba el desarrollo del Pozo Aljibe Manantial Galería Otro
/ / Plan de Cumplimiento: / / Provincia Hidrogeológica: Identificación Plancha 1:25.000 ó 1:50.000: Consecutivo:
N° Resolución por la cual se otorga Permiso de Fecha: (día / mes / año) Vigencia del Permiso de Vertimiento:
Vertimiento:
/ / Desde: / / Hasta: / / Unidad hidrogeológica de que capta: Nombre del Acuífero: Observaciones: Caudal explotable:
N° Resolución por el cual se aprueba el Plan de Fecha (día / mes / año): Vigencia del Plan de Saneamiento y Manejo de Vertimientos:
Saneamiento y Manejo de Vertimientos:
/ / Desde: / / Hasta: / / Aguas Lluvias
N° Resolución por la cual se aprueban planos: Fecha (día / mes / año): Fecha (día / mes / año): Observaciones: Oferta estimada:
N° Resolución por la cual se
/ / aprueban obras: / / Aguas Minerales y Termales
Fecha de Notificación (día / mes / año): Término: Observaciones: Caudal explotable:
/ / Años
Caudal de vertido autorizado (l/s): Norma que debe cumplir el
Aguas Servidas
Parámetro Unidad Valor
vertimiento: Observaciones: Oferta:

Modificación: N° Acto Administrativo Fecha: (día / mes / año) Observaciones: Departamento: Código DANE: Municipio: Código DANE: Corregimiento: Vereda:
relacionado:
/ /
Nombre: Nombre:
Renovación: N° Acto Administrativo Fecha: (día / mes / año) Observaciones: Subzona Nivel subsiguiente de
relacionado: Hidrográfica: Código: Subzona Hidrográfica: Código:
/ /
Evaluación Ambiental del Vertimiento: Observaciones:

Plan de Reconversión en Tecnologías limpias en Vertimientos: Observaciones:


6HUHFRPLHQGDWHQHUHQFXHQWDODVVLJXLHQWHVGH¿QLFLRQHV
Río: Corriente de agua de grandes dimensiones que sirve de canal natural en una cuenca
de drenaje.
/ / Quebrada: Curso natural de agua normalmente pequeño y poco profundo, por lo general,
Fecha procesamiento (día/mes/año) Firma Autoridad Ambiental Competente
GHÀXMRSHUPDQHQWHHQFLHUWRPRGRWXUEXOHQWR\WULEXWDULRGHXQUtR\RPDU
Edición 48.475
14 DIARIO OFICIAL Jueves, 28 de junio de 2012

$UUR\R&XUVRGHDJXDSHTXHxR\SRFRSURIXQGRSRUORJHQHUDOGHÀXMRSHUPDQHQWH IV. INFORMACIÓN DEL USO / APROVECHAMIENTO DEL RECURSO HÍDRICO


y en cierto modo turbulento. No. Personas permanentes: No. Personas transitorias: Días/mes:
Abastecimiento doméstico:
&DxR&XUVRQDWXUDOGHDJXDGHÀXMRLQWHUPLWHQWHSURSLRGH]RQDVSODQDV
Tipo: Número:

Lago: Es un cuerpo de agua natural, dulce o salada de tipo continental de gran tamaño Tipo: Número:
Abastecimiento de abrevaderos:
y profundidad, ubicado en depresiones del terreno de formas variadas, que se alimenta de Tipo: Número:
Tipo: Número:
un río o de aguas freáticas.
Tipo: Área (Has):
Acuicultura y pesca:
Laguna: Es un cuerpo de agua natural dulce o salada de tipo continental de menor ta- Tipo: Área (Has):

maño y profundidad que los lagos, ubicado en depresiones del terreno de formas variadas, Cultivo: Área (Has):

que se alimenta de ríos o de aguas freáticas. Cultivo: Área (Has):

Cultivo: Área (Has):


&LpQDJD Es un cuerpo de agua natural de poca profundidad alimentado por un río en Riego y Silvicultura: Cultivo: Área (Has):
los períodos lluviosos y de aguas altas, y con circulación del cuerpo de agua hacia el río, Pastos: Área (Has):

HQODVpSRFDVVHFDVGHDJXDVEDMDVTXHPDQWLHQHYHJHWDFLyQKLJUy¿ODLQFOXVRDUEyUHD Bosques: Área (Has):

adaptada a suelos saturados. Otros: Área (Has):

Pantano: 6HGH¿QHFRPRXQVXUJLPLHQWRQDWXUDOHOFXDOSUHVHQWDSRUVtPLVPRDFXPX- Tipo de Riego predominante Gravedad Goteo Microaspersión Aspersión Otro: Cuál?
Características:
ODFLRQHVGHDJXDVREUHODVVXSHU¿FLHVGHWLHUUDVEDMDVLQXQGDGDVQRUPDOPHQWHIDQJRVDV Uso industrial

Explotación minera y Tratamiento de minerales Características:


Estero: Zona de litoral comprendida entre el nivel máximo de la pleamar y el nivel Explotación petrolera Características:

mínimo de bajamar. Se llama también zona intertidal. Generación Térmica o nuclear de electricidad Características:

-DJH\ Son depósitos artesanales construidos para almacenamiento de agua para la Generación Hidroeléctrica Características:

Generación Cinética Directa Características:


época de sequía.
Inyección para generación geotérmica Características:
$JXDV6XEWHUUiQHDV Se entiende por aguas subterráneas las subálveas y las ocultas Flotación de Maderas Características:
GHEDMR GH OD VXSHU¿FLH GHO VXHOR R GHO IRQGR PDULQR TXH EURWD GH IRUPD QDWXUDO FRPR Transporte de Minerales y Sustancias Tóxicas Características:
ODVIXHQWHV\PDQDQWLDOHVFDSWDGRVHQHOVLWLRGHDÀRUDPLHQWRRODVTXHUHTXLHUHQSDUDVX Características:
Recreación y deportes
DOXPEUDPLHQWRREUDVFRPRSR]RVJDOHUtDV¿OWUDQWHVXRWUDVVLPLODUHV
Usos medicinales Características:

3R]R Excavación o perforación en el terreno realizada mecánicamente que alcanza las Otros usos minerales Características:

aguas subterráneas.
$FXtIHUR Unidad de roca o sedimento, capaz de almacenar y transmitir agua. Se tendrán en cuenta los usos establecidos en el artículo 36 del Decreto 1541 de 1978,
de la siguiente manera:
Manantial: Descarga de agua subterránea al exterior, concentrada en un punto o a lo
largo de una línea. “$UWtFXOR7RGDSHUVRQDQDWXUDORMXUtGLFDS~EOLFDRSULYDGDUHTXLHUHFRQFHVLyQ
SDUDREWHQHUHOGHUHFKRDODSURYHFKDPLHQWRGHODVDJXDVSDUDORVVLJXLHQWHV¿QHV
$JXDV/OXYLDV Aquellas recolectadas y almacenadas en los momentos y períodos de D $EDVWHFLPLHQWRHQORVFDVRVTXHUHTXLHUDGHULYDFLyQ
lluvias por cualquier mecanismo para su uso.
E 5LHJR\VLOYLFXOWXUD
INFORMACIÓN DE LA CAPTACIÓN EN LA FUENTE F $EDVWHFLPLHQWRGHDEUHYDGHURVFXDQGRVHUHTXLHUDGHGHULYDFLyQ
El presente módulo, amplía la información referente a la ubicación de la(s) estructura(s) G 8VRLQGXVWULDO
de captación y pretende documentar la información sobre extracción (caudal en litros por H *HQHUDFLyQWpUPLFDRQXFOHDUGHHOHFWULFLGDG
segundo) del recurso. I ([SORWDFLyQPLQHUD\WUDWDPLHQWRGHPLQHUDOHV
III. INFORMACIÓN DE LA CAPTACIÓN EN LA FUENTE
J ([SORWDFLyQSHWUROHUD
Tipo Captación K ,Q\HFFLyQSDUDJHQHUDFLyQJHRWpUPLFD
Toma Lateral Toma de sumergida Captación Mixta Flotante con elevación mecánica L *HQHUDFLyQKLGURHOpFWULFD
Toma de Rejilla Presa de derivación Cámara de toma directa Movil con elevación mecánica M *HQHUDFLyQFLQpWLFDGLUHFWD
Muelle de Toma Otra captación. Cuál? Estado: Bueno Regular Malo N )ORWDFLyQGHPDGHUD
Características Captación O 7UDQVSRUWHGHPLQHUDOHV\VXVWDQFLDVWy[LFDV
Capacidad de Diseño de la captación: P $JULFXOWXUD\SHVFD
Coordenadas Geográficas de la captación Q 5HFUHDFLyQ\GHSRUWHV
Características Sistema de Abastecimiento
Latitud Longitud Altura R 8VRVPHGLFLQDOHV\
(m.s.n.m)
Aducción Planta potabilización ° ´ , " ° ´ , " S 2WURVXVRVVLPLODUHV´
,
Desarenador Servidumbre: Continuidad Servicio: (QHOPLVPRVHQWLGRHVQHFHVDULRFRQVLGHUDUODVGH¿QLFLRQHVHVWDEOHFLGDVHQHO'HFUHWR
Tanque Almacenamiento
Observaciones:
3930 de 2010, de la siguiente manera:
Conducción Red distribución
“$UWtFXOR8VRSDUDFRQVXPRKXPDQR\GRPpVWLFR6HHQWLHQGHSRUXVRGHODJXD
SDUDFRQVXPRKXPDQR\GRPpVWLFRVXXWLOL]DFLyQHQDFWLYLGDGHVWDOHVFRPR
La información es requerida para cada punto de captación en la(s) fuente(s) de abas- %HELGDGLUHFWD\SUHSDUDFLyQGHDOLPHQWRVSDUDFRQVXPRLQPHGLDWR
tecimiento de agua que utilice el usuario. Se documenta información de localización
6DWLVIDFFLyQGHQHFHVLGDGHVGRPpVWLFDVLQGLYLGXDOHVRFROHFWLYDVWDOHVFRPRKLJLHQH
georreferenciada, es decir latitud, longitud y altitud del sitio donde se efectúa la captación, o
SHUVRQDO\OLPSLH]DGHHOHPHQWRVPDWHULDOHVRXWHQVLOLRV
donde se hace la derivación relacionada con los aprovechamientos del recurso. Así mismo,
las características relacionadas con los sistemas de captación, a efectos de establecer la ca- 3UHSDUDFLyQGHDOLPHQWRVHQJHQHUDO\HQHVSHFLDOORVGHVWLQDGRVDVXFRPHUFLDOL-
pacidad de extracción y/o volumen total captado, capacidad y volumen de almacenamiento ]DFLyQRGLVWULEXFLyQTXHQRUHTXLHUDQHODERUDFLyQ
y régimen de operación/extracción. $UWtFXOR8VRSDUDODSUHVHUYDFLyQGHÀRUD\IDXQD6HHQWLHQGHSRUXVRGHODJXD
SDUDSUHVHUYDFLyQGHÀRUD\IDXQDVXXWLOL]DFLyQHQDFWLYLGDGHVGHVWLQDGDVDPDQWHQHUOD
INFORMACIÓN DEL USO Y DEMANDA DEL RECURSO HÍDRICO vida natural de los ecosistemas acuáticos y terrestres y de sus ecosistemas asociados, sin
,GHQWL¿FDLQIRUPDFLyQVREUHODGHVWLQDFLyQGHOUHFXUVR\HVWLPDODFDQWLGDGGHDJXD causar alteraciones sensibles en ellos.
que se utiliza (litros por segundo) para cada actividad. Relaciona el aprovechamiento del $UWtFXOR8VRSDUDSHVFDPDULFXOWXUD\DFXLFXOWXUD6HHQWLHQGHSRUXVRSDUDSHVFD
recurso en el área de estudio y sus características. PDULFXOWXUD\DFXLFXOWXUDVXXWLOL]DFLyQHQDFWLYLGDGHVGHUHSURGXFFLyQVXSHUYLYHQFLD
FUHFLPLHQWRH[WUDFFLyQ\DSURYHFKDPLHQWRGHHVSHFLHVKLGURELROyJLFDVHQFXDOTXLHUDGHVXV
En cada caso se requiere presentar la demanda bruta por tipo de consumo en l/s, y se IRUPDVVLQFDXVDUDOWHUDFLRQHVHQORVHFRVLVWHPDVHQORVTXHVHGHVDUUROODQHVWDVDFWLYLGDGHV
HVWDEOHFHQDOJXQRVGDWRVDGLFLRQDOHVSDUDGHWHUPLQDUORVPyGXORVTXHMXVWL¿FDQRVXVWHQWDQ $UWtFXOR8VRDJUtFROD6HHQWLHQGHSRUXVRDJUtFRODGHODJXDVXXWLOL]DFLyQSDUD
el valor registrado. LUULJDFLyQGHFXOWLYRV\RWUDVDFWLYLGDGHVFRQH[DVRFRPSOHPHQWDULDV
En el caso de consumo doméstico se plantea el consumo de las personas permanentes $UWtFXOR8VRSHFXDULR6HHQWLHQGHSRUXVRSHFXDULRGHODJXDVXXWLOL]DFLyQSDUD
consideradas (l/s) y el consumo de personas transitorias y el estimativo del número de HOFRQVXPRGHOJDQDGRHQVXVGLIHUHQWHVHVSHFLHV\GHPiVDQLPDOHVDVtFRPRSDUDRWUDV
PHVHVFRQTXHVHHIHFWXyHOHVWLPDWLYR¿QDO(QHOFDVRGHDEUHYDGHURVHOWLSR\Q~PHURGH DFWLYLGDGHVFRQH[DV\FRPSOHPHQWDULDV
animales. En acuicultura el tipo y producción en toneladas. En riego y silvicultura el tipo, $UWtFXOR8VRUHFUHDWLYR6HHQWLHQGHSRUXVRGHODJXDSDUD¿QHVUHFUHDWLYRVVX
ODSURGXFFLyQHQWRQHODGDVHOiUHDFXOWLYDGD\ODH¿FLHQFLDHVWLPDGDGHULHJR XWLOL]DFLyQFXDQGRVHSURGXFH
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 15
&RQWDFWRSULPDULRFRPRHQODQDWDFLyQEXFHR\EDxRVPHGLFLQDOHV Meta Global de Reducción de Carga Contaminante
2. Contacto secundario, como en los deportes náuticos y la pesca. Quinquenio: DBO5 (Toneladas / 5 años) SST (Toneladas / 5 años)

$UWtFXOR8VRLQGXVWULDO6HHQWLHQGHSRUXVRLQGXVWULDOGHODJXDVXXWLOL]DFLyQHQ Desde: Hasta:

actividades tales como: Características Cuerpo Receptor

3URFHVRVPDQXIDFWXUHURVGHWUDQVIRUPDFLyQRH[SORWDFLyQDVtFRPRDTXHOORVFRQH[RV Características* cuerpo receptor aguas arriba del vertimiento


y complementarios. OD DBO5 DQO Nitrógeno Total Fósforo Total

*HQHUDFLyQGHHQHUJtD Unidad mg/L mg/L mg/L mg/L

3. Minería. pH SST Grasas y Aceites Coliformes Fecales SAAM

+LGURFDUEXURV Unidades mg/L mg/L NMP/100ml mg/L

 )DEULFDFLyQ R SURFHVDPLHQWR GH GURJDV PHGLFDPHQWRV FRVPpWLFRV DGLWLYRV \ Temperatura Material flotante Otros: *De conformidad con los criterios de calidad para la Caudal (l/s):
productos similares. °C P resencia/A usencia destinación del Recurso (Decreto 1594 de 1984, Capítulo IV; o la
norma que lo modifique o sustituya).
(ODERUDFLyQGHDOLPHQWRVHQJHQHUDO\HQHVSHFLDOORVGHVWLQDGRVDVXFRPHUFLDOL-
]DFLyQRGLVWULEXFLyQ Características* cuerpo receptor aguas abajo del vertimiento
OD DBO5 DQO Nitrógeno Total Fósforo Total
$UWtFXOR  1DYHJDFLyQ \ WUDQVSRUWH DFXiWLFR 6H HQWLHQGH SRU XVR GHO DJXD SDUD Unidad mg/L mg/L mg/L mg/L
WUDQVSRUWHVXXWLOL]DFLyQSDUDODQDYHJDFLyQGHFXDOTXLHUWLSRGHHPEDUFDFLyQRSDUDOD
PRYLOL]DFLyQGHPDWHULDOHVSRUFRQWDFWRGLUHFWR pH SST Grasas y Aceites Coliformes Fecales SAAM
mg/L mg/L NMP/100ml mg/L
$UWtFXOR8VRHVWpWLFR6HHQWHQGHUiSRUXVRHVWpWLFRHOXVRGHODJXDSDUDODDUPR- Unidades

QL]DFLyQ\HPEHOOHFLPLHQWRGHOSDLVDMH”. Temperatura Material flotante Otros: *De conformidad con los criterios de calidad para la Caudal (l/s):
°C P resencia/A usencia destinación del Recurso (Decreto 1594 de 1984, Capítulo IV; o la
Demanda Hídrica (Asociado a módulos de consumo) en l/s norma que lo modifique o sustituya).
U so / Abastecimiento de
A p r o vechamient o Abastecimiento doméstico: Acuicultura y pesca: Riego y Silvicultura:
abrevaderos

l/s INFORMACIÓN DEL VERTIMIENTO


U so /
Uso industrial:
Explotación minera y
Explotación petrolera:
Generación Térmica o nuclear (OYHUWLPLHQWRGHEHJHRUUHIHUHQFLDUVHFRQVLGHUDQGRTXHUH¿HUHDGHVFDUJDVSXQWXDOHV
A p r o vechamient o
Tratamiento de minerales de electricidad: estableciendo la localización en términos de departamento, municipio y centro poblado
l/s donde se genera.
U so /
A p r o vechamient o Generación Hidroeléctrica: Generación Cinética Directa
Inyección para generación
geotérmica:
Flotación de Maderas: 6HUHFRPLHQGDWHQHUSUHVHQWHVODVVLJXLHQWHVGH¿QLFLRQHV
l/s Descarga continua: el caudal y la concentración del agua residual no varían, debido a que
U so / Transporte de Minerales y
se derivan de un mismo ciclo productivo que no presenta cambios apreciables en el tiempo.
A p r o vechamient o Recreación y deportes Usos medicinales: Otros usos minerales:
Sustancias Tóxicas: Descarga irregular: El tiempo de descarga y la producción no es constante creando una
l/s variación continua tanto en el caudal como en la carga contaminante.
Observaciones generales:
Descarga periódica irregular: el tiempo entre descarga y descarga es constante, pero los
Total Uso/aprovechamiento l/s
ciclos productivos varían frecuentemente (aumento o disminución del volumen de produc-
ción), viéndose afectado el caudal y la concentración de los contaminantes.
Descarga periódica regular: el tiempo entre descarga y descarga es el mismo y los
Demanda: Cálculo asociado a módulos de consumo Doméstico, Pecuario, Acuícola, ciclos productivos no varían (volumen de producción constante), lo cual implica que no
Agrícola, Industrial, Minería, Generación eléctrica y la Demanda Total (L/seg.). habrá alteraciones en el caudal y las concentraciones de los contaminantes permanecerán
INFORMACIÓN LEGAL DE LA CONCESIÓN. aproximadamente constantes.
Este módulo relaciona la información legal correspondiente a las concesiones otorgadas VII. INFORMACIÓN DEL VERTIMIENTO
y vigentes a la fecha del Registro.
Características del vertimiento:
V. INFORMACIÓN LEGAL DE LA CONCESIÓN Nombre de la Fuente de abastecimiento asociada:
N° Expediente N° Resolución que asigna Caudal: Fecha: (día / mes / año) Término: Residual doméstico Residual Industrial Municipal/ESP Otro Cuál:
/ / Años Tipo de Flujo: Continuo Irregular Periódica Regular Periódica Irregular
N° Resolución por la cual se aprueban planos: Fecha (día / mes / año): Fecha de Notificación (día / mes / año): Caudal (l/s): Tiempo descarga (h/día): Frecuencia (días/mes):
/ / / /
Descripción punto(s) de descarga(s):
N° Resolución por la cual se aprueban obras: Fecha: (día / mes / año) Vigencia Concesión:
/ / Desde: / / Hasta: / / Sistema de Tratamiento Coordenadas Geográficas punto(s)de descarga(s)
Caudal Otorgado (l/s): Observaciones: Planta de tratamiento: A ltura (m.s.n.m)
Si No Latitud Longitud

Pretratamiento Primario ° ´ , " ° ´ , " ,


A ltura (m.s.n.m)
Modificación: N° Acto Administrativo relacionado: Fecha: (día / mes / año) Observaciones: Secundario Terciario Latitud Longitud

/ / Otro: Cual?: ° ´ , " ° ´ , " ,


Renovación: N° Acto Administrativo relacionado: Fecha: (día / mes / año) Observaciones:
Caracterízación del vertimiento**
/ /
pH Temperatura Material flotante Grasas y Aceites SST SSED DBO5
Traspaso: N° Acto Administrativo relacionado: Fecha: (día / mes / año) Observaciones: Unidades °C P resencia/A usencia mg/L mg/L mg/L mg/L
/ /
DQO SAAM Coliformes Fecales Nitrógeno Total Fósforo Total
INFORMACIÓN DE LA FUENTE RECEPTORA DE VERTIMIENTOS mg/L mg/L NMP/100ml mg/L mg/L

El presente módulo relaciona información sobre el tipo y nombre del cuerpo de receptor,
Otros:**De conformidad con las normas de vertimiento establecidas en el Decreto 1594 de 1984 (Capítulo VI), o la norma que lo modifique o sustituya.
VXORFDOL]DFLyQJHRUUHIHUHQFLDGD FRRUGHQDGDVJHRJUi¿FDVODWLWXGORQJLWXG\DOWLWXGGHO
sitio donde se efectúa el vertimiento).
En cuanto a la calidad de la fuente receptora de vertimientos debe relacionarse información Para cada punto de descarga al cuerpo receptor, debe consignarse la información disponible
sobre los parámetros físicos, químicos disponibles en la autoridad ambiental, o los exigidos VREUHVXORFDOL]DFLyQJHRUUHIHUHQFLDGD FRRUGHQDGDVJHRJUi¿FDVODWLWXG\ORQJLWXG DOWXUD
por la autoridad al usuario. Se considera pertinente abordar la calidad del cuerpo receptor y características de la descarga, el tipo de vertimiento, la clase y el período de descarga, el
en función del área aguas arriba y aguas abajo del sitio de vertimiento (zona de mezcla). número de horas del vertimiento, el caudal de vertido y el sistema de tratamiento empleado.
En cuanto a la calidad del vertimiento se solicita información sobre los parámetros
VI. INFORMACIÓN DE LA FUENTE RECEPTORA DEL VERTIMIENTO
¿VLFRTXtPLFRVTXHKD\DQVLGRH[LJLGRVSRUODVDXWRULGDGHVDPELHQWDOHV
Cuerpo Receptor
Río Quebrada Arroyo Caño Canal Lago Laguna Ciénaga Pantano
En relación con los sistemas de tratamiento de aguas residuales, se recomienda tener
presente:
Embalse Jagüey Estero Mar Suelo Otra Cuál:
Nombre de la Fuente Receptora: Tramo/Sector de la Fuente Receptora: Cada vertimiento que se realice debe indicar el sistema de tratamiento que se lleva a
cabo y las características del mismo, antes de ser descargado al cuerpo receptor. Para cada
Descripción de la Fuente Receptora:
etapa de tratamiento, es pertinente relacionar la unidad de tratamiento utilizada.
Departamento: Código DANE: Municipio: Código DANE: Corregimiento: Vereda:
Pretratamiento: cribado (cribas y desarenadores), igualamiento (amortiguamiento de
Nombre: Nombre:
caudales), separación de grasas (trampa de grasas), torre de enfriamiento.
Subzona Nivel subsiguiente de
Hidrográfica: Código: Subzona Hidrográfica: Código: 3ULPDULR WDPLFHV QHXWUDOL]DFLyQ FRDJXODFLyQ SUHFLSLWDFLyQ TXtPLFD  ÀRFXODFLyQ
Objetivos de Calidad Cuerpo Receptor Uso/Destinación Agua Cuerpo Receptor:
ÀRWDFLyQ ÀRWDFLyQSRUDLUHGLVXHOWR)$' VHGLPHQWDFLyQWDQTXHVpSWLFRWDQTXH,PKRII
DLUHDFLyQ¿OWUDFLyQ DUHQDJUDYDDQWUDFLWD 
OD DBO5 DQO Nitrógeno Total Fósforo Total
Unidad mg/L mg/L mg/L mg/L Secundario: laguna anaeróbica, laguna aireada, lagunas facultativas, lagunas de madura-
FLyQORGRVDFWLYDGRV ]DQMyQGHR[LGDFLyQ ¿OWURSHUFRODGRUFRQWDFWRUELROyJLFRURWDWRULR
pH SST Grasas y Aceites Coliformes Fecales SAAM Otro (Biodiscos), digestión anaerobia, SURFHVRVGHOHFKRÀXLGL]DGR\OHFKRH[SDQGLGRSURFHVR
Unidades mg/L mg/L NMP/100ml mg/L Unidad
ascensional de manto de lodos anaerobio (PAMLA-UASB), reactor anaerobio de pistón
5$3 ¿OWURVDQDHURELRVUHDFWRUDHURELRGLJHVWLyQDHURELDVHGLPHQWDFLyQ
Edición 48.475
16 DIARIO OFICIAL Jueves, 28 de junio de 2012

Terciario: Coagulación y sedimentación, adsorción con carbón, intercambio iónico, cada entidad territorial. Para ello dentro de los cuatro (4) meses siguientes a la aprobación
membrana (Ósmosis inversa). de los respectivos planes de desarrollo, según el procedimiento establecido en la Ley 152
Otros: evaporación, diálisis, algas, reacciones de oxido reducción, combustión húmeda, de 1994, las gobernaciones y alcaldías, a través de las Secretarías de Planeación o quien
desinfección, ultravioleta, centrifugado, adición de bacterias, otro. haga su veces, deberán reportar en el aplicativo SICEP la información requerida de línea
de base, según los lineamientos y orientaciones técnicas y metodológicas del Departamento
INFORMACIÓN LEGAL DE LAS AUTORIZACIONES DE VERTIMIENTOS
Nacional de Planeación. En el caso de los municipios dicho reporte se realizará a las Se-
El presente módulo relaciona la información legal y las características correspondientes cretarías de Planeación Departamental o quien haga sus veces, con copia al Departamento
a las autorizaciones de vertimiento otorgadas y vigentes a la fecha del Registro. Esto es, Nacional de Planeación, y en el caso de los departamentos y Bogotá, D. C., al Departamento
los Permisos de Vertimiento, Planes de Cumplimiento y Planes de Saneamiento y Manejo Nacional de Planeación”.
de Vertimientos.
Artículo 3°. Vigencia. La presente resolución rige a partir de su publicación.
VIII. INFORMACIÓN LEGAL DE LAS AUTORIZACIONES DE VERTIMIENTOS Publíquese, comuníquese y cúmplase.
N° Acto administrativo por el cual se inicia el trámite para resolver la solicitud del Fecha (día / mes / año): N° de Expediente:
Permiso de vertimiento:
/ /
Dada en Bogotá, D. C., a 27 de junio de 2012.
N° Acto administrativo por el cual se solicita Fecha (día / mes / año): N° Acto administrativo por el Fecha (día / mes / año): 0DXULFLR6DQWD0DUtD6DODPDQFD
presentación del Plan de Cumplimiento: cual se aprueba el desarrollo del
/ / Plan de Cumplimiento: / / (C. F.).
N° Resolución por la cual se otorga Permiso de Fecha: (día / mes / año) Vigencia del Permiso de Vertimiento:
Vertimiento:

N° Resolución por el cual se aprueba el Plan de


/ /
Fecha (día / mes / año):
Desde: / / Hasta: / /
SUPERINTENDENCIAS
Vigencia del Plan de Saneamiento y Manejo de Vertimientos:
Saneamiento y Manejo de Vertimientos:
/ / Desde: / / Hasta: / /
N° Resolución por la cual se aprueban planos: Fecha (día / mes / año):
/ /
N° Resolución por la cual se
aprueban obras:
Fecha (día / mes / año):
/ /
Superintendencia Nacional de Salud
Fecha de Notificación (día / mes / año): Término:
/ / Años RESOLUCIONES
Caudal de vertido autorizado (l/s): Norma que debe cumplir el Parámetro Unidad Valor
vertimiento:

Modificación: N° Acto Administrativo Fecha: (día / mes / año) Observaciones:


RESOLUCIÓN NÚMERO 000477 DE 2012
relacionado:
/ / (marzo 6)
Renovación: N° Acto Administrativo Fecha: (día / mes / año) Observaciones:
relacionado:
/ /
SRUPHGLRGHODFXDOVHSURUURJDHOWpUPLQRGHODWRPDGHSRVHVLyQLQPHGLDWDGHORVELHQHV
Evaluación Ambiental del Vertimiento: Observaciones: KDEHUHV\QHJRFLRV\ODLQWHUYHQFLyQIRU]RVDDGPLQLVWUDWLYDSDUDDGPLQLVWUDUOD(PSUHVD
0XWXDOSDUDHO'HVDUUROORGHOD6DOXG(66³(PGLVDOXG´ FRQ1,7
Plan de Reconversión en Tecnologías limpias en Vertimientos: Observaciones:
El Superintendente Nacional de Salud, en ejercicio de sus atribuciones legales y re-
JODPHQWDULDVTXHOHFRQ¿HUHQORVSDUiJUDIRVƒ\ƒGHODUWtFXOR\HOSDUiJUDIRžGHO
(C. F.). artículo 233 de la Ley 100 de 1993, el artículo 23, 25, 26 y 27 de la Ley 510 de 1999, el
numeral 42.8 del artículo 42, los incisos 1° y 5° del artículo 68 de la Ley 715 de 2001, los
artículos 35, 36, los numerales 1 y 5 del artículo 37, literales a), b), c), f) y g) del artículo
DEPARTAMENTO NACIONAL DE PLANEACIÓN 39, y los literales a), c), d), e), f) y j) del artículo 40 de la Ley 1122 de 2007, el artículo 124
de la Ley 1438 de 2011, el artículo 116 y 117 del Decreto-ley 663 de 1993, el artículo 1º del
RESOLUCIONES Decreto 1015 de 2002, el Decreto 1922 de 1994, el Decreto 788 de 1998, el artículo 4° del
Decreto 783 de 2000 y en especial con el artículo 1°, los numerales 1, 2, 4 y 8 del artículo
3°, los numerales 1, 6 y 8 y el parágrafo del artículo 4°, el artículo 5°, los numerales 1, 3,
RESOLUCIÓN NÚMERO 1332 DE 2012 4, 5, 8, 14, 15, 22, 23, 24, 25, 26, 30, 34, 38, 39, 40 y 45 del artículo 6°, los numerales 1,
(junio 27) 3, 7, 8, 9, 13, 22, 23, 24, 25, y 42 del artículo 8° del Decreto 1018 de 2007, y los artículos
SRU OD FXDO VH PRGL¿FDQ ORV DUWtFXORV ƒ \ ƒ GH OD 5HVROXFLyQ Q~PHUR  GH  9.1.1.1.1. al 9.1.1.3.3. y del 9.1.3.1.1. al 9.1.3.10.4. del Decreto 2555 de 2010, y,
SRUODFXDOVHGH¿QHQORVOLQHDPLHQWRVSDUDHOUHSRUWHGHODLQIRUPDFLyQUHTXHULGDSDUD CONSIDERANDO:
ODHYDOXDFLyQGHOGHVHPSHxRLQWHJUDOGHODVHQWLGDGHVWHUULWRULDOHV 1. ANTECEDENTES ADMINISTRATIVOS DE LA TOMA DE POSESIÓN IN-
El Director General del Departamento Nacional de Planeación, en ejercicio de sus MEDIATA DE LOS BIENES, HABERES Y NEGOCIOS Y LA INTERVENCIÓN
DWULEXFLRQHVOHJDOHV\HQHVSHFLDOODVTXHFRQ¿HUHHODUWtFXORGHOD/H\GH FORZOSA ADMINISTRATIVA PARA ADMINISTRAR LA EMPRESA MUTUAL
el artículo 90 de la Ley 715 de 2001 y el numeral 24 del artículo 3° del Decreto número PARA EL DESARROLLO DE LA SALUD ESS “EMDISALUD”
3517 de 2009, y 1.1 La Superintendencia Nacional de Salud, mediante la Resolución número 002042
CONSIDERANDO: del 16 de diciembre de 2010, vista a folios de 5 al 54 de la Carpeta número 1, dispuso lo
Que en virtud de lo señalado en el numeral 24 del artículo 3º del Decreto número 3517 de siguiente:
2009, corresponde al Departamento Nacional de Planeación diseñar y organizar los sistemas “Artículo 1°. Ordenar ODWRPDGHSRVHVLyQLQPHGLDWDGHORVELHQHVKDEHUHV\QHJRFLRV
de evaluación de gestión y resultados de la administración pública, en lo relacionado con \ODLQWHUYHQFLyQIRU]RVDDGPLQLVWUDWLYDGHOD(PSUHVD0XWXDOSDUDHO'HVDUUROORGHOD
políticas y con proyectos de inversión. El Departamento Nacional de Planeación, de manera 6DOXG(66³(PGLVDOXG´1,7FX\RGRPLFLOLRHVHQOD&DOOH1ƒ$
VHOHFWLYDSRGUiHMHUFHUGLFKDHYDOXDFLyQVREUHFXDOTXLHUHQWLGDGWHUULWRULDO GH0RQWHUtD &yUGRED FRQOD¿QDOLGDGGHHVWDEOHFHUODVLWXDFLyQUHDOGHODLQWHUYHQLGD
Que el parágrafo 3º del artículo 1° del Decreto número 159 de 2002, adicionado por el ORJUDUHOFDEDOFXPSOLPLHQWRGHVXREMHWRVRFLDO\JDUDQWL]DUODDGHFXDGDSUHVWDFLyQGHO
artículo 3° del Decreto número 777 de 2011, dispone que para efectos del desarrollo de la VHUYLFLRGHVDOXGHQORVWpUPLQRV\FRQODGHELGDREVHUYDQFLDGHODVQRUPDVTXHULJHQSDUD
HYDOXDFLyQGHOGHVHPSHxRLQWHJUDOHQORVFRPSRQHQWHVGHH¿FDFLDH¿FLHQFLDDVLVWHQFLD HO6LVWHPD*HQHUDOGH6HJXULGDG6RFLDOHQ6DOXG\ORGLVSXHVWRHQHO(VWDWXWR2UJiQLFR
técnica y capacidad administrativa, los municipios, distritos y departamentos deberán conti- GHO6LVWHPD)LQDQFLHUR
nuar reportando la información en el aplicativo dispuesto por el Departamento Nacional de Parágrafo(VWDPHGLGDWLHQHSRUREMHWRTXHOD6XSHULQWHQGHQFLD1DFLRQDOGH6DOXG
3ODQHDFLyQGHDFXHUGRFRQORVOLQHDPLHQWRVTXHHVWHGH¿QDKDVWDTXHGLFKDLQIRUPDFLyQ GHWHUPLQHGHQWURGHXQWpUPLQRQRPD\RUGHGRV  PHVHVSURUURJDEOHVSRUHOPLVPR
VHLQWHJUHDO)RUPXODULRÒQLFR7HUULWRULDO )87  WpUPLQRFRQWDGRVDSDUWLUGHODWRPDGHSRVHVLyQVLOD(PSUHVD0XWXDOSDUDHO'HVDUUR-
4XHPHGLDQWH5HVROXFLyQQ~PHURGHVHGH¿QLHURQORVOLQHDPLHQWRVSDUDHO OORGHOD6DOXG(66³(PGLVDOXG´GHEHVHUREMHWRGHOLTXLGDFLyQRVLVHSXHGHQWRPDU
reporte de información requerida sobre la evaluación del desempeño integral de las enti- PHGLGDVSDUDTXHHOPLVPRSXHGDGHVDUUROODUVXREMHWRFRQIRUPHDODVUHJODVTXHORULJHQ
GDGHVWHUULWRULDOHV «
4XHUHVXOWDQHFHVDULRPRGL¿FDUOD5HVROXFLyQQ~PHURGHFRQHO¿QGHDPSOLDU Artículo 3°. Designar FRPR$JHQWH(VSHFLDOGHOD(PSUHVD0XWXDOSDUDHO'HVDUUROOR
los plazos de las acciones previstas en sus artículos 5° y 6°, que garanticen el cumplimiento GHOD6DOXG(66³(PGLVDOXG´ DOGRFWRU'LRQLVLR9DUJDV*LUDOGRSRUWDGRUGHODFpGXOD
de las actividades en ellos contemplado. GHFLXGDGDQtDQ~PHURGH%RJRWiFRPR$JHQWH,QWHUYHQWRUTXHSDUDWRGRVORV
En mérito de lo expuesto: HIHFWRVVHUiHO5HSUHVHQWDQWH/HJDOGHODLQWHUYHQLGD«´
RESUELVE: (…)
Artículo 1°. Modifíquese el inciso 1° del artículo 5° de la Resolución número 435 de 1.2 Así mismo, esta Superintendencia con Resolución número 000326 del 11 de marzo
2012, el cual quedará así: de 2011, visible a folios 501 al 539 de la Carpeta número 4, decidió en el siguiente sentido:
“Artículo 5°. 8QDYH]UDGLFDGDODLQIRUPDFLyQHQOD2¿FLQDGH&RUUHVSRQGHQFLDGHO (…)
Departamento Nacional de Planeación, la Dirección de Desarrollo Territorial Sostenible
“Artículo 1°. Ordenar la reapertura GHOSURFHVRGHOSURFHVRGH,QWHUYHQFLyQ)RU]RVD
la revisará selectivamente en un período de tiempo máximo de veinte (20) días hábiles”.
$GPLQLVWUDWLYDGHOD(PSUHVD0XWXDOSDUDHO'HVDUUROORGHOD6DOXG(66³(PGLVDOXG´
Artículo 2°. Modifíquese el artículo 6° de la Resolución número 435 de 2012, el cual GH FRQIRUPLGDG FRQ OR H[SXHVWR HQ OD SDUWH PRWLYD GH HVWH DFWR DGPLQLVWUDWLYR SRU HO
quedará así: WpUPLQRGHFXDWUR  PHVHVFRQWDGRVDSDUWLUGHODHQWUDGDHQYLJHQFLDGHODSUHVHQWH
“Artículo 6°. 3DUDHIHFWRVGHODHYDOXDFLyQGHODH¿FDFLDHQFDGDSHULRGRGHJRELHUQR UHVROXFLyQSDUDTXHVHGHWHUPLQHVLODHQWLGDGSXHGHGHVDUUROODUVXREMHWRVRFLDORVLGHEH
se tomará como línea de base la programación de las metas para el cuatrienio realizada por VHUREMHWRGHOLTXLGDFLyQ
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 17
Artículo 2°. DesignarFRPR$JHQWH(VSHFLDOGHOD(PSUHVD0XWXDOSDUDHO'HVDUUROOR 2.ÈUHDFRQWDEOH\¿QDQFLHUD&RPRVRSRUWHDODHMHFXFLyQGHOSODQGHVDOYDPHQWRHO
GHOD6DOXG(66´ DOGRFWRU'LRQLVLR9DUJDV*LUDOGRLGHQWL¿FDGRFRQODFpGXODGHFLXGD- iUHD¿QDQFLHUD\FRQWDEOHKDVLGRVREUHODFXDOVHKDQSODQWHDGRPiVHVWUDWHJLDVFRQPLUDV
GDQtDQ~PHURGH%RJRWiTXHSDUDWRGRVORVHIHFWRVVHUiHO5HSUHVHQWDQWH/HJDO´ DPHMRUDUSURFHVRVGHGHSXUDFLyQFRQWDEOHHMHFXFLyQGHSDJRVLQYHQWDULRGHIDFWXUDFLyQ
1.3 La Superintendencia Delegada para las Medidas Especiales, tomó posesión de la SRUSDJDULQIRUPDFLyQDSURYHHGRUHV\FUXFHVGHFXHQWDV&RPRIXHVHxDODGRHQORVKD-
OOD]JRVGHODLQWHUYHQFLyQVRQODVFLIUDVGHORVHVWDGRV¿QDQFLHURVORVTXHHYLGHQFLDQORV
Empresa Mutual para el Desarrollo de la Salud E.S.S. “Emdisalud”, los días 17 y 18 de
SUREOHPDVGHVROYHQFLDTXHWLHQHODHQWLGDG&RQPLUDVDLGHQWL¿FDUORVVDOGRV~QLFRVDO
marzo de 2011, tal como consta en acta suscrita para el efecto. (Folios 546 al 549 de la PRPHQWRGHODWRPDGHSRVHVLyQVHHIHFWXyODVHSDUDFLyQFXHQWDVFRQWDEOHVTXHDIHFWDQ
Carpeta número 4). ORVHVWDGRV¿QDQFLHURVLQGLFDQGRDSDUWLUGHDJRVWRGHORVVDOGRVGHODYLJHQFLD
1.4 De igual manera, la Superintendencia Delegada Para las Medidas Especiales, po- DQWHV\GHVSXpVGHLQWHUYHQFLyQVLWXDFLyQTXHSHUPLWLyGHPDQHUDIDYRUDEOHODLGHQWL¿-
sesionó al doctor Dionisio Vargas Giraldo, del cargo de Agente Especial Interventor de la FDFLyQGHVDOGRVFRUULHQWHVFRPRPXHVWUDGHHMHFXFLyQDFWXDO(QFDGDXQRGHORVIUHQWHV
Empresa Mutual para el Desarrollo de la Salud E.S.S. “Emdisalud”, tal como consta en UHTXHULGRVSDUDVXEVDQDUODVFDXVDOHVGHLQWHUYHQFLyQGHtQGROH¿QDQFLHURVHKDQWHQLGR
Acta número 009 de 2011. (Folios 539A de la Carpeta número 4). avances, pero no los esperados ni proyectados, por lo cual es necesario seguir con ellos
1.5 Posteriormente, mediante Resolución número 001786 del 15 de julio de 2011, la de la siguiente manera:
Superintendencia Nacional de Salud, prorrogó el término de reapertura del proceso de in- D Depuración contable: &RQWLQXDUFRQODGHSXUDFLyQFRQWDEOHHQFDEH]DGHXQD¿UPD
tervención forzosa administrativa para administrar la Empresa Mutual para el Desarrollo H[SHULPHQWDGD 6$&&RQVXOWLQJ HQUHVROYHUEDMRSDUiPHWURVWpFQLFRV\GHPDQHUDGH¿QLWLYD
de Salud E.S.S. “Emdisalud” hasta el día 10 de septiembre de 2011. (Folios 1237 al 1243 ORVDVSHFWRVFRQWDEOHVDORVFXDOHVHOSHUVRQDOGH(PGLVDOXGGHOiUHDFRQWDEOHQRKDGDGR
de la Carpeta número 7). VROXFLyQSRUFDUHQFLDHQFULWHULRVFRPSHWHQWHV\DSURSLDGRVSDUDGDUHOGLFWDPHQVREUHORV
VDOGRVLQVROXWRVTXHDODIHFKDDIHFWDQHOEDODQFH(VWHSURFHVRVHKDFHQHFHVDULRHQYLVWD
1.6 Mediante Resolución número 002228 del 9 de septiembre de 2011, la Superinten- TXHHVLQGXGDEOHHOHVWDQFDPLHQWRGHOHMHUFLFLRGHGHSXUDFLyQFRQWDEOH(OHVWDEOHFLPLHQWR
dencia Nacional de Salud, prorrogó el término de la reapertura del proceso de intervención GHSOD]RGHHVWDODERUHVGHPHVHVUD]yQSRUODFXDOVHHVSHUDTXHDDJRVWRGHVH
forzosa administrativa para administrar la Empresa Mutual para el Desarrollo de Salud SUHVHQWHQHVWDGRV¿QDQFLHURVGHSXUDGRV
E.S.S. “Emdisalud”, desde el día 10 de septiembre de 2011 hasta el día 9 de marzo de 2012.
(Folios 1320 al 1327 de la Carpeta número 7). Anticipos y Avances
2. SOLICITUD DE PRÓRROGA DEL TÉRMINO DE LA TOMA DE POSESIÓN
INMEDIATA DE LOS BIENES, HABERES Y NEGOCIOS Y LA INTERVENCIÓN
FORZOSA ADMINISTRATIVA PARA ADMINISTRAR LA EMPRESA MUTUAL Diferencia de Anticipos por
100,000,000
PARA EL DESARROLLO DE LA SALUD E.S.S. “EMDISALUD” 90,000,000 Capitacion corriente, factor de
identificacion promedio 4 meses.
80,000,000
El doctor Dionisio Vargas Giraldo, Agente Especial Interventor de la Empresa Mutual 70,000,000
para el Desarrollo de la Salud E.S.S. “Emdisalud”, mediante escrito radicado en esta Super- 60,000,000
50,000,000
intendencia el día 29 de febrero de 2012 con NURC 1-2012-017304 solicitó la prórroga del 40,000,000
proceso de Intervención Forzosa Administrativa para Administrar dicha entidad, tal como 30,000,000
39%
se observa a folios 1346 al 1357 de la Carpeta número 7, con el cual, igualmente presentó 20,000,000
10,000,000
los avances del Plan de Recuperación de la ESPSS que demuestra la viabilidad de la misma 0
y las actividades encaminadas a su salvamento. 2011 2010
Del citado documento, se extrae lo siguiente:
“El enfoque del presente texto está centrado en las acciones que se han realizado y las Embargos Judiciales
TXHHVWiQSUR\HFWDGDVSDUDVXEVDQDUGHPDQHUDGH¿QLWLYDODVFDXVDOHVTXHOOHYDURQDOD
intervención. A continuación me permito exponer por cada eje temático los avances, logros,
falencias y propuestas de mejoramiento que considera pertinentes esta intervención para 50,000,000 45%
seguir adelante con el plan de salvamento, el periodo de referencia tendrá como corte estados
¿QDQFLHURVDGHGLFLHPEUHGHSDUDHIHFWRVGHHYDOXDFLyQ¿QDQFLHUD 40,000,000

1. Contexto General: /D(PSUHVD0XWXDOSDUDHO'HVDUUROOR,QWHJUDOGHOD6DOXG± 30,000,000


(PGLVDOXG±GHQWURGHVXSURFHVRGHLQWHUYHQFLyQKDHMHFXWDGRHVWUDWHJLDVHQWpUPLQRV 20,000,000
DGPLQLVWUDWLYRVMXUtGLFRV¿QDQFLHURVWHFQROyJLFRV\GHDVHJXUDPLHQWRHQPDUFDGRVHQVX
10,000,000
SODQGHVDOYDPHQWREDMRDFFLRQHVHVSHFt¿FDVTXHKDQSHUPLWLGRREWHQHUUHVXOWDGRVHQSUR
GHODHPSUHVD'HQWURGHWRGDVODVQHFHVLGDGHVLQVDWLVIHFKDVTXHSHUVLVWHQHQODHPSUHVD 0
\TXHIXHURQHYLGHQFLDGDVHQODWRPDGHSRVHVLyQVHORJUDURQFRQWURODUFLHUWRVIRFRVGH 2011 2010
GHVFRQWUROGHODHPSUHVDTXHIXHURQLGHQWL¿FDGRVHQWHPDVFRPRFRQWUDWDFLyQDXGLWRUtD
KRQRUDULRVJDVWRVDGPLQLVWUDWLYRVSDJRVDODUHGGHSULPHUQLYHO(VWHSODQGHVDOYDPHQWR Fuente: Estados Financieros Diciembre de 2011 – Cifras en Miles de Pesos
VHVRSRUWyHQODFRQGLFLyQGHRSHUDFLyQFRUULHQWHHQHTXLOLEULRRVXSHUDYLWDULDODFXDO E Conciliación de cartera: $SHVDUTXHVHKDGHVDUUROODGRXQSURFHVRGHFRQFLOLDFLyQ
FRQWHPSOyXQRVSDUiPHWURVJHQHUDOHVSDUDHODVt FRQSURYHHGRUHVGHPDQHUDDXWyQRPD\RWUDVFRQYRFDGDVSRUOD6XSHUVDOXGHVWHKDVLGR
D &UHFLPLHQWRGHODSREODFLyQHQPHQVXDO LQVX¿FLHQWHSDUDODGHPDQGDGHLQIRUPDFLyQTXHUHTXLHUHQORVSURYHHGRUHV3DUDPHMRUDU
E &RVWRVHQVDOXGHQ HVWHDVSHFWRVHKDSUR\HFWDGRXQFURQRJUDPDGHWUDEDMRHQODVFLXGDGHVSULQFLSDOHVGRQGH
(PGLVDOXGWLHQHVHGHSDUDUHDOL]DUUHXQLyQGHFUXFHGHFXHQWDV\HVWDEOHFHUODGHXGDFRQ
F *DVWRDGPLQLVWUDWLYRHQ FDGDSUHVWDGRUVLQUHDOL]DUFRPSURPLVRGHSDJRSXHVWRTXHHVWHGHSHQGHGHORVLQJUHVRV
G 0DUJHQGHDKRUURGHO TXHVHSXHGDQSHUFLELUSRUOLTXLGDFLyQGHFRQWUDWRVR\DGHSHQGHUiGHODRSFLyQTXHVH
Dentro del proceso que atraviesa Emdisalud se hacía necesario ajustar aspectos de tipo GH¿QDSRUHOUHVXOWDGRYLDELOLGDGTXHVHSODQWHDPiVDGHODQWH
DGPLQLVWUDWLYR\WHFQROyJLFRTXHDIHFWDEDQGLUHFWDPHQWHHOGHVDUUROORGHOHMHUFLFLR¿QDQFLHUR F  'H¿QLFLyQ GH JORVDV +DFLHQGR XVR GH ODV QRUPDV FRQWDEOHV VH LGHQWL¿FDURQ \
y contable, ya que la empresa no contaba con un archivo acorde con la magnitud de infor- UHFODVL¿FDURQODVJORVDVFRUUHVSRQGLHQWHVDYLJHQFLDVDQWHULRUHVODVFXDOHVDIHFWDEDQQH-
mación que procesa esta, sus programas de información no se encuentran documentados ni JDWLYDPHQWHHOEDODQFH\UHDOL]DUVHODOLPSLH]DGHHVWHVHORJUyHVWLPDUTXHPLOPLOORQHV
existían políticas de seguridad que permitieran el blindaje requerido para el procesamiento SHUWHQHFtDQDYLJHQFLDVDQWHULRUHVODVFXDOHVIXHURQUHFODVL¿FDGDVDFXHQWDVGHRUGHQ
y custodia de la información. A la fecha Emdisalud, ha efectuado los ajustes necesarios con G Plan de pagos acreencias antes de la intervención: El plan de pagos para la red
miras a obtener la optimización de sus prestaciones, en búsqueda de una cobertura univer- SUHVWDGRUDGHODVGHXGDVTXHVHJHQHUDURQDQWHVGHODLQWHUYHQFLyQKDVLGRUHYDOXDGR
VDOHQODDWHQFLyQDVXSREODFLyQD¿OLDGDSDUDORFXDOUHGLVHxyHOPDQHMRGHUHIHUHQFLD\ HQUD]yQDORVHVWXGLRVHIHFWXDGRVREUHODVFRQGLFLRQHV¿QDQFLHURVGH(PGLVDOXG\ODV
contrarefencia, suministro de medicamentos, actividades de P Y P y procesos de auditorías. condiciones generales sistema de salud en Colombia, en la medida que este plan de pagos
6XPDGRDORDQWHULRUVHKDWHQLGRTXHGHQWURGHORVHVWXGLRVUHDOL]DGRVSDUDHYDOXDU HVWiOLJDGRDOLQJUHVRHIHFWLYRTXHSXHGDGDUVHSRUFRQFHSWRGHOLTXLGDFLyQGHFRQWUDWRV
OD YLDELOLGDG ¿QDQFLHUD GH (PGLVDOXG HVWRV SUHFHSWRV VRQ EDVH IXQGDPHQWDO SDUD VX FRQ(QWHV7HUULWRULDOHV\ODFREHUWXUDGHHVWDGHXGDSRUSDUWHGHOJRELHUQR3DUDHOORHVWi
FRQWLQXLGDG&RQORDQWHULRUPHQWHVHxDODGR\ORVDYDQFHVTXHHOSURFHVRGHLQWHUYHQFLyQ VRSRUWDGRFRQODUHYLVLyQGHFLIUDVHIHFWXDGRSRUODGRFWRUD;LPHQD*XHUUHURFRQEDVHDO
KDORJUDGRVHKDQUHDOL]DGRORVDQiOLVLV¿QDQFLHURVUHVSHFWLYRVSDUDH[SRQHUHOSODQGH LQIRUPHGHOD¿UPDFRQVXOWRUD/7,&2/HQGRQGHHOSDQRUDPD¿QDQFLHURGH(PGLVDOXG
YLDELOLGDGTXHODHPSUHVDKDHYDOXDGR\GRQGHVHLQGLFDTXHEDMRXQVXSXHVWRGHHTXLOLEULR HVHVWDEOHHQVXYLJHQFLDFRUULHQWH\VREUHHOFXDOVHSXHGHORJUDUXQHVFHQDULRIDYRUDEOH
HQHOHMHUFLFLRFRUULHQWHODRSFLyQPiVIDYRUDEOHSDUDORJUDUVDOYDUODHPSUHVDHVUHDOL]DU HQWpUPLQRVGHSURJUDPDFLyQ\FXPSOLPLHQWRGHSDJRVSDUDODUHGFRQODFXDOVHWLHQHQ
OD)XVLyQFRQRWUDHPSUHVDGHODVPLVPDVFRQGLFLRQHVWpFQLFDVGHODLQWHUYHQLGDSUHIHULEOH- DFUHHQFLDVGHYLJHQFLDVDQWHULRUHVODVFXDOHVSXHGHQFDQFHODUVHDWUDYpVGH
PHQWHGHOVHFWRUVROLGDULRFRQORFXDOVHSHUPLWDUHDOL]DUXQD¿JXUDGHFDSLWDOL]DFLyQ\QR ‡/DLQPLQHQWHUHFXSHUDFLyQGHVDOGRVGH'HXGRUHVGHO6LVWHPDHQFXRWDVLJXDOHV
DSDODQFDPLHQWRTXHVHDFHUFDPiVDODVUHDOLGDGHVGHOPHGLRVRFLRHFRQyPLFRDFWXDO3DUD DSDUWLUGH6HSWLHPEUHGH
OOHYDUDFDERODHMHFXFLyQGHHVWDGLUHFWUL]VHKDFHQHFHVDULRWHQHUHODYDOGHOD$VDPEOHD
‡GHGHVFXHQWRVTXHEULQGHQORVSURYHHGRUHVD(PGLVDOXGSUHYLRDFXHUGRVGHSDJR
*HQHUDOGH$VRFLDGRVGH(PGLVDOXGHQGRQGHFRQEDVHDODUHDOLGDGWpFQLFD\¿QDQFLHUD
GHODHPSUHVDVHH[SUHVHHVWDQHFHVLGDGFRPRPHGLGDGHVDOYDPHQWR\EDMRHODYDOGHODV ‡7RGDODFDMDSRVLWLYDGLVSRQLEOHGHODRSHUDFLyQFRUULHQWHVHUiHPSOHDGDHQDWHQGHU
6XSHULQWHQGHQFLDVGH(FRQRPtD6ROLGDULD\1DFLRQDOGH6DOXGODFXDOGHEHUiUHDOL]DUVH ODVREOLJDFLRQHVFRQ3URYHHGRUHVGHVDOGRVDMXQLRGH
EDMRORVSDUiPHWURVVHxDODGRVHQHOPDUFRMXUtGLFRH[SXHVWRHQHOAnexo 1, que muestra H Pago a la red prestadora actual: 7HQLHQGRHQFXHQWDORVLQJUHVRVTXHDFWXDOPHQWH
ODVSRVLELOLGDGHVGHYLDELOLGDG¿QDQFLHUD\SDUDODVFXDOHVVHGHEHPDQWHQHUXQFRQWH[WR SHUFLEH(PGLVDOXGHOSDJRDODUHGSUHVWDGRUDDFWXDOVHYLHQHKDFLHQGRGHPDQHUDSURJUH-
FODURHQHOHMHUFLFLRFRUULHQWHGHODHPSUHVDHOFXDOVHORJUDUiHMHFXWDUEDMRODVDFFLRQHV VLYDHQFXPSOLPLHQWRGHORQRUPDGREDMRHOVLJXLHQWHPHFDQLVPRGHDFXHUGRDODIXHQWH
enunciadas en cada una de las áreas como se indica en los numerales subsiguientes. GH¿QDQFLDFLyQGHOLQJUHVR
Edición 48.475
18 DIARIO OFICIAL Jueves, 28 de junio de 2012

INGRESOS PAGOS TIEMPO DE RECAUDO Y PAGO YLFLRV$XWRUL]DFLRQHV0pGLFDV&7&/tQHD4XHMDV\6XJHUHQFLDV5DGLFDFLyQGH


------ ALTO COSTO Anticipado )DFWXUDVGH6DOXG7XWHODVHQWUHRWURVFRQHO¿QGHSUHVWDUHOPHMRUVHUYLFLRDQXHVWURV
SGP y FOSYGA PRIMER NIVEL Anticipado $¿OLDGRV6LQHPEDUJRSRUVHUXQSURGXFWRHQFRQVWDQWHGHVDUUROORUHTXLHUHGHDOWRUHFXUVR
FOSYGA EVENTO 30 Y 60 DÍAS
KXPDQR\GHODDFWXDOL]DFLyQDWHFQRORJtDVGHYDQJXDUGLDSRUORFXDOVHHVWiWUDEDMDQGR
HQODIRUPXODFLyQGHOSUR\HFWRGHUHLQJHQLHUtDDO6,(6SDUDVHUHMHFXWDGRHQXQWLHPSR
ESFUERZO PROPIO OTROS 60 Y 120 DÍAS
DSUR[LPDGRGHDPHVHVHQHOSUHVHQWHDxR
Se implementó satisfactoriamente el instrumento de giro directo ordenado por el Mi-
3RU VX SDUWH HO 6,(6 VXPLQLVWUD JUDQ FDQWLGDG GH LQIRUPDFLyQ DO VLVWHPD FRQWDEOH
nisterio de Protección Social, en donde Emdisalud de manera progresiva ha incrementado
6LVWHPD8QRODFXDOVHHVWiKDFLHQGRDWUDYpVGHSURFHVREDWFKSULQFLSDOPHQWHHQORTXH
HOYROXPHQGHJLURFRPRVHGHPXHVWUDHQHOVLJXLHQWHJUi¿FR
UHVSHFWDDODVFXHQWDVSRUSDJDUSRUFRQFHSWRVGHSUHVWDFLyQGHVHUYLFLRVGHVDOXGFDX-
sando mes a mes las cuentas contables correspondientes.
Giro Directo de EMDISALUD por MPS
E Reemplazo del software contable: 6HWRPy OD GHFLVLyQGHFRQRFHU\ DSURYHFKDU
$ 10,000,000,000.00 HOVLVWHPDFRQWDEOHDFWXDOWHQLHQGRHQFXHQWDTXHDGTXLULUXQQXHYRVRIWZDUHFRQWDEOH
$ 9,000,000,000.00 FRQOOHYDXQFRVWRGHLQYHUVLyQDOWR\UHTXLHUHGHXQWLHPSRSUXGHQWHSDUDUHDOL]DUORVWUDV-
$ 8,000,000,000.00 ODGRVGHVDOGRVGHPDQHUDFRUUHFWD3RUHOORVHUHWRPyODUHYLVLyQGHHVWHVLVWHPDHOFXDO
$ 7,000,000,000.00 (PGLVDOXGLPSOHPHQWyHQHOODYHUVLyQGHO6LVWHPD8QROLFHQFLDVDGTXLULGDVD
$ 6,000,000,000.00 OD¿UPD6(6$\GHVGHDKtKDYHQLGRUHFLELHQGRODVDFWXDOL]DFLRQHVDHVWHVLVWHPDKDVWD
$ 5,000,000,000.00
OOHJDUDODYHUVLyQDFWXDO(O6LVWHPD8QRHVXQD(53TXHDGLIHUHQFLDGHRWUDV
$ 4,000,000,000.00
SURSXHVWDV GHO PHUFDGR KD RSWDGR SRU VHJXLU HQ OD SODWDIRUPD WUDGLFLRQDO RIUHFLHQGR
$ 3,000,000,000.00
LPSRUWDQWHVDKRUURVHQPDWHULDGHLQIUDHVWUXFWXUDGHVRIWZDUH\KDUGZDUH\RIUHFLHQGR
$ 2,000,000,000.00
ODPHMRUUHODFLyQFRVWREHQH¿FLRSDUDOD(PSUHVD(O6RIWZDUHFRQVWDGHORVVLJXLHQWHV
$ 1,000,000,000.00
PyGXORVTXHWLHQHQDSOLFDELOLGDGHQODHQWLGDG
$-
sep-11 oct-11 nov-11 dic-11 ene-12 feb-12 )LQDQFLHUR &XHQWDVSRU3DJDU&XHQWDVSRU&REUDU\&RQWDELOLGDG*HQHUDO
sep-11 oct-11 nov-11 dic-11 ene-12 feb-12 $GPLQLVWUDWLYR 1yPLQD\$FWLYRV)LMRV
VALOR $ 2,395,094, $ 3,524,236, $ 3,632,343, $ 4,858,147, $ 7,998,786, $ 8,751,493,
&RPHUFLDO &RPSUDVH,QYHQWDULRGH6XPLQLVWURV 
(QODDFWXDOLGDGVHHVWiQOOHYDQGRDFDERSURFHVRVGHUHYLVLyQ\YHUL¿FDFLyQGHO6LV-
)XHQWH3XEOLFDFLyQ0HQVXDO2¿FLDO036±&LIUDVHQ0LOHVGH3HVRV WHPDHQFXDQWRDODFRQ¿JXUDFLyQ\SDUDPHWUL]DFLyQGHOPLVPRFRQHO¿QGHJDUDQWL]DU
ODLQWHJULGDGFRQ¿DELOLGDG\FDOLGDGGHODLQIRUPDFLyQ¿QDQFLHUDFRQWDEOH\DGPLQLV-
I Margen de solvencia:&RQHO¿QGHREWHQHUHOPDUJHQGHVROYHQFLDSRVLWLYRVHHVWi WUDWLYDTXHDOOtVHPDQHMD$VtPLVPRVHLPSOHPHQWDURQSROtWLFDVGHVHJXULGDGHQFXDQWR
KDFLHQGRHOHVWXGLRGHIRQGRGHODHVWUDWHJLDGHQRYDFLyQGHDFXHUGRDORVHxDODGRHQHO DODFRQ¿JXUDFLyQ\DGPLQLVWUDFLyQGHORVVHUYLGRUHVGHUHGTXHVRSRUWDQODSODWDIRUPD
7tWXOR;9GHO(VWDWXWR&LYLOTXHSHUPLWHH[WLQJXLUODVREOLJDFLRQHVSDUDVXVWLWXLUODSRU WHFQROyJLFDGHODHQWLGDGVHLPSOHPHQWDURQSROtWLFDVGHFUHDFLyQGHXVXDULRVDOVLVWHPD\
XQDQXHYDREOLJDFLyQVLWXDFLyQTXHVHGDUiHQHOFRUWRSOD]RXQDYH]VHORJUHUHDOL]DUHO VHPHMRUyHOHVTXHPDGHVHJXULGDGLQWHUQRGHODSOLFDWLYRDVtFRPRVXSUHVHQWDFLyQLQLFLDO
cruce de cuentas con los proveedores.
F Equipos de cómputo: 3DUDHO~OWLPRWULPHVWUHGHOVHKDQDGTXLULGRDOUHGHGRU
J $FWLYRV¿MRV&RQHO¿QGHFRQRFHUHOYDORUUHDOGHORV%LHQHVLQPXHEOHVGHOD(P- GHVHWHQWD  QXHYRVHTXLSRVGHFyPSXWR\VHKDQKHFKRLPSRUWDQWHVLQYHUVLRQHVHQOR
SUHVDVHUHDOL]DURQDYDO~RVDORV,QPXHEOHVPiVUHSUHVHQWDWLYRVGHOD(PSUHVDFRQHOORVH TXHUHVSHFWDDODSODWDIRUPDWHFQROyJLFDDFFHVRDLQWHUQHW\FRPXQLFDFLRQHVORVFXDOHV
HYLGHQFLDXQDYDORUL]DFLyQHQORVDFWLYRV¿MRVSRUYDORUGHGLVWULEXLGRVDVt KDQSHUPLWLGRRSWLPL]DU\DXWRPDWL]DUORVSURFHVRVHQODVGLIHUHQWHV2¿FLQDV5HJLRQDOHV
INMUEBLE EMPRESA QUE REALIZÓ EL AVALUO VALORIZACIÓN GH(PGLVDOXG3DUDHVWHDxRVHHVSHUDFRQWDUFRQODVKHUUDPLHQWDVGHFyPSXWRQHFHVDULDV
,QPXHEOH$UEROHWHV(GL¿FLR Lonja de Propiedad Raíz de Montería $265.303.823
SDUDODRSHUDFLyQHQFDGDXQRGHORVPXQLFLSLRVHQORVTXHVHWLHQHSUHVHQFLD\DPSOLDFLyQ
de cobertura por parte de la entidad.
Inmueble Arboletes - Casa Lonja de Propiedad Raíz de Montería $76.301.069
Inmueble Tierralta MN Lonja de Propiedad Raiz de Montería $53.840.223 5. Aseguramiento: Los procesos del área misional desde el momento de la toma de
Locales Cartagena Lonja de Propiedad Raiz de Cartagena $258.077.991
SRVHVLyQIXHURQYHUL¿FDGRV\UHRUJDQL]DGRVFRQPLUDVDRSWLPL]DUHOSHUVRQDOH[LVWHQWHGH
DFXHUGRDVXSHU¿OFRPSURPLVR\UHQGLPLHQWR/RDQWHULRUQRVKDSHUPLWLGRODJDUDQWtD
Inmueble Yopal Lonja de Propiedad Raiz de Yopal, Casanare y la $560.650.983
Orinoquia D ODV SUHVWDFLRQHV GHPDQGDGDV SRU QXHVWURV D¿OLDGRV D WUDYpV GH PHGLGDV LQPHGLDWDV
Terreno Paz de Ariporo Lonja de Propiedad Raiz de Yopal, Casanare y la $113.079.999
WHQGLHQWHVDRSWLPL]DUSURFHVRVGHODVHJXUDPLHQWRTXHSHUPLWDREWHQHUODLQIRUPDFLyQFRQ
Orinoquia SUHFLVLyQ\H¿FLHQFLD\DSOLFDUORVSHU¿OHVHSLGHPLROyJLFRVGHVDOXGSREODFLyQ\HQIRFDGR
,QPXHEOH2¿FLQD1DFLRQDO Lonja de Propiedad Raiz de Montería $493.965.589
HQORVJUXSRVPiVYXOQHUDEOHVTXHUHTXLHUHQDWHQFLyQ
Fuente: Prof. de Gestión Administrativa – Sistemas Uno. D $¿OLDFLyQ\UHJLVWUR(QFDGDiUHDVHKDUHDOL]DGRORFRUUHVSRQGLHQWHSDUDQRGHV-
FXLGDUORVDVSHFWRVYLWDOHVGHQWURGHODLQWHUYHQFLyQFRPRORVRQORVD¿OLDGRVTXHFRPRVH
3. Área Administrativa: /RVKDOOD]JRVHQHOPRPHQWRGHODWRPDGHSRVHVLyQKDQVLGR REVHUYDHQODJUi¿FDDQH[DGXUDQWHHODxRVHHYLGHQFLyXQDSpUGLGDVLJQL¿FDWLYDGH
FRPSUHQGLGRVHQVXJUDQPD\RUtDFRQUHIHUHQFLDDORVJDVWRV\HOSHUVRQDO6HUHSODQWHDURQ XVXDULRVODFXDOVHSUHVHQWyHQpSRFDVGHWUDVODGRV\TXHDSDUWLUGHHOODQRVKHPRVGDGR
ORVPRQWRV¿MRVTXHVHFDQFHODEDQHQDVSHFWRVFRPRDUULHQGRWHOHIRQtD¿MD\FHOXODUGH DODWDUHDGHDXPHQWDUODSREODFLyQ\PDQWHQHUXQDWHQGHQFLDFUHFLHQWHTXHQRVJDUDQWLFH
ORFXDOVHKDQREWHQLGRUHVXOWDGRVSRVLWLYRVHQFDGDDMXVWHTXHVHPDQWLHQHQFRPRSDUi- aumentar los niveles de ingresos.
PHWUREDVHGHDKRUUR6HHPSH]yDFRQFOXLUORVDVSHFWRVSHQGLHQWHVSRUDWDFDUFRPRVRQ
TOTAL AFILIADOS A EMDISALUD AÑO 2011
D Gestión documental: /DHPSUHVDQRFRQWDEDFRQXQDUFKLYRJHQHUDOQLHVWUXFWXUDGR
HOFXDOVHLQLFLyDFRQFHELUHQHOPHVGHVHSWLHPEUHGHSDUDORFXDOVHFHQWUDOL]y
WRGDODLQIRUPDFLyQGHODHPSUHVDHQVXVHGHSULQFLSDOHQODFLXGDGGH0RQWHUtDEDMR
XQ GLUHFFLRQDPLHQWR SUHFLVR SRU OD ¿UPD HVSHFLDOL]DGD /RJLVGRF OD FXDO KD EULQGDGR
FDSDFLWDFLyQDOSHUVRQDOH[LVWHQWH\DDFRPSDxDGRHOSUR\HFWRGHFRQVWLWXFLyQGHODUFKLYR
general de Emdisalud.
E Planta de cargos: 'HVGHHOiUHDGH*HVWLyQKXPDQDVHKDYHQLGRHYDOXDQGRHOSHU-
VRQDOH[LVWHQWHYHUVXVORVSURFHVRVFRQPLUDVDGH¿QLUODSODQWDGHFDUJRVUHTXHULGDSRU
ODVQHFHVLGDGHVGHODHPSUHVD/DGH¿QLFLyQGHHVWDVHHQFXHQWUDHQHWDSD¿QDOVREUHOD
FXDOVHHVWiQHYDOXDQGRODVQHFHVLGDGHVGHVHUYLFLRSURFHVRGHDSR\R\SHU¿O$FWXDOPHQWH
VHKDSUHVFLQGLGRGHSHUVRQDOGHPDQHUDSDXODWLQDEDVDGRVHQODHYLGHQFLDGHIDOODVHQ
HOSURFHVRDPHULWDQGRMXVWDFDXVDRSRUHOFRQWUDULRVHKDQDVXPLGRLQGHPQL]DFLRQHVHQ
casos estrictamente necesarios.
A nivel general están pendientes por desarrollar actividades de capacitación y reorga-
nización con relación a los procesos y procedimientos que se han levantado por cada área
\DGHPiVUHDOL]DUXQSODQGHPDQWHQLPLHQWRHQHOFXDOVHLQFOX\DQWRGDVODVR¿FLQDVGH Fuente: BDUA – Fosyga
Emdisalud, para prever anticipadamente el deterioro producto del uso y agotamiento de la
vida útil de componentes, partes, piezas, materiales y en general, elementos que constituyen E Contratación:&RPRJDUDQWHDOSURFHVRGHSUHVWDFLyQGHVHUYLFLRVVHGHVDUUROOy
la infraestructura, la planta física o los equipos de la organización, permitiendo su recupe- un despliegue precontractual a nivel nacional, sobre el cual se dieron las negociaciones
UDFLyQUHVWDXUDFLyQUHQRYDFLyQ\RSHUDFLyQFRQWLQXDFRQ¿DEOHVHJXUD\HFRQyPLFD\ FRQODUHGSUHVWDGRUDEDMRXQDVFDUDFWHUtVWLFDVGHDXVWHULGDG\DMXVWHGHWDULIDVTXHHQ
con esto realizar la depuración de activos que corresponde. ODJUDQPD\RUtDIXHURQUHFLELGDVGHPDQHUDSRVLWLYDVLQGHVFRQRFHUTXHHOSURFHVRKD
WHQLGRPRPHQWRViOJLGRV\FRPSOLFDGRVSRUODFRUUHODFLyQTXHHVWHSURFHVRSXHGHOOHJDU
 Área de sistemas de información: $HVWDiUHDHQODVHJXQGDHWDSDGHSUyUURJD
DWHQHUFRQHOPDQHMRGHOWHPDGHFDUWHUD3DUDHOSURFHVROOHYDGRDFDERHQHODxR
VHOH KD GDGR ODLPSRUWDQFLDTXHUHTXLHUHHQXQ SURFHVRFRPR HVWH\FRPR VH SODQWHy
se tuvo como resultado que:
LQLFLDOPHQWHVHUHDOL]DURQORVDMXVWHVSHUWLQHQWHV\UHTXHULGRVSRUODHPSUHVDGHDFXHUGR
a sus necesidades así: MODALIDAD
N° CONTRATOS N° DE CONTRATOS
% AVANCE
SUSCRITOS LEGALIZADOS
D Desarrollo de software: (IHFWLYDPHQWH(PGLVDOXGFXHQWDFRQXQVLVWHPDGHLQIRU-
Capitado 1.532 1.436 94%
PDFLyQLQKRXVHOODPDGRSIES, este es un sistema misional propio de Emdisalud, por lo
WDOVHKDGDGRHVSHFLDOWUDWDPLHQWRHLQYHUVLyQHQHOGHVDUUROORGHQXHYRVUHTXHULPLHQWRV Evento 297 208 70%
SDUDTXHVHDMXVWHQDORVSURFHVRVRSHUDWLYRVGHODHPSUHVDFRPRVRQ6ROLFLWXGHVGH6HU- Total 1.829 1.644 89.8%
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 19
En comparación con el momento de la toma de posesión, esta causal demuestra un gran D Acciones de Tutela:)XHURQQRWL¿FDGDVDOD(QWLGDG7XWHODVDQLYHO1DFLRQDO
avance en la medida, que en ese momento únicamente se pudo demostrar y soportar la red de FX\DSUHWHQVLyQSRUSDUWHGHORVWXWHODQWHVHUDODSUHVWDFLyQGHOVHUYLFLRGHVDOXGSDJR
prestadores con base en un contrato únicamente, mientras que a la fecha, Emdisalud cuenta GHVDODULRV\SUHVWDFLRQHVVRFLDOHV\SDJRGHFDUWHUDDORVSUHVWDGRUHVVHUHEDWLHURQ
con un archivo en el área de contratación que cuenta con 1.644 legalizados conforme a la ley. WXWHODVTXHFRUUHVSRQGHQDOGHODVPLVPDV
E Incidentes de Desacatos:6HOHGLRWUiPLWH\FRQWHVWDFLyQGHIRQGRDOGHORV
Incidentes de Desacatos impetrados por las mismas causas del numeral anterior, dentro
GHOSHULRGRGHOD,QWHUYHQFLyQ)RU]RVD$GPLQLVWUDWLYDGH(PGLVDOXG
F Suspensión, Cancelación y Levantamiento de Medidas cautelares dentro de Procesos
Ejecutivos:6HORJUyODVXVSHQVLyQGHOGHORVSURFHVRVHMHFXWLYRVTXHFXUVDQHQORV
GLIHUHQWHV'HVSDFKRVMXGLFLDOHVGHOSDtVFRQWUD(PGLVDOXGLJXDOPHQWHHOOHYDQWDPLHQWR
de las medidas cautelares de embargo que cursaban en contra de Emdisalud, quedando
SHQGLHQWHXQ
G Títulos Judiciales:6HORJUyUHFDXGDUHOGHOYDORUGHORV7tWXORV-XGLFLDOHV
VXPDTXHDVFLHQGHDTXHGDQGRSHQGLHQWHXQSRUUHFODPDU
TXHFRUUHVSRQGHQDOYDORUGH
H Sanciones:6HREWXYRODUHYRFDWRULDGHOGHODVVDQFLRQHVLPSXHVWDVDO$JHQWH
F Auditoría de cuentas médicas:6HUHTXLHUHGDUFRQWLQXLGDGDODFWXDOSURFHVRGH ,QWHUYHQWRUSRULQFXPSOLPLHQWRDORVIDOORVGHWXWHODV
DXGLWRUtDGHFXHQWDVHOFXDOHVWDWHUFHUL]DGRGRQGHVHKDQHYLGHQFLDGRORVORJURVVREUH
I Procesos administrativos: 6HOHYDQWDURQLPSOHPHQWDURQ\VRFLDOL]DURQORVSURFHVRV
HOPDQHMR\VHJXLPLHQWRGHODIDFWXUDFLyQDXGLWDGD(QHODxRVHDXGLWDURQ
GHOiUHDMXUtGLFD
IDFWXUDVTXHUHSUHVHQWDURQGHODYLJHQFLD(QFDGD]RQDVHUHDOL]DURQ
MRUQDGDVGHFRQFLOLDFLyQGHJORVDVFRQODUHGGHSUHVWDGRUHVGHPDQHUDRSRUWXQDHYLGHQ- J Convención Colectiva: 6HORJUyFRQFLOLDUH[WUDMXGLFLDOPHQWHODGHPDQGDTXHFXUVDED
FLDQGRHOFULWHULRWpFQLFRTXHYDOLGDODVJORVDVLQWHUSXHVWDVHOSURPHGLRDQXDOGHJORVDV contra la Entidad por parte del sindicato de la empresa, que pretendía el reconocimiento en
IXHGHO GLQHURGHGRWDFLRQHVFRUUHVSRQGLHQWHVDORVDxRVFRQFHUWiQGRVHUHFRQRFHUOHV
ODVXPDGHFRUUHVSRQGLHQWHVDGRWDFLRQHVSRUWUDEDMDGRUORJUiQGRVHXQ
G Auditoría en la gestión de calidad: 6HHVWiLPSOHPHQWDQGRHOSURFHVRGHDXGLWRUtD
DKRUURGH
HQFDGDXQDGHODV5HJLRQDOHVFRQHO¿QGHJDUDQWL]DUORVLQGLFDGRUHVGHFDOLGDGTXH
SHUPLWDQODWRPDGHGHFLVLRQHVFRQWUDFWXDOHVSDUDPHMRUDUODH¿FDFLDHQODVSUHVWDFLRQHV $SHVDUGHODVDFWLYLGDGHVHMHFXWDGDVVHLGHQWL¿FDQWUHVIRFRVGHHMHUFLFLRSHUPDQHQWH
GHVHUYLFLRVGHUHG(VWHVHFRQVWLWX\yFRQORVDXGLWRUHVPpGLFRVTXHD~QHVWiQGHQWURGHOD VREUHODVFXDOHVHVWDiUHDKDGLVWULEXLGRODVODERUHVDQLYHOQDFLRQDOFRRUGLQDGDVGHVGHHO
SODQWDGHOSHUVRQDO\FRRUGLQDGRGHVGHHOQLYHOFHQWUDOFRQXQHQIRTXHEiVLFRGHUHYLVLyQ QLYHOFHQWUDOHQGRQGHVHHIHFW~DHOVHJXLPLHQWRSHUPDQHQWHGHODVVLJXLHQWHVDVt
GHFDVRVHVSHFt¿FRVGHFRQFXUUHQFLD\FDOLGDG D Tutelas: 6HQRWL¿FDURQWXWHODVDQLYHO1DFLRQDOGHODVFXDOHVQRVHFRQWHVWDURQ
H Autorizaciones:$WUDYpVGHXQRXWVRXUFLQJVHFDQDOL]DQWRGDVODVOODPDGDVTXHGH- WXWHODVFRUUHVSRQGLHQWHDXQGHODVPLVPDV3DUDORJUDUHOFXPSOLPLHQWRGHODPHWD
PDQGHQQXHVWURVD¿OLDGRVGHOD5HJLRQDO1RURFFLGHQWDOHOFXDODSRUWDXQDLQIUDHVWUXFWXUD WUD]DGDSRUHO$JHQWH,QWHUYHQWRUTXHHVUHGXFLUODVWXWHODVDVHKDFHQHFHVDULRLPSOH-
VyOLGDHQWHOHFRPXQLFDFLRQHVVHKDFHQHFHVDULRLPSOHPHQWDUWDPELpQHVWDLQIUDHVWUXFWXUD PHQWDUHVWUDWHJLDVD¿QGHWUDEDMDUGHPDQHUDPDQFRPXQDGDFRQHOiUHDGHDVHJXUDPLHQWR
HQODVGHPiV5HJLRQDOHVSDUDDVtORJUDUXQDDVLJQDFLyQGHFLWDVRSRUWXQDV\UHVSXHVWDD E Suspensión de Procesos Ejecutivos, Cancelación y Levantamiento de Medidas
,36HQWLHPSRVFRPRORLQGLFDODOH\\DTXHHQODVWUHV5HJLRQDOHV5HVWDQWHVVHFUHyXQD cautelares:(QODDFWXDOLGDGVHHQFXHQWUDQSHQGLHQWHVSRUVXVSHQGHUXQGHORVSUR-
FHQWUDOGHDXWRUL]DFLRQHVHQODFLXGDGGHPRQWHUtD\XQOtQHD01800914823 encontrando FHVRVHMHFXWLYRVTXHFXUVDQHQFRQWUDGH(PGLVDOXGSRUSDUWHGHORVGHVSDFKRVMXGLFLDOHV
DFWXDOPHQWHUHWUDVRHQORVWLHPSRVGHUHVSXHVWDV(OSRUFHQWDMHGHHIHFWLYLGDGHQODUHV- ORDQWHULRUGHELGRDODSRVLFLyQGLODWRULDTXHKDQDGRSWDGRDOJXQRVMX]JDGRVGHOSDtVTXH
SXHVWDGHDXWRUL]DFLRQHVHVGHO FRQVLGHUDQTXHODSHWLFLyQGHODVXVSHQVLyQGHORVSURFHVRV\OHYDQWDPLHQWRGHPHGLGDV
FDXWHODUHVGHEHVHUVROLFLWDGDSRUHO6XSHULQWHQGHQWH1DFLRQDOGH6DOXG
F Títulos Judiciales:'HORVWtWXORV-XGLFLDOHVTXHGDQSHQGLHQWHVSRUHQWUHJDUSRU
SDUWHGHORVGHVSDFKRVMXGLFLDOHV\DWHQGLHQGRHOLQYHQWDULRTXHVHOHYDQWyFRQHODSR\R
GHO%DQFR$JUDULRVXPDTXHDVFLHQGHDXQYDORUGHTXHFRUUHVSRQGHD
XQ/DWDUGDQ]DGHHQWUHJDGHORVPLVPRVSRUSDUWHGHORVMX]JDGRVVHGHEHDTXH
DOJXQRV'HVSDFKRV-XGLFLDOHVH[LJHQSURQXQFLDPLHQWRGHOD6XSHULQWHQGHQFLD1DFLRQDO
GH6DOXGUHVSHFWRGHTXLpQHVODSHUVRQDLGyQHDSDUDUHFODPDUGLFKRVWtWXORV
(…)
2. CONSIDERACIONES DE LA SUPERINTENDENCIA NACIONAL DE SALUD
Partiendo de la situación expuesta en el presente acto administrativo, le corresponde a
este Despacho decidir sobre la solicitud de ampliación de término del proceso de la toma de
posesión inmediata de los bienes, haberes y negocios y la intervención forzosa administrativa
para administrar la Empresa Mutual para el Desarrollo de la Salud E.S.S. “Emdisalud”,
previo los siguientes aspectos de facto y de derecho así:
I Recobros:6HUHTXLHUHPDQWHQHUSURFHVRGHUHFREURVDODVGLIHUHQWHVLQVWDQFLDVFRPR a) De conformidad con los artículos 48 y 49 de la Constitución Política, la Seguridad
VRQ)RV\JDOREE\DQWHVHFUHWDUtDV\DODVFRPSDxtDVGHVHJXURVSDUDJDUDQWL]DUHOUHP- Social en su componente de atención en salud es un servicio público de carácter obligato-
EROVRGHORVUHFXUVRVLQYHUWLGRVSRUOD(36\TXHGHEHQSRUQRUPDDVXPLUODVHQWLGDGHV rio que se prestará bajo la dirección, coordinación y control del Estado, en sujeción a los
DQWHVPHQFLRQDGDVORDQWHULRUSDUDJDUDQWL]DUODVROYHQFLD\HOHTXLOLEULR¿QDQFLHUR3DUD SULQFLSLRVGHH¿FLHQFLDXQLYHUVDOLGDG\VROLGDULGDG
REWHQHUPHMRUÀXMRGHUHFXUVRVVHWHUFHUL]yHOSURFHVRDSDUWLUGHHVWHVHKDQLQLFLDGR b) El artículo 68 de la Ley 715 de 2001, dispuso que “La Superintendencia Nacional
PHVDVGHWUDEDMRFRQORV'HSDUWDPHQWRVGH%R\DFi\&DVDQDUH de Salud, ejercerá la intervención forzosa administrativa para administrar o liquidar las
J &RPLWpV7pFQLFR&LHQWt¿FR5HIHUHQWHDHVWHSURFHVRVHKDLPSOHPHQWDGRODWHU- entidades vigiladas que cumplan funciones de explotación u operación de monopolios ren-
FHUL]DFLyQGHOPLVPRSDUDGDUFXPSOLPLHQWRRSRUWXQRDODVVROLFLWXGHVUHDOL]DGDVHQOR tísticos, cedidos al sector salud, Empresas Promotoras de Salud e Instituciones Prestadoras
FRQFHUQLHQWHDORVVHUYLFLRVWDQWRDPEXODWRULRVFRPRKRVSLWDODULRVJDUDQWL]DQGRGHHVWD de Salud de cualquier naturaleza, así como intervenir técnica y administrativamente las
PDQHUDHODFFHVRRSRUWXQRGHORVXVXDULRVDODDWHQFLyQHQVDOXGVHJ~QODQRUPDWLYLGDG direcciones territoriales de salud, en los términos de ley y los reglamentos. La intervención
YLJHQWH 6RORFXDQGROD(366DVXPHOR12326\EXVFDHOUHFREURDOHQWHWHUULWRULDO  de la Superintendencia Nacional de Salud, a las Instituciones Prestadoras de Salud, tendrá
K Liquidación de contratos entes: 6HUHDOL]yHOSURFHVRGHOLTXLGDFLyQGHORVFRQWUDWRV una primera etapa que consistirá en el salvamento.
GHYLJHQFLDVDQWHULRUHVGHQWURGHORVFXDOHVVHSHUPLWLyHOSDJRGHREOLJDFLRQHVH[LVWHQWHV c) Por su parte, el artículo 124 de la Ley 1438 de 2011, preceptúo lo siguiente:” El nu-
FRQOD5HGGHSUHVWDFLyQGHVHUYLFLRVEDMDFRPSOHMLGDG\HOLQJUHVRHIHFWLYRGHUHFXUVRVD PHUDOGHODUWtFXORGHOD/H\GHTXHGDUiDVt³(MHGHDFFLRQHV\PHGLGDV
OD(36SDUDFXPSOLUFRQODVREOLJDFLRQHVH[LVWHQWHVFRQOD5HGGHSUHVWDFLyQGHVHUYLFLRV HVSHFLDOHV6XREMHWLYRHVDGHODQWDUORVSURFHVRVGHLQWHUYHQFLyQIRU]RVDDGPLQLVWUDWLYD
GHPHGLDQD\DOWDFRPSOHMLGDG(VQHFHVDULRODJHVWLyQDGPLQLVWUDWLYDSDUDJDUDQWL]DU SDUDDGPLQLVWUDUROLTXLGDUODVHQWLGDGHVYLJLODGDVTXHFXPSOHQIXQFLRQHVGH(QWLGDGHV
HOLQJUHVRGHUHFXUVRVTXHSRUOLTXLGDFLyQGHFRQWUDWRVD~QQRVHKDQKHFKRHIHFWLYRVD 3URPRWRUDVGH6DOXG,QVWLWXFLRQHV3UHVWDGRUDVGH6DOXGGHFXDOTXLHUQDWXUDOH]D\PR-
IDYRUGHOD(36 nopolios rentísticos cedidos al sector salud no asignados a otra entidad, así como para
L Liquidación de contratos IPS: 3DUDRSWLPL]DUODHMHFXFLyQRSRUWXQDGHOSURFHVRVH LQWHUYHQLUWpFQLFD\DGPLQLVWUDWLYDPHQWHODVGLUHFFLRQHVWHUULWRULDOHVGHVDOXGHQORVWpU-
FRQWUDWDGRDXQWHUFHURSDUDFRQFLOLDFLyQGHJORVDVH[LVWHQWHVHQWUHOD(36\ODUHGSUHVWD- PLQRVGHOH\\ORVUHJODPHQWRV/DLQWHUYHQFLyQ7UDWiQGRVHGHOLTXLGDFLRQHVYROXQWDULDV
GRUD$SDUWLUGHHVWHSURFHVRVHLQLFLyODOLTXLGDFLyQGHORVFRQWUDWRVH[LVWHQWHVFRQODUHG OD6XSHULQWHQGHQFLD1DFLRQDOGH6DOXGHMHUFHUiLQVSHFFLyQYLJLODQFLD\FRQWUROVREUHORV
GHSUHVWDFLyQGHVHUYLFLRVVLWXDFLyQTXHSHUPLWLyODGLVPLQXFLyQGHODFDUWHUDH[LVWHQWHOD GHUHFKRVGHORVD¿OLDGRV\ORVUHFXUVRVGHOVHFWRUVDOXG(QFDVRVHQTXHOD6XSHULQWHQ-
UHFXSHUDFLyQGHYDORUHVHIHFWLYRVSDUDOD(36\HOFRQWUROGHORVUHTXHULPLHQWRVSRUSDUWH GHQFLD1DFLRQDOGH6DOXGUHYRTXHHOFHUWL¿FDGRGHDXWRUL]DFLyQRIXQFLRQDPLHQWRTXHOH
de los entes de control por el incumplimiento a las obligaciones adquiridas. RWRUJXHDODV(QWLGDGHV3URPRWRUDVGH6DOXGR,QVWLWXFLRQHV3UHVWDGRUDVGH6DOXGGHEHUi
GHFLGLUVREUHVXOLTXLGDFLyQ´.
 Jurídica:3DUDHOiUHD-XUtGLFDGH(PGLVDOXGHOSURFHVRLQLFLDOGHLQWHUYHQFLyQVH
VXVFULELyDUHVROYHUODVDFFLRQHVLPSDUWLGDVSRUORVXVXDULRVFRPRFRQVHFXHQFLDVDODQR d) El numeral 26 del artículo 6° del Decreto 1018 de 2007 estableció lo siguiente:
DWHQFLyQVLWXDFLyQTXHIXHFDXVDOGHLQWHUYHQFLyQ\GHODVFXDOHVVHSXHGHSUHVHQWDUODV “26. Ejercer la intervención forzosa para administrar o liquidar las entidades vigiladas
actividades: que cumplan funciones de administración de monopolios rentísticos cedidos al Sector
Edición 48.475
20 DIARIO OFICIAL Jueves, 28 de junio de 2012

Salud, Entidades Promotoras de Salud de cualquier naturaleza que administren cualquier Parágrafo. La prórroga será por el término de seis (6) meses contados a partir del día 9
régimen e Instituciones Prestadoras de Salud de cualquier naturaleza, e intervenir técnica y de marzo de 2012, hasta el día 8 de septiembre de 2012.
administrativamente las direcciones territoriales de salud, en los términos que señale la ley Artículo 2°. Comunicar el contenido de la presente Resolución al doctor Dionisio Vargas
y los reglamentos. La intervención en las instituciones prestadoras de salud, tendrá siempre Giraldo, Agente Especial Interventor de la Empresa Mutual para el Desarrollo de la Salud
una primera fase de salvamento. E.S.S. “Emdisalud”, en la calle 22 N° 8A-38 en Montería - Córdoba, y al correo electrónico:
e) El término establecido en la Resolución número 002228 del 9 de septiembre de 2011, josedionisiovargas@gmail.com.
respecto de la medida de intervención Forzosa Administrativa Para Administrar la Empresa Artículo 3°. Comunicar el contenido del presente acto administrativo, al Ministerio de
Mutual para el Desarrollo de la Salud E.S.S. “Emdisalud”, vence el 9 de marzo de 2012. Salud y de Protección Social, a la Comisión de Regulación en Salud y a los Gobernado-
f) Ahora bien, el parágrafo del artículo 22 de la Ley 510 de 1999, preceptúa lo siguiente: res de los departamentos donde la Empresa Mutual para el Desarrollo de la Salud E.S.S.
“Parágrafo (…) ³(PGLVDOXG´WHQJDFREHUWXUDJHRJUi¿FDHVWRHV$WOiQWLFR%ROtYDU&yUGRED0DJGDOHQD
6XFUH$QWLRTXLD&KRFy$UDXFD%R\DFi&DVDQDUH&HVDU1RUWHGH6DQWDQGHU\6DQWDQ-
Término. Dentro de un término no mayor de dos (2) meses prorrogables contados a der, al Consorcio SAYP, y a la Superintendencia Delegada para Medidas Especiales de la
partir de la toma de posesión, la Superintendencia Bancaria, previo concepto del Fondo Superintendencia Nacional de Salud.
de Garantías de Instituciones Financieras, determinará si la entidad debe ser objeto de
liquidación, si se pueden tomar medidas para que la misma pueda desarrollar su objeto Artículo 4°. Publicar la presente resolución en el 'LDULR2¿FLDO.
conforme a las reglas que la rigen o si pueden adoptarse otras medidas que permitan a los Artículo 5°. La presente resolución rige a partir de su expedición y contra la misma no
depositantes, ahorradores o inversionistas obtener el pago total o un pago parcial de sus procede recurso alguno.
créditos de conformidad con este artículo. En los dos últimos casos, el Fondo de Garantías Comuníquese, publíquese y cúmplase.
de Instituciones Financieras presentará a la Superintendencia Bancaria el programa que
Dada en Bogotá a los 6 de marzo de 2012.
DTXpOVHJXLUiFRQHO¿QGHORJUDUHOFXPSOLPLHQWRGHODPHGLGD\HQHOFXDOVHVHxDODUiQ
ORVSOD]RVSDUDHOSDJRGHORVFUpGLWRV'LFKRSURJUDPDSRGUiVHUPRGL¿FDGRFXDQGRODV El Superintendente Nacional de Salud,
circunstancias lo requieran, evento que se comunicará a la Superintendencia Bancaria y a &RQUDGR$GROIR*yPH]9pOH]
los interesados. Lo anterior sin perjuicio de que pueda haber acuerdos entre los acreedores (C. F.).
y la entidad objeto de la toma de posesión.
En el evento de que se disponga la liquidación de la entidad por parte de la Superinten- RESOLUCIÓN NÚMERO 001776 DE 2012
dencia Bancaria, la toma de posesión se mantendrá hasta que termine la existencia legal de
la entidad o hasta que se entreguen los activos remanentes al liquidador designado por los (junio 26)
accionistas, una vez pagado el pasivo externo. Si se decide adoptar las medidas necesarias SRUODFXDOVHSURUURJDHOWpUPLQRGHOD5HDSHUWXUDGHOSURFHVRLQWHUYHQFLyQIRU]RVD
para que la entidad pueda desarrollar su objeto social de acuerdo con las normas que la administrativa para administrar la Empresa Social del Estado Hospital Local de Puerto
rigen u otras medidas que permitan obtener el pago total o parcial de los créditos de los &RORPELD$WOiQWLFR
depositantes, ahorradores e inversionistas, en la forma prevista en este artículo, la toma de El Superintendente Nacional de Salud, en ejercicio de sus atribuciones legales y re-
posesión se mantendrá hasta que la Superintendencia Bancaria, previo concepto del Fondo de JODPHQWDULDVTXHOHFRQ¿HUHQHOSDUiJUDIRƒGHODUWtFXORHOSDUiJUDIRƒGHODUWtFXOR
Garantías de Instituciones Financieras, determine la restitución de la entidad a los accionistas. 233 de la Ley 100 de 1993, el artículo 22 de la Ley 510 de 1999, el numeral 8 del artículo
Cuando no se disponga la liquidación de la entidad, la toma de posesión no podrá exceder 42, los incisos 1°, 3°, 5° y 6° del artículo 68 de la Ley 715 de 2001, los artículos 35, 36,
del plazo de un (1) año, prorrogable por la Superintendencia Bancaria, por un plazo no mayor los numerales 1, 3, 4, 5, 6 del artículo 37, los literales a), b), c), d) y f) del artículo 39 de
GHXQDxRVLHQHVHODSVRQRVHVXEVDQDUHQODVGL¿FXOWDGHVTXHGLHURQRULJHQDODWRPDGH la Ley 1122 de 2007, literales a), c), e), f), y h) del artículo 40 de la Ley 1122 de 2007, el
posesión, la Superintendencia Bancaria dispondrá la disolución y liquidación de la institu- artículo 124 de la Ley 1438 de 2011, el artículo 116 del Decreto-ley 663 de 1993, el Decreto
ción vigilada. Lo anterior sin perjuicio de que el Gobierno por resolución ejecutiva autorice número 1922 de 1994, Decreto número 788 de 1998, el artículo 4° del Decreto número 783
una prórroga mayor cuando así se requiera en razón de las características de la entidad.” de 2000, el artículo 1° del Decreto número 1015 de 2002, y en especial con el artículo 1°,
g) Adicionalmente la Asesora Encargada de las Funciones de Superintendente Delega- numerales 1, 2, 3, 4, 5 y 6 del artículo 3°, los numerales 1, 7 y 8 del artículo 4°, el artículo
do Para Medidas Especiales de la Superintendencia Nacional de Salud, conceptuó el 7 de 5° los numerales 1, 3, 4, 5, 10, 12, 13, 14, 18, 19, 21, 22, 23, 24, 25, 26, 28, 34, 36, 38, 40
marzo de 2012, sobre la viabilidad de prorrogar el término de la medida que nos ocupa, en y 42 del artículo 6°, numerales 7, 8, 22, 23, 25, y 42 del artículo 8° del Decreto número
los siguientes términos: 1018 de 2007, y los artículos 9.1.1.1.1 al 9.1.2.1.3 del Decreto número 2555 de 2010, y
“5. CONCLUSIÓN Y CONSIDERACIÓN DE LA SUPERINTEDENCIA DELE- CONSIDERANDO:
GADA PARA LAS MEDIDAS ESPECIALES I. Antecedentes administrativos de la toma de posesión inmediata de los bienes,
(…) haberes y negocios y la intervención forzosa administrativa para administrar la Em-
presa Social del Estado Hospital Local de Puerto Colombia-Atlántico.
Teniendo en cuenta lo expuesto anteriormente, la Superintendencia Delegada para Medidas
Especiales considera viable prorrogar el proceso de Intervención Forzosa Administrativa 1.1 La Superintendencia Nacional de Salud mediante Resolución número 001862 del
para Administrar la Empresa Mutual para el Desarrollo de la Salud E.S.S. “Emdisalud”, 27 de julio de 2011, visible a Folios 1 a 47 de la Carpeta número 1, dispuso lo siguiente:
SRUVHLV  PHVHVD¿QGHDMXVWDUHOSODQGHDFFLyQ\UHDOL]DUODVVLJXLHQWHVDFWLYLGDGHV «
‡'H¿QLUORVHVFHQDULRV¿QDQFLHURVSDUDHO3ODQGH5HVFDWHGHDFXHUGRFRQORH[SXHVWR “Artículo 1°. Ordenar la reapertura GHOSURFHVRGH,QWHUYHQFLyQ)RU]RVD$GPLQLVWUDWLYD
en la solicitud de prórroga presentada por el Agente Interventor (ver folios 1358 al 1385 de la Empresa Social del Estado Hospital Local de Puerto Colombia, GHFRQIRUPLGDG
de la carpeta 7). FRQORH[SXHVWRHQODSDUWHPRWLYDGHHVWH$FWR$GPLQLVWUDWLYRSRUHOWpUPLQRGHFLQFRV
‡(VWDEOHFHUODSHUWLQHQFLDGHODFDSLWDOL]DFLyQIXVLyQDOLDQ]DVHVWUDWpJLFDVRDOWHUQDWLYDV  PHVHVSURUURJDEOHVFRQWDGRVDSDUWLUGHODH[SHGLFLyQGHODSUHVHQWHUHVROXFLyQSDUD
que permitan el buen funcionamiento de la entidad, propendiendo por la protección de los TXHVHGHWHUPLQHVLODHQWLGDGSXHGHGHVDUUROODUVXREMHWRVRFLDORVLGHEHVHUREMHWRGH
D¿OLDGRV\ODJDUDQWtDGHODSUHVWDFLyQGHORVVHUYLFLRVGHVDOXG /LTXLGDFLyQ HQ ORV WpUPLQRV \ OD GHELGD REVHUYDQFLD GH ODV QRUPDV TXH ULJHQ SDUD HO
6LVWHPD*HQHUDOGH6HJXULGDG6RFLDOHQ6DOXG\ORGLVSXHVWRHQHO(VWDWXWR2UJiQLFRGHO
‡$MXVWDUHO3ODQGH3DJRV 6LVWHPD)LQDQFLHUR
‡*HQHUDUHVWUDWHJLDVGHLQWHUYHQFLyQGHOULHVJRGHDFXHUGRDOSHU¿OHSLGHPLROyJLFR\ Artículo 2°. DesignarFRPR$JHQWH(VSHFLDOGHODEmpresa Social del Estado Hospital
ODVFDXVDOHVGHPRUELPRUWDOLGDG(VSHFt¿FDPHQWHHQFDPLQDGDVDODUHGXFFLyQGHODPRU- Local Puerto Colombia DOGRFWRU%HQMDPtQ*XDUGRGHO5tRLGHQWL¿FDGRFRQODFpGXOD
talidad materna. GH FLXGDGDQtD Q~PHUR  GH 7XUEDFR%ROtYDU TXH SDUD WRGRV ORV HIHFWRV VHUi HO
‡0HMRUDPLHQWRGHOSURFHVRGHDXGLWRUtDPpGLFDDQLYHOQDFLRQDOGHDFXHUGRFRQHO representante Legal…”.
VHJXLPLHQWRGHLQGLFDGRUHV\UHVXOWDGRVUHÀHMDGRVHQHOFRVWRPpGLFR 1.2 El doctor Benjamín Guardo del Río tomó posesión del cargo de Agente Especial
De igual manera, deberá adelantar las demás acciones que considere pertinentes incluir Interventor de la Empresa Social del Estado Hospital Local de Puerto Colombia-At-
HQ VX 3ODQ GH$FFLyQ RULHQWDGDV D EXVFDU OD FDSLWDOL]DFLyQ \R UHVFDWH ¿QDQFLHUR GH OD lántico, el día 19 de agosto de 2011, tal como consta en Acta número 040, visible a Folio
Empresa Mutual para el Desarrollo de la Salud E.S.S. “Emdisalud”. 49 de la Carpeta número 1.
Lo anterior, además permitirá determinar a la Superintendencia Nacional de Salud, si 1.3 La Superintendencia Nacional de Salud en la Resolución número 004092 del 23 de
la entidad debe ser objeto de liquidación o puede cumplir su objeto social dentro de los diciembre de 2011, vista a Folios 493 a 498 de la Carpeta número 2, decidió lo siguiente:
HVWiQGDUHVGHSHUPDQHQFLDHVWDEOHFLGDVSDUDWDO¿Q´ « (…)
Teniendo en cuenta lo anterior, este Despacho considera necesario prorrogar el término “Artículo 1°. Prorrogar SRUHOWpUPLQRGHODWRPDGHSRVHVLyQLQPHGLDWDGHORVELH-
de la toma de posesión inmediata de los bienes, haberes y negocios y la intervención forzosa QHVKDEHUHV\QHJRFLRV\GHOD,QWHUYHQFLyQ)RU]RVD$GPLQLVWUDWLYDSDUDDGPLQLVWUDUOD
administrativa para administrar la Empresa Mutual para el Desarrollo de la Salud “Emdisa- Empresa Social del Estado Hospital Local Puerto ColombiaFRQ1,7SRU
OXG´KDVWDHOGHVHSWLHPEUHGHFRQHO¿QGHDGHODQWDUODVDFFLRQHVQHFHVDULDVTXH ODVUD]RQHVH[SXHVWDVHQODSDUWHPRWLYDGHOSUHVHQWHSURYHtGR
JDUDQWLFHQHOQRUPDOIXQFLRQDPLHQWRGHODHQWLGDG\ORVGHUHFKRVGHVXVD¿OLDGRV
Parágrafo 1°. /DSUyUURJDVHUiKDVWDSRUHOWpUPLQRGHVHLV  PHVHVFRQWDGRVDSDUWLU
En mérito de lo expuesto, este Despacho, GHOGtDGHGLFLHPEUHGHKDVWDHOGtDGHMXQLRGH
RESUELVE: 1RREVWDQWHSRUUD]RQHVGHFRQYHQLHQFLD\QHFHVLGDGGHELGDPHQWHFRPSUREDGDVOD6X-
Artículo 1°. Prorrogar el término de la toma de posesión inmediata de los bienes, ha- SHULQWHQGHQFLD1DFLRQDOGH6DOXGSRGUiUHDOL]DUODVSUyUURJDVTXHVHDQQHFHVDULDVGHQWUR
beres y negocios y de la Intervención Forzosa Administrativa para Administrar la Empresa GHORVWpUPLQRVVHxDODGRVSRUODOH\KDVWDTXHVHVXEVDQHQODVGL¿FXOWDGHVTXHGLHURQRULJHQ
Mutual para el Desarrollo de la Salud “Emdisalud”, por las razones expuestas en la parte DODWRPDGHSRVHVLyQ\HQWRGRFDVRGHEHREVHUYDUVHHOQXPHUDOGHODUWtFXORGHOD
motiva del presente proveído. /H\GHPHGLDQWHHOFXDOVHPRGL¿FyHODUWtFXORGHO'HFUHWROH\GH
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 21
'HOPLVPRPRGRHO$JHQWH(VSHFLDO,QWHUYHQWRUFXDQGRDVtORUHTXLHUDFRQSUHYLD trativa, para administrar o para liquidar las entidades vigiladasTXHFXPSODQIXQFLRQHV
MXVWL¿FDFLyQSRGUiVROLFLWDUODVSUyUURJDVQHFHVDULDVHQUD]yQGHODVFDUDFWHUtVWLFDVGH GHH[SORWDFLyQXRSHUDFLyQGHPRQRSROLRVUHQWtVWLFRVFHGLGRVDOVHFWRUVDOXG(PSUHVDV
la entidad. 3URPRWRUDVGH6DOXGH,QVWLWXFLRQHV3UHVWDGRUDVGH6DOXGGHFXDOTXLHUQDWXUDOH]DDVt
/R DQWHULRU VLQ SHUMXLFLR GH TXH HVWD HQWLGDG SUHYLR FRQFHSWR GHO$JHQWH (VSHFLDO FRPR HQ ORV GH LQWHUYHQFLyQ WpFQLFD DGPLQLVWUDWLYD GH ODV 'LUHFFLRQHV 7HUULWRULDOHV GH
LQWHUYHQWRU \ HYDOXDFLyQ SRU SDUWH GH HVWD 6XSHULQWHQGHQFLD GLVSRQJD OD GLVROXFLyQ \ 6DOXGODVQRUPDVGHSURFHGLPLHQWRSUHYLVWDVHQHODUWtFXORGHO'HFUHWROH\GH
OLTXLGDFLyQGHODLQWHUYHQLGD´ 1993, la Ley 510 de 1999, el Decreto número 2418 de 1999 y demás disposiciones que lo
PRGL¿TXHQ\GHVDUUROODQ”.
2. Solicitud de prórroga de la medida
³/D6XSHULQWHQGHQFLD1DFLRQDOGH6DOXGHQHMHUFLFLRGHVXVDWULEXFLRQHV\FRPSH-
El doctor Benjamín Guardo del Río, Agente Especial Interventor de la Empresa
WHQFLDVVHxDODGDVSRUORVDUWtFXORV\GHOD/H\GHSRGUiHQWRGRWLHPSR
Social del Estado Hospital Local Puerto Colombia-Atlántico, mediante escrito radicado HMHUFHUODLQWHUYHQFLyQIRU]RVDDGPLQLVWUDWLYDSDUDDGPLQLVWUDUROLTXLGDUODVLQVWLWXFLRQHV
en esta Superintendencia, el día 22 de mayo de 2012, con NURC 1-2012-0444423, solicitó SUHVWDGRUDVGHVDOXGVLQiQLPRGHOXFURFRQODVH[FHSFLRQHVDOOtSUHYLVWDV3DUDHVWHHIHFWR
prórroga de la intervención forzosa para administrar, de la referida entidad argumentando DSOLFDUiHOSURFHGLPLHQWRDGPLQLVWUDWLYRUHVSHFWLYRFRQIRUPHDODVQRUPDVDTXHDOXGH
las siguientes razones: el artículo anterior.
« Con el propósito de que se adopten las medidas concernientes, la Superintendencia
³&RQHO¿QGHGDUFXPSOLPLHQWRDODVDFFLRQHVSUHVHQWDGDVHQHO&URQRJUDPDGH$FWL- 1DFLRQDOGH6DOXGFRPXQLFDUiODGHFLVLyQDGPLQLVWUDWLYDFRUUHVSRQGLHQWH´
YLGDGHVGHO3URFHVRGH,QWHUYHQFLyQ)RU]RVD$GPLQLVWUDWLYDGHOD(6(+RVSLWDOGH3XHUWR F 3RURWURODGROD/H\GHTXHUHDOL]DPRGL¿FDFLRQHVDO6LVWHPD*HQHUDOGH
&RORPELDVHKDFHQHFHVDULRVROLFLWDUODFRQWLQXLGDGGHODPHGLGDGHLQWHUYHQFLyQSRUXQ Seguridad Social en Salud previsto en la Ley 100 de 1993, crea el Sistema de Inspección,
ODSVRDGLFLRQDOGH  RFKRPHVHVFRQHO¿QGHSUHVHUYDUHORUGHQDPLHQWR\ODWUDVFHQGHQFLD Vigilancia y Control del Sistema General de Seguridad Social en Salud, en cabeza de la
GHODLGHQWLGDGHQWUHHO(VWDGR\ODSUHVWDFLyQGHVHUYLFLRVS~EOLFRV 6XSHULQWHQGHQFLD1DFLRQDOGH6DOXG\SDUDHOGHVDUUROORGHVXVIXQFLRQHVGH¿QHDWUDYpV
/D(6(+RVSLWDOGH3XHUWR&RORPELDHVHO~QLFRHQWHSUHVWDGRUGHVHUYLFLRVGHVDOXG GHVXDUWtFXORFLQFR  (MHV7HPiWLFRVDVDEHU L )LQDQFLDPLHQWR LL $VHJXUDPLHQWR
HQHOPXQLFLSLR\FRUUHJLPLHQWRVDOHGDxRV\SDUDXQSRVLEOHSURFHVRGHUHHVWUXFWXUDFLyQ LLL 3UHVWDFLyQGHVHUYLFLRV LY $WHQFLyQDOXVXDULR\SDUWLFLSDFLyQVRFLDO\ Y (MHGH
HVQHFHVDULRHVWDEOHFHUPHFDQLVPRVTXHIRUWDOH]FDQODSUHVWDFLyQGHORVVHUYLFLRVGHVDOXG DFFLRQHV\PHGLGDVHVSHFLDOHV
a la comunidad usuaria. d) Conforme al artículo 12 de la Ley 1438 de 2011, el objetivo del eje de acciones y
/D (6( +RVSLWDO GH 3XHUWR &RORPELD GXUDQWH HO WLHPSR GH OD LQWHUYHQFLyQ QR KD medidas especiales es adelantar los procesos de intervención forzosa administrativa para
DOFDQ]DGRHOHTXLOLEULR¿QDQFLHUR\JHQHUDUORVH[FHGHQWHVTXHSHUPLWDQFDQFHODUODWRWD- administrar o liquidar las entidades vigiladas que cumplen funciones de Entidades Promo-
OLGDGGHORVSDVLYRVFDXVDGRVTXHDPDU]RGHODVFLHQGHQDFRQ toras de Salud, Instituciones Prestadoras de Salud de cualquier naturaleza y monopolios
ODLPSOHPHQWDFLyQGHOSURFHVRGH6DQHDPLHQWR&RQWDEOH\RWUDVGLVSRVLFLRQHVSHUPLWLGDV rentísticos cedidos al sector salud no asignados a otra entidad, así como para intervenir
SRUOD/H\GHVHKL]RODGHSXUDFLyQGHORVSDVLYRVHQODVXPDGH técnica y administrativamente las direcciones territoriales de salud. Tratándose de liquida-
3URYHHGRUHV\&RPLVLRQHVKRQRUDULRV\6HUYLFLRV  ciones voluntarias, la Superintendencia Nacional de Salud ejercerá inspección, vigilancia y
&RQ OD FXOPLQDFLyQ GHO SURFHVR GH 6DQHDPLHQWR &RQWDEOH D FRUWH  GH PDU]R GH FRQWUROVREUHORVGHUHFKRVGHORVD¿OLDGRV\ORVUHFXUVRVGHOVHFWRUVDOXG(QFDVRVHQTXHOD
ORVSDVLYRVTXHGDQHQ\FRQODFDQFHODFLyQGHORVSDVLYRVODERUDOHV 6XSHULQWHQGHQFLD1DFLRQDOGH6DOXGUHYRTXHHOFHUWL¿FDGRGHDXWRUL]DFLyQRIXQFLRQDPLHQWR
\RWURVSDVLYRV  SRUSDUWHGHO)RQGRGH6DOYDPHQWR\*D- que le otorgue a las Entidades Promotoras de Salud o Instituciones Prestadoras de Salud,
UDQWtDSDUDHO6HFWRU6DOXG )RQVDHW ODVLWXDFLyQGHORVSDVLYRVGHOD(6(WHQGUtDQXQD GHEHUiGHFLGLUVREUHVXOLTXLGDFLyQ
GLVPLQXFLyQGHDSUR[LPDGDPHQWH e) El numeral 26, del artículo 6° del Decreto número 1018 de 2007, faculta a la Su-
&RQHOSURFHGLPLHQWRGH6DQHDPLHQWR&RQWDEOHHIHFWXDGRSRUOD(6(+RVSLWDOGH3XHUWR perintendencia Nacional de Salud para ejercer la intervención forzosa para administrar o
&RORPELD\FRQOD&DQFHODFLyQGHODVGHXGDVSRUSDUWHGH)216$(7VHGLVPLQXLUtDQORV liquidar las entidades vigiladas que cumplan funciones de administración y operación de
SDVLYRVGHODHQWLGDGORFXDOVHFRQVWLWXLUtDHQXQDVLWXDFLyQIDYRUDEOHSDUDVXJHULUHQ monopolios rentísticos, cedidos al sector salud, entidades Promotoras de Salud de cualquier
HVWDLQVWDQFLDXQDUHHVWUXFWXUDFLyQDGPLQLVWUDWLYDHQOD(6(\IRUWDOHFLPLHQWRGHVHUYL- naturaleza que administren cualquier régimen e instituciones Prestadoras de Servicios de
FLRVGHOSULPHUQLYHOGHDWHQFLyQFRPRVHEXVFDSRUPHGLRGHODSURSXHVWDIRUPXODGDHQ salud de cualquier naturaleza, teniendo la intervención de Instituciones Prestadoras de
FRQMXQWRFRQOD6HFUHWDUtD'HSDUWDPHQWDOGH6DOXGSRULQGLFDFLRQHVGHO0LQLVWHULRGHOD 6HUYLFLRVGH6DOXGVLHPSUHXQDSULPHUDIDVHGHVDOYDPHQWR
3URWHFFLyQ6RFLDO I /DH[SHGLFLyQGHO'HFUHWRQ~PHURGHTXHPRGL¿FDODHVWUXFWXUDGHOD6X-
/D(6(+RVSLWDOGH3XHUWR&RORPELDVHHQFXHQWUDIRUPXODQGRXQ3UR\HFWRGH)RU- SHULQWHQGHQFLD1DFLRQDOGH6DOXGFUHDSDUDHOHIHFWROD¿JXUDGHODVGHOHJDGDVHQWUHHOODV
WDOHFLPLHQWR \ 5HRUJDQL]DFLyQ GH OD 3UHVWDFLyQ GH 6HUYLFLRV GH 6DOXG HQ HO PXQLFLSLR la Superintendencia Delegada para Medidas Especiales, con funciones, que se concretan así:
GH3XHUWR&RORPELDGHODPDQRFRQHOHTXLSRGHOFRQYHQLRGHVHPSHxRGHOD6HFUHWDUtD ³$VXPLUODLQVSHFFLyQYLJLODQFLD\FRQWUROGHODVHQWLGDGHVTXHHVWpQVRPHWLGDVD
'HSDUWDPHQWDOGH6DOXGHOFXDOEXVFDIRUPXODUODPDQHUDGHLPSOHPHQWDFLyQGHXQPR- medidas de salvamento.
GHORHVWUXFWXUDOIXQFLRQDO\RSHUDWLYRTXHSHUPLWDJDUDQWL]DUHOHTXLOLEULRRSHUDFLRQDO ³5HDOL]DUSRURUGHQGHO6XSHULQWHQGHQWH1DFLRQDOGH6DOXGODWRPDGHSRVHVLyQ\
VRVWHQLELOLGDG HQ HO WLHPSR \ FUHFLPLHQWR GH DFXHUGR D OD GHPDQGD FRQ JHQHUDFLyQ GH ODFRUUHVSRQGLHQWHLQWHUYHQFLyQSDUDDGPLQLVWUDUROLTXLGDUODVHQWLGDGHVYLJLODGDVTXH
UHQWDELOLGDG ¿QDQFLHUD DOWD FDOLGDG GH VHUYLFLR H LPSDFWR VRFLDO FRPR OD DSHUWXUD GH FXPSODQIXQFLRQHVGHDGPLQLVWUDFLyQH[SORWDFLyQXRSHUDFLyQGHPRQRSROLRVUHQWtVWLFRV
DFWLYLGDGHVGHHVSHFLDOLGDGHVPHGLFDVEiVLFDVFRPRFRQVXOWDH[WHUQDHQORVVHUYLFLRVGH ODV(QWLGDGHV3URPRWRUDVGH6DOXGGHO5pJLPHQ&RQWULEXWLYR\6XEVLGLDGRODV&DMDVGH
*LQHFRORJtD3HGLDWUtD\0HGLFLQD,QWHUQDDODFRPXQLGDGREMHWRGHFREHUWXUDWHQLHQGRHQ &RPSHQVDFLyQ)DPLOLDUDVtFRPRLQWHUYHQLUWpFQLFD\DGPLQLVWUDWLYDPHQWHODV'LUHFFLRQHV
FXHQWDHOSHU¿OHSLGHPLROyJLFRGHOPXQLFLSLR\HODOWRtQGLFHGHPHQRUHVGHHGDGHQHVWDGR 7HUULWRULDOHVGH6DOXGHQORVWpUPLQRVHVWDEOHFLGRVHQODOH\´
GHHPEDUD]RHOFXDOVHUiSUHVHQWDGRQXHYDPHQWHDO0LQLVWHULRGHOD3URWHFFLyQ6RFLDO
g) Queda claro entonces que el procedimiento aplicado por la Superintendencia Nacional
&RQODGLVPLQXFLyQGHORVSDVLYRVSRUSDUWHGH)216$(7VHULDQPHQRUHVORVUHFXUVRV de Salud en materia de procesos de intervención forzosa administrativa para administrar o
JHVWLRQDGRV DQWH HO 0LQLVWHULR GH OD SURWHFFLyQ 6RFLDO *REHUQDFLyQ GHO$WOiQWLFR \ OD liquidar las entidades vigiladas, hasta tanto no se disponga procedimiento diferente en la
$OFDOGtD0XQLFLSDOGH3XHUWR&RORPELDSDUDHIHFWXDUODUHVWUXFWXUDFLyQDGPLQLVWUDWLYD reglamentación que el Gobierno Nacional lleve a cabo a la Ley 1438 de 2011, es el previsto
de la entidad. HQHO'HFUHWROH\GHR(VWDWXWR2UJiQLFRGHO6LVWHPD)LQDQFLHURPRGL¿FDGRD
&RQODSUyUURJDGHODLQWHUYHQFLyQVHJDUDQWL]DODSUHVWDFLyQGHORVVHUYLFLRVGHVDOXG VXYH]SRUOD/H\GH
DODSREODFLyQGHOPXQLFLSLRGH3XHUWR&RORPELD\SRUPHGLRGHOEOLQGDMHRWRUJDGRSRU h) El Superintendente Delegado Para Medidas Especiales de la Superintendencia Nacional
OD,QWHUYHQFLyQIRU]RVDDGPLQLVWUDWLYDVHIUHQDQORVHPEDUJRV\GHPDQGDVHMHFXWLYDVSRU de Salud, en fecha 19 de junio de 2012, se pronunció sobre la viabilidad de la prórroga de
FRQFHSWRGHVXHOGRVSDJRSURYHHGRUHV,&%)'LDQ6HQD\&RPIDPLOLDUGHDFXHUGRDODV la Reapertura de la medida de Intervención Forzosa Administrativa de la Empresa Social
características constitucionales del proceso….”. del Estado Hospital Local de Puerto Colombia-Atlántico, en los siguientes términos:
3. Consideraciones de la Superintendencia Nacional de Salud «
Partiendo de la situación expuesta en el presente Acto Administrativo, le corresponde a “5. Conclusión
este Despacho decidir sobre la prórroga de la Reapertura del proceso de intervención forzosa
administrativa para administrar la Empresa Social del Estado Hospital Local Puerto En consideración a lo anteriormente expuesto, el Superintendente Delegado para
Colombia-Atlántico, este Despacho trae a colación los siguientes aspectos: Medidas Especiales considera viable prorrogar la reapertura del proceso de intervención
forzosa administrativa para administrar de la ESE Hospital de Puerto Colombia por solo
a) El artículo 68 de la Ley 715 de 2001, preceptúa que: 6 (seis) meses, y no por los ocho (8) meses solicitados por el Agente Especial Interventor
³  /D6XSHULQWHQGHQFLD1DFLRQDOGH6DOXGHMHUFHUiODLQWHUYHQFLyQIRU]RVDDGPL- en su solicitud de prórroga.
QLVWUDWLYDSDUDDGPLQLVWUDUROLTXLGDUODVHQWLGDGHVYLJLODGDVTXHFXPSODQIXQFLRQHVGH Lo anterior teniendo en cuenta que esta Superintendencia Delegada considera que seis
H[SORWDFLyQ X RSHUDFLyQ GH PRQRSROLRV UHQWtVWLFRV FHGLGRV DO VHFWRU VDOXG (PSUHVDV meses (6) es el tiempo necesario que le permitirá al Agente Especial Interventor adelantar
3URPRWRUDVGH6DOXGH,QVWLWXFLRQHV3UHVWDGRUDVGH6DOXGGHFXDOTXLHUQDWXUDOH]DDVt las siguientes actividades:
FRPRSDUDLQWHUYHQLUWpFQLFD\DGPLQLVWUDWLYDPHQWHODVGLUHFFLRQHVWHUULWRULDOHVGHVDOXG
0HGLDQWHOD5HVROXFLyQQ~PHURGHOGHGLFLHPEUHGHHO0LQLVWHULR
HQORVWpUPLQRVGHODOH\\ORVUHJODPHQWRV
GH 6DOXG \ 3URWHFFLyQ 6RFLDO D WUDYpV GHO )216$(7 DVLJQy SDUD OD (6( +RVSLWDO GH
³/DLQWHUYHQFLyQGHOD6XSHULQWHQGHQFLDGH6DOXGDODV,QVWLWXFLRQHV3UHVWDGRUDVGH 3XHUWR&RORPELDHOYDORUGH3RUORWDQWRHVSHUWLQHQWHTXHVHDGHODQWH
6DOXGWHQGUiXQDSULPHUDIDVHTXHFRQVLVWLUiHQHOVDOYDPHQWR  ´ SRUSDUWHGHO$JHQWH(VSHFLDO,QWHUYHQWRUORVWUiPLWHV\DFWLYLGDGHVFRUUHVSRQGLHQWHVSDUD
b) Ahora bien, el Decreto número 1015 de 2002, por el cual se reglamenta parcialmente ODHMHFXFLyQGHHVWRVUHFXUVRVGHVWLQDGRVDOSDJRGHOSDVLYRGHOD(6(
el artículo 68 de la Ley 715 de 2001, dispone los artículos 1° y 2° lo siguiente: (O$JHQWH,QWHUYHQWRUGHEHUiDGHODQWDUORVWUiPLWHVUHVSHFWLYRVDQWHODVHQWLGDGHV
“De conformidad con lo dispuesto en el artículo 68 de la Ley 715 de 2001, la Super GHO RUGHQ WHUULWRULDO \ QDFLRQDO D ¿Q GH HVWDEOHFHU GHQWUR GH OD UHG GH SUHVWDGRUHV GHO
intendencia Nacional de Salud aplicará en los procesos de intervención forzosa adminis GHSDUWDPHQWRGHO$WOiQWLFRODVFRQGLFLRQHVEDMRODVFXDOHVRSHUDUtDOD(6(SDUDJDUDQ-
Edición 48.475
22 DIARIO OFICIAL Jueves, 28 de junio de 2012

WL]DUODVRVWHQLELOLGDG¿QDQFLHUD\DGPLQLVWUDWLYDGHODLQVWLWXFLyQHQFXPSOLPLHQWRGHODV Artículo 2°. Sancionar al doctor Fabio RamírezLGHQWL¿FDGRFRQODFpGXODGHFLXGD-


QRUPDVTXHULJHQHO6LVWHPDGH6HJXULGDG6RFLDOHQ6DOXG\RSWLPL]DUODSUHVWDFLyQGHORV danía número 4895154, con amonestación escrita, por los motivos expuestos en la parte
VHUYLFLRVGHVDOXGDVXVXVXDULRV3DUDORFXDOHO$JHQWH(VSHFLDO,QWHUYHQWRUGHEHUiVHJXLU resolutiva de la presente resolución.
DGHODQWDQGRMXQWRFRQOD6HFUHWDULDGH6DOXGGHO'HSDUWDPHQWRHO(VWXGLRGH)DFWLELOLGDG Artículo 3°. Conceder al doctor Carlos Artunduaga Cruz, en calidad de apoderado
\HO3UR\HFWRGH)RUWDOHFLPLHQWR\5HRUJDQL]DFLyQGHOD(6( de la Empresa de Lotería y Juego de Apuestas Permanentes del departamento del
*DUDQWL]DUODSUHVWDFLyQDGHFXDGD\RSRUWXQDGHORVVHUYLFLRVGHVDOXGDODSREODFLyQ Huila, y al doctor Fabio Ramírez, en calidad de sancionado a título personal el recurso
XVXDULDFRPR~QLFDLQVWLWXFLyQGHSULPHUQLYHOGHOPXQLFLSLRGH3XHUWR&RORPELDGDQGR de apelación ante el Despacho del señor Superintendente Nacional de Salud.
FRQWLQXLGDGDO3ODQGH$FFLyQTXHVHKDYHQLGRHMHFXWDQGRHQOD(6(HOFXDOFRQWHPSOD Artículo 4°. Remitir el expediente correspondiente al Despacho del señor Superinten-
DFFLRQHVHQFDPLQDGDVDSUHVHQWDFLyQGHLQIRUPHVGHPDQHUDRSRUWXQDDORVyUJDQRVGH dente Nacional de Salud, para efectos de resolver los recursos de apelación interpuestos
FRQWUROORJUDUDFXHUGRVGHSDJRGHORVSURFHVRVMXUtGLFRVTXHVHHQFXHQWUDQVXVSHQGLGRV recursos de reposición interpuestos por el doctor Juan Carlos Artunduaga Cruz, en
HQODPHGLGDHQTXHORVUHFXUVRVORSHUPLWDQDXPHQWDUHOSRUFHQWDMHGH83&SRUYHQWD calidad de apoderado de la Empresa de Lotería y Juego de Apuestas Permanentes del
GHVHUYLFLRVFRQWLQXDUODUHDOL]DFLyQGHODVFRQFLOLDFLRQHVSHULyGLFDVGHODFDUWHUDFRQODV departamento del Huila, quien actúa a título institucional y el doctor Fabio Ramírez, en
(36DFWXDOL]DFLyQGHOVRIWZDUHGHIDFWXUDFLyQSUHVXSXHVWR\FRQWDELOLGDGUHPRGHODFLyQ calidad de sancionado a título personal en contra de la Resolución número 2715 del 11 de
GHOFHQWURGHVDOXGGHVDOJDU\GHODLQIUDHVWUXFWXUDGHOKRVSLWDOSDUDFXPSOLUHQXQ noviembre de 2009.
FRQORVHVWiQGDUHVGHKDELOLWDFLyQORJUDUODDGMXGLFDFLyQGHOLQPXHEOHDOKRVSLWDOUHFX-
SHUDFLyQGHDFWLYLGDGHVGHFRQVXOWDH[WHUQDSURPRFLyQ\SUHYHQFLyQDWHQFLyQGHOVHUYLFLR Artículo 5°. 1RWL¿FDU SHUVRQDOPHQWH la presente decisión al representante legal de
GHRGRQWRORJtDDWHQFLyQGHOVHUYLFLRGHODERUDWRULRPHMRUDPLHQWR\VHJXLPLHQWRDORV la entidad Empresa de Lotería y Juego de Apuestas Permanentes del departamento
SURFHVRVGHO62*&DFWXDOL]DFLyQGHO3DPHFGHODHQWLGDGDFWXDOL]DFLyQGHPDQXDOHV\ del Huila, doctor Hernán Leal Vargas, o por quien haga sus veces, en la Carrera 4 N°
SURWRFRORVFRQVWUXFFLyQGHOWDEOHURGHLQGLFDGRUHVGHODHQWLGDGUHDOL]DFLyQGHUHXQLRQHV (GL¿FLR'LHJR2VSLQDGHODFLXGDGGH1HLYD+XLODLQIRUPiQGROHTXHFRQWUDpVWD
SHULyGLFDVGHORVFRPLWpVGHREOLJDWRULRFXPSOLPLHQWRFRUUHFFLyQGHOSUR\HFWRGHIDFWLELOL- providencia proceden los recursos de reposición ante este Despacho y de apelación ante
GDGGHOD(6(VHJXLPLHQWRDOSUR\HFWRGHIRUWDOHFLPLHQWR\UHRUJDQL]DFLyQGHODHQWLGDG el Despacho del Superintendente Nacional de Salud, dentro de los cinco (5) días hábiles
FRQWLQXDFLyQFRQODFRQFLOLDFLyQDQWHORVIRQGRVGHSHQVLyQ\VDOXG«´ VLJXLHQWHVDODQRWL¿FDFLyQGHODPLVPDGHFRQIRUPLGDGFRQORGLVSXHVWRHQORVDUWtFXORV
50 y 51 del Código Contencioso Administrativo.
De las piezas procesales allegadas a la actuación y con base en el contenido del artí-
FXORGHO'HFUHWRQ~PHURGHPRGL¿FDGRSRUHODUWtFXORGHOD/H\ (QFDVRGHQRVHUSRVLEOHODQRWL¿FDFLyQSHUVRQDOVHSURFHGHUiGHFRQIRUPLGDGFRQODV
de 1999, este Despacho en el presente proveído dispondrá la prórroga de la Reapertura de prescripciones del artículo 45 y siguientes del Código Contencioso Administrativo.
la intervención forzosa administrativa para administrar de la Empresa Social del Estado Artículo 6°. 1RWL¿FDUSHUVRQDOPHQWH la presente decisión al doctor Fabio Ramírez, o a
Hospital Local Puerto Colombia-Atlántico, y continuar las acciones del plan de acción quien se designe para tal efecto, en la Calle 14 N° 35-13, Barrio Las Catleyas de la ciudad de
presentado por el Agente Especial Interventor. Neiva-Huila, informándole que contra ésta providencia proceden los recursos de reposición
En mérito de lo expuesto, este Despacho, ante este Despacho y de apelación ante el Despacho del Superintendente Nacional de Salud,
GHQWURGHORVFLQFR  GtDVKiELOHVVLJXLHQWHVDODQRWL¿FDFLyQGHODPLVPDGHFRQIRUPLGDG
RESUELVE: con lo dispuesto en los artículos 50 y 51 del Código Contencioso Administrativo.
Artículo 1°. Prorrogar por el término de seis (6) meses contados a partir del día 26 de (QFDVRGHQRVHUSRVLEOHODQRWL¿FDFLyQSHUVRQDOVHSURFHGHUiGHFRQIRUPLGDGFRQODV
junio de 2012, hasta el 25 de diciembre de 2012, la reapertura de la intervención forzosa
prescripciones del artículo 45 y siguientes del Código Contencioso Administrativo.
administrativa para administrar la Empresa Social del Estado Hospital Local Puerto
Colombia-Atlántico, de conformidad con lo expuesto en la parte motiva de este acto Artículo 7°. La presente resolución rige a partir de su expedición.
administrativo. Notifíquese y cúmplase.
Artículo 2°. Comunicar el contenido de la presente resolución al doctor Benjamín Dada en Bogotá, D. C., a 24 de septiembre de 2010.
Guardo del Río, Agente Especial Interventor de la Empresa Social del Estado Hospital La Superintendente Delegada para la Generación y Gestión de los Recursos Económicos
Local Puerto Colombia-Atlántico, en la calle 2 N° 3-13 del municipio de Puerto Colombia- para la Salud (e),
$WOiQWLFRRDOVLWLRTXHVHLQGLTXHSDUDWDO¿QRDOFRUUHRHOHFWUyQLFREHQJXDUGR#KRWPDLOFRP
0DUWKD6RXWK$OIRQVR$FKXU\
Artículo 3°. Comunicar el contenido del presente Acto Administrativo al Ministerio de
Salud y la Protección Social, a la Comisión de Regulación en Salud, al Alcalde de Puerto (C. F.).
Colombia, y al Gobernador del departamento de Atlántico.
Artículo 4°. Publicar la presente resolución en el 'LDULR2¿FLDO.
Artículo 5°. La presente resolución rige a partir de su expedición y contra la misma no
procede recurso alguno. Superintendencia de Servicios Públicos Domiciliarios
Comuníquese, publíquese y cúmplase.
Dada en Bogotá, D. C., a 26 de junio de 2012. RESOLUCIONES
El Superintendente Nacional de Salud,
&RQUDGR$GROIR*yPH]9pOH] RESOLUCIÓN NÚMERO SSPD-20121300017645 DE 2012
(C. F.). (junio 12)
SRUODFXDOVHPRGL¿FDQDFODUDQ\DGLFLRQDQDOJXQDVGLVSRVLFLRQHVGHOD5HVROXFLyQ
Q~PHUR\VXVUHVROXFLRQHVPRGL¿FDWRULDV
El Superintendente de Servicios Públicos, en ejercicio de sus facultades legales, en
NOTIFICACIÓN POR AVISO especial las contenidas en el artículo 77 de la Ley 142 de 1994, los artículos 14 y 15 de la
Ley 689 de 2001, Ley 1176 de 2007, el numeral 34 del artículo 7° del Decreto número 990
/D6XSHULQWHQGHQFLD1DFLRQDOGH6DOXGVHSHUPLWHQRWL¿FDUDOGRFWRUFabio Ramírez de 2002, los artículos 7°, 11 y 22 del Decreto número 028 de 2008, y
en calidad de investigado a título personal, el contenido de la Resolución número 4-2010-
CONSIDERANDO:
002587 del 24 de septiembre de 2010, en cuyo encabezado dice:
Que el artículo 14 de la Ley 689 de 2001 dispone que corresponde a la Superinten-
“RESOLUCIÓN NÚMERO 4-2010-002587 DE 2010
dencia de Servicios Públicos, establecer, administrar, mantener y operar el Sistema Único
(septiembre 24) de Información –SUI, que se surtirá de la información proveniente de los prestadores de
SRUPHGLRGHODFXDOVHUHVXHOYHORVUHFXUVRVGHUHSRVLFLyQLQWHUSXHVWRVSRUHOGRFWRUJuan servicios públicos sujetos a su control, inspección y vigilancia, conforme a lo establecido
Carlos Artunduaga Cruz, en calidad de apoderado de la Empresa de Lotería y Juego de HQHODUWtFXORGHOD/H\GH
Apuestas Permanentes del departamento del Huila, TXLHQDFW~DDWtWXORLQVWLWXFLRQDO\HO Que según el artículo anterior, el sistema de información que ha venido desarrollando la
doctor Fabio RamírezHQFDOLGDGGHVDQFLRQDGRDWtWXORSHUVRQDOHQFRQWUDGHOD5HVROXFLyQ Superintendencia de Servicios Públicos será único para cada uno de los servicios públicos,
Q~PHURGHOGHQRYLHPEUHGH([SHGLHQWH actividades inherentes y actividades complementarias de que tratan las Leyes 142 y 143 de
La Superintendencia Delegada para la Generación y Gestión de los Recursos Econó- 1994, y tendrá como propósitos entre otros, evitar la duplicidad de funciones en materia de
micos para la Salud“ LQIRUPDFLyQUHODWLYDDORVVHUYLFLRVS~EOLFRV
CONSIDERANDO: Que el artículo 15 de la Ley 689 de 2001, establece que la Superintendencia de Servicios
(…) Públicos elaborará un formato único de información que tendrá en cuenta además de los
criterios, características, indicadores y modelos de carácter obligatorio que permitan evaluar
RESUELVE:
la gestión y resultados de los prestadores de servicios públicos sujetos al control, inspección
Artículo 1°. 0RGL¿FDUel artículo 1° de la Resolución número 2715 del 11 de noviembre y vigilancia de la Superintendencia de Servicios Públicos, las necesidades y requerimientos
de 2009, el cual quedará así: de información de las Comisiones de Regulación, de los Ministerios y demás autoridades que
Artículo 1°. Sancionar a la entidad Empresa de Lotería y Juego de Apuestas Perma- WHQJDQFRPSHWHQFLDVHQHOVHFWRUGHORVVHUYLFLRVS~EOLFRVGHTXHWUDWDOD/H\GH
nentes del departamento del Huila, LGHQWL¿FDGDFRQHO1,7FRQamones- Que en desarrollo de las funciones establecidas desde el año 2001, la Superintendencia
tación escrita, por los motivos expuestos en la parte resolutiva de la presente resolución. ha venido estructurando el Sistema Único de Información, SUI, teniendo en cuenta los
Artículo 2°. 0RGL¿FDUel artículo 2° de la Resolución número 2715 del 11 de noviembre requerimientos de información solicitados principalmente para atender necesidades de
de 2009, el cual quedará así: LQIRUPDFLyQGHODVHQWLGDGHVTXHKDFHQSDUWHGHOVHFWRUGHVHUYLFLRVS~EOLFRV
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 23
Que de conformidad con la Resolución SSPD número 321 de 2003, cualquier reporte porcentaje de recaudo en el reporte de los Formatos 11 “Información Barrios Subnormales”,
de información a la Superintendencia de Servicios Públicos sólo debe hacerse a través del Formato 12 “Información Áreas Rurales de Menor Desarrollo” y Formato 13 “Información
6LVWHPDÒQLFRGH,QIRUPDFLyQ±68, de Zonas de Difícil gestión o Comunidades de Difícil Gestión”, así como con la información
4XHFRQHO¿QGHXQL¿FDUODQRUPDWLYDYLJHQWHVREUHHOFDUJXHGHODLQIRUPDFLyQDO GHODIHFKDGHFHUWL¿FDFLyQGHOÈUHD(VSHFLDO
Sistema Único de Información –SUI– y facilitar la búsqueda de la información que las Que de acuerdo a lo señalado en el Decreto número 111 de 2012 del Ministerio de
empresas prestadoras del servicio público domiciliario de Energía Eléctrica del Sistema 0LQDV\(QHUJtDSDUDHORWRUJDPLHQWRGHOEHQH¿FLR)2(6HVQHFHVDULRDMXVWDUHOFDPSR
Interconectado Nacional deben reportar al SUI, se requiere integrar los actos administrativos 6 del formato 12, por el nuevo indicador de las Necesidades Básicas Insatisfechas (NBI)
H[SHGLGRVKDFLHQGRUHIHUHQFLDH[SUHVDDVXIXHQWH SXEOLFDGRSRUHO'HSDUWDPHQWR$GPLQLVWUDWLYR1DFLRQDOGH(VWDGtVWLFD
4XHVHKDFHQHFHVDULRXQL¿FDUODQRUPDWLYDSRUWHPDRWySLFRWDOFRPRHVWiHVWUXFWXUDGR Que por todo lo anterior, se hace necesario incorporar nuevas variables al Sistema Único
el SUI para el cargue de la información por parte de los prestadores de los servicios de de Información –SUI y ajustar las frecuencias de recolección de datos sobre otras variables
(QHUJtD(OpFWULFDGHO6LVWHPD,QWHUFRQHFWDGR1DFLRQDO ya incorporadas, por parte de los prestadores de los servicios públicos de Energía Eléctrica
Que el formato único se actualizará de acuerdo con los objetivos asignados por la del Sistema Interconectado Nacional, para la generación de indicadores relacionados con
Constitución, la Ley 142 de 1994, la Ley 143 de 1994 y conforme con las necesidades las funciones propias del sector, razón por la cual esta Superintendencia:
de los Ministerios, las Comisiones y demás Entes relacionados con el sector de servicios RESUELVE:
S~EOLFRVGRPLFLOLDULRV $UWtFXORƒ0RGL¿FDUODQXPHUDFLyQGHORVFDStWXORVGHOD5HVROXFLyQ663'Q~PHUR
Que debido a que con las Resoluciones SSPD 201024000026245 y 20121300004345 20102400008055 del 16 de marzo de 2010, de la siguiente manera:
se eliminaron los Capítulos 16 y 12 de la Resolución SSPD 20102400008055 respecti- Capítulos de la Resolución Compilatoria
vamente y que mediante las Resoluciones SSPD 20111300003995, 201113000022695 y
20121300004355 se adicionaron los Capítulos 19, 20 y 21, se hace necesario renumerar 1. Instrucciones
ORVFDStWXORVSDUDJXDUGDUSHUWLQHQFLDFRQORVDMXVWHVKHFKRV 2. Formato de los Archivos a Reportarse
Que a partir de la expedición de la Resolución Compilatoria SSPD número 3. Registro Único de Prestadores
GHOGHPDU]RGHVHPRGL¿FyODIRUPDHQODFXDOORVDJHQWHV 4. Reporte de Información Comercial y de Calidad del Servicio
del Sistema Interconectado Nacional - SIN, reportan información al Sistema Único de
Información – SUI. 5. Información de Áreas Especiales
'LFKDPRGL¿FDFLyQWXYRFRPRREMHWLYRUHFRSLODUHQXQVROR$FWR$GPLQLVWUDWLYRWRGDV 6. Información de Costos de Energía
las resoluciones emitidas en torno al tema, de manera que el reporte de los agentes fuera 7. Información de Tarifas Aplicadas
consecuente con las necesidades de la Entidad y de las demás que emplean el SUI para 8. Información de los Componentes del Costo de Prestación del Servicio Para Usuarios
adelantar sus labores, buscando además garantizar información con la mayor calidad y No Regulados y Alumbrado Público
oportunidad posible. 9. Información de PQR de Comercializadores
Es así que, partiendo de la baja calidad en información reportada anteriormente por las 10. Información de Facturación y Recaudo
empresas, se tomó la decisión de efectuar validaciones entre los campos más relevantes
GHDOJXQRVIRUPDWRVDUHSRUWDUFRQHO¿QGHTXHKXELHUDFRQVHFXHQFLDHQODLQIRUPDFLyQ 11. Información Contable de Costos ABC y Financiera Complementaria
UHSRUWDGDSRUFDGDDJHQWH 12. Información de Ejecución de Proyectos de Inversión
4XHFRQHO¿QGHUHDOL]DUYLJLODQFLD\FRQWUROVREUHODFRUUHFWDDSOLFDFLyQGHODHVWUDWL- 13. Información Accidentes de Origen Eléctrico
¿FDFLyQVHFRQVLGHUyQHFHVDULRTXHHO68,FRQWDUDFRQODLQIRUPDFLyQGHOFyGLJRFDWDVWUDO 14. Información de Subsidios y Contribuciones
GHFDGDXVXDULRUHSRUWDGRHQORVIRUPDWRVFRPHUFLDOHV
15. Información del Programa Anual de Reposición y/o Remodelación
Que por otra parte, mediante la resolución emitida por la Comisión de Regulación para
16. Información de Flujos e Intercambios de Energía para Operadores de Red
(QHUJtD\*DV&5(*GHVHPRGL¿FyHOHVTXHPDGHFDOLGDGGHODSUHVWDFLyQ
GHOVHUYLFLR\ODPHWRGRORJtDGHUHPXQHUDFLyQDORVXVXDULRV 17. Información Relacionada con el Concurso Económico
Que según Resolución CREG 097 de 2008, la aplicación del nuevo esquema debió co- 18. Información No Reportada por el OR
menzar a más tardar en el mes de abril de 2010. En dicha resolución se estableció además  ,QIRUPDFLyQ GH 8VXDULRV ,QGXVWULDOHV %HQH¿FLDULRV GHO 'HVFXHQWR \ ([HQFLyQ
que la información técnica y comercial reportada por los operadores de red y los comer- Tributaria.
cializadores es la base para el cálculo de los indicadores de calidad y de las consecuentes 20. Cargos Administración Operación y Mantenimiento
FRPSHQVDFLRQHVDORVXVXDULRV
$UWtFXORƒ0RGL¿FDUHODUWtFXORƒQXPHUDO³)RUPDWRVD5HSRUWDU´GHOD5HVROXFLyQ
Que debido a lo anterior, se evidenció la necesidad de que los operadores de red y los 201024000026285 del 30 de julio de 2010, el cual quedará así:
comercializadores tuvieran la misma información, especialmente en lo referente al vínculo
XVXDULRWUDQVIRUPDGRU 1.1 Formatos a Reportar
Que antes de iniciar el reporte de información al SUI bajo la Resolución Compilatoria Los prestadores del servicio de energía eléctrica de la zona interconectada (SIN), de-
20102400008055 de 2010, no hubo adecuada interacción entre los operadores de red y los berán reportar la información solicitada en la presente Resolución de la siguiente manera:
comercializadores que participan en su mercado, y teniendo en cuenta que para efectos de FECHA DEL PRIMER REPORTE
FORMATO PERIODICIDAD FECHA LÍMITE DE REPORTE
YHUL¿FDUFDOLGDGHQODLQIRUPDFLyQUHSRUWDGDVHHIHFW~DQYDOLGDFLRQHVHQWUHIRUPDWRVUHSRU- DE INFORMACIÓN
tados por comercializadores y formatos reportados por operadores de red, se presentaron FORMATO 1 MENSUAL OCTUBRE DE 2010 16 DEL MES SIGUIENTE
DOWRVQLYHOHVGHLQFXPSOLPLHQWRHQHOFDUJXH\FHUWL¿FDFLyQGHODLQIRUPDFLyQQHFHVDULD FORMATO 2 MENSUAL OCTUBRE DE 2010 ÚLTIMO DÍA DEL MES SIGUIENTE
SDUDDSOLFDUHOQXHYRHVTXHPDGHFDOLGDG FORMATO 3 MENSUAL OCTUBRE DE 2010 ÚLTIMO DÍA DEL MES SIGUIENTE
Que aunado a esto, la metodología establecida por la Superintendencia para el reporte FORMATO 4 MENSUAL OCTUBRE DE 2010 ÚLTIMO DÍA DEL MES SIGUIENTE
GHODLQIRUPDFLyQGLVSRQHTXHSDUDTXHXQFRPHUFLDOL]DGRUSXHGDFHUWL¿FDUVXLQIRUPDFLyQ FORMATO 5 MENSUAL OCTUBRE DE 2010 ÚLTIMO DÍA DEL MES SIGUIENTE
comercial en el SUI, debe tener completos los datos de absolutamente todos los mercados FORMATO 6 MENSUAL OCTUBRE DE 2010 21 DEL MES SIGUIENTE
en los que participa. Generándose así, que al faltar información de un solo mercado, se 15 DEL SEGUNDO MES SIGUIENTE
EORTXHDUDODFHUWL¿FDFLyQGHODLQIRUPDFLyQSDUDORVGHPiVPHUFDGRVHQORVTXHSDUWLFLSy AL TRIMESTRE, DESPUÉS DEL INICIO 15 DEL SEGUNDO MES SIGUIENTE A
FORMATO 7 TRIMESTRAL
Lo anterior, debido a que los comercializadores reportan la información comercial de DEL ESQUEMA DE INCENTIVOS Y CADA TRIMESTRE
COMPENSACIONES
la totalidad de los mercados en los que participan en un periodo, en un solo Formato 2 y
15 DEL SEGUNDO MES SIGUIENTE
HQXQVROR)RUPDWRTXHQRVHSXHGHQFHUWL¿FDUHQHO68,PLHQWUDVQRHVWpFRPSOHWR\ AL TRIMESTRE, DESPUÉS DEL INICIO 15 DEL SEGUNDO MES SIGUIENTE A
validado versus la información contenida en los Formatos 1 reportados por los operadores FORMATO 8 TRIMESTRAL
DEL ESQUEMA DE INCENTIVOS Y CADA TRIMESTRE
de red de cada mercado. COMPENSACIONES
Por lo anterior, se vio la necesidad de desarrollar un modelo informático que permita 15 DEL SEGUNDO MES SIGUIENTE
cargar la información de los Formatos 1, 2 y 3 de forma desagregada, garantizando que los AL TRIMESTRE, DESPUÉS DEL INICIO 15 DEL SEGUNDO MES SIGUIENTE A
FORMATO 9 TRIMESTRAL
RSHUDGRUHVGHUHGSXHGDQFDUJDUHO)RUPDWRDPHGLGDTXHYD\DQ¿QDOL]DQGRODUHYLVLyQGH DEL ESQUEMA DE INCENTIVOS Y CADA TRIMESTRE
COMPENSACIONES
su información con cada uno de sus comercializadores y estos, a su vez, puedan realizar el
15 DEL QUINTO MES DESPUÉS DEL
FDUJXHGHORV)RUPDWRV\DPHGLGDTXHYD\DQ¿QDOL]DQGRODUHYLVLyQGHVXLQIRUPDFLyQ FORMATO 10 MENSUAL INICIO DEL ESQUEMA DE INCENTI- 15 DE CADA MES
FRQFDGDXQRGHVXVRSHUDGRUHV VOS Y COMPENSACIONES
Que por otra parte, la CREG, mediante las Resoluciones números 050, 051 de 2010 FORMATO 11 MENSUAL OCTUBRE DE 2010 25 DEL MES SIGUIENTE
y 024 de 2012 asignó a los operadores de red y transmisores nacionales, la obligación de FORMATO 12 MENSUAL OCTUBRE DE 2010 25 DEL MES SIGUIENTE
reportar la información concerniente al cálculo del porcentaje de Administración Operación FORMATO 13 MENSUAL OCTUBRE DE 2010 25 DEL MES SIGUIENTE
y Mantenimiento PAOM al LAC y a la SSPD, por esta razón se ve la necesidad de contar 15 JULIO PARA EL PRIMER SEMESTRE
con una plataforma en el Sistema Único de Información, SUI, para consignar y actualizar FORMATO 14 SEMESTRAL SEPTIEMBRE DE 2010 Y 15 DE ENERO PARA EL SEGUNDO
GHIRUPDiJLOHVWDLQIRUPDFLyQ SEMESTRE
Que de conformidad con lo establecido en el artículo 9° del Decreto número 111 de FORMATO 15 MENSUAL OCTUBRE DE 2010 20 DEL MES SIGUIENTE
2012 del Ministerio de Minas y Energía, mediante el cual se reglamenta el Fondo de Energía 20 DEL MES SIGUIENTE DE CADA
FORMATO 16 TRIMESTRAL OCTUBRE DE 2010
6RFLDO)2(6\VHGLFWDQRWUDVGLVSRVLFLRQHVHVQHFHVDULRFRQWDUFRQODLQIRUPDFLyQGHO TRIMESTRE
Edición 48.475
24 DIARIO OFICIAL Jueves, 28 de junio de 2012

FECHA DEL PRIMER REPORTE COMERCIALIZADORES DENTRO DEL MERCADO


FORMATO PERIODICIDAD FECHA LÍMITE DE REPORTE
DE INFORMACIÓN
FORMATO 17 ANUAL AGOSTO DE 2010 28 DE FEBRERO DE CADA AÑO
FORMATO 18 ANUAL ENERO DE 2011 30 DE ENERO DEL AÑO SIGUIENTE

COMERCIALIZADORES
15 DE ABRIL – PRIMER TRIMESTRE 15

COMERCIALIZADOR
DE JULIO – SEGUNDO TRIMESTRE 15 DE
FORMATO 19 TRIMESTRAL OCTUBRE DE 2010
OCTUBRE – TERCER TRIMESTRE 15 DE

A REGISTRAR
NÚMERO DE
ENERO – CUARTO TRIMESTRE
30 DEL MES SIGUIENTE DE CADA
FORMATO 20 TRIMESTRAL OCTUBRE DE 2010
TRIMESTRE
FORMATO 21 MENSUAL OCTUBRE DE 2010 15 DEL MES SIGUIENTE
30 DÍAS DESPUÉS DEL INICIO DEL
FORMATO 22 ANUAL ESQUEMA DE INCENTIVOS Y COM- 15 DE ENERO DE CADA AÑO 1 2
PENSACIONES
1. Número de Comercializadores a Registrar: En este campo se debe consignar el
FORMATO 23 ANUAL AGOSTO DE 2010 30 DE ABRIL DE CADA AÑO
número de Comercializadores a registrar que pertenecen a su Mercado.
FORMATO 24 ANUAL AGOSTO DE 2010 30 DE ABRIL DE CADA AÑO
30 DE ABRIL PARA EL PRIMER SEMES- 2. Comercializadores: Corresponde a un campo de selección múltiple donde el ope-
TRE DE CADA AÑO- 30 DE OCTUBRE rador de red elegirá todos los comercializadores que participan de su mercado.
FORMATO 25 SEMESTRAL 30 DE ABRIL DE 2011
PARA EL SEGUNDO SEMESTRE DE III. Posteriormente, cada Operador de Red reportará, a más tardar el 16 de cada mes,
CADA AÑO
el vínculo usuario - alimentador o usuario - transformador para el sistema que opera,
QUINTO DÍA HÁBIL SIGUIENTE A LA
correspondiente al último día del mes anterior, utilizando el siguiente formato:
FORMATO 26 MENSUAL FECHA MÁXIMA DE CERTIFICACIÓN
DE LOS FORMATOS 4 Y 5 FORMATO 1
30 DE ABRIL PARA PRIMER TRIMES-
TRE, 30 DE JULIO PARA SEGUNDO
TRIMESTRE, 30 DE OCTUBRE PARA
FORMATO 27 TRIMESTRAL 15 DE MARZO DE 2012
TERCER TRIMESTRE Y 30 DE ENERO
DEL AÑO SIGUIENTE PARA EL CUARTO
TRIMESTRE
Nota: La columna ³35,0(55(3257('(,1)250$&,Ï1´ corresponde al mes donde se realizará el
primer cargue de la información a reportar. Por ejemplo, en el Formato 6 se establece que la fecha de inicio
de reporte es octubre, razón por la cual el día 21 de ese mes, se deberá reportar la información correspon-
diente al mes de septiembre.
FORMATO DE LOS ARCHIVOS A REPORTAR
La información detallada en los siguientes anexos se deberá preparar en formato de
valores delimitados por comas (Comma Separated Values – CSV), en cuya elaboración se
deberá tener en cuenta lo siguiente:
1. El separador de valores será el símbolo coma (,).
1. NIU1:1~PHURGH,GHQWL¿FDFLyQGHO8VXDULRR6XVFULSWRU6HUH¿HUHDOQ~PHURTXH
2. El separador de punto decimal permitido será el símbolo punto (.). el Operador de Red le ha asignado a cada uno de los usuarios conectados a su sistema.
/RVYDORUHVQXPpULFRVGHEHQLUVLQHVSHFL¿FDFLRQHVGHXQLGDGGHPRQHGD Este código deberá ser comunicado por el OR al comercializador, a más tardar dentro de
4. Los valores numéricos no deben tener separador distinto al decimal. los diez (10) días calendario, siguientes a la conexión de un usuario.
5. Cada registro termina en nueva línea (LF) y retorno de carro (RC). 2. Código de conexión: Código asignado por el Operador de Red, el cual corresponde
6. Los campos de tipo texto no deben contener comas al interior del mismo ni caracteres a un Transformador o a un Alimentador en donde el operador de red realiza los cálculos
especiales (ñ, tildes, etc...). de los indicadores de calidad para el usuario. Si el usuario al que se hace referencia
7. Los campos de tipo fecha deben reportarse en formato dd-mm-aaaa corresponde al alumbrado público, deberá asignarle a todos los alumbrados el código
(ALPM0001). Este código deberá ser comunicado por el OR al comercializador, a más
8. Los campos de tipo hora deben reportarse en formato hh:mm:ss (formato 24 h) tardar dentro de los diez (10) días calendario, siguientes a la conexión de un usuario.
9. La primera línea del archivo deberá contener los títulos. (Este código deberá coincidir con los reportados en los formatos 4, 5 de la Resolución
10. La información de las categorías de las variables y/o mercados, se mantendrá ac- SSPD 2010240008055)
WXDOL]DGDDWUDYpVGHOVLWLR:(%GHO68,FRQHO¿QGHTXHVHFRQR]FDQORVQXHYRVFyGLJRV 3. Tipo de conexión (P/T): Corresponde al elemento (Transformador, Alimentador)
que puedan surgir. donde el operador de red calcula los indicadores de calidad del usuario basado en la
La información se debe reportar a través de Internet, según el procedimiento que se regulación vigente. Se colocará una “P” si la conexión es a un Circuito o línea o una “T”
describa en el Manual SUI. si corresponde a un Transformador (sin las comillas).
3DUDHIHFWRVGHOHQYtRGHODLQIRUPDFLyQHO68,KDGLVSXHVWRXQSURJUDPD68,±9DOLGDGRU Parágrafo. Cuando un usuario conectado a un nivel de tensión superior a 1, cuenta
WRGRDUFKLYR&69GHEHVHUFRWHMDGRPHGLDQWHHVWHYDOLGDGRU(VWHSURJUDPDYHUL¿FDODVLQ- con suplencia, es posible registrarlo con tipo de conexión “T” y con el nivel de tensión
taxis del archivo, realiza controles lógicos, comprime y fragmenta el archivo en volúmenes. del alimentador, asignándole el código de conexión del nodo de transformación o la placa
En el caso de reporte a través de formularios, estos estarán disponibles en el sitio del del transformador.
SUI, y dispondrán de su respectivo manual de diligenciamiento. 4. Nivel de Tensión: Nivel de Tensión al que pertenece el usuario. Debe corresponder
(QFXDOTXLHUDGHORVGRVFDVRVODLQIRUPDFLyQUHSRUWDGDGHEHUiVHUFHUWL¿FDGD(QHO exactamente al nivel de los cargos por uso de STR o SDL que se le liquidan en la factura.
caso donde no aplica el reporte de la información, deberá reportarse en las fechas estable- Debe tomar uno de los siguientes valores:
cidas como ³1R$SOLFD´\DOFHUWL¿FDUHOHQYtRGHEHUiLQGLFDUODUD]yQFRUUHVSRQGLHQWHHQ
Nivel de Tensión Descripción
el campo “Motivo”.
4 6LVWHPDVFRQWHQVLyQQRPLQDOPD\RURLJXDODN9\PHQRUGHN9
$UWtFXORƒ0RGL¿FDUHO&DStWXORGHOD5HVROXFLyQ663'GHO 3 6LVWHPDVFRQWHQVLyQQRPLQDOPD\RURLJXDODN9\PHQRUGH.Y
de marzo de 2010, de la siguiente manera: 2 6LVWHPDVFRQWHQVLyQQRPLQDOPD\RURLJXDODN9\PHQRUGHN9
3.1 Cargue de Información de los Formatos 1, 2 y 3 por Mercados 1 6LVWHPDVFRQWHQVLyQQRPLQDOPHQRVDN9
I. Adicionar el formulario Comercializadores Dentro del Mercado al Capítulo 4 de 0 Sistema de Transmisión Nacional (STN)
la Resolución SSPD 20102400008055 del 16 de marzo de 2010. Tabla 1 Niveles de Tensión
II. A más tardar el día 13 de cada mes, los operadores de red del SIN deberán registrar 5. Nivel de Tensión Prim.: Nivel de Tensión al cual se conectan los activos que
en el formulario Comercializadores Dentro del Mercado, el total de los agentes que sirven al usuario, de acuerdo con la Tabla 1. En el caso de activos de Nivel de tensión
efectúan la actividad de comercialización en su mercado, incluyendo su comercializador 1 que sirven al usuario, este campo solo puede tomar valores de 2 o 3. Se debe tener en
asociado. En caso de presentarse inconsistencias en la información registrada, esta podrá ser cuenta que en el caso que el usuario pertenezca a un nivel de tensión distinto a 1, este
PRGL¿FDGDXQD~QLFDYH]KDVWDHOGtD/XHJRGHHVWHGtDSDUDFDPELRVGHLQIRUPDFLyQ campo se reportará como cero (0).
se deberá solicitar reversión. La información será congruente con el número de agentes 6. Cargo de Inversión: Corresponde a la fracción del cargo máximo en el nivel de
que son reportados en los Formatos 1, 2 y 3, debido a que este procedimiento habilitará los tensión 1, por concepto de inversión que liquidó el Operador de Red al comercializador
formatos comerciales a los agentes reportados por el OR en el formulario. Adicionalmente,
para cada usuario. Podrá tomar los valores de la siguiente tabla:
el OR construirá tantos Formatos 1 como comercializadores participen de su mercado,
incluyendo su comercializador asociado. 1
 (O18,3GHEHVHU~QLFRHLQPRGL¿FDEOH\DVLJQDGRDO2SHUDGRUGH5HG
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 25
Fracción inversión Descripción Información Comercial Residencial
0 Cuando el comercializador liquida el 0% del cargo Máximo de Nivel de tensión 1 FORMATO 2
por concepto de inversión al usuario.
50 Cuando el comercializador liquida el 50% del cargo Máximo de Nivel de tensión

Contribuciones recaudadas después


Fecha de Expedición de la Factura

Contribuciones no recaudadas > 6


1 por concepto de inversión al usuario.

Fecha de inicio del período de

Refacturación Compensación

de conciliadas su no recaudo
100 Cuando el comercializador liquida el 100% del cargo Máximo de Nivel de tensión

Consumo Promedio Mensual

Refacturación por Consumo

Fecha de Registro Contable


Refacturación Contribución

Cédula ó Código Catastral


Consumo de Subsistencia
Facturación por Consumo

Código de Zona Especial


1 por concepto de inversión al usuario.

Valor de la Contribución
Refacturación Subsidio
Valor de Refacturación

Valor Total Facturado


Refacturación FOES

Número de Familias

Acto Administrativo
Tabla 2 Niveles de Tensión

Valor Compensado
Cargo de Inversión

Valor del Subsidio

ID Factura FOES
Días Facturados

Tipo de Factura
Tipo de Lectura

FOES Aplicado

Tarifa Aplicada
Valor por Mora

Días de Mora
Nota: Este campo se deberá reportar como cero (0) en el caso que el usuario permanezca

Código Dane

facturación

Consumos
ID Factura

Inquilinato
Ubicación

Dirección

Mercado
a un nivel de tensión distinto de 1.

Estrato

meses
NIU
7. Conexión Red (A/S): Hace referencia al tipo red a la cual se conecta el usuario. Se 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40
diligencia una “A” en el caso que el usuario se conecte a una red aérea o una “S” en el caso
que el usuario se conecta a una red subterránea. Donde:
8. ID Comercializador: 1~PHURGH,GHQWL¿FDFLyQDVLJQDGRDFDGDFRPHUFLDOL]DGRUHQ 1. NIU:1~PHURGH,GHQWL¿FDFLyQGHO8VXDULRR6XVFULSWRU6HUH¿HUHDOQ~PHURTXHHO
el Sistema Único de Información, el cual publica la Superintendencia en la página del SUI. Operador de Red le ha asignado a cada uno de los usuarios conectados a su sistema. Este
Nota: Si el código del comercializador a reportar no se encuentra en la información código deberá ser comunicado por el OR al comercializador, a más tardar diez (10) días
suministrada por el SUI, se podrá comunicar con el centro de soporte SUI al cual tiene calendario, siguientes a la conexión de un usuario.
acceso telefónico 6913006, para solicitar el código de dicho comercializador. 2. Código DANE: &RUUHVSRQGH D OD FRGL¿FDFLyQ GDGD SRU HO '$1( D OD GLYLVLyQ
9. ID Mercado: Es el código del mercado de comercialización donde se efectuó la político-administrativa de Colombia. Con la siguiente estructura: DDMMMCCC, donde
venta que se está facturando, los cuales publica la Superintendencia en la página del SUI. “DD” es el código del departamento, “MMM” corresponde al código del municipio y
“CCC” corresponde al código del centro poblado. Para los casos en que no aplique el centro
10. Grupo de Calidad: Corresponde al número del grupo al que pertenece el alimenta- poblacional, se debe diligenciar 000.
dor o transformador de conformidad con las disposiciones del reglamento de distribución y
ORVGH¿QLGRVHQHOQXPHUDOGHOD5HVROXFLyQ&5(*GH(OFyGLJRGHHVWH 3. Ubicación (R/U/C): Indica si la factura reportada corresponde a un inmueble rural
campo deberá coincidir con el campo 6 del formato 4 o Campo 3 del formato 5. disperso (R), urbano (U) o centro poblado (C). Se consideran Urbanos, aquellos inmuebles
localizados en la Cabecera Municipal2. Centro Poblado (C) es un área con características
11. Código de Frontera Comercial (kWh):&RUUHVSRQGHDOQ~PHURGHLGHQWL¿FDFLyQ urbanas, ubicada en el espacio rural del municipio, conformado por 20 o más viviendas
de la frontera comercial asignado por el Administrador del Sistema de Intercambios Comer- FRQWLJXDVRDGRVDGDVHQWUHVt(VWHFRQFHSWRSDUD¿QHVFHQVDOHVDJUXSDORVFDVHUtRVFRUUH-
ciales ASIC. En el caso de los usuarios del comercializador incumbente se deberá reportar gimientos municipales e inspecciones de policía3. Rurales dispersos, son aquellos inmue-
con el código “OR0001”. bles localizados en el espacio rural del municipio, conformado por menos de 20 viviendas
IV. La Superintendencia pondrá a disposición de cada comercializador en la página contiguas o adosadas entre sí.
www.sui.gov.co, la información de sus usuarios reportada por los operadores en cumpli- 4. Dirección: Esta información corresponde a la dirección del usuario.
miento del numeral I.
5. ID factura:&RUUHVSRQGHDOQ~PHURGHODIDFWXUDRLGHQWL¿FDFLyQGHODIDFWXUDDVLJ-
V. El Comercializador a más tardar el día 19 (calendario) de cada mes, deberá comunicar nada por el comercializador.
por escrito al Operador de Red respectivo las inconsistencias que detecte en la información
En el caso de aquellos suscriptores que no se les genere factura, deberán ser registrados
cargada en cumplimiento del numeral III. Adicionalmente, el comercializador deberá informar
con el código “USUARIONOFACT”, en este sentido no se incluyen los recibos o volantes
por escrito al Operador de red de manera inmediata cada vez que ingrese un nuevo usuario
de pago de los abonados de los usuarios o suscriptores comunitarios de las zonas especiales.
a una frontera comercial para que este le asigne el respectivo NIU, código de conexión,
nivel de tensión y grupo de calidad. Es decir, el usuario reportado con código USUARIONOFACT, podrá ser un usuario
activo que no se le genere factura, pero tiene cuentas vigentes ante el prestador.
Parágrafo. El comercializador deberá garantizar que la comunicación enviada al Ope-
rador de Red, en donde se informan las inconsistencias detectadas en el formato 1, sea 6. Fecha de expedición de la factura:6HUH¿HUHDODIHFKDGHH[SHGLFLyQGHODIDFWXUD
recepcionada a más tardar el día 19 (calendario) del mes correspondiente, sin perjuicio de acuerdo al formato establecido en el numeral 1.
de las acciones que se adelanten por parte de la Superintendencia de Servicios Públicos 7. Fecha de inicio periodo de facturación:6HUH¿HUHDODIHFKDGHVGHODFXDOFRPLHQ]D
Domiciliarios contra el Comercializador por su incumplimiento. a registrarse el consumo a facturar, de acuerdo al formato establecido en el numeral 1.
9,(O2SHUDGRUGH5HGDPiVWDUGDUHOGtD FDOHQGDULR GHEHUiFHUWL¿FDUDQWHHO68, 8. Días facturados: Corresponde al número de días facturados en el periodo.
la información reportada según el Numeral III. 9. Estrato:6HUH¿HUHDOHVWUDWRVRFLRHFRQyPLFRDVRFLDGRDODHVWUXFWXUDWDULIDUtDDSOL-
Para lo anterior, previamente deberá aclarar con los comercializadores la totalidad de FDGD(OYDORUUHSRUWDGRGHEHFRUUHVSRQGHUDODVLJXLHQWHFODVL¿FDFLyQ
las inconsistencias reportadas y, si es del caso, podrá reemplazar los datos inicialmente Código Estrato
cargados al SUI. 1 Bajo-Bajo
Si el Comercializador comunicó información de forma incompleta o incorrecta al Ope- 2 Bajo
rador de Red, será responsable por este hecho. 3 Medio-Bajo
6LHO2SHUDGRUGH5HGFHUWL¿FyLQIRUPDFLyQLQFRUUHFWDHVWHKHFKRVHFRQVLGHUDUiFRPR 4 Medio
reporte de información no veraz al SUI. 5 Medio-Alto
6 Alto
/RDQWHULRUGHEHUiVHULQIRUPDGRPHGLDQWHFRPXQLFDFLyQR¿FLDOSRUHO&RPHUFLDOL-
zador o el Operador de Red a la Superintendencia de Servicios Públicos Domiciliarios, sin 7DEOD&ODVL¿FDFLyQGHORVXVXDULRVUHVLGHQFLDOHVVHJ~QVXHVWUDWR
perjuicio de las acciones que se adelanten por esta entidad. 10. Tipo de Lectura:+DFHUHIHUHQFLDDOWLSRGHOHFWXUD\VHFODVL¿FDGHDFXHUGRDORV
Los comercializadores, a más tardar el último día calendario de cada mes deberán reportar siguientes códigos:
la información comercial para los sectores residencial y no residencial, correspondiente al Código Tipo de Lectura
mes anterior, según los siguientes Formatos 2 y 3. (Según lo establece la Resolución SSPD R Real
20102400008055 del 16 marzo de 2010). E Estimada
VII. Se entenderá que el comercializador que no efectúe comentarios al formato 1 hasta N No tiene medidor
el día 19 de cada mes, está de acuerdo con la información publicada por el operador de red 7DEOD&ODVL¿FDFLyQGHORVWLSRVGHOHFWXUD
\XQDYH]HVWDVHHQFXHQWUHFHUWL¿FDGDHOGtDVHUiODLQIRUPDFLyQR¿FLDOSDUDWRGRVORV Donde el consumo se determina a partir de:
efectos de aplicación en la regulación vigente. Lo anterior, sin perjuicio de las acciones
que pueda tomar la SSPD contra la empresa responsable del reporte erróneo o incompleto R: La lectura de un medidor exclusivo que sirve al suscriptor.
de la información y su impacto en el sector. E: Una estimación porque la lectura no pudo ser obtenida del medidor.
Artículo 3.2 Adicionar los campos “Cédula o Código Catastral” y “Acto Administrativo” N: Una estimación por la inexistencia de medidor.
al formato 2 y el campo “Cédula o Código Catastral” al Formato 3 del Capítulo 4 de la 11. Cargo de Inversión: Corresponde a la fracción del cargó máximo en el nivel de
5HVROXFLyQGHOGHPDU]RGHPRGL¿FDGDSRUODV5HVROXFLRQHV tensión 1, por concepto de inversión que liquidó el comercializador al usuario. Podrá tomar
201024000026285 del 30 de Julio de 2010, 20111300011645 del 10 de mayo de 2011 y los valores de la Tabla 2.
20121300004345 del 20 de Febrero de 2012, los cuales quedarán de la siguiente manera: 12. ID Mercado: Es el código del mercado de comercialización donde se efectuó la
INFORMACIÓN COMERCIAL venta que se está facturando, los cuales publica la Superintendencia en la página del SUI,
En los siguientes formatos se registrarán la totalidad de usuarios residenciales y no www.sui.gov.co.
residenciales que el Comercializador atienda. En este sentido, para la aplicación de la 
2
&DEHFHUD0XQLFLSDOHVHOiUHDJHRJUi¿FDTXHHVWiGH¿QLGDSRUXQSHUtPHWURXUEDQRFX\RVOtPLWHVVH
metodología del cargue por mercados, el comercializador deberá construir la información establecen por acuerdos del Concejo Municipal. Corresponde al lugar en donde se ubica la sede admi-
comercial por cada mercado en el que atienda usuarios, es decir, se generarán tantos For- nistrativa de un municipio. (División Político-administrativa de Colombia - Divipola DANE).
matos 2 y 3 como en mercados participe. 3
División Político-administrativa de Colombia - Divipola DANE.
Edición 48.475
26 DIARIO OFICIAL Jueves, 28 de junio de 2012

13. Consumos (kWh): (VHOFRQVXPRGHHQHUJtDHOpFWULFDHQN:KTXHHVIDFWXUDGR\ 28. FOES Aplicado ($): Corresponde al valor facturado por concepto del subsidio del
reportado para el respectivo periodo. Fondo de Energía Social (FOES).
14. Consumo Promedio Mensual: (kWh): Corresponde al consumo promedio men- 29. Refacturación FOES ($): Corresponde al valor en $ de los subsidios por concepto
VXDOGHOXVXDULRHQ.ZKGXUDQWHHOWULPHVWUHFDOHQGDULRHQHOFXDOVHUHDOL]yHOFiOFXORGHO del Fondo de Energía Social (FOES), consumidos durante períodos anteriores que se fac-
valor compensado al usuario peor servido, según lo establecido en el numeral 11.2.4.3 de turaron de más o se dejaron de facturar durante periodos anteriores al que corresponde la
la Resolución número 097 de 2008. factura que se reporta. Este valor será negativo si la empresa facturó de más y positivo si
Cuando el comercializador tenga facturación diferente a la mensual, el consumo pro- dejó de facturar. Es un valor numérico sin decimales.
medio mensual debe ser calculado a partir de la información disponible del último período 30. Valor Total Facturado ($): Corresponde al valor total facturado en pesos ($) al
facturado, anterior al reporte que se debe realizar en el SUI acerca del valor a compensar usuario, en el periodo reportado por concepto de consumos, incluyendo todos los conceptos
al usuario por el trimestre de análisis, es decir, se calcula como la relación del consumo liquidados tales como refacturaciones, cuotas de acuerdos de pago, intereses de mora, pagos
del usuario, entre el número de meses facturados de la última factura vigente de este. Para anticipados, entre otros.
facturación bimensual sería el consumo agregado de la última factura entre dos, que co- 31. Código de Zona Especial: Corresponde a un código de cuatro (4) dígitos asignado
rresponde al número de meses considerados para esta. por el comercializador, el cual debe coincidir con los códigos de los Formatos 9, 10 y 11,
Hasta tanto el OR respectivo no entre al esquema de compensaciones e incentivos de de la presente resolución. Se deberá reportar con valor cero “0” si el usuario no pertenece
la Resolución número CREG 097 de 2008, el comercializador deberá reportar el consumo a una zona especial.
promedio mensual establecido en el artículo 42 de la Resolución CREG 108 de 1997. 32. Contribuciones No Recaudadas > 6 meses ($): Valor total en pesos ($) de las
15. Facturación por consumo ($): Corresponde al valor en $ del consumo facturado contribuciones No recaudadas, después de seis meses de facturadas. Formato numérico
durante el periodo reportado (no incluye subsidios ni contribuciones). con (2) decimales.
16. Refacturación Consumo (kWh):&RUUHVSRQGHDOYDORUHQN:KGHFRQVXPRVTXH 33. Contribuciones Recaudadas después de conciliada su no Recaudo ($): Valor
se facturaron de más o se dejaron de facturar, durante periodos anteriores al que corresponde total en pesos ($) del Recaudo de Cartera por concepto de Contribución después de haberse
la factura que se reporta. Este es un valor numérico sin decimales. conciliado su no recaudo. Formato numérico con (2) decimales.
17. Valor Refacturación ($):&RUUHVSRQGHDOYDORUHQGHORVN:KFRQVXPLGRVTXHVH 34. Tarifa Aplicada ($/kWh): Corresponde al valor en pesos de la tarifa aplicada a con-
facturaron de más o se dejaron de facturar, durante los periodos anteriores al que corresponde sumos inferiores o iguales al Consumo de Subsistencia (CS), cuando se trate de un usuario
la factura que se reporta. Este valor será negativo si la empresa facturó de más y positivo VXEVLGLDGRRDODWDULIDFRQFRQWULEXFLyQFXDQGRVHWUDWHGHXQXVXDULRFRQWULEX\HQWHR
si dejó de facturar. (No incluye Subsidios ni contribuciones). al Costo Unitario (CU) cuando se trate de un usuario a quien se le aplique la tarifa plena.
18. Valor por mora ($): Corresponde al valor en $, facturados por concepto de mora Formato numérico con cuatro (4) decimales.
del suministro de energía eléctrica. 35. Fecha Registro Contable: Corresponde a la fecha en la cual se efectúa el registro
19. Días de Mora: Corresponde al número de días calendario contados a partir del de la factura en la contabilidad de la Empresa, de acuerdo al formato establecido en el
día siguiente a la fecha del vencimiento de la factura vencida más antigua, por concepto numeral 1 de la presente resolución.
de suministro de energía, que se está liquidando en la factura que se reporta. Es un valor 36. Tipo Factura: &RUUHVSRQGHDOWLSRGHIDFWXUDFLyQ\VHFODVL¿FDDVt
numérico sin decimales.
Código Tipo de Factura
20. Valor Compensado ($): Corresponde al valor en pesos de la compensación que se I Inicial
realiza al usuario peor servido, para el nivel de tensión correspondiente y transformador A Anulada
que esté conectado en el mes respectivo, según lo establecido en el numeral 11.2.4.3 de la L Reliquidación y Refacturación
Resolución CREG 097 de 2008.
Tabla 6 Tipos de Factura.
Hasta tanto el OR respectivo no ingrese al esquema de incentivos y compensaciones de
la Resolución CREG 097 de 2008, el comercializador deberá reportar las compensaciones 37. Inquilinato: Se deberá reportar con la letra “S”, si el inmueble asociado al NIU
de acuerdo a lo establecido en la Resolución CREG 096 del 2000. UHJLVWUDGRHQHOFDPSRFXPSOHFRQODGH¿QLFLyQGHLQTXLOLQDWRHVWDEOHFLGDHQHODUWtFXOR
ƒGHOD5HVROXFLyQ&5(*GHRODVTXHODPRGL¿TXHQRVXVWLWX\DQ(QFDVRGH
21. Refacturación Compensación ($): Corresponde al valor en $ de las compensa- no cumplir con lo anteriormente mencionado, se deberá reportar con la letra “N”.
ciones que se facturaron de más o se dejaron de facturar durante periodos anteriores al que
corresponde la factura que se reporta. Este valor será negativo si la empresa facturó de más 38. Número de Familias: Corresponde al número de familias que hacen parte del
y positivo si dejó de facturar. Es un valor numérico sin decimales. LQTXLOLQDWR(VWHFDPSRGHEHUiVHUPD\RURLJXDODWHQLHQGRHQFXHQWDODGH¿QLFLyQHVWD-
blecida en el artículo 1° de la Resolución CREG 108 de 1997. En los casos que la columna
22. Consumo de Subsistencia: &RUUHVSRQGHDODFDQWLGDGPtQLPDGHHOHFWULFLGDGGH¿-
37 (inquilinato) contenga la letra “N”, este campo no se deberá diligenciar.
nida por la UPME, utilizada en un mes por un usuario típico para satisfacer las necesidades
EiVLFDVTXHVRODPHQWHSXHGDQVHUVDWLVIHFKDVPHGLDQWHHVWDIRUPDGHHQHUJtD¿QDO3RGUi 39. Cédula Catastral:(VODLGHQWL¿FDFLyQDOIDQXPpULFDGHORVSUHGLRVFRQVLVWHHQ
tomar uno de los siguientes valores: una notación alfanumérica única para cada predio, urbano o rural, estructurada por cada
autoridad catastral (IGAC, Bogotá, Cali, Medellín, Antioquia), que facilita la ubicación
Código Consumo de Subsistencia
JHRJUi¿FDHLGHQWL¿FDFLyQGHFDGDLQPXHEOHSRUPHGLRGHODDVLJQDFLyQGHXQFRQMXQWR
1 N:KPHVSDUDDOWXUDVLQIHULRUHVDPHWURVVREUHHOQLYHOGHOPDU
de dígitos que los individualizan. En este campo, provisionalmente no obligatorio, se debe
2 N:KPHVSDUDDOWXUDVLJXDOHVRVXSHULRUHVDPHWURVVREUHHOQLYHOGHOPDU
colocar el código predial asignado por la autoridad catastral.
3 N:KPHVSDUDDOWXUDVLQIHULRUHVDPHWURVVREUHHOQLYHOGHOPDUSDUD%DUULRV6XEQRUPDOHV
 N:KPHV SDUD DOWXUDV LJXDOHV R VXSHULRUHV D  PHWURV VREUH HO QLYHO GHO PDU SDUD Por ejemplo, en el caso de Bogotá el tamaño del código son 11 caracteres alfanuméricos
4 continuos.
Barrios Subnormales
5 &XDQGRVHUH¿HUDDXVXDULRVGHHVWUDWRV\ 40. Acto Administrativo: En este campo se debe consignar el acto administrativo que
Tabla 5 Consumos de Subsistencia. sustenta la asignación de estrato, aplica solo para el Formato 2, información comercial
23. Valor del subsidio ($): Corresponde al valor facturado en pesos por concepto de residencial.
subsidios (Fondo de Solidaridad para Subsidios y Redistribución de Ingresos- FSSRI) de 41. Los datos son números del acto administrativo (alfanumérico), día (num2), mes
acuerdo a la normativa vigente. Este valor se deberá reportar positivo. (num2), año (num4), tipo de acto administrativo (alfanum1) en letra mayúscula.
24. Refacturación Subsidio ($): Corresponde al valor en pesos de los subsidios que Ejemplo: 00067B05061996D que corresponde al Decreto 00067B expedido el 5 de
se facturaron de más o se dejaron de facturar de acuerdo con la normativa vigente, durante junio de 1996
periodos anteriores al que corresponde la factura que se reporta y a los ajustes por concep- Información Comercial No Residencial
to de subsidios efectuados en el mismo mes de facturación. Este valor será negativo si la
empresa facturó de más y positivo si dejó de facturar. Es un valor numérico sin decimales. FORMATO 3
Contribuciones recaudadas después de conciliadas su no recaudo

25. Valor de la Contribución ($): Corresponde al valor facturado debido al concepto


de contribución, de acuerdo con la normativa vigente. Es un valor numérico sin decimales.
26. Refacturación Contribución ($): Corresponde al valor en pesos del concepto de
Facturación por Consumo de Energía Reactiva

contribución, que se facturó de más o se dejó de facturar durante periodos anteriores al que
Fecha de inicio del período de facturación

Contribuciones no recaudadas > 6 meses

corresponde la factura que se reporta. Este valor será negativo si la empresa facturó de más
Valor Refacturación Energía Reactiva

y positivo si dejó de facturar. Es un valor numérico sin decimales.


Fecha de Expedición de la Factura

Valor Refacturación por Consumo

Refacturación Energía Reactiva


Consumo de Energía Reactiva

Refacturación Compensación
Consumo Promedio Mensual

27. ID Factura FOES: Corresponde al número de la(s) factura(s) de referencia de donde


Refacturación por Consumo

Fecha de Registro Contable

Cédula o Código Catastral


Facturación por Consumo

Refacturación Contribución

Código de Zona Especial


Valor de la Contribución

Tarifa Energía Reactiva

Refacturación Subsidio

se tomó el valor del consumo que sirvió de base para la liquidación del valor del Subsidio,
Valor Total Facturado
Refacturación Foes
Valor Compensado
Cargo de Inversión

Valor del Subsidio

otorgado por el Fondo de Energía Social (FOES). En el caso en que se reporte más de una
Días Facturados

Id Factura Foes

Tipo de Factura
Tipo de Lectura

FOES Aplicado

Tarifa Aplicada
Valor por Mora
Tipo de Tarifa

Días de Mora
Código Dane

factura, estas se deberán registrar separadas únicamente por un guion.


ID Mercado

Consumos
ID Factura
Ubicación

Dirección

Sector

3DUDHOFDVRGHXVXDULRVTXHQRUHFLEHQEHQH¿FLRGHO6XEVLGLR)2(6VHGHEHUiUHJLVWUDU
NIU

con las letras “NA” 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42


Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 27
Donde: 18. Valor Refacturación ($):&RUUHVSRQGHDOYDORUHQGHORVN:KFRQVXPLGRVGX-
1. NIU:1~PHURGH,GHQWL¿FDFLyQGHO8VXDULRR6XVFULSWRU6HUH¿HUHDOQ~PHURTXHHO rante períodos anteriores consumidos durante períodos anteriores que se facturaron demás
Operador de Red le ha asignado a cada uno de los usuarios conectados a su sistema. Este o se dejaron de facturar durante periodos anteriores al que corresponde la factura que se
código deberá ser comunicado por el OR al comercializador, a más tardar diez (10) días reporta. Este valor será negativo si la empresa facturó demás y positivo si dejó de facturar.
calendario, siguientes a la conexión de un usuario. (No incluye subsidios ni contribuciones).
2. Código DANE: &RUUHVSRQGH D OD FRGL¿FDFLyQ GDGD SRU HO '$1( D OD GLYLVLyQ 19. Consumo de Energía Reactiva (kVARh): Es el consumo de energía reactiva en
político-administrativa de Colombia. Con la siguiente estructura: DDMMMCCC, donde N9$5KIDFWXUDGR
“DD” es el código del departamento, “MMM” corresponde al código del municipio y 20. Facturación por consumo de Energía Reactiva ($): Corresponde al valor en $
“CCC” corresponde al código del centro poblado. Para los casos en que no aplique el centro del consumo de energía reactiva facturado.
poblacional, se debe diligenciar 000. 21. Refacturación Energía Reactiva (kVARh):&RUUHVSRQGHDOYDORUHQN9$5KGH
3. Ubicación (R/U/C): Indica si la factura reportada corresponde a un inmueble rural consumos de energía reactiva realizados durante períodos anteriores consumidos durante
disperso (R), urbano (U) o centro poblado (C). Se consideran Urbanos, aquellos inmuebles períodos anteriores que se facturaron demás o se dejaron de facturar durante periodos an-
localizados en la Cabecera Municipal4. Centro Poblado (C) es un área con características teriores al que corresponde la factura que se reporta. Este valor será negativo si la empresa
urbanas, ubicada en el espacio rural del municipio, conformado por 20 o más viviendas facturó demás y positivo si dejó de facturar. Es un valor numérico sin decimales.
FRQWLJXDVRDGRVDGDVHQWUHVt(VWHFRQFHSWRSDUD¿QHVFHQVDOHVDJUXSDORVFDVHUtRVFRUUH- 22. Valor Refacturación Energía Reactiva ($): Corresponde al valor en $ de los
gimientos municipales e inspecciones de policía5. Rurales dispersos, son aquellos inmue- N9$5KFRQVXPLGRVGXUDQWHSHUtRGRVDQWHULRUHVFRQVXPLGRVGXUDQWHSHUtRGRVDQWHULRUHV
bles localizados en el espacio rural del municipio, conformado por menos de 20 viviendas que se facturaron demás o se dejaron de facturar durante periodos anteriores al que co-
contiguas o adosadas entre sí. rresponde la factura que se reporta. Este valor será negativo si la empresa facturó demás
y positivo si dejó de facturar. Es un valor numérico sin decimales. (No incluye subsidios
4. Dirección: Esta información corresponde a la dirección del usuario.
ni contribuciones).
5. ID factura: 1~PHUR GH OD IDFWXUD R LGHQWL¿FDFLyQ GH OD IDFWXUD DVLJQDGD SRU HO 23. Valor por mora ($): Corresponde al valor en $, facturados por concepto de mora
comercializador. del suministro de energía eléctrica.
6. Fecha de expedición de la factura:6HUH¿HUHDODIHFKDGHH[SHGLFLyQGHODIDFWXUD 24. Días de Mora: Corresponde al número de días calendario, contados a partir del
de acuerdo al formato establecido en el Anexo 1. día siguiente a la fecha del vencimiento de la factura vencida más antigua, por concepto
7. Fecha de inicio periodo de facturación: 6HUH¿HUHDODIHFKDGHVGHODFXDOFRPLHQ]D de suministro de energía que se está liquidando en la factura que se reporta. Es un valor
a registrarse el consumo a facturar, de acuerdo al formato establecido en el Anexo 1. numérico sin decimales.
8. Días facturados: Corresponde al número de días facturados en el periodo. 25. Valor Compensado ($): Corresponde al valor en ($) de la compensación que se
9. Sector: &RUUHVSRQGHDODFODVL¿FDFLyQGHOXVXDULRVHJ~QHOVHFWRUGHFRQVXPRDVt realiza al usuario peor servido para el nivel de tensión y transformador que esté conectado
en el mes respectivo, según lo establecido en el numeral 11.2.4.3 de la Resolución CREG
Código Descripción 097 de 2008.
I Industrial
26. Refacturación Compensación ($): Corresponde al valor en $ de las compensaciones
C Comercial consumidas durante períodos anteriores que se facturaron demás o se dejaron de facturar
O 2¿FLDO durante periodos anteriores al que corresponde la factura que se reporta. Este valor será
P Provisional negativo si la empresa facturó demás y positivo si dejó de facturar. Es un valor numérico
AP Alumbrado Público sin decimales.
EA Especial Asistencial*
27. Valor de la Contribución ($): Corresponde al valor facturado debido en pesos por
EE Especial Educativo** concepto de la contribución de solidaridad Fondo de Solidaridad para Subsidios y Redis-
AC Áreas Comunes tribución de Ingresos (FSSRI), de acuerdo con la normatividad vigente. Este valor deberá
IA Industrial Bombeo ser positivo sin decimales.
DR Distrito de Riego
28. Refacturación Contribución ($): Corresponde al valor en pesos de las contribu-
7DEOD&ODVL¿FDFLyQXVXDULRVQRUHVLGHQFLDOHVVHJ~QVHFWRUGHFRQVXPR ciones que se facturaron demás o se dejaron de facturar durante periodos anteriores al que
* Especial asistencial: Hace referencia a aquellas facturas correspondientes a usuarios corresponde la factura que se reporta, así como a los ajustes por concepto de contribución
especiales, tales como hospitales, clínicas, puestos o centros de salud, y demás instituciones efectuados en el mismo mes de facturación. Este valor será negativo si la empresa facturó
asistenciales exentas de pago de contribución conforme a lo dispuesto por la ley. demás y positivo si dejó de facturar. Es un valor numérico sin decimales.
** Especial educativo: Hace referencia a aquellas facturas correspondientes a usuarios 29. ID Factura FOES:&RUUHVSRQGHDORVQ~PHURVGHLGHQWL¿FDFLyQGHODVIDFWXUDV
especiales, tales como colegios, universidades y demás instituciones educativas exentas de de referencia, de donde se tomaron los valores de consumo que sirvieron de base para la
pago de contribución conforme a lo dispuesto por la ley. liquidación del valor del aporte otorgado por el Fondo de Energía Social (FOES).
Industrial Bombeo: Hace referencia a las facturas correspondientes de usuarios cuyos 30. FOES Aplicado ($): Corresponde al valor facturado por concepto de subsidio del
FRQVXPRVGHHQHUJtDVRQXWLOL]DGRVHVSHFt¿FDPHQWHHQODVDFWLYLGDGHVRSHUDWLYDVLQKHUHQWHV Fondo de Energía Social (FOES).
a la propia prestación del servicio de acueducto y/o alcantarillado. 31. Refacturación FOES ($): Corresponde al valor en $ de los subsidios por concepto
Distrito de Riego: Hace Referencia a las facturas correspondientes a usuarios de distritos del Fondo de Energía Social (FOES), consumidos durante períodos anteriores que se fac-
GHULHJRVHJ~QDUWtFXORGHOD/H\GHRODVTXHODPRGL¿TXHQRVXVWLWX\DQ turaron demás o se dejaron de facturar durante periodos anteriores al que corresponde la
factura que se reporta. Este valor será negativo si la empresa facturó demás y positivo si
10. Tipo de Tarifa (R/NR): Corresponde al tipo de tarifa con la que se liquidó los dejó de facturar. Es un valor numérico sin decimales.
últimos consumos de dicha factura, esta puede ser Regulada (R) o No Regulada (NR).
32. Valor Total Facturado ($): Corresponde al valor total facturado en pesos ($) al
11. Tipo de Lectura: +DFHUHIHUHQFLDDOWLSRGHOHFWXUD\VHFODVL¿FDGHDFXHUGRDORV usuario, en el periodo reportado por concepto de suministro de Energía Eléctrica, incluyendo
códigos contenidos en la tabla 4 de la presente resolución. conceptos liquidados con base en consumos de energía anteriores, tales como cuotas de
12. Cargo de Inversión: Corresponde a la fracción del cargó máximo en el nivel de tensión acuerdos de pago, intereses de mora, pagos anticipados, entre otros.
1, por concepto de inversión que liquidó el comercializador al usuario. Podrá tomar los 33. Código de Zona Especial: Corresponde a un código de cuatro (4) dígitos asignado
valores de la tabla 2 de la presente resolución. por el comercializador, el cual debe coincidir con los códigos de los formatos 10, 11 y 12,
13. ID Mercado: Es el código del mercado de comercialización donde se efectuó la de la presente resolución. Se deberá reportar con valor cero “0” si el usuario no pertenece
a una zona especial.
venta que se está facturando, los cuales publica la Superintendencia en la página del SUI.
34. Contribuciones No Recaudadas > 6 meses ($): Valor total en pesos ($) de las
14. Consumo (kWh):(VHOFRQVXPRGHHQHUJtDHOpFWULFDHQN:KTXHHVIDFWXUDGR\
contribuciones no recaudadas después de seis meses de facturadas. Formato numérico con
reportado para el respectivo periodo.
(2) decimales.
15. Consumo Promedio Mensual: (kWh): Corresponde al consumo promedio mensual
35. Contribuciones Recaudadas después de conciliado su no Recaudo ($): Valor
del usuario para el trimestre calendario anterior al mes facturado. total en pesos ($) del Recaudo de Cartera por concepto de Contribución después de haberse
16. Facturación por consumo ($): Corresponde al valor en $, del consumo facturado conciliado su no recaudo. Formato numérico con (2) decimales.
durante el periodo reportado (no incluye subsidios ni contribuciones). 7DULID$SOLFDGD N:K  Corresponde al valor en pesos de la tarifa aplicada a con-
17. Refacturación Consumo (kWh):&RUUHVSRQGHDOYDORUHQN:KGHFRQVXPRVUHDOL- sumos inferiores o iguales al Consumo de Subsistencia (CS), cuando se trate de un usuario
zados durante períodos anteriores consumidos durante períodos anteriores que se facturaron VXEVLGLDGRRDODWDULIDFRQFRQWULEXFLyQFXDQGRVHWUDWHGHXQXVXDULRFRQWULEX\HQWHR
demás o se dejaron de facturar durante periodos anteriores al que corresponde la factura al Costo Unitario (CU) cuando se trate de un usuario a quien se le aplique la tarifa plena.
que se reporta. Este valor será negativo si la empresa facturó demás y positivo si dejó de Formato numérico con dos (2) decimales.
facturar. Es un valor numérico sin decimales. 37. Fecha Registro Contable: Corresponde a la fecha en la cual se efectúa el registro
4
 &DEHFHUD0XQLFLSDOHVHOiUHDJHRJUi¿FDTXHHVWiGH¿QLGDSRUXQSHUtPHWURXUEDQRFX\RVOtPLWHV
de la factura en la contabilidad de la Empresa, de acuerdo al formato establecido en el
se establecen por acuerdos del Concejo Municipal. Corresponde al lugar en donde se ubica la sede numeral 1 de la presente resolución.
administrativa de un municipio. (División Político- 38. Tarifa Energía Reactiva ($/kVARh): Corresponde a la tarifa aplicada que se le
5
División Político-administrativa de Colombia - Divipola DANE. factura a un usuario por concepto de energía reactiva.
Edición 48.475
28 DIARIO OFICIAL Jueves, 28 de junio de 2012

39. Tipo Factura: Corresponde al tipo de facturación conforme la Tabla N° 6.


40. Valor del Subsidio: Corresponde al valor facturado en pesos de subsidios aplicados
HQODIDFWXUDDORVXVXDULRVQRUHVLGHQFLDOHVTXHHYHQWXDOPHQWHVHYHDQEHQH¿FLDGRVSRU
HVWH\SDUDORVXVXDULRVFODVL¿FDGRVHQHOFDPSR como Distritos de Riego (DR). Este valor
se deberá reportar positivo sin decimales.
41. Refacturación y Ajuste Subsidio: corresponde al valor en pesos de los subsidios

Rango de Porcentaje de Recaudo


que se facturaron de más o se dejaron de facturar de acuerdo con la normativa vigente,
durante periodos anteriores al que corresponde la factura que se reporta y a los ajustes por
concepto de subsidios efectuados en el mismo mes de facturación. Este valor será negativo si
la empresa facturó de más y positivo si dejó de facturar es un valor numérico sin decimales.

)HFKDGH&HUWL¿FDFLyQ
42. Cédula o Código Catastral: (VODLGHQWL¿FDFLyQDOIDQXPpULFDGHORVSUHGLRVFRQ-
siste en una anotación alfanumérica única para cada predio, urbano o rural, estructurada por
cada autoridad catastral (IGAC, Bogotá, Cali, Medellín, Antioquia), que facilita la ubicación
JHRJUi¿FDHLGHQWL¿FDFLyQGHFDGDLQPXHEOHSRUPHGLRGHODDVLJQDFLyQGHXQFRQMXQWR
de dígitos que los individualizan. En este campo, provisionalmente no obligatorio, se debe
colocar el código predial asignado por la autoridad catastral.
Ejemplo, en el caso de Bogotá el tamaño del código son 11 caracteres alfanuméricos, 13 14
continuos. 13. Rango Porcentaje de Recaudo: Corresponde al Rango Porcentaje de Recaudo
Artículo 4°. Adicionar los campos 12 ³5DQJR3RUFHQWDMHGH5HFDXGR´y campo 13 mensual de la facturación efectuada en el área especial, medido como el promedio móvil de
³)HFKDGH&HUWL¿FDFLyQ´al Formato 11 “Información Barrios Subnormales” de la Reso- ORV~OWLPRVGRFH  PHVHVGHDFXHUGRDODWDEODGH¿QLGDSRUOD5HVROXFLyQ\DORVHxDODGR
lución 20102400008055 de 16 de marzo de 2010, así: en el Decreto 0111 de 2012 del MME.
14. )HFKDGH&HUWL¿FDFLyQ&RUUHVSRQGHDODIHFKDGH&HUWL¿FDFLyQGHOÈUHD(VSHFLDO
expedida por el Alcalde Municipal o Distrital o por la autoridad competente en la cual conste
ODFODVL¿FDFLyQ\H[LVWHQFLDGHORV%DUULRV6XEQRUPDOHVODFXDOGHEHUiVHUH[SHGLGDGHQWUR
de los quince (15) días siguientes a la fecha de la respectiva solicitud efectuada por el OR,
según lo señalado en el Decreto 0111 de 2012 del MME.
Para el reporte de la información del campo “Rango Porcentaje de Recaudo”, se debe
Rango Porcentaje de Recaudo

seleccionar un código de 1 a 4, de acuerdo a la tabla (a):


Código de Reporte Rango de Porcentaje de Recaudo $SOLFDFLyQ%HQH¿FLR
)HFKDGH&HUWL¿FDFLyQ

1 De 1% hasta 25% 40,00%


2 Mayor de 25% Hasta 50% 60,00%
3 Mayor de 50% Hasta 75% 80,00%
4 Mayor de 75% Hasta 100% 100,00%
Tabla (a) Rango Porcentaje de Recaudo. Fuente Decreto 0111 de 2012 del MME.
$UWtFXOR ƒ 0RGL¿FDU HO FDPSR  ³&DOLGDGGH9LGD´ GHO )RUPDWR ³,QIRUPDFLyQ
12 13 Áreas Rurales de Menor Desarrollo”, el cual quedará así:
12. Rango Porcentaje de Recaudo: Corresponde al rango porcentaje de Recaudo men- 6. Índice de Necesidades Básicas Insatisfechas (NBI): Corresponde al Indicador de
sual de la facturación efectuada en el área especial, medido como el promedio móvil de los las Necesidades Básicas Insatisfechas (NBI), publicado por el Departamento Administrativo
~OWLPRVGRFH  PHVHVGHDFXHUGRDODWDEODGH¿QLGDSRUOD5HVROXFLyQ\DORVHxDODGR Nacional de Estadística. Según lo señalado en el Decreto 0111 de 2012 del MME.
en el Decreto 0111 de 2012 del MME. Artículo 8°. Adicionar el Capítulo XX ³&DUJRVGH$GPLQLVWUDFLyQ2SHUDFLyQ\ Man-
13.)HFKDGH&HUWL¿FDFLyQ&RUUHVSRQGHDODIHFKDGH&HUWL¿FDFLyQGHOÈUHD(VSHFLDO WHQLPLHQWR $20 a la Resolución 20102400008055 del 16 de marzo de 2010.
expedida por el Alcalde Municipal o Distrital o por la autoridad competente en la cual conste CAPÍTULO XX
ODFODVL¿FDFLyQ\H[LVWHQFLDGHORV%DUULRV6XEQRUPDOHVODFXDOGHEHUiVHUH[SHGLGDGHQWUR Cargos de Administración Operación y Mantenimiento
de los quince (15) días siguientes a la fecha de la respectiva solicitud efectuada por el OR,
según lo señalado en el Decreto 0111 de 2012 del MME. Para las vigencias 2008, 2009, 2010 y 2011, los Operadores de Red y Transmisores Na-
cionales, deberán efectuar el cargue de información referente a los cargos de Administración
Artículo 5°. Adicionar los campos 10 “Rango Porcentaje de Recaudo” y campo 11 Operación y Mantenimiento (AOM), al Sistema Único de Información (SUI). A partir del
³)HFKDGH&HUWL¿FDFLyQ´DO)RUPDWR³,QIRUPDFLyQÈUHDV5XUDOHVGH0HQRU'HVDUUROOR´ año 2013, el cargue estará condicionado al reporte de la información histórica mencionada.
de la Resolución 20102400008055 de 16 de marzo de 2010, así:
Cada Operador de Red y Transmisor Nacional reportará, a más tardar el 30 de abril de
cada año, el porcentaje del valor de los gastos de administración, operación y mantenimiento
junto con los cargos máximos actualizados, en los formularios dispuestos para esto en la
plataforma del Sistema Único de Información (SUI).
En circular posterior a la expedición de la presente resolución se darán las características
\HVSHFL¿FDFLRQHVQHFHVDULDVSDUDUHDOL]DUHOFDUJXHFRUUHVSRQGLHQWHDHVWDLQIRUPDFLyQSRU
lo anterior, hasta tanto se realicen los ajustes requeridos en el SUI, los agentes responsables
Rango de Porcentaje de Recaudo

del reporte continuarán aplicando la metodología de la Resolución CREG 024 de 2012, en


lo referente al reporte de información a la SSPD.
Artículo 9°. La presente resolución rige a partir de la fecha de su publicación en el
)HFKDGH&HUWL¿FDFLyQ

'LDULR2¿FLDOy de la publicación de su anexo en la página web de la Superintendencia de


Servicios Públicos: www.superservicios.gov.co.
Publíquese y cúmplase.
&pVDU*RQ]iOH]0XxR]
(C. F.).

10 11 RESOLUCIÓN NÚMERO SSPD – 20121300018545 DE 2012


10. Rango Porcentaje de Recaudo: Corresponde al Rango Porcentaje de Recaudo
(junio 15)
mensual de la facturación efectuada en el área especial, medido como el promedio móvil de
ORV~OWLPRVGRFH  PHVHVGHDFXHUGRDODWDEODGH¿QLGDSRUODUHVROXFLyQ\DORVHxDODGR SRUODFXDOVHHVWDEOHFHHOIRUPDWRSDUDUHSRUWHGHLQIRUPDFLyQGHXVXDULRVLQGXVWULDOHV
en el Decreto 0111 de 2012 del MME. H[HQWRVGHFRQWULEXFLyQGHDFXHUGRFRQORHVWDEOHFLGRHQHODUWtFXORƒGHO'HFUHWR
de 2011, para el servicio de Gas Natural.
11. )HFKDGH&HUWL¿FDFLyQ&RUUHVSRQGHDODIHFKDGH&HUWL¿FDFLyQGHOÈUHD(VSHFLDO
expedida por el Alcalde Municipal o Distrital o por la autoridad competente en la cual conste El Superintendente de Servicios Públicos Domiciliarios, en ejercicio de sus facultades y,
ODFODVL¿FDFLyQ\H[LVWHQFLDGHORV%DUULRV6XEQRUPDOHVODFXDOGHEHUiVHUH[SHGLGDGHQWUR HQHVSHFLDOGHODVTXHOHFRQ¿HUHQORVDUWtFXORV\GHOD/H\GHHOQXPHUDO
de los quince (15) días siguientes a la fecha de la respectiva solicitud efectuada por el OR, 22 del artículo 79 de la Ley 142 de 1994 y el numeral 34 del artículo 7° del Decreto 990
según lo señalado en el Decreto 0111 de 2012 del MME. de 2002,
Artículo 6°. Adicionar los campos 13 “Rango Porcentaje de Recaudo” y campo 14 “Fecha CONSIDERANDO:
GH&HUWL¿FDFLyQ´DO)RUPDWR³,QIRUPDFLyQGH=RQDVGH'LItFLOJHVWLyQR&RPXQLGDGHV Que de conformidad con los artículos 53 de la Ley 142 de 1994 y 14 de la Ley 689 de
de Difícil Gestión” de la Resolución 20102400008055 de 16 de marzo de 2010, así: 2001, corresponde a la Superintendencia de Servicios Públicos, establecer, administrar,
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 29
mantener y operar el Sistema Único de Información (SUI), que se surtirá de la información
proveniente de los prestadores de servicios públicos, sujetos a su vigilancia y control. UNIDADES ADMINISTRATIVAS ESPECIALES
Que el artículo 102 de la Ley 1450 de 2011 establece que, a partir del año 2012, los
usuarios industriales de gas natural domiciliario no serán objeto del cobro de la contribución
de que trata el numeral 89.5 del artículo 89 de la Ley 142 de 1994. Unidad de Planeación Minero-Energética
Que a su vez, el parágrafo de este artículo prevé que el Gobierno Nacional reglamentará
las condiciones necesarias para que los prestadores del servicio de gas natural domiciliario RESOLUCIONES
realicen un adecuado control entre las distintas clases de usuarios.
Que en cumplimiento de lo anterior, el Ministerio de Hacienda y Crédito Público expidió RESOLUCIÓN NÚMERO 0309 DE 2012
el Decreto 4956 del 30 de diciembre de 2011 “por el cual se reglamenta el artículo 102 de la
(junio 27)
/H\GH´HQFX\RDUWtFXORƒVHHVWDEOHFHTXH³3DUDODDSOLFDFLyQGHODH[HQFLyQ
prevista en el artículo 102 de la Ley 1450 de 2011, el usuario industrial debe radicar la por la cual se determinan los precios base de los minerales
respectiva solicitud ante la empresa prestadora del servicio de gas natural domiciliario, la SDUDODOLTXLGDFLyQGHUHJDOtDV
cual debe reportar esta información a la Superintendencia de Servicios Públicos Domicilia- El Director General de la Unidad de Planeación Minero-Energética, en ejercicio de sus
rios de conformidad con los formularios que se establezcan para tales efectos, anexando el facultades legales y reglamentarias y, en especial, las conferidas en el Decreto 255 del 28
5HJLVWURÒQLFR7ULEXWDULR 587 \HORORV1~PHURVGH,GHQWL¿FDFLyQGHO8VXDULR 1,8  de enero de 2004, en el artículo 9°, y
Que de igual forma en el artículo 5° del Decreto 4956 ibídem, se establece que las CONSIDERANDO:
empresas prestadoras del servicio público de gas natural domiciliario deben suministrar
trimestralmente a la Superintendencia de Servicios Públicos Domiciliarios a través del Que de conformidad con lo establecido en el Decreto 0070 del 19 enero de 2001 en su
Sistema Único de Información, la relación de los usuarios industriales a quienes les hayan artículo 5° numeral 22 el Ministerio de Minas y Energía, en ejercicio de sus funciones, le
aplicado la exención del cobro de la contribución especial o los que hayan sido objeto de su FRUUHVSRQGH¿MDUORVSUHFLRVGHORVGLIHUHQWHVPLQHUDOHVHKLGURFDUEXURVSDUDHIHFWRVGHOD
DSOLFDFLyQSRUDOJXQDPRGL¿FDFLyQGHVXDFWLYLGDGHFRQyPLFDSULQFLSDO<TXHFRUUHVSRQGH liquidación de regalías.
DHVWD6XSHULQWHQGHQFLDGH¿QLUORVIRUPDWRVDWUDYpVGHORVFXDOHVODVHPSUHVDVSUHVWDGRUDV Que mediante Resolución 8-0006 del 5 de enero de 2000, el Ministerio de Minas y
del servicio público de gas natural domiciliario deben suministrar la información referida Energía delegó en la Unidad de Planeación Minero-Energética como Unidad Administra-
y que las empresas prestadoras del servicio público de gas natural domiciliario serán res- WLYD(VSHFLDODGVFULWDDO0LQLVWHULRGH0LQDV\(QHUJtDODIXQFLyQGH¿MDUSRUPHGLRGH
ponsables por la calidad de la información que suministren. resolución los precios de los diferentes minerales para efectos de la liquidación de regalías.
Que en cumplimiento de la obligación descrita, se hace necesario incluir en el Sistema Que la Ley 141 del 28 de junio de 1994 en su artículo 22 establece los criterios a tener
Único de Información (SUI), el formato que permita obtener la información de los usua- HQFXHQWDSRUHO0LQLVWHULRGH0LQDV\(QHUJtDSDUDOD¿MDFLyQGHOSUHFLR básico en boca
ULRVEHQH¿FLDGRVFRQODH[HQFLyQGHODFRQWULEXFLyQHVSHFLDORORVTXHKDQSHUGLGRGLFKR o borde de mina para el carbón de consumo interno y de exportación y el artículo 23 es-
EHQH¿FLRGHDFXHUGRDODVFRQGLFLRQHVHVWDEOHFLGDVHQHOFLWDGR'HFUHWRGHOGH tablece el mecanismo para la determinación del precio básico en boca o borde de mina del
diciembre de 2011.
níquel para la liquidación de regalías y compensaciones monetarias.
4XHSRUORDQWHULRU
Que mediante Resolución 8-0760 del 27 de junio de 2001, el Ministerio de Minas y
RESUELVE: (QHUJtDGHWHUPLQyORVFULWHULRVTXHGHEHQWHQHUVHHQFXHQWDSDUDOD¿MDFLyQGHOSUHFLREDVH
Artículo 1°. Las Empresas Prestadoras de Servicios Públicos Domiciliarios de Gas de los minerales para la liquidación de regalías.
Natural, deberán reportar la información señalada en los artículos 4° y 5° del Decreto Que en las Resoluciones 8 1938 de agosto 25 de 1995 y 8 2187 de septiembre 20 de
4956 de 2011, siguiendo los criterios y parámetros contenidos en el Anexo 1 que hace parte 1995 del Ministerio de Minas y Energía se establecen las indicaciones para la determinación
integral de la presente resolución, relacionada con los usuarios industriales a quienes les
del precio base de liquidación de regalías por la explotación de esmeraldas.
hayan aplicado la exención del cobro de la contribución especial o los que hayan perdido
GLFKREHQH¿FLRSRUDOJXQDPRGL¿FDFLyQGHVXDFWLYLGDGHFRQyPLFDSULQFLSDO Que en la Ley 756 del 23 de julio de 2002 en su artículo 16 parágrafo 8° establece el
La información solicitada se deberá reportar trimestralmente, para lo cual se habilitarán mecanismo para efectos de liquidar las regalías por la explotación de minas de sal y en el
oportunamente los formatos correspondientes en los periodos señalados. parágrafo 9° del mismo artículo establece el procedimiento para determinar el valor de un
gramo oro, plata y platino en boca de mina, que debe tomarse para la liquidación de las
Artículo 2°. Una vez sea diligenciado el formato por parte de los prestadores de servicios
regalías.
S~EOLFRVGRPLFLOLDULRVGHJDVQDWXUDOHOVLVWHPDH[SHGLUiDXWRPiWLFDPHQWHHOFHUWL¿FDGRGH
reporte del cargue correspondiente, en caso contrario, se entenderá como No Reportado el Que el artículo 339 de la Ley 685 del 15 de agosto de 2001, declara de utilidad pública
Formato con las consecuencias que se derivan por el incumplimiento del mismo. la obtención, organización y divulgación de información relativa a la riqueza del subsuelo,
Artículo 3°. La presente resolución rige a partir de la fecha de su publicación. la oferta y estado de los recursos mineros y la industria minera en general. En consecuencia,
los concesionarios de títulos mineros o propietarios de minas, están obligados a recopilar y
Publíquese y cúmplase. suministrar, sin costo alguno, tal información a solicitud de la autoridad minera.
2ULJLQDO¿UPDGRSRU&pVDU$OIRQVR*RQ]iOH]0XxR].
ANEXO 1
Información de Usuarios Industriales exentos de Contribución,
según el Decreto 4956 de 2011

@
Las empresas prestadoras del servicio público de gas natural deberán reportar al SUI
la información relacionada con los usuarios industriales exentos de contribución de acuer-
do con lo establecido en el artículo 1° del Decreto 4956 de 2011, de conformidad con lo
ordenado en los artículos 4° y 5° del mencionado decreto, de manera trimestral, según el
siguiente formato:
Consulte
nuestros
Fecha Novedad

Tipo Novedad

servicios
Código RUT
NIU

1 2 3 4
En donde:
1. NIU:&RUUHVSRQGHDO1~PHURGH,GHQWL¿FDFLyQGHO8VXDULR
2. Fecha Novedad: Corresponde a la Fecha a partir de la cual la empresa realizó el
cambio de categoría del usuario.
3. Tipo Novedad: Corresponde al Tipo de Novedad que se reporta para el usuario, si
atencion_cliente@imprenta.gov.co
es ingreso – I si es salida – S.
4. Código RUT:6HUH¿HUHDO&yGLJRGHO5HJLVWURÒQLFR7ULEXWDULR 587 VHJ~QOR
establece la Resolución 00432 de 2008 de la DIAN.
(C. F.).
Edición 48.475
30 DIARIO OFICIAL Jueves, 28 de junio de 2012

Que mediante la Resolución 181074 del 17 de julio de 2007 del Ministerio de Minas
\(QHUJtDPRGL¿FóDOJXQRVFULWHULRVGH¿MDFLyQGHOSUHFLREDVHGHOLTXLGDFLyQGHUHJDOtDV Unidad de
Precio en Boca de Mina
MINERAL $/Unidad
medida
para el carbón de exportación. Res I Trim. 2012

Que en la Resolución 180507 del 1° de abril de 2009 del Ministerio de Minas y Energía, Arcillas Bentoníticas t 14.204
VHPRGL¿FDQDOJXQRVFULWHULRVGH¿MDFLyQGHOSUHFLREDVHGHOLTXLGDFLyQGHUHJDOtDVSDUDHO Arcillas Caoliníticas t 24.048
Arcillas Ceramicas t 9.258
carbón de exportación establecidos en la Resolución número 181074 de julio 17 de 2007. Arcillas Ferruginosas t 5.132
Arcillas Miscelaneas t 5.132
Que mediante Decreto número 4130 del 3 de noviembre de 2011 del Ministerio de Arcillas Refractarias t 9.000
Minas y Energía, en el artículo 5° -Reasignación de funciones a la Unidad de Planeación Arena de Cantera m3 9.897
Minero-Energética, establece que a la UPME le corresponde: Fijar los precios de los dife- Arena de Rio (Arenas lavadas) m3 5.693
Arenas Siliceas t 12.328
rentes minerales para efectos de la liquidación de regalías, asignada al Ministerio de Minas Asbesto (o Crisotilo) t 13.652
y Energía en el numeral 22 del artículo 5° del Decreto 70 de 2001. Asfaltita m3 24.177
Azufre t 11.127
Que en mérito de lo expuesto, Barita t 141.245
RESUELVE: Basalto t 6.161
Bauxita t 23.421
Artículo 1°. Fijar los precios base para la liquidación de regalías de los minerales en Carbonato de Calcio t 47.459
boca o borde de mina vigentes en el Registro Minero Nacional, de la siguiente manera: Caliza t 12.720
Cuarzo t 13.814
Cromo -Cromita t 16.965
PRECIOS EN BOCA MINA BASE PARA LA LIQUIDACION DE REGALIAS Diabasa m3 7.795
Pesos Corrientes Dolomita t 14.663
Feldespatos t 43.907
Precio en boca Fluorita t 132.460
Unidad de
MINERAL de mina Grafito t 28.968
medida
$/unidad Granito (bloque mayor o igual a 1 m 3) m3 659.821
Granito (bloque menor a 1 m 3) m3 329.572
Carbón de Consumo Interno
Gravas de Cantera m3 11.346
Carbón consumo Interno t 79.701 Gravas de Rio m3 6.577
Marmol (bloque mayor o igual a 1 m 3) m3 144.496
Carbón de Exportación
Marmol (bloque menor a 1 m 3) m3 47.363
Productores Zona Costa Norte Marmol en rajón ( Retal de mármol) t 17.965
Micas:Vermiculita,Moscovita, Biotita t 43.823
Térmico de La Guajira t 155.897 Mineral de Hierro t 24.509
Mineral de Magnesio (Magnesita) t 114.543
Sector el Descanso t 148.073 Mineral de Manganeso t 206.177
Piedra Arenisca-Piedra Bogotana m3 174.650
Sector de la Loma y el Puzolanas t 9.700
Térmico del Cesar t 155.573
Boquerón Recebo m3 7.195
Roca Coralina (Bloque mayor o igual a 1 m 3) m3 271.997
Sector de la Jagua de Ibirico t 153.277 Roca Coralina (bloque menor a 1 m 3) m3 106.480
Roca Fosforica t 88.040
Productores Zona Santanderes Sal Marina t 41.080
Sal Terrestre t 40.322
Térmico t 107.849 Sal Terrestre Zona Upín t 31.497
Serpentina (Bloque mayor o igual a 1 m 3) m3 373.997
Metalúrgico t 260.162 Serpentina (bloque menor a 1 m 3) m3 173.776
Serpentina en Rajón t 54.581
Serpentinita( Silicato de Magnesio) t 21.910
Antracitas t 459.618 Talco t 88.464
Travertino y Calizas Cristalinas en bloque mayor o igual a 1 m 3 m3 415.931
Productores Zona Interior Travertino y Calizas Cristalinas en bloque menor a 1 m 3 m3 132.220
Yeso t 42.930
Térmico t 80.086

Metalúrgico t 240.104
Parágrafo 1°. Las regalías de los minerales cuyo precio se establece mediante la presente
resolución, deberán cancelarse para el mineral principal y para los secundarios.
Antracitas t 439.560 Parágrafo 2°. De acuerdo con el artículo 11 del Decreto 0600 del 26 de marzo de 1996,
se establece que “en el caso del carbón de exportación, cuando el productor haya pagado
ODUHJDOtDFRQEDVHHQHOSUHFLR¿MDGRSDUDHOFRQVXPRLQWHUQRHOH[SRUWDGRUGHEHUiSD-
gar la diferencia e indicar la procedencia de la producción, para efectos de distribución y
transferencias”.

Consulte a Artículo 2°. El precio base para la liquidación de regalías por la explotación de esme-
raldas se regirá según lo establecido en las Resoluciones 8 1938 de agosto 25 de 1995 y 8
2187 de septiembre 20 de 1995, del Ministerio de Minas y Energía, que señala:
“El precio base para la liquidación de regalías por la explotación de esmeraldas será:
1.1 El reportado por el productor en el momento de efectuar la declaración ante el
respectivo Alcalde.

Di @ rio 1.2 El declarado por el exportador en los casos en que, al momento de solicitar la guía
de exportación, no presente copia de la declaración rendida por el productor ante el Alcalde
correspondiente.
Parágrafo. Al valor declarado por el exportador se le podrán efectuar las siguientes
deducciones:
a) Piedra en bruto: 10% por costos de comercialización.

el b)Piedra tallada: 60% por costos de comercialización y mano de obra.


c)Piedra engastada: 60% por costos de comercialización, mano de obra y artes”.
Artículo 3°. El precio base para la liquidación de regalías de níquel se regirá, según lo
establecido en el artículo 23 de la Ley 141 del 28 de junio de 1994 que contempla: “En las

'LDULR2¿FLDO
QXHYDVFRQFHVLRQHVRHQODVSUyUURJDVGHOFRQWUDWRYLJHQWHVLODVKXELHUHSDUDOD¿MDFLyQ
del precio básico en boca o borde de mina del níquel para la liquidación de regalías y
compensaciones monetarias, se tomará como base el promedio ponderado del precio FOB
en puertos colombianos en el trimestre inmediatamente anterior, descontando el setenta y
cinco por ciento (75%) de los costos de procesamiento en horno, de los costos de manejo,
de los costos de transporte y portuarios”.
www.imprenta.gov.co Artículo 4°. El precio base para la liquidación de regalías de los metales preciosos se
regirá, según lo establecido en el parágrafo 9° del artículo 16 de la Ley 756 de 2002, que
establece: “el valor de gramo oro, plata y platino en boca de mina para liquidar las regalías,
será del ochenta por ciento (80%) del precio internacional promedio del último mes, publi-
cado por la Bolsa de Metales de Londres en su versión Pasado Meridiano”.
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 31
Artículo 5°. El precio base para la liquidación de regalías de los metales preciosos y no 1. Carbón de consumo interno
preciosos exportados en concentrados polimetálicos, se regirá según lo establecido en el Las fuentes consultadas para el presente cálculo fueron los diferentes gremios-Fenalcarbón
numeral 3 del artículo 1° de la Resolución número 8 0760 del 27 de junio de 2001, expedida Boyacá-, empresas cementeras como Cemex y Holcim, empresas como Gensa, Emgesa y
por el Ministerio de Minas y Energía, que indica: “para la liquidación de las regalías de 7HUPRWDVDMHUR'HLJXDOIRUPDHPSUHVDVSDSHOHUDVFRPR6PXU¿W&DUWyQGH&RORPELD\
los metales preciosos y no preciosos exportados en concentrados polimetálicos, se tomará Cooperativas como Colcarbex del Norte de Santander. Los resultados de la información
FRPREDVHHOSUHFLRGHFDGDPHWDOHQHOPHUFDGRH[WHUQR¿MDGRSRUOD%ROVDGH/RQGUHV fueron los siguientes:
WHQLHQGRSUHVHQWHORVÀHWHVTXHFRUUHVSRQGDQHQFDGDFDVR\ODFHUWL¿FDFLyQGHODFDQWLGDG
Valor Valor en Boca
H[DFWDGHPHWDOHVH[SRUWDGRVH[SHGLGDSRUODHQWLGDGTXHUHDOL]yODRSHUDFLyQGHUH¿QDFLyQ Empresas Contacto
Precio
Transporte de Mina
HQHOH[WHULRUVLJXLHQGRHQWRGRORVFULWHULRVGH¿QLFLRQHV\SURFHGLPLHQWRVHVWDEOHFLGRV $/Ton.
y Manejo $/Ton.
para los metales preciosos”. Holcim Victoria Eugenia Vargas 102.663 27.482 75.180
Artículo 6°. Se exceptúa de lo dispuesto en esta resolución, la determinación de precios Cemex (Ibagué) Mario Fernando Mendoza 113.722 40.396 73.326
pactada en los contratos vigentes a la fecha de la promulgación de la Ley 141 de 1994. Cemex (Cúcuta) Mario Fernando Mendoza 111.307 31.000 80.307
Artículo 7°. Cuando se presenten explotaciones de minerales no incluidos en la presente Termotasajero Hernando Díaz 138.104 31.000 107.104
UHVROXFLyQOD8QLGDGGH3ODQHDFLyQ0LQHUR(QHUJpWLFD 830( GHR¿FLRRDVROLFLWXG GENSA Gonzalo Araque 89.431 27.482 61.948
GHSDUWHSURFHGHUiD¿MDUORVSUHFLRVEDVHHQERFDGHPLQDSDUDODOLTXLGDFLyQGHUHJDOtDV Emgesa Fernando Gutiérrez 144.921 38.799 106.122
Colcarbex Cooperativa Mul-
Artículo 8°. Con el Decreto 2191 de agosto 4 de 2003, se adoptó el Glosario Técnico tiactiva
Jaime Rodríguez 108.000 31.000 77.000
Minero el cual es de obligatorio uso por parte de los particulares, autoridades y funcionarios SMURFIT Cartón Colombia Luis Gilberto Parra 143.676 87.057 56.620
en la elaboración, presentación y expedición de documentos, solicitudes y providencias que Promedio Precio Interno 79.701
se produzcan en las actuaciones reguladas por la Ley 685 de 2001 y Decretos Reglamentarios.
)XHQWH(PJHVD+ROFLP&(0(;7HUPRWDVDMHUR*(16$6PXU¿W&DUWyQGH&RORPELD&ROFDUEH[\+ROFLP
(QHOPHQFLRQDGRJORVDULRVHGH¿QHHQWUHRWUDV&DQWHUDVGH)RUPDFLyQGH$OXYLyQ
El precio en boca de mina es el siguiente:
Canteras de Roca y Recebo.
Artículo 9°. Téngase como soporte técnico de la presente resolución, el Anexo 1 que Carbón Resolución actual $/Ton.
hace parte integral de la misma. Consumo Interno 79.701

Artículo 10. La presente resolución rige para el periodo 1° de julio de 2012 a 30 de La variación respecto a la resolución del II trimestre de 2012 es la siguiente:
septiembre de 2012, deroga las disposiciones que le sean contrarias y deberá ser publicada Resolución actual $/Ton. Precio Resol. 0141 Variación %
en el 'LDULR2¿FLDO y en la página web de la UPME. de 29-03-2012 $
Consumo Interno 79.701 105.400 -24,4
Publíquese y cúmplase.
La UPME se encuentra desarrollando un “Estudio para el establecimiento de los precios
Dada en Bogotá, D. C., a 27 de junio de 2012.
de los minerales en boca de mina y cálculo de los costos unitarios de producción asociados
El Director General, a la industria minera.”, el cual será el insumo para actualizar los precios de los minerales
2VFDU8ULHO,PLWROD$FHUR base para liquidar regalías.
SOPORTE TÉCNICO DE LA RESOLUCIÓN POR LA CUAL SE DETERMI- Carbón de Exportación
NAN LOS PRECIOS BASE DE LOS MINERALES PARA LA LIQUIDACIÓN DE 2. Periodo comprendido entre los meses de octubre de 2011 a marzo de 2012
REGALÍAS III TRIMESTRE DE 2012 - Consideraciones iniciales:
1.1.1.1 ANTECEDENTES De acuerdo con la metodología establecida en la Ley de Regalías (Ley 141 de 1994),
El artículo 332 de la Constitución Política de la República de Colombia dispone que el y en las Resoluciones 181074 del 17 de julio de 2007 y 180507 del 1° de abril de 2009
Estado es propietario del subsuelo y de los recursos naturales no renovables, sin perjuicio H[SHGLGDVSRUHO0LQLVWHULRGH0LQDV\(QHUJtDSDUDOD¿MDFLyQGHOSUHFLRGHOFDUEyQTXH
de los derechos adquiridos y perfeccionados conforme a las leyes preexistentes. Adicio- se destina al mercado externo, se toma como base el promedio ponderado del precio FOB
QDOPHQWHHQVXDUWtFXORVHGH¿QHTXH³«/DH[SORWDFLyQGHXQUHFXUVRQDWXUDOQR en puertos colombianos, correspondiente al semestre que se liquida, descontando los costos
renovable causará a favor del Estado, una contraprestación económica a título de regalía, de transporte, manejo y portuarios.
sin perjuicio de cualquier otro derecho o compensación que se pacte”. - Metodología:
La Ley 141 de 1994 en su artículo 13 dispuso que toda explotación de recursos naturales 6HXWLOL]DURQGRVPHWRGRORJtDVLQGHSHQGLHQWHVXQDSDUDHOFDUEyQWpUPLFR\RWUDSDUD
no renovables de propiedad del Estado genera regalías a favor de este. los carbones metalúrgicos y las antracitas, de acuerdo con las resoluciones emitidas por el
El artículo 16 de la Ley 756 de 2002 establece las regalías por la explotación de recursos Ministerio de Minas y Energía, así:
naturales no renovables de propiedad nacional, sobre el valor de la explotación en boca o De acuerdo con lo establecido en la Resolución Minminas número 181074 del 17 de
borde de mina o pozo, según corresponda. julio del 2007, para el cálculo de precio base para la liquidación de regalías del carbón
De conformidad con lo establecido en el Decreto 0070 de 2001 en su artículo 5° numeral WpUPLFRGHH[SRUWDFLyQVHXWLOL]DODVLJXLHQWHIyUPXODODFXDOKDVLGRDGRSWDGDSDUDUHÀHMDU
DO0LQLVWHULRGH0LQDV\(QHUJtDHQHMHUFLFLRGHVXVIXQFLRQHVOHFRUUHVSRQGH¿MDUORV las diferentes zonas de procedencia y los tipos de carbón:
precios de los diferentes minerales e hidrocarburos para efectos de la liquidación de regalías. n $3,i - BCI7i  * SRQGHUDGR por volumen deFDUEyQWpUPLFRde
El Ministerio de Minas y Energía mediante Resolución número 80006 del 5 de enero de
GHOHJDHQOD830(ODIXQFLyQGH¿MDUPHGLDQWHUHVROXFLyQORVSUHFLRVGHORVGLIHUHQWHV
PP ¦i 1 H[SRUWDFLy QGHO PHV LGHO VHPHVWUHLque se liquida
minerales para efectos de la liquidación de regalías. Donde:
El 27 de junio de 2001 mediante Resolución número 8 0760 determina los criterios que API 2i: Es el indicador del precio de carbón térmico en US$ por tonelada métrica a
GHEHQWHQHUVHHQFXHQWDSDUDOD¿MDFLyQGHOSUHFLREDVHGHORVPLQHUDOHVSDUDODOLTXLGDFLyQ NFDONJ1$5 TXHHQODIyUPXODDFRUGDGDVHFRQVLGHUDUiHTXLYDOHQWHD%78OE
de regalías y se adiciona la Resolución 8 0006 del 5 de enero de 2000. GAR) para entregas CIF ARA (Amsterdam, Rotterdam, Antwerp), publicado semanalmente
(OGHMXOLRGHOPHGLDQWH5HVROXFLyQQ~PHURVHPRGL¿FDQDOJXQRVGH GXUDQWHHOPHV L FRPR7)6$3,HQHO$UJXV0F&ORVNH\¶V&RDO3ULFH,QGH[5HSRUW3DUD
ORVFULWHULRVGH¿MDFLyQGHOSUHFLREDVHSDUDODOLTXLGDFLyQGHUHJDOtDVGHOFDUEyQWpUPLFR efectos de establecer el precio FOB, se realizará el promedio aritmético de los indicadores
de exportación. vigentes semanales en el mes (i).
(OƒGHDEULOGHOPHGLDQWH5HVROXFLyQQ~PHURVHPRGL¿FDHODUWtFXORƒ BCI7i(VHOLQGLFDGRUGHORVYDORUHVGLDULRVGHOÀHWHPDUtWLPRHQWUH3XHUWR%ROtYDU\
de la Resolución 181074 de julio de 2007. Rotterdam, publicados en el SSY Mineral FFA Report, con fuente Baltic Exchange. Para
Que mediante Decreto número 4130 de noviembre 3 de 2011, a la UPME le corresponde efectos de establecer el precio FOB, se realizará el promedio aritmético de los indicadores
según lo determinado en el numeral 2 lo siguiente: Fijar los precios de los diferentes mine- vigentes diarios en el mes (i) del semestre que se liquida.
rales para efectos de la liquidación de regalías, asignada al Ministerio de Minas y Energía n: Es el semestre que se liquida.
en el numeral 22 del artículo 5° del Decreto 70 de 2001. PP: Corresponde al precio ponderado por volumen de carbón térmico de exportación
Con el ánimo de dar cumplimiento a la delegación, a continuación se presenta el soporte del mes i del semestre que se liquida: Se obtiene, para el mes i, dividiendo el volumen total
WpFQLFRGHORVFiOFXORVHIHFWXDGRVSDUD¿MDUORVSUHFLRVGHODUHVROXFLyQ de exportación del mes i entre el volumen total de exportación del semestre que se liquida.
ESTIMACIÓN DE PRECIO BASE PARA LA LIQUIDACIÓN DE LAS REGA- 35&N 86 (OSUHFLREDVHSDUDODOLTXLGDFLyQGHUHJDOtDVGHFDUEyQWpUPLFRTXHVH
LÍAS CARBÓN dedica al mercado externo, para cada mina, expresado en dólares americanos por tonelada
(US$/t), el cual se obtiene restando del precio FOB promedio ponderado en puertos co-
El precio base para la liquidación de las regalías de carbón se establece en esta resolución lombianos (PP), los costos de transporte, manejo y portuarios para cada caso particular, y
en forma discriminada así: a las que se le aplica la siguiente fórmula:
1. Carbón de consumo interno. 35&N 86  337N0N3N
&DUEyQGHH[SRUWDFLyQVHFODVL¿FDWHQLHQGRHQFXHQWDORVVLJXLHQWHVDVSHFWRV Donde:
a) Procedencia. PRCk: Es el precio base para la liquidación de las regalías de carbón térmico para cada
b) Tipo de carbón: PLQDH[SUHVDGRHQGyODUHVDPHULFDQRVSRUWRQHODGD 86W SDUDOD]RQDN
Edición 48.475
32 DIARIO OFICIAL Jueves, 28 de junio de 2012

PP: Es el Precio FOB promedio ponderado en puertos colombianos para carbón térmico A continuación se presenta el desarrollo de la metodología realizada para el cálculo del
de exportación, expresado en dólares americanos por tonelada (US$/t). precio base de liquidación de regalías de los carbones térmicos de exportación, Resolución
7k:(TXLYDOHDORVFRVWRVGHWUDQVSRUWHGHFDGDH[SRUWDGRUGHODUHJLyQNWRPDGRVGHVGH GHOGHMXOLRGHTXHPRGL¿FDDOJXQRVFULWHULRVGH¿MDFLyQGHOSUHFLREDVH
el borde o boca de mina hasta el puerto colombiano, expresados en dólares americanos por para liquidación de regalías del carbón de exportación.
tonelada (US$/ton). Aplicación metodológica:
Mk:&RUUHVSRQGHDORVFRVWRVGHPDQHMRGHFDGDH[SRUWDGRUGHODUHJLyQNH[SUHVDGRV Determinación del precio FOB de exportación calculado con base en la diferencia
en dólares americanos por tonelada (US$/ton). entre el índice API2 y BCI7, teniendo en cuenta calidades de las regiones de proce-
Pk:&RUUHVSRQGHDORVFRVWRVSRUWXDULRVGHFDGDH[SRUWDGRUGHODUHJLyQNH[SUHVDGRV dencia. Se realizó otro ejercicio para calcular el precio FOB con base en el índice API21
en dólares americanos por tonelada (US$/ton). DOFXDOVHOHGHVFXHQWDHOYDORUGHORVÀHWHVGHOtQGLFH%&,1, ponderando según la calidad
de origen de la región productora.
De acuerdo con lo establecido en la Resolución Minminas número 80760 de 2001, para
el cálculo de precio base para la liquidación de regalías del carbón metalúrgico y antracita Para el cálculo de precio base para la liquidación de regalías del carbón de exportación
GHH[SRUWDFLyQVHXWLOL]DODVLJXLHQWHIyUPXODODFXDOKDVLGRDGRSWDGDSDUDUHÀHMDUODV se utiliza la siguiente fórmula:
diferentes zonas de procedencia y los tipos de carbón: PRCk = PPajustado - Tk - Mk - Pk

PRC k PP  7k  0 k  3k n $3,i - BCI7i  * SRQGHUDGR por volumen deFDUEyQWpUPLFRde


Donde: PP ¦i 1 H[SRUWDFLy QGHO PHV LGHO VHPHVWUHLque se liquida
PRCk: es el precio base para la liquidación de las regalías de carbón tipo i en la región
NH[SUHVDGRHQGyODUHVDPHULFDQRVSRUWRQHODGD 86W 
PPi: es el precio promedio FOB del carbón colombiano tipo i en puertos colombianos,
expresado en dólares americanos por tonelada (US$/t). PPajustado PP x (BTU/Lb) región
7k: equivale a los costos de transporte desde el borde o boca de mina hasta el puerto
FRORPELDQRGHVGHODUHJLyQNH[SUHVDGRVHQGyODUHVDPHULFDQRVSRUWRQHODGD 86W  11.370 (BTU/Lb)
Mk: corresponde a los costos de manejo de cada exportador, expresados en dólares
americanos por tonelada (US$/t).
Pk: corresponde a los costos portuarios de cada exportador expresados en dólares ame- Donde PP se establece de la siguiente forma:
ricanos por tonelada (US$/t). Precio Ponderado por
Factor de Pond.
- Fuentes de información consultadas: Mes (API2-BCI7) US$/t (a) Volumen de Exporta-
Exportaciones (b)
‡'$1(YRO~PHQHV\YDORUHVGHH[SRUWDFLyQSRUSDUWLGDDUDQFHODULDHQGyODUHV\SHVRV ciones US/t (a * b)
FOB. OCTUBRE 101,45 14,3% 14,51
‡6,0&2\%DQFRGHOD5HS~EOLFDSDUDODWDVDUHSUHVHQWDWLYDGHOPHUFDGR750 NOVIEMBRE 99,77 15,2% 15,14
‡0LQLVWHULRGH7UDQVSRUWHSDUDHOYDORUGHODVWDULIDVGHORVÀHWHVGHOFDUEyQDGLIHUHQWHV DICIEMBRE 95,52 19,2% 18,30
puertos colombianos SICE. ENERO 95,35 15,8% 15,11
‡6RFLHGDGHVSRUWXDULDVGH%DUUDQTXLOOD6DQWD0DUWD%XHQDYHQWXUD\&DUWDJHQDSDUD FEBRERO 89,77 16,5% 14,83
obtener tarifas de uso y manejo en puertos. MARZO 87,99 19,0% 16,73
‡6HUYLFLR*HROyJLFR&RORPELDQRSDUDREWHQHUODVFDOLGDGHVSRUUHJLyQVHJ~QOD5HVR- TOTAL SEMESTRE 100,0% 94,61
lución número 180507 de 2009.
Fuente: DIAN–DANE, Argus, Baltic Exchange. Cálculos UPME.
‡3XEOLFDFLRQHVHVSHFLDOL]DGDVFRPR$UJXV\0F0F&ORVNH\SDUDSUHFLRVGHFDUEyQ\
%DOWLF([FKDQJHSDUDHOYDORUGHÀHWHVPDUtWLPRV El PP ajustado, según las calidades regionales de los carbones es el siguiente:
‡,QIRUPDFLyQGHJUHPLRVFRPR)HQDOFDUEyQ%R\DFi$VRFDUEyQ\&ROFDUEH[HQ1RUWH Zona/ región PP US/t
Calidades PP Ajustado US/
de Santander. BTU/Libra Libra
Dentro de las limitaciones actuales en el desarrollo de la estimación del precio base Guajira 94,61 11.048 91,93
se tienen: Cesar Sector el Descanso 94,61 10.582 88,05
‡/DLQIRUPDFLyQGLVSRQLEOHGHH[SRUWDFLRQHV IXHQWH',$1'$1( SUHVHQWDFRPR Sector de la Loma y el Boquerón 94,61 11.066 92,08
mínimo tres meses de rezago en lo relacionado con el volumen exportado, por esta razón se Sector de la Jagua de Ibirico 94,61 12.171 101,27
tomó la información correspondiente al semestre comprendido entre los meses de octubre Zona Santanderes 94,61 13.135 109,29
GHDPDU]RGHFRQHO¿QGHDSOLFDUODPHWRGRORJtD\GHWHUPLQDUHOSUHFLR)2%
con el cual se calcula el precio en boca de mina. Zona centro 94,61 12.637 105,15

‡6HFXHQWDFRQLQIRUPDFLyQGHRWUDVIXHQWHVFRPR&HUUHMyQ//& FRVWRVSRUWXDULRV Fuente: Servicio Geológico Colombiano, DIAN-DANE, cálculos UPME.


calidad y de transporte), Drummond (Exportaciones y calidad del carbón realizadas durante Ahora se descuentan los costos de transporte, manejo y portuarios para cada caso particular:
el periodo a considerar), Prodeco (costos, volumen y calidad para el periodo considerado),
teniendo en cuenta que ni el Servicio Geológico o la Agencia Nacional de Minería respon- PRCk (US$) = PPajustado – Tk – Mk – Pk
GLHURQORVR¿FLRVFRQODVVROLFLWXGHVGHLQIRUPDFLyQUHDOL]DGDV
‡3DUDHOFiOFXORGHORVFRVWRVGHWUDQVSRUWH\PDQHMRHQSXHUWRVHWUDEDMyFRQEDVHHQ Precios boca de mina con base en el índice API2-BCI7, para el carbón térmico
LQIRUPDFLyQGHO0LQLVWHULRGH7UDQVSRUWHVREUHÀHWHVSDUDHOFDUEyQDORVGLIHUHQWHVSXHUWRV colombiano por regiones y calidades
colombianos, y adicionalmente se consultaron las sociedades portuarias de Barranquilla, Costos deducibles PRCk
Zona/región PP US$/t
Santa Marta, Cartagena y Buenaventura, contrastadas con las facturas de las diferentes US$/t US$/t
empresas para obtener las tarifas de manejo en puerto para el carbón. La Guajira 91,93 8,2 83,77
‡3DUDORVFDVRVGRQGHVHKDUHTXHULGRFRQYHUWLUGyODUHVDSHVRVFRORPELDQRVVHKD Sector el Descanso 88,05 8,5 79,57
utilizado la TRM que de acuerdo con lo señalado en la Ley 141 de 1994, se hace tomando
Cesar Sector de la Loma y el Boquerón 92,08 8,5 83,60
como base la tasa de cambio representativa del mercado promedio de dicha moneda en el
semestre que se liquida que fue de $1.860,99 pesos por dólar. Sector de la Jagua de Ibirico 101,27 18,9 82,36

Costos de Transporte y Portuarios para el Carbón de Exportación Zona Santanderes 109,29 51,3 57,95
Zona Centro 105,15 62,1 43,03
Valor
Costo Trans- Costo Manejo Fuente: Servicio Geológico Colombiano, DIAN - DANE, cálculos UPME.
Zona / Región Total TRM Octubre
porte y Portuario 2011-Marzo Determinación de los precios en boca mina en pesos:
US $ / t 2012
Zona/región PRCk US/t TRM PRCk $/t
US $ / t US $ / t $/US $/t
La Guajira 3,6 4,6 8,2 1.860,99 15.185,7 Guajira 83,77 1.860,99 155.897,08
Cesar Sector el Descanso 3,9 4,6 8,5 1.860,99 15.779,3 Cesar Sector el Descanso 79,57 1.860,99 148.072,52
Sector de la Loma y el 3,9 4,6 8,5 1.860,99 15.779,3 Sector de la Loma y el Boquerón 83,60 1.860,99 155.572,88
Boquerón Sector de la Jagua de Ibirico 82,36 1.860,99 153.277,32
Sector de la Jagua de 12,1 6,8 18,9 1.860,99 35.187,4 Zona Santanderes 57,95 1.860,99 107.848,52
Ibirico Zona centro 43,03 1.860,99 80.086,05
Zona Santanderes 38,3 13,0 51,3 1.860,99 95.539,8
Fuente: Servicio Geológico Colombiano, DIAN-DANE, cálculos UPME.
Zona Interior País 49,1 13,0 62,1 1.860,99 115.597,9
)XHQWH&RVWRIDFWXUDHQ6RFLHGDGHVSRUWXDULDV0LQLVWHULRGH7UDQVSRUWH6,&(FRQVRUFLRVFRPR&HUUHMyQ 1
Precio API#2 es un índice que representa precios carbón térmico 11.370 BTU, y BCI7 es índice que
Fenalcarbón, Vale y Prodeco. UHSUHVHQWDÀHWHVGH3XHUWR%ROtYDU$5$
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 33
9DULDFLyQGH3UHFLRVSURSXHVWRVHQERFDPLQDUHVSHFWRDORV¿MDGRVHQOD5HVROXFLyQ MES TONELADAS PARTICIPACIÓN %
número 0141 del 29 de marzo de 2012 OCTUBRE 36,0 6,2
Precio Resolución NOVIEMBRE 0,0 0,0
Propuesta PRCk
Zona/región 0141 de 29-03-2012 Variación % DICIEMBRE 279,0 47,7
$/Ton
$/Ton ENERO 5,3 0,9
Guajira 155.897 176.929 -11,9 FEBRERO 222,0 38,0%
Cesar Sector el Descanso 148.073 162.720 -9,0 MARZO 42,2 7,2%
Sector de la Loma y el Boquerón 155.573 177.859 -12,5 TOTAL 584 100%
Sector de la Jagua de Ibirico 153.277 177.882 -13,8 Fuente DIAN –DANE.
Zona Santanderes 107.849 132.829 -18,8
Estimación del precio promedio ponderado FOB:
Zona Centro 80.086 108.021 -25,9
Fuente: Servicio Geológico Colombiano, DIAN-DANE, cálculos UPME. REGIÓN TONELADAS FOB DÓLARES US$/t
Norte de Santander 305,00 75.145,20 246,38
Carbón Metalúrgico Zona Centro 279,40 99.188,67 355,01
Para el carbón metalúrgico, se utilizó la información disponible de comercio exterior Total 584,40 174.333,87
del DANE, para el periodo octubre de 2011 a marzo de 2012 para la partida arancelaria Fuente DIAN –DANE.
2701120090 - Carbón metalúrgico / Las demás hullas bituminosas, la cual determina un Con base en la información del DANE para el periodo octubre de 2011 marzo de 2012,
volumen de exportaciones para el semestre de 938.926 toneladas. se calculó el precio promedio ponderado FOB en puertos colombianos indicativo para el
EXPORTACIONES DE METALÚRGICO carbón antracita de exportación.
MES TONELADAS PARTICIPACIÓN % 2. Determinación del precio en boca mina
OCTUBRE 222.170 23,7 Una vez estimado el precio promedio ponderado FOB en puertos colombianos, se
NOVIEMBRE 171.996 18,3 procedió a calcular el precio en boca de mina siguiendo la metodología de deducción de
DICIEMBRE 40.219 4,3 los costos de transporte, manejo y portuarios.
ENERO 184.360 19,6
Región US$ / Tonelada Deducibles US$/t PRCk $/t
FEBRERO 187.163 19,9
Norte de Santander 298,31 51,34 246,97
MARZO 133.019 14,2
Zona Centro 298,31 62,12 236,20
TOTAL 938.926 100,0
Fuente DIAN –DANE, Ministerio Transporte. Cálculos UPME.
Fuente DIAN–DANE.
A estos costos se les aplica la tasa representativa del mercado correspondiente al período
El origen de estas exportaciones corresponde a: de análisis ($1.860,99) para llegar al precio en boca de mina en pesos colombianos.
REGIÓN TONELADAS FOB DÓLARES US$/t Región PRCk US/t TRM PRCk $/t
Norte de Santander 100.533,29 12.672.031,52 126,05 Norte de Santander 246,97 1.860,99 459.618
Zona Centro 838.393,10 166.789.942,42 198,94 Zona Centro 236,20 1.860,99 439.560
TOTAL 938.926,39 179.461.973,94
Fuente DIAN –DANE, Banrep. Cálculos UPME.
Fuente DIAN –DANE.
Variación del precio en boca mina propuesto para Antracita versus precio de la Reso-
Se realizó el siguiente análisis de la información: lución 0141 de 29 de marzo de 2012.
1. Estimación del precio promedio ponderado FOB: Precio Resol. Precio Resol. 0141
Región Variación %
Propuesta $ de 29-03-2012 $
TONELADAS % PRECIO US$/t
Norte de Santander 459.618,19 513.808,00 -10,55
Norte de Santander 10,71 126,05 13,50
Zona Centro 439.560,10 497.609,00 -11,67
Zona Centro 89,29 198,94 177,64
PROMEDIO PONDERADO 191,14 Fuente: SIMCO, Banco de la República, DIAN-DANE, cálculos UPME.

Fuente DIAN–DANE. De esta forma determinamos que los precios de carbón metalúrgico y carbón antracita
según la información suministrada por DIAN-DANE. Las consideraciones respecto a la
Con base en la información de DIAN - DANE para el periodo octubre 2011 a marzo variación del precio en boca de mina para el carbón apuntan a un precio FOB relativamente
de 2012, se calculó el precio promedio ponderado FOB en puertos colombianos indicativo estable, devaluación del tipo de cambio y a la calidad de los carbones de La Guajira y Cesar
para el carbón metalúrgico de exportación. en el caso de carbón térmico.
2. Determinación del precio en boca de mina LOS DEMÁS MINERALES
Una vez estimado el precio promedio ponderado FOB en puertos colombianos, se Dado que la UPME realizará el estudio denominado “Estudio para el establecimiento
procedió a calcular el precio en boca de mina siguiendo la metodología de deducción de de los precios de los minerales en boca de mina y cálculo de los costos unitarios de pro-
los costos de transporte, manejo y portuarios. ducción asociados a la industria minera”. Se procederá a validar la información y actualizar
los precios base de los minerales en el 2012.
Región US$ / Tonelada Deducibles US$/t PRCk US$/t
Norte de Santander 191,14 51,34 139,80 Unidad de Precio en Boca de Mina $/
MINERAL
Zona Centro 191,14 62,12 129,02 medida Unidad Res III Trim. 2012

Fuente DIAN –DANE. Arcillas Bentónicas t 14.204

A estos precios se les aplica la tasa representativa del mercado correspondiente al período Arcillas Caoliníticas t 24.048
de análisis para llegar al precio en boca de mina en pesos colombianos. Arcillas Cerámicas t 9.258

Región PRCk US/t TRM PRCk $/t Arcillas Ferruginosas t 5.132


Norte de Santander 139,80 1.860,99 260.162 Arcillas Misceláneas t 5.132
Zona Centro 129,02 1.860,99 240.104 Arcillas Refractarias t 9.000
Fuente DIAN –DANE, cálculos UPME.
Arena de Cantera m3 9.897
Variación del precio en boca de mina de la Resolución 0141 de marzo 29 de 2012 y Arena de río (Arenas lavadas) m3 5.693
precio para carbón metalúrgico es:
Arenas Silíceas t 12.328
Región Precio Resol. Propuesta $ Precio Resol. 0141 Variación %
Asbesto (o Crisolito) t 13.652
de 29-03-2012 $
Norte de Santander 260.161,89 281.911,00 -7,71 Asfaltita m3 24.177
Zona Centro 240.103,80 265.713,00 -9,64 Azufre t 11.127
Fuente DANE, Banrep, Sociedades Portuarias, cálculos UPME. Barita t 141.245
Antracita Basalto t 6.161
De la misma manera, el precio base de liquidación para la antracita de exportación se Bauxita t 23.421
determinó con base en los datos de comercio exterior del DANE, para la partida 2701110000 Carbonato de Calcio t 47.459
- Carbón antracita en bruto / Antracitas, para el período octubre de 2011 marzo de 2012.
Caliza t 12.720
Las exportaciones de carbón antracita en bruto fueron del orden de 584 toneladas con
Cuarzo t 13.814
un valor FOB Dólares de $US 174.334.
Cromo-Cromita t 16.965
Se realizó el siguiente análisis de la información del volumen exportado por mes:
Edición 48.475
34 DIARIO OFICIAL Jueves, 28 de junio de 2012

MINERAL
Unidad de Precio en Boca de Mina $/ Instituto Colombiano de Bienestar Familiar
medida Unidad Res III Trim. 2012
Grupo Jurídico - Regional Bogotá
Diabasa m3 7.795
Dolomita t 14.663 RESOLUCIONES
Feldespatos t 43.907
Fluorita t 132.460 RESOLUCIÓN NÚMERO 0972 DE 2012
*UD¿WR t 28.968 (junio 21)
Granito (bloque mayor o igual a 1 m3) m3 659.821 SRUODFXDOVHRWRUJDSHUVRQHUtDMXUtGLFD\DSUXHEDHVWDWXWRVDODHQWLGDGGHQRPLQD-
Granito (bloque menor a 1 m3) m3 329.572 GD)XQGDFLyQSRUXQD6RQULVD
Gravas de Cantera m3 11.346 El Profesional Universitario con funciones de Director ICBF Regional Bogotá, en
Gravas de río m3 6.577 uso de sus facultades legales y estatutarias y, en especial, las refrendadas en el parágrafo
del artículo 11 de la Ley 1098 del 2006 “Código de la Infancia y la Adolescencia”,
Mármol (bloque mayor o igual a 1 m3) m3 144.496
Decreto 276 de 1988, Decreto 2388 de 1979, Decreto 1422 de 1996, y la Resolución
Mármol (bloque menor a 1 m3) m3 47.363 Q~PHURGHSRUODFXDOVHPRGL¿FDQODV5HVROXFLRQHVQ~PHURGHOGH
Mármol en rajón ( Retal de mármol) t 17.965 febrero de 1988, 0615 del 12 de abril de 1988 y 3899 de 8 de septiembre de 2010, que
Micas:Vermiculita,Moscovita, Biotita t 43.823 versan sobre la función de otorgar y reconocer las personerías jurídicas a las institucio-
Mineral de Hierro t 24.509 nes de utilidad común que presten el servicio de Bienestar Familiar, y demás normas
pertinentes emanadas del Instituto Colombiano de Bienestar Familiar,+
Mineral de Magnesio (Magnesita) t 114.543
CONSIDERA:
Mineral de Manganeso t 206.177
Primero. Que las normas orgánicas del ICBF regulan expresamente en forma
Piedra Arenisca-Piedra Bogotana m3 174.650
HVSHFt¿FDODFUHDFLyQ\IXQFLRQDPLHQWRGHODVLQVWLWXFLRQHVGHO6LVWHPD1DFLRQDOGH
Puzolanas t 9.700 %LHQHVWDU)DPLOLDU\TXHODVPLVPDVOHFRQ¿HUHQFRPSHWHQFLDOHJDOSDUDUHFRQRFHU
Recebo m3 7.195 otorgar, suspender y cancelar personerías jurídicas y licencias de funcionamiento a las
Roca Coralina (Bloque mayor o igual a 1 m3) m3 271.997 instituciones del Sistema, en su condición de entidad rectora del mismo.
Roca Coralina (bloque menor a 1 m3) m3 106.480 Segundo. Que por mandato expreso de la Ley 1098 de 2006, el Instituto Colom-
Roca Fosfórica t 88.040 biano de Bienestar Familiar, es el Ente Coordinador del Sistema Nacional de Bien-
estar Familiar y, en consecuencia, las instituciones del mismo, en su organización y
Sal Marina t 41.080
funcionamiento, deben dar cumplimiento estricto a las normas del Servicio Público
Sal Terrestre t 40.322 GH%LHQHVWDU)DPLOLDUGLFWDGDVSRUHO,&%)3RUHVWDUD]yQDO,QVWLWXWRVHOHFRQ¿ULy
Sal Terrestre Zona Upín t 31.497 la competencia de ³5HFRQRFHU2WRUJDUVXVSHQGHU\FDQFHODUSHUVRQHUtDVMXUtGLFDV\
Serpentina (Bloque mayor o igual a 1 m3) m3 373.997 OLFHQFLDVGHIXQFLRQDPLHQWRDODV,QVWLWXFLRQHVGHO6LVWHPD´
Serpentina (bloque menor a 1 m3) m3 173.776 Tercero. Que las instituciones vinculadas, a los organismos, Instituciones, Entidades
Serpentina en Rajón t 54.581
y agencias de carácter privado sin ánimo de lucro que cumplan actividades relaciona-
das con la protección preventiva y especial del menor, la garantía de sus derechos y
Serpentinita (Silicato de Magnesio) t 21.910
la realización e integración armónica de la familiar se consideran propias del Sistema
Talco t 88.464 Nacional de Bienestar Familiar.
Travertino y Calizas Cristalinas en bloque mayor o igual
m3 415.931 Cuarto. Que la Señora Liliana Sevilla García, LGHQWL¿FDGDFRQFpGXODGHFLXGDGDQtD
a 1 m3
número 51735360 de Bogotá, actuando en calidad de Representante Legal, Solicitó
Travertino y Calizas Cristalinas en bloque menor a 1 m3 m3 132.220 PHGLDQWHHO2¿FLR5DGQ~PHURGHDEULOGHRWRUJDPLHQWRGHSHUVRQHUtD
Yeso t 42.930 jurídica y aprobación de estatutos de la entidad denominada Fundación por una Sonrisa,
(C. F.). constituida mediante Acta número 01 celebrada el 10 de febrero de 2012.
Quinto. Que de acuerdo al acta de Asamblea General número 2 celebrada el 26 de
ESTABLECIMIENTOS PÚBLICOS marzo de 2012 se aprueban los estatutos de la Fundación por una Sonrisa.
Sexto. Que examinando cuidadosamente los estatutos, se reconoce la existencia de
actividades relacionadas con la protección preventiva y especial del menor, la garantía
Instituto Geográfico Agustín Codazzi y protección de sus derechos consideradas propias del Sistema Nacional de Bienestar
Familiar, observándose que se ajustan a la Constitución Política y a la ley y no contra-
RESOLUCIONES vienen el orden público, la moral y las buenas costumbres.
Séptimo. Que con fecha 20 de junio de 2012, el Coordinador Grupo Jurídico de la
RESOLUCIÓN NÚMERO 52-000-026-2012 DE 2012 Regional Bogotá, emitió concepto favorable para la aprobación del reconocimiento de
(junio 25) personería jurídica solicitado, por cumplirse los requisitos legales especialmente los
SRUODFXDOVHRUGHQDODIRUPDFLyQ\RDFWXDOL]DFLyQFDWDVWUDOGHOD]RQDXUEDQD señalados por la Resolución 3899 de septiembre 8 de 2010, emanada por parte de la
\UXUDOGHOPXQLFLSLRGH3DVWRGHSDUWDPHQWRGH1DULxR Dirección General del Instituto Colombiano de Bienestar Familiar.
(O'LUHFWRUGHO,QVWLWXWR*HRJUi¿FR³$JXVWtQ&RGD]]L´7HUULWRULDOGH1DULxRHQXVRGH Que, en consideración a los expuestos, esta Dirección Regional.
VXVDWULEXFLRQHVOHJDOHVHQHVSHFLDOGHODVTXHOHFRQ¿HUHHODUWtFXORGHOD5HVROXFLyQ RESUELVE:
Q~PHURGHGHO,QVWLWXWR*HRJUi¿FR³$JXVWtQ&RGD]]L´ Artículo 1°. Otorgar personería jurídica y aprobar estatutos a la entidad denominada
RESUELVE: Fundación por una Sonrisa, como una entidad sin ánimo de lucro Vinculada al Sistema
Artículo 1°. Ordenar la formación y/o actualización catastral de la zona urbana y rural Nacional de Bienestar Familiar, domiciliada en la ciudad de Bogotá, con Dirección
del municipio de Pasto en el departamento de Nariño, de acuerdo a las normas y procedi- Cra. 31 N° 1 G - 41 Piso 2, Barrio Asunción.
mientos ordenados por la Ley 14 de 1983, su Decreto Reglamentario número 3496 de 1983, Artículo 2°. Inscribir como Representante Legal de la Fundación por una Sonrisa, a
Resolución número 070 de 2011 y demás disposiciones vigentes. la señora Liliana Sevilla García, LGHQWL¿FDGDFRQFpGXODGHFLXGDGDQtDQ~PHUR
Artículo 2°. Copia de la presente remítase a la Imprenta Nacional de Colombia para de Bogotá, de acuerdo al Acta de Constitución celebrada el 10 de febrero de 2012.
efectos de su publicación en el 'LDULR2¿FLDO, de conformidad a lo establecido en la Ley Artículo 3°. A partir de la ejecutoria de la presente resolución la Fundación por
489 del 29 de diciembre de 1998. una Sonrisa podrá prestar los servicios de protección, previo trámite y obtención de
Publíquese y cúmplase. la licencia de funcionamiento ante el Grupo Jurídico de la regional, donde aspire a
desarrollar los programas.
Dada en Pasto, a 25 de junio de 2012.
$UWtFXORƒ1RWL¿FDUSHUVRQDOPHQWHODSUHVHQWHUHVROXFLyQGHODHQWLGDGDWUDYpV
El Director Territorial,
de su Representante Legal o su apoderado, dentro de los cinco (5) días siguientes a su
eGJDU5REHUWR0RUD*yPH] ([SHGLFLyQ\VLQRVHSXGLHUHUHDOL]DUHQGLFKRWpUPLQRVH¿MDUiXQHGLFWRHQOXJDU
Imprenta Nacional de Colombia. Recibo Banco Agrario de Colombia 0838603. público del Grupo Jurídico de esta Regional por el término de diez (10) días, con la
26-V-2012. Valor $248.000. inserción de la parte resolutiva de esta providencia.
Edición 48.475
Jueves, 28 de junio de 2012 DIARIO OFICIAL 35
Artículo 5°. Contra el presente acto administrativo procede el recurso de repo- En mérito de lo expuesto,
sición ante el Director Regional del ICBF el cual se deberá interponer por escrito RESUELVE
DOPRPHQWRGHVXQRWL¿FDFLyQSHUVRQDORGHQWURGHORVFLQFR  GtDVVLJXLHQWHVD Artículo 1°. Otorgar por el término de seis (6) meses que dura la comisión de
HOODRDODGHV¿MDFLyQGHOHGLFWRFRPRORHVWDEOHFHHODUWtFXORGHO'HFUHWR servicios concedida mediante Resolución número 2-1492 de fecha 11 de mayo de
de 1984 y, en todo, caso con sujeción a los requisitos establecidos en el artículo 52 2012 proferida por la Secretaría General de la Fiscalía General de la Nación, al doctor
del citado decreto. +HUEHUW0HUFKiQ3XOLGRLGHQWL¿FDGRFRQODFpGXODGHFLXGDGDQtDQ~PHUR
Artículo 6°. De conformidad con lo establecido por el artículo 11 de la Resolución Profesional Universitario III de la Unidad Nacional de Derechos Humanos y Dere-
3899 de 2010, expedida por el Instituto Colombiano de Bienestar Familiar, impone el cho Internacional Humanitario en encargo, para apoyar las Indagaciones, en aras de
deber de acreditar la publicación en el 'LDULR2¿FLDOdel presente acto administrativo. desarrollar cabalmente los programas metodológicos realizados y dadas las calidades
profesionales, el conocimiento y manejo del tema por parte del doctor Merchán Pulido,
Notifíquese y cúmplase. Investigaciones asignadas por reparto números:
Dada en Bogotá, D. C., a 21 de junio de 2012. 110016000049201106588, 110016000049201103318, 110016000049201001878,
El Profesional Universitario con funciones de Director ICBF Regional Bogotá, 110016000049201109798, 110016000049201007381, 110016000049201006947,
110016000049201106699, 110016000049201103285, 110016000049201109797
Edgard Ricardo Lombo Bastidas.
\FRQIXQGDPHQWRHQHO2¿FLRQ~PHUR
Imprenta Nacional de Colombia. Recibo 21201115. 28-VI-2012. Valor $48.200. 412 suscrito por el Fiscal Jefe Unidad de la Unidad Nacional de Anticorrupción.
Artículo 2°. La función de policía judicial que se otorga se cumplirá con estricto
V A R I O S
apego a lo dispuesto por el artículo 205 de la Ley 906 de 2004, y quedará facultado
para realizar las siguientes diligencias, entre otras: i) Recibir denuncias, querellas
Fiscalía General de la Nación RLQIRUPHVGHRWUDFODVHGHORVFXDOHVVHLQ¿HUDODSRVLEOHFRPLVLyQGHXQGHOLWR
LL 5HDOL]DUHQWUHYLVWDVLLL 6HUFLWDGRVFRPRWHVWLJRVGXUDQWHHOMXLFLRRUDOGHFRQ-
IRUPLGDGFRQORVHxDODGRHQHODUWtFXORGHOD/H\GHLY 2EWHQHUORV
RESOLUCIONES documentos que requiera el Fiscal superior inmediato, a efectos de realizar la inves-
WLJDFLyQ\VROLFLWDUSUXHEDVGXUDQWHHOMXLFLRY 5HFLELU,QWHUURJDWRULRD,QGLFLDGR
RESOLUCIÓN NÚMERO 0 0943 DE 2012 Para tales efectos deberá acatar las reglas técnicas pertinentes y someter los escritos,
(junio 25) grabaciones o archivos a cadena de custodia, de conformidad con las normas vigentes
y el Manual de Policía Judicial.
SRUPHGLRGHODFXDOVHRWRUJDIXQFLRQHVWUDQVLWRULDVGH3ROLFtD-XGLFLDODXQFDUJRGH
3URIHVLRQDO8QLYHUVLWDULR,,,GHOD8QLGDG1DFLRQDOGH'HUHFKRV+XPDQRV\'HUHFKR Parágrafo. El servidor mencionado no está facultado para realizar actos de inves-
tigación de
,QWHUQDFLRQDO+XPDQLWDULRGHOD)LVFDOtD*HQHUDOGHOD1DFLyQHQHQFDUJRPHGLDQWH
5HVROXFLyQQ~PHURGHOGHRFWXEUHGH campo, ni de estudios y análisis de laboratorio.
El Fiscal General de la Nación, en ejercicio de sus facultades constitucionales y Artículo 3°. La presente función transitoria de Policía Judicial al servidor Merchán
Pulido, se concede por el término que dura la Comisión de Servicios, es decir por seis
legales, en especial las conferidas por el artículo 251-5, de la Constitución Política
(6) meses conforme a la Resolución número 2-1492 de fecha 11 de mayo de 2012.
GH&RORPELDPRGL¿FDGRSRUHODUWtFXORƒGHO$FWR/HJLVODWLYRQ~PHURGH
el artículo 203 de la Ley 906 de 2004 y el numeral 6 del artículo 11 de la Ley 938 Artículo 4°. Comunicar la presente resolución a través de la Secretaría General, al
de 2004, y 9LFH¿VFDO*HQHUDOGHOD1DFLyQ'LUHFFLyQ1DFLRQDOGH)LVFDOtDV'LUHFFLyQ1DFLRQDO
del Cuerpo Técnico de Investigación, a la Dirección de la Escuela de Estudios e In-
CONSIDERANDO: vestigaciones Criminalísticas y Ciencias Forenses de la Fiscalía General de la Nación,
Que la Policía Judicial es entendida como la función que cumplen las entidades SDUDORV¿QHVTXHVHDQGHVXFRPSHWHQFLD
del Estado para apoyar la investigación penal, y en el ejercicio de la misma dependen Artículo 5°. La presente resolución rige a partir de la fecha de su expedición.
IXQFLRQDOPHQWHGHO)LVFDO*HQHUDOGHOD1DFLyQ\VXVGHOHJDGRV Publíquese, comuníquese y cúmplase.
4XHSRUGLVSRVLFLyQGHODUWtFXORGHOD&RQVWLWXFLyQ3ROtWLFDPRGL¿FDGR Dada en Bogotá, D. C., a 25 de junio de 2012.
por el artículo 3° del Acto Legislativo número 03 de 2002, el Fiscal General de
El Fiscal General de la Nación,
la Nación se encuentra facultado para otorgar atribuciones transitorias de Policía
-XGLFLDODHQWHVS~EOLFRV Eduardo Montealegre Lynett.
(C. F.).
Que en virtud de lo dispuesto por el artículo 203 de la Ley 906 de 2004, ejer-
cen funciones de Policía Judicial, de manera transitoria los entes públicos que
por resolución del Fiscal General de la Nación, hayan sido autorizados para ello,
quienes deberán actuar conforme con las autorizaciones otorgadas y en los asuntos
VHxDODGRVHQHOUHVSHFWLYRDFWRDGPLQLVWUDWLYR
Que con base en lo establecido en el artículo 11-6 de la Ley 938 de 2004 el Fiscal
General de la Nación está facultado para expedir las resoluciones de que trata el artículo
GHO&yGLJRGH3URFHGLPLHQWR3HQDO
4XHPHGLDQWH2¿FLRQ~PHURGHIHFKDƒGHMXQLRGH
Haga sus
solicitudes
el doctor Mario Montes Giraldo, Fiscal Jefe Unidad de la Unidad Nacional de
Anticorrupción, solicita asignar funciones de Policía Judicial al doctor Herbert
0HUFKiQ3XOLGRLGHQWL¿FDGRFRQODFpGXODGHFLXGDGDQtDQ~PHUR3UR-
fesional Universitario III de la Unidad Nacional de Derechos Humanos y Derecho
Internacional Humanitario en encargo, adscrito en comisión de servicios en la

vía e-mail
mencionada Unidad, mediante Resolución número 2-1492 de fecha 11 de mayo
de 2012, por el término de seis (6) meses, con el propósito de apoyar de la mejor
manera las Indagaciones que se adelantan con ocasión a la creación al interior de
la Unidad Nacional Anticorrupción una Subunidad para el tema Pensión, Ayuda
+XPDQLWDULD\6DOXG±3$6
Que sustenta su solicitud mediante Resoluciones números 1-0001 del 13 de abril
de 2012 y 0-0714 de 20 de abril de 2012, en las que se le asignaron especialmente
al Fiscal Delegado adscrito a la Subunidad para el tema Pensión, Ayuda Humani-
taria y Salud – PAS, de la Unidad Nacional de Fiscalía Especializada en Delitos
contra la Administración Pública por reparto el conocimiento de las siguientes prof_mventas@imprenta.gov.co
investigaciones:
110016000049201106588, 110016000049201103318, 110016000049201001878,
110016000049201109798, 110016000049201007381, 110016000049201006947,
110016000049201106699, 110016000049201103285, 110016000049201109797 y
110016000049201106696.
Edición 48.475
36 DIARIO OFICIAL Jueves, 28 de junio de 2012

Autoridad Nacional de Televisión Artículo 2°. Ordenar la publicación de este acto administrativo, por una sola vez, en un
periódico de amplia circulación nacional.
RESOLUCIONES Artículo 3°. La presente resolución rige a partir de la fecha de su publicación.
Dada en Bogotá, D. C., a 27 de junio de 2012.
RESOLUCIÓN NÚMERO 037 DE 2012
Publíquese y cúmplase.
(junio 27)
SRUODFXDOVHSURUURJDHOWpUPLQRSUHYLVWRHQOD5HVROXFLyQGH La Directora,
La Autoridad Nacional de Televisión, en ejercicio de sus facultades legales y, en espe- 7DWLDQD$QGUHD5XELR/.
FLDOODVTXHOHFRQ¿HUHHOOLWHUDOD GHODUWtFXORž\ORVOLWHUDOHVD \F GHODUWtFXORƒGH
la Ley 1507 de 2012, y (C. F.).
CONSIDERANDO:
Que mediante Resolución ANTV número 005 del 14 de mayo de 2012, publicada en C O N T E N I D O
el 'LDULR2¿FLDO número 48.432 del 16 de mayo de 2012, se suspendieron las actuaciones
administrativas, y de los procesos de jurisdicción coactiva que se encontraba adelantando
la Comisión Nacional de Televisión con anterioridad al diez (10) de abril del año en curso, MINISTERIO DE AMBIENTE Y DESARROLLO SOSTENIBLE Págs.
y en relación con las cuales ha operado, en favor de la Autoridad Nacional de Televisión Resolución número 0949 de 2012, por la cual se sustrae temporalmente un área de la
$179 ODVXVWLWXFLyQDGPLQLVWUDWLYDDTXHVHUH¿HUHHODUWtFXORGHOD/H\GH Reserva Forestal del Río Magdalena establecida mediante Ley 2ª de 1959 y se toman
2012, por 30 días hábiles prorrogables por un término igual, previo acto administrativo. otras determinaciones. ................................................................................................ 1
Que la resolución en mención se motivó en el hecho del cambio de autoridad admi-
nistrativa competente para conocer de las actuaciones administrativas que se encontraba Resolución número 0955 de 2012, por la cual se adopta el Formato con su respectivo
adelantando la Comisión Nacional de Televisión (hoy en liquidación), con anterioridad al instructivo para el Registro de Usuarios del Recurso Hídrico. .................................. 11
diez (10) de abril del año en curso. DEPARTAMENTO NACIONAL DE PLANEACIÓN
Que teniendo en cuenta que las labores citadas anteriormente no han culminado, se hace Resolución número 1332 de 2012, SRU OD FXDO VH PRGL¿FDQ ORV DUWtFXORV ƒ \ ƒ
conveniente ampliar el término de suspensión contenido en la Resolución 005 de 2012, a GH OD 5HVROXFLyQ Q~PHUR  GH  SRU OD FXDO VH GH¿QHQ ORV OLQHDPLHQWRV
partir de la fecha de vencimiento del término de suspensión previsto en dicha resolución, para el reporte de la información requerida para la evaluación del desempeño
es decir, por el término de 30 días hábiles. integral de las entidades territoriales. ......................................................................... 16
En mérito de lo expuesto,
Superintendencias
RESUELVE:
Superintendencia Nacional de Salud
Artículo 1°. Prorrogar el término de suspensión previsto en la Resolución ANTV número
005 de 2012, de las actuaciones administrativas, y de los procesos de jurisdicción coactiva Resolución número 000477 de 2012, por medio de la cual se prorroga el término de
que se encontraba adelantando la Comisión Nacional de Televisión con anterioridad al la toma de posesión inmediata de los bienes, haberes y negocios y la intervención
diez (10) de abril del año en curso, y en relación con las cuales ha operado, en favor de la forzosa administrativa para administrar la Empresa Mutual para el Desarrollo
$XWRULGDG1DFLRQDOGH7HOHYLVLyQ $179 ODVXVWLWXFLyQDGPLQLVWUDWLYDDTXHVHUH¿HUHHO de la Salud E.S.S. “Emdisalud”, con NIT 811.004.055-5. ......................................... 16
artículo 21 de la Ley 1507 de 2012, por 30 días hábiles.
Resolución número 001776 de 2012, por la cual se prorroga el término de la Reapertura
Exclúyanse de la presente suspensión, aquellas actuaciones administrativas originadas del proceso intervención forzosa administrativa para administrar la Empresa Social
con ocasión de las prórrogas de los contratos de concesión de los operadores de televisión del Estado Hospital Local de Puerto Colombia-Atlántico. ........................................ 20
por suscripción modalidad de cable, así como también los trámites administrativos que
subsisten en relación con la auditoría ejecutada actualmente por el Consorcio BDO-ASITEC 1RWL¿FDFLyQSRUDYLVR. /D6XSHULQWHQGHQFLD1DFLRQDOGH6DOXGVHSHUPLWHQRWL¿FDUDO
a tales operadores. doctor Fabio Ramírez en calidad de investigado a título personal, el contenido de la
En caso de que la ANTV considere que puede reactivar algunas actuaciones adminis- Resolución número 4-2010-002587 del 24 de septiembre de 2010. ......................... 22
trativas, así lo dispondrá en cada caso y comunicará tal decisión a quienes hagan parte o Superintendencia de Servicios Públicos Domiciliarios
hubiesen sido reconocidos como terceros interesados en la respectiva actuación.
Resolución número SSPD-20121300017645 de 2012, por la cual se modifi-

D
can, aclaran y adicionan algunas disposiciones de la Resolución número

iario Oficial
\VXVUHVROXFLRQHVPRGL¿FDWRULDV ................................................. 22
Resolución número SSPD – 20121300018545 de 2012, por la cual se estable-
ce el formato para reporte de información de usuarios industriales exentos
NACIONAL
IMPRENTA

D E C O L O M B I A
Cupón de Suscripción de contribución de acuerdo con lo establecido en el artículo 1° del Decreto
4956 de 2011, para el servicio de Gas Natural. .......................................................... 28
Nombre o razón social: UNIDADES ADMINISTRATIVAS ESPECIALES
Apellidos: Unidad de Planeación Minero-Energética
C.C. o NIT. No.: Resolución número 0309 de 2012, por la cual se determinan los precios base
Dirección envío: de los minerales para la liquidación de regalías. ....................................................... 29
Teléfono: Fecha: ESTABLECIMIENTOS PÚBLICOS
Ciudad: ,QVWLWXWR*HRJUi¿FR$JXVWtQ&RGD]]L
Departamento:
Resolución número 52-000-026-2012 de 2012, por la cual se ordena la formación y/o
/RVSDJRVSRGUiQHIHFWXDUVHDVt'DYLYLHQGDFXHQWDGHDKRUURVQ~PHUR actualización catastral de la zona urbana y rural del municipio de Pasto, departamento
Banco Agrario cuenta número 3192000339-4, a favor de la Imprenta Nacional de de Nariño. ................................................................................................................... 34
Colombia,HQHOIRUPDWRLQGLFDGRSDUDWDO¿QTXHVHHQFXHQWUDGLVSRQLEOHHQORV
Instituto Colombiano de Bienestar Familiar
bancos mencionados. Grupo Jurídico - Regional Bogotá
Tarjeta de Crédito: Resolución número 0972 de 2012, por la cual se otorga personería jurídica y aprueba
Visa estatutos a la entidad denominada Fundación por una Sonrisa. ................................. 34
VAR I O S
Suscripción nueva Renovación
Fiscalía General de la Nación
Sí No Sí No Resolución número 0 0943 de 2012, por medio de la cual se otorga funciones transitorias
Valor suscripción anual: $180.100.00 - Bogotá, D. C. de Policía Judicial a un cargo de Profesional Universitario III de la Unidad Nacional
$180.100.00 - Otras ciudades, más los portes de correo de Derechos Humanos y Derecho Internacional Humanitario de la Fiscalía General
Suscripción electrónica nacional: $180.100.00 de la Nación en encargo mediante Resolución número 2-3325 del 25 de octubre
Suscripción electrónica internacional: $263.600.00
de 2011. ...................................................................................................................... 35
Autoridad Nacional de Televisión
Suscripción Anual
En caso de consignación, favor remitirla vía fax al 4578034 adjuntando este cupón. Para mayor información, Resolución número 037 de 2012, por la cual se prorroga el término previsto en la
dirigirse a la carrera 66 No 24-09 (Av. Esperanza con Av. 68), Imprenta Nacional de Colombia-
Grupo de Promoción y Divulgación, o comunicarse con nuestra línea de Servicio al Cliente: 4578044. Resolución 005 de 2012. ............................................................................................ 36
IMPRENTA NACIONAL DE COLOMBIA - 2012