Está en la página 1de 10

Universidad Regional Amazónica

Uso de herramientas de bioinformática para el análisis de secuencias proteicas


Barahona, D., Endara, D., Falconí, F, .Galarza, A,. Jiménez, G.
Tena, 24-Junio-2019
1. Resultados
>CCKP-1
AVSAECARYGLACNKMLAPVCGTDGTTSNQCMLCYYNRKNKKNIEIRSRGRC
Tabla 1: Propiedades Fisicoquímicas
Peso molecular (Mr) 5763.75 g / mol

Punto isoeléctrico 9.2

Carga neta a pH 7.0 5.7

Hidrofilia media 0.1

Relación de residuos hidrófilos / 40%.


Número total de residuos:

Figura 1. Gráfica de carga neta vs. pH Figura 2. Gráfico de hidrofobia

Figura 3. Predicción de estructura secundaria


Tipo de hélice: alfa Longitud de secuencia: 52 a.a.

Predicción de hidrofobicidad
Figura 4. Gráfica de Hidrofobicidad y momento hidrofóbico.
Predicción de estructura terciaria

Figura 5. Estructura terciaria de CCKP-1

>CZS-18
GFLDLVKHVGKATGKAALNAVTEMVNQGEYPKLRKCKI

Tabla 2. Propiedades Fisicoquímicas

Peso molecular (Mr) 4128.92 g/mol

Punto isoeléctrico 10.1

Carga neta a pH 7.0 4.0

Hidrofilia media 0.1

Relación de residuos hidrófilos / 34%


Número total de residuos:
Figura 6. Gráfica de carga neta vs. pH Figura 7. Gráfico de hidrofobia

Figura 8. Predicción de estructura secundaria

Tipo de hélice: alfa

Longitud de secuencia: 38 aa
Predicción de hidrofobicidad

Figura 9. Gráfica de Hidrofobicidad y momento hidrofóbico.

Predicción de estructura terciaria


Figura 10. Estructura terciaria de CZS-18

>DRS-CC1
GLWSIIKTVGKLAAKEAAKAAGKAALNTVAEKVNE-amina

Tabla 3. Propiedades Fisicoquímicas

Peso molecular (Mr) 3551.19 g/mol

Punto isoeléctrico 10.6

Carga neta a pH 7.0 4.0

Hidrofilia media 0.2

Relación de residuos hidrófilos / 34%


Número total de residuos:

Figura 11. Gráfica de carga neta vs. pH Figura 12. Gráfico de hidrofobia

Figura 13.Predicción de la estructura secundaria


Tipo de hélice: alfa Longitud de secuencia: 35 aa

Predicción de hidrofobicidad

Figura 14. Gráfica de Hidrofobicidad y momento hidrofóbico.

Predicción de estructura terciaria

Figura 15. Estructura terciaria de DRS-CC1

Figura 16. Secuencia similar a la de DRS-CC1

>CC-long peptide-CC1
NLWNVIKTVGKQAAKTAAKAAAKAAAKAAAKAAAKIALNKIVEKISGADQES

Tabla 4. Propiedades físico-químicas

Peso molecular (Mr) 5204.11 g/mol

Punto isoeléctrico 10.7

Carga neta a pH 7.0 7.0

Hidrofilia media 0.2


Relación de residuos hidrófilos / 38%
Número total de residuos:

Figura 17. Gráfica de carga neta vs. pH Figura 18. Gráfico de hidrofobia

Figura 19.Predicción de estructura secundaria

Tipo de hélice: alfa Longitud


de secuencia: 52 aa

Predicción de hidrofobicidad

Figura 20. Gráfica de Hidrofobicidad y momento hidrofóbico.

Predicción de estructura terciaria


Figura 21. Estructura terciaria de CC-long peptide-CC1

Figura 22. Secuencia similar de CC-long peptide-CC

2. Discusión
Para el análisis de secuencias proteicas se utilizó información básica de bioinformática, ciencia que usa
métodos matemáticos, estadísticos y computacionales que solucionan problemas biológicos usando secuencias
de ADN y aminoácidos e información relacionada. En base a esto se desarrolla herramientas o programas de
procesamiento y visualización. [1]
BLAST (Basic Local Alignment Search Tool) es una herramienta de búsqueda de alineación local, su
función es encontrar regiones de similitud local entre secuencias genéticas, comparando secuencias de proteínas
con bases de datos de secuencias estándares. Además, se usa para inferir relaciones funcionales y evolutivas
entre secuencias, así como para ayudar a identificar miembros de familias de genes y para comparar una
secuencia nueva con las contenidas en bases de datos de las proteínas al alinear la secuencia nueva con genes
previamente caracterizados. Otro software ExPASy (Expert Protein Analysis System) de última generación, es
un portal de Recursos de Bioinformática SIB que proporciona acceso a bases de datos científicas y herramientas
de software en diferentes áreas de las ciencias de la vida, incluyendo proteómica, genómica, filogenia, biología
de sistemas, genética de poblaciones, transcriptómica, etc. Además, tiene acceso a bases de datos de secuencias
de proteínas como UniProt Knowledgebase (Swiss-Prot y TrEMBL) y ENZIME, un repositorio de información
relativa a la nomenclatura de enzimas. Basada principalmente en las recomendaciones de la (IUBMB)
International Union of Biochemistry and Molecular Biology (Unión Internacional de Biouímica y Biología
Molecular) y describe cada tipo de enzima caracterizada para la que se ha otorgado un número EC (Enzyme
Commission)[2]

Primera secuencia:
Al obtener una secuencia idéntica al inhibidor precursor de tripsina, se analizó que la proteasa se encuentra en la
secreción cutánea de la rana espléndida (Cruziohyla calcarifer) información encontrada en blast de la página
NCBI. La figura 1 indica el punto isoeléctrico de 9,2 a un pH de 7 con carga neta de 5,7. A pH neutro, el ion
dipolar puede actuar como ácido o base ya que la gran parte de los aminoácidos presentes son ionizables. Según
la figura 2, el comportamiento hidrofóbico es mayor que el hidrofílico, ya que el porcentaje de residuos
hidrófílos es del 40 %, los cuales están orientados al interior del poro. Se predice que la secuencia se encuentra
en un entorno medianamente acuoso porque su plegamiento proteico está dirigido por la fuerte tendencia de los
residuos hidrofóbicos a ser excluidos del agua.
Con referencia a la cita de (Proaño, C et al). indica que CCKP-1 muestra actividad inhibitoria de la tripsina y
posee una lisina en su sitio P1 e inusualmente asparagina en su sitio P2 que desempeñan un papel para controlar
el equilibrio entre otros péptidos funcionales producidos en las secreciones de la piel de anfibios [3].
Segunda secuencia:
Al analizar la segunda secuencia en la base de datos de NCBI, no se pudo detectar la identidad de esta secuencia,
pero con ayuda de la herramienta Blast, se pudo encontrar una similitud muy fuerte en algunas moléculas como
Cruzioseptin-11, la cual están presente en las ranas. Por lo tanto, se puede suponer que nuestra secuencia
desconocida tendrá una función de actividad antimicrobiana con actividad peptídica de la piel de estos anfibios
[5]. También, se puede observar que los péptidos de la molécula Cruzioseptin-11 adoptan una estructura de hélices
alfa lo que le da una hidrofobicidad media [5] (Véase Anexo 2), lo que hace que esta molécula sea más parecida
a la secuencia desconocida. Si nos fijamos en la Tabla 2, podemos observar que el pH es más bajo que el pI de la
molécula, por lo tanto ésta tendrá carga negativa. Si queremos comparar esta secuencia con las otras tres
secuencias desconocidas, podemos suponer que lo que tienen en común es que todas son moléculas que están
presentes en las ranas y sapos. Además, poseen características físico-químicas muy similares, así como su
hidrofobicidad y su momento hidrofóbico.

Tercera secuencia:
Al analizar la tercera secuencia de en la página NCBI encontramos que la concordancia es menor a 40 por lo
que con la ayuda de la herramienta bioinformática de la página Swiss model que busca entre una base de datos
de internet una secuencia previamente estudiada que tenga en mayor grado de similitud a la que analizamos
(Véase Figura 16). Se ingresó la secuencia similar generada por Swiss model a la página NCBI la cual
reconoció dicha secuencia (Véase Anexo 3) como una proteína con función antimicrobiana y con actividad
peptídica extraída de la piel de una rana de hoja en Brasil [4]. Si efectivamente comparamos el grado de
similitud podemos ver que su secuencia se asemeja mucho, por lo que al tener dicho grado de similitud
podríamos decir que la actividad de nuestra secuencia problema debería tener una actividad similar a la proteína
descrita anteriormente. De manera similar si analizamos su característica hidrofóbica los péptidos de la
secuencia similar adoptan una estructura típica de hélices a cuando no se encuentran en solución acuosa [4] ,es
decir tiene una hidrofobicidad media (Véase Figura 12) que la hace aún más parecida a nuestra secuencia
desconocida, además de que su estructura es una hélice alfa en las dos.
Cuarta secuencia:
La cuarta secuencia al ingresarla en la página NCBI no se encontró ninguna similitud con su base de datos por
lo que se utilizó nuevamente la página Swiss model en la cual se encontró la secuencia de la Figura 22. Se
ingresó la secuencia similar generada por Swiss model a la página NCBI la cual reconoció dicha secuencia
(Véase Anexo 4) como una proteína con función antimicrobiana y con actividad peptídica similar a la secuencia
tres, ya que se extrajo de la piel de una rana de la misma familia que la anterior [6]. Si comparamos el grado de
similitud podemos ver que su secuencia tiene algunos aminoácidos similares pero la mayoría es diferente por lo
que a pesar de que sean similares podemos decir que su función podría variar. En tanto que si analizamos su
característica hidrofóbica los péptidos de la secuencia similar adoptan una estructura típica de hélices a cuando
no se encuentran en solución acuosa [6] de manera similar a la secuencia 3,es decir tiene una hidrofobicidad
media (Véase Figura 18) que la hace que las dos secuencias se parezcan más entre ellas.

3. Bibliografía
[1] Salinas, J., & Lisbona, F. J. Y. (2016). Manual de prácticas de Bioinformática. Universidad Almería-
Armería_España
[2]Bairoch, Amos. (1999). The Enzyne database 2000. Nucleic Acids Research, 2000, Vol. 28, No. 1. Swiia
Institute of bioinformatics.
[3]Proaño-Bolaños, Carolina & li, Renjie & Zhou, Mei & Wang, Lei & Tapia, Elicio & Coloma, Luis & Chen,
Tianbao & Shaw, Chris. (2017). Novel Kazal-type Proteinase inhibitors from the skin secretion of the Splendid
leaf frog, Cruziohyla calcarifer. EuPA Open Proteomics. 15. 1-13. 10.1016/j.euprot.2017.02.001.
[4] Batista, C., L. Rosendo da Silva, A. Sebben, A. Scaloni, L. Ferrara, G. Paiva, C. Bloch, et al. "Antimicrobial
peptides from the Brazilian frog Phyllomedusa distincta1." Peptides 20, no. 6 (1999), 679-686.
doi:10.1016/s0196-9781(99)00050-9.
[5] Proaño-Bolaños, C., Zhou, M., Wang, L., Coloma, L. A., Chen, T., & Shaw, C. (2016). Peptidomic approach
identifies cruzioseptins, a new family of potent antimicrobial peptides in the splendid leaf frog, Cruziohyla
calcarifer. Journal of proteomics, 146, 1-13.
[6]Chen, Tianbao, Lijun Tang, and Chris Shaw. "Identification of three novel Phyllomedusa sauvagei
dermaseptins (sVI–sVIII) by cloning from a skin secretion-derived cDNA library." Regulatory Peptides 116, no.
1-3 (2003), 139-146. doi:10.1016/j.regpep.2003.08.001.

4. Anexos

Anexo 2.Predicción de estructura secundaria la molécula Cruzioseptin-11

Anexo 3. Resultados del analisis de la secuencia similar de DRS-CC1

Anexo 4. Resultados del analisis de la secuencia similar de DRS-CC1