Está en la página 1de 18

Acta Bioquímica Clínica Latinoamericana

ISSN: 0325-2957
actabioq@fbpba.org.ar
Federación Bioquímica de la Provincia de
Buenos Aires
Argentina

de Roodt, Adolfo Rafael


Veneno de escorpiones (alacranes) y envenenamiento
Acta Bioquímica Clínica Latinoamericana, vol. 49, núm. 1, 2015, pp. 55-71
Federación Bioquímica de la Provincia de Buenos Aires
Buenos Aires, Argentina

Disponible en: http://www.redalyc.org/articulo.oa?id=53541285007

Cómo citar el artículo


Número completo
Sistema de Información Científica
Más información del artículo Red de Revistas Científicas de América Latina, el Caribe, España y Portugal
Página de la revista en redalyc.org Proyecto académico sin fines de lucro, desarrollado bajo la iniciativa de acceso abierto

Toxicología Actualización

Reconocimiento a la trayectoria del Prof. Dr. José Alberto Castro

Veneno de escorpiones (alacranes)


y envenenamiento
Scorpion (alacran) venom and envenomation
Veneno de escorpião (alacran) e envenenamento
`` Adolfo Rafael de Roodt1a

1 Médico Veterinario, Magister en Ciencias y Resumen


Doctor de la Universidad de Buenos Aires). En las últimas décadas en Argentina se han incrementado de forma muy im-
a Dirección Nacional de Determinantes de la
portante las notificaciones por picadura de escorpiones y de muertes debido
Salud e Investigación, Ministerio de Salud de a éstas. En el período 1993-1999 se comunicaron 3 muertes y en el período
la Nación, Av. 9 de Julio 1925, Piso 1, CP 2000-2006 se registraron 19, haciendo que el envenenamiento por estos
C1073ABA, CABA. arácnidos se haya transformado en uno de los emponzoñamientos de mayor
Cátedra de Toxicología 1, Facultad de Medici-
impacto sanitario en Argentina. En esta breve revisión se describen algunos
na de la Universidad de Buenos Aires, Para-
de los mecanismos tóxicos conocidos y propuestos para el envenenamiento
guay 2155, Piso 8, CP1121ABG, CABA.
por escorpiones, así como algunos de los componentes conocidos del veneno
de Tityus trivittatus, el escorpión de mayor importancia médica de Argentina.
Palabras clave: escorpiones * toxinas * Tityus * envenenamiento * veneno

Summary
In the last decades the number of notifications by scorpion stings and deaths
by scorpion envenoming increased very significantly in Argentina. In the period
1993-1999 three deaths were reported while in the period 2000-2006, nine-
teen deaths were registered, turning the envenomation by these arachnids in one
of the envenoming of highest sanitary impact in Argentina. In this brief revision
some of the known and proposed toxic mechanisms for scorpion envenomation
as well as some of the venom discovered components in the venom of Tityus tri-
vittatus the scorpion of highest medical importance in Argentina, are described.
Key words: scorpions * toxins * Tityus * envenomation * venom

Resumo
Nas últimas décadas na Argentina aumentaram de forma muito significativa no-
tificações de picadas de escorpião e de mortes devido a elas. No período 1993-
Acta Bioquímica Clínica Latinoamericana 1999 três mortes foram registradas e no período 2000-2006 foram 19, fazendo
com que o envenenamento por estes aracnídeos se tenha transformado num dos
Incorporada al Chemical Abstract Service.
envenenamento de maior impacto sanitário na Argentina. Nesta breve revisão são
Código bibliográfico: ABCLDL. descritos alguns dos mecanismos tóxicos conhecidos e propostos para o evenena-
ISSN 0325-2957 mento por escorpiões, bem como alguns dos componentes conhecidos do veneno
do Tityus trivittatus, o escorpião de mayor importância médica da Argentina.
ISSN 1851-6114 en línea
ISSN 1852-396X (CD-ROM) Palavras chave: escorpiões * toxinas * Tityus * envenamento * veneno

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


56 de Roodt AR

Introducción cranismo y los casos de muerte debido al envenenamiento


escorpiónico, en todos los casos por especies del género
En el mundo se comunican anualmente más de Tityus (T.), estando en especial involucrado T. trivittatus
1.200.000 accidentes por picadura de escorpiones con (Fig. 1) en primer lugar y T. confluens en menor medida
más de 3.250 muertes, lo que representaría una mortali- (5-8). En el período 1993-1999 se comunicaron 3 muer-
dad del 0,27% (1). tes (5), en el período 2000-2006, 19 muertes (6), mante-
Como muchos otros animales venenosos, estos arác- niéndose y aumentando hasta la actualidad los casos de
nidos han despertado la imaginación de artistas y reli- envenenamientos graves y manteniéndose una mortali-
giosos debido a características anatómicas, biológicas y dad importante (8-10). Por otro lado se han producido
fisiológicas, pero posiblemente y de forma principal, por accidentes de gravedad en zonas del país en donde el
la toxicidad que posee su veneno. Si bien las serpientes veneno de estos escorpiones no mostraba toxicidad, tal
son los representantes más “icónicos” y reconocidos entre como estaría sucediendo en la ciudad de Buenos Aires
estos grupos de animales venenosos en las civilizaciones (11). Todos estos factores hacen que el envenenamiento
occidentales judeo-cristianas, los arácnidos en general y por estos arácnidos se haya transformado en uno de los
los escorpiones en particular despertaron la imagina- emponzoñamientos de mayor impacto sanitario en Ar-
ción y admiración en otras civilizaciones como en las gentina (12). En esta breve revisión se comentan algunos
prehispánicas del actual México, la antigua de Egipto y de los mecanismos tóxicos conocidos y propuestos del en-
las culturas mesopotámicas y greco-romanas (2). venenamiento por escorpiones, así como el conocimiento
Estos arácnidos descienden de los euriptéridos, sus actual sobre los componentes del veneno de T. trivittatus.
ancestros marinos hace 300 millones de años y serían
los primeros animales que colonizaron la tierra desde
el ambiente marino (3). Su nombre es indistintamente Algunas características biológicas
escorpión (del latín, scorpio, onis) o alacrán (del árabe generales de los escorpiones
hispánico al´aqráb o del árabe clásico, aqrab).
Si bien sólo unos pocos escorpiones poseen impor- Zoológicamente los alacranes son artrópodos, quelice-
tancia médica, en ciertas regiones del mundo el enve- rados y arácnidos que pertenecen al orden Scorpionida.
nenamiento por alacranes ha sido (y en algunos casos Este orden posee varias familias, siendo aquella a la que
sigue siendo) una de las causas de muerte más impor- pertenecen casi la totalidad de los escorpiones de interés
tantes por animales venenosos y una de las causas más toxicológico en medicina humana, la familia Buthidae.
frecuentes de consulta toxicológica (4). De las 1500-2000 especies descritas de alacranes en el
En las últimas décadas en Argentina se han incremen- mundo, algo más de 30 especies son comprobadamente
tado de forma muy importante las notificaciones por ala- peligrosas para el ser humano y casi la totalidad pertene-

Figura 1. Ejemplar adulto de Tityus trivittatus. Obsérvese las tres líneas longitudinales en el dorso que le dan el nombre a la especie, los
pedipalpos (“pinzas”) largas y delicadas y en el último segmento abdominal en la estructura última denominada telson, en donde se encuentra
el acúleo (“aguijón”) puede observarse un tubérculo, la apófisis subaculear, típica de este género. En el recuadro de la esquina se muestra un
telson de Tityus y uno de un ejemplar de la famila Bothriuridae (sin importancia médica) en el que puede observarse la ausencia de la apófisis
subaculear). Con estos detalles puede diferenciarse a T. trivittatus de otros escorpiones. Esta apófisis está presente en todos los Tityus y puede
ser utilizada junto con los datos de coloración y tipo de pedipalpos como criterio de identificación para diferenciar Tityus de otros escorpiones
sin importancia médica en Argentina. Fotos del autor.

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


Veneno de escorpiones (alacranes) y envenenamiento 57

cen a esta familia. En América el 100% de los escorpiones lo que le facilita la supervivencia poblacional.
de importancia médica pertenecen a los géneros Centru- Los escorpiones pueden pasar largos períodos sin
roides desde Centroamérica a Norteamérica y Tityus desde agua y algunos resistirían más de un año sin comer. Se
Centroamérica a Sudamérica (13), ambos de la familia menciona que algunos resistirían temperaturas por de-
Buthidae. bajo del punto de congelación y pueden sobrevivir bajo
Los escorpiones habitan casi toda la superficie del el agua uno o dos días.
globo terrestre, con excepción de los casquetes pola-
res y las altas cumbres nevadas. Se los encuentra ma-
yormente en zonas tropicales y subtropicales, aunque Escorpiones de importancia médica
también se los puede encontrar en zonas áridas hasta en Argentina
desérticas y en zonas húmedas como cuevas y selvas.
Una característica importante de estos animales es La Familia Buthidae en Argentina está representada
que son vivíparos. La hembra pare sus crías, las que por tres géneros: Zabius, con dos especies, Ananteris con
emergen de sus aberturas genitales todavía envueltas una especie y Tityus actualmente con 7 especies, en la que
en membranas fetales. se encuentran aquellos con importancia médica (3). Las
Tienen costumbres muy sedentarias, suelen pasar especies de este género en Argentina son T. argentinus,
horas o días escondidos bajo troncos, piedras, ladrillos, T. uruguayensis, T. paraguayensis, T. bahiensis, T. confluens,
rocas, corteza de árboles. La mayoría son de hábitos T. trivittatus y recientemente se comunicó la presencia
nocturnos, y se estima que pasan el 92-97% de su vida de T. serrulatus en el NE (15) que es el escorpión de
en sus refugios. Sólo se movilizan para capturar alimen- mayor importancia médica en Brasil. Como se puede
tos y para reproducirse, si bien muchas especies tienen ver en la Figura 2, se los halla mayormente en el centro
potencial partenogenético, entre ellas T. trivittatus (14), y norte de Argentina.

Figura 2. Distribución de los ejemplares de escorpiones del género Tityus con mayor importancia sanitaria en la Argentina. Tt= T. trivittatus,
Tc= T. confluens, Tb= T. bahiensis, Ts= T. serrulatus.

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


58 de Roodt AR

Veneno de escorpiones fracción que contiene las neurotoxinas que bloquean


los canales de Na+, al ser analizada por HPLC exhibe
El veneno de los alacranes de importancia médica más de 70 diferentes péptidos (28). Esta abundancia en
(aquellos que pueden provocar envenenamientos en diferentes tipos de neurotoxinas le permite un mayor
humanos), afecta especialmente a los sistemas car- espectro de posibilidades para que el escorpión pueda
diovascular y pulmonar. Esta característica del enve- paralizar a su futuro alimento o potencial predador.
nenamiento escorpiónico era bien conocida en la an- Esta variabilidad se ve aumentada dado que estas toxi-
tigüedad. La diosa egipcia Serget, relacionada con el nas pueden fijarse específicamente no sólo a canales ió-
tratamiento y curación mágica de las picaduras por nicos sino a diferentes partes de los mismos (39-41). Un
serpientes y escorpiones, era conocida en el Egipto an- ejemplo grosero, pero bastante descriptivo, es relacio-
tiguo como Serquet-hetu “la que hace que la garganta nar esto a la caza con rifle o escopeta. La amplia varie-
respire”. Esto aludiría a los problemas que la picadura dad de péptidos neurotóxicos permite que al inyectar
de escorpión puede producir en el sistema respiratorio el alacrán su veneno, pueda tener una mayor probabi-
y por otro lado a que estos signos se pueden revertir (2). lidad de paralizar a las posibles presas o agresores. De
Sus venenos son de interés no sólo para las ciencias la misma manera que la perdigonada de una escope-
médicas. Sus componentes se utilizan como sondas ta abarca un área mayor a la del disparo de un rifle,
para estudios neurofisiológicos, como así también para la variedad de péptidos neurotóxicos también abarca
la obtención de compuestos de actividad insecticida. mayor cantidad de receptores a bloquear o modular, lo
Algunos componentes de estos venenos se han expre- que aumenta la probabilidad de paralizar al agresor o
sado en determinados virus y hongos que afectan a de- presa. Si tuvieran sólo un tipo de péptido neurotóxico,
terminados artrópodos considerados plagas, a fin de por mayor toxicidad que este tuviere, la probabilidad
aumentar su virulencia y poder plaguicida y aún se han de actuar estaría limitada solamente a las especies que
expresado en vegetales para poder proteger cosechas poseyesen un tipo determinado de estructura de canal
de plagas sensibles (16-26). iónico correspondiente a ese péptido neurotóxico.
Estos motivos tornan a los venenos de escorpiones Las neurotoxinas de los venenos de escorpiones pue-
interesantes para la ciencia biomédica y la biotecnolo- den reconocer al menos a canales iónicos de artrópo-
gía. En Argentina las muertes registradas y el aumento dos, crustáceos o mamíferos. Son excelentes modelos
de notificaciones de accidentes, tornaron al estudio de para los estudios de la relación de estructura y función
estos venenos ya no sólo un tema de interés académico de proteínas, debido a que a la vez son sondas excelen-
sino en una necesidad sanitaria. tes para el estudio del funcionamiento de canales ióni-
cos en diferentes tejidos.
Hasta el presente se han identificado más de cien
CARACTERÍSTICAS DEL VENENO DE ESCORPIONES
clases diferentes de canales iónicos en las distintas célu-
Los escorpiones usan al veneno para paralizar a sus las. Estos pueden existir aisladamente o constituir parte
presas cuando el tamaño de estas lo requiere y even- de estructuras más complejas. La cantidad de canales
tualmente para defenderse de predadores o agresores. iónicos depende del tipo de célula y especies estudia-
Contienen una variedad de compuestos biológicamen- das. Por ejemplo, en 1 µm2 de superficie de membra-
te activos como enzimas, nucleótidos, lípidos, muco- na de músculo esquelético hay un canal de K+, en la
proteínas, aminas biogénicas y péptidos, tóxicos para misma superficie en los axones amielínicos existen 110
muchos organismos como insectos, arácnidos e incluso canales de Na+ mientras que hay 10.000 canales de Na+
mamíferos, incluyendo al hombre (27-29). Entre sus asociados al receptor de acetilcolina en la unión neu-
componentes se destacan los péptidos neurotóxicos romuscular. Esto explicaría al menos parcialmente, el
(27), si bien se han descripto también otros tipos de “tropismo” por el sistema nervioso autónomo de los ve-
componentes tóxicos como péptidos potenciadores de nenos escorpiónicos en los casos de emponzoñamiento
bradiquinina (30), toxinas de acción curarizante (31- natural y experimental, y los efectos sobre el músculo
32) y algunas enzimas y otros componentes tóxicos (33- esquelético observados en algunos casos.
38). Se ha sugerido que estas últimas poseen alguna El veneno es producido por glándulas que se en-
participación en los mecanismos de toxicidad, como cuentran tras el quinto segmento abdominal, denomi-
en las lesiones relacionadas con la pancreatitis (35). Sin nado telson. Las glándulas están rodeadas de una capa
embargo, el papel de estas en el cuadro de envenena- muscular que al contraerse permiten que el veneno
miento, con excepción de las relacionadas con algunos contenido en ellas sea inoculado mediante el “aguijón”
procesos que afectarían la hemostasia (36)(37), debe en el que termina el telson (Fig. 1).
investigarse más. La característica más singular del veneno de escor-
El veneno es una mezcla compuesta por gran can- piones es que su letalidad radica en la presencia de
tidad de péptidos básicos. Por ejemplo, al separar las toxinas dirigidas a sitios específicos modificando así el
fracciones del veneno Centruroides en Sephadex G-50, la comportamiento de los mecanismos de selección ióni-

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


Veneno de escorpiones (alacranes) y envenenamiento 59

ca imprescindibles para la fisiología celular. Todas estas puentes disulfuro (28) mientras que las que bloquean
toxinas producen una perturbación severa de los pro- los canales de K+ tienen 31-39 residuos de aminoácidos
cesos de excitación y conducción del impulso nervioso, y están estabilizadas por tres puentes disulfuro, aunque
además de alterar los procesos neuroquímicos al inducir se ha comunicado también que puede haber algunas
liberación desorganizada de neurotransmisores como la estabilizadas por cuatro puentes disulfuro y algunas de
acetilcolina, adrenalina y oxido nítrico (Fig. 3). mayor masa (43-45). Las toxinas que actúan sobre ca-
nales de Cl- (clorotoxina) poseen sólo 36 aminoácidos
pero están estabilizadas por cuatro puentes disulfuro
TOXINAS DE VENENOS DE ESCORPIONES
(29)(42). A pesar de la variación en su estructura pri-
Se conocen menos del 1% de los 100.000 péptidos maria hay un motivo estructural conservado entre estas
que se estima que existen en los venenos de escorpión. proteínas, a excepción de las toxinas que bloquean los
Puede especularse que con la selección natural co-evo- canales de Ca2+ (28).
lucionaron distintos tipos y subtipos de receptores (ca- Todas estas familias de péptidos poseen un core al-
nales iónicos) en varios grupos de animales, y al mismo tamente conservado formado por una a-hélice y tres
tiempo en los escorpiones evolucionaron los ligandos b-plegamientos, motivos estructurales mantenidos por
específicos (péptidos con actividad de toxinas) capaces dos pares de puentes disulfuro ubicados entre dos se-
de interferir con el funcionamiento normal de los ca- cuencias constantes Cys-X-X-X-Cys y Cys-X-X-X-Cys.
nales iónicos, y brindarle de esa forma a los escorpiones Una excepción a este patrón es una toxina excitatoria
una manera de paralizar a sus presas o de defenderse de de Buthotus judaicus, donde hay dos cortas a-hélices en
predadores (27-29)(42). lugar de una. En las toxinas específicas para canales de
Las toxinas de escorpiones afectan la permeabilidad Na+ dos regiones que protruyen, los loops B y J, están en-
a iones de células excitables y se han descripto cuatro tre algunos de los rasgos diferenciales más importantes
diferentes familias de toxinas que interactúan con los ca- entre las a y b neurotoxinas de escorpión (43), las que
nales iónicos: neurotoxinas moduladoras de canales de poseen diferentes mecanismos tóxicos de acción. Las
Na+, neurotoxinas bloqueadoras de canales de K+, neu- a-toxinas se unen al sitio 3 de los canales de Na+ en una
rotoxinas para canales de Cl- y neurotoxinas para canales forma voltaje dependiente, retardando o bloqueando
de Ca2+. Las más estudiadas hasta el presente son las que los mecanismos de inactivación de estos canales, y al
actúan sobre los canales de Na+ y los de K+ (41). mantenerlos abiertos prolongan los potenciales de ac-
Las toxinas que afectan los canales de Na+ poseen en- ción despolarizando los músculos y nervios. En contras-
tre 60-76 aminoácidos y están estabilizadas por cuatro te, las b-toxinas se unen al sitio 4 independientemente

Figura 3. Ratones inoculados con veneno de T. trivittatus de Argentina. Obsérvese la intensa sudoración producida por la estimulación
autonómica simpática de todos los animales y las posiciones ortopneicas en algunos de ellos, signo de dificultad respiratoria a causa del
comienzo del distress respiratorio. Foto del Autor.

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


60 de Roodt AR

del potencial de membrana, y afectan la activación del tener en casos específicos de alteraciones de canales o en
canal de Na+, determinando que se abran a potenciales casos en donde la conductibilidad o contractibilidad mio-
más negativos (39)(45). Inicialmente se pensaba que cárdica estén alteradas. Tal podría ser el caso de pacientes
las a-toxinas estaban presentes en los escorpiones del chagásicos, en el norte de nuestro país, donde también la
hemisferio norte y el viejo mundo, mientras que las b- fauna de escorpiones es más abundante (3). Este es un
toxinas estaban presentes en los sudamericanos; actual- tema que merecería ser estudiado.
mente se sabe que no es así sino que pueden hallarse Hasta el momento se han publicado sólo cuatro es-
los dos tipos de toxinas en sus venenos. tructuras de toxinas del veneno de T. trivittatus (Tabla I)
Diferencias en el extremo C terminal de las toxinas (Tabla II).
para canales de Na+ parecerían ser las responsables de la
especificidad de especie capaz de reconocer entre tejidos
TOXINAS DE TITYUS SPP. QUE AFECTAN LOS CANALES
de mamíferos y de insectos (28)(43). Se ha propuesto la
DE Na+
existencia de un macro-receptor funcional en el sitio 3
de los canales de Na+ de los insectos y mamíferos, donde Las toxinas que actúan sobre canales de Na+ son las
las α-toxinas homólogas se unen a varios sitios coinciden- principales responsables de la toxicidad en mamíferos
tes de receptores causando los efectos fisiológicos de las (28) (45). La mayoría de las toxinas de canales de Na+ es-
α-toxinas, pero con diferentes eficacias. Modelos tridi- tudiadas del veneno de Tityus son de especies de Brasil y
mensionales computarizados muestran que los residuos Venezuela (43). Se llamaba tityustoxina a las toxinas de
30-38 y 49-58 están entre las posiciones más probables Tityus que actuaban sobre canales de Na+, considerando
donde existe una diferencia consistente entre toxina de que eran un solo tipo de toxinas, pero actualmente se
insecto o de mamífero (45)(46). conoce que la originalmente llamada tityustoxina com-
Las toxinas que bloquean los canales de K+ son ver- prende un grupo de péptidos. Por ejemplo, las toxinas
daderos bloqueadores de canales iónicos, que se unen gamma (ó VII) y III-8 (ó II) son b-toxinas mientras que
a la faz extracelular del canal e impiden el pasaje de io- las toxinas IV-5 (ó IV) y la TsTX-V son a-toxinas.
nes. No se las considera toxicológicamente importantes En el veneno de T. trivittatus, el escorpión de mayor
para mamíferos, siendo las de importancia toxicológica importancia médica en la Argentina, se encontró una b-
las moduladoras de canales de Na+. Sin embargo, no se toxina, moduladora de canales de Na+, con una homolo-
puede descartar su participación en los eventos fiosio- gía estructural del 95% respecto a la toxina gamma de T.
patológicos del envenenamiento, si bien estos aspectos serrulatus (Ts1), el escorpión de mayor importancia médi-
no se conocen en profundidad. ca en Brasil. Esta toxina se nombró toxina Tt tipo-gamma
En este punto cabe mencionar que si bien el papel (en inglés: Ttgamma-like) (49). Esta es una b-toxina, que
de las neurotoxinas bloqueadoras de canales de K+ en
los envenenamientos no está totalmente clarificado, su Tabla I. Manifestaciones catecolaminérgicas (simpáticas) o colinér-
estudio es tema de interés por sus efectos insecticidas e gicas (parasimpáticas) que pueden observarse en los cuadros de
inclusive por su posible aplicación para estudios neurofi- envenenamiento sistémico por veneno de alacranes. Las manifesta-
siológicos, o incluso como potencialmente terapéuticos. ciones no necesariamente serán colinérgicas o adrenérgicas puras
Dentro de su utilidad para estudios neurofisiológicos sino que pueden manifestarse cuadros mixtos de estimulación sim-
uno de los temas que recientemente generaron mucho pática y parasimpática.
interés ha sido la capacidad de algunas de estas toxinas
Manifestaciones parasimpáticas Manifestaciones simpáticas
de combinarse con los canales que poseen la mutación
HERG, causante del síndrome del QT prolongado, que Diaforesis Ansiedad
reduce el flujo de la corriente en el miocardio prolon- Sialorrea Excitación psicomotriz
gando la fase de repolarización del corazón. Justamen- Rinorrea Sudoración
te individuos que poseen esta mutación en sus canales Hipersecreción pancreática Palidez cutánea
de K+ pueden sufrir accidentes cardíacos fatales a causa Náuseas, vómitos, diarreas Frialdad de extremidades
de esta característica particular que altera el proceso de Bradicardia sinusal Piloerección
repolarización miocárdica. Este síndrome es una enfer- Hipotensión arterial por Midriasis
medad familiar (frecuencia de 1/5.000) que se distingue vasodilatación
por la prolongación de la repolarización ventricular y la Broncoconstricción Taquipnea
aparición de síncopes y muerte súbita secundarios a ta- Broncorrea Taquicardia
quicardia ventricular polimorfa, principalmente en niños Parestesias Hipertensión arterial
y jóvenes, en los que sería la principal causa de muerte Priapismo Arritmias ventriculares
súbita (47). Varias toxinas de escorpión pueden pegarse Hipotensión esfinteriana Hipopotasemia
a estos canales (48). Esto independientemente de su inte- Hiperamilasemia Hiperglucemia
rés neurofisiológico, obliga a poner atención en el poten- Calambres y fasciculaciones Hiperlactacidemia
cial papel tóxico que las toxinas de canales de K+ podrían musculares

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


Veneno de escorpiones (alacranes) y envenenamiento 61

Tabla II. Toxinas aisladas y caracterizadas de T. trivittatus. Hasta la fecha se han descripto y publicado tres toxinas
bloqueadoras de canales de K+ (tipo butantoxina, Tt28, k-butitoxina-Tt2b) y una b-toxina moduladora de canales de
Na+ (Tt1g). (*) Solo se indican algunos de los canales en que fueron realizados los estudios neurofisiológicos.

Toxina Tipo de canal (*) Familia Tamaño Referencia


Tipo-butantoxina Shaker B K+ a-KTx 12.2 40 A. ác. Coronas et. al, 2003 (52)
Tt28 Kv1.3 a-KTx 20.1 29 A. ác. Abdel-Mottaleb et al. 2006 (53)
k-Butitoxina-Tt2b Shaker IR K+ – Kv1.2 a-KTx 20 28 A. ác. Saucedo et al. 2012 (54)
Tt1g (b-toxina) hNav1.3. hNav1.4 NaTx6 61 A. ác. Coronas et al., 2014 (49)

por su similitud con la Ts1, fue denominada Tt 1g (T. tri- sería importante para nosotros, los mamíferos, segura-
vittatus toxin 1 gamma-like). Esta es un péptido de 61 ami- mente sí son de utilidad para los escorpiones. También
noácidos estabilizado por cuatro puentes disulfuro, con del veneno de T. trivittatus se ha aislado un nuevo tipo
un peso molecular de 6.938,12 Da. Su estructura primaria de toxinas para canales de K+ la cual se ha denominado
se determinó por degradación de Edman y por secuen- Tt28, que entre otros, bloquea a los canales Kv1.3 que
ciación del gen. El gen que codifica para la Ttgamma-like se encuentran en linfocitos humanos (53). Este tipo de
posee una secuencia deducida de 84 aminoácidos, los pri- toxinas podrían ser la base de nuevos compuestos inmu-
meros 20 corresponden al péptido señal y los 84 restantes nomoduladores de valor terapéutico. Esta toxina actúa a
al péptido expresado. Los últimos tres residuos GKK son nivel nanomolar sobre estos tipos de canales por lo que
procesados durante la maduración para dar un residuo podría ser un buen candidato para ese uso.
C-terminal amidado (cisteinamida), exactamente como Una de las toxinas de K+ de T. trivittatus, la butito-
lo posee la Ts1. La toxina se probó sobre diferentes sub- xina-Tt2b (en inglés: buthitoxin-Tt2b) (54) conserva el
tipos de canales de sodio, mostrando un desplazamien- espaciamiento por cisteínas comunes a los péptidos de
to de las corrientes a voltajes más negativos. Los canales escorpión, pero exhibe un patrón no convencional de di-
más afectados fueron los hNav1.3. (49). Sería, al menos sulfuros, acompañados por un re-arreglo completo de la
hasta ahora, la toxina más importante del veneno de este topología del plegamiento CS hélice – loop – hélice. Esto
escorpión. Y esto explicaría lo ya ampliamente conocido mostraría una nueva elaboración de CSα/β y una versa-
respecto a la protección que brinda el antiveneno anti-T. tilidad estructural que no se conocía en estas pequeñas
serrulatus en los casos de envenenamiento por T. trivittatus proteínas ricas en puentes disulfuro (54). En la Figura 4
(50)(51). Los antivenenos brasileños, que poseen como se muestran algunas características de esta toxina.
inmunógeno el veneno de T. serrulatus, fueron utilizados
antes de la producción nacional de antiveneno anti T. tri- OTRAS TOXINAS DEL VENENO DE ESCORPIONES
vittatus con mucho éxito (5) (8) (50), y aún suelen ser uti-
lizados cuando la producción nacional no llega a cubrir En el veneno de escorpiones se han descripto otros
la demanda de suero antiescorpión (51). componentes, como toxinas que actúan sobre los canales
de Cl- o Ca2+ (42)(43), como así también el menciona-
do componente curarizante que actúa a nivel de la placa
TOXINAS DEL VENENO DE TITYUS SPP. QUE AFECTAN mioneural en el veneno de T. discrepans (31). Sin embar-
LOS CANALES DE K+ go, en lo referente a las toxinas que actúan sobre estos
El veneno de escorpiones es una fuente rica de pép- canales iónicos, hasta el momento no se conoce bien el
tidos bloqueadores de canales de K+ (29) (44). La ma- papel en el envenenamiento humano y en el caso del
yoría de ellos son proteínas pequeñas estructuralmente componente curarizante descripto en el veneno de T.
relacionadas y ricas en puentes disulfuro, que conser- discrepans, estaría en una concentración baja, por lo que
van un patrón de seis cisteínas que se asume que dictan no jugaría un papel importante en la fisiopatología del
su plegamiento tridimensional. En los patrones conven- envenenamiento. Otros componentes menos estudiados
cionales, dos puentes disulfuro conectan un segmento serán mencionados más adelante en referencia a la fisio-
de la alfa-hélice a una trenza del C-terminal o a una do- patología del envenenamiento.
ble o triple trenza del plegamiento β, conformando una
estructura α/β estabilizada por cistina (CSα/β).
Del veneno de T. trivittatus se aisló un péptido idén- Envenenamiento por escorpiones.
tico a la butantoxina de T. serrulatus. Este posee 40
aminoácidos con cuatro puentes disulfuro, que bloquea
Fisiopatología
reversiblemente los canales de K+ shaker B y ha sido de-
ENVENENAMIENTO EXPERIMENTAL
nominado TtButantoxina (en inglés: TtButantoxin) (52).
Péptidos similares a este se han encontrado en otras es- En animales de experimentación inoculados con ve-
pecies de Tityus y si bien su relevancia toxicológica no nenos de Buthidae se observa lagrimeo, sialorrea con

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


62 de Roodt AR

Figura 4. A) Diagrama de listones de la Tt2b, toxina bloqueadora de canales de K+ de Tityus trivittatus. B) Alineamiento estructural de la
toxina Tt2b (azul) con la y caribdotoxina (verde) del escorpión Leiurus quinquestriatus, representativa, del motivo Cs alfa/beta, del mismo
tipo de toxinas. C) y D) Obsérvense las diferencias entre la Tt2b (C) con otra alfa k-toxina, la tamapina o alfa-Ktx5.4 (D), proveniente del
alacrán de la India Mesobuthus tamulus, que posee una estructura conocida como convencional pero diferente a la Tt2b.
Las imágenes fueron realizadas y cedidas gentilmente por el Dr. Federico Del Rio Portilla, del Departamento de Química de Macromoléculas
del Instituto de Química de la Universidad Autónoma de México.

saliva filante, distensión abdominal, diarrea, diuresis, Buthidae, pueden llevar a cuadros graves y a la muerte.
eyaculación, fasciculaciones musculares o contraccio- Los signos y síntomas locales por la inoculación del
nes tetaniformes, espasmo laringeo y protrusión ocular veneno, son posiblemente los menos importantes desde
(65), signos observados en su mayoría, en el envenena- el punto de vista médico, si bien inicialmente son más
miento experimental por Tityus de Argentina (7)(50). conspicuos debido al dolor agudo y de aparición inme-
El veneno de T. trivittatus inoculado a ratones produ- diata. Los signos que se pueden apreciar son hiperes-
ce epífora, sialorrea, sudoración, diarreas y piloerección. tesia, inflamación local mínima o ausente, con algunas
Puede observarse un intenso prurito local e hiperexcita- manifestaciones (a veces ausentes) como piloerección,
ción, con una respuesta exagerada a los estímulos táctiles palidez cutánea o eritema, frío en el lugar de la picadu-
y auditivos, en ocasiones de naturaleza convulsiva, difi- ra, entre otras. Ocasionalmente puede haber prurito.
cultad respiratoria con adopción de posiciones ortopnei- Las molestias en el sitio de emponzoñamiento se irra-
cas y muerte (50) (Fig. 3). La inoculación de ratones con dian a partir del lugar de inoculación. Puede observarse
el veneno de ejemplares de Tityus de diferentes regiones también alteraciones por acción directa sobre células
de Argentina produce una signo-sintomatología muy si- excitables (músculos lisos y estriados), por acción so-
milar, con sólo algunas diferencias sutiles en los cuadros bre canales iónicos, llegando en algunos casos a verse
de envenenamiento, independientemente de la poten- cuadros tetaniformes, que si bien son comunes de ob-
cia letal, que varía mucho en los venenos provenientes servar en envenenamientos experimentales con vene-
de diferentes regiones (12)(50), en mayor proporción nos de algunos Tityus, se ven más comúnmente en en-
que la variación comunicada para la toxicidad del vene- venenamientos humanos en otras latitudes (4)(56-58).
no de T. serrulatus (55). A diferencia de la picadura de algunos otros animales
ponzoñosos, el dolor es agudo y se produce desde el
mismo momento de la picadura. El dolor en el caso de
SIGNOS LOCALES DEL ENVENENAMIENTO
la picadura de los Tityus podría estar relacionado sus-
EN HUMANOS
tancialmente con las quininas y el NO (59). Aún los es-
La picadura de escorpión produce intenso dolor lo- corpiones sin importancia médica, producen localmen-
cal y en pocos casos signos sistémicos, que en los acci- te un importante dolor con mínimos signos locales (60)
dentes ocasionados por algunos miembros de la Familia (61) lo que debe ser tenido en cuenta siempre.

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


Veneno de escorpiones (alacranes) y envenenamiento 63

ENVENENAMIENTO SISTÉMICO de (1) y (2) y del aumento de ácidos grasos, y (6) ten-
dencia a la CID, posiblemente debido a alteraciones de
Todos los síntomas del envenenamiento severo se la función plaquetaria (65) (67) y a la activación del fac-
deben a la estimulación del sistema nervioso periférico tor tisular por el veneno con la consiguiente activación
(62-64) en especial a alteraciones en el sistema nervioso del fibrinógeno. En relación a este último punto se des-
autónomo con la aparición de la “tormenta autonómi- taca que en el envenenamiento por Tityus se producen
ca” dada la desregulación simpática y parasimpática con alteraciones en la coagulación. Se han encontrado en
la consecuente liberación desorganizada de catecolami- veneno de algunos Tityus enzimas activadoras tisulares
nas y acetilcolina (50)(64). del plasminógeno y enzimas fibrinolíticas y fibrinóge-
Algunos autores (65) se refieren al envenenamiento noliticas (36)(37)(68)(69).
escorpiónico como un síndrome de déficit de “combus- Las principales causantes de estos cuadros de pro-
tible y energía” y de incapacidad de utilizar los sustratos funda alteración metabólica, son las neurotoxinas que
metabólicos por los órganos vitales, lo que conduce a la modulan o bloquean los canales iónicos y que genera-
falla multiorgánica y a la muerte debido a la liberación rán la “tormenta autonómica”.
masiva de catecolaminas, glucagón y angiotensina II y a
la reducción de los niveles de insulina (66). El aumento
en las hormonas contra-regulatorias (glucagón, cortisol DISTRIBUCIÓN DEL VENENO
y catecolaminas) se opone a la función anabólica de la Las neurotoxinas de escorpión actúan a nivel de las
insulina. Así, el metabolismo general se dirigiría hacia terminaciones nerviosas produciendo retardo de la in-
el catabolismo. Las catecolaminas inhiben la actividad activación o alterando la sensibilidad a la apertura de los
tirosina kinasa por lo que producen “resistencia al re- canales de Na+ y bloqueando los canales de K+ activados
ceptor” de la insulina (66) y estimulan la glucogenólisis, por Ca2+ (27-29) (41). Esto se produce al poco tiempo
lo que aumenta la lactacidemia por liberación de ácido de la picadura dado que el veneno se distribuye por el
láctico del músculo esquelético, promoviendo la acido- organismo muy rápidamente, el veneno de Centruroides
sis láctica. Como consecuencia de la hipoinsulinemia inoculado por la vía endovenosa se absorbe totalmente
y la alta glucagonemia hay aumento de ácidos grasos en 4-7 minutos y las vidas medias de eliminación se en-
libres y cetosis, fenómenos que se agravan por el bajo cuentran entre 4 y 13 horas (70). De ahí la necesidad
contenido de glucógeno hepático. Se observa también de la rápida aplicación de los antivenenos en los casos
la disminución de sustancia surfactante pulmonar lo de envenenamiento. Estudios tanto en pacientes como
que se podría relacionar con la disminución del glucó- en animales experimentales demuestran que la rápida
geno hepático (el surfactante se forma a partir de éste), aplicación intravenosa de los antivenenos conduce a
y para su formación se necesita insulina. Esto último una completa y duradera neutralización de las toxinas,
se podría relacionar con las alteraciones pulmonares así como a su redistribución parcial desde los compar-
observadas en algunos envenenamientos escorpióni- timentos periféricos al vascular, lo que se ha observado
cos y con la hipersecreción bronquial que se observa tanto en casos de envenenamiento por Tityus (71-73)
en el síndrome de distrés respiratorio producido en el como por el de escorpiones del viejo mundo (74-76).
envenenamiento por Tityus en Sudamérica, descripto
inicialmente y comprobado experimentalmente por
D`Suze y colaboradores en Venezuela (68). ACCIÓN SOBRE EL SISTEMA NERVIOSO AUTÓNOMO
Ultraestructuralmente se observan defectos en el Sistémicamente, el rasgo característico del envenena-
sarcolema, depresión del glucógeno auricular, ventricu- miento, es la actividad de las toxinas del veneno sobre
lar, del músculo esquelético e hígado (65). Se observa el sistema nervioso autónomo (SNA), cuyas membranas
también hiperglucemia, lipólisis, liberación de ácidos celulares amielínicas poseen gran cantidad de canales
grasos, pancreatitis aguda, coagulación intravascular di- iónicos a fin de conducir el impulso nervioso. La mul-
seminada (CID), disminución de la PPO2, de HCO3- y tiplicidad de “blancos” de los péptidos neurotóxicos
del pH plasmático, aumento de ácido láctico y cetonas, es la responsable de la variada signo-sintomatología
hipoinsulinemia, aumento de los niveles de angioten- autonómica en los cuadros de emponzoñamiento, por
sina II y alteraciones electrocardiográficas. Estas alte- verse afectados los procesos de excitación y conducción
raciones se atribuyen a: (1) actividad de catecolaminas del impulso nervioso. La actividad de las toxinas sobre
que aumentarían el consumo de O2, producirían vaso- este sistema resulta en la liberación desorganizada de
constricción coronaria y periférica, aumento de la pos- neurotransmisores (77)(78). La actividad conjunta y si-
carga cardíaca y lipólisis, (2) aumento de la angiotensi- nérgica de los distintos componentes del veneno serían
na II que produce constricción coronaria y periférica y responsables de las lesiones observadas en el envenena-
potencia la acción de las catecolaminas, (3) hipoinsuli- miento, provocando la “tormenta autonómica” debida
nemia, (4) aumento del consumo de O2 miocárdico y a la liberación de mediadores del sistema nervioso au-
aumento de ácidos grasos libres, (5) arritmias por causa tónomo que conduce al complicado compromiso sisté-

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


64 de Roodt AR

mico por la distonía neurovegetativa, que conduce a las ecocardiográficos y angiográficos realizados en niños tras
alteraciones metabólicas que pueden llevar a la muerte la picadura de escorpiones de Oriente Medio mostraron
(4)(51)(57)(70)(79). anormalidades en la perfusión (88), y se comunicó la evi-
La signo-sintomatología autonómica del envenena- dencia física de lesión miocárdica en necropsias por casos
miento no suele ser pura sino mixta, simpática y para- de envenenamiento fatal (93), lo que también se observó
simpática. Según los tejidos a los que se fijen las toxinas en animales de experimentación inyectados con venenos
será la estimulación del sistema nervioso autónomo, de escorpiones americanos (50) (94). Las anormalidades
lo que complica mucho la terapéutica, ya que pueden miocárdicas son comunes en el envenenamiento por Ti-
coexistir signos adrenérgicos con manifestaciones coli- tyus y se correlacionan topográficamente con la disfun-
nérgicas (Tabla III). ción contráctil. La recuperación de la contractibilidad
miocárdica se correlaciona con la reversibilidad de los
ACCIÓN SOBRE EL SISTEMA CARDIOPULMONAR defectos de perfusión lo que sugiere la participación de
las anormalidades en la perfusión del músculo cardíaco
El edema pulmonar y la falla cardíaca son conside- en la patofisiología de la falla ventricular aguda (95).
rados entre las causas de muerte más frecuentes tanto Las anormalidades en la funcionalidad miocárdi-
en los modelos animales como en las víctimas humanas ca en el síndrome por envenenamiento escorpiónico
que fueron picados por Tityus (80). La actividad de las (usualmente enmascaradas por la estimulación auto-
neurotoxinas del veneno de los escorpiones en general nómica) podrían ser provocadas por los cambios elec-
resulta en alteraciones hemodinámicas pronunciadas, trolíticos debido a la hiperkalemia inducida por las
de origen adrenérgico como hipertensión arterial, ta- catecolaminas (96)(97), el déficit en los mecanismos
quicardia sinusal. Esto se observa con los venenos de responsables por el ingreso de K+ (como el aumento
los escorpiones americanos (80-83) como con los del de la glucogenólisis y la hiperglucemia debida a la hi-
viejo mundo (74)(84). Por otro lado, se observa daño poinsulinemia) y el descenso de la calcemia (6)(66)
miocárdico que podría favorecer la falla cardíaca y el (96) y la magnesemia (84). Estos cambios pueden ex-
edema pulmonar (68)(83)(85-88). plicar el retraso en la conductividad aurículoventricular
Existen discrepancias respecto a la toxicidad del ve- que favorece la ocurrencia de ritmo idioventricular, la
neno sobre el miocardio. Algunos atribuyen una activi- disociación del ritmo aurículoventricular, taquicardia y
dad directa mientras que otros mencionan que la activi- fibrilación ventricular (65)(96). El factor cardiogénico
dad tóxica del veneno sobre el miocardio se debería a la y la hipovolemia provocada por la excesiva pérdida de
actividad adrenérgica. Posiblemente el efecto sobre el fluidos, la acumulación de potentes sustancias vasodila-
miocardio se deba a ambas causas (89) por fenómenos tadoras (quininas y/o prostaglandinas) contribuirían a
adrenérgicos, citotóxicos e isquémicos, que explicarían la hipotensión terminal refractaria a la acción hiperten-
la disfunción cardíaca (89-90). Sin embargo, parecería siva de la noradrenalina (96).
que las catecolaminas cumplirían un papel preponde-
rante en la lesión miocárdica si bien las citoquinas y/o
ALTERACIONES ELECTROCARDIOGRÁFICAS
el neuropéptido Y liberados en el envenenamiento par-
ticiparían en la génesis de la miocarditis al actuar sobre El electrocardiograma (EKG) es de gran utilidad
los vasos coronarios (91). Por otro lado, la hipergluce- para el seguimiento de los pacientes. Puede haber alte-
mia puede favorecer el daño miocárdico (90). En el raciones semejantes a algunas observadas en el infarto
músculo cardíaco se observaron lesiones representadas agudo de miocardio (como la presencia de ondas Q y el
por pequeños cambios isquémicos consistentes en ede- desnivelamiento del segmento S-T).
ma interfibrilar, condensación citoplasmática aislada y En la mayoría de los pacientes picados por Tityus de
cuerpos eosinofílicos similares a cuerpos apoptóticos. Brasil, todas las alteraciones desaparecen en la mayoría
La liberación de catecolaminas y otros neurotransmi- de los casos a los 3 días pero pueden persistir por 7 o
sores conducen a alteraciones hemodinámicas como hi- más días.
pertensión aguda y taquicardia sinusal (80)(92). Estudios Entre las alteraciones electrocardiográficas debidas

Tabla III. Se muestran las secuencias de aminoácidos de las cuatro toxinas conocidas de Tityus trivittatus y publicadas hasta el
presente, Tt1g (49), TtBut (52), Tt28 (53) y Tt2b (54).

Toxina Estructura primaria


Tt1g (moduladora de canales de Na+). MKGMILFISCILLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECAIKKGSSGYC-
AWPACYCYGLPNWVKVWERATNRCgkk
TtBut (bloqueadora de canales de K+). WCSTCLDLACGASRECYDPCFKAFGRAHGKCMNN-KCRCYT
Tt28 (bloqueadora de canales de K+). GCTPEYCSMWCKVKVSONYCVKNCKCPGR
κ-BUT-Tt2b (bloqueadora de canales de K+). GCMPEYCAGQCRGKVSQDYCLKNCRCIR

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


Veneno de escorpiones (alacranes) y envenenamiento 65

al envenenamiento por escorpiones se han descripto e IL-6 pulmonares en el envenenamiento por Tityus,
(51)(64)(79)(90)(95)(98)(99): que pueden ser responsables de la exacerbación y man-
tenimiento de la respuesta inflamatoria al veneno es-
Trastornos de la conducción aurículoventricular: se pue- corpiónico en los pulmones y contribuiría de manera
den observar bloqueos de 1er o 2do grado o bloqueo au- muy importante en el síndrome de distrés respiratorio
rículoventricular completo. (103).
Trastornos del ritmo: taquicardia sinusal, bradicardia, En el veneno del escorpión indio Mesobuthus tamulus
extrasístoles supraventriculares y/o ventriculares, fibri- se ha descripto una proteína de aproximadamente 100
lación auricular, taquicardia paroxística supraventricu- kDa que sería responsable del edema de pulmón produ-
lar sostenida. cido por ese veneno (110). Sin embargo, el edema de
Trastornos en la repolarización ventricular: aplanamien- pulmón o el síndrome de distrés respiratorio parecería
to o inversión de la onda T, desnivel negativo del seg- ser el resultado de la acción conjunta de varias toxinas y
mento S-T. la alteración de diferentes sistemas y no producto de un
Otras: alargamiento del espacio Q-T y trastornos de la solo componente.
conducción intraventricular. En el caso en que existe pancreatitis, no habría que
descartar la participación indirecta de las enzimas y
otros componentes pancreáticos liberados a la circula-
ALTERACIONES PULMONARES
ción en la génesis y mantenimiento de lesiones pulmo-
El edema pulmonar no estaría provocado por una nares (100).
sola causa. Se han mencionado causas cardiogénicas y
no cardiogénicas y algunos autores cuestionan el uso del
ALTERACIONES EN EL SISTEMA DIGESTIVO
término “edema” en estos cuadros. Esto es debido a que
los fenómenos observados no serían los típicos de un En pacientes con envenenamiento escorpiónico se
edema de pulmón, debido a la presencia (además de la ha observado pancreatitis, la que también se ha repro-
del edema) de hemorragias, presencia de material fibri- ducido en modelos experimentales (31)(32)(50)(94)
nohemático, trombos y émbolos y una secreción bron- (100)(111). La génesis de la misma no está del todo cla-
quial muy importante. Por ese motivo es que se propuso rificada, sin embargo la hiperestimulación autonómica
el uso del término de “síndrome de distrés respiratorio” podría tener relación con los fenómenos que desenca-
para referirse a las alteraciones producidas por estos ve- denan la pancreatitis. En páncreas de animales tratados
nenos (68). Diversos investigadores han descripto una con venenos de Tityus de Argentina pueden observarse
importante reacción inflamatoria del parénquima pul- hemorragia, inflamación y lesiones en los acinos (7)
monar con presencia de citoquinas y de células inmunes, (12). La liberación de sustancias de los acinos puede
pero el mecanismo de las importantes lesiones que se comenzar una secuencia de efectos sistémicos y evolu-
observan aún no está totalmente clarificado (100-106). cionar hasta la muerte. Las lesiones estarían causadas
Las quininas circulantes aumentarían la permeabilidad al menos parcialmente por la estimulación de recepto-
vascular pulmonar contribuyendo a las alteraciones que res muscarínicos (32)(111) y pueden evolucionar hasta
se observan a este nivel. En los pulmones de animales de una respuesta inflamatoria sistémica (112-117); sin em-
experimentación inoculados se observa colapso vascular, bargo, no habría que descartar la acción de otros com-
lesiones de la barreras capilares, y zonas hemorrágicas ponentes sobre el parénquima pancreático (33).
con importantes depósitos fibrinohemáticos con impor- Se sugirió recientemente que metaloproteinasas que
tante infiltración neutrofílica (7)(12)(50)(101). estarían presentes en el veneno de escorpiones (32-34)
La participación de sustancias hipotensoras como las inclusive en el de Tityus trivittatus (118) podrían estar
quininas y/o prostaglandinas en la génesis del edema relacionadas con la génesis de la pancreatitis por actuar
pulmonar y la hipotensión terminal está apoyada por el sobre proteínas asociadas a los mecanismos de libera-
hecho que en las ratas y en conejos inyectados con ve- ción de vesículas.
neno de escorpiones la administración de indometacina En la pancreatitis la liberación de factores pro infla-
(inhibidor de la prostaglandinasintetasa) (107), de BN- matorios y otros componentes deletéreos contribuyen
52021 (antagonista del factor de activación plaquetaria) a la ocurrencia de lesiones en otros órganos. De esa
(107), o de aprotinina (inhibidor del sistema kalicreína- forma la lesión aguda en los pulmones es la complica-
bradiquinina) previnieron el desarrollo del edema pul- ción más frecuente en la pancreatitis (114)(119) y este
monar inducido por el veneno y en experimentos de res- mecanismo ha sido sugerido en el envenenamiento por
cate aumentaron el tiempo de sobrevida y permitieron el Tityus (100).
rescate del 50% de los animales (106)(108). El sistema kalicreína-bradiquinina parecería jugar
En humanos picados por T. serrulatus se observó el algún papel en el envenenamiento (120) (121), y se ha
aumento en los niveles de IL-1α, IFNγ; IL-6 y GM-CSF relacionado su activación con la hipertermia en el enve-
(109). Se han observado altos niveles de mRNA de IL-1 nenamiento por Tityus (59).

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


66 de Roodt AR

Tratamiento del antiveneno de producción nacional sobre estos escor-


piones (7)(12). Asimismo se han aislado y caracterizado
El único tratamiento específico para el envenenamien- algunas de las toxinas del veneno de T. trivittatus (52-54) y
to escorpiónico es la aplicación del antiveneno (51). Las la que sería su principal toxina para mamíferos (49). Sin
evidencias muestran que cuando el antiveneno correcto embargo, mucho falta conocer sobre los mecanismos fi-
es aplicado en tiempo y en forma, disminuye drástica- siopatológicos relacionados con el envenenamiento para
mente la mortalidad por envenenamiento escorpiónico de esta manera poder mejorar el tratamiento.
tal como se ha visto y demostrado en países como Méxi- Una pregunta que aún no tiene respuesta es porqué
co, Arabia Saudita, Brasil y EE.UU. (57) (63-64)(70)(121) el veneno de T. trivittatus de la ciudad de Buenos Ai-
(122). Recientemente en EE.UU. se ha implementado el res no posee la toxicidad de los de otras partes del país
uso de un antiveneno escorpiónico anti-Centruroides, pro- (12), lo que se traduce en la prácticamente ausencia
ducido en México y aprobado por la FDA, cuyo ensayo de casos moderados o graves en esta ciudad (5) con un
clínico no dejó dudas sobre la buena efectividad de su solo caso moderado registrado en su historia (11). En
uso (57). Un hecho que debe ser tenido en cuenta es la otras ciudades del país la toxicidad habría variado (8),
importancia de la internación en la UTI pediátrica de los pero esto aún no se ha visto en la ciudad de Buenos Ai-
pacientes con envenenamiento escorpiónico. En Brasil el res. Estudios transcriptómicos y proteómicos ayudarían
uso de antiveneno respecto a la internación sola dismi- a entender estas diferencias y posibles variaciones en la
nuyó la mortalidad de 3,5 % a 1,8%, mientras que combi- toxicidad de los venenos de las diferentes poblaciones
nando el uso de antiveneno con la internación en la UTI, de escorpiones. Otra deuda es un mayor conocimiento
la mortalidad disminuyó a 0,26 (63). de la biología y la historia natural de estos escorpiones
Si bien no existe una oferta cuantitativa de antivene- para tomar medidas ambientales adecuadas para dismi-
no escorpiónico tan importante como la de antivenenos nuir la cantidad de accidentes en humanos (8).
ofídicos, afortunadamente en el continente hay varios Estos no son problemas sólo de Argentina, sino de to-
productores de antiveneno escorpiónico. Sin embargo, dos los países en los que hay casos de escorpionismo (1)
en Argentina existe un solo productor de este antivene- (4). Desde que se conoce ciertamente la peligrosidad de
no, el Instituto Nacional de Producción de Biológicos, a la picadura de los alacranes y desde el primer desarrollo
diferencia de Brasil en donde existen al menos tres ins- de un suero antialacrán, en México en 1925-1926 por los
tituciones productoras y cuatro diferentes antivenenos Dres. Isauro Venzor y Carlos León de La Peña (130), bási-
(8). Afortunadamente, las necesidades nacionales de camente, a nivel sanitario, no se ha avanzado en el enten-
antiveneno son cubiertas por la producción nacional, y dimiento del tratamiento de estos accidentes tanto como
además la similitud del veneno de T. trivittatus con el de en otros campos de la toxicología básica y la clínica toxi-
T. serrulatus (el escorpión de mayor importancia médica cológica. Sin embargo, las nuevas tecnologías que permi-
en Brasil y contra cuyo veneno se producen los antive- ten el mejor estudio de los venenos, la comprensión de la
nenos brasileños) hace que ante la necesidad puedan fisiopatología del envenenamiento e interpretación del
usarse antivenenos escorpiónicos realizados en Brasil. cuadro clínico del envenenamiento, así como la produc-
Independientemente del tratamiento, como en to- ción de antivenenos más purificados (y posiblemente en
dos los accidentes por animales ponzoñosos, las princi- el futuro mucho más refinados), harán que en un tiem-
pales medidas deberían ir dirigidas a la prevención de po no muy lejano, los óbitos debidos al envenenamiento
los accidentes (51). por escorpión disminuyan en el mundo. La comprensión
del cuadro de envenenamiento y de las herramientas te-
rapéuticas disponibles para toda la población afectada,
Comentarios finales son las metas a alcanzar para disminuir la mortalidad por
el envenenamiento de estos arácnidos, en el que mayor-
El escorpionismo en los últimos años ha emergido en- mente los niños son los más afectados (1)(4)(51).
tre otros envenenamientos por animales venenosos como
uno de los problemas sanitarios más destacados, a causa AGRADECIMIENTOS
del aumento de los accidentes y de las muertes provocadas
por estos arácnidos. En Argentina hasta el momento la Al Dr. Federico del Rio Portilla del Departamento de Química de
mayor cantidad de muertes se debieron a T. trivittatus (8) Macromoléculas del Instituto de Química de la Universidad Autó-
noma de México, quien confeccionó las figuras de la estructura de
y muy en segundo lugar a T. confluens (7). La respuesta sa-
la Tt2b y quien con su grupo aisló y caracterizó esa toxina. Al Dr.
nitaria ha sido buena, generándose material técnico para Lourival D. Possani del Departamento de Medicina Molecular y
los equipos de salud (51), realización de estudios epide- Bioprocesos del Instituto de Biotecnología de la Universidad Autó-
miológicos nacionales (5), publicaciones en relación a la noma de México, quien con su equipo y colaboradores inició y con-
temática (11)(61)(123-129) así como manteniendo la pro- tinúa el estudio de los componentes del veneno de este escorpión.
ducción de antiveneno nacional y estudiando la toxicidad A los diferentes colaboradores en las diferentes provincias argenti-
de los venenos y su variación y la capacidad neutralizante nas que desde hace años colaboran con la provisión de escorpiones

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


Veneno de escorpiones (alacranes) y envenenamiento 67

o veneno para la producción del antídoto específico y el estudio del 11. Docampo PC, Fernández ME. Escorpionismo: Present-
veneno y su toxicidad (Entre Ríos: Dra. Silvina Saavedra; Santa Fe: ación de un posible caso grave ocurrido en la Ciudad
Dres. Juan Carlos Beltramino y Osvaldo González Carrillo; Santiago de Buenos Aires. Acta Toxicol Argent 2011; 19: 16-8.
del Estero: Dra. Miriam Vurcharchuc de Barrionuevo; Catamarca: 12. de Roodt AR, Coronas FIV, Lago N, González ME, Las-
Dr. Raúl López; Córdoba: Lic. Gustavo Reati; La Rioja: Dr. Eduar- kowicz RD, Beltramino JC, et al. General biochemi-
do Bazan; CABA: Dras. Elda Carngel y Valeria Malinovsky) sin cuya cal and immunological characterization of the venom
colaboración hubiese sido imposible no solo la investigación del from the scorpion Tityus trivittatus of Argentina. Toxi-
veneno sino la producción de antiveneno en los últimos años.
con 2010; 55: 307-19.
13. Bucherl W. Classification, biology and venom ex-
CORRESPONDENCIA traction of scorpions. En: Bucherl, W., Buckley, E.
(Eds.). Venomous Animals and their Venoms. Venom-
DR. ADOLFO RAFAEL DE ROODT ous Invertebrates, vol. III. New York: Academic Press;
Área Investigación y Desarrollo,
1971; pp. 317–47.
INPB-ANLIS ”Dr. Carlos G. Malbrán”
14. Toscano-Gadea CA. Confirmation of parthenogene-
Ministerio de Salud de la Nación
sis in Tityus trivittatus Kraepelin 1898 (Scorpiones,
Av. Vélez Sarsfield 563
Buthidae). J Arachnol 2004; 32: 866-9.
1281 CIUDAD DE BUENOS AIRES. Argentina
E-mail: aderoodt@gmail.com
15. Camargo FJ, Ricciardi A. Sobre la presencia de un
escorpión Tityus serrulatus Lutz e Mello (Scorpiones,
Buthidae) en la ciudad de Corrientes. Comunicaciones
Científicas y Tecnológicas 2000, UNNE, Actas; Univer-
Referencias bibliográficas sidad Nacional del Nordeste Ed.: Corrientes, Argentina,
2000. Disponible en: URL: http://www.iaea.unne.edu.
1. Chippaux JP, Goyffon M. Epidemiology of scorpionism: ar/unnevieja/Web/cyt/cyt/2000/8_exactas/e_pdf/e_038.
a global appraisal. Acta Trop 2008; 107: 71-9. pdf. Fecha de acceso: 17 de septiembre de 2014.
2. Chávez-Haro AL. En los territorios de scorpio. Expe- 16. Klaiber K, Williams N, Roberts TM, Papazian DM, Jan
riencias y recuerdos de un alacranólogo. México, DF: LY, Miller C. Functional expression of Shaker K+ chan-
Lab. Silanes Inst. Bioclón; 2007. nels in a baculovirus-infected insect cell line. Neuron
3. de Roodt AR, Lanari LC, Laskowicz RD, Costa de Oli- 1990; 5: 221–6.
veira V. Identificación de los escorpiones de importan- 17. Gordon D, Karbat I, Ilan N, Cohen L, Kahn R, Gilles N,
cia médica en la Argentina. Acta Toxicol Argent 2014; et al. The differential preference of scorpion alpha-toxins
22: 5-14. for insect or mammalian sodium channels: Implications
4. Khattabi A, Soulaymani-Bencheikh R, Achour S, Sal- for improved insect control. Toxicon 2007; 49: 452-72.
mi LR. The Scorpion Consensus Expert Group. Clas- 18. Gurevitz M, Karbat I, Cohen L, Ilan N, Kahn R, Turkov
sification of clinical consequences of scorpion stings: M, et al. The insecticidal potential of scorpion be-
consensus development. Trans R Soc Trop Med Hyg ta-toxins. Toxicon 2007; 49: 473-89.
2011; 105: 364–9. 19. Karbat I, Frolow F, Froy O, Gilles N, Cohen L, Turkov
5. de Roodt AR, García SI, Salomón OD, Segre L, Dolab M, et al. Molecular basis of the high insecticidal po-
JA, Funes RF, et al. Epidemiological and clinical as- tency of scorpion alpha-toxins. J Biol Chem 2004;
pects of scorpionism by Tityus trivittatus in Argentina. 279: 31679-86.
Toxicon 2003; 41: 971-7. 20. Pang SZ, Oberhaus SM, Rasmussen JL, Knipple DC,
6. Piola JC, Prada DB, Waksman JC, Evangelista M. In- Bloomquist JR, Dean DH, et al. Expression of a gene
creased mortality and morbidity from Tityus trivitattus encoding a scorpion insectotoxin peptide in yeast,
envenomation in Argentina. Clin Toxicol 2006; 44: 650. bacteria and plants. Gene 1992; 116: 165-72.
7. de Roodt AR, Lago NR, Salomón OD, Laskowicz RD, 21. Yao B, Fan Y, Zeng Q, Zhao R. Insect-resistant tobac-
Neder de Román LE, et al. A new venomous scorpion co plants expressing insect-specific neurotoxin AaIT.
responsible for severe envenomation in Argentina: Ti- Chin J Biotechnol 1996; 12: 67-72.
tyus confluens. Toxicon 2009; 53: 1-8. 22. Regev A, Rivkin H, Inceoglu B, Gershburg E, Hammock
8. de Roodt AR. Comments on environmental and sanitary BD, Gurevitz M, et al. Further enhancement of bacu-
aspects of the scorpionism by Tityus trivittatus in Buenos lovirus insecticidal efficacy with scorpion toxins that
Aires City, Argentina. Toxins (Basel) 2014; 6: 1434-52. interact cooperatively. FEBS Lett 2003; 537: 106-10.
9. Casas N, Geffner L, Echenique H, Costa de Oliveira 23. Wang J, Chen Z, Du J, Sun Y, Liang A. Novel insect
V, de Roodt AR. Epidemiologic situation of envenom- resistance in Brassica napus developed by transforma-
ation by venomous animals in Argentina. 2007-2011 tion of chitinase and scorpion toxin genes. Plant Cell
period. Toxicon 2012; 60: 238-9. Rep 2005; 24: 549-55.
10. de Roodt AR, Lanari LC, García SI, Costa de Olivei- 24. Wang C, St Leger RJ. A scorpion neurotoxin increases
ra V, Casas N, de Titto EH. Accidentes y óbitos por the potency of a fungal insecticide. Nat Biotechnol
envenenamiento por animales venenosos-ponzoñosos 2007; 25: 1455-6.
en Argentina en el período 2000-2011. Acta Toxicol 25. Wu J, Luo X, Wang Z, Tian Y, Liang A, Sun Y. Transgen-
Argent 2013; 21 (Supl.): 100. ic cotton expressing synthesized scorpion insect toxin

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


68 de Roodt AR

AaHIT gene confers enhanced resistance to cotton veneno de alacranes en el contexto de la biología mo-
bollworm (Heliothis armigera) larvae. Biotechnol Lett lecular, la farmacología y la medicina. Biotecnología
2008; 30: 547-54. 2007; 14: 177-87.
26. Gordon D, Ilan N, Zilberberg N, Gilles N, Urbach D, 41. Possani LD, Merino E., Corona M, Bolivar F, Becerril
Cohen L, et al. An ‘Old World’ scorpion beta-toxin B. Peptides and genes coding for scorpion toxins that
that recognizes both insect and mammalian sodium affect ion-channels. Biochimie 2000; 82: 861-8.
channels. A possible link towards diversification of be- 42. Becerril B, Marangoni S, Possani LD. Toxins and genes
ta-toxins. Eur J Biochem 2003; 270: 2663–70. isolated from scorpions of the genus Tityus. Toxicon
27. Becerril B, Corona M, García C, Bolívar L, Possani L. 1997; 35: 821-35.
Cloning of genes encoding scorpion toxins: an interpre- 43. Rodríguez de la Vega RC, Possani LD. Current views
tative review. J Toxicol - Toxins Rev 1995; 14: 339-57. on scorpion toxins specific for K+-channels. Toxicon
28. Possani LD, Becerril B, Delepierre M, Tytgat J. Scor- 2004; 43: 865-75.
pion toxins specific for Na+-channels. Eur J Biochem 44. Rodríguez de la Vega RC, Possani LD. Overview of
1999; 264: 287-300. scorpion toxins specific for Na+ channels and relat-
29. Possani LD, Selisko B, Gurrola GB. Structure and ed peptides: biodiversity, structure–function relation-
function of scorpion toxins affecting K+-channels. Per- ships and evolution. Toxicon 2005; 46: 831–44.
spect Drug Discov 1999; 15/16: 15-40. 45. Gurevitz M, Froy O, Zilberberg N, Turkov M, Strugatsky
30. Verano-Braga T, Figueiredo-Rezende F, Melo MN, D, Gershburg E, et al. Sodium channel modifiers from
Lautner RQ, Gomes ERM, Mata-Machado LT, et al. scorpion venom: structure-activity relationship, mode of
Structure-function studies of Tityus serrulatus Hypo- action and application. Toxicon 1998; 36: 1671-82.
tensin-I (TsHpt-I): A new agonist of B2 kinin receptor. 46. Zhu L, Peigneur S, Gao B, Tytgat J, Zhu S. Two recom-
Toxicon 2010; 56: 1162-71. binant alpha-like toxins from Mesobuthus eupeus with
31. D‘Suze G, Sevcik C, Ramos M. Presence of curariz- differential affinity toward insect and mammalian Na+
ing polypeptides and a pancreatitis-inducing fraction channels. Biochimie 2013; 95: 1732-40.
without muscarinic effects in the venom of the Ven- 47. Tamariz-Martel Moreno A. Trastornos del ritmo cardía-
ezuelan scorpion Tityus discrepans (Karsch). Toxicon co más frecuentes en pediatría. Síndrome del QT alar-
1995; 33: 333-45. gado. Pediatr Integral 2008; 12: 793-804.
32. 32- Fletcher PL, Fletcher M, Fainter LK, Terrian DM. 48. Jiménez-Vargas JM, Restano-Cassulini R, Possani LD.
Actions of New World scorpion venom and its neuro- Toxin modulators and blockers of hERG K+ channels.
toxins in secretion. Toxicon 1996; 34: 1399-411. Toxicon 2012; 60: 492-501.
33. 33- Venancio EJ, Portaro FCV, Kuniyoshi AK, Carvalho 49. Coronas FIV, Diego-García E, Restano-Cassulini R, de
DC, Pidde-Queiroz G, Tambourgi DV. Enzymatic prop- Roodt AR, Possani LD. Biochemical and physiologi-
erties of venoms from Brazilian scorpions of Tityus ge- cal characterization of a novel Na+-channel specific
nus and the neutralisation potential of therapeutical peptide from the venom of the Argentinean scorpion
antivenoms. Toxicon 2013; 69: 180-90. Tityus trivittatus.
34. Carmo AO, Oliveira-Mendes BB, Horta CC, Magalhães 50. de Roodt AR, Gimeno E, Portiansky E, Varni L, Dolab
BF, Dantas AE, Chaves LM, et al. Molecular and JA, Segre L, et al. A study on the experimental enven-
functional characterization of metalloserrulases, new omation in mice with the venom of Tityus trivitattus
metalloproteases from the Tityus serrulatus venom Kraepelin 1898 (Scorpiones, Buthidae) captured in
gland. Toxicon 2014; 90: 45-55. Argentina. J Nat Toxins 2001; 10: 99-109.
35. Brazón J, Guerrero B, D’Suze G, Sevcik C, Arocha- 51. Ministerio de Salud de la Nación. Guía de Prevención,
Piñango CL. Anticoagulant and factor Xa-like activities Diagnóstico, Tratamiento y Vigilancia Epidemiológica
of Tityus discrepans scorpion venom. Acta Toxicol Ar- del Envenenamiento por Escorpiones; Ministerio de
gent 2013; 21: 26-32. Salud, Temas de Salud Ambiental No 4, Ministerio de
36. Brazón J, D’Suze G, D’Errico ML, Arocha-Piñango Salud de la Nación, Buenos Aires, Argentina, 2011.
CL, Guerrero B. Discreplasminin, a plasmin inhibitor 52. Coronas FV, de Roodt AR, Olamendi Portugal T, Zamu-
isolated from Tityus discrepans scorpion venom. Arch dio FZ, Batista CVF, et al. Disulfide bridges and block-
Toxicol. 2009; 83: 669-78.  age of Shaker B K+-channels by another butantoxin
37. Xia X, Ma Y, Xue S, Wang A, Tao J, Zhao Y, et al. Clon- peptide purified from the Argentinean scorpion Tityus
ing and molecular characterization of BumaMPs1, a trivittatus. Toxicon 2003; 41: 173-9.
novel metalloproteinases from the venom of scorpion 53. Abdel-Mottaleb Y, Coronas FV, de Roodt AR, Possani
Buthus martensi Karsch. Toxicon 2013; 76: 234-8. LD, Tytgat J. A novel toxin from the venom of the scor-
38. Corzo G. Determinantes moleculares de las neurotoxi- pion Tityus trivittatus, is the first member of a new
nas de arácnidos implicados en la unión a los canales alpha-KTX subfamily. FEBS Lett 2006; 580: 592–6.
de sodio dependientes de voltaje. Mensaje Bioquímico 54. Saucedo AL,  Flores-Solis D,  Rodríguez de la Vega
2011; 35: 131-42. RC,  Ramírez-Cordero B,  Hernández-López R,  Ca-
39. Salceda E, Ortega A. Neurotoxinas: significado biológico no-Sánchez P,  et al. New  tricks  of an old pattern:
y mecanismos de acción. Elementos 2009; 74: 29-37. structural versatility of scorpion toxins with common
40. Possani Postay LD. El estudio de los componentes del cysteine spacing. J Biol Chem 2012; 287: 12321-30.

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


Veneno de escorpiones (alacranes) y envenenamiento 69

55. Oliveira FN, Mortari MR, Carneiro FP, Guerrero-Vargas tory Distress Syndrome in rabbits trough an indirect
JA, Santos DM, Pimenta AMC, et al. Another record of mechanism. Toxicon 1999; 37: 173–80.
significant regional variation in toxicity of Tityus serru- 69. Brazón J, Guerrero B, D’Suze G, Sevcik C, Aro-
latus venom in Brazil: a step towards understanding cha-Piñango CL. Fibrin(ogen)olytic enzymes in scorpi-
the possible role of sodium channel modulators. Toxi- on (Tityus discrepans) venom. Comp Biochem Physiol
con 2013; 73: 33-46. B Biochem Mol Biol 2014; 168: 62-9.
56. Pardal  PP,  Ishikawa EA,  Vieira JL,  Coelho JS,  Dórea 70. Dehesa-Dávila M, Possani LD. Scorpionism and sero-
RC,  Abati PA,  et al. Clinical aspects of envenomation therapy in Mexico. Toxicon 1994; 32: 1015-8.
caused by Tityus obscurus (Gervais, 1843) in two dis- 71. De Rezende NA, Borges Dias M, Campolina D,
tinct regions of Pará state, Brazilian Amazon basin: a Chávez-Olórtegui C, Amaral CFS. Standarization of
prospective case series. J Venom Anim Toxins Incl Trop an enzyme linked immunosorbent assay (ELISA) for
Dis 2014; 20: 3. detecting circulating toxic venom antigens in patients
57. Boyer LV, Theodorou AA, Berg RA, Mallie J, Arizona stung by the scorpion Tityus serrulatus. Rev Inst Med
Envenomation Investigators, Chávez-Méndez, et al. An- Trop São Paulo 1995; 37: 71-4.
tivenom for critically ill children with neurotoxicity from 72. De Rezende NA, Chávez-Olórtegui C, Amaral CFS. Is
scorpion stings. N Engl J Med 2009; 360: 2090-8. the severity of Tityus serrulatus scorpion envenom-
58. Osnaya-Romero N, de Jesus Medina-Hernández T, ing related to plasma venom concentrations? Toxicon
Flores-Hernández SS, León-Rojas G. Clinical symp- 1996; 34: 820-3.
toms observed in children envenomated by scorpion 73. Santana GC, Freire ACT, Ferreira APL, Cháves- Olór-
stings, at the children’s hospital from the State of Mo- tegui C, Diniz CR, Freire-Maia L. Pharmacokinetics of
relos, Mexico. Toxicon 2001; 39, 781–5. Tityus serrulatus scorpion venom determined by en-
59. Pessini AC, Kanashiro A, Malvar DC, Machado RR, zyme-linked immunosorbent assay in the rat. Toxicon
Soares DM, Figueiredo MJ, et al. Inflammatory media- 1996; 34: 1063-6.
tors involved in the nociceptive and oedematogenic re- 74. Ismail M, Abd-ELsalam MA. Are the toxicological ef-
sponses induced by Tityus serrulatus scorpion venom fects of scorpion envenomation related to tissue ven-
injected into rat paws. Toxicon 2008; 52: 729–36. om concentration? Toxicon 1998; 26: 233-56.
60. Salomón OD, de Roodt AR. Escorpiones: Denuncia es- 75. Krifi MN, El Ayeb M. An equilibrium ELISA for the
pontánea en dos centros de referencia en la ciudad de dosage of Androctonus australis garzonii (Aag) and
Buenos Aires, 1997-2000. [Scorpions: spontaneous Buthus occitanus tunetanus (Bot) scorpion venoms:
report in 2 reference centers in the city of Buenos Ai- set up and calibration. Arch Inst Pasteur Tunis 1998;
res, 1997-2000]. Medicina (Buenos Aires) 2001; 61: 75: 185- 94.
391-6. 76. Krifi MN, Savin S, Debray M, Bon C, El Ayeb M, Cho-
61. Saracco AS, de Roodt AR, Cabrera AM, García SI. Es- umet V. Pharmacokinetic studies of scorpion venom
corpionismo. ATA Informa, Boletín de la Asociación before and after antivenom immunotherapy. Toxicon
Toxicológica Argentina 2006; 20: 17-23. 2005; 45: 187-98.
62. Freire-Maia L. Pharmacology of Tityus serrulatus scor- 77. Possani LD, Fletcher PL, Fletcher MD, Rode GS, Mo-
pion venom. Mem Inst Butantan 1990; 52: 51-7. chca-Morales J, Lucas S, et al. Structural and func-
63. Freire-Maia L, Campos JA, Amaral CFS. Approaches to tional characteristics of toxins purified from the ven-
the treatment of scorpion envenoming. Toxicon 1994; om of the Brazilian scorpion Tityus serrulatus Lutz and
32: 1009-14. Mello. Mem Inst Butantan 1992; 54: 35-52.
64. Cupo P, de Azevedo-Marques MM, Hering SE. Es- 78. Kalapothakis E, Chávez-Olórtegui C. Venom variability
corpionismo. En: Animais Peçonhentos no Brasil. among several Tityus serrulatus specimens. Toxicon
Biologia, Clínica e Terapêutica dos Acidentes. Costa 1997; 35: 1523-9.
Cardoso J.LC, Siqueira França FO, Fan WH, Sant’Ana 79. Ministério da Saúde. Manual de Diagnóstico e Trata-
Málaque CM, Haddad V Jr. Ed. Sarvier – Fapesp, São mento de Acidentes por Animais Peçonhentos. Brasil-
Paulo, 2003. p. 198-208. ia. Fundação Nacional de Saúde; 1992.
65. Murthy RK, Hase NK. Scorpion envenoming and the 80. Freire-Maia L. Pharmacology of Tityus serrulatus scor-
role of insulin. Toxicon 1994; 32: 1041-4. pion venom. Mem Inst Butantan 1990; 52: 51-7.
66. Murthy RK. The scorpion-envenoming syndrome: a 81. Amaral CFS, Barbosa AJA, Leite VHR, Tafuri WL,
different perspective. The physiological basis of the Rezende NA. Scorpion sting-induced pulmonary ede-
role of insulin in scorpion envenoming. J Venom Anim ma: evidence of increased alveolo-capillary membrane
Toxins 2000; 6: 4-51. permeability. Toxicon 1994; 32: 999-1003.
67. Brazón J, Hughes CE, Mori J, Sevcik C, D’suze G, Wat- 82. Freire-Maia L, Campos JA. Response to the Letter to
son SP. Tityus discrepans scorpion venom activates the Editor by Gueron and Ovsyshcher. On the treatment
platelets through GPVI and a novel Src-dependent sig- of the cardiovascular manifestations of scorpion enven-
naling pathway. Platelets 2011; 22: 165-72. omation. Toxicon 1987; 25: 125-30.
68. D’Suze G, Comellas A, Pesce L, Sevcik C, Sánchez-de 83. Freire-Maia L, Campos JA. Pathophysiology and treat-
León R. Tityus discrepans venom produces a Respira- ment of scorpion poisoning. En: Ownby CL, Odell GV,

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


70 de Roodt AR

editores. Natural Toxins. Characterization, Pharmacology myocardial perfusion and function in victims of scorpi-
and Therapeutics. Proceedings of the 9th World Con- on envenomation using Gated-SPECT]. Arq Bras Cardiol
gress on Animal, Plant and Microbial Toxins. Pergamon 2010; 94: 444-51.
Press, Oxford. Stillwater, Oklahoma; 1989. p. 140-59. 96. Ismail M. The scorpion envenoming syndrome. Toxicon
84. Sofer S, Gueron M. Respiratory failure in children fol- 1995; 33: 825-58.
lowing envenomation by the scorpion Leiurus quinques- 97. Langer SZ, Adler-Graschinsky E, Almeida AP, Diniz CR.
triatus: Hemodynamic and neurological aspects. Toxicon Prejunctional effects of a purified toxin from the scor-
1988: 26: 931-9. pion Tityus serrulatus: release of 3H-noradrenalin and
85. Azevedo AD, Silva AB, Cunha-Melo JR, Freire-Maia L. enhancement of transmitter overflow elicited by nerve
Cardiovascular and respiratory effects induced by a pu- stimulation. Naunyn Schmiedeber´g s Arch Pharmacol
rified scorpion toxin (tityustoxin) in unanesthetized rats. 1975; 287: 243-59.
Toxicon 1983; 21: 753-59. 98. Mazzei de Dávila CA, Parra M, Feunmayor A, Salgar N,
86. Amaral CF, Dias MB, Campolina D, Proietti FA, de González Z, Davila DF. Scorpion envenomation in Méri-
Rezende NA. Children with adrenergic manifestations of da, Venezuela. Toxicon 1997; 35: 1459-62.
envenomation after Tityus serrulatus scorpion sting are 99. Santiago JJ, Mazzei de Dávila CA, Davila DF, Donis
protected from early anaphylactic antivenom reactions. JH, Villaroel V. Antiadrenergic rescue therapy with
Toxicon 1994; 32: 211-5. amiodarone in children with severe left ventricular dys-
87. Freire-Maia L, de Matos IM. Heparin or a PAF antago- function secondary to scorpion envenomation. Arq Bras
nist (BN-52021) prevents the acute pulmonary edema Cardiol 2010; 94: 18-24.
induced by Tityus serrulatus scorpion venom in the rat. 100. D’Suze G, Salazar V, Díaz P, Sevcik C, Azpurua H, Bra-
Toxicon 1993; 31: 1207-10. cho N. Histopathological changes and inflammatory re-
88. Gueron M, Ilia R. Non-cardiogenic pulmonary oedema sponse induced by Tityus discrepans scorpion venom in
after scorpion envenomation: a true entity? Toxicon rams. Toxicon 2004; 44: 851-60.
1996; 34: 393-5. 101. D’Suze G, Díaz P, Salazar V, Sevcik C, Brazón J. Effect
89. Amaral CFS, Rezende NA. Both cardiogenic and non-car- of leukocyte inhibitors benzydamine and cyclophospha-
diogenic factors are involved in the pathogenesis of mide, on lung injury caused by Tityus discrepans scorpi-
pulmonary oedema after scorpion envenoming. Toxicon on venom. Toxicon 2007; 50: 1116-25.
1997; 35: 997-8. 102. Coelho FM, Pessini AC, Coelho AM, Pinho VS, Souza
90. Bahloul M, Kallel H, Rekik N, Ben Hamida C, Chelly DG, Arantes EC, et al. Platelet activating factor receptors
H, Bouaziz M. Réanimation - Atteinte cardiovasculaire drive CXC chemokine production, neutrophil influx and
lors d’envenimation scorpionique grave. [Logro de Rean- edema formation in the lungs of mice injected with Tity-
imación cardiovascular durante severo envenenamiento us serrulatus venom. Toxicon 2007; 50: 420-7.
103. Andrade MV, Lisboa FA, Portugal AL, Arantes RM,
por escorpión]. [Cardiovascular reanimation achievement
Cunha-Melo JR. Scorpion venom increases mRNA ex-
following severe scorpion envenomation. Mechanisms
pression of lung cytokines. Comp Biochem Physiol A Mol
and physiopathology]. Presse Med 2005; 34: 115-20.
Integr Physiol 2007; 146, 581-7.
91. Ouanes-Besbes L, El Atrous S, Nouira S, Aubrey N,
104. Paneque Peres AC, Nonaka PN, de Carvalho P de T,
Carayon A, El Ayeb M, et al. Direct vs. mediated effects
Toyama MH, Silva CA, Vieira RP, et al. Effects of Tityus
of scorpion venom: an experimental study of the effects
serrulatus scorpion venom on lung mechanics and in-
of a second challenge with scorpion venom. Intensive
flammation in mice. Toxicon 2009; 53: 779-85.
Care Med 2005; 31: 441-6.
105. Zuliani JP, Freitas TA, Conceição IM, Kwasniewski FH.
92. Cupo P, Jurca M, Azevedo-Marques MM, Oliveira JSM,
Tityus serrulatus venom increases vascular permeabili-
Hering SE. Severe scorpion envenomation in Brazil. Clin- ty in selected airway tissues in a mast cell-independent
ical, laboratory and anatomopathological aspects. Rev way. Exp Toxicol Pathol 2013; 65: 229-34.
Inst Med Trop São Paulo 1994; 36: 67-76. 106. Yarom R, Braun K. Electron microscopic studies of the
93. Daisley H, Alexander D, Pitt-Miller P. Acute myocardi- myocardial changes produced by scorpion venom injec-
tis following Tityus trinitatis envenoming: morphological tions in dogs. Lab Invest 1971; 24: 21-30.
and patophysiological characteristics. Toxicon 1999; 107. Ismail M, Fatani AJ, Dabees TT. Experimental treatment
37: 159-65. protocols for scorpion envenomation: a review of com-
94. Corrêa MM, Sampaio SV, Lopes RA, Mancuso LC, Cunha mon therapies and an effect of kallikrein-kinin inhibi-
OAB, Franco JJ, et al. Biochemical and histopathological tors. Toxicon 1992; 30: 1257-79.
alterations induced in rats by Tityus serrulatus scorpi- 108. Hagag M, Tu AT, El-Asmar F. Isolation of minax toxins
on venom and its major neurotoxin tytiustoxin-I. Toxicon from the venom of the scorpion Buthus minax and their
1997; 35: 1053-67. metabolic effects. Arch Biochem Biophys 1983; 220:
95. Baldini de Figueiredo A, Cupo P, Pintya AO, Caligaris 459-66.
F, Marin-Neto JA, Hering SE, et al. Avaliação da per- 109. Magalhães MM, Pereira MES, Amaral CFS, Rezende
fusão e função miocárdicas em vítimas de escorpionismo NA, Campolina D, Bucaretchi F, et al. Serum levels of
utilizando o Gated-SPECT. [Evaluación de la perfusión cytokines in patients envenomed by Tityus serrulatus
y función miocárdicas en víctimas de envenenamiento scorpion sting. Toxicon 1999; 37: 1155-64.
por escorpión mediante Gated-SPECT]. [Assessment of 110. Deshpande SB, Alex AB, Jagannadham MV, Rao GR,

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71


Veneno de escorpiones (alacranes) y envenenamiento 71

Tiwari AK. Identification of a novel pulmonary oedema caused by the Tityus serrulatus scorpion sting. Toxicol
producing toxin from Indian red scorpion (Mesobuthus Appl Pharmacol 2004; 196: 390-5.
tamulus) venom. Toxicon 2005; 45: 735-43. 121. Ismail M. The treatment of the scorpion envenoming
111. Fletcher PL Jr, Fletcher MD, Possani LD. Characteris- syndrome: The Saudi experience with serotherapy.
tics of pancreatic exocrine secretion produced by ven- Toxicon 1994; 32: 1019-26.
om from the Brazilian scorpion, Tityus serrulatus. Eur 122. Krishnamurthy S, Mahadevan S. Efficacy of scorpion an-
J Cell Biol 1992; 58: 259-70. tivenom in children. Indian Pediatr 2014; 51: 499-500.
112. Norman J. The role of cytokines in the pathogenesis 123. Docampo PC. Escorpionismo. Registro de consultas
of acute pancreatitis. Am J Surg 1998; 175: 76–83. médicas en el Centro Nacional de Intoxicaciones: pe-
113. Steer ML, Meldolesi J. Pathogenesis of acute pancre- ríodo 2000-2010. Acta Toxicol Argent 2014; 22: 33-8.
atitis. Annu Rev Med 1988; 39: 95–105. 124. Tomassone R. Emponzoñamiento por picadura de es-
114. Steer ML. Classification and pathogenesis of pancre- corpión. Presentación de cinco casos y revisión biblio-
atitis. Surg Clin North Am 1989; 69: 467–80. gráfica. Rev Col Médico Pcia. Santa Fe 1994; 27: 3-8.
115. Frossard JL, Kwak B, Chanson M, Morel P, Hadenque 125. Del Valle Luna MG, Luna M. Escorpionismo por Tityus
A, Mach F. Cd40 ligand-deficient mice are protect- trivittatus. Arch Argent Pediatr 1997; 95: 406-12.
ed against cerulein-induced acute pancreatitis and 126. Gordillo ME, Bugliolo AG, Delloni A. Escorpionismo en
pancreatitis-associated lung injury. Gastroenterology Pediatría. Arch Argent Pediatr 2000; 98: 296–303.
2001; 121: 184–94. 127. Tomassone R, Vainstub V, Peirano S. Envenenamiento
116. Frossard JL, Pastor CM. Experimental acute pancreati- grave por escorpión en Pediatría. Arch Argent Pediatr
tis: new insights into the pathophysiology. Front Biosci 2003; 101: 392–7.
2002; 7: d275–87. 128. Álvarez Parma J, Palladino CM. Envenenamiento por
117. Frossard JL, Saluja AK, Mach N, Lee HS, Bhagat L, escorpión en la Argentina. [Scorpion envenomation in
Hadenque A, et al. In vivo evidence for the role of Argentina]. Arch Argent Pediatr 2010; 108: 161–7.
GM-CSF as a mediator in acute pancreatitis-associ- 129. Adilardi RS, Ojanguren Affilastro AA, Martí DA, Mola
ated lung injury. Am J Physiol. Lung Cell Mol Physiol LM. Cytogenetic analysis on geographically distant
2002; 283: 541-8. parthenogenetic populations of Tityus trivittatus
118. Ortiz E, Rendón-Anaya M, Rego SC, Schwartz EF, Pos- Kraepelin, 1898 (Scorpiones, Buthidae): karyotype,
sani L. Antarease-like Zn-metalloproteases are ubiq- constitutive heterochromatin and rDNA localization.
uitous in the venom of different scorpion genera. Bio- Comp Cytogenet 2014; 8: 81-92.
chim Biophys Acta 2014; 1840(6): 1738-46 130. Boyer L. History of scorpion antivenom: one Arizonan’s
119. Ranson JH, Roses DF, Fink SD. Early respiratory insuffi- view. Toxicon 2013: 69: 14-20.
ciency in acute pancreatitis. Ann Surg 1973; 178: 75-9.
120. Fukuhara YD, Dellalibera-Joviliano R, Cunha FQ, Reis Recibido: 19 de septiembre de 2014
ML, Donadi EA. The kinin system in the envenomation Aceptado: 28 de noviembre de de 2014

Acta Bioquím Clín Latinoam 2015; 49 (1): 55-71

También podría gustarte