Está en la página 1de 264

Beneficios y Costos de la

Democracia Participativa

Juan Arroyo
Marina Irigoyen
© CARE Perú
Av. General Santa Cruz 659 - 673
Jesús María - Lima 11
Telf.: 431 7430 - 433 4721 - 433 4781
Fax: 433 4753 - 433 0492
www.carepe.org.pe

Oxfam
Baltazar La Torre 906
San Isidro - Lima 27
Telf.: 264 1223
www.oxfam.org.uk
programa_peru@oxfam.org.pe

1ª Edición, octubre de 2008


Tiraje: 1000 ejemplares
Impreso en Perú

ISBN: 978-9972-227-45-5
Hecho el Depósito Legal en la Biblioteca Nacional del Perú Nº 2008-13954

Los auspiciadores no comparten necesariamente las opiniones vertidas en el


presente libro.
Agradecimientos

Nuestro agradecimiento por el apoyo con opiniones


al texto “Desafíos de la Democracia Participativa
Local en la Descentralización”, y en algunos casos
FRQDQRWDFLRQHVD0DUN/HZLV0DUÀO)UDQFNH&DUORV
Herz, Javier Azpur, Eduardo Barzola, Julio Chávez,
Julio Díaz Palacios, Roxana García Bedoya, Sinesio
López, Carlos López, Carlos Paredes, Artemio Pérez,
María Isabel Remy, Esperanza Castro, Walter Varillas,
Víctor Zamora, Mercedes Barnechea y Martín Soto.
Igualmente nuestro agradecimiento a Carlos Rivera
Rúa, asistente de investigación en el presente estudio.
También a quienes han contribuido a la realización
del estudio “Los Costos de la Participación Local” en
particular a los actores sociales de los distritos de Ayaviri,
Santa Rosa y Orurillo, a los directivos y miembros de
sus organizaciones sociales y sus autoridades locales.
Índice

Introducción 9

Prólogo 11

PRIMERA PARTE
Desafíos de la Democracia Participativa Local en la Descentralización
Capítulo 1:
La cobertura y calidad del proceso participativo en la descentralización:
franjas municipales y variantes de democracia local 21

Capítulo 2:
Una descentralización de doble pista: actores que construyen instituciones
e instituciones que promueven actores 33

Capítulo 3:
La fórmula de la sostenibilidad de las experiencias: las combinaciones entre
alcaldes, equipos, proyectos políticos, ONGs y organizaciones sociales 39

Capítulo 4:
Viejas y nuevas institucionalidades mezcladas en la franja avanzada:
Democracia participativa limitada, democracia participativa de representantes
y democracia participativa de representantes con poblaciones 51

Capítulo 5:
Demanda participativa elástica e inelástica: la franja de desempeño óptimo de
la participación 65

Capítulo 6:
La participación de la mujer en la gestión municipal y el desarrollo local con
equidad de género 79

Capítulo 7:
Transición democrática descentralista en post-transición nacional 87

Capítulo 8:
La comunidad epistémica descentralista y el cambio de discurso de la acción
directa a la construcción de sociedades civiles con movimientos sociales 91

5HIHUHQFLDVELEOLRJUiÀFDV 
SEGUNDA PARTE
Estudios de Casos: Desafíos de la Democracia Participativa
Local en la Descentralización

1. La experiencia de Azángaro 103


2. La experiencia de Curahuasi 113
3. La experiencia de Huaccana 125
4. La experiencia de Ichocán 133
5. La experiencia de Jabon Mayo 141
6. La experiencia de Limatambo 149
7. La experiencia de Huancavelica (MECODEH) 155
8. La experiencia de Morropón 163
9. La experiencia de San Marcos 173
10. La experiencia de Santa Rosa 185
11. La experiencia de Santo Domingo 193
12. La experiencia de Nor Yauyos 203

Lista de entrevistados 211

TERCERA PARTE
Los Costos de la Participación Local. El Caso de Puno-Perú

Capítulo 1:
Construyendo una metodología de análisis de los costos de la participación 217

Capítulo 2:
Para un marco teórico sobre la democracia participativa en el Perú 225

Capítulo 3:
El entorno de la participación 235

Capítulo 4:
Las características de la participación social 245

Capítulo 5:
Los costos de la participación 257

5HIHUHQFLDVELEOLRJUiÀFDV 

Relación de entrevistados 266


Introducción

Es una feliz casualidad que este libro se reestrene y pase a su segunda edición,
acompañado de un estudio adicional, justamente a pocos días del ingreso del Presidente
Regional de Lambayeque, Yehude Simon, al Premierato, esto es, en el momento en
que las fuerzas descentralistas agrupadas en la Asamblea Nacional de Presidentes de
Gobiernos Regionales expresan su peso nacional ingresando en el Ejecutivo.

Justamente el libro relata procesos que son fruto de la gesta de una cohorte de
gente descentralista y participacionista en el Perú que en los 90 e incluso desde antes,
comenzó un largo itinerario de acumulación de fuerzas, desde cuando una docena de
alcaldes fundara mesas de concertación para cogobernar con ellas, hasta cuando en
el 2001 ingresaron en la gran política y empujaron y esbozaron una gran reforma de
Estado descentralista, hasta ahora en curso. El último capítulo de esta historia se está
empezando a escribir en vivo, también desde el Gabinete, porque antes se hizo sólo
en la base, en los casos que estudia este libro.

Evidentemente las cosas nunca son parejas y esta trayectoria ha tenido sus
momentos de alza y bajas en los dos últimos años del nuevo gobierno. Ha habido
cambios en el marco institucional que llevaron a la desaparición del Consejo Nacional
de Descentralización y su reemplazo por la Secretaría Técnica de la Descentralización
HQOD3UHVLGHQFLDGHO&RQVHMRGH0LQLVWURV6RQLQLFLDOHVORVHVIXHU]RVTXHVHSHUÀODQ
de su parte para, por ejemplo, promover el desarrollo de capacidades y es por ello
que gobiernos regionales y locales reclaman su concurso. Mientras, está pendiente la
mejora de capacidades de funcionarios y autoridades descentralistas que no logran
invertir los ingentes recursos que el canon ha generado.

+D KDELGR LJXDOPHQWH PiV GHVFHQWUDOL]DFLyQ ÀQDQFLHUD TXH GHPRFUDFLD


participativa y la vida ha llevado a la emergencia de la Asamblea de Presidentes
Regionales y la instalación de hecho de un Gabinete Intergubernamental constituido
por las reuniones periódicas entre el Presidente de la República con la Asamblea. El
Comité de Coordinación Intergubernamental creado por la Ley Orgánica del Poder
Ejecutivo no tiene aún un Reglamento para instalarse, pero las cosas necesitan seguir
canalizándose y ahí están avanzando las mancomunidades de municipalidades, los
concursos del FONIPREL, la descentralización del SNIP, la iniciativa de Presupuesto
por Resultados, la renovación instrumental de los Presupuestos Participativos, además
de los aprendizajes que conlleva las transferencias de funciones y competencias. Y
aún se sienten las airadas voces de protesta de los indígenas de la selva que –en un
HMHUFLFLRGHGHPRFUDFLDFRQÁLFWLYDKR\UHFODPDQRSLQDUVREUHODVLQWHUYHQFLRQHVHQ
sus tierras. No hay nada que se sepa de antemano respecto a este incipiente gobierno
multinivel en el Perú y a las fuerzas sociales que construyen la descentralización.

Este libro estudia el proceso que antecedió a un presente lleno de sorpresas.


Lo hizo con el apoyo de la Cooperación Británica (DFID), CARE Perú, Red Perú,
OXFAM, Centro IDEAS y UNFPA, a los que quedamos eternamente agradecidos,
SXHVQRVD\XGDURQDUHÁH[LRQDUHQPHGLRGHORVVXFHVRV\DFWLYLGDGHV$HVDLQLFLDO
UHÁH[LyQVHVXPDXQDFiSLWHUHIHULGRDORVEHQHÀFLRV\FRVWRVGHODSDUWLFLSDFLyQWHPD
que nos apasiona al retraernos a la cruda realidad y en la búsqueda de balance entre
nuestras aspiraciones por democratizar el Perú y el esfuerzo increíble que varones y
mujeres deben realizar para plasmar sus aspiraciones. En ese trabajo participarón Ana
María Benique y Juan Gonzáles, además de Juan Arroyo y Marina Irigoyen. La rica
H[SHULHQFLDGH3XQRHVXQUHIHUHQWHTXHKDLQVSLUDGRHVWDVUHÁH[LRQHV

Esperamos que este libro sirva a su cometido de abrirle terreno al fortalecimiento


de la descentralización y la democracia en el Perú.

Lima, octubre de 2008


Juan Arroyo y Marina Irigoyen
Prólogo

La insurgencia de los jóvenes parisinos en 1968 y la revueltas juveniles que la


siguieron agotaron la teoría elitista de la democracia en sus diversas variantes. Los
jóvenes exigían espacios políticos de participación y de deliberación y demandaban que
la democracia fuera más allá de los procedimientos para plantear algunos contenidos
que contribuyeran a mejorar la calidad de vida de los ciudadanos. Como resultado
de estos cuestionamientos surgieron nuevos modelos de la teoría democrática,
especialemente la democracia participativa y la democracia deliberativa.

Macpherson se pregunta si en sociedades complejas es posible, además de


elecciones periódicas, la participación en el proceso de la toma de decisiones en cada
una de las esferas de la vida. Argumenta en favor de una transformación política que
combine el sistema de partidos de la democracia representativa con las organizaciones
de democracia directa1. Los partidos políticos deben mantenerse para responder más
a las aspiraciones de sus miembros y de la sociedad y así participan en el parlamento,
complementados y controlados por las organizaciones de autogobierno en los lugares
de trabajo y de comunidades locales.2

0DFSKHUVRQ QR ORJUy GDUOH VLQ HPEDUJR XQ SHUÀO SUHFLVR D OD GHPRFUDFLD
participativa. Pateman ha avanzado un poco en esa direccción. La democracia
SDUWLFLSDWLYD IRPHQWD HO GHVDUUROOR KXPDQR LQWHQVLÀFD XQ VHQWLGR GH HÀFDFLD
política, reduce el sentido de enajenación respecto a los poderes centrales, alimenta la
preocupación por los problemas colectivos e impulsa una ciudanía activa. Ella puede
corregir esa correlación positiva que existe entre apatía y status socioeconómico bajo,
muy típica de las democracias liberales. Esa apatía disminuiría si la democracia contase
con mecanismos de control que comprometan a las instituciones en las que la mayoría
de las personas pasan su vida.

En un continuum que vaya de la participación efectiva a la participación limitada,


las democracias liberales se ubicarían en este último extremo para los sectores más
bajos de la sociedad. Las oportunidades de participación efectiva e involucramiento
en ella de los problemas de la vida cotidiana, producirían ciudadanos activos y darían
mayor consistencia a la democracia.

Mientras la autodeterminación se restrinja a las esfera del gobierno, la democracia


será restringida al voto ocasional y tendrá poco que ver con la calidad de vida de
muchas personas. Para lograr la autodeterminación, los derechos democraticos tienen
que extenderse desde el Estado a las empresas económicas y a otras instituciones

1
Macpherson, C. B. 1977. La Democracia Liberal y su época. Alianza editorial. Madrid. España.
2
Held, David. 1992. Modelos de democracia. Alianza editorial. México
sociales. Dahl proponía en 1986 limitar y democratizar al Leviatán Corporativa (las
corporaciones) que incide decisivamente en la vida de los ciudadanos sin que éstos
puedan responder y defenderse3.

No es posible extender los mecanismos de la democracia directa a toda la


sociedad. La democracia representiva siempre será necesaria. Tampoco la igualdad y la
libertad podrán darse en la dirección de todas las esferas. En toda sociedad moderna
es inevitable el papel reducido del ciudadano en la política nacional.

Muchas de las instituciones centrales de la democracia liberal –los partidos, los


representantes políticos, las elecciones periódicas– son elementos ineludibles también
en una democracia participativa. Estas concesiones no deben ser mal interpretadas.
La participación a nivel local es fundamental no sólo para los ciudadanos porque los
perfecciona sino también para la democracia representativa porque llena algunos de
sus vacíos y la mejora. La participación local los prepara mejor para una participación
nacional. Las conexiones entre lo público y lo privado se entenderían mejor. La
SDUWLFLSDFLyQORFDO\QDFLRQDOGHEHVHUDELHUWD\ÁXLGD/DVRFLHGDGSDUWLFLSDWLYDGHEH
ser una sociedad experimental, una sociedad capaz de exprimentar.

El gran supuesto es que las gentes quieren aumentar el control sobre sus vidas y
que quieren participar... ¿Y sino quieren? He ahí el problema.

1. Representación y participación
La democracia participativa surge como respuesta al agotamiento de la teoría
elitista de la democracia, de larga vigencia en el siglo XX, que había reducido a la
democracia a un procedimiento electoral –eliminando como contenido a la deliberación
y a la participación– y al ciudadano a un voto.

La democracia participativa no es la democracia clásica, tampoco es la democracia


directa, sino que es una variante de la democracia liberal4. Comparte con ellas, sin
embargo, la presencia activa de los ciudadanos sin negar la forma representativa de
toda democracia moderna. En una sociedad moderna, sin representación no hay
democracia5

La democracia representativa comprende, necesariamente, la democracia


electoral, pero la supera con el agregado de elementos propios. La democracia
representativa no excluye la participación ni los mecanismos plebiscitarios sino que

3
Dahl, Robert. Dahl, Robert. 1994. ¿Después de la revolución?. La autoridad en las sociedades avanzadas. Gedisa,
Barcelona.
4
Ver Mcpherson. La democrcia liberal y su época.
5
Ver Dahl, Robert. 1991. La Democracia y sus críticos Paidos. Buenos Aires, Barcelona, México.
Tambien Manin, Bernard. Los principios del gobierno representativo. Alianza, Madrid, 1998.
los incluye pero como elementos subordinados. La participación no sustituye la repre-
sentación.

La participación implica la ciudadanía activa en los asuntos públicos. En este


sentido, tiene un cierto aire de familia con la democracia clásica de los griegos, con el
republicanismo cívico de las ciudadanas italianas del medioevo y con la democracia
directa de la Comuna de París. Este rasgo implica una limitación en el número, al
menos. También en la extensión y en la complejidad.

La participación, como ha demostrado Sartori, está en relación inversa con el


número de los participantes: “Así, en un grupo de cinco mi acción de tomar parte
vale o cuenta un quinto, en un grupo de cincuenta un quincuagésimo y en uno de
cien mil casi nada. En suma, el participar es operable tal como una fracción cuyo
denominador mide la parte (el peso) de cada participante, y en tanto el denominador
crece, igualmente disminuye la potencia de la participación del individuo”6 .

(VWRLPSOLFDTXHODGHPRFUDFLDSDUWLFLSDWLYDWLHQHXQiPELWRTXHOHpVHVSHFtÀFR
el local. En el nivel nacional pueden operar los mecanismos plebiscitarios7, además de
los propiamente representativos.

Un tema que es necesario considerar es el de la intensidad de la participación:


Ella depende de múltiples factores. Mencionaré solamente los dos más importantes.
En primer lugar, ella está en relación directa con el tiempo disponible dentro de los
múltiples roles que cumplen los hombres y las mujeres en una sociedad moderna. En
segundo lugar, del desarrollo de la cultura cívica con el cual la participacion guarda
una relación directa.

2. Los principios y las formas institucionales


Erick Olin Wright y Archon Fung8 han analizado las nuevas formas institucionales
deGobiernoParticipativoconPoderdeDecisión(GPPD)parapromovertrestendencias
en las ciencias sociales y la teoría democrática: “En primer lugar, el modelo deriva
muchas de sus orientaciones normativas de los análisis de las prácticas y los valores de
la comunicación, el debate público y la deliberación. La aplicación de la deliberación se
H[WLHQGHGHOiPELWRDEVWUDFWRGHOSUREOHPDGHORVFRQÁLFWRVGHYDORUHV\ORVSULQFLSLRV
de la justicia hasta aterrizar en asuntos concretos como la pavimentación de vías, el
mejoramiento de las escuelas y la administración del ecosistema… Una buena parte de
los estudios recientes sobre la participación ciudadana y las asociaciones secundarias
ofrecen una segunda bifurcación del GPPD. Esta línea de trabajo intelectual busca

6
Sartori, Giovanni. 1997 ¿Qué es la democracia? Nueva Imagen. México.
7
Pateman, Carole .1970. Participation and Democratic Theory. Cambridge University Press. Cambridge.
8
Fung, Archon y Olin Wright, Eric. 2003. Democracia en profundidad. Nuevas formas institucionales de gobierno
participativo con poder de decisión.
entender, y con ello demostrar, la importancia de la vida cívica y de las organizaciones
no gubernamentales para una democracia vigorosa. El GPPD se basa en estos aportes
para explorar nuevas alternativas de reorganización de las instituciones formales del
Estado que puedan estimular la participación democrática de la sociedad civil, y de
esta forma articula un círculo virtuoso de refuerzo recíproco. Finalmente, el GPPD es
parte de una tarea más amplia, en la que están involucrados muchos investigadores y
ciudadanos, que pretende imaginar y descubrir instituciones democráticas que sean, a
ODYH]PiVSDUWLFLSDWLYDV\HIHFWLYDVTXHODVFRQÀJXUDFLRQHVGHUHSUHVHQWDFLyQSROtWLFD
y administración burocrática a las que estamos acostumbrados. Al enriquecer en
forma considerable nuestra comprensión de las instituciones, prácticas y resultados de
la participación ciudadana, el modelo GPPD contribuye a esa tarea amplia”.

El GPPD parte de tres principios generales que son fundamentales a todos los
H[SHULPHQWRV \D GHVFULWRV   FRQFHQWUDFLyQ HQ SUREOHPDV HVSHFtÀFRV \ WDQJLEOHV
(2) participación activa de la gente común y corriente a quienes los afectan esos
SUREOHPDV\GHORVIXQFLRQDULRV FHUFDQRVD HOOD\  HOGHVDUUROOR GHOLEHUDWLYR GH
soluciones a esos problemas. En los contextos de reforma institucional, son tres los
diseños institucionales que parecen darle estabilidad y profundidad a la práctica de
esos principios básicos. Tales rasgos institucionales son: (1) la delegación de autoridad
DODVXQLGDGHVORFDOHVFRQSRGHUSDUDODWRPDGHGHFLVLRQHVS~EOLFDV  ODFUHDFLyQGH
eslabones formales de responsabilidad, distribución de recursos y comunicación que
FRQHFWDQHVDVXQLGDGHVHQWUHVt\FRQODVDXWRULGDGHVFHQWUDOHVDQLYHOHVVXSHULRUHV
(3) el uso y la generación de nuevas instituciones estatales que apoyan y guían los
esfuerzos de solución de problemas de una forma descentralizada.

3. Participación y competencia política


Las teorías contemporáneas de la democracia participativa incluyen el
argumento según el cual los individuos deberían recibir algún tipo de “entrenamiento”
democrático fuera del proceso político nacional. Dahl o Eckstein indican cómo podría
darse este “entrenamiento” y señalan que es algo paradójico que en las organizaciones
y asociaciones existentes, especialmente en las industriales que son estructuras
oligárquicas y jerárquicas, se produzca un entrenamiento para la democracia9.

Resulta más coherente el argumento según el cual la educación para la democracia,


que tiene lugar a través del proceso participativo en estructuras de autoridad no
gubernamentales, requiere que dichas estructuras hayan experimentado un proceso de
democratización. La teoría de la democracia participativa argumenta que la experiencia
de participación de algún modo deja al individuo mejor equipado psicológicamente
para iniciar una mayor participación en el futuro.

9
Pateman, Parlicipation and Democratie Theory (1970)
John Stuart Mill argumentó que un carácter “activo” de los ciudadanos resulta
de la participación. Cole sostuvo que el carácter “no-servil” de los ciudadanos sería
fortalecido con la participación. Una de las más importantes correlaciones positivas
que han surgidos de las investigaciones empíricas es la que existe entre la participación
\ODHÀFDFLDSROtWLFDRODFRPSHWHQFLDSROtWLFD$OPRQG\9HUEDDXWRUHVGH´/D&XOWXUD
Cívica”, encontraron que en los cinco países examinados (U.S.A., Gran Bretaña,
Alemania, Italia y México) se mantiene una relación positiva entre el sentimiento de
HÀFDFLDSROtWLFD\ODSDUWLFLSDFLyQSROtWLFD(OVHQWLPLHQWRGHFRPSHWHQFLDIXHPiVDOWR
en el nivel local que en el nivel nacional. También se encontró que en U.S.A. y Gran
Bretaña, donde existen más oportunidades institucionales para la participación local,
el nivel de competencia fue más alto que en los otros países.

Ellos analizaron también los efectos de la participación en las organizaciones


GHYROXQWDULRV\HQFRQWUDURQTXHHQORVFLQFRSDtVHVHOVHQWLGRGHHÀFDFLDSROtWLFD
fue más alto entre los miembros de organizaciones que entre los no-miembros y
que el más alto de todos se hallaba entre los miembros activos de organizaciones
explícitamente políticas. La teoría participativa de la democracia tiene similitudes con
los argumentos recientes acerca del pluralismo social. Almond y Verba sostienen que
el pluralismo, especialmente el pluralismo explícitamente político, es uno de los más
importantes fundamentos de la democracia política. Recientes investigaciones en
socialización política sostienen que los teóricos de la democracia participativa estaban
ELHQHQFDPLQDGRVFXDQGRDÀUPDURQTXHODVH[SHULHQFLDVGHODJHQWHHQHVWUXFWXUDV
de autoridad no gubernamental ayudarían a la participación en la esfera propiamente
SROtWLFD$OPRQG\9HUEDDÀUPDURQTXHKD\TXHHVWDUDWHQWRVDHVWDVH[SHULHQFLDVGH
participación que tienen los adultos. Easton, en cambio, sostuvo que las experiencias
comienzan en la niñez. En realidad, es necesario analizar las experiencias de la adultez
que están relacionadas más directamente con la esfera política participativa sin desdeñar
las experiencias tempranas de los niños. Ciertamente, las experiencias de participación
HQHOFHQWURGHWUDEDMRDIHFWDQHOVHQWLGRGHHÀFDFLDSROtWLFDHQORVDGXOWRV

El argumento principal de la teoría de la democracia participativa es que la


participación en estructuras de autoridad no gubernamentales es necesaria para
IRUWDOHFHU \ GHVDUUROODU ODV FXDOLGDGHV SVLFROyJLFDV HO VHQWLGR GH HÀFDFLD SROtWLFD 
requeridas para la participación en el nivel político nacional. La evidencia también
ha mostrado que la industria es la más importante esfera para esta participación en la
sociedad moderna.

Pese a que la participación en el lugar de trabajo ha sido demostrado como vital


para la amplia participación política, puede argumentarse, sin embargo, que no es de
importancia central ya que en la actualidad el tiempo libre es crecientemente la parte
más importante de la vida del trabajador y la esfera donde él espera ganar, y puede
ganar, satisfacciones psicológicas. Los autores que plantean esto están convencidos
de que los trabajadores, especialmente los trabajadores manuales, tienden a considerar
al trabajo como algo puramente instrumental y que centran sus aspiraciones en
el tiempo libre. Puede decirse también de que el tiempo libre puede proveer un
UHHPSOD]R SDUD HO WUDEDMR PiV DOOi GHO VHQWLGR GH OD HÀFDFLD SROtWLFD 6LQ HPEDUJR
KD\ DOJXQDV GLÀFXOWDGHV HQ HVWH DUJXPHQWR 3ULPHUR H[LVWH XQD GHVLJXDOGDG EiVLFD
en la sociedad en la que un segmento de consumidores son creativos en su tiempo
libre aunque tienen un trabajo sin sentido y un segundo segmento que es capaz de la
DXWRUHDOL]DFLyQHQDPEDVHVIHUDVGHODYLGD HOWUDEDMR\HOWLHPSROLEUH (VWRVLJQLÀFD
TXHORVEHQHÀFLRVSVLFROyJLFRVYDQDVHUGLIHUHQWHVSDUDDPERVVHJPHQWRV6HJXQGR
el “argumento del tiempo libre” ignora la aserción de los teóricos de la democracia
participativa de la interrelación de individuos e instituciones. Si una cierta clase de
estructura de autoridad industrial puede afectar la participación política, entonces ¿por
TXpQRSXHGHDIHFWDUHOWLHPSROLEUHWDPELpQ")LQDOPHQWHH[LVWHHOKHFKRVLJQLÀFDWLYR
según el cual aquellas personas que más participan en tipos ‘públicos’ de actividades
de tiempo libre (organizaciones voluntarias, políticas), son justo aquellos grupos que
tienen el estatus socioeconómico más alto: ellos son los más propensos a trabajar en
XQDPELHQWHTXHSHUPLWHGHVDUUROODUXQVHQWLGRGHHÀFDFLDSHUVRQDO

4. Participación y esfera pública


La teoría democrática elitista supone una contradicción entre gobernabilidad
y participación. El origen de esta contradicción hay que buscarlo en el debate entre
guerras y la crítica de Max Weber, Carl Schmitt y Schumpeter a dos concepciones
centrales en la teoría democrática: la soberanía popular y la publicidad. Esta crítica
dio origen al elitismo democrático, según el cual la democracia para practicarse
necesita restringir la soberanía de las masas a un procedimiento para la selección de
los gobernantes10

Para el elitismo democrático el mantenimiento de la democracia está ligado a la


restricción de la soberanía popular y a la transferencia de la racionalidad de las elites
al sistema político.

Esta teoría ha sido cuestionada en los últimos 20 años por dos motivos.

D 3RUODVIRUPDVGHPRYLOL]DFLyQSURSLDGHHQWUHJXHUUDV FRQIURQWDFLRQDOHV 


por las formas de acción colectiva de la tercera ola de democratización. Estas
movilizaciones en lugar de amenazar a la democracia, la demandaban.
b. Con la consolidación de la democracia apareció la importancia de las
formas públicas de rendición de cuentas y la transparencia en las nuevas
democracias.

10
Avritzer,Leonard. En: Metapolítica N. 16. Ver también: Bohman, James.1997. Deliberative Democracy and
effective Social Freedom: Capabilities, Resources, and Opportunities. En: Bohman, James and Rehg, William.
1997. Deliberative Democracy. The MIT Press. Cambridge-Massachussetts-London. Habermas, Jurgen 1997.
Popular sovereignty as Procedure. En: Bohman, James and Rehg, William. 1997. The MIT Press. Cambridge-
Massachussetts-London.
De este modo se recupera el elemento societal en las teorías de la democratización.
Esto supone: a. la introducción de elementos deliberativos más fuertes en la esfera
pública. b. La incorporación de los movimientos sociales en una propuesta de la esfera
pública ofensiva. c. La democracia va más allá del debate entre elitistas y republicanos,
SXHVHOODFRQWLHQHHOHPHQWRVGHOLEHUDWLYRVHQVXFRQÀJXUDFLyQLQVWLWXFLRQDO

El concepto de esfera pública tiene dos características centrales desde un punto


de vista de la democracia.

a. La reivindicación de un espacio para la interacción cara a cara distinto del


Estado. Allí se discute las decisiones tomadas por la autoridad, el contenido
moral de las diferentes relaciones existentes en la sociedad y se presentan
demandas al Estado. Los individuos discuten y deliberan sobre cuestiones
políticas y elaboran estrategias para sensibilizar a la autoridad. El uso público
de la razón establece una relación entre participación y argumentación
pública. El argumento prevalece sobre la jerarquía social.
b. La ampliación del dominio público que conduce a la politización de nuevas
cuestiones. Hay una desacralización de la política al sacarla del monopolio
del Estado o de la Iglesia para extenderla y someterla a la discusión pública.
Por ello la esfera pública es igualitaria no sólo porque permite la participación
en el debate sino también porque nuevas cuestiones, presentes en mundo
privado, entran a la esfera pública.

La esfera pública rompe con dos elementos del elitismo democrático:

a. Conlaimposibilidaddelaexistenciadeformasparticipativasdeadministración.
Al distinguir Estado de esfera pública, se introduce un nivel adicional para la
participación política. No emerge inmediatamente una nueva administración
sino que emerge un nuevo espacio de discusión que pone en cuestión la
administración.
b. La disociación entre el bien común y las formas sustantivas de alcanzarlo.
El bien común puede ser formal y puede ser pensado en términos de la
capacidad de los diferentes actores sociales de publicitar su lucha contra las
formas privadas de dominación. La construcción pública de identidades y
de nuevas formas de solidaridad, posibilita la superación de las formas de
dominación privada.

La teoría de la esfera pública no sólo abre un espacio para la participación sino que
la fundamenta de acuerdo con la forma como se estructuran las sociedades modernas.
(OORJURGHOFRQVHQVRDWUDYpVGHODFRPXQLFDFLyQFDUDDFDUDHVHOHOHPHQWRTXHMXVWLÀFD
la existencia permanente de un espacio público. Así la publicidad es una característica
de la democracia moderna. Esto implica una ruptura con el elitismo democrático en la
medida que todos los actores sociales son igualmente capaces de dominar el lenguaje
y argumentar públicamente. Esto implica la posibilidad de someter a la autoridad
pública a la crítica. La administración pública para Habermas está vinculada al proceso
de complejización al que se puede aplicar la razón instrumental.

Al diferenciar racionalización de complejización, Habermas ofrece una alternativa


a las respuestas republicanas y elitistas de la democracia acerca de la participación. De la
tradición elitista el rescata la preocupación sobre los límites internos consustanciales a la
complejidad de la administración pública. Del republicanismo rescata la comprensión
de la democracia como un proceso de utilización pública de la razón.

Habermas opera entre una administración estatal cuya autonomía está asegurada
por el derecho y un principio de la formación de la opinión pública que tiene dos
características principales: su informalidad, en la medida que para Habermas sólo
HOVLVWHPDSROtWLFRSXHGHDFWXDU\ODFDSDFLGDGGHJHQHUDUÁXMRVFRPXQLFDWLYRVTXH
esclarezcan las formas administrativas del poder político.

A diferencia de la democracia directa, la democracia participativa no niega a la


democracia representativa sino que busca llenar algunos vacíos que ésta implica al operar
en sociedades extensas, pobladas y complejas. La democracia participativa funciona
sobre todo a nivel local. Por esa razón todas las investigaciones que buscan esclarecer
su organización y funcionamiento se concentran en la investigación de aspectos de
la misma o de localidades en donde ella opera. Este fue el sentido de la primera
investigación sobre democracia participativa de Marina Irigoyen y Juan Arroyo. A ellos
se suman en esta nueva investigación Ana María Benique y Juan González Cutipa. La
principal contribución de la investigación sobre la participación en Puno es el análisis
GHVXVFRVWRV6LQGXGDODSDUWLFLSDFLyQWLHQHFRVWRV\EHQHÀFLRV+DVWDDKRUDVHKD
HQIDWL]DGRHOODGRGHORVEHQHÀFLRV<DHUDKRUDTXHVHLOXPLQDUDHOODGRGHORVFRVWRV
aunque esa incursión implique apelar a otra tradición teórica: la teoría de la elección
racional cuyo pionero en el campo de la democracia fue Anthony Downs11. Uno
de los mayores costos puede ser la introducción de elementos de ingobernabilidad,
especialmente cuando la participación invade el campo de la administración que se
JXtDQRSRUODOyJLFDGHODSDUWLFLSDFLyQVLQRSRUHOGHODHVSHFLDOL]DFLyQ\ODHÀFDFLD

Sinesio López Jiménez

11
Downs, Anthony. 1957. An Economic Theory of Democracy.Harper and Row Publishers. New York.
PRIMERA PARTE

Desafíos de la Democracia
Participativa Local en la
Descentralización

Juan Arroyo
Marina Irigoyen
Desafíos de la Democracia Participativa Local en la Descentralización

Capítulo 1:
La cobertura y calidad del proceso
participativo en la descentralización:
franjas municipales
y variantes de democracia local

1.1 La cobertura del proceso


¿Cuál es el universo de población involucrada en las experiencias participativas en
HOSDtV"(VGLItFLOSUHFLVDUORSRUTXHQRH[LVWHXQVLVWHPDGHLQIRUPDFLyQTXHSHUPLWD
el seguimiento de la participación en la descentralización en base a data objetiva. El
&RQVHMR1DFLRQDOGH'HVFHQWUDOL]DFLyQ &1' FDOFXODTXHKDVWDHOSUHVHQWHDxRKDEtD
Consejos de Coordinación Local (CCL) en 600 municipios del país (Díaz Palacios,
 /D0HVDGH&RQFHUWDFLyQGH/XFKDFRQWUDOD3REUH]D 0&/3 HVWLPDTXH
se han instalado CCL en el 59% de los distritos, si bien aún está por ser aplicado un
instrumento de recolección de información. A nivel provincial se informa existen
CCL en 159 provincias, esto es en el 82% del total.1 Dada la diferencia de las cifras,
KHPRVSUHIHULGREDVDUQRVHQDPEDVIXHQWHVSDUDXQFiOFXORSURSLRTXHQRVLQGLFD
TXHGDGRTXHH[LVWHQDKRUDPXQLFLSLRVGLVWULWDOHV\PXQLFLSLRVSURYLQFLDOHV
en el Perú, aproximadamente el 45% de los municipios habría entrado ya al proceso
de reforma de la relación Estado-sociedad a nivel local. Este porcentaje da cuenta
aproximada de la “cobertura del proceso participativo”.

___________________________________________________
1 La información del CND ha sido tomada del informe de Julio Díaz Palacios y la de la MCLP fue proporcionada por Roxana
García Bedoya, estimada en base a una evaluación rápida en un Taller de la MCLP.

13
Juan Arroyo y Marina Irigoyen

1.2 La calidad de la participación: las franjas municipales


participacionista, institucionalista y tradicional
La extensión no da cuenta sin embargo de la “calidad de la participación en la
GHVFHQWUDOL]DFLyQµYDULDEOHTXHWDPELpQHVSUHRFXSDFLyQGHOSUHVHQWHLQIRUPH3DUD
aproximarnos a ella es necesario diferenciar franjas municipales dentro del proceso
de descentralización local.

Del total de 900 municipios con procesos participativos en curso hay


aproximadamente 200 municipios conducidos por alcaldes participativos “por
FRQYLFFLyQµTXHVRQORVTXHHVWiQYLQFXODGRVDUHGHVGHPXQLFLSDOLGDGHV\GHHVSDFLRV
de concertación como RED Perú, REMURPE y a asociaciones municipales regionales
como AMRA en Apurímac, AMRESAM en San Martín, MUNIRED en Huanuco
y AMCEC en el Corredor Crisnejas, Cajamarca. Esta franja es uno de los actores
FODYHVGHOSURFHVRGHGHVFHQWUDOL]DFLyQQDFLRQDO6HSXHGHLQIHULUTXHHQHVWDIUDQMD
TXHFRPSUHQGHDSUR[LPDGDPHQWHDOGHORVPXQLFLSLRVGHOSDtVORVSURFHVRV
de participación son más activos y de mayor calidad.

6HGHGXFHHQWRQFHVTXHHVSRVLEOHGLVWLQJXLUWUHVIUDQMDVPXQLFLSDOHVHQFXDQWR
a la calidad de la participación en la descentralización:

• la de los municipios con alcaldes participativos por convicción,


• la de los municipios participativos por cumplimiento de las normas o
“institucionalistas” y,
• la de los municipios rezagados en el proceso de descentralización participativa,
con una relación tradicional o incluso autoritaria con la población.

Hay así experiencias municipales participacionistas, institucionalistas y tradicionales.


Actualmente –conforme a lo anterior– la primera franja abarca el 10% de los
municipios, la segunda el 35% y la tercera el 55% de los mismos.

Nuestras doce experiencias están ubicadas en la primera franja municipal, la de


DOFDOGHVSDUWLFLSDWLYRV(VWRTXLHUHGHFLUTXHQRGDQFXHQWDGHOFRQMXQWR6LQHPEDUJR
dichos municipios han sido y son la locomotora del proceso y el laboratorio de la nueva
DUTXLWHFWXUDLQVWLWXFLRQDOWHQLHQGRDGHPiVXQDJUDQLQÁXHQFLDHQVXVUHVSHFWLYRV
GHSDUWDPHQWRV+HPRVFRQVWDWDGRTXHWLHQHQXQ´HIHFWRGHGHPRVWUDFLyQµVREUH
ORV GHPiV PXQLFLSLRV GH VXV GHSDUWDPHQWRV TXH HQ SDUWH GHVHDQ LPLWDUORV (VWD
IUDQMDKDFHGLH]DxRVHUDDSHQDVXQQ~FOHRGHQRPiVGHH[SHULHQFLDVPXQLFLSDOHV
participativas y hoy ha terminado compartiendo el liderazgo de un proceso nacional.

14
Desafíos de la Democracia Participativa Local en la Descentralización

/RVFiOFXORVUHDOL]DGRVSRU5('3HU~HVWLPDQTXHHODxRSRUORPHQRV
personas se han involucrado en los Presupuestos Participativos (PP). Se estima esta
FLIUDSRGUtDVHUPiVGHOGREOHHOSUy[LPRDxR2 /RTXHVXFHGDFRQHVWDIUDQMDPXQLFLSDO
avanzada tendrá entonces suma importancia en la cobertura, calidad, sostenibilidad
e impacto de la descentralización local sobre la calidad de vida y el empoderamiento
de las comunidades y personas.

En la década del fujimorismo la abrumadora mayoría de gestiones locales era


GH WLSR WUDGLFLRQDO \ VyOR XQD tQÀPD PLQRUtD GH WLSR SDUWLFLSDWLYR $ SDUWLU GHO
*RELHUQR GH 7UDQVLFLyQ OD FRQFHUWDFLyQ VH FRQYLUWLy HQ SROtWLFD RÀFLDO DO FUHDUVH
OHJDOPHQWHHQHQHURGHODxROD0HVDGH&RQFHUWDFLyQGHOD/XFKDFRQWUDOD
Pobreza y luego legislarse la participación local vía los CCLs y PPs, empezando a
coexistir las tres franjas municipales actuales: la participacionista, la institucional y
la tradicional. Actualmente, como vimos, la franja tradicional aún prima, pero la
WHQGHQFLDSDUDHOSUy[LPRDxRGHELHUDVHUTXHODVGRVSULPHUDVIUDQMDVFUH]FDQ\OD
tercera disminuya.

3HURWRGRGHSHQGHGHTXpVXFHGDFRQODGHVFHQWUDOL]DFLyQ\FXiOVHDODUHVXOWDQWH
GHODFFLRQDUGHORVDFWRUHVTXHODYLHQHQPROGHDQGR/RVLQGLFDGRUHVFUtWLFRVGHp[LWR
D PRQLWRUHDU VLVWHPiWLFDPHQWH VRQ DTXt OD SURSRUFLyQ GH PXQLFLSLRV LQWHJUDGRV DO
proceso de descentralización y el peso de las franjas municipales participacionista
e institucionalista en el conjunto, además del porcentaje del presupuesto nacional
UHGLVWULEXLGRHQORVQLYHOHVUHJLRQDO\PXQLFLSDO/DHYLGHQFLDDFWXDOLQGLFDTXHVLGRV
tercios no aplica la Ley Orgánica de Municipalidades (LOM) y un 35% lo hace al mínimo
²WRGDYtDQRVHGHÀQHHOSHUÀOGHVDOLGDGHOSURFHVRGHGHVFHQWUDOL]DFLyQPXQLFLSDO(V
YHUGDGTXHHOSURFHVRHVWRGDYtDLQLFLDO\QRHVSRVLEOHVDFDUFRQFOXVLRQHVGHÀQLWLYDV
3HURWDPELpQHVYHUGDGTXHVHKDHVWDGRWUDEDMDQGRHQHOVXSXHVWRGHTXH\DH[LVWHOD
GHVFHQWUDOL]DFLyQGHPRFUiWLFDFRPRSROtWLFDGH(VWDGRFRQFHSWRTXHQRWLHQHTXHYHU
VyORFRQORTXHGLJDQORVGRFXPHQWRVRÀFLDOHVVLQRFRQHOFRQVHQVRFRQVWUXLGRHQHO
SDtVTXHOHVRWRUJDLUUHYHUVLELOLGDG<HQORVSDtVHVGHVLQVWLWXFLRQDOL]DGRVODGLVWDQFLD
entre las normas y la realidad es mayor. No es casual “la inefectividad de la ley” se haya
convertido en un objeto de estudio en las ciencias sociales latinoamericanas (O´Donnell,
 7RGRSDUHFHLQGLFDUHQWRQFHVTXHH[LVWHXQGLOHPDLQVWLWXFLRQDOHQHOSDtVXQD
LQGHFLVLyQD~QVREUHHOWLSRHVSHFtÀFRGHUpJLPHQGHPRFUiWLFRPiVFRQYHQLHQWHDOSDtV
(VWRDQLYHOPXQLFLSDOWLHQHTXHVHUGHÀQLGRHODxRDXQTXHSRGUtDVHUSRVWHUJDGR
TXHWDPELpQHVXQDIRUPDGHGHÀQLUOR

___________________________________________________
2 Entrevista a Julio Díaz Palacios, 14 de diciembre de 2004.

15
Juan Arroyo y Marina Irigoyen

1.3 Las bases sociales de las experiencias estudiadas: democracias


inclusivas en zonas de exclusión
¿Pero está realmente participando una parte importante de la población, en
particular los pobres, en las nuevas estructuras descentralizadas locales? Nuestro
HVWXGLR SXHGH GDU FXHQWD GH OR TXH VXFHGH DO UHVSHFWR HQ ODV GRFH H[SHULHQFLDV
SDUWLFLSDWLYDV HVWXGLDGDV \ GHGXFLU DOJR GH OR TXH SXHGH HVWDU VXFHGLHQGR HQ ODV
franjas institucionalista y tradicional.

Conforme se puede observar en la Tabla Nº 1, las doce experiencias locales


HVWXGLDGDVVXPDQXQDVXSHUÀFLHDSUR[LPDGDGHPLONLOyPHWURVFXDGUDGRV\XQD
población de alrededor de 836,716 personas, de las cuales 460 mil corresponden
al departamento de Huancavelica. Es en este universo donde se procesan algunas
de las experiencias más profundas y variadas de participación y concertación local
en el país.

Lo más resaltante para introducirnos a su comportamiento social y político


QR HV HO WDPDxR GH ODV H[SHULHQFLDV SXHV ODV KD\ PX\ SHTXHxDV VLQR VXV
características sociales, en particular los elevados niveles de pobreza de todos
los distritos y provincias, sus altos porcentajes de ruralidad y las altas tasas de
PRUWDOLGDGLQIDQWLO\GHGHVQXWULFLyQSUHVHQWHVHQHOORV(VWRTXLHUHGHFLUTXH
las bases estructurales donde se asienta la actividad de esta parte de la franja
municipalista participacionista son contextos de gran pobreza y exclusión social,
dándose en ellas una mezcla de democracias avanzadas y economías rezagadas. Se
trata de experiencias de democracias inclusivas en zonas de exclusión, una cosa
LQLPDJLQDEOHSDUDTXLHQHVSLHQVDQTXHHO~QLFRHVTXHPDGHFRPSRUWDPLHQWRVRFLDO
de los pobres son los movimientos irruptivos e inorgánicos, sólo de protesta,
reactivos, sobre los cuales teorizara Smelser (1989). En una franja de distritos
y provincias pobres del país se viene intentando pasar de la teoría de la acción
directa de los 70´s a la construcción de sociedades civiles y movimientos sociales,
GH SREUHV KH DKt OD DSXHVWD KLVWyULFD TXH OD IUDQMD PXQLFLSDOLVWD SDUWLFLSDWLYD
VHKDSURSXHVWR\TXHYDOHODSHQDHOSDtVFRQR]FD\YDORUHFRPRRWURFDPLQR
posible.

Salvo la provincia de Yauyos, todas las demás experiencias provinciales se


levantan sobre poblaciones con más de 80% de pobres: Azángaro, en donde el
DOFDOGH3HUF\&KRTXHFRQVWUX\HXQDGHODV0HVDVPiVDUERULÀFDGDVGHOSDtVWLHQH
GHSREUHV\H[WUHPDGDPHQWHSREUHV6DQ0DUFRVSURYLQFLDFDMDPDUTXLQD
con una Mesa de larga trayectoria y reconocimiento (CINDESAM), tiene 86,5% de

16
Desafíos de la Democracia Participativa Local en la Descentralización

pobres y pobres extremos. Huancavelica, el departamento donde surgió entre 1998


y el 2000 la experiencia de la Mesa de Concertación del Desarrollo de Huancavelica
(MECODEH), tiene 88,5% de su población en pobreza y pobreza extrema.

,JXDOSDVDFRQORVGLVWULWRVHVWXGLDGRV6DOYR$OLVHQ<DX\RVTXHWLHQHVyOR
XQGHSREUHV\GHSREUHVH[WUHPRVORTXHSXHGHD\XGDUDH[SOLFDU
su dinámica basada fuertemente en el consenso pasivo -, todos los distritos están
por encima del 70% de población en pobreza y pobreza extrema. Huaccana y
Curahuasi, ambos de Apurímac, tienen respectivamente 98,7% y 95% de población
SREUHHLQGLJHQWH(OGLVWULWRGH6DQWD5RVDHQ3XQRDTXHOHQGRQGH-XOLiQ3iXFDU
VXDOFDOGHKDUHLQYHQWDGRHOHVTXHPDQRUPDGRGHJRELHUQRORFDOHLQVWDODGRXQ
Consejo de Autogobierno Local con 120 miembros, tiene 92,8% de pobres y
SREUHV H[WUHPRV /LPDWDPER HO GLVWULWR FXVTXHxR GHVGH GRQGH :LOEHUW 5R]DV
proyectara al país durante los 90 una nueva forma de buen gobierno local, tiene
88,1% en pobreza y extrema pobreza. Santo Domingo, el distrito piurano del
alcalde Carlos López, otra de las experiencias modelo en el país, tiene 80,9%
de pobres y pobres extremos; cifra muy similar a la de su vecino distrito de
Morropón, con 79,1% de pobres. Ichocán en Cajamarca tiene 82% de pobres
e indigentes y todos los distritos de la provincia de Canas involucrados en la
experiencia de Jabon Mayo tienen una población pobre y en extrema pobreza
TXHYDHQWUH\

17
18
Tabla N° 1: Características de los Experiencias de Participación Estudiadas

Distrito Estudiado Km2 Pob2004 Pob0-6 Pob7-13 Pob65-mas Mujer15-49 % Pob. TMI 96 Desnut. 99 % Pobres % Pobr.
Rural Extrem.
CURAHUASI 818.0 20.688 4.037 3.642 1.343 4.161 82.9 56.5 46 95.0 62.5
HUACCANA 472.1 11.289 1.410 1.305 489 2.406 94.4 66.1 51.1 98.7 70.3
ICHOCAN 76.1 3.706 672 659 184 862 81.3 44.1 37.2 82.0 15.3
LIMATAMBO 512.9 9.264 1.611 1.555 487 2.219 89.8 69.2 40.6 88.1 24.8
Juan Arroyo y Marina Irigoyen

YANAOCA* 293.0 11.787 2.029 1.964 612 2.925 81.9 102.3 48.4 78.8 15.5
CHECCA * 503.8 6.690 1.190 1.147 361 1.670 97.7 153.9 46.3 86.7 12.3
LANGUI* 187.1 3.824 649 627 196 926 86.6 122.8 34.9 82.8 17.3
LAYO* 452.6 7.547 1.320 1.274 400 1.858 93.4 95.9 42.3 85.1 20.6
PAMPAMARCA* 29.9 2.547 446 428 136 630 63.2 131.5 50.6 68.5 4.6
QUEHUE* 143.5 3.289 560 541 174 810 95.9 139.9 52.1 83.3 16.3
TUPAC AMARU* 117.8 3.688 639 616 194 913 81.1 119.5 53.1 83.1 14.7
ALIS 142.1 3.210 254 264 114 872 6.6 43.2 28.3 15.6 0.8
MORROPON 170.0 17.650 2.996 3.005 892 4.386 36.4 62.3 21.1 79.1 21.4
STO. DOMINGO 187.3 10.209 1.603 1.605 478 2.454 89.0 77.4 34.9 80.9 18.8
SANTA ROSA 790.4 7.381 1.158 1.165 473 1.805 56.0 101.3 38.7 92.8 59.5
Provincia Estudiada Km2 Pob2004 Pob0-6 Pob7-13 Pob65-mas Mujer15-49 % Pob. TMI 96 Desnut. % Pobres % Pobr.
Rural 99 Extrem.
SAN MARCOS 1.362 62.215 11.029 10.813 3.052 13.612 83.8 60.8 45.6 86.5 25.1
YAUYOS 6.902 29.091 3.340 3.472 1.440 7.802 39.9 78.6 37.1 54.2 5.8
AZANGARO 4.970 162.659 26.682 26.840 10.810 40.843 78.7 84.5 39.9 96.1 67.3
% Pob. % Pobr.
Depart. Estudiado Km2 Pob2004 Pob0-6 Pob7-13 Pob65-mas Mujer15-49 TMI 2000 Desnut. % Pobres
Rural 99 Extrem.
HUANCAVELICA 22.132 459.982 91.583 86.282 26.477 101.805 73.5 71 55.4 88.5 74.1
Fuentes: INEI, Mapa de Pobreza del MEF y Censo de Talla Escolar 1999 del MINEDU.
* Distritos que corresponden a la experiencia de Jabon Mayo.
Desafíos de la Democracia Participativa Local en la Descentralización

/D PHGLFLyQ GHO ,QGLFH GH 'HVDUUROOR +XPDQR UHDOL]DGD HO  UDWLÀFD
estas características de las provincias estudiadas: los puntajes de San Marcos,
Azángaro y Canas salieron en 0.459, 0.474, 0.477 respectivamente. Sólo Yauyos
salió mejor librado, con 0.584 de puntaje. Las altas tasas de mortalidad infantil
\GHGHVQXWULFLyQVRQODPHQWDEOHPHQWHÀHOUHÁHMRGHODVFDUHQFLDVTXHVHYLYHQ
en estas zonas.

Se trata entonces de experiencias de democracia local participativa en contextos


de pobreza y pobreza extrema mayoritarios. La realidad social de las localidades rurales
VHDSUHFLDHVFDVLVLPLODUXQSHTXHxRYpUWLFHQRSREUH\XQJUDQFXHUSR\EDVH
de pobres y extremadamente pobres.

6HGHGXFHGHHVWRTXHWRGDDSHUWXUDLQVWLWXFLRQDOPXQLFLSDOHQODPD\RUtDGH
estas experiencias involucra necesariamente a los pobres, hasta por el hecho de
TXHODIUDQMDQRSREUHHVDYHFHVPX\SHTXHxD(Q+XDFFDQDORVQRSREUHVVRQHO
1,3%, en Curahuasi son el 5%, en Santa Rosa llegan al 7,2%, en Limatambo son el
11,9%, en la provincia de Azángaro el 3,9% y en el departamento de Huancavelica
el 11,5%. En todos los demás distritos y provincias los no pobres suman entre el
\GHODSREODFLyQ(QWUHODVGRFHH[SHULHQFLDVKD\DOJXQDVHQTXHSULPDOD
SREUH]DH[WUHPDVREUHODSREUH]DPLHQWUDVTXHHQRWURVGLVWULWRV\SURYLQFLDVORV
pobres no extremos son mayoría sobre la pobreza extrema. Sólo Yauyos sale de este
WUDVIRQGRHVWUXFWXUDOGHODSDUWLFLSDFLyQTXHQRVKDWRFDGRDQDOL]DUSXHVHOGLVWULWR
de Alis tiene un 84,4% de no pobres y en la provincia de Yauyos los no pobres son
el 45,8% de la población.

Tenemos así tres situaciones:

D ORFDOLGDGHVPX\SREUHVHQTXHORVSREUHV\SREUHVH[WUHPRVVXPDQFLIUDV
superiores a los 90% de la población y encima los pobres extremos son
mayoría;
E ORFDOLGDGHVPD\RULWDULDPHQWHSREUHVHQTXHORVSREUHV\SREUHVH[WUHPRV
varían entre 70% y 89% y en los cuales la franja de pobres no extremos es
mayoría; y
c) localidades con una distribución similar al promedio nacional entre pobres y
no pobres (54%/45% cada uno).

Cinco de las experiencias estudiadas son del tipo a (Azángaro, Angaraes,


Huaccana, Curahuasi y Santa Rosa), seis del tipo b (Limatambo, Ichocán, Jabon Mayo,
Santo Domingo, San Marcos y Morropón) y una del tipo c (Alis-Yauyos).

19
Juan Arroyo y Marina Irigoyen

1.4 Variantes de democracias locales: tipos de democracias


participativa
La posibilidad de la inclusión de los pobres en las formas participativas depende
VLQHPEDUJRQRVyORGHOQLYHOGHLQJUHVRVHQODVORFDOLGDGHVVLQRGHOWLSRHVSHFtÀFR
GHUpJLPHQPXQLFLSDOHQSUiFWLFD5HVSHFWRDHVWRODREVHUYDFLyQPXHVWUDTXHQR
sólo existe en la base la democracia representativa y la democracia participativa, sino
varios subtipos de ambas y gradaciones diversas entre democracia directa, democracia
SDUWLFLSDWLYD\GHPRFUDFLDUHSUHVHQWDWLYD(QQXHVWURUHFRUULGRKHPRVHQFRQWUDGRTXH
HOPRGHORPiVFRP~QHVHOGH´GHPRFUDFLDSDUWLFLSDWLYDGHUHSUHVHQWDQWHVµTXHHV
DTXpOHQTXHSDUWLFLSDQORVOtGHUHVVRFLDOHVSHURQRQHFHVDULDPHQWHKD\FRPXQLFDFLyQ
con sus bases.

Los regímenes de democracia directa y de democracia representativa son los


casos más claros evidentemente en cuanto a la existencia o no de una vocación
inclusiva. En los casos de democracia directa hay inclusión de los pobres y en los
casos de democracia representativa no: se gobierna en nombre de y hasta a favor de
los pobres, pero no con ellos.

(O HMHPSOR DUTXHWtSLFR GH OD GHPRFUDFLD GLUHFWD HV HO GH ODV FRPXQLGDGHV
FDPSHVLQDVFOiVLFDVHQHVWHFDVRODVGHORV&KRSFFDVHQ+XDQFDYHOLFDTXHUHVSHWDQ
OD DXWRULGDG GH VXV DOFDOGHV YDUD\RTV \ HQ ODV FXDOHV OD YROXQWDG HPDQD GH VXV
asambleas.

Entre nuestras experiencias revisadas el caso de Jabon Mayo es también el de una


GHPRFUDFLDGLUHFWDDXQTXHUHQRYDGDFHQWUDGDHQHOGHVDUUROORORFDOSHURXQDH[SHULHQFLD
FHQWUDOPHQWHGHDXWRJHVWLyQ&RQXQHQIRTXHGHGHVDUUROORKXPDQRVHEXVFDODVHJXULGDG
alimentaria y en función a ello la vinculación al mercado. Se trata de una experiencia
promovida desde la Federación Departamental de Campesinos del Cusco (FDCC),
coordinada con los municipios del corredor del Jabon Mayo en la provincia de Canas,
pero cuyo eje no es la relación sociedad-Estado sino la relación sociedad-economía,
en la construcción de un movimiento social de nuevo tipo, de productores, con una
base de solidaridad entre sí. El objetivo es forjar un movimiento campesino en base a
XQDH[SHULHQFLDGHPRVWUDWLYDGHJHVWLyQLQWHJUDOGHODPLFURFXHQFDFRQXQHQIRTXH
agroecológico, en base a la capacitación tecnológica y la implementación de tecnologías
productivas, conservacionistas y de transformación (FDCC, 2004). Es por tanto un caso
aparte de las otras once experiencias municipales de participación y concertación.

/RVRWURVFDVRVFODURVHQTXHVHJRELHUQDVLQLQYROXFUDUDODSREODFLyQ\SRU
tanto a los pobres son, en el otro extremo, los de democracia representativa clásica,

20
Desafíos de la Democracia Participativa Local en la Descentralización

TXHFRPSUHQGHQWRGDVODVJHVWLRQHVHGLOHVGHODIUDQMDPXQLFLSDOWUDGLFLRQDOTXHD~Q
se mantienen prácticamente en el régimen municipal anterior a la actual Ley Orgánica
de Municipalidades.

El problema más complejo es calibrar la capacidad inclusiva de las experiencias


GHGHPRFUDFLDSDUWLFLSDWLYDSRUTXHHQHVWHFDVRKD\YDULDQWHVPiVFHUUDGDV\RWUDVPiV
abiertas.

'HXQODGRHVWiQORVDOFDOGHVLQVWLWXFLRQDOLVWDVTXHVyORDSOLFDQORQRUPDGR
VREUH&&/TXHHQHOIRUPDWROHJDODFWXDOHVXQDIRUPDGH´GHPRFUDFLDSDUWLFLSDWLYD
OLPLWDGDµSRUORVUHTXLVLWRVSDUDSDUWLFLSDU\HOSRUFHQWDMHGHUHSUHVHQWDFLyQGHODV
organizaciones sociales. Como se sabe, la Ley exige a las organizaciones sociales tener

Tabla Nº 2: Capacidad inclusiva de las variantes institucionales


Inclusión de pobres
Franja y extremadamente
municipal Variante institucional Inclusión de Género
pobres
Franja de Municipio vertical No inclusivos No inclusivos
municipios (Democracia local
tradicionales elitista)
Franja de Sólo CCL – Aplicación Muy poco inclusivos Acciones mínimas
municipios estricta de la Ley para la participación de
institucionalistas (Democracia mujeres
participativa limitada)
Franja de - CCL con Mesas Poco inclusivos Poco inclusivos aún
municipios mononucleares, por
participacionistas ser procesos iniciales
o en retroceso luego
GHDxRV 'HPRFUDFLD
participativa de
representantes)
- CCL con Mesas Inclusivos $OJXQDVDFFLRQHVTXH
DUERULÀFDGDV\ SURPXHYHQHTXLGDGGH
territorializadas, género, básicamente
con rendiciones de interés de invitación
cuentas, vinculantes a organizaciones de
de facto (Democracia mujeres a reuniones
participativa de de trabajo y algunas
representantes y acciones de capacitación
poblaciones) a liderazgos. Liderazgos
intermedios emergentes
en las municipalidades y
organizaciones sociales.

21
Juan Arroyo y Marina Irigoyen

De otro lado están los municipios participacionistas, la mayoría de los cuales


tienen CCLs y Mesas. Una parte de éstos ha convertido a sus circunscripciones en
laboratorios de nuevas formas institucionales de democracia local avanzada, generando
articulaciones diversas entre ambas instancias y la población. En contraste, otra
SDUWH PDQWLHQH IRUPDV SDUWLFLSDWLYDV TXH LQYROXFUDQ EiVLFDPHQWH D ORV GLULJHQWHV
sociales, sean estos hombres o mujeres. Hemos denominado a los casos más abiertos
HLQFOXVLYRVHQTXHODV0HVDVVRQDUERULÀFDGDV\VHFUHDQSRUFXHQFDV\]RQDV\
HQTXHORV&&/VKDQVLGRUHIRUPDGRV\DPSOLDGRVFRPR´PRGHORGHGHPRFUDFLD
participativa de representantes y poblaciones”. Esta última se acerca al modelo de
democracia directa, sin dejar de ser un modelo de cogestión. Los casos más cerrados,
HQTXHORV&&/VVRQLQVWDQFLDVIRUPDOHV\ODV0HVDVWLHQHQEDMDDFWLYLGDG\VXHOHQVHU
mononucleares, las hemos denominado como “modelo de democracia participativa
de representantes”.

*UiÀFR1ƒ*
Distritos rurales y Modelos de Democracia
Municipios
Municipios Municipios participacionistas
institucionalistas
tradicionales 55% 10%
35%
Huaccana
Tipo a: Azángaro
Muy Pobres Curahuasi

San Marcos Limatambo


Tipo b: 2004 1993 2002
Mayoría Ichocán Santo Rosa
Morropón Santo
Pobres
2004 Domingo
Tipo c:
En el promedio Yauyos
nacional

Democracia elitista limitada representantes poblaciones


representativa clásica Democracia Democracia
Democracia participativa participativa de participativa de
representantes y
Modelos de Democracia

___________________________________________________
* No se han incluido las experiencias de MECODEH y Jabon Mayo porque no corresponden a experiencias municipales de
concertación.

22
Desafíos de la Democracia Participativa Local en la Descentralización

En las variantes institucionales más cerradas la participación social es todavía


centralmente de la sociedad civil mesocrática y no de la sociedad civil popular ni de
los pobres y pobres extremos. Y viceversa, cuanto más abierta la institucionalidad de
participación y concertación, más inclusiva socialmente. Una localidad tipo a, muy
pobre, con un modelo de democracia participativa de representantes y poblaciones,
activa, de hecho involucra a pobres y pobres extremos (Azángaro, Curahuasi). Una
ORFDOLGDGWLSREFRQPD\RUtDSREUH\XQHVTXHPDGHGHPRFUDFLDGHUHSUHVHQWDQWHV\
SREODFLRQHVFRQ0HVDVDUERULÀFDGDVWDPELpQLQYROXFUDDORVSREUHV\SUREDEOHPHQWH
a los muy pobres (Santo Domingo). Una localidad tipo b, con mayoría pobre y un
HVTXHPDLQVWLWXFLRQDOGH&&/HQORVWpUPLQRVQRUPDGRV\XQD0HVDPRQRQXFOHDU
con reuniones periódicas de sólo líderes y rendiciones de cuentas formales, difícilmente
involucrará a la población y a los pobres de ella (Ichocán). Una localidad tipo c, con
ODPLWDGGHODSREODFLyQQRSREUHFRQXQHVTXHPDGHUHSUHVHQWDQWHVHVGHKHFKR
XQDSROLDUTXtDORFDO <DX\RV 

23
.
Desafíos de la Democracia Participativa Local en la Descentralización

Capítulo 2:
Una descentralización de doble pista:
actores que construyen instituciones
e instituciones que promueven actores

En realidad todo el proceso de la descentralización local se resume en una


WUD\HFWRULDGHGREOHSLVWDHQWUHDFWRUHVHLQVWLWXFLRQHVHQTXHHQXQDSULPHUDIDVH²HQ
ORVVORVDFWRUHVGLVHxDURQXQDLQVWLWXFLRQDOLGDGQXHYDHQYLYR\HQXQDVHJXQGD
IDVHORVDOFDOGHV\HTXLSRVGHFRQGXFFLyQORFDOHVDSDUWLUGHHVWDLQVWLWXFLRQDOLGDG
hecha ley, han ido promoviendo nuevos actores.

Primero los actores participacionistas hicieron el Estado local a su semejanza –en


SHTXHxDHVFDOD\OXHJRHVWHQXHYRGLVHxRQRUPDGRDQLYHOQDFLRQDOKDHPSH]DGR
a reconstituir las sociedades locales.

Como dicen Fung y Wright (2003: 15), el modelo de “Gobierno Participativo


FRQ3RGHUGH'HFLVLyQµ (3* TXHHVHOTXHHQJHQHUDOHVWDUtDPRVVLJXLHQGRHQOD
reforma descentralista participativa, se construye “explorando nuevas alternativas
GH UHRUJDQL]DFLyQ GH ODV LQVWLWXFLRQHV IRUPDOHV GHO (VWDGR TXH SXHGDQ HVWLPXODU
la participación democrática de la sociedad civil, y de esta forma formar un círculo
virtuoso de refuerzo recíproco.”

Evidentemente la relación entre actores e institucionalidad ha variado en el


tiempo: no fue lo mismo ser participativo en el punto más alto del autoritarismo
IXMLPRULVWDTXHHQHOPDUFRGHODWUDQVLFLyQGHPRFUiWLFD(VWRKDFHTXHVHSXHGDQ
diferenciar tres generaciones de municipios participativos:

25
Juan Arroyo y Marina Irigoyen

a  OD´JHQHUDFLyQGHORVPXQLFLSLRVSUHFXUVRUHVµTXHFRPSUHQGHD9LOOD(O
Salvador (VES) e Ilo, no estudiados por nosotros, pero referentes para todas
las generaciones municipales posteriores;

E  OD ´JHQHUDFLyQ GH ORV PXQLFLSLRV SLRQHURVµ DTXHOORV TXH HPSH]DURQ VXV
H[SHULHQFLDV SDUWLFLSDWLYDV HQ ORV DOERUHV GH ORV  TXH FRPSUHQGH D
&DMDPDUFD\+XDQWDTXHQRKHPRVHVWXGLDGR\DORVFDVRVGH/LPDWDPER
Morropón, San Marcos y Yauyos. MECODEH no es una experiencia
PXQLFLSDOSHURVHXELFDHQORVWUHV~OWLPRVDxRVGHORV6LELHQ&XUDKXDVL
y Santo Domingo cronológicamente deberían estar ubicados en este período,
SRUTXHHPSLH]DQHQVHGHVDUUROODQPiVDPSOLDPHQWHFRQODUHVWDXUDFLyQ
de la democracia; y

c) la “generación de los municipios participativos con un contexto a favor”


GDGRSRUODWUDQVLFLyQGHPRFUiWLFD\ODGHVFHQWUDOL]DFLyQHQWUHORVDxRV
\TXHFRPSUHQGHHQQXHVWURHVWXGLRDODVH[SHULHQFLDVGH$]iQJDUR
Curahuasi, Huaccana, Santo Domingo y Santa Rosa.

/DV H[SHULHQFLDV PXQLFLSDOHV SDUWLFLSDFLRQLVWDV TXH VRQ ODV TXH KHPRV


estudiado, comprenden en parte a experiencias de la generación de pioneros,
en donde la participación y concertación local se hicieron sin marco legal a
favor, y comprenden también a experiencias de la generación 2001-2004, con
FRQWH[WRDIDYRUHQODVFXDOHVH[LVWHXQHVTXHPDGHSDUWLFLSDFLyQ\FRQFHUWDFLyQ
institucionalizadas (CCLs, CCRs, PP) y además, en este caso, por tratarse de
JHVWLRQHV SDUWLFLSDFLRQLVWDV P~OWLSOHV HVTXHPDV GH GHPRFUDFLD SDUWLFLSDWLYD QR
institucionalizada.

/D ~QLFD H[SHULHQFLD SDUWLFLSDWLYD GHO JUXSR HVWXGLDGR TXH VLJXH XQ FXUVR
diferente a esta doble vía entre actores locales e institucionalidad local es la de Jabon
Mayo, por tratarse de un proyecto de autogestión con diversos puntos de apoyo
institucional (FONCODES, Gobierno Regional, municipios, etc.).

/D GLIHUHQFLDFLyQ GH WUHV JHQHUDFLRQHV PXQLFLSDOHV HV LPSRUWDQWH SRUTXH


SHUPLWHHQWHQGHUTXHORVQXHYRVDOFDOGHV\OtGHUHVORFDOHVTXHVHYDQLQYROXFUDQGR
en el proceso de descentralización municipal reciben ya modelos básicos de nueva
institucionalidad municipal a seguir, con sus avances y limitaciones, a diferencia de
ORVDOFDOGHV\DFWRUHVORFDOHVSDUWLFLSDFLRQLVWDVGHODGpFDGDSDVDGDTXHFUHDURQHVWD
institucionalidad.

26
Desafíos de la Democracia Participativa Local en la Descentralización

/DGLIHUHQFLDFLyQGHJHQHUDFLRQHVHVFODYHDOÀQDOSDUDUHVSRQGHUDODSUHJXQWD
TXHLPSOLFDHOFtUFXORYLUWXRVRSODQWHDGRSRU)XQJ\:ULJKW¢&XiQWRFDPELRVRFLDO
\SURPRFLyQGHDFWRUHVHVSRVLEOHGHVGHXQDQXHYDLQVWLWXFLRQDOLGDG"¢(QTXpQLYHOHV
de resistencia pasiva no funciona el estímulo para el involucramiento de la sociedad
FLYLO"¢4XpPH]FODGHDFFLyQGHVGHDEDMR\GHVGHDUULEDHVODPHMRUSDUDTXH´SUHQGDµ
el círculo virtuoso? ¿Cómo puede la franja municipal participacionista heredar al país
ODFXOWXUDSDUWLFLSDWLYDKDFHUODSDUWHGHODFXOWXUDQDFLRQDOVLQTXHOOHYH\DHOVHOOR
doctrinal de sus orígenes?

6RQpVWDVODVFRVDVTXHFRPSHWHHYDOXDUSRUTXHODYLGDKDOOHYDGRDODFRPXQLGDG
epistémica descentralista municipalista a tener cierta presencia en la formulación
legislativa descentralista y legislar para la nación implica invitarla a ser participativa
VLQDGVFULELUQHFHVDULDPHQWHDORVHQIRTXHVGHVGHORVFXDOHVVHSODQWHyRULJLQDOPHQWH
ODGHPRFUDFLDSDUWLFLSDWLYDHQHOSDtVTXHIXHHOGLVFXUVRTXHDQLPyDORVDFWRUHV
sociales en las décadas de los 70 y 80. Después de todo, la comunidad epistémica
descentralista municipalista ha obtenido la re-conexión comunicacional con la nación
también a partir de un cambio de discurso. La participación social de la acción directa
DQWLHVWDWDO²GHGpFDGDVDWUiVQRHVODPLVPDTXHODGHODFRJHVWLyQ(VWDGRVRFLHGDG
actual.

La generación de los municipios precursores de la actual política nacional de


participación y concertación local comprende a Villa El Salvador e Ilo, experiencias
TXHQRKDQVLGRHVWXGLDGDVSRUQRVRWURVSHURVREUHODVFXDOHVKD\PXFKRVWUDEDMRV
9LOOD(O6DOYDGRUVHIXQGyHQVLJXLHQGRXQPRGHORGHDXWRJHVWLyQ'HDKtTXHVH
generase como Comunidad Urbana Autogestionaria de Villa El Salvador (CUAVES)
FUHiQGRVHXQDHVWUXFWXUDEDVWDQWHDUERULÀFDGDGHSDUWLFLSDFLyQSRUPDQ]DQDVJUXSRV
residenciales y sectores. Luego Villa El Salvador se convirtió en distrito en 1983 y los
acuerdos de la CUAVES tenían carácter vinculante para sus alcaldes participativos,
TXHVHVXFHGLHURQHQWUH\/XHJRGHXQODSVRGHDOFDOGHVWUDGLFLRQDOHVD
partir de 1998 VES retomó y relanzó su experiencia participativa, con una consulta
ciudadana en donde votaron más de 50,000 pobladores para la elaboración del tercer
Plan de Desarrollo Concertado y del primer Presupuesto Participativo del distrito.
VES se ha constituido así en un referente mundial por la amplitud de mecanismos
\ SURFHVRV LQQRYDGRUHV GH SDUWLFLSDFLyQ TXH KD FXOWLYDGR )UDQFR  =DSDWD
1996; Remy, 2003).

Ilo sorprende igualmente por la versatilidad de procesos y prácticas generadas,


como sus Asambleas Populares, su Concejo Municipal con integración con voz de
representantes de las organizaciones sociales, los Comités de Gestión, el Plan de

27
Juan Arroyo y Marina Irigoyen

Desarrollo, los Presupuestos Concertados, todo ello en un contexto de constante


FRQÁLFWRQHJRFLDFLyQ\DFXHUGRFRQOD6RXWKHUQ3HU~&RUSRUDWLRQHQUHODFLyQDO
medio ambiente. Ilo construyó durante siete gestiones municipales participativas
ininterrumpidas – con los alcaldes Julio Díaz Palacios y Ernesto Herrera - múltiples
espacios de concertación entre la municipalidad, la ciudadanía y las empresas
públicas y privadas locales, para la formulación y ejecución de planes y proyectos
para el desarrollo sostenible de Ilo y para la información directa y la toma de
posición de la población (Díaz Palacios, 1990; López Follegatti, 2000; Irigoyen y
Balvín, 2002).

La generación de los pioneros comprende a las experiencias municipales


TXHUHFRUULHURQHQORVVODSULPHUDSLVWDODSLVWDGHORVDFWRUHVFRQVWUXFWRUHV
GHQXHYDVLQVWLWXFLRQHV6HGLHURQVREUHWRGRHQHOSULPHUTXLQTXHQLRGHORVV
y entre ellas las más conocidas son las de Cajamarca y Limatambo. Esta generación
comprende también a otras gestiones municipales participativas estudiadas como
las de Morropón (Piura), San Marcos (Cajamarca) y Yauyos (Lima). En el segundo
TXLQTXHQLRGHORVVXUJLHURQRWUDVJHVWLRQHVSDUWLFLSDWLYDVFRQWDJLDGDVGHOpODQ
participativo de los pioneros, como la Mesa de Concertación del Desarrollo de
Huancavelica (MECODEH), matriz de todas las experiencias participativas posteriores
en Huancavelica, entre ellas Angaraes. En este segundo lustro fue importante la labor
GHVSOHJDGDSRU&$5(3HU~ 3UR\HFWR)2*(/ TXHIRUPy0HVDVGH&RQFHUWDFLyQ
Interinstitucional (MCI).

3RUHOFRQWUDULRORVJRELHUQRVORFDOHVTXHVHLQWURGXFHQUHFLpQDODQXHYDIRUPD
de “buen gobierno” recorriendo la segunda pista - inversa a la anterior – son los de
la generación con contexto a favorTXHWRPDQFRPRDSR\RODLQVWLWXFLRQDOLGDG
para dialogar y reconstituir sociedades locales.

(VWD HWDSD HV OD TXH HVWDPRV YLYLHQGR DKRUD GH SURJUHVLYD H[WHQVLyQ HQ HO
país de la participación concertada. En la etapa previa cada municipalidad o Mesa
intentaba tener su propio manual e instrumentos sobre cómo formular su plan
desarrollo, cómo hacer el PP, o cómo procesar su gestión. Hoy la participación está más
institucionalizada, con organizaciones formalizadas de concertación, instrumentos
de gestión como los diagnósticos, los planes, los presupuestos participativos, las
rendiciones de cuentas. Hay normativas, directivas y plazos, todos con múltiples
LPSHUIHFFLRQHV FRPR VH YLHQH VHxDODQGR HQ OD GRFXPHQWDFLyQ SURGXFLGD SRU OD
comunidad descentralista, pero representando de todos modos un paso adelante
respecto a la forma de gobierno edil tradicional. Esta pista la hemos observado
PiVFODUDPHQWHHQODVH[SHULHQFLDVSDUWLFLSDWLYDVGHODHWDSDTXHKHPRV
estudiado: Azángaro, Curahuasi, Huaccana, Santo Domingo y Santa Rosa.
28
Desafíos de la Democracia Participativa Local en la Descentralización

Tabla N° 3: Generaciones de municipios participativos

Generación Experiencias de participación y concertación

Generación de municipios 9LOOD(O6DOYDGRU /LPD H,OR 0RTXHJXD 


precursores
(Décadas de 70s y 80s)

Generación de municipios 3ULPHUTXLQTXHQLRGHORV3URYLQFLDOGH&DMDPDUFD


pioneros Limatambo (Cusco), San Marcos (Cajamarca), Morropón
(Década de los 90s) (Piura), Yauyos (Lima)

6HJXQGRTXLQTXHQLRGHORV0(&2'(+
(Huancavelica), Ichocán (Cajamarca)

Generación de municipios Azángaro (Puno), Curahuasi (Apurímac), Huaccana


con contexto a favor (Apurímac), Santo Domingo (Piura) y Santa Rosa (Puno)
(Periodo 2000-actualidad)

29
.
Desafíos de la Democracia Participativa Local en la Descentralización

Capítulo 3:
La fórmula de la sostenibilidad
de las experiencias: las combinaciones
entre alcaldes, equipos, proyectos políticos,
ONGs y organizaciones sociales

/D UHYLVLyQ \ ODV YLVLWDV PXHVWUDQ TXH VHLV HOHPHQWRV KDQ YHQLGR VLHQGR
centrales en el lanzamiento y sostenibilidad de las experiencias participativas:

a) la presencia de alcaldes con voluntad de liderazgo participativo;


b) la existencia de formaciones políticas con adhesión a la participación;
F  ODSUHVHQFLDRFUHDFLyQGHXQHTXLSRGHFRQGXFFLyQ
G  ODSUHVHQFLDGH21*V\RDJHQFLDVFRRSHUDQWHVFRQHVTXHPDVLQFOXVLYRV
de inversión local;
e) el involucramiento activo de la sociedad civil y las organizaciones
sociales;
I  ODJHQHUDFLyQGHXQDFRPXQLFDFLyQÁXLGDHQODORFDOLGDGFRQODFRQVLJXLHQWH
formación de una esfera pública local deliberante; y
g) el tiempo de maduración de las experiencias.

Hay experiencias con uno, con dos, tres, cuatro, cinco y hasta con los siete
factores o fuerzas motrices de la participación y concertación. A veces un factor
empezó y trajo a los otros. Al revés, procesos con varios de estos elementos a veces
se elitizaron en el camino y perdieron fuerzas motrices. Los procesos orgánicos
tienden a tener todos.

31
Juan Arroyo y Marina Irigoyen

3HURODVRVWHQLELOLGDGQRVyORWLHQHTXHYHUFRQODSUHVHQFLDGHHVWDVIXHU]DV
motrices sino con el factor tiempo. Experiencias largas llegan a un punto de no retorno
HQTXHODGLQiPLFDWLHQHXQQLYHOGHDXWRVRVWHQLELOLGDG 9(6 3HURQRH[LVWHQXQFD
la garantía de perdurabilidad.

El factor sin el cual no hay una experiencia de concertación entre el Estado


\ OD VRFLHGDG D QLYHO ORFDO HV HO SULPHUR XQ DOFDOGH SDUWLFLSDWLYR TXH SXHGH VHU
independiente y adscribir a la participación para aumentar su base de legitimidad,
o proceder de un proyecto político participativo, sea éste nacional, regional o local.
La presencia de partidos políticos no es determinante en el desarrollo de estas
experiencias; la mayoría en todo caso corresponde a movimientos locales o regionales
poco estructurados.

Pero si lo fundamental de todo el proceso reposa sólo en la acción del alcalde


SDUWLFLSDWLYRGHVDSDUHFHFXDQGRpVWHSLHUGHODVHOHFFLRQHV&XDQGRKD\HTXLSRGH
conducción, la experiencia tiene mayor sostenibilidad y hay posibilidad de relevo sin
TXHÀQDOLFHODH[SHULHQFLD ,OR6DQ0DUFRV 

Cuando no existen los alcaldes, estamos hablando de otra participación social,


la de los movimientos sociales, esto es de experiencias desde abajo, con alcaldes y
DXWRULGDGHVUHJLRQDOHVDYHFHVDPHGLRFDPLQRFRPRHQ<DX\RVTXHVHLQLFLDHQHO
distrito de Alis con un comité de gestión de un proyecto y luego se accede a la alcaldía
y a un consejo interdistrital; o en Jabon Mayo, en donde se trata de un movimiento
GH FDPSHVLQRV GLULJHQWHV FDPSHVLQRV  FDSDFLWDGRUHV ´\DFKDFKLTµ \ FDPSHVLQRV
productores; o en MECODEH, una experiencia de movilización regional masiva e
intensa pero de corta duración.

$O UHYpV WRGDV ODV H[SHULHQFLDV GH FRQFHUWDFLyQ UHTXLHUHQ OD SUHVHQFLD GH OD
autoridad, se trate de una concertación entre Estado y sociedad, o entre Estado,
sociedad y empresas privadas. La concertación es para la autoridad una etapa superior
ya no sólo respecto al estilo de gobierno tradicional sino respecto a la antigua gestión
SDUWLFLSDWLYDHQTXHVHDEUHQODVSXHUWDVSDUDUHFRJHURSLQLRQHV\DSR\RVSRUTXH
la autoridad concertadora acepta la interlocución y el diálogo para buscar arribar a
acuerdos. Pero puede haber una concertación sin mayor participación social, sólo
con los representantes.

El factor más raro pero clave cuando existe, es el involucramiento y


HPSRGHUDPLHQWRSREODFLRQDO<GHQWURGHHVWHLQYROXFUDPLHQWRPiVH[WUDxRD~Q
es el de las mujeres y de los jóvenes, cuya participación, si existe, es episódica, más

32
Desafíos de la Democracia Participativa Local en la Descentralización

SUHVHQFLDOTXHFXDOLWDWLYD6HJ~QORVLQIRUPDQWHVHQWUHYLVWDGRVFXDQGRODGHPRFUDFLD
participativa se convierte en cultura cívica poblacional, luego de procesos más
SURORQJDGRVHOSURFHVRDGTXLHUHJDUDQWtDGHPD\RUVRVWHQLELOLGDG

8QIDFWRUTXHRWRUJDPXFKDVRVWHQLELOLGDGHVXQDEXHQDFRPXQLFDFLyQHQWUH
todos: entre el municipio y la población, entre los líderes y sus bases, entre todas las
LQVWLWXFLRQHV\ODJHQWH(OORSXHGHJHQHUDUXQDHVIHUDS~EOLFDORFDOGHOLEHUDQWHTXH
VXSHUDODHTXLYDOHQFLDTXHVHVXHOHKDFHU´GHPRFUDFLD DVDPEOHDVµ\IRUMDHQXQ
razonamiento colectivo permanente, voluntades compartidas. Algo de ello se aprecia
en algunas experiencias con políticas comunicacionales, como en Curahuasi, pero es
aún un factor escaso.

Tabla N° 4 Fuerzas motrices de la sostenibilidad de las


experiencias participativas

Experiencia Factores claves

Azángaro $OFDOGHSDUWLFLSDWLYRSUR\HFWRSROtWLFRUHJLRQDOHTXLSR

Curahuasi Alcalde participacionista, influencia y apoyo de ONGs y


FRRSHUDFLyQ\HTXLSRGHJHVWLyQ\FRQGXFFLyQ

Huaccana Cooperación-ONGs y alcalde

Ichocán Alcalde participativo sin experiencia política, apoyo de la


Asociación de Municipalidades del Corredor Económico
Crisnejas (AMCEC)

Jabon Mayo Proyecto gremial, proyecto político y apoyo de ONGs y


cooperación

Limatambo Alcalde participativo de proyecto político participativo

MECODEH-Huancavelica Inducción de ONGs, formación de cohorte dirigencial


regionalista y reactivación de sociedad civil regional

Morropón $OFDOGHSDUWLFLSDWLYRSUR\HFWRSROtWLFRSDUWLFLSDWLYRHLQÁXHQFLD
y apoyo de ONGs/cooperación

Santo Domingo $OFDOGHSDUWLFLSDWLYRSUR\HFWRSROtWLFRSDUWLFLSDWLYRHLQÁXHQFLD


y apoyo de ONGs y cooperación

San Marcos Alcaldes participativos independientes, liderazgos compartidos


\HTXLSRFRQLQGXFFLyQ\DSR\RGHODFRRSHUDFLyQ

Yauyos ONGs y alcaldes de un Corredor (Nor Yauyos)

33
Juan Arroyo y Marina Irigoyen

La experiencia provincial de San Marcos en Cajamarca es un ejemplo de una


experiencia basada en una fórmula de tres pies: alcaldes participativos independientes
FRQ LQGXFFLyQ \ DSR\R GH OD FRRSHUDFLyQ LQWHUQDFLRQDO \ HTXLSR GH JHVWLyQ
conducción.

Efectivamente en las provincias del norte este de Cajamarca, San Marcos entre
ellas, la cooperación internacional (UNICEF y el proyecto especial APRISABAC)
tuvo una fuerte inversión en salud y servicios sociales. Sobre la base de una condición
EiVLFDODFRQFHUWDFLyQSXVLHURQDGLVSRVLFLyQIRQGRVSDUDSHTXHxRVSUR\HFWRVGH
HGXFDFLyQDJXD\VDQHDPLHQWR6HGHPDQGDEDTXHORVDFWRUHVS~EOLFRV\SULYDGRVVH
SXVLHUDQGHDFXHUGRHQODVSULRULGDGHVTXHFRPSDUWLHUDQODGHFLVLyQHOPRQLWRUHR\
ODVFRQWUDSDUWLGDVGHODVREUDV$HVDVDFFLRQHVVHDxDGLyHOGHVDUUROORGHFDSDFLGDGHV
Así nació el Comité Interinstitucional por el Desarrollo de San Marcos (CINDESAM),
TXHGHVGHGHVDUUROOyXQSURFHVRGHFRQFHUWDFLyQDJUXSDQGRSULQFLSDOPHQWH
a actores públicos y sus proyectos de trabajo, combinando la acción concreta con
FLHUWDUHÁH[LyQSUiFWLFD\VLVWHPDWL]DFLRQHVVREUHODFRQFHUWDFLyQSDUDHOGHVDUUROOR
(Irigoyen, 1996).

'XUDQWH VXV SULPHURV FLQFR DxRV GH H[LVWHQFLD &,1'(6$0 FRQYRFy


principalmente a los representantes de los sectores Salud, Educación, Agricultura,
institutos, municipalidades distritales y ONGs como Centro IDEAS y la Fundación
Terra. Con ellos debatió, decidió, avaló, ejecutó e hizo rendiciones colectivas de los
SHTXHxRV SUR\HFWRV FRQ TXH FRQWDED 7DPELpQ &,1'(6$0 KD VLGR XQ HVSDFLR
de intercambio y apoyo mutuo de la institucionalidad local en acciones comunes y
FRWLGLDQDVSDUDHOGHVDUUROORGH6DQ0DUFRVHIHFWLYL]DQGRRDSR\DQGRFDPSDxDV
GHYDFXQDFLyQGHDOIDEHWL]DFLyQSRUODPHMRUDDPELHQWDO\ODJHVWLyQGHSHTXHxRV
proyectos productivos. Ha tenido un interés particular en promocionar la participación
de las mujeres en las juntas de agua y saneamiento y la mejora de la educación
HVFRODUL]DGDFRQHTXLGDGGHJpQHUR

3RUDxRVFRQVHFXWLYRVFXDWURJRELHUQRVPXQLFLSDOHVFRQGLIHUHQWHVDOFDOGHV
y grupos políticos han considerado a CINDESAM como plataforma clave para
el desarrollo. Además ha sido un referente para la constitución de la Red Perú.
Se ha logrado atraer la cooperación y los propios recursos locales para mejorar
VLJQLÀFDWLYDPHQWHODVFRQGLFLRQHVGHYLGDHQHVSHFLDOODVDOXEULGDGHQODSURYLQFLD
explorando ahora el desarrollo económico local. Esto ha generado cierta cultura
de la concertación, crecientemente interiorizada en autoridades, líderes y dirigentes
sociales. La Mesa provincial, además, integra a los distritos.

34
Desafíos de la Democracia Participativa Local en la Descentralización

Si bien no todas las autoridades le han dado la misma fuerza a CINDESAM,


se reconoce este espacio y se mantiene el espíritu de concertación. Hoy la Mesa se
HQFXHQWUDDOJRPiVGpELOOXHJRGHKDEHUYLYLGRVXDXJHHQWUHORVDxRV\\
HQIUHQWDQXHYRVUHWRVDOKDEHUVHHVWDEOHFLGRSRUOH\HO&&/WHQLHQGRTXHFRPSDUWLU
DOJXQDVGHODVIXQFLRQHVTXHDQWHVHMHUFtD$XQTXHQRHVWiQWRWDOPHQWHFODURVORV
PHFDQLVPRVGHDUWLFXODFLyQVHSODQWHDTXHWUDEDMHQFRQMXQWDPHQWH\VHFRQYRFD
actualmente a nuevos actores.

La experiencia de Limatambo en Anta, Cusco, es un ejemplo de una experiencia


basada en una fórmula de una fuerza motriz original: un alcalde participativo
procedente de un proyecto político participativo. El apoyo de ONGs y la cooperación
fué posterior y reforzaron el proceso.

En dicho distrito Wilbert Rozas ganó en 1992 las elecciones municipales con el
movimiento político Unidad Campesina Popular, organizado en base a la Federación
Distrital de Campesinos, e inició tres gestiones participativas exitosas, creando
primero un Consejo Comunal con representantes de las 33 comunidades campesinas
\OXHJRXQ&RQVHMR&RPXQDO9HFLQDO &&9 TXHLQFOX\yDODUHSUHVHQWDFLyQGHOD
Junta Vecinal.

(QHVWHFDVRHOÀQDQFLDPLHQWRGHODLQYHUVLyQHVWXYRDFDUJRGHOSURSLRJRELHUQR
local, siendo la fuente principal de los recursos el presupuesto municipal, con ingresos
propios. La ONG Centro Bartolomé de las Casas (CBC) y la cooperación internacional
complementaban el apoyo. En Limatambo no se formó una Mesa, debatiéndose el
SUHVXSXHVWRSDUWLFLSDWLYRFRQODSUHVHQFLDGLUHFWDGHODSREODFLyQ3RUGLH]DxRVVH
DEULyODVSXHUWDVGHODPXQLFLSDOLGDGDORVVHFWRUHVFDPSHVLQRVTXHDQWHVQRWHQtDQ
oportunidad de diálogo con las autoridades, compartiendo con todos y todas las
decisiones de inversión municipal y las líneas prioritarias de trabajo. Las organizaciones
de mujeres pasaron también de excluidas a participantes.

$XQTXH QR ORJUy VRVWHQHUVH OD H[SHULHQFLD D QLYHO GLVWULWDO SRU XQ FXDUWR
período municipal, se abrió las puertas a una forma diferente de gestionar y pensar
un municipio rural, proyectando la experiencia a la provincia de Anta en el 2003, en
TXHHOWUHVYHFHVDOFDOGHGLVWULWDOGH/LPDWDPERIXHHOHJLGRDOFDOGHSURYLQFLDO

La experiencia de Morropón es un ejemplo de una fórmula de tres pies: un alcalde


SDUWLFLSDWLYRSURFHGHQWHGHXQSUR\HFWRSROtWLFRSDUWLFLSDWLYR\ODLQÁXHQFLDVLPXOWiQHD
de ONGs y la cooperación.

35
Juan Arroyo y Marina Irigoyen

En dicha localidad durante tres periodos consecutivos, entre 1990 y 1998, el


DOFDOGH0D[LPLOLDQR5XL]SRSXODUPHQWHFRQRFLGRFRPR0DTXLLPSXOVySURFHVRV
FRQFHUWDGRVGHSODQLÀFDFLyQ\DEULyHOJRELHUQRORFDODOGLiORJRVLQFUHDUXQD0HVD
5HFLpQHODxRDSDUHFHUtDOD0&/30DTXLJDQyODVHOHFFLRQHVEDMRODVVLJODVGH
un movimiento regional, Unidad Popular, fuerza formada luego de la dispersión de
,]TXLHUGD8QLGD/DJHVWLyQGH0RUURSyQWXYRDGHPiVLQÁXHQFLDGH&,3&$\GH
DJHQFLDVFRRSHUDQWHV+R\WRGRVUHFRQRFHQODSUiFWLFDVRVWHQLGDGHSODQLÀFDFLyQ
FRQFHUWDGDTXHHQGLFKDpSRFDVHH[WHQGLy3HURHVWHSURFHVRGHLQWHUUXPSLyHQOD
JHVWLyQPXQLFLSDOLQLFLDGDHQSRUHODOFDOGHIXMLPRULVWD-XOLR/DPTXHQRWRPy
como base el Plan Concertado de Desarrollo PCD y desechó lo avanzado. Gran parte
GHORFRQVWUXLGRVHSHUGLy\ODVRUJDQL]DFLRQHVGHPXMHUHVTXHKDEtDQWHQLGRXQD
UHODWLYDSUHVHQFLDH[SUHVDQTXHVHVLQWLHURQHQHVHSHUtRGRPDUJLQDGDV\FDUHQWHV
GHDSR\R8QQXHYRFDPELRVHGLRFRQODJHVWLyQLQLFLDGDHOHQTXHHO$35$
ganó la alcaldía provincial, con Carlos Ramos, retomándose parcialmente la gestión
SDUWLFLSDWLYDDXQTXHQRDVtODSURPRFLyQGHODSDUWLFLSDFLyQGHODVPXMHUHV

La experiencia de la Mesa de Concertación del Desarrollo de Huancavelica


(MECODEH) es un ejemplo de la presencia de casi todos los elementos de la fórmula
de sostenibilidad pero en forma secuencial y por corto tiempo (1998-2000). Pese a su
WHPSUDQDGHVDSDULFLyQDJUXSy\IRUPyDXQDFRKRUWHUHJLRQDOTXHSURVLJXHJDQDQGR
alcaldías en Huancavelica y es parte activa de la comunidad descentralista nacional.

MECODEH es importante como matriz de muchos desarrollos de concertación


posteriores. Su antecedente fue la formación en 1995 de una Mesa de Trabajo sobre
Desplazados por la Violencia Política, a iniciativa de la entidad cooperante Consejería
GH3UR\HFWRVPHVDTXHWHUPLQySDXODWLQDPHQWHDVXPLHQGRRWURVWHPDV\UHODFLRQHV
&RQHOFRUUHUGHOWLHPSRVHIXHJHVWDQGRXQPRYLPLHQWRUHJLRQDOTXHUHDOL]yOD
Cabalgata hacia Lima en 1998, bajo la bandera de “Huancavelica, región autónoma
y piloto”. Participó en ella la comunidad Chopcca huancavelicana, conjuntamente
con más de 1,500 líderes regionales y alcaldes distritales y provinciales. Luego
GH OD &DEDOJDWD VH FRQVWLWX\y OD 0(&2'(+ TXH WXYR XQD JUDQ FRQYRFDWRULD
incorporando activamente a 80 de los 94 alcaldes de la región, muchas organizaciones
sociales y todas las entidades públicas presentes en la región.

/DH[SHULHQFLDGXUyWUHVDxRVKDVWDHO\DOHQWyGHVGHXQSURFHVR
masivo de formulación participativa del Plan de Desarrollo Regional, desde el nivel
FRPXQDOGLVWULWDO\SURYLQFLDOTXHVHFDOFXODPRYLOL]yDDOUHGHGRUGHSHUVRQDV
GXUDQWH GRV DxRV (O 3ODQ (VWUDWpJLFR TXH VXUJLy KD VLGR OD EDVH SDUD WRGRV ORV
planes regionales, provinciales y distritales posteriores, originándose mesas en todos
ORVQLYHOHV/DH[SHULHQFLDWHUPLQyHODxRGLOX\pQGRVH0(&2'(+SHVHD
36
Desafíos de la Democracia Participativa Local en la Descentralización

TXHVXVLQWHJUDQWHVVHKDEtDQHPSRGHUDGRKDVWDJDQDUSRVWHULRUPHQWHDOFDOGtDVHQ
Castrovirreyna, Angares, Yauli y muchos distritos de la región. Hay ahora cerca de
15 alcaldes procedentes de la experiencia, activando mesas y participación.

/D H[SHULHQFLD GH +XDQFDYHOLFD HV SDUWH GH OR TXH SRGUtDPRV GHQRPLQDU OD
JHQHUDFLyQSDUWLFLSDWLYDGHODUHVLVWHQFLDDOIXMLPRULVPRSXHVDÀQHVGHORVVH
desató una ofensiva por parte del autoritarismo por ganarse aliados municipales
ofreciendo a cambio recursos para obras locales.

La experiencia participativa de Huanta es un ejemplo de una fórmula muy centrada


en un solo factor, el liderazgo del alcalde participativo, si bien con apoyo de ONGs,
deviniendo en una experiencia poco sostenible en el tiempo.

Huanta no ha sido estudiada directamente por nosotros pero la revisión de


IXHQWHVVHFXQGDULDVLQGLFDVXLPSRUWDQFLDSXHVIXHXQRGHORVFDVRVHQTXHHODOFDOGH
SDUWLFLSDWLYRFDPELyVXÀOLDFLyQSROtWLFD\VHKL]RRÀFLDOLVWDIXMLPRULVWDJDQDQGR
HQ HVD QXHYD FRQGLFLyQ XQD VHJXQGD HOHFFLyQ DO LJXDO TXH SDVy FRQ GHFHQDV GH
autoridades ediles presionadas por el fujimorismo e incentivadas con la promesa de
UHFXUVRVDGLFLRQDOHVDÀQHVGHORVV $YLOD7iYDUD 

En Huanta Milton Córdova La Torre ganó las elecciones municipales de 1995


con la lista independiente Paz y Desarrollo, integrada centralmente por profesionales
huantinos. La provincia había sido devastada durante más de una década por
la violencia política e incluso había perdido población pues entre los censos de
1981 y 1993 disminuyó de 76,060 a 60,819 habitantes. A inicios de 1996 un taller
organizado por PACT y TADEPA permitió al recién electo consejo municipal
conocer las experiencias participativas, decidiendo trabajar en forma concertada.
Hubo así encuentros de concertación en seis de los siete distritos de la provincia y en
marzo de 1997 se realizó el Primer Encuentro Provincial de Concertación con 137
delegados. Ahí se acordaron los ejes del plan de desarrollo distrital y el organigrama
de la Mesa, compuesta por los municipios, organizaciones sociales e instituciones
públicas y privadas. Hubo al inicio una primera etapa de mucha actividad de las
Mesas y sus comisiones, pero al cabo de un tiempo las asambleas comenzaron a ser
HOHVFHQDULRGHSHWLWRULRVIUDJPHQWDGRV\FOLHQWHODUHVPiVTXHGHXQDFRQFHUWDFLyQ
$ODFHUFDUVHODVHOHFFLRQHVGHHODOFDOGHVHDGKLULyVRUSUHVLYDPHQWHDODVÀODV
RÀFLDOLVWDV\FDQGLGDWHySRU9DPRV9HFLQRJDQDQGRSRUVHJXQGDYH]FRQXQGH
los votos. Como dice Avila, la Mesa era “presidencialista” y la adhesión de Córdova
a la concertación era de tipo utilitario, siendo su reelección un realineamiento de la
alcaldía con la cultura prebendalista incentivada por el fujimorismo.

37
Juan Arroyo y Marina Irigoyen

La experiencia de Santo Domingo es un ejemplo de una fórmula de tres fuerzas


motrices: un alcalde participacionista, un proyecto político participativo y el apoyo e
LQÁXHQFLDGH21*V\ODFRRSHUDFLyQ

En 1998 ganó las elecciones distritales el actual alcalde Carlos López con la lista
8QLGDG3RSXODUTXHSRVWXOyDQLYHOSURYLQFLDOHQ0RUURSyQD0D[LPLOLDQR5XL]
sin éxito. Hoy está en su segundo período municipal. La ONG CIPCA contribuyó a
ODJHVWLyQGHVGHHOLQLFLRFRQVWLWX\pQGRVHXQHTXLSRPL[WRSDUDOLGHUDUHOSURFHVRGH
planeamiento estratégico. El liderazgo del alcalde es innegable y su reconocimiento
regional y nacional, siendo directivo de la Red de Municipalidades Rurales del Perú
(REMURPE).

En el primer período municipal se dió la constitución del espacio de concertación,


HO GLDJQyVWLFR SDUWLFLSDWLYR \ HO SODQHDPLHQWR HVWUDWpJLFR 3DUD HOOR VH ]RQLÀFy HO
distrito en 8 zonas y se hizo un Plan de Acción Concertado en cada zona. Se acordaron
entonces los ejes estratégicos del Plan distrital. En el segundo periodo se procesó
participativamente la formulación del Plan Operativo Concertado, poniendo en
marcha para ello toda la estructura de instancias generadas antes.

6DQWR'RPLQJRWLHQHXQD0HVDPX\DUERULÀFDGD(QORVGRVSULPHURVDxRV
VHDUPyHO&RQVHMRGH'HVDUUROOR'LVWULWDO &2'(', TXHOXHJRVHWUDQVIRUPy
HQHODxRHQHO&RPLWpGH'HVDUUROOR(VWUDWpJLFR\/XFKDFRQWUDOD3REUH]D
(CODELCP), cuyo presidente es el párroco, ocupando la vide-presidencia el alcalde.
Sesiona cada seis meses. Existen además las Comisiones Municipales de Concertación
&208& FRPRyUJDQRVFRQVXOWLYRV\GHÀVFDOL]DFLyQHQFDGD(MH(VWUDWpJLFRGH
Desarrollo del PCD, a reunirse bimensualmente. También se han creado los Comités
de Desarrollo Zonal (CODEZO), conformados el 2003 con 7 representantes en
las 9 zonas, con el objetivo de descentralizar la gestión municipal; y los Comités de
Desarrollo de Caserío (CODECA). El organigrama culmina en la Asamblea General
'LVWULWDO TXH UH~QH D ORV  PLHPEURV GHO &&/$ ORV  UHSUHVHQWDQWHV GH ORV
CODEZOS y 287 representantes de CODECAS. Además de todo esto, funciona el
CCL Ampliado, con 32 integrantes. Toda esta organización aspira a democratizar la
gestión edil pero a la vez constituye un desafío por la multiplicidad de reuniones y
la articulación entre instancias. Santo Domingo es, también, uno de las experiencias
de mejor ejecución de PP.

La experiencia de Curahuasi es un ejemplo de una fórmula de tres fuerzas motrices:


un alcalde participacionista independiente con base en la Federación Campesina, un

38
Desafíos de la Democracia Participativa Local en la Descentralización

HTXLSRWpFQLFRSROtWLFR\HODSR\RHLQÁXHQFLDGH21*V\ODFRRSHUDFLyQ'HIRUPD
embrionaria se trabaja niveles de comunicación con la población y el relacionamiento
con la juventud.

(OSURFHVRSDUWLFLSDWLYRHPSH]yHQFDEH]DGRSRUHODOFDOGH$XJXVWR0RVTXHLUD
%DUD]RUGDHOHFWRSDUDHOSHULRGRTXHLQLFLyVXJHVWLyQGHPRFUiWLFDPHQWH
constituyendo el Comité de Concertación Interinstitucional de Curahuasi (CCOI)
como espacio interinstitucional público-privado. El alcalde provenía de la Federación
Campesina. La experiencia recibió la asesoría de ONGs, como el Centro de
Investigación y Capacitación Campesina (CICCA) y el Centro Bartolomé de las
Casas (CBC), y de agencias de cooperación, como COSUDE y UNICEF. Bajo
OD DGPLQLVWUDFLyQ PXQLFLSDO GHO DOFDOGH 0RVTXHLUD VH IRUPXOy HO SULPHU 3ODQ GH
Desarrollo Estratégico del Distrito de Curahuasi al 2010, con la participación de
instituciones públicas y privadas y de las organizaciones sociales, como la Federación
Distrital de Campesinos y Campesinas, comunidades campesinas, asociaciones de
productores, comités CLAS y juntas vecinales. UNICEF y la ONG CICCA (con
el proyecto PROESA) dieron un apoyo decidido al proceso. El CCOI cuenta con
personería jurídica y reglamento de funcionamiento, y está adscrito a Red Perú. Luego,
hacia el 2000, se creó la Mesa de Negociación del Anís (MENA), el producto líder
de la provincia.

Desde el 2003 la actual gestión municipal del alcalde Julio César Luna ha
UHWRPDGR\SRWHQFLDGRODH[SHULHQFLDUHIRU]DQGRHOHTXLSRGHJHVWLyQ\FRQGXFFLyQ
Curahuasi es laboratorio de múltiples prácticas y formulación de instrumentos para
la democracia participativa, como las “rendiciones de cuentas estructuradas”, con
agenda previa debatida, trasmitidas por la radio “en vivo y en directo”. Esta experiencia
ha potenciado la participación de jóvenes, hombres y mujeres, y variadas formas
comunicacionales en el campo (teatralizaciones, música, pasacalles).

La experiencia participativa de Azángaro es un ejemplo de un proceso en dos


fases distintas, una primera en el 2000 basada en la fuerza motriz de una ONG y
una segunda, desde el 2003, centrada en una fórmula de cuatro pies: un alcalde
SDUWLFLSDWLYRXQSUR\HFWRSROtWLFRUHJLRQDOXQHTXLSRWpFQLFRSROtWLFR\HODSR\RGH
ONGs y la cooperación.

(Q $]iQJDUR VH FRQVWLWX\y HQ HO DxR  OD 0HVD GH &RQFHUWDFLyQ
Interinstitucional con el apoyo de CARE Perú. Dicha apertura contó con el auspicio
GHOD0XQLFLSDOLGDGFX\RDOFDOGHHQWRQFHVHUD(XVHELR0D\WDTXH\DHVWDEDHQVX
WHUFHUSHULRGR\FRQPDJUDSRSXODULGDG/D0HVDGXUDQWHVXSULPHUDxRGHEDWLy

39
Juan Arroyo y Marina Irigoyen

\DFRUGyHO3ODQGH'HVDUUROOR&RQFHUWDGRTXHOXHJRHODxRIXHGpELOPHQWH
implementado. La experiencia se desarrollaba entonces en un contexto de gran
FRQIURQWDFLyQ SROtWLFD FRQ HO DOFDOGH OR TXH KDFtD TXH HO SURSLR DOFDOGH WXYLHVH
GLÀFXOWDGHVSDUDDVLVWLUDOD0HVD

(ODxRJDQyODVHOHFFLRQHV3HUF\&KRTXHLQWHJUDQWHGHO3DUWLGR3RGHU
Democrático Regional (PDR) y asesor de la Federación Departamental de Campesinos
GH3XQR(O3'5SHUGLySRUSRFRPDUJHQODVHOHFFLRQHVUHJLRQDOHVGHODxR
pero ganó en algunos distritos y en Azángaro. La gestión provincial cuenta con el
apoyo del Proyecto Fortalece (MIMDES- DFID), CARE Perú, SER y Red Perú. En
HVWRVGRVDxRVODPXQLFLSDOLGDGKDGHVFHQWUDOL]DGROD0HVDHVWDEOHFLHQGRXQD0HVD
XUEDQDHQTXHSDUWLFLSDQWRGRVORVEDUULRV\0HVDVUXUDOHVHQFLQFRPLFURFXHQFDV
En forma participativa se ha actualizado el Plan Estratégico al 2012, buscándose
priorizar proyectos de desarrollo económico en vez de los tradicionales proyectos de
infraestructura. Los ejes de la actual gestión son tres: transparencia, participación y
producción. El Alcalde lidera la Red de Mesas de Concertación Interinstitucionales
(MCI) de Azángaro, Ayaviri-Melgar y Huancané.

La experiencia de Yauyos es una experiencia sui generis en dos etapas, una


primera en el distrito de Alis, centrada en la gestión participativa de un proyecto, y
una segunda, más amplia, a nivel del Corredor Nor Yauyos, de formación del Comité
de Desarrollo del Norte de Yauyos (CODENY), en una fórmula con dos pies: los
alcaldes y las ONGs.

Walter Varillas promovió primero el Comité de Desarrollo del Distrito de Alis


(CODALIS) en Yauyos en 1994, para luego acceder a la alcaldía en 1996, por un
SHULRGR&2'$/,6IXpHQODSUiFWLFDXQ'LUHFWRULRSDUWLFLSDWLYRTXHJHVWLRQDXQ
proyecto, inicialmente transferido del Instituto Salud y Trabajo (ISAT), del cual Varillas
era Director. CODALIS no es una Mesa, por tanto. Con dicho proyecto se hicieron
obras en el distrito, como la piscigranja, los pastos cultivados, etc. Luego de una fase de
confrontación entre sus integrantes en 1996, Varillas accedió a la alcaldía en el periodo
1996-98 y generó una alianza entre su nueva ONG Pro Yauyos y la ONG Instituto
Rural Valle Grande para impulsar la Corporación de Desarrollo del Norte de Yauyos
(CODENY). CODENY va más allá de Alis e integra a los 7 distritos del Corredor
GHODPLFURFXHQFLDGHOULR&DxHWHDGHPiVGH21*V\RUJDQL]DFLRQHVFDPSHVLQDV
'HVGHORVPXQLFLSLRV 7RPDV/DUDRV+XDQFD\D9LWLV0LUDÁRUHV&DUDQLD\
Huantán), comunidades campesinas, organizaciones públicas, privadas y de base de los
distritos de esta zona se agruparon en la Corporación de Desarrollo del NorYauyos
(CODENY), estando inscrita en los Registros Públicos como asociación civil sin

40
Desafíos de la Democracia Participativa Local en la Descentralización

ÀQHVGHOXFUR&2'(1<KDIRUPXODGRHO3ODQGH'HVDUUROOR(VWUDWpJLFRGHO1RU
Yauyos 1997-2002 y ahora ultimo el segundo Plan de Desarrollo Estratégico del Nor
Yauyos 2002-2006. El logro más importante de la CODENY hasta el momento ha
sido la declaración de Área Natural Protegida en la categoría de Reserva Paisajística
del Nor Yauyos – Cochas.

Yauyos es, entonces, un caso particular entre los estudiados por varios motivos.
'HXQODGRVHGLIHUHQFLDGHOUHVWRSRUVXEDVHVRFLDOFRQPHQRVSREUHVTXHODVRWUDV
experiencias estudiadas. De otro lado, en Alis se inicia la concertación sin alcaldía, en
1994, alrededor de la gestión de un proyecto, y posteriormente se da su ampliación,
en 1997, a todo el Corredor de la Reserva Paisajística de Nor Yauyos, en un Comité
TXHHVLQWHUGLVWULWDO(OKLORFRQGXFWRUGHWRGDODH[SHULHQFLDHVODSUHVHQFLDGHOD
ONG Pro Yauyos.

La experiencia participativa de Huaccana en Apurímac es un ejemplo de un


proceso motorizado en forma importante por fuerzas exógenas públicas y privadas,
SRUHQGHFRQUHODWLYDVRVWHQLELOLGDG1RKD\IXHUWHOLGHUD]JRQLXQHTXLSRGHJHVWLyQ
y conducción.

En este distrito de la provincia de Chincheros Nilo Najaro ganó las elecciones


SDUD HO SHULRGR  \ HPSH]y SULPHUR HO DxR  SRU OD IRUPXODFLyQ
GHO 3ODQ GH 'HVDUUROOR &RQFHUWDGR 3&'  ² ´+XDFFDQD DO µ TXH OXHJR VH
reformulo como “Huaccana al 2012” -, con apoyo del Ministerio de la Presidencia
GHVGHHOSUR\HFWR',(635,(6ÀQDQFLDGRSRUOD&RPXQLGDG(XURSHD7HUPLQDGR
el proceso el anterior Comité de Desarrollo Distrital se transformó en la Mesa de
&RQFHUWDFLyQ'LVWULWDOTXHDVXYH]JHQHUyVLHWHPHVDV]RQDOHV HQ$QRUL7RFVR
Suari, Maramara, Pumachuco, Rio Blanco, Ahuayro y Alaypampa), todas ellas
instancias de seguimiento e implementación del PCD. En las mesas participan la
municipalidad, las instituciones locales y las organizaciones sociales. Luego, desde el
DxRHOGLVWULWRUHFLELyHODSR\RGH&$5(3HU~SDUDODIRUPXODFLyQGHVX33DO
ser incluido el distrito como una experiencia piloto ante el MEF para la validación
de la metodología para el PP distrital, hasta entonces formulada en gabinete.
En las elecciones del 2002 ganó el profesor Roberto Medina, del movimiento
/ODSDQFKLTIUHQWHUHJLRQDOLVWD+D\YROXQWDGSDUWLFLSDWLYDSHURODVLQVWDQFLDVQR
generan agregación de intereses sino sumatorias de pedidos, encima con muy
HVFDVRVUHFXUVRV'XUDQWHWRGRVHVWRVDxRV+XDFFDQDUHFHSFLRQyUHFXUVRVWpFQLFRV
\ÀQDQFLHURVSDUDSURPRYHUODSDUWLFLSDFLyQFLXGDGDQD\HO fortalecimiento de la
democracia local. En la actualidad el distrito ha dejado de ser ámbito de intervención
de proyectos de cooperación y la experiencia no ha dado nuevos pasos interesantes,

41
Juan Arroyo y Marina Irigoyen

luego de haber sido el “laboratorio del PP rural”.

Se concluye de esta revisión de factores claves de la sostenibilidad algunas


lecciones:

1. Los factores exógenos pueden inducir el proceso pero no reemplazarlo,


SRUTXHHOHIHFWRWHUPLQDFRQODLQWHUYHQFLyQ
2. Los factores endógenos de alta volatilidad son los alcaldes con liderazgos
SHUVRQLÀFDGRV
3. Los factores endógenos de mayor perdurabilidad son la existencia o creación
GHHTXLSRVGHFRQGXFFLyQ\ODH[LVWHQFLDRJHQHUDFLyQGHSUR\HFWRVSROtWLFRV
regionales o nacionales;
4. El factor más raro pero clave cuando existe, es el involucramiento y
empoderamiento poblacional;
5. El factor comunicación es de primera importancia para construir una esfera
pública local deliberante, escuela pública de ciudadanía: ahora se presenta
como el más incipiente en las experiencias;
6. El factor tiempo es central para arribar al punto de retorno social de la
inversión: hay así tiempos de formación y de maduración.

42
Desafíos de la Democracia Participativa Local en la Descentralización

Capítulo 4:
Viejas y nuevas institucionalidades
mezcladas en la franja avanzada:
Democracia participativa limitada,
democracia participativa de representantes
y democracia participativa
de representantes con poblaciones

¿Cómo funciona la institucionalidad democrática en la franja municipal


participacionista? En la mayoría de experiencias locales participacionistas visitadas la
UHDOLGDGGHODSDUWLFLSDFLyQVRFLDOHVWiPiVDOOiGHODVQRUPDVVREUH&&/\33ORTXH
VLJQLÀFDTXHKD\HQHOODVuna coexistencia de dos democracias participativas, la institucional
\QRLQVWLWXFLRQDO7RGDVWLHQHQ&&/\0HVDVVDOYR0RUURSyQ\6DQWD5RVDTXH
tienen sólo Mesa.

(VWRGHPXHVWUDTXHODIUDQMDPXQLFLSDOSDUWLFLSDWLYDQRKDGHMDGRGHIXQFLRQDU
como un laboratorio generador de variantes institucionales por el hecho de haberse
emitido leyes sobre ello en el marco de la descentralización.

/DVYDULDQWHVGHGHPRFUDFLDSDUWLFLSDWLYDTXHODPD\RUtDGHHVWDVH[SHULHQFLDV
viene ensayando rebasan la legislación sobre CCLs y PP. Pero esta situación es inversa
HQODIUDQMDPXQLFLSDOLQVWLWXFLRQDOLVWD\HQODWUDGLFLRQDOHQTXHVHFXPSOHHOPtQLPR
legal o no se cumple la ley.

(VWRTXLHUHGHFLUTXHORV&&/VRQGHDOJXQDPDQHUDFULWLFDGRVWDQWRSRUOD
IUDQMD SDUWLFLSDWLYD TXH ORV VLHQWH PiV DWUiV GH OR QHFHVDULR FRPR SRU OD IUDQMD
WUDGLFLRQDOLVWDTXHORVVLHQWHLQQHFHVDULRVGDWRGHSULPHUDLPSRUWDQFLDSDUDUHVROYHU
el dilema institucional sobre si el régimen municipal participativo va ser real o

43
Juan Arroyo y Marina Irigoyen

formal, o incluso obviarse, como muchas leyes en el Perú. Como veremos, la actual
FRPSRVLFLyQ\IXQFLRQHVGHORV&&/ORVKDFHQSRFRDWUDFWLYRVSDUDORVTXHFUHHQ
HQODGHPRFUDFLDFRPRXQÀQSHURWDPELpQSDUDORVTXHFUHHQHQODGHPRFUDFLD
como un medio. Los primeros, los participacionistas, los sienten poco democráticos,
y los segundos, los institucionalistas y tradicionales, los sienten poco útiles como un
organismo con interlocutores sociales numerosos y representativos, con los cuales
legitimar sus gestiones.

4.1 Las reingenierías institucionales: Mesas y CCLs


La superposición objetiva de funciones entre las Mesas y los CCLs ha
REOLJDGR D ORV OLGHUD]JRV \ HTXLSRV ORFDOHV D EXVFDU VROXFLRQHV QRYHGRVDV D HVWH
nuevo problema.

En realidad el problema de la superposición de funciones y competencias


es característico del Estado peruano, por su modelo de gestión burocrático-
SDWULPRQLDOLVWD3HURORQXHYRHVTXHKDWUDVODGRGLFKRWUDVODSHFRQVWDQWHGHFRVDV
al terreno de la participación y concertación. En el país ha habido hasta hoy tres olas
de creación de instancias de concertación: la de las Mesas de Concertación de los
90s, la de las Mesas de Concertación de Lucha contra la Pobreza (MCLCP) a partir
del 2001 y ahora la de los CCL y PP. 3

El paso de una oleada a otra siempre ha originado un reacomodo, no sin


FRQÁLFWRV\GXSOLFLGDGHV 5HP\ (QPXFKRVFDVRVORVDOFDOGHV\GLULJHQWHV
de las Mesas existentes han debido apelar precisamente a su capacidad de concertación
para evitar un paralelismo indeseable en el propio campo de la concertación. En
Santo Domingo, Piura, enfrentados al problema el 2001, optaron por cambiar el
nombre de la instancia existente – el Comité de Desarrollo Distrital (CODEDI)
– para convertirla en Comité de Desarrollo y Lucha contra la Pobreza (CODELCP).
(Q6DQ0DUFRV&,1'(6$0GHEDWLyHOSXQWR\DFRUGyTXHGDUVHFRQOD0HVDGH
siempre, constituyendo una comisión temática sobre pobreza. En Curahuasi se
acordó conservar el Comité de Concertación Interinstitucional (CCOI) existente a
QLYHOGLVWULWDOSHURDÀOLDUVHDOD0&/3GHOQLYHOSURYLQFLDO(OGLUHFWRUPXQLFLSDOHQ
representación de la municipalidad distrital asiste a la MCLP provincial.

___________________________________________________
3 En el presente informe el tipo de Mesas de Concertación que se han estudiado – salvo un caso - son las previas a la Mesa de
Concertación de la Lucha contra la Pobreza, por lo que se utiliza el término Mesas para las primeras, más antiguas, y las siglas
MCLP para las segundas.

44
Desafíos de la Democracia Participativa Local en la Descentralización

$KRUD TXH VH KDQ JHQHUDGR ORV &&/ \ &&5 GH QXHYR VXUJHQ ]RQDV GH
VXSHUSRVLFLyQ(VHYLGHQWHTXHKDFHIDOWDRUGHQDUODVGLYHUVDVLQVWDQFLDVWHUULWRULDOHV\
temáticas de participación y concertación en un sistema político local, como ha planteado
Varillas (2004).

(QODVGRFHH[SHULHQFLDVTXHKHPRVHVWXGLDGRKHPRVHQFRQWUDGRFLQFRWLSRV
de soluciones a la relación entre Mesas y CCLs, cuatro de las cuales buscan evitar la
duplicidad y en algunos casos darle un valor agregado a los CCL:

a) Inclusión del CCL dentro de la Mesa de Concertación: Azángaro

  (Q$]iQJDUROD0HVDWLHQHPXFKDPD\RULPSRUWDQFLDTXHHO&&/
y sus acuerdos tienen poder vinculante de facto, reuniéndose el CCL luego
VyORSDUDDVXPLUORVIRUPDOPHQWH(ODOFDOGHSUHVLGHOD0HVDTXHWLHQHXQD
IURQGRVDUDPLÀFDFLyQ/RVLQWHJUDQWHVGHO&&/DFW~DQFRQIRUPHH[SOLFD
HODOFDOGH3HUF\&KRTXHFRPRIDFLOLWDGRUHVGHODVUHXQLRQHVGHODV0HVDV

b) Ampliación del CCL y complementariedad con la Mesa: Santo


Domingo y Curahuasi

En Santo Domingo, el alcalde Carlos López ha reglamentado el CCL


a través de una Ordenanza, ampliándolo hasta sumar 32 representantes:
el alcalde, 5 regidores, 1 alcaldesa del CP Simiris, 3 de la sociedad civil, 9
presidentes de los CODEZOS, 9 presidentes de organizaciones sociales y
productivas de nivel distrital, el presidente del CODELP y 3 representantes
VHFWRULDOHV(QHVWHGLVWULWRSLXUDQRQRVHH[LJLHURQORVSUHUUHTXLVLWRVTXH
exige la norma para la inscripción de organizaciones sociales, habiendo sido
PDVLYDODHOHFFLyQ$VXYH]OD0HVD²TXHYLHQHPX\GHDQWHVHVPX\
UDPLÀFDGD\GHSHUPDQHQFLDVLVWHPiWLFD(OFDPELRHQVtQWHVLVKDFRQVLVWLGR
HQGDUOHXQDQXHYDRUJDQLFLGDGDO&&/TXHORKDJDYDOHGHUR(OORKDREOLJDGR
a construir un triángulo comunicacional alcalde-CCL, alcalde-Mesa y Mesa-
&&/TXHIXQFLRQDPHMRUHQORVGRVSULPHURVQH[RV\REOLJDDXQDODERUHGLO
itinerante.

En Curahuasi el Comité de Concertación Interinstitucional (CCOI)


viene de 1999 y cuenta actualmente con un PCD y 7 mesas temáticas. A inicios
del 2004 constituyó su CCL con una amplia difusión en las comunidades y
RUJDQL]DFLRQHVVRFLDOHVDOSXQWRTXHKXERRUJDQL]DFLRQHVVRFLDOHVLQVFULWDV

45
Juan Arroyo y Marina Irigoyen

Actualmente el CCL tiene su Reglamento y cuenta con 30 representantes, 6


GHODPXQLFLSDOLGDG\GHODVRFLHGDGFLYLO+D\XQDUHODFLyQÁXLGDHQWUHHO
&&/\HO&&2,WHQLHQGRHOSULPHURXQDDPSOLDUHSUHVHQWDFLyQVRFLDOTXH
le puede posibilitar tener un rol, según los entrevistados, de interlocución
SREODFLRQDO\ÀVFDOL]DFLyQHGLO

c) Representación de la Mesa en el CCL: San Marcos

 (Q HVWD SURYLQFLD FDMDPDUTXLQD OD DQWLJXD 0HVD &,1'(6$0  VLJXH


reuniéndose y su composición integra centralmente a la “oferta institucional
SURYLQFLDOµ VHFWRU S~EOLFR LQVWLWXFLRQHV ORFDOHV  PLHQWUDV TXH ODV
organizaciones sociales – la “demanda provincial” - están más representadas
HQHO&&/(O&&/WLHQH267UDWDQGRGHFRQVWUXLUXQÁXMRFRPXQLFDFLRQDO
adecuado entre la Mesa y el CCL la municipalidad ha acordado mediante una
Ordenanza integrar a un representante de CINDESAM como representante
en el CCL.

d) Mesa sin CCL: Morropón y Santa Rosa

En Morropón, luego del activismo participativo entre 1990-98 con el alcalde


Maximiliano Ruiz y de la fase de declive posterior, desde el 2001 hay una
0&/3SHVHDYDULRVLQWHQWRVDÀQHVGHOQRVHKDEtDFRQVWLWXLGRHO&&/
(ODOFDOGHPDQLÀHVWDTXHDVXPLUORLPSOLFDUtDXQDVREUHFDUJDGHWUDEDMR

En Santa Rosa, en la provincia de Melgar, hubo una primera experiencia de


creación de una Mesa de Concertación Interinstitucional (MCI) entre 1999 y
2002 a partir del apoyo de CARE Perú (proyecto FOGEL), durante la gestión
del alcalde Domisiano Ccama. El nuevo alcalde Julián Páucar, ex Secretario
General de Federación Departamental de Campesinos de Puno (FDCP), en
octubre del 2003 reemplazó la MCI por otra instancia de concertación local,
el Consejo de Autogobierno Local (CAL), intentando seguir el modelo de
Consejo Comunal Vecinal de Limatambo. Dicho CAL tiene 60 miembros
titulares y 60 suplentes y se reúne cada tres meses, teniendo una secretaría
WpFQLFDTXHSUHSDUDORVLQIRUPHVQHFHVDULRVSDUDVXVDFXHUGRV(VWH&$/KD
debatido el Plan Estratégico y el PP, pero hasta el momento no se implementa
el CCL.

46
Desafíos de la Democracia Participativa Local en la Descentralización

*UiÀFR1ƒ
Tipos de Relación entre Mesas de Concertación y CCLs
1. CCL dentro de la MC
CCL MC Azángaro: MC vinculante de facto, CCL formaliza
acuerdos - Integrantes son facilitadores de MC.

2. CCL ampliado
Santo domingo: Reglamento del CCL lo amplia 32 y
CCL MC Mc Fuerte
Vurahuasi: CCL ampliado a 30 representantes, 24 de
sociedad civil: Mesa fuerte

3. MS Consultiva de CCl
MC CCL San Marcos: Ordenanza municipal legaliza 1
representante de mesa en CCL

4. MC sin CCL
Morropón: Mesa débil y CCL no instalado por
MC ¨sobrecarga de actividades¨
Santa Rosa: Mesa fuerte (CAL), CCL no instalado

5. MC y CCL, vidas separadas


Ichocan: Ambas débiles, sobre todo la MC, y
CCL separadas
MC
Yauyos: CODENY, espacio de concertación de
corredor, no relacionados con los CCL distritales

e) La Mesa y el CCL sin relación, vidas paralelas: Ichocán y Yauyos

Ichocán es una mesa de tipo declinante, mononuclear, cuyo apogeo


VHGLRHQWUHORVDxRV\FRQHOQRPEUHGH&RPLWpGH&RRUGLQDFLyQ
Interinstitucional. Fue relanzada con el nombre de Mesa del Desarrollo
+XPDQR6RVWHQLEOHHODxR\HVWiDFWXDOPHQWHPX\GpELO(QHVHFRQWH[WR
llegó la normatividad sobre los CCL y el municipio lo formó con apoyo de
la Asociación de Municipalidades del Corredor Crisnejas (AMCEC), pero
QRKDOOHJDGRDIRUWDOHFHUVH/DH[SHULHQFLDSDUHFHVHxDODUTXHGRVLQVWDQFLDV
HQXQGLVWULWRSHTXHxR\FRQSRFDRUJDQLFLGDGQRIXQFLRQDQ

En Yauyos, conforme vimos, el CODENY abarca un corredor con


GLVWULWRVSRUORTXHODH[SHULHQFLDVLJXHXQFXUVRSDUDOHORDORV&&/33
y Rendición de Cuentas (RC).

47
Juan Arroyo y Marina Irigoyen

6HGHGXFHGHHVWHFXDGURGHVLWXDFLRQHVTXHHQODIUDQMDDYDQ]DGDODSUHVHQFLD
de los CCL no ha sido vista como una oportunidad, por contar ya con Mesas. La
presencia de dos instancias parecidas ha obligado a reingenierías institucionales
TXHHQGHODVYDULDQWHVYLHQHQWUDWDQGRGHHYLWDUUHSHWLFLRQHV(QWUHVFDVRVHO
SULQFLSLRUHFWRUGHODUHLQJHQLHUtDKDVLGRODHÀFLHQFLDEXVFiQGRVHHFRQRPL]DUFRVWRV
en términos de tiempos y espacios, sea integrando los CCL a las Mesas (Azángaro)
o en la versión más drástica, no formando los CCL (Morropón y Santa Rosa). En
otros casos el principio rector de la reingeniería ha sido la efectividad, esto es, dada
ya la duplicidad, tratar de construir la mejor articulación para el máximo provecho en
WpUPLQRVGHSDUWLFLSDFLyQ\FDOLGDGGHODVGHFLVLRQHVVHDKDFLHQGRTXHOD0HVDVHD
integrante formal del CCL (San Marcos) y/o ampliando los CCL hasta convertirlos
en Mesas cuasi-institucionalizadas (Santo Domingo y Curahuasi), cuyas reuniones
tengan un peso mayor.

Cuando se estuvo formulando la Ley Orgánica de Municipalidades la


recomendación de RED Perú y otros actores de la comunidad epistémica a los
GLVHxDGRUHV IXH LQFRUSRUDU ODV 0HVDV FRQ VX QDWXUDOH]D DPSOLD FRPR LQVWDQFLDV
formalizadas de concertación, pero ello no fue aceptado. Finalmente la realidad se
viene imponiendo, procesándose readecuaciones organizacionales de facto. Como
decíamos, el CCL actual es casi una reedición - algo ampliada - del consejo municipal
y es necesario la mayor presencia de la sociedad civil para hacerlo atractivo, tanto
SDUDORVTXHHQIDWL]DQODGHPRFUDFLDFRPRXQÀQFRPRSDUDORVTXHFUHHQHQOD
democracia sólo como un medio. Respecto a éstos últimos, un incentivo para la
vigencia de los CCL es su rol en el proceso de los PP pero durante el ejercicio del
33GHOHO0()DÁRMyHVWHUHTXLVLWRSRUORVPiUJHQHVGHLQFXPSOLPLHQWR
con lo cual mermó su atractivo. Al parecer la fórmula de CCL Ampliados podría
VHUODTXHPHMRUIXQFLRQHHQODIUDQMDLQVWLWXFLRQDOLVWDSXHVHQHOODQRKD\0HVDV
previamente, mientras en la franja participacionista podría ser la dinámica articulada
entre las Mesas pre-existentes y CCLs Ampliados.

4.2 Presupuesto participativo y rendiciones de cuentas:


cumplimientos formales y reales
En general se observa el cumplimiento de los Presupuestos Participativos, con
XQDWHQGHQFLDJHQHUDODXQDDPSOLDSDUWLFLSDFLyQHQODGHÀQLFLyQGHSULRULGDGHV\
SUR\HFWRV(YLGHQWHPHQWHKD\LQWHUpVGHODSREODFLyQSRUGHÀQLUFRVDVDVXIDYRU
habiéndose sin embargo recogido los siguientes problemas:

48
Desafíos de la Democracia Participativa Local en la Descentralización

1) La desligazón relativa entre los PCD y los PP por la no conservación de la


visión distrital o provincial en el procesamiento de los PP, fragmentándose
el gasto y dispersándose los recursos;

  (OGpÀFLWGHFDSDFLGDGHVSDUDHMHFXWDUODVREUDV\SUR\HFWRVDSUREDGRVHQ
HO33HQSDUWLFXODUSDUDFXPSOLUFRQORVUHTXLVLWRVWpFQLFRVSDUDHOGLVHxR
GHSHUÀOHV\SUR\HFWRV ,FKRFiQ6DQWD5RVD 

  /D FRPSOHMLGDG GH SDVRV \ UHTXLVLWRV GHO LQVWUXFWLYR TXH REOLJDQ D ORV
municipios a buscar “rutas cortas”;

  /D ULJLGH] DFWXDO GHO FRQFHSWR GH LQYHUVLyQ S~EOLFD TXH QR UHFRJH
LQWHUYHQFLRQHV SURSLDPHQWH VRFLDOHV SRU HMHPSOR HO WHPD GH HTXLGDG GH
género o el de desarrollo de capacidades;

5) El rol impreciso y en algunos casos marginal de los CCL en la actualización


de los PCD y en los procesos de PP;

6) La necesidad de proyectos de mayor envergadura y por tanto la coordinación


con otros niveles para proyectos provinciales y regionales.

8QHOHPHQWRFRP~QHQORV33HVTXHODVPXMHUHVWLHQHQXQDPtQLPDSDUWLFLSDFLyQ
generalmente como espectadoras o alcanzando propuestas limitadas a demandas de
capacitación para el empleo, local comunal o similares. Son casi inexistentes los
pedidos de capacitación para temas como derechos en salud, familia, violencia familiar
o formación de liderazgos participativos. De hecho la estructura presupuestal y la
normatividad limitan la posibilidad de ir más allá de obras tangibles. La incorporación
GHOWHPDGHJpQHURVHYHGLÀFXOWDGDSRUHOHVFDVRPDQHMRGHOPLVPRSRUSDUWHGHO
personal municipal y de las propias dirigentas.

Huaccana fue el laboratorio para la validación de la metodología del Presupuesto


Participativo y por tanto realizó su proceso con fuerte soporte externo. El problema
TXHSUHVHQWDDKRUDTXH\DQRWLHQHGLFKRDSR\RHVODVRVWHQLELOLGDGGHODFDOLGDG
GHSDUWLFLSDFLyQSUHYLD\HQHOFDVRGHO33ODFRPSDWLELOL]DFLyQHQWUHORVSHTXHxRV
UHFXUVRVFRQTXHFXHQWD\ODDUERULÀFDFLyQGHVXVLQVWDQFLDVORTXHOOHYDDXQDSXMD
distributiva. En Huaccana se vienen implementando comités de vigilancia para la
ejecución de lo programado participativamente.

(Q,FKRFiQFDVLWRGRHOWUDEDMRWpFQLFRIXHUHDOL]DGRSRUHOHTXLSRGHOD
AMCEC, tanto para la elaboración de la ordenanza, como para la preparación
y realización de los talleres de capacitación, el proceso de inscripción de agentes

49
Juan Arroyo y Marina Irigoyen

participantes y la asamblea de priorización de proyectos. Este proceso animó la


participación de diversos actores, principalmente institucionales, y de vecinos de
OD SHTXHxD FLXGDG 7DPELpQ SDUWLFLSDURQ UHSUHVHQWDQWHV GHO &RPLWp GH 9DVR GH
Leche.

En Azángaro el proceso del PP se realiza desde antes de la dación de la norma,


HQ IRUPD PX\ DPSOLD HQ ORV HVSDFLRV GH FRQFHUWDFLyQ GHVFHQWUDOL]DGRV FRQ TXH
FXHQWD(QHODxRVHORJUyHODFXHUGRGHTXHFDGDXQRGHORVYHFLQRVGHOFDVFR
urbano aportara 150 soles para la construcción del sistema de desagüe, existente solo
para el 10% de los hogares.

(Q6DQ0DUFRVHO33KDVLGRHOHVSDFLRGHWUDEDMRPiVDQLPDGRGHODxR6H
WUDEDMy\HQULTXHFLyHOLQVWUXFWLYRGHO0()DVXPLHQGRFRPRFULWHULRVGHDSUREDFLyQ
de proyectos su alcance y el aporte de contrapartida. El énfasis ha sido favorecer
proyectos productivos de desarrollo, estando entre los aprobados a nivel provincial la
PLFURSUHVDGH3RWUHULOORODHOHFWULÀFDFLyQUXUDOGHFDVHUtRV\HO0HUFDGRGH$EDVWRV
y a nivel distrital, el apoyo al Centro Educativo y servicios de agua potable y letrinas.
Quedaron sin aprobar proyectos para la formación de liderazgos juveniles, para el
apoyo a microempresas procesadoras de cereales y el fortalecimiento de hábitos de
QXWULFLyQSRUFRQVLGHUDUORVIXQFLRQDULRVTXHHVWRVSUR\HFWRVQRSRGtDQVHUSDUWH
del presupuesto de inversión. El PP se trabajó en el nivel distrital y provincial. En
el PP del distrito capital, Pedro Gálvez, participaron los 8 miembros de sociedad
civil del CCL más otras 5 organizaciones (CVL, Liga Distrital de Fútbol, entre
otros), 50 representantes de los caseríos y de tres barrios. En el PP provincial se
convocó a los alcaldes distritales, el CCL, CINDESAM, invitados de los sectores
(GXFDFLyQ$JULFXOWXUD6DOXG ´(VGHUHFRQRFHUTXHIXHSRFDODSDUWLFLSDFLyQGH
ODUHSUHVHQWDFLyQIHPHQLQDHQHO33µVHxDODODUHJLGRUD/LO\4XLUR]$~QQRVHKD
instituido un sistema de seguimiento a los acuerdos del PP.

En Morropón la municipalidad ha cumplido con impulsar con estándares


mínimos el Presupuesto Participativo en el 2003 y 2004, coordinando con la MCLP.
En general hay una participación de baja calidad en la localidad. Hacia el 2003 el
DOFDOGH \ HO 3iUURFR VH FRPSURPHWLHURQ HQ UHODQ]DU OD 0&/3 HQ OR TXH VHUtD VX
tercera etapa, pero este proceso aún no da frutos. Se trató de actualizar el Plan de
(VWUDWpJLFRGH'HVDUUROORFRQDSR\RGHOD)XQGDFLyQ(EHUWSHURHOSURFHVRTXHGy
paralizado. El alcalde alude a una recarga de labores.

(Q 6DQWR 'RPLQJR HO 33  KD YHQLGR VLHQGR GHÀQLGR FRQ DPSOLD
participación de los vecinos. “Hubo como 500 participantes en la reunión de mayo”,

50
Desafíos de la Democracia Participativa Local en la Descentralización

VHxDODHO*REHUQDGRU(QHVWHGLVWULWRHOPXQLFLSLRGHFLGLyGHVGHDQWHVGHO33DEULUDOD
toma de decisiones el 100% del precario presupuesto municipal de inversiones (alrededor
de medio millón de soles anual), algo muy poco practicado en esos momentos.

De otro lado, en relación a las Rendiciones de Cuentas (RC), hasta el momento


VHSXHGHLGHQWLÀFDUWUHVIRUPDVSDUDVXUHDOL]DFLyQ

1. Cabildo abierto: es la modalidad más utilizada y la más común en las


experiencias;

2. Rendiciones de cuentas en los presupuestos participativos y espacios de concertación: por


lo general todo proceso comienza con una rendición de cuentas, explicando
los montos de ingresos, egresos y el monto asignado al presupuesto
participativo;

 /D5HQGLFLyQGH&XHQWDVFRPRSURFHVRHVSHFtÀFR en este caso se trata de procesos ad


KRFORTXHVXSRQHTXHVHYDPiVDOOiGHODFWRGHLQIRUPDU3RUORJHQHUDOVH
trabaja concertadamente con la propia sociedad civil la metodología de rendir
cuentas y su ejecución, y en algunos casos es reglamentada por ordenanza
PXQLFLSDO6HHVWiQGLVHxDQGR\GLIXQGLHQGRJXtDVSDUDHVWDIRUPDGHUHQGLU
cuentas.

Tabla N° 5:
Tipos de Rendiciones de Cuentas implementados
en las Experiencias, 2004
RC en Cabildo RC con Guía
RC en PP
Abierto metodológica

Santa Rosa Si Si No
Azángaro Si Si Si
Huaccana No Si No
Curahuasi Si Si Si
Limatambo Si Si No
San Marcos Si Si No
Ichocán Si Si No
Santo Domingo Si Si No
Morropón Si Si No
Nor Yauyos Si Si No

51
Juan Arroyo y Marina Irigoyen

En realidad hay dos niveles de cumplimiento de la rendición de cuentas: el


FXPSOLPLHQWRPtQLPR\ODUHQGLFLyQUHDO/DVGRVH[SHULHQFLDVTXHKDFHQPHMRUOD
rendición de cuentas son Azángaro y Curahuasi.

En Azángaro en el 2003 se realizaron dos cabildos abiertos y en el 2004 se


implemento la RC con una guía metodológica aportada por el proyecto Fortalece,
durando el proceso 3 meses, desde septiembre hasta mediados de diciembre. El
proceso ha implicado la convocatoria a las organizaciones, la publicación de la
ordenanza, la formulación de las preguntas para rendir cuentas, y todos los pasos
contemplados.

En Curahuasi se ha cumplido con la normatividad municipal vigente y en los dos


DxRVGHODJHVWLyQVHKDUHDOL]DGROD5HQGLFLyQGH&XHQWDVFRRUGLQDQGRFRQHO&&/
reuniones amplias. La segunda Rendición, el 21 de setiembre del 2004, contó con una
Guía orientadora y fue difundida por la radio en directo, buscando intencionalmente
cimentar la comunicación entre autoridades y la población.

En Santa Rosa hasta el momento se han implementado dos cabildos abiertos,


brindándose información sobre el presupuesto y sobre los acuerdos del Consejo de
Autogobierno Local (CAL) a toda la población. En el presupuesto participativo se ha
rendido cuentas de los montos generales de egresos e ingresos y obras implementadas
en el distrito.

En Huaccana la rendición de cuentas esta asociada a la transparencia en la


información en el proceso de presupuesto participativo. No por casualidad Huaccana
fue el laboratorio en la validación de la metodología de PP.

(Q 6DQWR 'RPLQJR VH GD OD 5HQGLFLyQ GH &XHQWDV GRV YHFHV SRU DxR XQD
GHHOODVHQXQD&HQDGH1DYLGDGTXHVHRIUHFHDPSOLDPHQWH(ODOFDOGHDVXPHOD
responsabilidad de las rendiciones.

En San Marcos se cumple con estándares mínimos con la Rendición de Cuentas


XQDYH]SRUDxR DXQTXHQRKD\XQPHFDQLVPRWDQFODUDPHQWHHVWDEOHFLGRSDUDHOOR
No se cuenta con una política amplia de comunicación municipalidad-población.

En Morropón se realizó una primera Audiencia Pública de RC en mayo del 2003,


con cerca de 200 participantes, y la segunda en enero del 2004, con 300 participantes.
Allí la población fue ampliamente informada de los gastos, recursos disponibles y
obras.

52
Beneficios y costos de la democracia participativa

Si comparamos la experiencia de Ichocán con otras, podríamos decir que hubo


una Rendición de Cuentas con estándares mínimos.

Tabla N° 6: Calidad de ejecución de instancias e


instrumentos en las Experiencias

Azángaro Curahuasi Huaccana Icho-cán Limatambo Morropón Santo San Santa Nor Corredor
2004 2004 Domingo Marcos Rosa Yauyos Jabón
Mayo
No
Mesa
99 99 9 9 9 9 99 99 99 9 aplica

No No
CCL
9 99 9 9 9 8 99 9 8 aplica aplica

No No
PCD
9 9 99 9 9 9 9 9 9 aplica aplica

No No
PP
9 9 9 9 9 9 99 9 9 aplica aplica

No No
RC
99 99 9 9 9 9 9 9 9 aplica aplica

99 Cumplimiento de calidad 9 Cumplimiento mínimo 8 No cumplimiento

En realidad al revisar la aplicación de los instrumentos y mecanismos de


participación se evidencia una mejor ejecución de Mesas, PCD y PP, siguiendo en
segundo lugar los CCL y en último lugar, las RC. En algunos casos de cumplimiento
mínimo de PP, CCL y RC hay un cumplimiento formal, que deja documentación
pero no realidades y capacidades.

4.3 Democracias locales participativas


A partir de la información recopilada hemos identiÀFDdo tres modelos de
democracia participativa. Evidentemente se trata de alguna manera de “tipos ideales”
pues las gradaciones entre uno y otro modelo imperan en la realidad:

a) El modelo de democracia participativa de representantes.

Lo que es medular de esta variante es la participación de los directivos


de instituciones y líderes de organizaciones sin mandato de sus representados ni
rendición de cuentas de sus actos. Suelen por tanto ser o devenir en democracias

61
Juan Arroyo y Marina Irigoyen

GHpOLWHVRSROLDUTXtDVORFDOHV6XVDFXHUGRVVLQPXFKRUHVSDOGRSRUORJHQHUDO
tienen carácter consultivo para los decisores. La fórmula organizativa más
FRP~QGHOD´GHPRFUDFLDSDUWLFLSDWLYDGHUHSUHVHQWDQWHVµHVODTXHKHPRV
denominado Mesa mononuclear, esto es, una Mesa única, sin un organigrama
de mesas temáticas ni territoriales. Ejemplos de este tipo son Ichocán y
Yauyos.

b) El modelo de democracia participativa de representantes con


poblaciones.

En este caso el poder moral de la población reunida periódicamente


se convierte en vinculante de hecho y hay una co-gestión entre Estado
\ VRFLHGDG &RUUHVSRQGH SRU OR JHQHUDO D 0HVDV DUERULÀFDGDV HVWR HV
LQVWDQFLDVTXHFXHQWDQFRQXQQ~FOHRFHQWUDOSHURIXQFLRQDQWDPELpQSRU
FXHQFDVR]RQDV\SRUHMHVWHPiWLFRVGHWDOIRUPDTXHLQYROXFUDQDXQD
parte de la población. Los representantes tienden a la consulta de sus actos
\YRWDFLRQHV\ULQGHQFXHQWDGHVXODERU(MHPSORVTXHVHDFHUFDQDHVWH
tipo son Azángaro, Santo Domingo y Limatambo en el periodo 1993-2002.
San Marcos es un caso intermedio pues CINDESAM no es mononuclear
SHURVXVUDPLÀFDFLRQHVQRHVWiQPX\DFWLYDVVtVXQ~FOHRFHQWUDOTXHWXYR
DOUHGHGRUGHUHXQLRQHVHODxR\DOJRPHQRVHO

c) El modelo de democracia participativa limitada.

En este caso los municipios sólo tienen el CCL, cumpliendo


IRUPDOPHQWHORQRUPDGRTXHWLHQHLQVXÀFLHQFLDV\DVHxDODGDVHQWUHHOODVHO
SRUFHQWDMHGHPLHPEURVGHODVRUJDQL]DFLRQHVVRFLDOHV\ORVUHTXLVLWRVOHJDOHV
SDUDVXLQVFULSFLyQ(OPRGHOR&&/DFWXDOHVGHQWURGHODFODVLÀFDFLyQGH
espacios de participación de Andrea Cornwall (2002:17-21), una “institución
regulada de intermediación”, esto es, una instancia de participación por
LQYLWDFLyQGLIHUHQWHGHORVRWURVWLSRVGHHVSDFLRVGHSDUWLFLSDFLyQTXHOD
DXWRUDFODVLÀFDHQFXDWURD ORVHVSDFLRVDXWyQRPRVGHVRFLHGDGFLYLOE ORV
PRYLPLHQWRVDOWHUQDWLYRVRGHUHVLVWHQFLDF ODV´IRUPDFLRQHVÁRWDQWHVµR
movimientos irruptivos; y d) las instituciones reguladas de intermediación.
En este último tipo hay menos márgenes de libertad y menos horizontalidad,
HYLGHQWHPHQWHTXHHQHOFDVRGHODV0HVDVVXUJLGDVGHVGHDEDMRHQTXHOD
UHODFLyQDOFDOGHV0HVDVHQGyJHQDVHVPiVÁXLGD

54
Desafíos de la Democracia Participativa Local en la Descentralización

  6HGHGXFHGHODSUHVHQWDFLyQGHORVWUHVWLSRVTXHHOPRGHORUHDOGH
GHPRFUDFLDORFDOHQODVFLUFXQVFULSFLRQHVHQODVTXHH[LVWH&&/\0HVDHVXQ
“modelo híbrido” entre un modelo institucional de participación limitada”
(CCL) y alguna de las dos variantes participativas, sólo de representantes
o de representantes con poblaciones. El modelo más abierto – de
UHSUHVHQWDQWHVFRQSREODFLRQHVHVHOGH&&/$PSOLDGR\0HVDDUERULÀFDGD
(o descentralizada).

4.4 El ciclo de vida de los movimientos: experiencias emergentes,


persistentes y declinantes

(VLPSRUWDQWHDGYHUWLUTXHOD´FDOLGDGGHODGHPRFUDFLDµ 2'RQQHOO 
es móvil y puede ampliarse o retrotraerse, en este caso conforme a la mixtura
HQWUH VX YDULDQWH LQVWLWXFLRQDO \ QR LQVWLWXFLRQDO (VWR TXLHUH GHFLU TXH KD\
democracias participativas “de ida” y “de venida”, de menos a más o viceversa,
esto es, de ida hacia un modelo de representantes con poblaciones o de venida
hacia un modelo de representantes o de participación limitada, con todas sus
etapas intermedias.

&RKHQ \ $UDWR   HQVHxDURQ TXH KDEtD XQ ´FLFOR GH YLGD GH
ORV PRYLPLHQWRV VRFLDOHVµ 'LFKR FLFOR FXEUH XQ DUFR TXH YD GH ODV SULPHUDV
IRUPDVQRLQVWLWXFLRQDOHVGHORVPRYLPLHQWRVHQTXHSULPDQODVUHGHVDPSOLDV\
ÁH[LEOHVODDVRFLDWLYLGDGYROXQWDULDODGLVWLQFLyQPtQLPDHQWUHOtGHUHV\VHJXLGRUHV
D XQD VHJXQGD HWDSD HQ TXH VH DYDQ]D KDFLD OD RUJDQL]DFLyQ IRUPDO OD LQFOXVLyQ
y la institucionalización, con los peligros de la cooptación, la profesionalización,
la burocratización y la centralización. Pero este tránsito no es ineluctable y la
VRVWHQLELOLGDGGHORVPRYLPLHQWRVSDUWLFLSDWLYRVORFDOHVWLHQHTXHYHUFRQHOPDQHMR
adecuado de la tensión entre organización misionaria e institucionalidad (Mintzberg,
1993). Justamente la diferencia de los adherentes a la democracia participativa respecto
DORVTXHSRVWXODQODGHPRFUDFLDUHSUHVHQWDWLYDFOiVLFDHVTXHSDUDORVSULPHURVOD
GHPRFUDFLDHVQRVyORXQPpWRGR²XQGLVHxRLQVWLWXFLRQDOSDUDDUULEDUDGHFLVLRQHV
- sino un modelo de sociedad (Pateman, 1970).

$SOLFDGRDOFDVRVHREVHUYDTXHKD\GHPRFUDFLDVSDUWLFLSDWLYDVHPHUJHQWHV
persistentes y declinantes. Algunas experiencias están en expansión, otras en el
orto de su desarrollo y unas terceras en su fase de retraimiento. Hay también
relanzamientos.

55
Juan Arroyo y Marina Irigoyen

Tabla N° 7: Etapas de mayor y menor desarrollo de las experiencias


de democracia participativa

1990 - 1992 1993 - 1995 1996 - 1998 1999 - 2002 2003 - 2006
San Marcos Néstor Mendoza
MECODEH (TXLSRUHJLRQDO
Limatambo Wilbert Rosas
Ichocán Ichocán
Curahuasi Julio Luna
Sto. Domingo Carlos López
Azángaro 3HUF\&KRTXH
Yauyos Experiencia ALIS Walter Varillas
Morropón Maximiliano Ruiz
Santa Rosa Julián Páucar
Huaccana Nilo Najaro

Etapas de mayor desarrollo Etapas de menor desarrollo

San Marcos, una de las más antiguas, tuvo su orto entre 1993 y 1998 y hoy es
una experiencia persistente pero en un nivel de funcionamiento menor. Azángaro
IXQGyVX0HVDHQHODxR\QRGHVSHJyVLQRFRQODQXHYDJHVWLyQ
HVWDQGR KR\ HQ DVFHQVR &2'(1< GH <DX\RV WXYR VX RUWR HQWUH  \ HO DxR
2000, estando hoy en una fase de estabilización. Huaccana vive el estancamiento de
su experiencia, luego de haber sido receptor de múltiples proyectos de cooperación
durante la etapa 2002-2003.

56
Desafíos de la Democracia Participativa Local en la Descentralización

Capítulo 5:
Demanda participativa
elástica e inelástica:
la franja de desempeño óptimo
de la participación

Las experiencias de participación y concertación local revisadas tienen su


“núcleo duro” en la presencia de tres actores: las autoridades municipales, las ONGs
y las organizaciones sociales. ¿Quienes no vienen? Las empresas privadas. ¿Quiénes
vienen a veces y en algunos casos, con cierta regularidad? Los representantes de
entidades el Estado. ¿Participan las mujeres y los jóvenes? Poco. ¿Participan los
PX\SREUHV"$YHFHV¢3DUWLFLSDQORVSDUWLGRV"(YHQWXDOPHQWH¢3RUTXpHVWHSHUÀO
de la participación? ¿Es un tema estructural o institucional? ¿Es objetivamente así
RGHSHQGHGHDUUHJORVLQVWLWXFLRQDOHV"(VWHHVHOSXQWRTXHVXVFLWDGHEDWHHQHO
sector municipalista avanzado.

Si la “calidad de la democracia” supone un nivel de actividad e involucramiento


mayor cabe de todos modos preguntarse, como lo hacemos nosotros, cuál es la
´HODVWLFLGDGGHODGHPDQGDSDUWLFLSDWLYDµHVWRHVODIUDQMDGHGHVHPSHxRySWLPRGH
ODSDUWLFLSDFLyQHQTXHVXPD\QROOHYDDOFDQVDQFLRKDELGDFXHQWDGHODSUHRFXSDFLyQ
generalizada por la proliferación de instancias de participación. Acá deseamos
SUHVHQWDUWUHVGHEDWHVTXHFRDG\XYHQDXELFDUHVDIUDQMDDSDUWLUGHVDEHUTXLHQHV
YLHQHQ\TXLHQHVQR

D  ODVPRWLYDFLRQHVGHORVTXHYLHQHQHVDHQWUHPH]FODGHLQWHUHVHV\YDORUHVTXH
lleva siempre al debate en las ciencias sociales entre la teoría de la movilización

57
Juan Arroyo y Marina Irigoyen

de recursos (Olson) y la teoría de los movimientos sociales e identidades


colectivas (Touraine);

b) la utilidad del involucramiento en instancias sin carácter vinculante


IRUPDOPHQWH HVWDEOHFLGR TXH FRQYRFD DO GHEDWH VREUH OD GHOHJDFLyQ \ HO
poder de decisión descentralizado entre los puntos de vista partido-céntricos
y socio-céntricos; y

c) la posibilidad de expandir la participación y representabilidad de los excluidos


desarrollando elementos comunicacionales de la democracia deliberativa en
ORVDFWXDOHVHQWRUQRVSDUWLFLSDWLYRVORTXHVXSRQHGHEDWLUODHTXLYDOHQFLD
´GHPRFUDFLDSDUWLFLSDWLYD DVDPEOHDµ

5.1 Quiénes participan y quiénes no

/DSUHJXQWDDTXtHVVL\DOOHJyDVXWHFKRODSDUWLFLSDFLyQHQHOSDtV\VREUH
WRGR HQ OD IUDQMD DYDQ]DGD R VL KD\ UD]RQHV SDUD SHQVDU HQ TXH SXHGH VHJXLU
desplegándose y cómo.

a) (OSHUÀOGHODVRUJDQL]DFLRQHVVRFLDOHVHQODVORFDOLGDGHVORTXHKD\
ORTXHQRKD\ORTXHVHUHFUHDORTXHVHYDTXHGDQGR

Lo nuevo con la descentralización local participativa no es tanto


el surgimiento de organizaciones sociales sino más bien su reactivación
y articulación en otro piso, el territorial. El tejido social en las doce
experiencias se podría resumir en una fórmula de pisos históricos agregados:
federación campesina + organizaciones de mujeres de sobrevivencia
+ organizaciones urbanas vecinales o barriales + organizaciones de
productores por producto o por cuenca/zona. Hay variaciones según
FDGDORFDOLGDGSHURHQJHQHUDOHVWHHVHOPDSDVRFLDOTXHODFRQFHUWDFLyQ
UHDYLYD\DUWLFXODEDMRHOQXHYRIRUPDWRGHSURFHVRVGHSODQLÀFDFLyQGHO
desarrollo local y ahora presupuestos participativos.

  6HDSUHFLDTXHHOPD\RUGLQDPLVPRORWLHQHQGRVVHFWRUHVHOGH
SHTXHxRVSURGXFWRUHV\HOGHODVFDSDVFRPSURPHWLGDVFRQODFRQFHUWDFLyQ
SRUHOGHVDUUROORORFDO/RVSHTXHxRVSURGXFWRUHVFRPSDWLELOL]DQFRQHO
discurso municipal del desarrollo económico local y se presentan como el

58
Desafíos de la Democracia Participativa Local en la Descentralización

motor del enfrentamiento de la pobreza. Las organizaciones de mujeres


“aportan” con presencia amplia, eventualmente con acciones de presión
(como se dio en Azángaro) o de respaldo (como en la primera gestión de
0RUURSyQFRQHODOFDOGH0DTXL SHURQRVHDSUHFLDFRPRYHUHPRVPiV
adelante, una agenda de género propia.

Estos actores sociales entran a la política local y debieran ir pasando


de discursos corporativos a discursos territoriales, si bien en muchos casos
sólo agregan sus intereses corporativos. Las organizaciones sociales tienen
hoy la posibilidad de integrar sus demandas en una perspectiva territorial,
TXHQRHVODVLPSOHDJUHJDFLyQGHODVGHPDQGDVSDUWLFXODUHV

  /DV JHQHUDFLRQHV VRFLDOHV GH ODV TXH KHPRV KDEODGR LQJUHVDQ


superpuestas a la nueva institucionalidad de la descentralización y con sus
KLVWRULDVGHYLGD\HQIRTXHV6LKD\DOJRHVFDVRHQORVSURFHVRVHVWXGLDGRV
VRQODVYLHMDVHVWUXFWXUDVGHORTXHKHPRVGHQRPLQDGRHO´FODVLVPRWDUGtRµ
(SUTEP, CGTP). Evidentemente por sus características de ruralidad, en
QXHVWUDVH[SHULHQFLDVKD\PX\SRFRWUDEDMRGHSHQGLHQWHTXHHVODEDVH
social de la CGTP. Sin embargo aún en provincias con más trabajadores
estatales como Azángaro o San Marcos, no se evidencia un movimiento de
trabajadores estatales ni su involucramiento en los procesos participativos.
/RVPDHVWURVVRQSHUFLELGRVFRPRXQVHFWRUTXHUHDFFLRQDSHULyGLFDPHQWH
por sus salarios pero no es un actor del desarrollo local.

Todas las demás OS suelen ingresar a las experiencias desde


ópticas redistributivas, sean temáticas o territoriales. No ingresan siempre
desde el inicio ni masivamente, salvo se trate de alcaldes procedentes de
)HGHUDFLRQHV&DPSHVLQDV(QORVHVSDFLRVGHFRQFHUWDFLyQSXHGHQGHÀQLU
una nueva identidad colectiva, más amplia, y pasar a sociedades civiles
movilizadas, movimientos sociales de concertación. Este es el proceso de
las experiencias en su etapa de mayor desarrollo.

La forma de comportamiento social en las experiencias es por


tanto de sociedad civil: diálogo, negociación permanente, momentos de
tensión, deliberación, consensos, acuerdos. La forma de comportamiento
social en las experiencias no es centralmente el de movimientos irruptivos
desinstitucionalizados. Hubo en Azángaro un germen de protesta violenta
el 2004, a pocas semanas del caso Ilave, pero no llegó a prosperar por
una oportuna reacción de las autoridades. Tampoco se han constituido

59
Juan Arroyo y Marina Irigoyen

WRGDYtDPRYLPLHQWRVVRFLDOHVHVWUXFWXUDGRVGHVRFLHGDGFLYLOTXHSRQGHUHQ
adecuadamente la propuesta, el diálogo, la intervención, la vigilancia y la
movilización. El proceso está en sus primeros pasos. Faltan seguramente
DxRVGHDSUHQGL]DMHVRFLDOSDUDVDEHUTXpVHSXHGHKDFHUGHVGHDEDMR\TXp
se puede proponer, solicitar y exigir a los niveles regional y nacional.

b) La ausencia del sector privado y la presencia variable del Estado.

Una verdadera concertación local debiera involucrar a las tres


patas de la mesa: la sociedad, el Estado y el mercado. Pero en la tradición
peruana de la concertación es muy rara la presencia de las empresas privadas
y variable la presencia del Estado. Las empresas generalmente han estado
ausentes o con presencia episódica, tendiendo a retirarse.

Sin embargo, en tiempos más recientes las instituciones públicas


han ido dándole mayor importancia a su involucramiento, sea en las
MCLP o en las Mesas independientes. En San Marcos, por ejemplo, se
ha dado la presencia masiva de los sectores del Estado (salud, educación,
DJULFXOWXUD (Q/LPDWDPERKXERXQSULPHUPRPHQWRHQTXHODUHODFLyQ
fue sólo entre el municipio y las comunidades campesinas, pero luego se
integraron los vecinos, los sectores públicos y las ONGs. Curahuasi es un
caso mixto, con presencia simultánea de sectores públicos, instituciones
locales y organizaciones sociales. Este involucramiento del sector público
en varias regiones se ha visto ahora afectado por la nueva Ley Orgánica
GH0XQLFLSDOLGDGHVTXHQRFRQVLGHUDODSDUWLFLSDFLyQGHOVHFWRUS~EOLFR
HQORV&RQVHMRVGH&RRUGLQDFLyQ/RFDO &&/ ORTXHKDPRWLYDGRTXH
municipalidades como Azángaro, Ichocán y San Marcos hayan tomado el
acuerdo de integrarlos como invitados.

c) El viraje al desarrollo agropecuario y las organizaciones de


productores.

En mérito a propiciar una mayor participación de productores en


relación al mercado y al desarrollo local, se han creado múltiples asociaciones
de productores en provincias y distritos. Estas asociaciones son una opción
para sostener una oferta agregada y tener competitividad. Hay asociaciones

60
Desafíos de la Democracia Participativa Local en la Descentralización

de productores de panela, café y menestras en Santo Domingo; de la tara,


de lácteos, de cuyes y de forestales en San Marcos; de anís en Curahuasi; de
hierbas aromáticas y tubérculos en Yauyos; entre muchas otras.

Estas asociaciones se han venido articulando a las mesas de


FRQFHUWDFLyQEXVFDQGREHQHÀFLRVWDQJLEOHVSDUDVXGHVDUUROOR/RV33
hemos constatado - han sido una oportunidad para presentar sus demandas.
/RVSURGXFWRUHVOiFWHRVGH$]iQJDURREWXYLHURQHODxRSDVDGRHODSR\R
del PP para cobertizos y contaron con presupuesto para semillas de
pastos cultivados. Las comunidades de la cuenca del Jabon Mayo, igual,
presentaron proyectos productivos logrando en 70 distritos se reoriente
la inversión del FONCOMUN hacia una prioridad productiva (Paredes,
2004). En Huancané, la asociación de productores lácteos logró apoyo para
unos cobertizos en el último PP. Y así en muchas localidades.

d) La participación de los partidos.

  &RQFDUJRDXQHVWXGLRHVSHFtÀFRVREUHHOWHPDORTXHKHPRVYLVWR
HQODVH[SHULHQFLDVYLVLWDGDVHVTXHHQJHQHUDOH[LVWHXQDGHVFRQÀDQ]DGH
los partidos hacia la sociedad civil. En algunos casos participan militantes
GHORVSDUWLGRVHQODV0HVDVGH&RQFHUWDFLyQSHURHOORQRVLJQLÀFDXQD
UHSUHVHQWDFLyQRUJiQLFDGHVXVSDUWLGRVQLXQDPRGLÀFDFLyQGHORVHQIRTXHV
y políticas de sus partidos respecto a la relación entre sociedad civil y
sociedad política o entre el Estado y la sociedad. En la base hay mayor
HQWHQGLPLHQWR TXH HQ ORV QLYHOHV VXSHULRUHV HQ WpUPLQRV JHQHUDOHV ODV
GLULJHQFLDVSDUWLGDULDVVRQSDUWLGRFpQWULFDV\HQDOJXQRVFDVRVVHFUHHTXH
la sociedad civil es sinónimo de ONGs. Hay en este terreno mucho techo
SDUDXQDPRGHUQL]DFLyQGHODSROtWLFDHQHOSDtVGHVDItRTXHUHSODQWHDOD
forma de ejercicio del poder político.

En las experiencias estudiadas, y en otras revisadas indirectamente,


VH DSUHFLD TXH ORV SDUWLGRV SUiFWLFDPHQWH QR SDUWLFLSDQ /D PD\RUtD GH
PLOLWDQWHVTXHSDUWLFLSDVRQGHSDUWLGRVORFDOHVRUHJLRQDOHVFRQDPSOLR
SUHGRPLQLR GH OLGHUD]JRV PDVFXOLQRV +D\ TXH FRQVLGHUDU DGHPiV TXH
muchas de las listas ganadoras han venido siendo elegidas con votaciones
LQIHULRUHV D XQ  GHO HOHFWRUDGR OR TXH PXHVWUD OD IUDJLOLGDG GH OD
representación.

61
Juan Arroyo y Marina Irigoyen

5.2 ¿Por qué se participa? Valores e intereses

El Perú es uno de los países latinoamericanos con mayor densidad


organizacional (López, 1997). Sólo un 26,5% no participa en ninguna organización
(Tanaka y Zárate, 2000). Pero venimos de una etapa de fragmentación, de retroceso
GHORVRFLDO<DQRH[LVWHODVRFLHGDGFLYLODXWyQRPDDQWHULRUTXHGDQDOJXQDVYLHMDV
estructuras organizacionales pero sin bases sociales renovadas. Hemos denominado
´FODVLVPRWDUGtRµDHVWDIRUPDVRFLDOGHVIDVDGDFRQODQXHYDÀVRQRPtDVRFLDOGHO
país. Y sobre este piso se han agregado las generaciones sociales posteriores, como
vimos.

IMASEN (2004), en un estudio comparativo con 7 países latinoamericanos,


FRQFOX\HTXHODSDUWLFLSDFLyQVRFLDOHQHO3HU~HVVLPLODUDODGHRWURVSDtVHVHQ
cuanto a la primacía de la participación en organizaciones comunales, del barrio o
ciudad (33,3%), en organizaciones religiosas o actividades religiosas (26,4%) y en
actividades de apoyo a la educación (25%). Esto se corrobora en las experiencias
estudiadas: en todos los ámbitos hay comunidades campesinas o juntas vecinales,
RUJDQL]DFLRQHV OLJDGDV D ODV SDUURTXLDV GH OD ,JOHVLD &DWyOLFD X RWUDV LJOHVLDV
especialmente evangélicas, y las APAFAS. Lo diferente encontrado por IMASEN
UHVSHFWRDRWURVSDtVHVHVTXHHQORVGHPiVHOSHVRGHODSDUWLFLSDFLyQHQDFWLYLGDGHV
EHQpÀFDVRYROXQWDULDGRHVHQSURPHGLRGHO\HQHO3HU~HO

(VWRHYLGHQFLDTXHODSDUWLFLSDFLyQVRFLDOHQHO3HU~H[SUHVDPD\RULWDULDPHQWH
LQWHUHVHV/DSURSLDSREODFLyQLGHQWLÀFDFRPRPRWLYDFLyQSDUDODSDUWLFLSDFLyQHO
EHQHÀFLRSURSLRRODFRQYHQLHQFLD ,0$6(1LELGHP (OUHFLHQWHHVWXGLR
GH +XUWDGR   HQ 0HOJDU 3XQR FRQFOX\H TXH OD JHQWH ´GHVHD ÀQDOPHQWH
UHVROYHU VXV SUREOHPDV GH VXEVLVWHQFLD DO ÀQDO VXV GHPDQGDV VH FRQYLHUWHQ HQ
DFWLYRVTXHOHVDVHJXUHIXHQWHVGHWUDEDMRµ(VWDPRWLYDFLyQFODUDGHODSDUWLFLSDFLyQ
KR\HQHO3HU~WLHQHVHJXUDPHQWHTXHYHUFRQHOKHFKRGHTXHHQQXHVWURSDtVOD
participación se da en las franjas de bajos ingresos, a diferencia de otros países
GH$PpULFD/DWLQDHQTXHVHGDXQDPD\RUSDUWLFLSDFLyQHQRWUDVIUDQMDVVRFLDOHV
(IMASEN, ibidem).

Sin embargo, no funciona mecánicamente la fórmula de “a más pobreza más


SDUWLFLSDFLyQµ +D\ PXFKRV VHFWRUHV SREUHV TXH VH DXWRH[FOX\HQ GH SDUWLFLSDU
MXVWDPHQWHSRUQRWHQHUODVFRQGLFLRQHVVRFLRHFRQyPLFDVTXHOHVSHUPLWDQDVXPLU
HOFRVWRGHODSDUWLFLSDFLyQ6HSURGXFHDVtXQFiOFXORGHFRVWRV\EHQHÀFLRVGH
ODSDUWLFLSDFLyQTXHWDPELpQHVGHLQWDQJLEOHVHVWRHVGHFRVDVPDWHULDOHVSHUR

62
Desafíos de la Democracia Participativa Local en la Descentralización

WDPELpQGHJDQDQFLDVDIHFWLYDVRGHFDSDFLGDGHV'DGRTXHYHQLPRVGHXQDGpFDGD
de primacía de una cultura pragmática, promovida por el fujimorismo, la franja
TXHSDUWLFLSDLQLFLDOPHQWHWLHQGHDH[LJLUVyORGHUHFKRV\QRHOFXPSOLPLHQWRGH
GHEHUHV\UHVSRQVDELOLGDGHV(VHQHOSURFHVRGHSDUWLFLSDFLyQTXHVHSURGXFHOD
oportunidad del tránsito a una mayor conciencia de obligaciones y un reencuentro
PiVFODURGHLQWHUHVHV\YDORUHV(VWRTXLHUHGHFLUTXHno toda participación social es
participación ciudadanaSHURTXHDODYH]QRSXHGHKDEHUSDUWLFLSDFLyQFLXGDGDQD
sin participación social. En Azángaro la población urbana llegó al convencimiento
GHTXHQRKDEtDRWUDIRUPDGHUHVROYHUHOSUREOHPDGHOVDQHDPLHQWREiVLFRTXH
DXWRÀQDQFLiQGROR\MXQWyPLOORQHVGHVROHV(Q+XDQFDYHOLFDKXERTXHFDPLQDU
masivamente hasta Lima en la Cabalgata de 1998 para poner en la agenda nacional a
la región. En muchas experiencias los PP fueron recortados por falta de presupuesto
\PRWLYDURQTXHODVFRPXQLGDGHVDQDOLFHQFXiOHVREUDVRVHUYLFLRVHUDQXUJHQWHV
DFHSWDQGRSDVDUVXVSHWLWRULRVSDUDORVVLJXLHQWHVDxRV

(Q SRFDV SDODEUDV ORV YDORUHV H LQWHUHVHV OD GHPRFUDFLD FRPR ÀQ \ OD
democracia como medio, el hombre egoísta y el hombre solidario, en la vida,
HVWiQHQWUHPH]FODGRV6HHTXLYRFDQTXLHQHVDQDOL]DQXQLOLQHDOPHQWHODVFRVDVVHD
TXLHQHVSHUFLEHQHOPRYLPLHQWRGHVFHQWUDOLVWDORFDOFRPRXQJUDQMXHJRGHDJHQWHV
\SULQFLSDOHVODFRQVWUXFFLyQDUWLÀFLDOGHIDFLOLWDGRUHV\21*VRTXLHQHVYHQHQ
él sus propias representaciones ideológicas y no las relaciones sociales reales.

(VWRWLHQHLPSOLFDQFLDVSDUDODIUDQMDPXQLFLSDOLVWDSDUWLFLSDFLRQLVWDSRUTXH
ORTXHOHHVHVSHFtÀFRHVTXHHOODHVSDUWLGDULDGHODGHPRFUDFLDFRPRÀQ/RVUROHV
TXHMXHJDFRQGXFLHQGRPXQLFLSLRV\VRFLHGDGHVUXUDOHVODKDQOOHYDGRDLQWHJUDU
el tema del desarrollo local, la calidad de vida, el desarrollo agropecuario. Pero la
LQIRUPDFLyQUHFRJLGDLQGLFDTXHQRKD\PXFKDVLQWHUYHQFLRQHVGHFDOLGDGHLPSDFWR
para atacar la pobreza en los casos estudiados. Se privilegia el apoyo a los sectores
emprendedores, pero no hay igual énfasis, salvo excepciones, en el mejoramiento de
ORVSURJUDPDVVRFLDOHVRHQLQLFLDWLYDVDQWLSREUH]DGHHQYHUJDGXUDPHQRVD~QTXH
DSXQWHQDXQDPD\RUHTXLGDGHQWUHJpQHURV6LQHPEDUJRODVEDVHVVRFLDOHVGHVXV
H[SHULHQFLDVSDUWLFLSDWLYDVDOLJXDOTXHODVGHODVRWUDVGRVIUDQMDVODLQVWLWXFLRQDOLVWD
y la tradicional, tienen una óptica pragmática de la democracia como medio. Por
tanto los procesos participativos van a funcionar cuando esos procesos respondan
QRVyORDSULQFLSLRVFRQYLFFLRQHVVLQRJHQHUHQUHVXOWDGRV1RVyORKD\TXHYDORUDU
por tanto el proceso de la participación sino los resultados de la participación, tanto
en términos de calidad de vida como de empoderamiento.

63
Juan Arroyo y Marina Irigoyen

5.3 La cuestión de la representación y la representabilidad:


la elasticidad de la demanda de participación.
En las experiencias de los alcaldes pioneros la presencia de los diferentes
actores era voluntaria y podían acudir todas las organizaciones y personas
interesadas, sin límite. En Limatambo y Morropón eran reuniones masivas, con la
presencia de cientos de delegados campesinos de comunidades y anexos, así como
de organizaciones de corte asistencial (Comités de Vaso de leche, Comedores
Populares), que expresaban su opinión sobre los proyectos municipales. En las
experiencias de Cajamarca, al revés, el peso estaba en la representación institucional,
pero las pocas OS que participaron al inicio se retiraron luego de un tiempo,
aparentemente agotadas por la falta de logros. En San Marcos fue también limitada
la participación de OS en CINDESAM, explicable en parte por la escasa presencia
de éstas en su ámbito. Ahora en muchas experiencias hay sólo presencia de líderes
sociales.

Pero ÀQDOPHQWe, ¿a quiénes representan los dirigentes de organizaciones? Cabe


preguntarse si son representativos, quién los eligió, si están conectados con sus bases, si
hay una ÁXidez, un diálogo, una comunicación con sus representados. La información
recogida señala que en muchos casos hay una distancia entre los dirigentes y sus
bases y que no hay correas de transmisión que posibiliten un ÁXMR de comunicación
entre representantes y representados. Retomando un concepto forjado por Chirinos
(1991), el de “representación sin mandato”, hoy en día los líderes representantes de
OS tienen la tendencia a sentirse autónomos frente a quienes los eligieron y no dan
cuenta de su accionar. Los balances recientes de la MCLP (Henríquez, 2004) y de la
Red Perú (Basombrío y Frías, 2004) evidencian la debilidad de las representaciones de
las organizaciones sociales en las Mesas y CCL, en términos de su representatividad
y relación con las bases.

Sin embargo, pareciera existir no sólo una debilidad en la calidad de la


representación social sino también una GLÀFXOWDG de los propios representados para
hacerse representar, tema que alude a su representabilidad. La extrema pobreza y
exclusión generan limitaciones para ÀMDU intereses y opciones algo más permanentes.
Como señala una de las evaluaciones reciente, los procesos de participación requieren
de niveles de compromiso y organicidad que no todos tienen en la sociedad, con
mayor razón los más pobres, limitados al mínimo, con muchas diÀFultades para
involucrarse en procesos que requieren tiempo, toma de distancia frente al drama
inmediato y visión de mediano plazo (Basombrío y Frías, ibidem).

72
Desafíos de la Democracia Participativa Local en la Descentralización

La participación -hay que reconocerlo- tiene un costo y el primer costo es el


tiempo que se le dedica. La gente LGHQWLÀFD que no participa no por falta de interés
sino por falta de tiempo. El estudio auspiciado por el Instituto de Estudios Peruanos
el 2000 reveló que un 52,5% de los encuestados declaraba que le gustaría participar
más en las organizaciones, pero el 61,4% de ellos no lo hacía por falta de tiempo
(Tanaka y Zárate, 2000). En nuestras experiencias sucede igual. Una dirigenta de
Limatambo señalaba que no asistía a las reuniones de capacitación porque a pesar
que le cubrían la movilidad no tenía tiempo ni con quien dejar a sus hijos menores.
Situación que podríamos extrapolar para el caso de Así, muchas madres de familia
tienen a veces la oportunidad de un espacio para el desarrollo de capacidades pero no
acceden a ello por carecer de mecanismos de apoyo que faciliten su promoción. El
párroco de Morropón contaba que cuando la Iglesia lanzó una convocatoria para que
las comunidades campesinas se integren a las acciones de concertación, los dirigentes
campesinos le contestaron que no tenían dinero para quedarse en la ciudad, con todo
lo que eso supone. En San Marcos, los propios alcaldes de los distritos más pobres
tampoco se integran al espacio de concertación provincial, aduciendo los costos de
asistir a las reuniones, traslados y alojamiento.

Esto es lo que ha contribuido a abrir una brecha, más evidente ahora que antes,
entre la sociedad civil mesocrática, de capas medias, y la sociedad civil popular, además
de poner barreras para que la franja más pobre pueda constituirse en sociedad civil
(Ames et al, 2000; López, 1997).

Esto quiere decir que la demanda de participación por la gente depende del
costo y calidad del sistema participativo. Toda la data hace pensar que en nuestro
país ahora la demanda de participación no es inelástica sino relativamente elástica a los cambios
en los costos y calidad de la participación, esto es, es muy variable al factor costo-tiempo,
al factor calidad-de-la-reunión o al factor importancia-de-la-agenda. Hay una franja
que no puede pagar el costo de oportunidad de las horas-reunión (más viaje) que
VLJQLÀFD participar y no entra a la democracia participativa. Esta requiere abaratar los
costos del enrolamiento de esta franja ausente, con otras modalidades, ÁH[LELOL]DQGR
el ingreso. Pero quien ya ha pagado el costo-tiempo de ir a las reuniones, está atento a
la calidad de la instancia de participación-concertación. Si la reunión es larga, tediosa,
desordenada y sin buenos acuerdos, la demanda de participación se retrae. Si la Mesa
es descentralizada y en su zona, baja el costo-tiempo y es posible asistir. Pero si la
participación implica engancharse a todas las reuniones del nuevo instructivo hecho
en Lima, el costo sube y el interés, después de un punto, decaerá. Si la agenda va a
debatir algunos proyectos del PP que sabe lo EHQHÀFLDUiQ va a tratar de asistir, pero
si asiste y después no se ejecuta nada, va a ser más difícil volverlo a enrolar. Si las

65
Juan Arroyo y Marina Irigoyen

elasticidad fuera muy volátil, todos se irían a la primera; pero felizmente hay un sector
duro, que funciona como colchón del sistema y que paga incluso los costos de los
errores de diseño y ejecución. Todo esto lo saben los economistas.

Es cierto que conforme hay más interés y compromiso la gente está más
dispuesta a pagar el costo de oportunidad de la participación y viceversa. Pero
siendo la gente pobre y muy pobre, el costo siempre es muy alto. Se trata entonces
de revisar cómo se podría llegar a estos sectores. Desde nuestro punto de vista
esto exige reconsiderar la concepción de democracia participativa con que se ha
venido trabajando, asambleística, de presencia siempre física, muy emparentada a la
concepción de democracia directa rousseauniana, para enriquecerla con elementos
del modelo de democracia deliberativa, más comunicacional.

5.4 La participación como discrecionalidad del decisor y el


carácter vinculante.
Las personas participantes evalúan también otro costo-beneficio de la
participación: su utilidad. Como han enseñado muchos autores, entre ellos Andrea
Cornwall (2002: 17), de entre todos los tipos de espacios de participación la gran
diferencia es entre los que han sido constituidos por la gente misma, y los creados
por el Estado para la “participación por invitación”. Con los primeros espacios,
de carácter voluntario, la utilidad depende de sus mismos integrantes, pero con los
segundos, la efectivización de los acuerdos depende de sus normas de constitución
y en este caso cuanto más consultiva la instancia, menos posibilidad de que se lleven
a la práctica los acuerdos tomados. La discrecionalidad del decisor es amplia.

Esto genera una incertidumbre en los participantes, que lógicamente piensan


que las instancias de concertación local debieran tener legalmente un carácter
vinculante. En realidad la práctica demuestra que las Mesas activas tienen un carácter
vinculante de facto, estableciéndose un contrato implícito entre el decisor y los
actores de la localidad: el poder moral del consenso se asume por la institucionalidad
posteriormente, por el consejo municipal y la alcaldía. Con esto se establece un trade-
off entre la Mesa y el alcalde, en que conforme se redistribuye poder hacia abajo se
incrementa la legitimidad hacia arriba, hacia la autoridad. Pero esta mecánica pactada
no está exenta a veces de GLÀFXOWDGHV al ser la participación y concertación una escuela
social de gobierno para todas las partes. Ahí la población aprende el formato de la
administración pública dentro del cual puede moverse y el funcionariado edil, las
virtudes de la voluntad compartida y las formas concretas de su construcción.

66
Desafíos de la Democracia Participativa Local en la Descentralización

En síntesis, la democracia participativa no institucionalizada (Mesas) es


autorregulada por sus actores y si cuenta con el respaldo de la autoridad municipal,
WLHQHWRGRVORVJUDGRVGHOLEHUWDGTXHODGHPRFUDFLDSDUWLFLSDWLYDLQVWLWXFLRQDOL]DGD
(CCL) no tiene. El tema es evaluar esta segunda, su pertinencia y fórmula óptima
GHQWURGHOFRQWH[WRQDFLRQDODFWXDO3RUTXHHQHOFDPSRGHODGHPRFUDFLDSDUWLFLSDWLYD
QRLQVWLWXFLRQDOL]DGDODIUDQMDSDUWLFLSDFLRQLVWDSURVLJXHDYDQ]DQGRIyUPXODVTXH
PLHQWUDVQRVLJQLÀTXHQHODJRWDPLHQWRGHODSREODFLyQUHVSRQGHQDODKHWHURJHQHLGDG
de situaciones. Las experiencias más cercanas a la democracia directa reeditan la
H[SHULHQFLDLQLFLDOGH9LOOD(O6DOYDGRUHO&$/GH6DQWD5RVDPiVHQHOHVStULWXTXH
en la realidad, es una forma de autogobierno local. Pero en la mayoría de casos se
ha establecido una relación de mayor o menor horizontalidad – de cogestión, en el
sentido amplio del término - entre la municipalidad y la representación local en las
0HVDVHQTXHQRVHEXVFDYRWDFLRQHVSRUPD\RUtDVLQRFRQVHQVRV

(OWHPDSUREOHPDVRQORV&&/SRUTXHVXVUHVWULFFLRQHVDFWXDOHVOOHYDQDDOJXQDV
autoridades y líderes a dos posiciones diferentes: a) algunos entrevistados plantean
TXH QR HV QHFHVDULD XQD GHPRFUDFLD SDUWLFLSDWLYD LQVWLWXFLRQDOL]DGD HVWR HV QR
deberían existir los CCL y creen mejor la alternativa de seguir con la participación y
FRQFHUWDFLyQDQWHULRU\E RWURVSRVWXODQTXHORV&&/&&5\WRGRWLSRGHLQVWDQFLD
de concertación institucionalizada debiera tener un carácter vinculante, esto es, sus
acuerdos deberían tener mandato sobre las autoridades ediles, con lo cual se exige
una reforma global del Estado y un cambio constitucional pues se trataría de otro
régimen institucional en el país. La mayoría de autoridades y líderes se encaminan en
otro sentido, el de resolver la cuestión del carácter vinculante en términos prácticos,
D WUDYpV GHO SRGHU PRUDO TXH RWRUJD OD SREODFLyQ UHXQLGD \ D WUDYpV GH DUUHJORV
LQVWLWXFLRQDOHVTXHUHVXHOYDQODDUWLFXODFLyQHQWUH0HVDV\&&/PHGLDQWHODVP~OWLSOHV
IyUPXODVTXHVHYLHQHQHQVD\DQGR1XHVWUDUHFRPHQGDFLyQPDUFKDHQHVWHVHQWLGR
no en el de oponer las Mesas y los CCL sino en el de buscar implementar la fórmula
GH&&/$PSOLDGRVHQODIUDQMDLQVWLWXFLRQDOLVWDTXHQRWLHQH0HVDVSUHYLDPHQWH
y articular la presencia de CCLs Ampliados con la de las Mesas pre-existentes en
la franja avanzada, como se ha hecho en varios sitios del país, hasta un cambio de
VLWXDFLyQTXHREOLJXHDXQDUHHYDOXDFLyQ

5.5 La posibilidad de enriquecer la democracia participativa


con elementos de la democracia deliberativa.
La tipología de franjas municipales participacionista, institucionalista y tradicional
ayuda a resolver la pregunta sobre si vivimos en el país un exceso de participación

67
Juan Arroyo y Marina Irigoyen

o falta aún más participación. En realidad hay dos opiniones contrapuestas sobre la
SDUWLFLSDFLyQVRFLDOHQODGHVFHQWUDOL]DFLyQODTXHGHÀHQGHTXHHVLQVXÀFLHQWH\OD
TXHSRVWXODTXHH[LVWHHQGHPDVtD(QFLHUWRVHQWLGRDPEDVRSLQLRQHVVRQYHUGDG
SXHVODLQIRUPDFLyQUHFRJLGDPXHVWUDTXHODSDUWLFLSDFLyQVRFLDOVHGDPD\RUPHQWH
en la franja de municipios participacionistas. En realidad en el país falta aún más
SDUWLFLSDFLyQSRUTXHODIUDQMDPXQLFLSDOWUDGLFLRQDOHVD~QPD\RULWDULD\SRUTXHOD
IUDQMDPXQLFLSDOLQVWLWXFLRQDOLVWDLPSOHPHQWDIRUPDOPHQWHXQHVTXHPDGHGHPRFUDFLD
participativa limitada.

(V YHUGDG VLQ HPEDUJR TXH HQ OD IUDQMD PXQLFLSDOLVWD SDUWLFLSDFLRQLVWD KD\
XQD PXOWLSOLFDFLyQ XQ WDQWR GHVRUGHQDGD GH LQVWDQFLDV GH SDUWLFLSDFLyQ TXH VH
DxDGHQDOKLSHUUHJODPHQWDULVPROHJLVODWLYR8QDSDUWHGHORVDOFDOGHVIDYRUDEOHVD
ODSDUWLFLSDFLyQPDQLÀHVWDFRQUD]yQVHQWLUVHDEUXPDGRSRUODFDQWLGDGGHHVIXHU]R
TXHLPSOLFD6LHOPRGHORHVGHGHPRFUDFLDSDUWLFLSDWLYDGHUHSUHVHQWDQWHVODVHVIHUDV
S~EOLFDVGHODVVRFLHGDGHVORFDOHVVRQSHTXHxDV\HOOROOHYDDTXHWRGDVODVVHPDQDV
se reúnan bajo diferentes rótulos – comités, redes, mesas temáticas u otros - casi los
mismos grupos de líderes locales. Si el modelo es el de una democracia participativa
de representantes y poblaciones, los alcaldes y líderes entran y salen continuamente de
reuniones y asambleas. De otro lado están todos los pasos a seguir por las directivas
\QRUPDVVREUH&&/33\5&'HKHFKRVHQHFHVLWDÁH[LELOL]DUODOHJLVODFLyQYLJHQWH
y reexaminar si los arreglos institucionales formales y no formales se adecuan a
OD GHPRFUDFLD SDUWLFLSDWLYD R VL VRQ PiV ELHQ PHFDQLVPRV TXH GHVLQFHQWLYDQ OD
demanda de participación, en particular de los más pobres, aumentando los costos
de la participación.

3DUHFLHUDTXHXQDEXHQDSRVLELOLGDGGHH[SDQGLUODSDUWLFLSDFLyQHQHOSDtVGH
mejorar la relación entre los dirigentes y las bases y de traspasar la barrera de la baja
representabilidad actual de los excluidos es desarrollando elementos comunicacionales
GHODGHPRFUDFLDGHOLEHUDWLYDHQORVDFWXDOHVHQWRUQRVSDUWLFLSDWLYRVORTXHVXSRQH
UHGLVFXWLUODHTXLYDOHQFLDHQXVR´GHPRFUDFLDSDUWLFLSDWLYD DVDPEOHDµ

&RPRDÀUPDQ)XQJ\:ULJKW  HOPRGHORGH*RELHUQR3DUWLFLSDWLYRFRQ


Poder de Decisión “impulsa los valores de la participación, la deliberación y el poder
decisión hasta los límites de la prudencia y la factibilidad.” Ahora hay en la franja
PXQLFLSDODYDQ]DGDPiVSDUWLFLSDFLyQTXHGHOLEHUDFLyQ\DOJ~QSRGHUGHGHFLVLyQ
compartido (carácter vinculante de facto). Pero en la franja municipal tradicional hay
poder de decisión concentrado en la autoridad, sin mayor deliberación ni participación.
En la franja institucionalista se repite con pocos cambios esta situación.

68
Desafíos de la Democracia Participativa Local en la Descentralización

En el modelo de democracia participativa en práctica las asambleas son un


HVSDFLRGHGHOLEHUDFLyQOLPLWDGD&RPRVHxDOD(OVWHU  ´HQDVDPEOHDVGH
WDOPDJQLWXG²VHUHÀHUHDODVDWHQLHQVHVSHURDSOLFDDODVQXHVWUDVOD´GHOLEHUDFLyQµ
VLJQLÀFDDORVXPRXQDGLVFXVLyQHQWUHXQSHTXHxRQ~PHURGHRUDGRUHVGHODQWHGH
XQDXGLWRULR\QRXQGHEDWHHQWUHWRGRVORVPLHPEURVµ'HDKtTXHODSUHSDUDFLyQ
de acuerdos por diversas vías previas a las asambleas resulta crucial, pero este
razonamiento se hace entre funcionarios, regidores y líderes, en representación
de los representados, obviándole a la comunidad la deliberación. En la mayoría de
experiencias la política de comunicación social todavía está en construcción y es de
ida pero no de ida y vuelta: tiende a informar pero no establece un diálogo, salvo en
asambleas y por un tiempo limitado. Existe además voluntad de transparencia pero
HVPiVIiFLODXPHQWDUODGLVSRQLELOLGDGGHODLQIRUPDFLyQTXHVXXVR

(VWRKDFHTXH²PiVDOOiGHORVSURSyVLWRVH[SOtFLWRVVHSURSHQGDDOPRGHOR
GH GHPRFUDFLD UHSUHVHQWDWLYD HQ TXH HO UHSUHVHQWDQWH GHOLEHUD HQ QRPEUH GH ORV
representados y tiene el poder de decisión sin mandato imperativo. Según el alegato
clásico de Burke en defensa de la representación, los representantes no conviene
VHDQLQWHUPHGLDULRVGHVXVUHSUHVHQWDGRVSRUTXH´HO3DUODPHQWRQRHVXQFRQJUHVR
de embajadores” sino una “asamblea deliberante de una nación” (Sartori, 1992:229).
Pero ahora podemos deliberar todos o casi todos, por las mayores posibilidades de
FRQVWUXFFLyQGHXQDHVIHUDS~EOLFDPiVDPSOLDHQTXHVHFRPELQHODLQWHUYHQFLyQ
D WUDYpV GH ORV UHSUHVHQWDQWHV \ DTXHOOD FRQ YR] SURSLD (VWD HV OD GHPRFUDFLD
SDUWLFLSDWLYDTXHHOSXQWRGHYLVWDSDUWLGRFpQWULFRQRDFHSWDHQHO3HU~

El modelo de democracia deliberativa enfatiza, entonces, la necesidad de la


argumentación pública y la deliberación entre ciudadanos y representantes antes de la
toma de decisiones (Gutmann y Thompson, 2004). En el modelo participativo clásico,
TXHHVODYHUVLyQURXVVHDXQLDQDORFHQWUDOHVHOPRPHQWRGHODGHFLVLyQFROHFWLYDHQ
asamblea, para la constitución de la voluntad de la mayoría. En el modelo deliberativo
ORTXHVHEXVFDHVHOLQWHUFDPELRGHRSLQLRQHV\HOFDPELRGHODVSUHIHUHQFLDV7LHQH
por ventaja brindar más posibilidades para superar las concepciones agregativas de
ODGHPRFUDFLDHQTXHQRVHMXVWLÀFDQODVSUHIHUHQFLDVVLQRVHFRPELQDQTXHHVOR
TXHDYHFHVVHFRQVWDWDHQORVSURFHVRVGH33HQTXHVHIUDJPHQWDODLQYHUVLyQORFDO
y posterga el PCD.

Se trata, sin embargo, de hacer la combinación más adecuada entre los elementos
de la democracia representativa, participativa y deliberativa. No se trata de oponer los
principios de cada modelo de democracia sino de articularlos en una formula sinérgica,
adecuada al mundo local. La deliberación pública debe aligerar los organigramas y

69
Juan Arroyo y Marina Irigoyen

los acuerdos, usada con discreción. De paso la vía comunicacional educa y reeduca.
2EOLJDDGHPiVDODSUHVHQWDFLyQGHDUJXPHQWRV3HURFRPRVHKDVHxDODGRWDPELpQ
hay “patologías de la deliberación”, así como patologías de la votación y patologías
de la participación. Todo ello es cierto, pero el modelo de decisión en nombre de
WRGRVTXHHVHOUHSUHVHQWDWLYR\HOPRGHORGHGHFLVLyQVLHPSUHMXQWRVTXHHVHO
SDUWLFLSDWLYRKDQOOHJDGRDXQSXQWRHQTXHQHFHVLWDQHODX[LOLRFRPXQLFDFLRQDOGH
la deliberación y la comunicación todos-con-todos.

Las experiencias desarrolladas en el marco de una democracia participativa tienen


FRVDVDYDQ]DGDVDOUHVSHFWR(ODOFDOGHGH&XUDKXDVLKL]RTXHODDVDPEOHDGHUHQGLFLyQ
de cuentas se trasmitiera por radio. En Huancavelica la propaganda en algunas de
sus provincias, como Angaraes, es profusa. La misma red electrónica dglocal es un
ejemplo de democracia deliberativa. Pero en la mayoría de experiencias hay todavía
PiVSUHQVD\SURSDJDQGDTXHFRPXQLFDFLyQ/RTXHVXJLHUHTXHHVWHDSUHVWDPLHQWR
YDDUHTXHULULQYHUWLUHQGLQiPLFDVPHWRGRORJtDVDSURSLDGDVLQQRYDGRUDVTXHHVHO
FRVWRTXHODIUDQMDDYDQ]DGDGHEHUiSDJDUSDUDWHUPLQDUGHDSRUWDUDOSDtVXQQXHYR
modelo de gobernabilidad democrática.

70
Desafíos de la Democracia Participativa Local en la Descentralización

Capítulo 6:
La participación de la mujer
en la gestión municipal
y el desarrollo local
con equidad de género

Si el estudio y promoción de la participación ciudadana son temas muy recientes


en la agenda peruana, más incipientes aún son los balances de la participación de
las mujeres en la gestión local, particularmente en las zonas altoandinas del país.

Esto exige revisar los impactos del proceso de descentralización y democratización


ya no sólo en el espacio político local sino en las formas de pensar y actuar, en los
procesos sociales y en la interacción de hombres y mujeres y su construcción como
actores en los distritos rurales del país. Ello hace parte de la calidad de participación
y es consustancial a una gestión democrática entendida como construcción de las y
los ciudadanos y desarrollo de sus capacidades para decidir, ejecutar, evaluar y vigilar
las acciones colectivas.

En este informe no se ha pretendido abordar todas estas dimensiones. Ni el


tiempo ni los recursos han posibilitado una exhaustiva investigación sobre el tema.
Nuestro abordaje avanza en dar una mirada general a la participación de las mujeres –o
DORVOtPLWHVSDUDGLFKDSDUWLFLSDFLyQHQODVVRFLHGDGHVORFDOHVHVWXGLDGDVLQÀULHQGR
algunas conclusiones sobre procesos similares en el país.

71
Juan Arroyo y Marina Irigoyen

6.1 El ejercicio de la ciudadanía por la mujeres en las sociedades


rurales altoandinas
/R SULPHUR D UHOLHYDU HV TXH HQ ODV VRFLHGDGHV UXUDOHV GH QXHVWUR SDtV
particularmente en las estudiadas, con sus altos niveles de pobreza y exclusión social,
las condiciones de vida son aún más severas para las mujeres y sus familias por la
discriminación de género y cultural existente.

En múltiples diagnósticos de la situación de la mujer rural se han apuntado las


siguientes características se su situación:

a) su exclusión en relación a derechos sociales básicos (educación y salud);


b) su relegamiento respecto a oportunidades económicas (en el caso de la
seguridad alimentaria, su no acceso a crédito, asistencia técnica y gerencial,
microempresas);
c) los limites puestos a sus derechos políticos, y por tanto al ejercicio autónomo
de su participación social y política;
G  ODHVFDVDYDORUDFLyQ\UHVSHWRDODVFXOWXUDVTXHFKXDD\PDUD\DPD]yQLFDV
TXHHOODVSDUWLFXODUPHQWHFRQVHUYDQ

En una buena parte de las sociedades rurales del país el fenómeno de la


violencia política de las dos últimas décadas tuvo como efecto migraciones forzadas,
SULQFLSDOPHQWH GH ORV KRPEUHV 4XHGy DVt HO HVSDFLR S~EOLFR DEDQGRQDGR TXH
fue asumido por las mujeres rurales, abriéndose un horizonte no previsto para su
crecimiento personal y dirigencial. Debió ingresar a la participación comunal y en
menor medida a la gestión local.

En las experiencias estudiadas las mujeres campesinas tienen participación en


GLIHUHQWHVHVSDFLRVD HQODVDVDPEOHDVE HQODVIDHQDV\HQODVREUDVFRPXQDOHVTXH
tradicionalmente han sido espacios masculinos; y c) en las organizaciones funcionales
de alimentación relacionadas a los programas sociales.

Sorteando todos los obstáculos, desde la oposición de sus cónyuges hasta


el hecho de no tener muchas veces documentos de identidad, las mujeres se han
ido haciendo un espacio y un tiempo para participar en sus comunidades y en sus
PXQLFLSDOLGDGHV(Q/LPDWDPER,FKRFiQ\&XUDKXDVLTXHIXHURQHVFHQDULRVGH
procesos de violencia de manera cercana - muchas mujeres asumieron una mayor
participación en la gestión comunal y en la responsabilidad de sus propias familias.

72
Desafíos de la Democracia Participativa Local en la Descentralización

La mujer participa en las organizaciones sociales ligadas a los programas sociales


GHO(VWDGR 9DVRGH/HFKHFRPHGRUHVSRSXODUHV HQODE~VTXHGDGHVDWLVIDFFLyQ
GHQHFHVLGDGHVSUiFWLFDV(VWDSDUWLFLSDFLyQQRQHFHVDULDPHQWHVHDFRPSDxDGHXQD
conciencia plena sobre sus derechos sociales, económicos u culturales, existiendo en
muchos casos una tensión entre la defensa legítima de un derecho social por parte
GHORVODVEHQHÀFLDULDV\ODFXOWXUDFOLHQWHODU\SUHEHQGDOLVWDTXHDYHFHVVHLQWHQWD
sembrar desde el Estado.

Otros espacios de participación son las asociaciones de padres de familia de las


escuelas de los hijos, las APAFAS, donde algunas mujeres participan en las directivas.
6HVDEHGHDXWRULGDGHVGHORVFROHJLRVTXHSUHÀHUHQFRQWDUFRQODSDUWLFLSDFLyQGHORV
SDGUHVGHELGRDTXHODVPXMHUHVVRQPiVH[LJHQWHVHQHOFXPSOLPLHQWRGHDFXHUGRV
y en el planteamiento de cambios para mejorar la calidad educativa. A la vez, hay
DXWRULGDGHVHGXFDWLYDVTXHVHxDODQTXHODPD\RUtDGH´ODVVHxRUDVµQRSDUWLFLSDQFRQ
iniciativa pues sólo escuchan y trabajan en las actividades.

'HRWURODGRHQORViPELWRVHVWXGLDGRVVHKDHQFRQWUDGRTXHODUHOLJLRVLGDGGHOD
población campesina tiene un doble papel respecto a la participación social y política
de las mujeres, en unos casos alentándola, en otros desalentándola, dependiendo de
ODV LJOHVLDV TXH WLHQHQ LQÁXHQFLD HQ ODV FRPXQLGDGHV (Q PXFKDV ]RQDV ODV LJOHVLDV
evangélicas animan la participación femenina. Es el caso de la región de Ayacucho,
]RQDHQTXHODVFRPXQLGDGHVTXHIXHURQYtFWLPDVGHODYLROHQFLDHQFRQWUDURQDSR\R
de las iglesias evangélicas. Contradictoriamente, diferentes estudios promovidos por el
SUR\HFWR5HSUR6DOXGGH$\DFXFKRKDQGHPRVWUDGRTXHHVWDFRQYHUVLyQHYDQJpOLFDKD
GLÀFXOWDGRODSDUWLFLSDFLyQFRPXQLWDULDHQORVSURJUDPDVGHVDOXGVH[XDO\UHSURGXFWLYD
De nuestra parte, hemos encontrado en algunas experiencias indicios de la promoción
TXHKDFHOD,JOHVLD&DWyOLFDGHODSDUWLFLSDFLyQGHODPXMHUHQDFWLYLGDGHVGHVREUHYLYHQFLD
y de desarrollo comunal. Incluso en zonas como Morropón y Santo Domingo, como
se ha visto, las autoridades eclesiales tienen un rol muy activo en las instancias de
concertación y alientan el rol de la mujer en dichos espacios.

6H FRUURERUD HQWRQFHV FRPR \D KD VLGR HVWXGLDGR TXH HQ HO 3HU~ KD\ XQD
tendencia a la participación paritaria de hombres y mujeres en lo social, a diferencia
de otros países de América Latina, donde la participación de varones sobrepasa
notablemente la de mujeres. Hay participación de la mujer pero hay un rezago en
la calidad de esta participación en estos procesos de descentralización participativa.
Existe pero no en la dimensión necesaria ni en todos los niveles para producir cambios
socioculturales del modelo patriarcal y machista, hacia un modelo de democracia
SDUWLFLSDWLYDFRQHTXLGDGVRFLDO\GHJpQHURHQWUHKRPEUHV\PXMHUHV

73
Juan Arroyo y Marina Irigoyen

6.2 La formación de liderazgos femeninos


/DVOLGHUHVDVHQWUHYLVWDGDVHQVXPD\RUtDKDQWHQLGRTXHOXFKDUHQXQSULPHU
PRPHQWR FRQ OD RSRVLFLyQ GHO FRPSDxHUR R FyQ\XJH SDUD SRGHU VHU GLULJHQWDV
Esta oposición en algunos casos podía llegar hasta la violencia física y casi siempre
VHH[SUHVDHQXQDWHQVLyQFRQWtQXD3LQ]iVKDHVWXGLDGRTXHSRUUD]RQHVKLVWyULFDV
D~QSRFRFODUDVODVVRFLHGDGHVGHODFRVWD\VLHUUDGHOQRUWHVRQPiVMHUDUTXL]DGDV
\WUDGLFLRQDOHVTXHODVGHRWUDVUHJLRQHVGHOSDtV 3LQ]DV 3RUHOORORV
procesos de formación de liderazgos femeninos y el desarrollo de ciudadanía toman
XQWLHPSRODUJRORVOLGHUD]JRVIHPHQLQRVVHIRUPDQVRUWHDQGRGLÀFXOWDGHVTXHQR
tienen los liderazgos masculinos.

Además, para ser lideresas las mujeres, sobretodo las mujeres jóvenes con hijos
SHTXHxRV WLHQHQ OD QHFHVLGDG GH UHVROYHU OD DWHQFLyQ GH VXV QLxRV FRVD TXH QR
siempre comparten sus esposos. En esto las necesidades de las mujeres son diferentes
GHDFXHUGRDVXFLFORGHYLGDVLHQGRODVPXMHUHVHQHGDGIpUWLO DxRV ODVTXH
WLHQHQPD\RUGLÀFXOWDGSDUDSDUWLFLSDUHQMRUQDGDVSXHVUHTXLHUHQTXHVHWHQJDHQ
FXHQWDHOVHUYLFLRFRPSOHPHQWDULRGHDWHQFLyQGHQLxRVTXHOHSHUPLWDSDUWLFLSDUVLQ
WHQHUTXHGLVWUDHUVXDWHQFLyQVREUHWRGRHQHOFDVRGHFDSDFLWDFLRQHV

*UDFLHODGHOD&UX]DÀUPDTXHODVPXMHUHVUXUDOHVDOWRDQGLQDVWUDQVLWDQSRU
diferentes estadios en la construcción de sus liderazgos: a) primero suelen ser
LGHQWLÀFDGDVFRPROLGHUHVDVHÀFLHQWHVSDUDODJHVWLyQ VHUYLFLRVEiVLFRVSURJUDPDV
alimenticios); (b) luego pasan a ser lideresas defensoras de derechos (casa de la mujer,
FRPLVDUtD'HPXQDV \ F ÀQDOPHQWHVHFRQVWLWX\HQHQOLGHUHVDVFRQFDSDFLGDGGH
negociación y conducción política (Mesas de concertación, redes de mujeres, CCL,
presupuesto participativo)4.

Así, encontramos en zonas como Jabon Mayo a muchas mujeres destacadas


animando los CECOSAS (Centros Comunales de Seguridad Alimentaria), con gran
responsabilidad y compromiso. Son menos las lideresas en cargos de responsabilidad.
En la DEMUNA de San Marcos las mujeres tienen un rol destacado y esta instancia
ha logrado prestigiarse en la provincia merced a ese trabajo. En general, en muchas
municipalidades funcionan las DEMUNAS con escasa inversión y cierta efectividad
gracias al aporte de las mujeres. También hay mujeres participando en los CCL
HQUHSUHVHQWDFLyQGHODVRFLHGDGFLYLOHQ,FKRFiQSRUHMHPSORHQTXHGHFXDWUR

___________________________________________________
4 Entrevista a Graciela de La Cruz, consultora del “Diagnóstico de Socios Potenciales para la promoción y defensa de los derechos
de las Mujeres”, DEMUS, 2003.

74
Desafíos de la Democracia Participativa Local en la Descentralización

representantes, tres son mujeres - pero su rol en estas instancias suele ser muy limitado;
tienen poca capacidad de propuesta y negociación.

Navegando a contracorriente, hay regidoras destacadas en algunas municipalidades


&XUDKXDVLSRUHMHPSOR DVtFRPRMXH]DV 0RUURSyQ (VDFRQWUDFRUULHQWHSRUTXH
en los espacios locales persiste una visión tradicional del rol de la mujer. Emma
Zevallos lo expresa con claridad: “en la casi totalidad de municipios (rurales), el alcalde,
HQFRQYHQLHQFLDFRQORVUHJLGRUHVDVXPHQTXHODVPXMHUHVWLHQHQPiVGLVSRVLFLyQ
\FRQGLFLRQHVSDUDKDFHUVHFDUJRGHODVWDUHDV IHPHQLQDV TXHWUDGLFLRQDOPHQWHOH
corresponden” (Zevallos, 2001).

(OHVWXGLRQREXVFyPHGLUODHÀFDFLDGHODJHVWLyQHGLO6LQHPEDUJRVHKDSRGLGR
UHFRJHUWHVWLPRQLRVVREUHODUHVSRQVDELOLGDGHÀFLHQFLD\HÀFDFLDGHODVUHJLGRUDV6H
reconoce su esfuerzo por cumplir con las responsabilidades asumidas, su creatividad
para encarar las carencias económicas y su tesón para realizar su gestión pese a
YHFHVDVXIDOWDGHFDSDFLWDFLyQ\DODPDUJLQDFLyQGHTXHVRQREMHWRHQODWRPDGH
GHFLVLRQHVGHQWURGHORV&RQFHMRV0XQLFLSDOHV6HSXHGHGHFLUTXHOD/H\GH&XRWDV
ha permitido una democratización de género. Hay ahora mayor presencia de mujeres
UHJLGRUDVSHURWDPELpQIXQFLRQDULDV\WUDEDMDGRUDVORTXHXQLGRDVXHÀFLHQFLD\
compromiso con el trabajo edil y a la sensibilización de los actores presentes en la
institucionalidad municipal, va ganándole creciente reconocimiento.

En el liderazgo barrial hay más presencia femenina. En todos los distritos y


provincias estudiados las comunidades son dirigidas por varones y las organizaciones
de sobrevivencia por mujeres. Existen numerosos comedores o clubes de madres
RULHQWDGRVDODDOLPHQWDFLyQ\QXWULFLyQTXHVRQHOGXFWRSULQFLSDOGHSDUWLFLSDFLyQ
de la mujer en la gobernabilidad local. A nivel familiar-comunal, las mujeres asumen
UROHV SULPRUGLDOHV HQ OD VHJXULGDG DOLPHQWDULD FRQ GREOH SURSyVLWR OD VXÀFLHQFLD
alimentaria para el autoconsumo familiar y la generación de ingresos a la economía
familiar.

En términos del tipo de problemas asumidos por las organizaciones de mujeres,


pVWRVQRUHÀHUHQQHFHVDULDPHQWHDODHTXLGDGGHJpQHUR3ULPDQORVWHPDVDOLPHQWDULRV
o de supervivencia frente a temas propios de una agenda de género, poco visibilizados,
FRPRORVUHODFLRQDGRVDODYLROHQFLDLQWUDIDPLOLDUHODFFHVRDODHGXFDFLyQGHODVQLxDV
la salud reproductiva y la libertad de decisión sobre su propio cuerpo, o los problemas
de documentación para el ejercicio de su ciudadanía, etc. Cuando la agenda de género
DSDUHFHKDVLGRSRUODLQWHUYHQFLyQGHXQDJHQWHH[WHUQRJHQHUDOPHQWHXQD21*TXH
a partir de un proyecto contribuye a develar los problemas de género existentes.

75
Juan Arroyo y Marina Irigoyen

Es el caso de la experiencia en el 2001 del Centro IDEAS y CESIP en la


provincia de Morropón-Chulucanas y particularmente en el distrito de Morropón.
Allí, conjuntamente con la municipalidad distrital y las organizaciones de mujeres,
trabajaron alrededor del tema de la violencia familiar. Para ello se llevó a cabo un
conjunto de acciones para la formación de regidoras y lideresas de organizaciones de
mujeres, convocando además a trabajadores varones y mujeres y autoridades locales,
SURSLFLDQGRODSDUWLFLSDFLyQGHpVWDVHQHOGLVHxRGHSROtWLFDVPXQLFLSDOHVIDYRUDEOHVD
ODHTXLGDG$VLPLVPRVHKLFLHURQSURSXHVWDVGHLQFRUSRUDFLyQGHHTXLGDGGHJpQHUR
HQORVSODQHVGHGHVDUUROORORFDOTXHIXHURQDSUREDGDVPHGLDQWH5HVROXFLyQ0XQLFLSDO
1R0'0$GHOGHDEULOGH,JXDOPHQWHVHGHÀQLHURQFULWHULRVGH
HTXLGDGGHJpQHURHQODVSROtWLFDVGHSHUVRQDOGHODVPXQLFLSDOLGDGHVSURYLQFLDOHVGH
Morropón-Chulucanas y en la municipalidad distrital de Morropón, criterios referidos
a la igualdad de oportunidades en la selección y contratación de nuevo personal; el
DFFHVR LJXDOLWDULR D ODV RSRUWXQLGDGHV GH FDOLÀFDFLyQ \ DVFHQVR OD SURPRFLyQ GH
mujeres a cargos de dirección; las facilidades a varones para el otorgamiento de
permisos por enfermedad de los hijos e hijas y/o la pareja. Un elemento adicional
fue la incorporación de mecanismos de cuota del 50% en la contratación de personal
obrero, favoreciendo a las mujeres organizadas de Morropón. Estos notables
UHVXOWDGRVQRWXYLHURQVXÀFLHQWHVRVWHQLELOLGDGDOSDUHFHUHOWLHPSRGHPDGXUDFLyQ
de la experiencia fue corto y también limitado el proceso de difusión y asunción por
la sociedad de los nuevos planteamientos. En esto se expresó también la necesidad
GHPHFDQLVPRVGHODGHPRFUDFLDGHOLEHUDWLYDTXHSRVLELOLWHQTXHWRGDODSREODFLyQ
GHEDWD\DVXPDSURSXHVWDVTXHSODQWHDQOtGHUHV\DXWRULGDGHVFRQYLVLyQ

En Santo Domingo ha habido cierto interés en impulsar la organización de


mujeres y en buscar la articulación del Programa Vaso de Leche a lo productivo.
Para eso se constituyó el 2000 la Asociación Distrital de Mujeres de Santo Domingo
(ADIMUSAD), asentada en los clubes de madres, pero su dinámica propia fue efímera,
DOJHQHUDUVHFRQÁLFWRVLQWHUQRV7UHVDxRVGHVSXpVHOLPSDVHQRKDVLGRVXSHUDGR
y la vida orgánica de la asociación es mínima. La Asociación de Productores ahora
DEDVWHFHGHOHFKHIUHVFDDOSURJUDPDPXQLFLSDOTXHODVPXMHUHVVyORDFRSLDQ

'H RWUR ODGR HQ ODV H[SHULHQFLDV HVWXGLDGDV VH REVHUYD TXH ORV FDUJRV PiV
elevados siempre son para varones y sólo aparece la presencia femenina en cargos
menores: cuanto más arriba en las instancias sociales y de concertación más
pronunciada es la presencia de adultos varones y cuanto más abajo más paritaria es
la presencia entre hombres y mujeres.

(VWRH[SUHVDTXHVHKDHVWDEOHFLGRWDPELpQXQDVXHUWHGHGLYLVLyQGHJpQHUR
en el trabajo en este campo social, no sólo en el terreno doméstico. Hay así en las

76
Desafíos de la Democracia Participativa Local en la Descentralización

Directivas cargos para hombres y para mujeres. La participación de la mujer es


fundamentalmente formal en muchas directivas comunales o federaciones y en las
DVDPEOHDVFRPXQDOHV\YHFLQDOHV(QEDVHDHQIRTXHVUHJUHVLYRVODVSRVLFLRQHVGH
ODV PXMHUHV VRQ UHOHJDGDV D FDUJRV HVSHFtÀFRV6HFUHWDULD GH$VXQWRV)HPHQLQRV
Vocal, Tesorera. Ciertamente hay reconocimiento de su honestidad y compromiso
VRFLDOYDORUHVTXHHOODVWUDVODGDQGHVXVSUiFWLFDVGRPpVWLFDVEDVDGDVHQHODIHFWR
y la sinceridad, y de sus prácticas comunitarias, basadas en la ética de la solidaridad
\ODD\XGDPXWXD3HURHOUHFRQRFLPLHQWRDOHPSHxRUHVSRQVDELOLGDG\KRQUDGH]
de las mujeres es también tributaria de un estereotipo de mujer, de una idea clásica
UHVSHFWRDOVDFULÀFLR\HQWUHJDGHODPDGUHRMHIDGHKRJDU

Sólo en algunos ámbitos se han generado asociaciones distritales o federaciones


SURYLQFLDOHVGHPXMHUHVHQHOSDtVFRQÀQHVGHSURPRFLyQGHODVPXMHUHVUXUDOHV
y de desarrollo más generales. Entre las experiencias estudiadas, en Limatambo se
creó la Federación Distrital de Mujeres, en Morropón la Asociación de Mujeres En
Defensa de la Vida y en Huancavelica, la Federación de Mujeres de Yauli. Otros
casos han sido la Central de Mujeres de Santa Rosa, la Asociación de Mujeres de
Santo Domingo (ADIMUSAD) y la Federación de Mujeres de Curahuasi.

La falta de sostenibilidad es un elemento común de estas organizaciones de


mujeres de segundo nivel, siendo la precariedad material de las familias rurales
SHUXDQDVXQRGHORVIDFWRUHVTXHODVKDFHYXOQHUDEOHV6HKDVHxDODGRTXHHOORYD
GHODPDQRGHVXSUHFDULHGDGLQVWLWXFLRQDOGHODGLÀFXOWDGSDUDIRUMDULQVWLWXFLRQHV
organizacionalmente autónomas y con capacidad de convocatoria más allá de lo local
3DQÀFKL 3RUHVRVXFHGHPXFKDVYHFHVTXHXQDYH]TXHVHUHWLUDHODSR\RGHO
DJHQWHH[WHUQR21*XRWURODRUJDQL]DFLyQWLHQHPXFKDVGLÀFXOWDGHVSDUDFRQWLQXDU
activa. Es el caso de Morropón donde ahora hay una situación de extrema fragilidad
HQOD$VRFLDFLyQGH0XMHUHV\GHOD)HGHUDFLyQGH0XMHUHVGH/LPDWDPERTXHVHKD
debilitado por la discontinuidad en la atención de su proceso organizacional. Esto
SDUHFH LQGLFDU TXH VyOR VH REWLHQHQ LPSDFWRV HQ UHODFLyQ D OD HTXLGDG GH JpQHUR
promoviendo procesos de mediano y largo plazo.

3RU~OWLPRSRGHPRVDÀUPDU²FRQIRUPHVHVHxDOyPiVDGHODQWHTXHHOPRGHOR
GHGHPRFUDFLDSDUWLFLSDWLYDHVHQJHQHUDOPiVLQFOXVLYRTXHHOPRGHORGHGHPRFUDFLD
UHSUHVHQWDWLYDFOiVLFD\TXHHQWUHORVGLIHUHQWHVVXEWLSRVGHGHPRFUDFLDSDUWLFLSDWLYD
DTXpOTXHDEUHODVSXHUWDVQRVyORDORVOtGHUHVVRFLDOHVVLQRDVXVEDVHVSRVLELOLWDXQD
PD\RUHTXLGDGGHJpQHUR/DVH[SHULHQFLDVSDUWLFLSDWLYDVSRVLELOLWDQLQFOXLUDWRGDV\
todos los actores sociales (varones, mujeres, jóvenes, tercera edad) en la concertación,
en la articulación de consensos, y en la realización de diversas acciones colectivas
HQEHQHÀFLRGHODSREODFLyQPiVYXOQHUDEOH 3URJUDPD9DVRGH/HFKH&RPHGRUHV

77
Juan Arroyo y Marina Irigoyen

3RSXODUHV \HQHVSHFLDOGHODVPXMHUHV\QLxRV '(081$V&HQWURGH(PHUJHQFLD


contra la Violencia Intrafamiliar, Casa de la Mujer). Comparativamente, frente al
modelo de democracia limitada o el modelo municipal tradicional, hay más avances
y posibilidades.

6.3 La democratización local, ¿una puerta para la equidad


de género?
Hoy asistimos al impulso desde el Estado, las multilaterales y la cooperación
internacional a la modernización y democratización del Estado. Los objetivos
de descentralización y democratización de la gestión pública implican aportar al
fortalecimiento de la gobernabilidad y alientan la participación ciudadana concertada
en las decisiones y en la vigilancia de las políticas públicas. Ello supone desarrollar
las capacidades y habilidades individuales y colectivas de la mujer para elaborar
SURSXHVWDVGHGHVDUUROORFRQHTXLGDGGHJpQHURHQEDVHDODUHÁH[LyQGHVXVSURSLDV
H[SHULHQFLDVGHLQHTXLGDGHV\DODFRQVLGHUDFLyQSHUPDQHQWHGHODVRSRUWXQLGDGHV
\DPHQD]DVTXHVHSUHVHQWDQHQHOFRQWH[WRORFDOUHJLRQDOQDFLRQDOHLQWHUQDFLRQDO
6LQHPEDUJRHVWDVSXHUWDVDELHUWDVQRHVWiQVLHQGRXWLOL]DGDVVXÀFLHQWHPHQWH

6HKDVHxDODGRODQHFHVLGDGGHTXH´HOHQIRTXHGHJpQHURVHDWUDQVYHUVDODORV
planes de desarrollo y tenga de referencia los procesos socio-políticos locales y no
sólo la agenda de género, visibilizando las brechas existentes” (Consorcio ProMujer,
2001). En el terreno de la descentralización la situación actual es sin embargo de
P~OWLSOHVRSRUWXQLGDGHVLQVXÀFLHQWHDSURYHFKDGDV

La Ley de Cuotas ha tenido un efecto democratizador posibilitando un mayor


acceso de las mujeres a las esferas de poder. En las elecciones al Congreso del 2000
se duplicó el número de congresistas mujeres de 13 a 26, siendo ocho congresistas
representantes de departamentos altoandinos. Esta cuota se amplió al 30% con
HOFDPELRGHO'LVWULWR(OHFWRUDOÓQLFRDO0~OWLSOHSHUPLWLHQGRTXHVHDPSOLDUDHO
acceso de más mujeres como alcaldesas provinciales y distritales. Si bien todavía
VRQPX\SRFDV\PDVTXHQDGDVRQUHJLGRUDVHVXQDFRQWHFLPLHQWRQRWDEOHSDUDOD
democratización en los distritos ubicados en pobreza y extrema pobreza, con una
SREODFLyQ PD\RULWDULDPHQWH UXUDO  $ QLYHO QDFLRQDO OD HVWDGtVWLFD VHxDOD TXH KD\
50 consejeras regionales; 5 alcaldesas provinciales; 400 regidoras provinciales; 48
alcaldesas distritales; y 2,313 regidoras distritales, es decir alrededor de una regidora
por distrito. En los ámbitos estudiados la presencia de las mujeres fue similar al
promedio nacional; no hemos encontrado ninguna alcaldesa mujer.

78
Desafíos de la Democracia Participativa Local en la Descentralización

Capítulo 7:
Transición democrática descentralista
en post-transición nacional

6HGHGXFHGHWRGRORDQWHULRUTXHH[LVWHXQDSDUDGRMDHQHOSDtVKD\´XQH[FHVR
de oferta sobre la demanda” en términos de participación, esto es, la institucionalidad
descentralista puede ser criticada por ser limitadamente participativa pero incluso
HQHVDVFRQGLFLRQHVQRORJUDODFRQYRFDWRULDSOHQDGHTXLHQHVGHEtDQSDUWLFLSDUHQ
el proceso. Este raro caso de un marco normativo sobre gobernabilidad local más
DYDQ]DGRTXHODUHDOLGDGVRFLDO\FXOWXUDODFWXDOWLHQHTXHYHUFRQORVRUtJHQHVGHO
DFWXDO SURFHVR GH GHVFHQWUDOL]DFLyQ \ HO GHVWLQR TXH KD WHQLGR HQ QXHVWUR SDtV OD
transición democrática.

(QUHDOLGDGODGHVFHQWUDOL]DFLyQQRWLHQHQHFHVDULDPHQWHTXHVHUFRLQFLGHQWH
FRQXQSURFHVRGHGHPRFUDWL]DFLyQGHO(VWDGRSRUORTXHVHKDYLVWRHQRWURVSDtVHV
latinoamericanos, por ejemplo Chile con Pinochet. En esos casos se abren procesos
de descentralización subnacional del Estado pero sin una apertura del Estado hacia
la sociedad. La delegación de autoridad y de recursos es del nivel nacional al nivel
UHJLRQDO\ORFDOSHURVHWUDWDGHXQUHGLVHxRGHODLQVWLWXFLRQDOLGDGSDUDODJREHUQDQ]D
QRGHODLQVWLWXFLRQDOLGDGTXHWLHQHTXHYHUFRQODJREHUQDELOLGDG $UUR\R 
(VHVWRORTXHHVWiHQFXHVWLyQFXDQGRVHGHEDWHDKRUDHOSURFHVRGHWUDQVIHUHQFLD
GHORVSURJUDPDVVRFLDOHVODVFDSDFLGDGHVWpFQLFDVODGHVFHQWUDOL]DFLyQÀVFDO\HO
UHGLVHxR LQVWLWXFLRQDO GH ORV JRELHUQRV UHJLRQDOHV \ PXQLFLSLRV SDUD ODV QXHYDV
competencias.

79
Juan Arroyo y Marina Irigoyen

En nuestro caso por tanto hay un doble dilema en torno a la descentralización:


H[LVWHQ TXLHQHV HVWiQ SRU OD GHVFHQWUDOL]DFLyQ WpFQLFRÀQDQFLHUD SHUR QR SRU OD
GHVFHQWUDOL]DFLyQSDUWLFLSDWLYDVLHQGRPiVUDURHOFDVRSHURH[LVWHQWDPELpQTXLHQHV
ponen el énfasis en la descentralización participativa sin apreciar la dimensión técnico-
ÀQDQFLHUDGHOSURFHVR7HQHPRVWDPELpQORVTXHHVWiQHQFRQWUDGHDPERVWLSRVGH
descentralización. En realidad el frente nacional por la descentralización es más amplio
TXHHOIUHQWHSRUXQDGHVFHQWUDOL]DFLyQFRPRSURFHVRGHGHPRFUDWL]DFLyQFLXGDGDQD
La descentralización democratizadora ha llegado sin contar con una sociedad activa,
PiV ELHQ FRQ XQD FRQ PXFKD IUDJPHQWDFLyQ VRFLDO \ GHVFRQÀDQ]D \ HVR H[SOLFD
HOGHVIDVHHQWUHODQXHYDLQVWLWXFLRQDOLGDG\ORVDFWRUHVTXHDSDUHFHFRPRVLIXHUD
exclusivamente de capacidades cuando es centralmente de ciudadanía activa.

La descentralización como proceso de democratización del Estado viene


LPSOHPHQWiQGRVH DVt FRPR VL IXHUD XQD UHIRUPD GHVGH DUULED (V FLHUWR TXH XQ
movimiento social amplio contribuyó a la salida del régimen dictatorial fujimorista
pero luego éste volvió a disolverse en el momento de la reforma descentralista. Como
HVWDPRVHQXQDHWDSDGHIUDJPHQWDFLyQVRFLDOVXGLVHxRHLQLFLDOLPSOHPHQWDFLyQ
QRWLHQHQHODFRPSDxDPLHQWRGHXQPRYLPLHQWRVRFLDORUJDQL]DGR\YLJLODQWH<VLQ
HPEDUJRHOGLVHxRHVSDUWLFLSDWLYRORTXHJHQHUDXQGHVIDVHFRQDFWRUHVVRFLDOHVTXHHQ
mucho se siguen moviendo en la dinámica de la década pasada. Como resultado, desde
una nueva institucionalidad se promueve el proceso de organización de los actores
sociales. Es el Estado en busca de su sociedad, como expresa Huber (2004). Esto
HVORTXHGLIHUHQFLDHOSURFHVRFRQWHPSRUiQHRUHVSHFWRDODWUDQVLFLyQGHPRFUiWLFD
TXHHOSDtVYLYLyDÀQHVGHODGLFWDGXUDGH)UDQFLVFR0RUDOHV%HUP~GH]HQWUH\
1980, cuando un movimiento popular orgánico abrió al Estado y la forma de gobierno
volvió a la democracia clásica de los 60s.

Y sin embargo esta reforma descentralista excede a la democracia representativa


FOiVLFDDGLIHUHQFLDFRQORTXHSDVyHQODDQWHULRUWUDQVLFLyQGHPRFUiWLFD/DUD]yQ
GHHVWDE~VTXHGDGHXQDDUTXLWHFWXUDLQVWLWXFLRQDOPiVDELHUWDTXHODGHPRFUDFLD
UHSUHVHQWDWLYD HV OD JUDYH FULVLV GH UHSUHVHQWDFLyQ SROtWLFD TXH VH YLYH HQ HO SDtV
TXH\DYDSRUVXVHJXQGDGpFDGD/DFULVLVGHUHSUHVHQWDFLyQKDFHTXHSDUWLGRVTXH
no necesariamente comparten el ideario de la democracia participativa otorguen
HOFRQVHQWLPLHQWRSDUDTXHODIUDQMDGHVFHQWUDOLVWDPXQLFLSDOLVWDPRGHOHSDUWHGHO
(VWDGRVXEQDFLRQDOFRQIRUPHDODVH[SHULHQFLDVORFDOHVTXHVROLWDULDPHQWHEULOODURQ
en el decenio fujimorista. Algunos representantes de las experiencias avanzadas
de participación local de los 90 (Cajamarca, Ilo, Huancavelica, etc.) han pasado así
D VHU SDUWH GH ORV GLVHxDGRUHV GH OD GHVFHQWUDOL]DFLyQ /D FRPXQLGDG HSLVWpPLFD
descentralista municipalista tiene iniciativa legislativa no sólo desde fuera – desde las
redes de articulación y grupos de apoyo, como RED Perú, Mesa de Concertación de

80
Desafíos de la Democracia Participativa Local en la Descentralización

Lucha contra la Pobreza, REMURPE, Grupo Propuesta Ciudadana, etc.- sino desde
dentro de los espacios de decisión.

¿Cómo así han llegado diferentes miembros de esta comunidad epistémica


descentralista municipalista a tener una relativa importancia en casi la única reforma del
(VWDGRHQGHVDUUROORODGHVFHQWUDOL]DFLyQSDUWLFLSDWLYD"/DUHVSXHVWDDHVWRWLHQHTXH
ver con el protagonismo desarrollado entre 1999 y el 2000 por los frentes regionales
GHGHIHQVD\ORVPXQLFLSLRVSDUWLFLSDWLYRVHQHODPSOLRIUHQWHQDFLRQDOTXHHVWXYR
PX\DFWLYROXFKDQGRSRUHOÀQDOGHOIXMLPRULVPR+D\TXHDFRUGDUVHGHTXHDÀQHV
GHORVVXUJLyOD&RRUGLQDGRUDGH)UHQWHV5HJLRQDOHV\HQIHEUHURGHODxR
ODVH[SHULHQFLDVPXQLFLSDOHVGHFRQFHUWDFLyQGLHURQYLGDDOD5HG3HU~\TXHDPEDV
vertientes participaron activamente en la Marcha de los 4 Suyos en julio del 2000. En
VHWLHPEUHGHHVHDxRVHGHVWDSyHOHVFDQGDORVRYLGHR.RXUL0RQWHVLQRV\VHPDQDV
después Fujimori fugó a Japón. Luego se instaló el Gobierno de Transición presidido
SRUGHO'U9DOHQWtQ3DQLDJXDTXHHQHQHURGHOUHVSRQGLHQGRDORVQXHYRV
tiempos democráticos, institucionalizó la experiencia de las Mesas de Concertación
creando legalmente la Mesa de Concertación de la Lucha contra la Pobreza. En esos
meses de preparativos de las elecciones de abril del 2001 la Coordinadora de Frentes
Regionales negoció con Perú Posible colocar a sus propios candidatos en su lista
SDUODPHQWDULDFDQGLGDWRVTXHOXHJRHQHOFRQJUHVRVHFRQYLUWLHURQHQGLVHxDGRUHV
GHODGHVFHQWUDOL]DFLyQ(OGHMXOLRHODxRLQJUHVyHOQXHYRJRELHUQRGHO
Presidente Toledo y anunció en el primer mensaje presidencial la descentralización y
las elecciones regionales. El gobierno debió convocar así a conocedores del tema para
afrontar la promesa hecha, con lo cual representantes de esta comunidad descentralista
llegaron a algunas instancias de formulación y decisión política, en el Congreso, el
Consejo Nacional de Descentralización y el Ministerio de la Presidencia, encargado
inicialmente de promoverla. La Comisión de Descentralización del Congreso fue
presidida no por casualidad por Luis Guerrero primero, Walter Alejos después y
Ernesto Herrera en tercer lugar. La Secretaria Técnica para la Descentralización,
TXHVHXELFDEDHQHO0LQLVWHULRGHOD3UHVLGHQFLDLQWHJUyWDPELpQDXQDSDUWHGHOD
comunidad epistémica. Estos integrantes de la comunidad descentralista no están
VRORVHQODWDUHD\FRPSDUWHQHOGLVHxRHLPSOHPHQWDFLyQGHODGHVFHQWUDOL]DFLyQ
con especialista y funcionarios procedentes de otras experiencias. Esto explica las
hibridaciones existentes en la legislación descentralista.

De otro lado esta transición democrática ha tenido un curso particular, pues


se truncó como proceso nacional pero se continúa desarrollando como proceso
VXEQDFLRQDO\VREUHWRGRORFDO<DDHVWDVDOWXUDV²ÀQHVGHOVHFHUUyHO´PRPHQWR
FUHDWLYRµGHOSHULRGRGHJRELHUQR\SDVyHODXJHGHODWUDQVLFLyQGHPRFUiWLFDTXH
ocupó el Gobierno de Transición y el primer gabinete de “todas las sangres”. Los

81
Juan Arroyo y Marina Irigoyen

ministros civilistas salieron y los proyectos de reformas sectoriales se extinguieron.


La reforma constitucional se pasmó y la reforma del Estado se postergó, viviéndose
OD FRQWLQXLGDG GHO (VWDGR EXURFUiWLFRSDWULPRQLDOLVWD TXH WRGRV FRQRFHPRV /D
descentralización rural es así la veta viva de un proceso de transición muerto en otras
HVIHUDV'HDKtODHQRUPHLPSRUWDQFLDGHORTXHVHHVWiGLVFXWLHQGRHQHOFDPSRGH
ODFRPXQLGDGGHVFHQWUDOLVWDPXQLFLSDOLVWDTXHSURFHVDHODSUHQGL]DMHVRFLDOPDVLYR
TXH GHELy GDUVH FRQ WRGR HO (VWDGR \ OD QDFLyQ VREUH OD IRUPD LQVWLWXFLRQDO TXH
ajusta mejor para promover ciudadanía y calidad de vida en un entorno nacional de
GLÀFXOWDGHVSDUDODDFFLyQFROHFWLYD\IXHUWHVWHQGHQFLDVFHQWUtIXJDV

La descentralización participativa es en este contexto una gran reforma


constituyente de su propia base social. Como ya se ha discutido en las ciencias políticas,
los representantes y los representados se constituyen mutuamente, no existen por
separado (Novaro, 2000). La comunidad descentralista municipalista - integrada
por los alcaldes participacionistas, los especialistas en descentralización, las ONGs
ruralistas y municipalistas, las agencias cooperantes comprometidas con el proceso
KDPDQWHQLGRSRUDxRVXQGLVFXUVRTXHHQORVWLHPSRVGHOFHQWUDOLVPRDXWRULWDULR
era una subcultura de minorías. Ahora a través de los talleres, las mesas, los CCL, los
Diplomas, las comisiones, este discurso tienta su paso a una cultura de masas. Es más,
muchos de sus planteamientos vienen tentando convertirse en política de Estado.

El discurso descentralista ruralista articula los legados del desarrollo humano, del
gerencialismo social, de la democracia participativa, del desarrollo de capacidades, del
HQIRTXHGHGHUHFKRV\DOLHQWDXQSUR\HFWRQDFLRQDOTXHVRORHVSRVLEOHVLQHPEDUJR
transformándose en el mismo proceso.

82
Desafíos de la Democracia Participativa Local en la Descentralización

Capítulo 8:
La comunidad epistémica descentralista
y el cambio de discurso de la acción directa
a la construcción de sociedades civiles
con movimientos sociales

Como se sabe, el concepto de “comunidad epistémica” en sentido estricto se usa


SDUDGHQRPLQDUDXQJUXSRGHH[SHUWRVTXHFRPSDUWHQXQGLVFXUVRVREUHXQFDPSR
temático. La teorización sobre las comunidades epistémicas provino originalmente de
Peter Haas (1992) y tuvo dicha connotación. En este caso la comunidad epistémica
GHVFHQWUDOLVWDPXQLFLSDOLVWDHVXQDFRPXQLGDGGHDFFLyQ\UHÁH[LyQXQHQWUDPDGR
de gestores y estudiosos alrededor de un discurso con ideas-fuerza, con una franja
de matices y énfasis diversos a su interior, pero posicionada de conjunto a favor de
la descentralización, de la participación y de la construcción de ciudadanía. La teoría
GHODVFRPXQLGDGHVHSLVWpPLFDVDGYLHUWHTXHHOGLVFXUVRGHWRGDFRPXQLGDGDJLJDQWD
algunos aspectos de la realidad y opaca otros, teniendo también “puntos ciegos”,
]RQDVTXHQRYH

/RVFUtWLFRVGHODFRPXQLGDGGHVFHQWUDOLVWDUXUDOLVWDDÀUPDQTXHHOFULVWDOFRQHO
TXHPLUDHOSURFHVRGHGHVFHQWUDOL]DFLyQ\SDUWLFLSDFLyQLGHDOL]DDORVDFWRUHVVRFLDOHV
y por tanto a la democracia participativa (Grompone, 1998). La verdad éste es un
viejo debate en las ciencias sociales peruanas pues en las últimas décadas fueron
surgiendo nuevos actores sociales y nuevas etapas de lo social y una parte de los
estudiosos de lo social fué descubriendo periódicamente viejos y nuevos movimientos
VRFLDOHV/RKL]RSDUDGHVFULELUHOÀQGHORVPRYLPLHQWRVFODVLVWDVGHORVV\HOSDVR

83
Juan Arroyo y Marina Irigoyen

a las “organizaciones de sobrevivencia” y “organizaciones de mujeres”, luego para


describir el cambio de “marginales a informales” o de “informales a productores”
o empresarios. Durante buen tiempo se habló así de viejos y nuevos movimientos
VRFLDOHVLQFOXVRFXDQGRpVWRV\DQRH[LVWtDQKDVWDTXHHQORVODDXVHQFLDVHKL]R
evidente y sobrevino el silencio. Se había tocado fondo.

(VSUREDEOHTXHHVH´FLFORVRFLDOODUJRµTXHVHFRQVWUX\yHQHOSDtVHQWUH\
1990 no se hubiera construido si no hubiera existido toda esa franja de articuladores
VRFLDOHV\SROtWLFRVTXHOHRWRUJDEDsu sentido a actores y procesos y es probable
WDPELpQTXHGHUHSHQWHORFRQVWUXLGRHQWRQFHVKXELHUDWHQLGRPD\RUVRVWHQLELOLGDG
o hasta se hubiera atemperado la captura de la sociedad por la cultura autoritaria,
SDWULPRQLDOLVWD\FHQWUDOLVWDFXOPLQDGDHQHOSULPHUTXLQTXHQLRGHORVVVLVH
hubiera escuchado desde mucho antes a las criticas, a veces poco amistosas pero
YDOLRVDVGHTXLHQHVYHtDQORVÁDQFRVGHOPRYLPLHQWR

/DVSUHJXQWDVTXHVXUJHQDKRUDVRQHQFLHUWDPHGLGDXQDUHHGLFLyQGHOGHEDWH
HQWUH YROXQWDULVWDV \ UHDOLVWDV VROR TXH FRQ YDULDV GpFDGDV GH H[SHULHQFLD ¢/DV
WUDQVIRUPDFLRQHV VRFLDOHV TXH VH YLHQHQ SURGXFLHQGR HQ XQD IUDQMD QDFLRQDO GH
localidades rurales, a partir de los procesos de concertación, autorizan a pensar en
XQDPXWDFLyQSURJUHVLYDVLJQLÀFDWLYDGHORVRFLDOHQXQDUHDOSDUWLFLSDFLyQFLXGDGDQD"
6LIXHUDDVt¢FXiOHVVRQORVGHVDItRVGHHVWHSURFHVR\DQRVyORDTXHOORVTXHUHÀHUHQ
D OD GHVFHQWUDOL]DFLyQ \ VX LQVWLWXFLRQDOLGDG VLQR ORV TXH WLHQHQ TXH YHU FRQ VX
SURSLDFRQVWUXFFLyQFRPRPRYLPLHQWRGHFLXGDGDQtD"¢1RKD\PiVTXHDxDGLUD
ORTXHVHHVWiKDFLHQGR\SHQVDQGR"(QXQDPLUDGDKLVWyULFD¢HVWDUHPRVDEULHQGR
inadvertidamente, un nuevo ciclo social de largo plazo, cuyos primeros pasos se sienten
en las experiencias locales participativas, o la democracia participativa concertadora
es más de lo mismo, una nueva envoltura para el mismo entramado de intereses
SDUWLFXODUHV\SHTXHxDVSDVLRQHVGHDOFDOGHV21*VLJOHVLDV\OtGHUHVVRFLDOHVFRPR
DÀUPDQODVYHUVLRQHVPiVFUtWLFDV"

/RTXHKHPRVYLVWRHQODVGRFHH[SHULHQFLDVHVWXGLDGDVQRVOOHYDDSHQVDUTXH
el nuevo marco institucional de la descentralización viene propiciando esta otra
WUDQVLFLyQGHORVDFWRUHV\VXVIRUPDVFROHFWLYDVPHQRVDQDOL]DGDTXHODWUDQVLFLyQ
democrática - si bien sólo está en sus primeros pasos. La comunidad descentralista
UXUDOLVWDHVODSURWDJRQLVWDFHQWUDOHQHVWHWHUUHQR\PiVDOOiGHORTXHVHSXHGDGHEDWLU
sobre sus intereses e ideales, viene motorizando la descentralización democratizadora
SXJQDQGRFRQHVDRWUDJUDQFRPXQLGDGTXHQRVHQYXHOYHDFDVLWRGRVHQHOSDtV
ahora, la del pragmatismo. Efectivamente, como se ha dicho, la concertación es más
TXHXQPHFDQLVPRGHJHVWLyQHVXQDFRQWUDFXOWXUD

84
Desafíos de la Democracia Participativa Local en la Descentralización

Este movimiento actual tuvo su origen en la generación de municipios


SUHFXUVRUHV\SLRQHURVTXHVHGLIHUHQFLDQEiVLFDPHQWHGHODWHUFHUDJHQHUDFLyQQR
VyOR SRU KDEHU FUHDGR XQD QXHYD LQVWLWXFLRQDOLGDG VLQR SRUTXH FRQVWUX\HURQ VXV
experiencias participativas en el momento más profundo de la derrota de todas las
LGHDVTXHIXQGDURQHOFLFORVRFLDO(QODVH[SHULHQFLDVSLRQHUDVHVWXGLDGDV
encontramos siempre un patrón de surgimiento: Wilbert Rozas en Limatambo,
Maximilano Ruiz en Morropón y Luis Guerrero en Cajamarca ganaron las elecciones
HQFRQPRYLPLHQWRVLQGHSHQGLHQWHVGHL]TXLHUGDIXQGDGRVOXHJRGHODGLiVSRUD
GH,]TXLHUGD8QLGDDSDUWLUGH(Q/LPDWDPERVHOODPy8QLGDG&DPSHVLQD
Popular, en Morropón Unidad Popular y en Cajamarca Frente Independiente Regional,
SRFRLPSRUWDHOQRPEUHYLVWRKLVWyULFDPHQWH$KtHPSH]yHOp[RGRTXHWRGDYtDQR
termina. La generación municipalista siguiente recibió gestiones con viento a favor,
pero esta generación de pioneros comenzó a construir entonces nuevas formas
de institucionalidad, con Mesas de Concertación Interinstitucional y Consejos
Comunales Vecinales, se apropió sin incomodidad del planeamiento estratégico
local y las novedades del gerencialismo, replanteó la visión-objetivo social hacia el
GHVDUUROORORFDO\HPSUHQGLyUHGLVHxRVRUJDQL]DFLRQDOHVPXQLFLSDOHV(VWDJHQHUDFLyQ
KL]RXQYLUDMHSURIXQGRIXQGDQGRXQDQXHYDSUiFWLFDVRFLDOSHURVLQTXHGHVGHODV
WUDGLFLRQHVQDFLRQDOHVGHODVFXDOHVVHYHQtDVHKLFLHUDXQEDODQFHGHOPXQGRTXHVH
había extinguido, hasta ahora pendiente.

(QUHDOLGDGVHHVWDEDGDQGRÀQDODKHJHPRQtDGHOYLHMRGLVFXUVRPRYLPLHQWLVWD
TXHVREUHGLPHQVLRQDEDDODSOD]DS~EOLFDODFDOOHODFRQIURQWDFLyQFRQHO(VWDGR
como las escuelas de conciencia política, ciudadanía diríamos hoy. Con ese ethos
durante la década de los 70s se construyó un movimiento social estructurado. El
contexto de una dictadura facilitó el predominio de la teoría de la acción directa,
TXHHVHQEXHQDFXHQWDODDSXHVWDDODFWRUVLQLQVWLWXFLyQRLQFOXVRDQWLLQVWLWXFLRQDO
El Perú de ese entonces tenía clases sociales, no era predominantemente informal
como hoy. Todo estaba a favor de esa forma de lo social: los actores, las instituciones
y las estructuras. Pero cuando en el Perú de los 80s empezaron a disolverse las
bases estructurales del clasismo, cuando además se reabrió el régimen democrático
y aparecieron formas de canalización institucional de lo social, y encima se debilitó
el ethos movimientista, el dinamismo social cambió y empezó la mezcla actual de
disgregación y fragmentación, organizaciones sociales prebendalistas y movimientos
sociales irruptivos.

Los alcaldes participativos pioneros produjeron entonces un cambio más grande


TXHHOLPDJLQDGR'HODFRQFHSFLyQGHGHPRFUDFLDGLUHFWD\HQFLHUWDPHGLGDDQWL
representativa, se pasó a la de democracia participativa. De la idea de un cambio al

85
Juan Arroyo y Marina Irigoyen

todo o nada se pasó a la expectativa en el desarrollo micro sin necesariamente un


apoyo importante de los niveles meso y macro, al aprovechamiento de las autonomías
relativas respecto a esos niveles y en última instancia a la aplicación consecuente
de lo glocal, esto es, la vinculación directa con el mundo vía la exportación. Del
VRVOD\DPLHQWRGHORWpFQLFR\ODVXEHVWLPDFLyQGHODHÀFDFLDVHSDVyDODDGPLVLyQ\
renovación del gerencialismo como gerencialismo social. De la idea de municipios de
registros públicos y servicios a municipios-nodos de red y promotores del desarrollo.
Carlos Paredes, asesor de la Federación Campesina del Cusco, inspirador de la
H[SHULHQFLDGH-DERQ0D\RFXHQWDTXHOD)HGHUDFLyQXQDYH]TXHFRQVWDWyHQ
TXHQRKDEUtDPiVSUpVWDPRVDJUDULRVSRUGHVDSDULFLyQGHO%DQFR$JUDULRQLDSR\R
del Estado, hizo un Congreso con el lema “Qué podemos hacer sin el Estado”.

1DFLy DVt HO DFWXDO FLYLOLVPR UXUDOLVWD TXH SDVy HQWRQFHV D RWUD IRUPD GH
construcción de lo social, el de las sociedades civiles con movimientos sociales, con
una doble apuesta a nuevos actores y nuevas instituciones. Evidentemente nadie puede
DVHJXUDUTXHORTXHHVWiDSHQDVHQHPEULyQWHQJDHOIXWXURDVHJXUDGR(VPiVHO3HU~
tiene cruzados los dos tipos de relación sociedad-Estado, el desinstitucionalizado
tipo Ilave y el institucionalizado, tipo experiencias de concertación. Además,
el proceso está lleno de errores. Como se ha dicho, la descentralización es una
UHIRUPDGHPRFUDWL]DGRUDTXHDYDQ]DVLQQRUWHQLFRQGXFFLyQHVWUDWpJLFD $]SXU
2004). La nueva preocupación es ahora, habida cuenta de la hiper-reglamentación
de los presupuestos participativos y de las inscripciones para los CCL, cuánta
LQVWLWXFLRQDOLGDGQHFHVLWDPRVSDUDSURPRYHUDFWRUHVVLQDVÀ[LDUORV

Pero la mudanza de ideas ha otorgado oxígeno a este nuevo desarrollo. Hay


SDVLYRVTXHVHYLVLELOL]DUiQVHJXUDPHQWHPiVWDUGH\FXDQWRPiVWHPSUDQRPHMRU3HUR
XQQXHYRHQIRTXHOXHJRGHXQSHULRGRDFLHJDVUHVWDEOHFHHOGLiORJRFRQODUHDOLGDG\
HVHEHQHÀFLRLQPHGLDWRSHUPLWHODH[SDQVLyQGHOPHQVDMH3RUHVRHODVFHQGLHQWHTXH
vienen teniendo en el mundo municipal las experiencias participativas. Su número es
UHODWLYDPHQWHSHTXHxRSHURVXLPSDFWRHVDVFHQGHQWH<WLHQHXQHQRUPHGHVDItRHQ
VXVPDQRVKHUHGDUDODQDFLyQVXVYHLQWHDxRVGHH[SHULHQFLDORFDO

86
5HIHUHQFLDVELEOLRJUi¿FDV

Aguilar, Gloria.
2004 Equidad de Género en el modelo de gestión municipal participativa. La Paz: Nova Interactiva SRL,
USAID. 400 pp.
Ames, Rolando, Enrique Bernales et.al.
2000 Situación de la Democracia en el Perú. 2000- 2001. Lima: Fondo Editorial de la PUCP. Lima.
Arroyo, Juan
2001 La función de gobierno, la intersectorialidad y la sciedad civil en salud. En: CIES, Políticas de Salud
2001-2006, Lima: CIES, pp. 35-94.
Asociación Aurora Vivar.
2004 Género y desarrollo en los gobiernos locales y regionales. Lima: Oxfam – UK. 129 pp.
Avila, Javier.
2003 ¿Descentralización “desde abajo”? Cultura política, sociedad civil y estrategias de concertación en Huanta.
En: Ludwig Huber (editor), Ayacucho, Centralismo y Descentralización, Lima: IEP,
Estudios de la Sociedad Rural 22, pp. 105-153.
Azpur, Javier.
2004 La descentralización: una reforma democratizadora que avanza sin norte ni conducción estratégica. En:
Javier Azpur, Rosa Pizarro, Luis Sirumbal et al, Perú Hoy: Los mil días de Toledo, Lima:
DESCO, pp. 101-147.
Basombrío, Carlos y Carlos Frías.
2004 /D5HG3HU~8QDUHÁH[LyQHQ3HUVSHFWLYDGHVX3ODQ(VWUDWpJLFR'RFXPHQWRGH7UDEDMR. Lima,
diciembre de 2004.
Boggio, María R.; Doris Balvín, Felipe Vargas y Oscar Ugarte.
2000 Espacios locales y descentralización. Lima: Centro IDEAS. 125 pp.
Ccama Aroni, Domisiano
2001 Mesa de Concertación Interinstitucional de Santa Rosa. Revista Concertando N° 2, Septiembre,
pp 6-7.
CESIP.
2003 Promoción de la equidad de género en el desarrollo local. La concertación entre municipalidad y sociedad
civil. Lima, 2003.
Cohen, Jean y Andrew Arato.
2000 6RFLHGDG&LYLO\7HRUtD3ROtWLFD. México: Fondo de Cultura Económica.
Consejo Nacional de Descentralización
2003 Documento de trabajo N° 1: Plan nacional de descentralización 2003 - 2006; Plan nacional de
Desarrollo territorial . Lima: Grupo Propuesta Ciudadana. 112pp.
Consorcio ProMujer
2001 8QDH[SHULHQFLDLQVWLWXFLRQDO\SROtWLFD . Lima: Diciembre.
Córdova La Torre, Alejandro
2003 La Mesa de Concertación Provincial de Huanta. El Desafío de la Concertación: consolidando lo
iniciado. Revista Concertando N° 4, Marzo, pp. 17 – 21.

95
Juan Arroyo y Marina Irigoyen

Cornwall, Andrea.
2002 Making Spaces, Changing Places: Situating Participation in Development. Brighton, Sussex:
Institute of Development Studies, Working Paper 170.
Chirinos, Luis.
1991 La participación sin mandato. En: Henry Pease, editor. Construyendo un Gobierno
metropolitano. Políticas Municipales 1984-1986. Lima: IPADEL.
Dammert Ego Aguirre, Manuel.
2003 La Reforma Descentralista Peruana, enfoque territorial y autonómico. Lima: Universidad Nacional
Mayor de San Marcos. 292pp.
DESCO
2001 Fortalecimiento de la gestión local - FOGEL: Sistematización del Programa. Lima: Desco (no
publicado).
Díaz Palacios, Julio.
1990 Municipio: Democracia y desarrollo. 1ª. Edición, Lima: CIDAP-IPADEL-LABOR-Ilo-
TAREA.
2004 Guía Metodológica sobre el buen gobierno local. Lima: Proyecto Fortalece, convenio DFID -
MIMDES. 34pp.
2004 Estrategias para un buen gobierno local. Lima: proyecto fortalece, convenio DFID - MIMDES.
Cartilla de difusión
2004 La incidencia política: nuevos caminos para la sociedad civil. Lima: DFID, Calandria. 78pp.
Diez Hurtado, Alejandro.
2003 Elites y poderes locales: sociedades regionales ante la descentralización. Los casos de Puno y Ayacucho.
Lima: DFID, Servicios educativos rurales – SER. 153pp.
DFID. Ministerio Británico para el Desarrollo Internacional
2003 'HPRFUDFLDSDUWLFLSDWLYDHQORV$QGHVODH[SHULHQFLDGHFXDWURPXQLFLSDOLGDGHVUXUDOHVHQHO3HU~.
Lima: DFID, Remurpe, Oxfam, CICDA. 158 pp.
Dienel, Peter C. y Harms Hans.
2000 Repensar la Democracia. Los nuevos núcleos de intervención participativa. Barcelona: Ediciones del
Serbal, 214 pp.
Elster, Jon (comp.).
2001 La democracia deliberativa. Barcelona: Editorial Gedisa.
Federación Departamental de Campesinos del Cusco.
2004 Lineamientos para el desarrollo del mercado interno en base al progreso de la pequeña producción
campesina. Cusco: FDC.
Fung, Archon and Erick Olin Wright.
2003 Deepening Democracy. Institutional Innovations in Empowered Participatory Governance. London:
Verso.
García, Soledad y Steven Lukes.
1999 Ciudadanía: justicia social, identidad y participación. Madrid: Siglo veintiuno editores. 288 pp.
Grey Figueroa, Carlos y José Ventura.
2003 Democratizando el presupuesto público: presupuesto participativo, metodología y herramientas al alcance.
Lima: CARE Perú, 262 pp.

96
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

Grompone, Romeo.
1998 La descentralización y el desprecio de la razón política. En: Bruno Revesz, editor Descentralización
y Gobernabilidad en tiempos de globalización. Lima: CIPCA, IEP.
Grupo Propuesta Ciudadana.
2001 Cuadernos Descentralistas 1, Las condiciones de la transición democrática para la reforma descentralista.
Lima: Escuela para el desarrollo, Grupo Propuesta Ciudadana, 90 pp.
2001 Cuadernos Descentralistas 2, Lineamientos para la construcción de un consenso descentralista. Lima:
SER, Grupo Propuesta Ciudadana. 98 pp.
2002 Cuadernos Descentralistas 4, Huancavelica: Situación regional y propuestas para una agenda de
desarrollo. Lima: Escuela para el desarrollo, Grupo Propuesta Ciudadana, 52 pp.
2002 Cuaderno Descentralista 5. Cajamarca: Situación regional y propuestas para una agenda de desarrollo.
Lima: Escuela para el desarrollo; Grupo Propuesta Ciudadana, 51 pp.
2003 &XDGHUQRV 'HVFHQWUDOLVWDV  $SRUWHV D OD GHVFHQWUDOL]DFLyQ \ HO GHVDUUROOR ORFDO Lima: Grupo
Propuesta Ciudadana, 145 pp.
2003 Reporte nacional Vigila Perú N° 1. sistema de vigilancia ciudadana de la descentralización. Lima:
Grupo Propuesta Ciudadana, 52 pp.
2003 Reporte nacional Vigila Perú N° 2. sistema de vigilancia ciudadana de la descentralización.Lima:
Grupo Propuesta Ciudadana, 64 pp.
2003 Reporte nacional Vigila Perú N° 3. Sistema de vigilancia ciudadana de la descentralización. Lima:
Grupo Propuesta Ciudadana, 72 pp.
2004 Cuadernos Descentralistas 11, la Participación ciudadana en el presupuesto participativo. Lima:
Grupo Propuesta Ciudadana. Junio, 57 pp.
2004 Reporte nacional Vigila Perú N° 4. Sistema de vigilancia ciudadana de la descentralización.Lima:
Grupo Propuesta Ciudadana, 68 pp.
Gutmann, Amy
1999 Democracia deliberativa y regla de la mayoría: una réplica a Waldron. En: Harold Hongju Koh
y Ronald C Slye, Democracia deliberativa y Derechos Humanos, Barcelona, Editorial
Gedisa, pp. 269-278.
Gutmann, Amy and Dennis Thompson.
2004 Why Deliberative Democracy? Princeton and Oxford: Princeton University Press.
Haas, Peter M.
1992 Introduction: Epistemic communities and international policy coordination. International
Organization, 46, 1: 1-35.
Hongju Koh Harold y Ronald C. Slye (comps.).
2004 Democracia deliberativa y derechos humanos. 1ª. Edición, Barcelona: Editorial Gedisa.
Henríquez, Narda.
2004 Mesa de Concertación para la Lucha contra la Pobreza: Situación actual y principales procesos.
Informe preliminar. Lima: MCLP.
Huber, Ludwig.
2004 El Estado en busca de su sociedad: fomentando la participación ciudadana en San Marcos y Cajabamba.
Informe de Consultoría. Lima, SER, julio/agosto.
Hurtado, Isabel.
2004 8QDDSUR[LPDFLyQPHWRGROyJLFDDOÌQGLFHGH3DUWLFLSDFLyQ&LXGDGDQD9DOLGDFLyQHQHO1RUWHGH3XQR.
Informe, Proyecto DECIDES. Lima: CARE Perú, Documento no publicado.

97
Juan Arroyo y Marina Irigoyen

IMASEN. Investigación Sociológica y de Mercados.


2004 ÌQGLFHGH3DUWLFLSDFLyQ&LXGDGDQDHQSDtVHVGHOD5HJLyQ. Lima: Red Interamericana para la
Democracia. Partners of the Américas – SER.
Instituto de Estudios Peruanos.
2002 La opinión de los peruanos y las peruanas sobre la descentralización: una mirada a los resultados de las
encuestas de opinión. Lima: Instituto de Estudios Peruanos. 22pp.
Irigoyen, Marina.
1996 Concertación Interinstitucional y Mejoramiento ambiental. En Miranda L (editora) Ciudades para
la Vida. Experiencias exitosas y propuestas para la acción. DGID, IPADEL, IHS, PROA.
Lima.
2000 La concertación interinstitucional: ¿sueño imposible o realidad en construcción?. Lima: Centro IDEAS.
170pp.
2003 (OFRQWH[WRGHODGHVFHQWUDOL]DFLyQ\ORVHVSDFLRVGHFRQFHUWDFLyQ. Revista Concertando N° 4, Marzo, pp.
4 – 7.
Lizárraga, Raúl.
2003 La Descentralización y el desarrollo Regional y local en el ojo de la tormenta. Cusco: Instituto
REDES. 124pp.
Lynch, Nicolás.
1991 Demandas sociales y confrontación política en un periodo de transición democrática. Lima:
FOMCIENCIAS. 49 pp.
López Follegatti, José Luis
2000 Ilo: Los Sueños de una Ciudad. 1ª. Edición, Lima: Asociación Civil Labor.
López, Sinesio.
1997 Ciudadanos reales e imaginarios: concepciones, desarrollo y mapas de la ciudadanía en el Perú. Lima:
IDS-Instituto de Diálogo y Propuestas.
Macassi, Sandro.
2002 Sondeo de opinión: Los ciudadanos y ciudadanas frene a los procesos de concertación del desarrollo local.
Lima: Calandria, 32 pp.
2004 Juventud y Gobiernos Locales. Espacios y Mecanismos de Concertación. Lima: CONAJU, GTZ.
Mansilla, Julio.
2004 Gestión municipal del distrito de Curahuasi. Asumiendo con responsabilidad y aprendiendo de nuestros
aciertos y errores. Exposición del alcalde distrital al Seminario Internacional “La Nueva
Ruralidad. Desafíos y Propuestas”
0D\WD4XLVSH7HyÀOR&UX]&*HRUJLQD\&DVWLOOR(-XOLR
2001 Implementación del plan estratégico e inicio de la gestión concertada del desarrollo de Azángaro Revista
Concertando N° 2, Septiembre, pp. 8-9.
Mena Melgarejo, Máximo
2004 Sociedad civil y presupuesto participativo. Lima: Congreso de la Republica, 170 pp.
Mesa de Concertación departamental de Huancavelica - MECODEH.
2002 Plan de Desarrollo Humano, Sostenido, Concertado y Participativo del Departamento de Huancavelica
2000 - 2021. Huancavelica: Consejería de Proyectos, 88 pp.
Mintzberg Henry, James Brian Quinn y John Voyer.
1997 (OSURFHVRHVWUDWpJLFR&RQFHSWRVFRQWH[WRV\FDVRV. Edición Breve. México: 1a. edición, Prentice
Hall Hispanoamericana S.A.

98
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

Municipalidad de Huanta
2000 Plan estratégico de desarrollo Huanta al 2010. Huanta: Care - Perú, Asociación SER.35 pp.
Municipalidad de Santa Rosa
2000 Plan estratégico concertado Santa Rosa al 2013. Puno: Care - Perú, Oxfam - DFID. 32pp.
Muñoz, Fanni.
2002 ¢4Xp SHQVDPRV HQ OD GHVFHQWUDOL]DFLyQ" 9LVLRQHV \ H[SHFWDWLYDV GH DOFDOGHV OtGHUHV GH RSLQLyQ \
funcionarios públicos. Lima: ESCUELA para el desarrollo.
Novaro, Marcos
2000 Representación y Liderazgo en las Democracias Contemporáneas. Rosario, Argentina: Homo
Sapiens Ediciones.
O´Donnell, Guillermo.
2002 Las poliarquías y la (in)efectividad de la ley en América Latina. En: Méndez Juan, Guillermo
O´Donnell y Paulo Sérgio Pinheiro (comps.). La LQ HIHFWLYLGDGGHODOH\\ODH[FOXVLyQHQ$PpULFD
Latina, 1ª. Edición, Buenos Aires, Piados, pp. 305-336.
2003 Democracia, Desarrollo Humano y Derechos Humanos. En: Guillermo O´Donnell, Osvaldo
Iazzetta y Jorge Vargas Cullell (comp.), Democracia, Desarrollo Humano y Ciudadanía,
5HÁH[LRQHVVREUHOD&DOLGDGGHOD'HPRFUDFLDHQ$PpULFD/DWLQD, 1ª. Edición, Rosario: Homo
Sapiens, pp. 25-147.
3DQÀFKL$OGR (GLWRU 
2002 Sociedad Civil, Esfera Política y Democratización en América Latina: Andes y Cono Sur. Lima:
Fondo Editorial PUCP-FCE.
Paredes, Carlos.
2004 Introducción. Lineamientos para el Desarrollo del Mercado interno en base al progreso de la pequeña
producción campesina. Cusco: FDC, La Escalera del Progreso.
Pateman, Carole.
1970 3DUWLFLSDWLRQ DQG 'HPRFUDWLF 7KHRU\ Cambridge, New York, Melbourne: Cambridge
University Press, 1970.
Pinzas, Alicia.
2001 Jerarquías de Género en el mundo rural. Lima: CMP Flora Tristan.
Ramírez Augusto y Oscar Butteler.
2003 Proceso de Formulación del Presupuesto Participativo 2004, Curahuasi. Informe Final. Julio.
Red Perú.
2001 IV Encuentro Nacional de la Red Perú: Descentralización, concertación y democracia participativa.
Lima: Red Perú. 169 pp.
2002 V Encuentro Nacional de la Red Perú: Construyendo la Gobernabilidad Democrática desde los espacios
regionales y locales. Lima: Red Perú. 105pp
2003 Crisis de Gobernabilidad y descentralización democrática. Boletín 9. Lima: Red Perú. Red de
Municipalidades Rurales del Perú (REMURPE)
2003 II Encuentro Nacional de la Red de Municipalidades Rurales del Perú. Lima: DFID. 22pp.
Remy, Maria Isabel.
2003 Los Múltiples campos de la participación ciudadana en el Perú. Un reconocimiento del terreno y algunas
UHÁH[LRQHV%RUUDGRU, 78 pp.

99
Juan Arroyo y Marina Irigoyen

Rojas Maritza.
2004 Informe Final Proceso de Presupuesto Participativo, Curahuasi. Junio.
Ruíz Rosales, Maximiliano
1999 La Concertación para el Desarrollo Local y Regional en Piura. En: ONG, Concertación y
Desarrollo Local, Lima: CEPES, ALOP.
2002 3URSXHVWDV PHWRGROyJLFD FyPR JHQHUDU SURFHVRV GH SODQLÀFDFLyQ \ JHVWLyQ PXQLFLSDO FRQFHUWDGD SDUD
promover el desarrollo local. Piura: CIPCA, EED, GTZ. 92pp.
Sartori, , Giovanni.
1992 (OHPHQWRVGH7HRUtD3ROtWLFD. Madrid: Alianza Editorial.
Távara, Gerardo
1999 Concertación y gobierno local. La mesa de concertación de la provincia de Huanta. Lima: SER
Tanaka, Martín (Compilador)
1999 El poder visto desde abajo. Democracia, educación y ciudadanía en espacios locales. Lima: Instituto de
Estudios Peruanos, 330 pp.
1999 La participación social y política de los pobladores populares urbanos: ¿Del movimientismo a una política de
ciudadanos? El caso de El Agustino. Lima: IEP, Documento de Trabajo N° 100, 39 pp.
2001 3DUWLFLSDFLyQSRSXODUHQSROtWLFDVVRFLDOHV&XDQGRSXHGHVHUGHPRFUiWLFD\HÀFLHQWH\FXDQGRWRGROR
contrario. Lima: Instituto de Estudios Peruanos. Colección mínima N° 44, 78 pp.
Tanaka Martín y Patricia Zárate.
2000 Valores Democráticos y Participación Ciudadana en el Perú. Lima: Instituto de Estudios
Peruanos.
Tocón Armas, Carmen.
1999 Entre ollas y cucharones: Movimiento social o movimiento de base?. Chimbote: Asociación la Casa
de la Mujer. 200pp.
Tumi Quispe, Jesús.
2004 %DODQFHGHH[SHULHQFLDVGHSODQHVFRQFHUWDGRV\SUHVXSXHVWRVSDUWLFLSDWLYRV. Revista Concertando N°
5, Marzo, pp. 24–30.
Urrutia, Jaime.
2001 Pueblos, Villas y ciudades intermedias. Gobiernos locales, procesos y dinámicas de descentralización y
articulación de los espacios. En: SEPIA IX, ponencia de balance “Espacio, Poder y Mercado:
Preguntas actuales para una vieja agenda”. Puno: CARE, SEPIA. 2-33pp.
Varillas, Walter
2004 Propuesta de Sistema Político Local para la Participación y la Concertación. Documento de Trabajo.
Lima: Centro IDEAS-Red Perú, abril.
Vigil, Nila; Roberto Zariquiey (editores).
2003 Ciudadanías inconclusas. El ejercicio de los derechos en sociedades asimétricas /LPD 3RQWLÀFLD
Universidad Católica del Perú, CTZ.
Zárate Ardela, Patricia.
2002 3HUFHSFLyQ FLXGDGDQD VREUH HO SURFHVR GH GHVFHQWUDOL]DFLyQ GHO HVWDGR XQD DSUR[LPDFLyQ FXDOLWDWLYD.
Lima: Instituto de Estudios Peruanos. 45pp.
Zevallos Aguilar, Emma.
2001 ¿La Política? Percepciones y conductas políticas en mujeres y varones rurales. Lima: CEDEP.

100
SEGUNDA PARTE

Estudios de Casos:
Desafíos de la Democracia
Participativa Local en la
Descentralización

Juan Arroyo
Marina Irigoyen
.
AZÁNGARO:
La inclusión descentralizada
de la población
Juan Arroyo y Marina Irigoyen

AZÁNGARO:
La inclusión descentralizada de la población

1. Características generales del ámbito


La provincia de Azángaro está localizada en la zona noreste del departamento de
Puno. Posee una extensión de 6,446.85 km2 y cuenta con una población de 151, 843, de
la cual el 80% es rural.1$]iQJDURFRPSUHQGHGLVWULWRVGHORVFXDOHVORVTXHWLHQHQ
PD\RUHVtQGLFHGHSREUH]DVRQ6DQ-XDQGH6DOLQDV6DQWLDJRGH3XSXMD\0XxDQL

La principal actividad productiva es la agropecuaria. La población se dedica a


ODFUtDGHYDFXQRVRYLQRV\FDPpOLGRV\DODSURGXFFLyQGHODQDÀEUD\SLHOHVD
DFWLYLGDGHVGHWUDQVIRUPDFLyQFRPRORVTXHVRVODSDVWHXUL]DFLyQGHOHFKHKDULQD
FKDORQD\FKDUTXL2 La comercialización de su producción se destina a las ciudades
GH&XVFR$UHTXLSD\/LPD

Sustentan la producción agropecuaria los productores de subsistencia ubicados


HQ ODV FRPXQLGDGHV SHTXHxRV \ PHGLDQRV SURSLHWDULRV XQ UHGXFLGR QXPHUR GH
grandes productores y algunas empresas asociativas (SAIS y CAPs). La producción de
DUWHVDQtDV\GHULYDGRVGHODOHFKH\JUDQRVHVOOHYDGDDFDERSRUSHTXHxDV\PHGLDQDV
organizaciones del casco urbano.

2. Proceso social local y/o regional


2.1 Periodización e hitos claves
‡ (O *RELHUQR GHO DOFDOGH 7HyÀOR 0D\WD 4XLVSH FRPSUHQGLy  SHUtRGRV
consecutivos desde 1994 hasta el 2002. Terminó completamente desgastado
\ GHMy XQD JUDQ GHVFRQÀDQ]D HQ OD SREODFLyQ UHVSHFWR D ODV DXWRULGDGHV
PXQLFLSDOHVORTXHVHH[SUHVyHQORVSULPHURVPHVHVGHODQXHYDJHVWLyQ
municipal instalada el 2003.

___________________________________________________
1 Municipalidad Provincial de Azángaro. Azángaro al 2010. Plan de Desarrollo Concertado. Puno: 2003.
2 Choquehuanca Jesús. Resumen del Plan de Desarrollo Concertado de Azángaro. II Encuentro de Mesas de Concertación
Interinstitucionales de Puno, CARE Perú, 2001, Puno.

98
Desafíos de la Democracia Participativa Local en la Descentralización

‡ (Q HO DxR  VH IRUPy HQ OD SURYLQFLD GH $]iQJDUR XQD 0HVD GH
Concertación Interinstitucional (MCI), bajo el impulso de CARE Perú,
TXH YHQtD SURPRYLHQGR 0&, HQ ODV ]RQDV GH WUDEDMR GH VX SUR\HFWR
FOGEL. En esta Mesa la representación municipal la tenía el hermano
GHO DOFDOGH TXH HUD IXQFLRQDULR PXQLFLSDO SRU HO IXHUWH DQWDJRQLVPR
con el alcalde. Entonces se empezó a elaborar el Plan de Desarrollo
Concertado.

‡ (QHODxRFRQODQXHYDJHVWLyQGHODFWXDODOFDOGH3HUF\&KRTXHVHDEULy
la participación de manera general, reimpulsando la MCI y descentralizando
los espacios de participación a toda la provincia. Se implementaron así mesas
urbanas y rurales, se actualizó el Plan, impulsó el presupuesto participativo
y la instalación del CCL, entre otros.

2.2 Hechos relevantes dentro de cada período


La instalación de la Mesa de Concertación el 2000 tuvo como objetivo
fundamental, según los actores del proceso, “contribuir en la reconstrucción del
tejido social...superar la debilidad e inestabilidad institucional...y dotar a Azángaro
de una visión compartida de futuro”.3 El resultado de este primer esfuerzo fue la
elaboración del Plan de Desarrollo Concertado de la provincia, titulado “Azángaro
al 2001”, bajo el auspicio de CARE Perú.

(O DxR VLJXLHQWH OD 0HVD SURFHVy OD UHFRPSRVLFLyQ GH VX &RPLWp (MHFXWLYR
debido al cambio de autoridades sectoriales y a la renovación de directivas de las
RUJDQL]DFLRQHVVRFLDOHV\SURGXFWLYDV+XERXQQXHYRLPSXOVRUHÁHMDGRHQHOWUDEDMR
activo de los comités de gestión de la mesa, formados por ejes del plan, como los de
'HVDUUROOR9LDO\&RPHUFLDO\0HMRUDPLHQWRGHOD6DOXGTXHHODERUDURQVXVSODQHV
de acción, agenda de trabajos y proyectos.

En el proceso electoral del 2002 la sociedad civil de Azángaro impulsó la política


GH$FXHUGRVGH*REHUQDELOLGDG/RFDOHVHVWRHVODE~VTXHGDGHOFRPSURPLVRGH
los candidatos al Plan concertado, al cual se adhirieron con su rúbrica todos los
candidatos a la alcaldía.

___________________________________________________
3 Mayta, T., Cruz, G. y Castillo J. Implementación del Plan Estratégico e inicio de la gestión concertada del desarrollo de Azángaro.
CONCERTANDO, revista de la Red de MCI de Puno, N° 3, Care Perú, Puno, 2001.

99
Juan Arroyo y Marina Irigoyen

(QODVHOHFFLRQHVGHÀQHVGHOHOSURIHVRU3HUF\&KRTXHGHODVÀODVGHO
Partido Democrático Regional PDR, ganó la alcaldía de Azángaro. Su triunfo fue
OXHJRGHXQUHxLGRSURFHVRHOHFWRUDO VHHVSHUyFDVLXQPHVSDUDGHÀQLUDOJDQDGRU 
6XOLVWDJDQyDQLYHOSURYLQFLDOSHURQRDQLYHOGHORVGLVWULWRVSRUORTXHHOHVFHQDULR
previsible a inicios del 2003 era de pronóstico difícil. La nueva gestión decidió impulsar
una política amplia con todos los ex candidatos y fuerzas políticas de la provincia,
con lo cual se logró un gobierno municipal no sólo participativo con la población
VLQRGHIUHQWHDPSOLR(VDVtTXHODJHVWLyQORJUyLQWHJUDUDDOFDOGHVGLVWULWDOHVGH
la provincia en la nueva política de concertación, empezándose a trabajar desde el
LQLFLRFRRUGLQDGDPHQWHFRQ&KRTXHFXPSOLHQGRORHVWLSXODGRHQORVDFXHUGRVGH
gobernabilidad local.

(QWUHWRGRVKDQORJUDGRFRQYHUWLUDOJRELHUQRSURYLQFLDOHQHVWRVGRVDxRVHQ
XQUHIHUHQWHGHEXHQJRELHUQRHQODUHJLyQGHORTXHGDIpODFRQWtQXDDVLVWHQFLD
GHIXQFLRQDULRVDOFDOGHV\UHJLGRUHVGHGLIHUHQWHVGLVWULWRV\SURYLQFLDVSXQHxDVD
pasantías, talleres y demás actividades promovidas por la provincia.

&DEHVLQHPEDUJRUHOLHYDUTXHODVFRVDVQRKDQVLGRIiFLOHVHQ$]iQJDURSDUD
OD QXHYD JHVWLyQ /D SREODFLyQ WHQtD XQD SURIXQGD GHVFRQÀDQ]D UHVSHFWR D ODV
DXWRULGDGHVPXQLFLSDOHVDOLQVWDODUVHHODOFDOGH3HUF\&KRTXHDOSXQWRTXHHQORV
SULPHURVPHVHVGHODxRODVUHXQLRQHVGHOD0HVDGH&RQFHUWDFLyQFXHVWLRQDEDQ
al nuevo alcalde, previendo continuaría la pésima relación con la población e
irregularidades del anterior alcalde. Sólo luego de esta primera fase la municipalidad
ORJUyHOOLGHUD]JRGHOD0&,+D\TXHDFRUGDUVHDGHPiVGHTXH$]iQJDURIXHHO
SULQFLSDOFHQWURGHDVHQWDPLHQWRGH6HQGHUR/XPLQRVRHQODUHJLyQORTXHKDGHMDGR
VHFXHODVGHPXFKDGHVFRQÀDQ]D

Por eso, cuando en abril del 2004 - en plena crisis de gobernabilidad regional
con los sucesos de Ilave y la toma de la municipalidad en Ayaviri - se realizó un paro
de 48 horas contra la gestión municipal de Azángaro, acción promovida por un grupo
de opositores aliados a la gestión del gobierno regional, se pudo resolver la tensión
utilizando las instancias de democracia participativa para el diálogo de la autoridad
PXQLFLSDOFRQORVVHFWRUHVHQFRQÁLFWR\HODUULERDVROXFLRQHV

Un elemento innovador en la gestión participativa actual de Azángaro viene


siendo el soporte a la gestión participativa. Se le ha dado valor al tema de la facilitación,
contratándose facilitadores permanentes para los espacios de concertación, para el
proceso de Presupuesto Participativo (PP) y para la atención a los procesos en los
distritos. Esta acción luego fue imitada por los distritos y otras provincias.

100
Desafíos de la Democracia Participativa Local en la Descentralización

Los primeros 6 meses de gobierno fueron de capacitación y de preparación


de las acciones futuras. Según un ex funcionario municipal y ahora facilitador local,
“tratamos de hacer una gestión totalmente diferente a la dejada por el cholo Mayta;
WRPDPRVODGHFLVLyQGHUHGXFLUHOH[RUELWDQWHSHUVRQDOTXHH[LVWtDTXHHUDXQDUHG
GHFOLHQWHODDVLPLVPRSODQLÀFDPRVQXHVWURVUHODFLRQHVFRQRWUDVLQVWLWXFLRQHVFRPR
CARE, RED PERU, Caritas, para fortalecer el desarrollo de capacidades y promover
la institucionalidad de la MCI.”

&KRTXHUHLPSXOVyWRGRHOSURFHVRGHFRQFHUWDFLyQ\SDUWLFLSDFLyQFLXGDGDQD
DFWXDOL]y HO SODQ GH GHVDUUROOR FRQFHUWDGR DxDGLHQGR  HMHV HVWUDWpJLFRV D ORV 
existentes; descentralizó la mesa de concertación generando espacios de diálogo y
consulta a nivel de calles, barrios, caseríos y micro cuencas; e implementó de manera
creativa el Consejo de Coordinación Local (CCL), en forma coordinada con la MCI,
SDUDHYLWDUODGXSOLFLGDG\GLVSHUVLyQTXHVHREVHUYDHQRWURVHVFHQDULRV

En estos momentos es una preocupación central el desarrollo de capacidades


para la trasferencia de competencias y recursos producto de la descentralización.

2.3 Actores claves del proceso actual


‡ $OFDOGH3HUF\&KRTXH
• Proyecto Fortalece (MIMDES)
• Red de MCI de Huancané, Melgar y Azángaro.
• Federación Provincial Campesina
• Foncodes
•· Cáritas
• Care Perú.
• SER
• Red Perú
• PRISMA

2.4 Logros y limitaciones


Los ejes de la actual gestión son tres: transparencia, participación y
producción.

Un objetivo central del gobierno local es el desarrollo económico local, a trabajar


con las organizaciones sociales y el apoyo del Estado, las ONGs y la cooperación.

101
Juan Arroyo y Marina Irigoyen

/DSDUWLFLSDFLyQWLHQHXQHQIRTXHLQVWUXPHQWDOSHURWDPELpQGHHPSRGHUDPLHQWR
Con el interés de llegar a la población más vulnerable se han formado espacios deliberativos
por micro cuencas, buscando acercarse a la población y articularse a sus necesidades.

La apertura descentralizada de la MCI ha promovido la participación masiva de


ODVRUJDQL]DFLRQHVSUHVHQWHVHQODSURYLQFLD/DPHVDVHRUJDQL]DHQIRUPDDUERULÀFDGD
en zonas urbanas y rurales; por barrios y por micro cuencas. La participación además
está articulada a las necesidades de los actores, se trabaja con los productores en
el mejoramiento de sus pastos y ganados y en la producción de sus derivados; con
los barrios se ha trabajado necesidades básicas como la implementación de un
VLVWHPDGHGHVDJHHQHOFDVFRXUEDQRTXHIXHÀQDQFLDGRHQWUHODSURSLDSREODFLyQ
y la municipalidad. Estos espacios dinámicos son el soporte organizacional del
presupuesto participativo.

'HRWURODGRVHKDFDPELDGRHOHQIRTXHGHLQYHUVLyQHQ´FHPHQWRµSRUHOGH
“desarrollo humano”. Muchos líderes asumen este nuevo discurso apelando a la
YLVLyQGHODUJRSOD]RDFRUGDGDTXHLQWHJUDHOFXLGDGRGHOPHGLRDPELHQWHVDOXG
educación y el desarrollo económico local.

2WURDVSHFWRLPSRUWDQWHWLHQHTXHYHUFRQODLPSRUWDQFLDGDGDDODFRQVWLWXFLyQ
y funcionamiento del CCL provincial. La municipalidad ha dotado de oficina
\GH XQ VHFUHWDULR WpFQLFR SDUD HO IXQFLRQDPLHQWR GHO &&/ 3URPRYLy TXH HVWH
HVSDFLRFRRUGLQDUDHOSURFHVRGH33\HQUHDOLGDGHQHVWHXOWLPRDxRHO
&&/WXYRPDVSURWDJRQLVPRTXHOD0&,3URGXFWRGHHVWHSURFHVRDÀQHVGHDxR
se han constituido los comités de gestión de desarrollo territorial por microcuencas
\GHOiUHDXUEDQDFRPRLQVWDQFLDVYLQFXODGDDO&&/\0&,HQFDUJDGRVGHSODQLÀFDU
gestionar y vigilar los avances del plan de desarrollo y el PP. Han sido reconocidas
\UHJODPHQWDGDVPHGLDQWHRUGHQDQ]D(DOFDOGHLQIRUPDTXHHO&&/DFW~DGHPiV
facilitando los procesos de la MCI.

Por último, está en curso la preocupación por el desarrollo de capacidades, en la


E~VTXHGDGHOVRVWHQLPLHQWRGHORVSURFHVRV/RVIDFLOLWDGRUHVORFDOHVMyYHQHVSURIHVLRQDOHV
VHJ~Q HO DOFDOGH &KRTXH ´KDQ FDSDFLWDGR D OD PD\RUtD GH ORV GLVWULWRV GH $]iQJDUR
tanto a regidores, funcionarios municipales como a los propios alcaldes y líderes de las
RUJDQL]DFLRQHVVRFLDOHVµ0DVD~QDxDGH´ODGHPDQGDGHQXHVWUDUHGGHIDFLOLWDGRUHV
ya no sólo proviene de la propia provincia, sino de las provincias vecinas fuera de Puno”.
2WURVHQWUHYLVWDGRVQRVRQWDQDÀUPDWLYRVFRPRHODOFDOGH´(VXQSURFHVRLQLFLDO\ORV
facilitadores necesitan mayor capacitación si desean fortalecer la descentralización en
Azángaro”, comenta un promotor de una ONG muy activa en la localidad.

102
Desafíos de la Democracia Participativa Local en la Descentralización

3. La situación actual
3.1 Condiciones socio-organizativas de la sociedad civil
Luego del largo período de violencia política de los 80, las organizaciones
sociales entraron en honda crisis en Azángaro, en especial el movimiento campesino.
“Sendero Luminoso tuvo una base importante en Azángaro desde 1986 hasta 1992,
TXH GHVWUR]y WRGD OD RUJDQL]DFLyQ VRFLDO HQ 3XQR FRQIURQWDQGR D OD L]TXLHUGD \
polarizando a la sociedad”, explica un líder local.

Si bien es cierto la participación y concertación son política del gobierno local,


todavía persiste el rastro del comportamiento social irruptivo, sólo denunciativo,
capaz de usar sus energías para manifestar su cólera pero no para construir soluciones.
Como nos dice el mismo líder, “Esta escuela de Sendero tiene sus herederos en la
práctica política de confrontación, repiten el mismo discurso. Para ellos no existe la
concertación ni el diálogo con las instituciones, estos mecanismos son sólo parte de
sus estrategias, asistir a cabildos, al presupuesto participativo, a las audiencias, etc.;
son sólo tribunas para denunciar a la autoridad corrupta.”

Al parecer, conforme a los entrevistados, las organizaciones donde existe mayor


GLÀFXOWDGSDUDFRQFHUWDU\DUWLFXODUSURSXHVWDVHVWiQHQHOFDVFRXUEDQR\HQSDUWH
GHOPDJLVWHULR'HRWURODGRODVRUJDQL]DFLRQHVTXHKDQHQWUDGRFRQPD\RUYLJRU
a los procesos de concertación y participación se encuentran en el campo, en los
productores. En Azángaro urbano hay organizaciones clásicas como el Vaso de Leche,
clubes de madres, padres de familia, etc. Y en el campo, comuneros, productores y
regantes.

3.2 Apertura democrática del gobierno local


(Q HO DxR  VH LPSOHPHQWy HQ OD SURYLQFLD GH $]iQJDUR OD 0HVD GH
Concertación Interinstitucional (MCI), promovida por Care Perú. Debido al rechazo
JHQHUDOGHODOFDOGHSRUSDUWHGHODVRUJDQL]DFLRQHVVRFLDOHVHVWDLQVWDQFLDWXYRTXH
VHUSUHVLGLGDSRUHOKHUPDQRGHODFDOGHTXHDODYH]HUDIXQFLRQDULRPXQLFLSDOFRPR
UHVHxDPRV

El trabajo de la Mesa estaba articulado a la implementación del plan de desarrollo,


SRUORTXHWHQtDFRPLWpVGHJHVWLyQRJUXSRVGHWUDEDMRXQRSRUFDGDHMHGHOSODQ
El desarrollo de la concertación era por tanto a nivel temático.

103
Juan Arroyo y Marina Irigoyen

(QHOFRQODJHVWLyQGH3HUF\&KRTXHOD0&,DGTXLHUHRWUDFDUDFWHUtVWLFD
PXFKRPDVGLQiPLFD\DUERULÀFDGD(QSULPHUOXJDUVHGHVFHQWUDOL]yODPHVDHQGRV
ámbitos, urbano y rural, buscando un diálogo con la municipalidad de acuerdo a sus
QHFHVLGDGHV\GHPDQGDVHVSHFtÀFDVGHDFXHUGRDOWLSRGHHQWRUQR

Para hacer sus decisiones más democráticas se ha tratado de llegar a niveles de


base implementando los espacios a nivel de barrios en la mesa urbana y por micro
cuenca en la mesa rural. Hay 5 mesas por micro cuencas a nivel provincial y la
SDUWLFLSDFLyQYDDFRPSDxDGDGHFXUVRVGHFDSDFLWDFLyQ\DSUHQGL]DMHDSR\DGRSRU
instituciones privadas. El trabajo fundamental es el mejoramiento de sus actividades
DJURSHFXDULDV6HKDDSR\DGRHQHOÀQDQFLDPLHQWRSDUDODLPSOHPHQWDFLyQGHSDVWRV
cultivados, donde los campesinos invierten el 50% del monto total y el saldo restante
los coloca la municipalidad con ayuda de instituciones privadas. También se viene
SURPRYLHQGRODFDSDFLWDFLyQGHOiFWHRV\TXHVR

La mesa urbana articula a todos los barrios de la ciudad, organizados por mesas
TXHQRPEUDQDVXVUHSUHVHQWDQWHV\FRQIRUPDQVXMXQWDGLUHFWLYDFRPRSDUWHGHOD
mesa urbana están representadas en la MCI provincial.

(VWHQXHYRGLVHxRHVODEDVHGHOSURFHVRGHOSUHVXSXHVWRSDUWLFLSDWLYR 33 
El presupuesto participativo en Azángaro es anterior a los dispositivos legales
VREUHODPDWHULD'HVGHHODxRVHKDLPSXOVDGRHVWHSURFHVRVXVFLWDQGRHO
LQWHUpV GH OD JHQWH ORJUDQGR HO DxR  OD LQFOXVLyQ GH PRQWRV QR VyOR GH OD
municipalidad sino de instituciones privadas y de la propia población. En efecto,
los vecinos del casco urbano han aportado 150 nuevos soles cada uno -además de
ODPDQRGHREUDSDUDODFRQVWUXFFLyQGHOVLVWHPDGHGHVDJHTXHDQWHVVyORFXEUtD
el 10% de los hogares.

Se ha instalado en el 2004 el Consejo de Coordinación Local (CCL), pero se está


tratando de implementar en coordinación con la estructura de la MCI, cumpliendo
con la norma pero tratando de evitar la duplicidad. En palabras del alcalde Percy
&KRTXH´HO&&/DFRPSDxDFDSDFLWDIDFLOLWDUHYLVDGRFXPHQWRVWUDEDMDFRQODJHQWH
HVXQEUD]RPiV\ÀQDOPHQWHIRUPDOL]DORVDFXHUGRVµ$FXHUGRVGHSRUVtYLQFXODQWHV
Los representantes del CCL, como se dijo, cuentan con un local, computadoras y
logística para sus actividades.

El proceso de elección para instalar el CCL convocó a 260 organizaciones sociales,


ÁH[LELOL]iQGRVHORVUHTXLVLWRVOHJDOHVSDUDODLQVFULSFLyQGHODVPLVPDV$~QDVtGHELGR
a su reciente instalación, no se percibe claramente cuál es su verdadero rol y el tipo
de relación con la MCI. Según el alcalde, el CCL formaliza lo visto por la Mesa. Para

104
Desafíos de la Democracia Participativa Local en la Descentralización

algunos facilitadores de ONGs los miembros del CCL “hasta el momento no están
DUWLFXODGRVDOD0&,\DTXHSDUWLFLSDQGHQWURGHHOODFRPRXQDJHQWHSDUWLFLSDQWHPiV
y a veces tanto el CCL como la MCI convocan a reuniones por separado”.

3.3 Nivel de participación de la sociedad civil


Las organizaciones sociales participan en la MCI, en las mesas urbanas y rurales,
en los comités de gestión de la propia mesa y en la elección de los representantes de
la sociedad civil ante el CCL.

(OGHVDUUROORGHFDSDFLGDGHVHVXQSURFHVRUHWRPDGRKR\OXHJRGHODUJRVDxRV
GHGHVHVWUXFWXUDFLyQGHOFDPSRSXQHxR6LELHQODPXQLFLSDOLGDGHVWiFRPSURPHWLGD
HQ HO HVIXHU]R ODV RSLQLRQHV DÀUPDQ TXH HVWH SURFHVR VH WLHQH TXH SRWHQFLDU H
institucionalizar, con estrategias claras de aprendizaje.

3.4 Efectos del proceso de concertación sobre las


organizaciones
Los efectos sobre las organizaciones empiezan a verse en la reactivación
del tejido social existente y en la democratización de las organizaciones sociales,
la renovación de sus juntas directivas de acuerdo a sus normas y el refuerzo
GHO DVRFLDFLRQLVPR GH DFXHUGR D VXV ÀQHV &RPR GLFH HO DOFDOGH &KRTXH ´ODV
organizaciones se asocian para poder vender sus productos, para ser mas
FRPSHWLWLYDV\H[SRUWDUORVEDUULRVWLHQHQTXHRUJDQL]DUVHHQWUHHOORVSDUDSRGHU
VROXFLRQDU VXV SUREOHPDV \ FRQ OD H[SHULHQFLD TXH WLHQHQ HQ FRQFHUWDU FRQ OD
municipalidad, ellos mismos democratizan sus organizaciones; ya no es el líder el
TXHDFW~DVRORVLQRTXHSLGHHODSR\R\HODSRUWHGHVXVFRPSDxHURVµ/RVSURSLRV
actores sociales son concientes de esto y trabajan insertos en los comités de gestión
del plan de desarrollo.

El proceso de descentralización participativa promueve además la generación de


liderazgos. Al existir una “oferta de involucramiento”, se hace necesaria la existencia
GHOLGHUHVTXHDVXPDQODFRQGXFFLyQGHVGHVXVRUJDQL]DFLRQHV3RFRDSRFRVHYH
emerger nuevos actores. Dice al respecto Jorge Romero, del Proyecto Fortalece,
´VHKDGHMDGRGHODGRODDFWLWXGGHO´SRUTXpYDPRVDKDFHUREUDVVLHVSDUWHGHOD
IXQFLyQGHO(VWDGRµDXQPRPHQWRGHGLiORJRFRQODDXWRULGDGSDUDODE~VTXHGD
de soluciones”. Sin embargo, esto es un proceso inicial.

105
Juan Arroyo y Marina Irigoyen

3.5 Resultados conseguidos sobre calidad de vida de la


población
)DOWD WRGDYtD DxRV GH SURPRFLyQ GHO GHVDUUROOR ORFDO SDUD TXH VH DSUHFLHQ
resultados claros sobre la calidad de vida.

/DRSLQLyQGHODJHVWLyQDFWXDOHVHYLGHQWHPHQWHRSWLPLVWDDOUHVSHFWR\RSLQDTXH
la promoción del desarrollo económico local ya ha permitido dinamizar la economía
local, y no solo de Azángaro sino de toda la región. Habría así productos como el
FKDUTXLODFKDORQDHOTXHVRODVDUWHVDQtDV\ORVWHMLGRVTXHYHQGUtDQGLQDPL]DQGR
las cadenas productivas y abriendo mercados. Igual vendría sucediendo en las zonas
XUEDQDVTXHHVWiQPHMRUDQGRODLQIUDHVWUXFWXUDGHVHUYLFLRVFRPRHOFDVRGHOVLVWHPD
de desagüe.

Pero el punto de partida es una realidad muy dura, muy difícil. “La vida rural
es muy fuerte, la mayoría de las organizaciones campesinas viven para el trabajo en
VXVWLHUUDV\ODRUJDQL]DFLyQKDSDVDGRDXQVHJXQGRSODQRµVHxDODXQIXQFLRQDULR
PXQLFLSDO/DVLWXDFLyQGHORV´QRRUJDQL]DGRVµ\GHODV´RUJDQL]DFLRQHVSHTXHxDV\
débiles” se convierten así en desafíos para la concertación pues se trata de incluirlos
social y políticamente.

3.6 Resultados conseguidos sobre el empoderamiento de la


población y en particular de las mujeres y los pobres
Azángaro están en otra ruta diferente a la de los movimientos desestructurados,
SHURQHFHVLWDWLHPSR\FDOLGDGGHJHVWLyQSDUDTXHVHYHDQVXVIUXWRV'RVDxRVHV
todavía demasiado poco para ver impactos, sí algunos efectos. La apertura democrática
de la actual gestión y la constante capacitación por parte de la red de facilitadores,
KDQKHFKRTXHODSREODFLyQQRVHD\DLQGLIHUHQWHDORVSURFHVRVSDUWLFLSDWLYRV

(VWi D~Q PiV DWUiV OD HTXLGDG GH JpQHUR HQ HVWH SURFHVR +D\ Vt GLYHUVDV
organizaciones de mujeres: de seguridad alimentaria, de artesanía y la asociación
de mujeres campesinas. Dentro de todas estas, las organizaciones de seguridad
alimentaria han tenido un inicial empoderamiento en la provincia, demostrado un
nivel de independencia de sus actividades y de incidencia a la hora de denunciar
LUUHJXODULGDGHV3HURQRVHSXHGHGHFLUWRGDYtDTXHHQHODOWLSODQRVHKD\DQYHQFLGR
viejos resortes machistas y la discriminación para con las mujeres.

106
CURAHUASI:
Construyendo un modelo
de concertación
en la capital del anís
Juan Arroyo y Marina Irigoyen

CURAHUASI:
Construyendo un modelo de concertación
en la capital del anís

1. Condiciones generales del ámbito 4

El distrito de Curahuasi se ubica en la provincia de Abancay y cuenta con


alrededor de 20 mil habitantes y 817 Km2. La pobreza comprende al 95% de su
población, estando el 62,5% en extrema pobreza. La zona es de clima templado,
SURGXFWRUD WUDGLFLRQDO \ UHFRQRFLGD PXQGLDOPHQWH FRPR FDSLWDO GHO DQtV TXH HV
comprado por acopiadores y seleccionado para exportación. La zona altoandina es
de producción pecuaria. Las principales relaciones comerciales se dan con Cusco,
SRUWHQHUPD\RUFHUFDQtD\GLQDPLVPRTXH$EDQFD\ODFDSLWDOGHOGHSDUWDPHQWR(O
distrito forma parte de la cuenca del Río Apurímac y Vilcanota.

En Curahuasi hay 43 centros poblados y la mayoría de ellos no cuentan con


servicios básicos. En la zona no se toma agua potable sino entubada. Ello incide
efectivamente en la parasitosis y la consecuente desnutrición infantil, ampliamente
H[WHQGLGD $OUHGHGRU GHO  GH ODV FRPXQLGDGHV FDUHFH GH HOHFWULÀFDFLyQ \ HO
circuito de comunicación vial es limitado; la principal carretera conduce al Cusco en
3 horas de viaje. El 28% de analfabetismo, especialmente de mujeres, es superior al
promedio nacional y regional. Se accede a cuatro emisoras radiales: Radio Agricultura,
RPP, Radio Curahuasi y Radio Andina, así como a cuatro canales de televisión; no
DVtDPSOLRVVHFWRUHVUXUDOHVDOQRWHQHUHOHFWULÀFDFLyQ(VVLJQLÀFDWLYDODSUHVHQFLD
GHLJOHVLDVHYDQJpOLFDVLQFOXVLYHH[LVWHXQDDVRFLDFLyQGH,JOHVLDVORTXHLQÁX\H
HQTXHDVXPDQFDUJRVPXQLFLSDOHV\JUHPLDOHV

La violencia política tuvo una presencia directa en la zona pero no es generalmente


tema de agenda en los diálogos y estudios locales.

___________________________________________________
4 La mayor parte de la información consignada en este acápite proviene del “Plan Estratégico de Desarrollo Curahuasi al 2010”,
Comité de Concertación Interinstitucional (CCOI), aprobado por Resolución No. 66-A-MDC, 2001.

108
Desafíos de la Democracia Participativa Local en la Descentralización

2. Proceso social local


2.1 Periodización e hitos claves
‡ 'HVGH ORV DxRV  HO $35$ H ,]TXLHUGD 8QLGD GH PDQHUD DOWHUQDGD R
continua, dirigieron el gobierno local.
• A partir de los 90, el gobierno de Fujimori privilegió la relación con las
Organizaciones Sociales (OS) en forma directa y proselitista, conllevando el
debilitamiento de la autonomía municipal y de las OS. “Antes del 2000 había
mayor presencia del Vaso de leche, Club de madres, pero las autoridades se
DJDUUDEDQGHHOODVHUDQREMHWRGHPDQLSXODFLyQµVHxDODXQDGLULJHQWHEDUULDO
‡ (O JRELHUQR PXQLFLSDO HQFDEH]DGR SRU HO DOFDOGH $XJXVWR 0RVTXHLUD
Barazorda (1999-2002) inició una gestión democratizadora constituyendo
el Comité de Concertación Interinstitucional de Curahuasi (CCOI), como
HVSDFLRLQWHULQVWLWXFLRQDOS~EOLFRSULYDGRHQ6HGLVHxy\DSUREyHO
primer Plan de Desarrollo distrital
• Desde el 2003 la actual gestión municipal retomó y potenció la
experiencia.

2.2 Hechos relevantes


‡ $ ÀQHV GH ORV  VHFWRUHV LQGHSHQGLHQWHV FHUFDQRV D ODV FRPXQLGDGHV
tomaron conocimiento de las experiencias de gobiernos locales democráticos
y participativos nacionales e internacionales y afirmaron la necesidad
GH GHPRFUDWL]DU OD JHVWLyQ KDFLHQGR XVR GH LQVWUXPHQWRV HVSHFtÀFRV H
incorporando de forma institucionalizada la participación ciudadana.

‡ %DMRODDGPLQLVWUDFLyQPXQLFLSDOGHODOFDOGH0RVTXHLUDVHGLyHOGLVHxRGHO
primer Plan de Desarrollo Estratégico del Distrito de Curahuasi al 2010,
LQLFLDGRHQPDU]RGH\TXHFXOPLQyHQHO(VWHFRQWyFRQOD
participación de las organizaciones de base e instituciones públicas y privadas,
como la Federación Distrital de Campesinos y Campesinas, comunidades
campesinas, la asociación de productores, CLAS y juntas vecinales. En
HVHFRQWH[WRVHFRQVWLWX\yHO&&2,TXHFXHQWDFRQSHUVRQHUtDMXUtGLFD\
5HJODPHQWRGHIXQFLRQDPLHQWRHOPLVPRTXHVHDGVFULELyDOD5HG3HU~GH
Iniciativas de Concertación.

109
Juan Arroyo y Marina Irigoyen

• El trabajo de las ONGs apuntaló un cierto reactivamiento de OS y la creación


de la Federación de Mujeres de Curahuasi.

• A inicios de los 2000 se creó la Mesa de Negociación del Anís, la MENA,


alentada por un proyecto de la Cooperación Suiza- PYMAGROS. pero
fracasó en su intento de convocar a los productores, priorizando el trabajo
con intermediarios. Hoy tiene una labor limitada, pero es un referente para
otros trabajos productivos.

• En noviembre del 2002 salió ganadora para el período 2003-2006 la lista


encabezada por Julio Luna Mansilla sobre otras seis fuerzas políticas (APRA,
UPP, )XHU]D 'HPRFUiWLFD 8QLGDG 1DFLRQDO /ODSDQFKLT \ 5HQDFLPLHQWR
Andino).

2.3 Actores fundadores o anteriores


‡ $QWHULRU$OFDOGH0RVTXHUD
• Federación Campesina
• ONGs como el Centro de Investigación y Capacitación Campesina (CICCA)
y Centro Bartolomé de las Casas
• Cooperación internacional: COSUDE y UNICEF

2.4 Logros y limitaciones


La gestión municipal logró la constitución y desarrollo de un primer espacio
de diálogo, el CCOI, y siete mesas de trabajo temáticas, destacando la de salud,
agricultura y de adolescentes, entre otras; igualmente se formuló el Plan de Desarrollo
(VWUDWpJLFRGHO GLVWULWR (O 3ODQFXHQWDFRQXQGHWDOODGRGLDJQyVWLFR\XQGLVHxR
GHIXWXURTXHLQFOX\HSHUÀOHVGHSUR\HFWRV6HOOHJyDHVWDEOHFHUXQDGLQiPLFDTXH
involucraba a liderazgos organizacionales y se avanzó en generar una actitud de
cambio participativa y concertadora de la población en general, como las autoridades
actuales lo reconocen.

Instituciones como UNICEF y la ONG CICCA (con el proyecto PROESA,


dedicado a la seguridad alimentaria y con un componente de gobernabilidad), dieron
XQDSR\RGHFLGLGRDOSURFHVR/RTXHVHSHUFLEHHVTXHIDOWyXQDPD\RUSURPRFLyQGH
la labor iniciada en las comunidades, y una mayor integración de la población en estos

110
Desafíos de la Democracia Participativa Local en la Descentralización

espacios y en la toma de decisiones, pues las organizaciones sociales no resultaron


VXÀFLHQWHPHQWHRUJDQL]DGDVQLIRUWDOHFLGDVHQHOSURFHVR

El trabajo de instituciones y ONGs como el Centro de Investigación y


Capacitación Campesina (CICCA), el Centro Bartolomé de las Casas y de UNICEF,
a través de proyectos relacionados con el fortalecimiento de las capacidades locales
de los actores sociales, generó cambios positivos en la actitud de la población. Pero
ODIDOWDGHH[SHULHQFLDODLQVXÀFLHQWHFRPXQLFDFLyQODIDOWDGHXQDUHGGHDFWRUHVGH
VRSRUWH\GHLQVWUXPHQWRVPiVWHFQLÀFDGRVIXHURQOLPLWDQWHVGHHVWDJHVWLyQ

3. La situación actual
3.1 Características y condiciones organizativas de la
sociedad civil
Según registros municipales, en Curahuasi hay 58 organizaciones. De ellas 43
VRQ FRPXQLGDGHV FDPSHVLQDV TXH UHSUHVHQWDQ HO   GHO WRWDO GH OD SREODFLyQ
del distrito). Hay además un Club de Madres con 140 socias, Comité de Regantes,
Asociación de Productores, Asociación de Ganaderos, Comités del Programa de Vaso
GH/HFKH TXHUHDOL]DODERUHVGHWHMLGRVKXHUWRVIUXWDOHV &RPLWpGH$XWRGHIHQVD
Clubes Deportivos, la Asociación de Mercados y ocho organizaciones de barrios.
Una organización de corte especializado es la Asociación Chacra Verde (alentada
SRU&,&&$ TXHDJUXSDDSURGXFWRUHVGHDQtV\TXHFXHQWDFRQHODSR\RGHXQD
ONG para la comercialización de sus productos.

Tienen especial reconocimiento la Federación Distrital de Campesinos (más


reivindicativa), la Asociación de Productores Agropecuarios (de corte más empresarial)
y los Comités de Vaso de Leche.

A pesar de este amplio bagaje social\TXHPXFKDVGHHVWDVRUJDQL]DFLRQHV


están reconocidas, las comunidades tienen una vida organizacional con carencias; al
LJXDOTXHHQPXFKDV]RQDVQRH[LVWHÁXLGH]GHLQIRUPDFLyQFRQODVEDVHVSRUSDUWH
GHORVGLULJHQWHV(OIXHXQDxRPiVGLQiPLFRHQWpUPLQRVGHSDUWLFLSDFLyQ\D
TXHVHSULRUL]DURQWUHVREUDVSDUDHO33ODVTXHIXHURQOOHYDGDVSRUORVSUHVLGHQWHV
de las comunidades al pleno.

111
Juan Arroyo y Marina Irigoyen

Los liderazgos están concentrados en manos de personas mayores y


JHQHUDOPHQWHYDURQHVDXQTXHVXUJHQSUR\HFWRVTXHWUDWDQGHIRUMDUQXHYRVOtGHUHV
como el CHA (Capacidades, Habilidades, Actitudes para el Desarrollo) del CICCA
\HOSURJUDPD352',5UHIHULGRDORVGHUHFKRVKXPDQRVTXHEXVFDSURPRFLRQDU
a 40 jóvenes líderes por comunidad. Las iglesias evangélicas llevan a cabo cursos
de liderazgo y en las comunidades y organizaciones de regantes empiezan a verse
nuevos dirigentes jóvenes. Al parecer muchas acciones formativas son todavía muy
centralizadas en la ciudad. Las mujeres tienen una presencia mínima en el liderazgo
de las organizaciones sociales o como autoridades (hay una teniente gobernadora
y una mujer directiva de la federación distrital). En general la elección de líderes se
KDFHSRUFRQÀDQ]D'HVWDFDQQXHYRVLQWHUHVHVGHORVSURGXFWRUHV\ODVIDPLOLDVGH
corte productivo y reivindicativo.

3.2 Apertura democrática del gobierno local


/D DFWXDO JHVWLyQ PXQLFLSDO KD OOHJDGR DO HQWHQGLPLHQWR TXH HV LPSRUWDQWH
la gestión municipal democrática TXH GD UpGLWRV SROtWLFRV \ TXH LQIOX\H
GHFLVLYDPHQWHHQODHVWDELOLGDGGHODJHVWLyQ6XDOFDOGHGRQ-XOLR&pVDU/XQDVHxDOD
´1RVSURSXVLPRVSRVWXODUDODDOFDOGtDSDUWLHQGRGHXQDQXHYDSURSXHVWDTXHVH
sustentaba en la concertación y la participación ciudadana para consolidar la nueva
JREHUQDELOLGDG$QWHVpVWDHUDHQWHQGLGDFRPRTXHHODOFDOGH\VXVUHJLGRUHVHUDQ
ORV~QLFRV´UHSUHVHQWDQWHVGHODVRFLHGDGFLYLOµ\SRUORWDQWRHOORVSODQLÀFDEDQ\
decidían el desarrollo del distrito”.5

5HFRQRFHHODOFDOGHTXHDOLQLFLRKDEtDGHVFRQÀDQ]DSRUSDUWHGHODSREODFLyQ
\SODQWHDTXHSDUDHQIUHQWDUODFRQYRFyDORV3UHVXSXHVWRV3DUWLFLSDWLYRVSDUDTXHOD
población trajera sus propuestas, no sólo los líderes sino las propias organizaciones.
De esa forma –expresa- incluso se logró neutralizar un intento de revocatoria, en
ODPHGLGDTXHODSREODFLyQFRQVWDWyTXHQRKDEtDDUJXPHQWRVSDUDSURFHGHUDVX
realización. Y enfatiza: “este estilo de trabajo, nos garantiza una mayor democracia y
relaciones cada vez más horizontales entre los ciudadanos, las autoridades y el gobierno
local, garantizando de esta manera el desarrollo sostenible de nuestro distrito, por lo
TXHODWRPDGHGHFLVLRQHVGHODVREUDV\SUR\HFWRVVHKDUiFRQODSDUWLFLSDFLyQDFWLYD
de los involucrados por priorización y consenso.”

___________________________________________________
5 Luna Mansilla, Julio. Gestión Municipal del Distrito de Curahuasi. Asumiendo con responsabilidad y aprendiendo de nuestros
aciertos y errores. Exposición del alcalde distrital Julio Luna Mansilla al Seminario Internacional “LA NUEVA RURALIDAD.
Desafíos y Propuestas.”

112
Desafíos de la Democracia Participativa Local en la Descentralización

La gestión municipal respeta y apoya el CCOI pre-existente y sus mesas de


trabajo. A la par, se ha constituido a inicios del 2004 el Consejo de Coordinación
Local, CCL, con base a una amplia difusión en comunidades, barrios y organizaciones
promoviendo la inscripción de 51 organizaciones para su representación con
base a seis segmentos de población (Comunidades campesinas, organizaciones
de mujeres, comités especiales, asociación de productores, barrios y comunidad
educativa). Actualmente el CCL tiene su Reglamento, cuenta con 30 representantes,
6 municipales y 24 de sociedad civil (80% de representantes del CCL). Con el CCL
se ha revisado y actualizado la Visión, Misión y Objetivos del Plan de Desarrollo.
Además ha participado en la aprobación del presupuesto participativo y su reglamento
GHIXQFLRQDPLHQWRYHULÀFDFLyQGHREUDV\SUR\HFWRVDVtFRPRODRUJDQL]DFLyQ\
preparación de la segunda rendición de cuentas del 2004.

La gestión propicia una ÁXLGDUHODFLyQ del CCL con el CCOI6 VHxDODQGRLQFOXVLYH


TXHHOSOHQRGHO&&/HVWDUiLQWHJUDGRSRUORVPLHPEURVGHO&RQVHMR0XQLFLSDOORV
miembros del CCOI y los consejeros elegidos por la sociedad civil. Pero hay diferentes
PLUDGDVDVXUROFRLQFLGLHQGRHQVHxDODUVXFRPSOHPHQWDUHLGDG(O&&/VHxDODXQ
regidor- actúa como una mesa central y convoca al CCOI. El director municipal ve al
&&2,FRPRXQHQWHWpFQLFR\DVHVRUGHOJRELHUQRPXQLFLSDOPLHQWUDVTXHHO&&/HV
PiVÀVFDOL]DGRU(O&&2,UHSUHVHQWDDXQDJHQHUDFLyQGHOtGHUHVVHxDOD

/DV PLUDGDV GH ORV DFWRUHV FRLQFLGHQ HQ VHxDODU TXH HQ JHQHUDO ODV PHVDV
temáticas generadas alrededor del CCOI contribuyen a sensibilizar a la población,
y evalúan el PP; destacan algunas como la de Agricultura. En el caso del CCL,
en correspondencia con su amplia representación de sociedad civil, se posibilita un
GLiORJRPiVÁXLGRSRUSDUWHGHODPXQLFLSDOLGDGFRQODSREODFLyQ6LELHQHO&&/
tiene corto tiempo ya se presentan iniciativas en el PP referidas al agua potable,
PD\RUDSR\RDFHQWURVHGXFDWLYRVXQHQIRTXHGHGHVDUUROORDVRFLDGRDODVFDGHQDV
productivas, irrigaciones, etc.

&XPSOLHQGRODQRUPDWLYLGDGPXQLFLSDOYLJHQWHHQORVGRVDxRVGHODJHVWLyQVH
ha realizado la Rendición de Cuentas coordinando con el CCL reuniones amplias.
La segunda Rendición, el 21 de setiembre del 2004, contó con una Guía orientadora
y fue difundida por la radio en directo, buscando intencionalmente cimentar la
comunicación entre autoridades y la población.7

___________________________________________________
6 El Reglamento del CCL estipula reuniones cuatro veces al año, con sesiones públicas, debiendo coordinar permanentemente con
el CCOI y presentar informes anuales documentados.
7 La Guía de Rendición de Cuentas, elaborada con el apoyo del Proyecto Fortalece, señala los pasos a seguir, relativos a la
sensibilización, convocatoria, audiencias públicas y otras orientaciones.

113
Juan Arroyo y Marina Irigoyen

El director municipal en representación de la municipalidad asiste a la Mesa de


Concertación de Lucha contra la Pobreza (MCLP) provincial; no se vio conveniente
crear esta instancia en el espacio distrital existiendo el CCOI.

/DJHVWLyQPXQLFLSDOVHxDODFRQRUJXOORTXHKDVWDODIHFKDVHKDFXPSOLGRFRQORV
pasos para alcanzar la adecuada participación de la población en todos los espacios de
toma de decisiones: presupuesto participativo 2004 y 2005 y rendiciones de cuentas a
la población 2003 y 2004. Además se ha mejorado o implementado instrumentos de
organización institucional: Manual de Organización y Funciones-MOF; Reglamento de
Organización y Funciones-ROF, Cuadro de Asignación del Personal-CAP; Actualización
del Texto Unico de Procedimientos Administrativos-TUPA; Reglamento del Comité
de Administración y Especial del Programa del Vaso de Leche, etc).

La comunicación es una práctica permanente y extendida, la radio da amplia


FREHUWXUDDODJHVWLyQ\WRGRHOHTXLSRPXQLFLSDOVHPRYLOL]DSRUHOGLVWULWRFHQWURV
poblados y busca articularse a la provincia. La Municipalidad ha desarrollado un Plan
de Comunicaciones.

Como parte de una gestión transparente, la municipalidad estimó los costos (12.100
nuevos soles) para la ejecución de las actividades y/o acciones implementadas para efectos
GHHVWRVSURFHVRVORVTXHIXHURQWRPDGRVHQFXHQWDHQHOSUHVXSXHVWRSDUWLFLSDWLYRGHO
DxRDQWHULRUFRQWDQGRDGHPiVFRQHODSRUWHGHLQVWLWXFLRQHVDOLDGDVFRPROD$VRFLDFLyQ
de Municipalidades de Abancay, UNICEF y el Proyecto Fortalece.

/DPXQLFLSDOLGDGKDLQVWDODGRXQDRÀFLQDPXQLFLSDOGHDSR\RDODSHTXHxDHPSUHVD
OD203(TXHDSR\DHQODRUJDQL]DFLyQGHORVSURGXFWRUHVDFWXDOL]DFLyQGHGRFXPHQWRV
y asesoría. Pero no hay una práctica de inversión municipal en lo productivo.

8QDGHODVHVWUDWHJLDVTXHIDYRUHFHODJHVWLyQHVODDUWLFXODFLyQDUHGHVSURYLQFLDOHV
regionales y nacionales: Asociación Provincial de Abancay (APMA); Asociación de
Municipalidades de la Región Apurímac (AMRA); Red de Municipalidades Rurales
del Perú (Remurpe); Red de Turismo Regional, Red Perú, Mesa de Concertación y
Lucha Contra la Pobreza.

3.3 Nivel de participación de la sociedad civil


En Curahuasi se da una vida organizacional media, con presencia de
LQVWDQFLDVGHEDVH\GHQLYHOLQWHUPHGLRDXQTXHODFRPXQLFDFLyQDOLQWHULRUGHODV

114
Desafíos de la Democracia Participativa Local en la Descentralización

RUJDQL]DFLRQHVQRHVWDQÁXLGD(O&&2,\VXODERUVRQUHFRQRFLGRVSRUOtGHUHV
y autoridades.

La municipalidad ha propiciado la creación de nuevas instancias como 14 comités


GHURQGDVFDPSHVLQDVHQFRPXQLGDGHVDOWRDQGLQDVFRQODÀQDOLGDGGHFRQWUROVRFLDO
GHODELJHDWRORVURERV\GHEDWLUVDQFLRQHV(OHQIRTXHPXQLFLSDOKDFRQVLGHUDGR
TXH ´HO GHVDUUROOR GHO GLVWULWR QR HV XQ SUREOHPD VyOR GH DXWRULGDGHV WpFQLFRV\
especialistas, sino también de la ciudadanía en su conjunto, donde varones y mujeres,
no importa edad, ni condición, tienen el derecho y la obligación de aportar y participar
FRQRSLQLRQHVSURSXHVWDVHLGHDVHQODGHÀQLFLyQ\SXHVWDHQPDUFKDGHORVSODQHV
y proyectos para el desarrollo del distrito.8

3.4 Efectos del proceso de concertación sobre las


organizaciones en general y de las organizaciones de
mujeres, e instituciones, y sobre el capital social
6H REVHUYDQ DYDQFHV HQ ORV QLYHOHV GH FRQÀDQ]D FRQ ODV DXWRULGDGHV  WDQWR
municipales como con instituciones religiosas y educativas. La población tiene una
PD\RUDSHUWXUDSDUDDSRUWDUHQREUDVTXHOHVIDYRUHFHDGLIHUHQFLDGHRWURVDxRVHQ
TXHSHGtDWRGRDODPXQLFLSDOLGDG(QJHQHUDOVHKDORJUDGRTXHPiVJHQWHVHLQYROXFUH
HQORVSURFHVRVGHWRPDGHGHFLVLRQHV´/DJHQWHWRPDFRQFLHQFLDTXHVLVXVOtGHUHV
vienen (a las reuniones) van a conseguir algo, van a plantear sus problemas, la autoridad
VHYDDHQWHUDUµ(VHOGHUHFKRDVHUHVFXFKDGRHOTXHVHYDLQWHUQDOL]DQGR

6HFRPHQWDTXH&XUDKXDVLHVXQGLVWULWRKRQUDGRODERULRVRVROLGDULRGRQGHVH
PDQWLHQHODVIRUPDVGHWUDEDMRFRPXQLWDULR$~QDVtDOJXQRVSHUFLEHQTXHODSROtWLFD
ha dividido a la población por buen tiempo.

3.5 Resultados conseguidos sobre la calidad de vida de la


población
$SDUWLUGHO33GHODxRVHKDFRQFRUGDGRHQREUDVFRQLQFLGHQFLDGLUHFWD
HQODFDOLGDGGHYLGD(QHODxRODPD\RUDVLJQDFLyQSUHVXSXHVWDOVHKL]RHQ

___________________________________________________
8 Ibid.

115
Juan Arroyo y Marina Irigoyen

la línea estratégica Propiciar el Desarrollo Sostenible, arribando a las siguientes


prioridades:9

• Mejora del sistema de agua potable para la ciudad, siendo el reservorio la


REUDFHQWUDOORTXHSRVLELOLWDUiODPHMRUDGHODFDOLGDGGHODJXDSRWDEOH\SRU
tanto bajar los índices de parasitosis.
‡ (OHFWULÀFDFLyQGHFRPXQLGDGHV
‡ 0HMRUD GH ODV DJXDV WHUPDOHV FRQ HO ÀQ GH EULQGDU XQ PHMRU VHUYLFLR \
complementariamente atraer turistas e ingresos.

&RQHO33SDUDHODxR10 se priorizó la construcción de aulas, la irrigación,


ODUHQRYDFLyQGHOVLVWHPDGHDJXDSRWDEOHORVHVWXGLRV\REUDVGHHOHFWULÀFDFLyQ\OD
construcción de un subsistema de aguas pluviales.

3.6 Resultados conseguidos sobre el empoderamiento de la


población, de las mujeres y de los pobres en particular
La multiplicidad de actores participantes y los roles asignados evidencia un
LQWHUpVH[SUHVRHQHOHPSRGHUDPLHQWRGHODSREODFLyQ\KD\LQGLFLRVTXHDVtVHHVWi
avanzando:

La municipalidadDFW~DFRPRHQWHTXHOLGHUDHOWUDEDMRFRQFHUWDGRORVsectores
públicos respaldan la acción e iniciativa municipal; las comunidades campesinas,
DXQTXHDOLQLFLRWXYLHURQXQDSDUWLFLSDFLyQOLPLWDGDIXHURQLQWHJUDQGRVXVSURSXHVWDV
en los presupuestos participativos. Asimismo han incidido para la conformación del
CCL y Comité de Vigilancia nombrado últimamente para aprobar el presupuesto
participativo para el 2005. Por último, las organizaciones sociales de baseparticipan
especialmente a través de representantes en el PP, con algunos líderes jóvenes y con
PHMRUFDSDFLGDGSURSRVLWLYD´1RVVHQWLPRVTXHVRPRVXQHQODFHFRQHOSXHEORVH
ORJUDTXHPiVJHQWHVHLQYROXFUHµVHxDODXQDGLULJHQWH

Las ONGs: han jugado un rol muy importante en el desarrollo local, sobre todo
en el fortalecimiento de las capacidades de los actores sociales, estando integradas al
CCOI; destacan CICCA, PRISMA y CBC.

___________________________________________________
9 Augusto Ramírez y Oscar Butteler. Proceso de Formulación del PP 2004, Curahuasi. Informe Final. Julio 2003.
10 Rojas Maritza. Informe Final del Proceso de Presupuesto Participativo Curahuasi 2005. Junio 2004.

116
Desafíos de la Democracia Participativa Local en la Descentralización

Los proyectos de desarrollo (SENASA, PRONAMACHCS, PLAN


MERISS,INADE) en un inicio estuvieron abocados al desarrollo de actividades
puntuales y cumplimiento de metas físicas sobre sus proyectos, insertándose luego al
CCOI, e integrando varias mesas de trabajo temáticas. Apuntalan la gestión municipal
y se constituyen como aliados los proyectos Fortalece y APPODER. Con ONG,
DJHQFLDVGHFRRSHUDFLyQ\SUR\HFWRVVHGDODÀUPDGHFRQYHQLRVGHFRRSHUDFLyQ11

Agencias de cooperación: Una institución de especial fuerza ha sido y es


81,&()TXHDSR\DHOGHVDUUROORGHDFWLYLGDGHVGHO&RQVHMR'LUHFWLYRGHO&&2,\
4 mesas de trabajo (Salud, Educación, Justicia y Orden Interno y Adolescente); por
otro lado, se cuenta con el apoyo de Cosude, Prisma, PAR Salud, Coopop, en acciones
de capacitación a lideres/as y autoridades rurales y urbanos según ejes temáticos.

Los medios de comunicación: OD UDGLR \ WHOHYLVLyQTXH WXYLHURQ OLPLWDGD


participación en un inicio, ahora se integran gradualmente en los procesos
SDUWLFLSDWLYRV SUHVXSXHVWRSDUWLFLSDWLYR&&/\YLVLWDVJXLDGDVSDUDODYHULÀFDFLyQ
de obras).

Los partidos y movimientos políticos: el APRA, IU, Renacimiento Andino, UPP,


Llapanchis, Fuerza Democrática y Unidad Nacional y el Movimiento Independiente
Nuevo Curahuasi, ejercen vida política activa; sin embargo, su participación en la
gestión municipal y en los procesos participativos no es relevante.

En Curahuasi se expresa un sentir de cambio progresivo en relación a la mujer,


hay más capacitación, más cultura, oposición frente al machismo. La DEMUNA

___________________________________________________
11 Se señalan los siguientes convenios:
• Convenio de Cooperación Técnica Interinstitucional entre la Municipalidad Distrital de los Olivos.
• Convenio de Cooperación Técnica Interinstitucional con el Gobierno Regional de Apurímac.
• Convenio de compromiso con el Departamento de Agroecología del INIA
• Convenio de Cooperación Técnica Interinstitucional con Grupo Voluntario Civil GVC de Italia ,el Instituto Región y Desarrollo
- IRD y el Centro de Investigación y Capacitación Campesina-CICCA
‡ &RQYHQLR0DUFRGH&RRSHUDFLyQ$FDGpPLFD&LHQWt¿FD7HFQROyJLFD&XOWXUD\'HVDUUROOR7XUtVWLFRFRQOD8QLYHUVLGDG5LFDUGR
Palma.
• Convenio de Cooperación con la Universidad Nacional de Educación “Enrique Guzmán y Valle” LA CANTUTA.
‡ &RQYHQLR,QWHULQVWLWXFLRQDOGHFRRSHUDFLyQWpFQLFD\¿QDQFLHUDFRQHO3UR\HFWR(VSHFLDO6LHUUD&HQWUR6XU
• Convenio Marco de Asistencia Técnica para el Desarrollo Local con visión empresarial a través de la implementación y
GHVDUUROORGHODVR¿FLQDVPXQLFLSDOHVGHSURPRFLyQHPSUHVDULDO±203(7FRQ)25021*3(58
‡ &RQYHQLRGH&RPRGDWRFRQOD$VRFLDFLyQ%HQp¿FD35,60$
• Convenio de Cooperación Interinstitucional con la Asociación de Municipalidades de la Región Apurimac-AMRA, Programa
de Apoyo al Redoblamiento-PAR Apurimac y la Comisión de Trabajo por lo Indocumentados-CONTRAIN Ayacucho.
• Convenio de Cooperación para ejecutar “Redes Primarias y Sub Estaciones del Distrito de Curahuasi con la Gerencia Sub
Regional de Apurimac-Electro Sur Este S.A.A
‡ &RQYHQLRHVSHFt¿FRGH&RRSHUDFLyQ,QWHULQVWLWXFLRQDOFRQHO3URJUDPD1DFLRQDOGH0DQHMRGH&XHQFDV+LGURJUi¿FDV\
Conservación de Suelos (Pronamachs)

117
Juan Arroyo y Marina Irigoyen

cumple un rol en procesar denuncias por violencia contra la mujer. La sociedad


local avanza en el reconocimiento del potencial de las mujeres por sus características
GH KRQUDGH] UHVSRQVDELOLGDG ´$KRUD HVFRJHQ D PiV PXMHUHV SLHQVDQ TXH HOODV
deben estar preparadas y tienen buenas opiniones. Los jóvenes también se están
LQFRUSRUDQGRDOOLGHUD]JRµVHxDODOD~QLFDUHJLGRUDSURYLQFLDOPXMHU8QDGLULJHQWH
EDUULDO DÀUPD TXH ´DQWHV ODV PXMHUHV HVWDEDQ VHQWDGDV HQ ODV UHXQLRQHV DKRUD
SDUWLFLSDQHQODVUHQGLFLRQHVGHFXHQWDVµ$XQTXHVRQSRFDVODVPXMHUHVMyYHQHVTXH
participan. Entre los campos de interés de las mujeres está el trabajo: “las mujeres
SLGHQPiTXLQDVSDUDWUDEDMDUELRKXHUWRVµVHxDOD/XLVDSURPRWRUDGHO9DVRGH/HFKH
/DFDUDFWHUtVWLFDGHODGHPDQGDIHPHQLQDHVXQUHTXHULPLHQWRSHURQRHVD~QXQ
proyecto. Los Clubes de Madres, por ejemplo, no llegaron a procesar sus demandas
a nivel organizacional, se mimetizaron en su barrio.

Los jóvenes tienen un acercamiento episódico pero importante en los


procesos locales; ellos participaron ampliamente en la Mesa de Trabajo de Juventud
\$GROHVFHQFLDRUJDQL]iQGRVHJUXSRVGHWHDWUR\DQLPDFLyQTXHVDOLHURQDFDPSR
a realizar labores educativas con el apoyo municipal y de UNICEF; esa labor se ha
visto interrumpida, aparentemente por falta de recursos. “Falta más énfasis en los
MyYHQHVµVHxDODXQHVWXGLDQWHGHO,QVWLWXWR7HFQROyJLFR

1R VH SHUFLEH XQ HQIRTXHH[SOtFLWR GH OXFKD FRQWUD OD SREUH]D DXQTXHKD\
GLYHUVDVDFFLRQHVPXQLFLSDOHVHQODVREUDVDSUREDGDVHQHO33TXHDSXQWDQDHQIUHQWDU
la pobreza, especialmente las referidas a mejoramiento de infraestructura educativa
y de agua potable.

118
Desafíos de la Democracia Participativa Local en la Descentralización

HUACCANA:
Piloto del Presupuesto
Participativo rural

119
Juan Arroyo y Marina Irigoyen

HUACCANA:
Piloto del Presupuesto Participativo rural

1. Características generales del ámbito


6LWXDFLyQGHPRJUiÀFD El distrito de Huaccana tiene 11,454 habitantes de los
cuales el 5.6 % es urbano y el 94.4% es rural. Al 2001 había 5,866 varones y 6,035,486
mujeres. Huaccana se encuentra ubicado al noroeste de la provincia de Chincheros,
región Apurimac. Esta dividida en 7 zonas: 6 rurales (Alaypampa, Toccso-Sauri,
Maramara, Pumachuco, Río Blanco, Ahuayro); y 1 zona urbana: Anori. Huaccana
tiene tres pisos ecológicos marcados, puna, zona interandina, valle.12

Actividades económicas.- Las principales actividades económicas son la


agricultura y ganadería. Algunos de los productos predominantes en el distrito son:
WULJRIUHMROSDSDIUXWDOHVFRPRODWXQDQDUDQMDPDQJRVSDOWD\ODFDxDGHD]~FDU(Q
cuanto a la ganadería, la producción se centra en los vacunos criollos, ovinos porcinos
\HTXLQRV7LHQHXQDSHTXHxDDJURLQGXVWULDSDUDODWUDQVIRUPDFLyQGHODFDxDGHD]~FDU
HQFDxD]RDJXDUGLHQWH(OGHOD3($VHGHGLFDDDFWLYLGDGHVDJURSHFXDULDV

2. Proceso social local y/o regional


2.1 Periodización e hitos claves
‡ (QHOVHLQLFLRHOSURFHVRGHSODQLÀFDFLyQFRQFHUWDGDHLPSOHPHQWDFLyQ
del Plan de Desarrollo.
• El 16 de octubre del 2001 se instaló el Comité de Desarrollo Distrital, órgano
consultivo de la municipalidad para la formulación y ejecución del plan de
desarrollo distrital.
‡ (QHODxRFRQHODSR\RGHODOFDOGH1LOR1DMDUUR&$5(3HU~DSR\y
directamente al distrito en la formulación del Presupuesto Participativo.
• En el 2003 el alcalde electo Roberto Medina retomó los procesos participativos
profundizando aun más el Presupuesto Participativo.

___________________________________________________
 +LQRMRVD*XDGDOXSH6XPDQGRHVIXHU]RV3HU¿OSDUDHOFDVR+XDFFDQD'RFXPHQWRQRSXEOLFDGR

120
Desafíos de la Democracia Participativa Local en la Descentralización

‡ (Q HO  VH SUHVHQWDURQ DOJXQDV GLÀFXOWDGHV HQ HO 33 UHIHULGDV D OD
atomización del gasto distrital entre las mesas zonales.

2.2 Hechos relevantes


'HVGHHODxRHOSURFHVRGHFRQFHUWDFLyQKDVLGRSURPRYLGRSRUDFWRUHV
externos. Los antecedentes se encuentran en la capacitación realizada por CARE
Perú a través de su proyecto FOGEL a los funcionarios de la municipalidad y lideres
locales del distrito.

(QHODxRVHLQVWDOyOD0HVDGH&RQFHUWDFLyQSDUDLPSOHPHQWDUHO3ODQ
GH'HVDUUROORIRUPXODGRHQHO(OGLVHxRGHOD0HVDHVDUERULÀFDGR\H[LVWH
XQDSRUFDGD]RQDGHOGLVWULWRORTXHVHKDWHUPLQDGRH[SUHVDQGRHQODVHOHFFLyQGH
proyectos del PP:

$ ÀQHV GHO  +XDFFDQD IXH OD H[SHULHQFLD SLORWR GH OD PHWRGRORJtD GH
Presupuesto Participativo rural. Fue seleccionado por tener las tres características
TXHVHEXVFDEDQSDUDODYDOLGDFLyQGHORVLQVWUXPHQWRVGLVWULWRUXUDOSRFDGHQVLGDG
poblacional y en extrema pobreza. Este modelo de intervención ha sido replicado
HQRWUDVORFDOLGDGHVTXHWLHQHQODPLVPDFDUDFWHUtVWLFDV

En estos momentos se están promoviendo los Comités de Vigilancia Ciudadana,


tratando de generar un mayor involucramiento a la población.

2.3 Actores centrales del proceso


• Municipalidad y alcaldes distritales
‡ 0LQLVWHULR GH OD 3UHVLGHQFLD HQ HO DxR  GHVGH HO SUR\HFWR ',(6
– PRIES
• CARE PERU (asesoramiento en el presupuesto participativo)
• Consultores externos

2.4 Logros y limitaciones


/D ÀFKD FRQ HO SHUÀO GH OD H[SHULHQFLD GH +XDFFDQD VHxDOD ORV VLJXLHQWHV
logros: “lograr una visión integral de su desarrollo a partir de su plan estratégico y

121
Juan Arroyo y Marina Irigoyen

la puesta en marcha de sus proyectos a partir de la formulación de los presupuestos


participativos; Consolidación de los espacios de concertación, las mesas zonales
juegan un rol importante en la información y como nexo entre el estado y la sociedad
FLYLO6XURODFWLYRHQODYLGDGHODJHVWLyQPXQLFLSDO\ODE~VTXHGDGHOGHVDUUROORHV
permanente. Generar responsabilidad en la comunidad, pues no se trata de pedir
sino también de dar”.

El logro mas importante fue la generación de la concertación local como


política tanto de la municipalidad como de la propia población. Sin embargo aun
HVXQSURFHVRLQLFLDOTXHWDPELpQWLHQHOLPLWDFLRQHV8QDGHHOODVHVODGHSHQGHQFLD
técnica para impulsar los procesos participativos, la debilidad en la formulación y
SURGXFFLyQ GHRUGHQDQ]DV TXHDGDSWHQVXVSURFHVRVDORUHTXHULGRSRU ODOH\OD
escasez de facilitadores y cuadros de la propia localidad.

3. La situación actual
3.1 Condiciones socio-organizativas de la sociedad civil
El primer Plan de Desarrollo realizó un mapeo de las organizaciones sociales,
TXHHV~WLODOUHVSHFWR6HJ~QpOORVFOXEHVGHPDGUHVVHLQLFLDURQHQWUHHOSHULRGR
FRQODÀQDOLGDGGHWUDEDMDUORVSURJUDPDVGHOYDVRGHOHFKH\FRPHGRUHV
populares. “Existen Comités de vaso de leche, constituidos en cada centro
poblado, con el objeto de gestionar y administrar la distribución de alimentos para
ORVQLxRVPHQRUHVGHDxRV\ODV0DGUHVJHVWDQWHV\ODFWDQWHVµ13 Los comedores
populares son ocho: Micaela Bastidas de Huaccana, Santa Rosa de Huarapari, Santa
Isabel de Mara Mara, Virgen del Rosario de Pumachuco, Virgen de la Concepción
de Huallhua, Virgen de Cocharcas de Maucallacta, Rosa Merino de Cabracancha,
C.I. las Estrellidas de Huaccana, C.I. Los Angelitos de Cuchucusma. Se informa de
la presencia de problemas de democratización de las directivas en algunos de estas
organizaciones.

Existen además, como organizaciones sociales de base, la Asociación Distrital de


Mujeres, representada por Sonia Allende Caspedes; el Comité Distrital de Seguridad
Ciudadana, a cargo del jefe PNP del distrito de Huaccana, y la Asociación Civil
Anovi.14
___________________________________________________
13 Plan de Desarrollo Distrital Huaccana al 2004.
14 Plan de Desarrollo, ibidem.

122
Desafíos de la Democracia Participativa Local en la Descentralización

También existen organizaciones de autodefensa como el Comité de Autodefensa


Civil Distrital (DECAS), los Comités de Autodefensa Civil Zonales y los Comités de
Autodefensa Civil Comunales (08 comunidades o anexos).

6REUHODRUJDQL]DFLyQGHORVSURGXFWRUHVHO3ODQ'LVWULWDOLQIRUPDTXH´1R
existe una base organizativa por parte de los productores; ello constituye una gran
GLÀFXOWDGSDUDGHVDUUROODUDFWLYLGDGHVFRQRULHQWDFLyQHPSUHVDULDO/DVFRPXQLGDGHV
asentadas en los pisos bajos, como Ahuayro y Río Blanco, con mayor relación con el
PHUFDGRVRQODVTXHSUHVHQWDQPHMRUHVFRQGLFLRQHVGHRUJDQL]DFLyQ\SUHGLVSRVLFLyQ
para impulsar este tipo de organizaciones. Las ONGs, y otras instituciones como el
SENASA, coordinan con las organizaciones comunales para brindar asistencia técnica
y capacitación en temas productivos”.15

3.2 Apertura democrática del gobierno local


Según Guadalupe Hinojosa, promotora de Care y responsable en la zona,
“la situación de la población antes del proceso era el de desconocimiento de los
presupuestos del gobierno local. A pesar del acercamiento de las autoridades a la
FRPXQLGDGVLHPSUHH[LVWtDFLHUWDGHVFRQÀDQ]DVREUHODXWLOL]DFLyQGHIRQGRVSDUDOD
realización de diferentes obras comunales, por otras gestiones municipales anteriores,
HQTXHODPDOYHUVDFLyQGHIRQGRVIXHHYLGHQWH/DSRFDWUDQVSDUHQFLDGHOXVRGHORV
presupuestos públicos era notoria, así como el descontento entre las zonas mas pobres
del distrito. Existían también problemas entre la zona urbana y la rural”. Superar este
FOLPDGHGHVFRQWHQWR\GHVFRQÀDQ]DIXHXQGHVDItRSDUDORVDFWRUHVSURPRWRUHVGH
los procesos participativos.

(QHODxRVHKDEtDIRUPXODGRHO3ODQGH'HVDUUROOR´+XDFFDQDDOµ
JUDFLDVDODSR\RGHOHQWRQFHV0LQLVWHULRGHOD3UHVLGHQFLDFRQXQSUR\HFWRÀQDQFLDGR
por la Comunidad Europea. Posteriormente, a propósito de la implementación del
presupuesto participativo, el plan fue revisado y reformulado con una visión al 2012.

La Mesa de Concertación se denomina Comité de Desarrollo Distrital, la


LQVWDQFLD TXH DSUREy HO SODQ GH GHVDUUROOR FRQFHUWDGR 8QD GH VXV IXQFLRQHV HV
SUHFLVDPHQWHHOVHJXLPLHQWRHLPSOHPHQWDFLyQGHORSODQLÀFDGR/XHJRODSURSLD
GLQiPLFDORFDOKDJHQHUDGRDJHQGDVTXHODPHVDKDWHQLGRTXHDVXPLUFRQYLUWLpQGRVH
___________________________________________________
15 Plan de Desarrollo, ibidem, pp. 34-35

123
Juan Arroyo y Marina Irigoyen

HQXQDLQVWDQFLDSDUDODJREHUQDELOLGDGORFDO/D0&VHHQFXHQWUDDUERULÀFDGDGH
manera territorial, de acuerdo a la división del distrito: Anori, Tocso Suari, Maramara,
Pumachuco, Rio Blanco Ahuayro y Alaypampa. Es decir existen 7 mesas territoriales
y 1 mesa distrital

Las mesas de concertación zonales son los vínculos territoriales de la Mesa de


Concertación Distrital con la población. En estos espacios se informan los procesos
llevados a cabo por la municipalidad, se coordina con las organizaciones sociales de la
]RQDVHSODQLÀFDODSUHVHQWDFLyQGHVXVQHFHVLGDGHVHQHOSUHVXSXHVWRSDUWLFLSDWLYRVH
Informa a la población de las obras ejecutadas y por ejecutar, y de manera transversal
se promueve la participación de todos los actores de la zona. Si bien es cierto las mesas
territoriales no son propiamente mesas de concertación, pues sólo son integradas
por la población, son importantes por tratarse de asambleas de deliberación y de
formalización de los acuerdos zonales a llevar a la MC distrital.

La Mesa distrital es el espacio de cogestión, en donde todas las sugerencias


y demandas desde los territorios son asumidos y concertados. Obviamente es un
proceso vinculante de facto, gracias a demanda social movilizada y a la voluntad
política del gobierno local.

El presupuesto participativo fue un proceso promovido en sus inicios por


ODPXQLFLSDOLGDGGHOGLVWULWRFRQHODSR\RGLUHFWRGHODRÀFLQDUHJLRQDOGH&$5(
Ayacucho. De esta forma la municipalidad empezó a contar con la asistencia técnica del
consultor Carlos Grey Figueroa. Según Grey, se impulsó la experiencia de presupuesto
SDUWLFLSDWLYR HQ +XDFFDQD SDUD ´YDOLGDU XQ PRGHOR GH PHWRGRORJtD TXH KDVWD HO
PRPHQWRKDEtDVLGRHODERUDGRHQJDELQHWH\SDUDTXHIXHUDXQDH[SHULHQFLDSLORWR
insertando los parámetros exigidos por el nuevo marco normativo sobre participación
\GHO0()TXHVLUYLHUDGHUHSOLFDSDUDORFDOLGDGHVVLPLODUHVµ/DPXQLFLSDOLGDGPRVWUy
interés en la propuesta desde sus inicios.

Se menciona 4 factores fundamentales para el logro del proceso:

• Existía una mapeo de los diversos actores locales;


‡ ([LVWtD OD PHVD GH FRQFHUWDFLyQ GLVWULWDO \ DGHPiV PHVDV ]RQDOHV TXH
viabilizarían el proceso;
• La municipalidad tenía una gestión participativa y el alcalde tenía una voluntad
de liderazgo democrático
‡ ([LVWtD XQ HVTXHPD GH JREHUQDELOLGDG FRQ FRUUHDV GH GLiORJR HQWUH OD
municipalidad y el tejido social.

124
Desafíos de la Democracia Participativa Local en la Descentralización

'HPDQHUDVHQFLOODVHGHÀQLHURQDOJXQDVSDXWDVSDUDHOLQLFLRGHOSUHVXSXHVWR
SDUWLFLSDWLYRODVHJPHQWDFLyQWHUULWRULDOODGHÀQLFLyQGHOPRQWRJOREDOSDUDHOSURFHVR
ODGHÀQLFLyQGHOFULWHULRSDUDODHOHFFLyQGHORVGHOHJDGRVODDVLJQDFLyQGHOWHFKR
SUHVXSXHVWDOORVFULWHULRVSDUDODDVLJQDFLyQGHUHFXUVRVGHÀQLGDSRUODFDQWLGDGGH
SREODFLyQHQFDGD]RQD\ÀQDOPHQWHODGHÀQLFLyQGHORVFULWHULRVGHSULRUL]DFLyQ
de los proyectos de inversión.

Una de la limitaciones TXHVHSHUFLEHQKDVWDHOPRPHQWRWLHQHTXHYHUFRQOD


atomización del gasto, por los escasos recursos de la municipalidad, provenientes del
FONCOMUN, y la distribución de dicho monto entre todas las zonas. Ha habido
DVtGLÀFXOWDGHVSDUDFRQFHUWDUSUR\HFWRVGHDOFDQFHLQWHU]RQDOORTXHKDSURPRYLGR
HOFRUWRSOD]R\REUDVTXHVROREHQHÀFLDQSREODFLRQHVSHTXHxDV

6LELHQHVFLHUWRTXHHOSURFHVRHVLQLFLDO\FRQOLPLWDFLRQHV+XDFFDQDHVXQ
UHIHUHQWHHQHOSUHVXSXHVWRSDUWLFLSDWLYRSRUKDEHUVLGRSUXHEDSLORWR(QHODxR
2004 se ha avanzado en la conformación de los comités de vigilancia ciudadana de
las obras programadas en el presupuesto participativo, contándose con recursos de
la propia municipalidad para promoverlos.

3.3 Resultados sobre el empoderamiento de la población


Las organizaciones sociales han avanzado en términos de participación y
FRQFHUWDFLyQ &RPR VHxDOD +LQRMRVD ´$FWXDOPHQWH VH UHDOL]DQ UHXQLRQHV GHO
Concejo Municipal para evaluar el avance del presupuesto, a nivel de las comunidades.
/D LQIRUPDFLyQ GH ORV PRQWRV \ OD GLVWULEXFLyQ HQ FDGD ]RQD SHUPLWHQ TXH ODV
FRPXQLGDGHV EXVTXHQ RWUDV LQVWDQFLDV GH VROXFLyQ D VXV SUREOHPDV \ QR VHD
~QLFDPHQWHHOJRELHUQRORFDOTXLHQORDVXPD6HHVWiQHYLWDQGRLPSURYLVDFLRQHV\
se procura una mejor utilización de los fondos.”

125
.
Desafíos de la Democracia Participativa Local en la Descentralización

ICHOCÁN:
El tiempo pasa
y los procesos se estancan

127
Juan Arroyo y Marina Irigoyen

ICHOCAN:
El tiempo pasa y los procesos se estancan

1. Características generales del ámbito


Ichocán es un distrito rural a 20 minutos de San Marcos, capital de la provincia, y a
2 horas de Cajamarca. Cuenta con una población estimada de 3,700 habitantes, dedicada
a actividades agropecuarias como minifundistas, con una reducida actividad comercial
\XQSXHEORSHTXHxRTXHFRQFHQWUDXQPHUFDGRVHPLYDFtRXQDVFXDQWDVERGHJXLWDV
y algunas dependencias públicas, escuelas y colegios. Un 82% de la población está en
condición de pobreza y dentro de ella un 15% en extrema pobreza.

Ichocán es mencionada como una ciudad “fantasma” debido a la poca población


FRQTXHFXHQWD\SRUTXHJHQHUDOPHQWHpVWDPLJUDD&DMDPDUFDR6DQ0DUFRVHQEXVFD
de empleo o estudios y regresa episódicamente al pueblo. Un mercado construido
DxRV DWUiV \ UHPRGHODGR UHFLHQWHPHQWH FRQ GHFHQDV GH SXHVWRV VLQ DFWLYLGDG
comercial, es símbolo del abandono y letargo de este pueblo, escenario de la violencia
SROtWLFDDPHGLDGRVGHORVDxRVHQTXH6HQGHUR/XPLQRVRWRPyODVSDUWHVDOWDV
como parte de su corredor político.

2. Proceso social local


2.1 Periodización e hitos claves
• 1996: Formación del Comité de Concertación del Distrito de Ichocán.
• 1997: implementación de proyectos promovidos por APRISABAC.
• 2000-2002: Período crítico del CCI, debilitamiento, ausencia de iniciativas
• 2003: Relanzamiento del CCI con el nombre de Mesa del Desarrollo Humano
Sostenible
• 2003 y 2004: Presupuesto Participativo y Rendición de Cuentas
• 2004: implementación del Consejo de Coordinación Local.

2.2 Hechos relevantes dentro de cada periodo


El Comité nace a iniciativa del alcalde en 1996 y en respuesta a la iniciativa del
Coordinador del CINDESAM (Comité de Coordinación Interinstitucional por el

128
Desafíos de la Democracia Participativa Local en la Descentralización

Desarrollo de San Marcos), Ing. Rosseles Machuca, al inicio de la gestión municipal.


(QHVRVPRPHQWRVHOSUR\HFWR$35,6$%$&SURSLFLDEDSHTXHxRVSUR\HFWRV\)HULDV
GH3UR\HFWRVTXHFRQYRFDEDQSUHIHUHQWHPHQWHDiPELWRVTXHWXYLHUDQHVSDFLRVGH
concertación; interesado en esa perspectiva el alcalde de entonces promocionó la
formación del comité, a partir de una reunión ampliada urbano-rural para analizar los
problemas por caseríos. El referente inmediato fue el CINDESAM.16&DVLVLHWHDxRV
GHVSXpV9tFWRU=DPRUDIXQFLRQDULRPXQLFLSDOUHFXHUGDODREUDGHDJXDSRWDEOHTXH
se apoyó por ese entonces, así como la cercanía al CINDESAM, la participación en
las constantes reuniones de programación, coordinación y evaluación.

Una segunda etapa se da cuando se implementa el seguimiento a los proyectos


y se trabaja el Plan de Desarrollo Distrital. Al haber conseguido el sistema de
agua potable, la municipalidad se animó a presentarse en la Feria de Proyectos de
7HPEODGHUD&DMDPDUFDDODTXHFRQFXUULHURQPXFKDVPXQLFLSDOLGDGHVGHODUHJLyQ
algunas agencias de cooperación y entidades del estado. Pero las expectativas no
lograron satisfacerse: Ichocán no logró algún proyecto nuevo. Entró entonces una
IDVHGHGHVPRUDOL]DFLyQTXHDODODUJDFRQOOHYyDODOHMDPLHQWRGHO&,1'(6$0HQ
DOJXQRVPRPHQWRVPiVTXHRWURV\OXHJRDOGHELOLWDPLHQWRGHOSURSLR&RPLWp

2.3 Actores fundadores o anteriores


En Ichocán resalta principalmente el Alcalde distrital y el Coordinador del
CINDESAM, Ing. Rosseles Machuca como líderes del proceso. Han sido actores
participantes:

• Policía Nacional
• Posta de Salud
• Gobernación
• Hermanas de la Misericordia
• Agencia Agraria
• Delegación de los tenientes gobernadores
• Delegación de los agentes municipales
• Delegados de Educación
• Jueces

___________________________________________________
16 Irigoyen A. Marina. La concertación interinstitucional: ¿Sueño imposible o realidad en construcción? Centro IDEAS- APRISABAC.
2000. Lima.

129
Juan Arroyo y Marina Irigoyen

2.4 Logros y limitaciones


El apoyo de UNICEF y APRISABAC al inicio del proceso fue decisivo para la
IRUPDFLyQ\GHVDUUROORGHO&RPLWpHOTXHLQLFLDOPHQWHFRQYRFyDODVIXHU]DVORFDOHV
\GLIXQGLyODQRFLyQGHFRQFHUWDFLyQ$VLPLVPRVHSURPRYLyHOGLVHxRGHOSULPHU
Plan de Desarrollo concertado, con un nivel básico de participación de los actores
ORFDOHV8QDREUDWDQJLEOHTXHPHMRUyODVFRQGLFLRQHVGHYLGDGHODSREODFLyQ\DQLPy
la participación fue el sistema de agua potable del caserío de Poro Poro.

/DJUDQOLPLWDQWHGHODH[SHULHQFLDHQHVWDSULPHUDHWDSDHVTXHQRWXYROD
FDSDFLGDGGHRUJDQL]DUVH\PRYLOL]DUVHDSDUWLUGHVXVUHFXUVRVSURSLRVVLQRTXHDFWXy
en espera de la cooperación internacional: al reducirse ella el CCI se vio altamente
afectado en su trabajo paralizándose por un tiempo.

3. La situación actual
3.1 Condiciones socio-organizativas de la sociedad civil
Como otros ámbitos de Cajamarca, el distrito cuenta con pocas organizaciones
y éstas están débilmente estructuradas. Destacan las 12 Juntas de Agua Potable y
Saneamiento y los 12 Comités de Vaso de Leche. Asimismo, la Asociación de Regantes
de 3 caseríos y la Junta de Administración de Agua Potable del pueblo. Se reconoce la
H[LVWHQFLDGH5RQGDV&DPSHVLQDVTXHFRQWULEX\HQDIUHQDUHODELJHDWRHLQWHUYLHQHQ
en disputas menores de los caseríos.

La organización de productores es casi inexistente. Recientemente se ha formado


XQ&RPLWpGH3URGXFWRUDVGH9LQRSHTXHxDPLFURHPSUHVDFRQVWLWXLGDSRUPXMHUHV
TXHSURFHVDYLQRGHVDXFRHQIRUPDDUWHVDQDO\TXHORSURGXFHHQPtQLPDVFDQWLGDGHV
SRUFDUHFHUGHFDSLWDOGHWUDEDMR(OODVVHFRQIRUPDURQOXHJRGHXQDFDSDFLWDFLyQTXH
brindó un proyecto de la cooperación alemana (GTZ). De otro lado, hay productores
de tejas con proyección regional pero están desorganizados, sin vínculos establecidos
ni acciones de apoyo mutuo.

3.2 Apertura democrática del gobierno local


(O DFDOGH DFWXDO SHUWHQHFH D OD PLVPD DJUXSDFLyQ HOHFWRUDO TXH HO DOFDOGH
provincial de San Marcos, el Movimiento Independiente San Marcos, manifestando
FRQRUJXOORTXHIXHHOHJLGRFRPRFDQGLGDWRHQXQDDPSOLDUHXQLyQGHSREODGRUHV

130
Desafíos de la Democracia Participativa Local en la Descentralización

(Q HO  SULPHU DxR GH JRELHUQR PXQLFLSDO HO DOFDOGH SODQWHy OD
reestructuración del CCI constituyéndose la Mesa de Concertación por el Desarrollo
Humano de Ichocán. La Mesa tiene como Presidente al Alcalde e integran su directiva
el Gobernador, los representantes del Centro de Salud y de Educación, así como la
Asociación de Artesanos.

/D PHVD FXHQWD FRQ (VWDWXWRV DXQTXH QR HVWiQ UHJLVWUDGRV OHJDOPHQWH /D
PXQLFLSDOLGDGGHVWLQyXQDVHVRUWpFQLFRUHPXQHUDGRTXHGLQDPL]yOD0HVDSRUXQ
WLHPSRDXQTXHOXHJRGHODUHQXQFLDGHHVWHDVHVRU²SRUPRWLYRVSHUVRQDOHVGHFD\y
nuevamente; tampoco la municipalidad ha vuelto a contratar un apoyo. El alcalde
UHFRQRFHTXHHQODDFWXDOLGDGOD0HVDHVVXPDPHQWHGpELOQRKDELHQGRUHXQLRQHV
periódicas ni actividades comunes.

En Ichocán se ha constituido recientemente el Consejo de Coordinación Local


TXHVLJXLHQGRODOyJLFDSURYLQFLDOFXHQWDFRQGRVLQYLWDGRVHQUHSUHVHQWDFLyQGHO
estado: el Centro de Salud y el Ministerio de Educación. Son parte del CCL, por
la sociedad civil, la representante del Vaso de Leche, de la JASS y del Comité de
3URGXFWRUHVGH9LQR(/&&/SDUWLFLSyGHOGLVHxRGHO33FRQOD0HVDSHURQROOHYD
una vida regular.

La existencia de dos instancias de concertación, como son la Mesa de


&RQFHUWDFLyQ\HO&&/HQXQGLVWULWRSHTXHxRFRQWDQSRFDRUJDQLFLGDGLPSOLFDXQD
WHQVLyQGHIXHU]DVGLItFLOGHVRVWHQHUSRUODFDQWLGDGGHUHFXUVRVTXHHOORGHPDQGD\
SRUHOFUXFHGHIXQFLRQHVTXHFRQOOHYD(QODSUiFWLFDFRPRVHKDVHxDODGROD0HVD
GH&RQFHUWDFLyQHVWiVLQDFWLYLGDG\HO&&/D~QQRGHÀQHVXGLQiPLFD

La Municipalidad de Ichocán es partícipe de iniciativas de más amplio impacto


lideradas por la municipalidad provincial de San Marcos, como la formación de la
$VRFLDFLyQGH0XQLFLSDOLGDGHVGHO&RUUHGRU(FRQyPLFR&ULVQHMDV$0&(&TXH
FXHQWDFRQHODSR\RGHO3UR\HFWR352'(/,&$$SHVDUTXHHODOFDOGHGH,FKRFiQ
DVXPHHOFDUJRGH9RFDOHVPX\OLPLWDGDODLQIRUPDFLyQFRQTXHFXHQWDODSREODFLyQ
sobre la marcha de estas iniciativas.

Con el apoyo metodológico de la AMCEC, en el 2004 se realizó el presupuesto


SDUWLFLSDWLYR HQ ,FKRFiQ DO LJXDO TXH HQ WRGRV ORV PXQLFLSLRV PLHPEURV GH OD
asociación. Este proceso animó la participación de diversos actores, principalmente
LQVWLWXFLRQDOHV \ GH YHFLQRV GH OD SHTXHxD FLXGDG H LQFOXVLYH SDUWLFLSDURQ YDULDV
PXMHUHV D QRPEUH GHO &RPLWp GH 9DVR GH /HFKH DXQTXH QR H[SUHVDURQ DOJXQD
propuesta.

131
Juan Arroyo y Marina Irigoyen

Periódicamente se realizan las Rendiciones de Cuentas mediante Cabildo Abierto,


dos de ellos se realizaron en el 2003, uno en el 2004.

3.3 Nivel de participación de la sociedad civil


&RPRKDVLGRVHxDODGRSRUGLYHUVRVHVWXGLRVRVGH&DMDPDUFDHQODUHJLyQOD
organización es muy limitada. Así, en Ichocán son escasas las organizaciones sociales
y es limitada la calidad de su participación; los delegados, caso del Comité de Vaso
de Leche, tienen poca comunicación con sus bases en referencia a los procesos de
FRQFHUWDFLyQHQTXHHVWiQLQYROXFUDGRVWDPSRFRORVFDVHUtRVHVWiQFRPSURPHWLGRV
En la última rendición de cuentas, en setiembre del 2004, hubo mínima participación,
no más de 30 personas, estando ausentes los jóvenes y las mujeres, como en la mayoría
de actividades.

La organización más extendida, el Comité de Vaso de Leche, se reúne una vez


DODxRSDUDGHFLGLUTXpFRPSUDUODVPDGUHVGHIDPLOLDSDUWLFLSDQWHVQRUHDOL]DQXQD
evaluación de su marcha y la municipalidad no cuenta con mayores incentivos para
su desarrollo. El Tesorero Administrador, motivado por un curso sobre Gestión
6RFLDO D FDUJR GH XQD 21* PHQFLRQD TXH WLHQHQ SUR\HFWDGR XQ SURJUDPD GH
HGXFDFLyQDOLPHQWDULD\DTXHVHKDFRQVWDWDGRORVQLYHOHVGHGHVQXWULFLyQH[LVWHQWHV
\ODLPSRUWDQFLDGHUHYHUWLUORSDUDHOGHVDUUROORGHODQLxH]

/DSREODFLyQGH,FKRFiQHVPX\VHQFLOODWUDQTXLODSDFtÀFD(QHOSXHEORQDGD
KDFHUHFRUGDUTXHXQDGpFDGDDWUiV6HQGHUR/XPLQRVRFRQWURODEDODV]RQDVDOWDV
FRPRiPELWRGHGHVFDQVRTXL]iVDPSDUiQGRVHHQHVHDSDUHQWHFDUiFWHUVHQFLOORGH
ODSREODFLyQHVXQWHPDGHOTXHQDGLHFRPHQWDKR\HQGtD3HUR\DDSDUHFHFLHUWD
SUHRFXSDFLyQSRUURERVSHTXHxRVTXHKDFHQSHUGHUODFRQÀDQ]DTXHPDQLÀHVWDQVH
mantiene en el distrito, sobre todo en el ámbito rural. También en el ámbito rural se
mantiene el trabajo comunal y la solidaridad.

8QD PtQLPD RUJDQL]DFLyQ GHPRFUiWLFD VH SHUÀOD FRQ OD HOHFFLyQ GH ORV
7HQLHQWH *REHUQDGRUHV SRU FDVHUtRV ORV TXH VH UH~QHQ SHULyGLFDPHQWH SDUD
tratar asuntos de la localidad. Mayormente no se perciben líderes locales y son
YDULRVORVTXHFRPHQWDQHOGHVLQWHUpVGHODSREODFLyQTXHYLYHHQODFLXGDGSDUD
FRQ ORV SURFHVRV FRQFHUWDGRV \ TXH ODV RUJDQL]DFLRQHV VRFLDOHV H[LVWHQWHV QR
son muy dinámicas.

132
Desafíos de la Democracia Participativa Local en la Descentralización

3.4 Calidad de los productos concertados


A tenor con la realidad de municipalidades de distritos rurales, Ichocán cuenta
con mínimos recursos constituidos por el FONCOMUN (alrededor de 300 mil soles
DQXDOHV \HO&DQRQ0LQHUR FHFDGHPLODQXDOHV DORTXHGHEHQGHVFRQWDUORV
gastos corrientes y las deudas; así se tiene un presupuesto estimado de 270 mil soles
SDUDHODxR

Con ese limitado presupuesto de inversión se aprobó en el PP 2004-2005,


SHTXHxDVREUDVGHVHUYLFLRVVRFLDOHVFRPRODFRQVWUXFFLyQGHGRVFHQWURVHGXFDWLYRV
HOHTXLSDPLHQWRGHO&HQWURGH6DOXG\HOPHMRUDPLHQWRGHOVLVWHPDGHDJXDSRWDEOH
ORVTXHGHDOJXQDIRUPDLQFLGLUiQHQODPHMRUDGHFDOLGDGGHYLGDGHORVPiVSREUHV
También en Ichocán se evidencia el nuevo interés de autoridades y población por
GHVDUUROODUSHTXHxRVSUR\HFWRVSURGXFWLYRVFRPRHOGHULHJRSRUDVSHUVLyQDGHPiV
GHODFRQVWUXFFLyQGHXQDWURFKDFDUUR]DEOH/RTXHHVUHDOHVTXHODVREUDVVRQGH
PtQLPRLPSDFWRSRUHOSUHVXSXHVWRFRQTXHVHFXHQWD

3.5 Efectos del proceso de concertación sobre las


organizaciones, la mujer y las instituciones
Fruto de las relaciones de coordinación con el CINDESAM y otras instituciones,
se puede observar el surgimiento de organizaciones productivas como la de
SURGXFWRUHVGHYLQRGHVDXFRDXQTXHODHVFDODHVUHDOPHQWHOLPLWDGD6RQPHQRV
de diez asociadas, careciendo de capital de trabajo y teniendo un mínimo mercado
interno.

El proceso participativo no llega a integrar a las mujeres; el potencial


organizacional de los Comités del Vaso de Leche no es aprovechado; ellas no reciben
ningún incentivo para el desarrollo de sus capacidades.

3.6 Resultados conseguidos sobre calidad de vida de la


población
(Q,FKRFiQSDUHFLHUDTXHHOWLHPSRQRSDVDQRKD\PD\RUHVFDPELRVHQDxRV
y continúan los ciclos de migración. Si algo ha mejorado, y en ello ha incidido los
procesos de concertación, es el acceso al agua potable en diversos caseríos y en la
SHTXHxDFLXGDG<GpELOPHQWHDSDUHFHQWURFKDVFDUUR]DEOHVTXHFRQWULEX\HQDOD
integración de la población, tanto en lo social como económico.

133
Juan Arroyo y Marina Irigoyen

3.7 Resultados conseguidos sobre el empoderamiento de la


población y en particular de las mujeres y los pobres
/DVFDUDFWHUtVWLFDVRUJDQL]DFLRQDOHVGHODSREODFLyQTXHKLVWyULFDPHQWHVHKDQ
mantenido, y la debilidad del proceso, explican una población poco comprometida;
no se percibe a la población empoderada, ni hay nuevas generaciones de líderes. Más
bien hay fuerte relación, y hasta cierta dependencia, con la provincia de San Marcos
y con sus iniciativas. Las mujeres no han tenido ningún protagonismo ni se ha dado
alguna acción orientada en esta lógica; igualmente los jóvenes no han recibido mayor
atención.

Sin embargo se encuentra una noción básica de trabajo concertado en los actores
HQWUHYLVWDGRVFRQVLGHUiQGRORSRVLWLYRSDUDVXGHVDUUROORHOORVWUDVPLWHQTXHHVWR
HVFRPSDUWLGRSRUSDUWHGHODSREODFLyQDXQTXHVLQPD\RUHQWXVLDVPRHQIRUPD
SDVLYDDPHULWDQGRHOORXQWUDEDMRHVSHFtÀFRFRQODSREODFLyQGHEDVHSDUDUHYHUWLU
la situación.

134
Desafíos de la Democracia Participativa Local en la Descentralización

LA MICROCUENCA
DE JABON MAYO:
Apuntando al cambio
desde las bases

135
Juan Arroyo y Marina Irigoyen

LA MICROCUENCA DE JABON MAYO:


Apuntando al cambio desde las bases

1. Características generales del ámbito


En la microcuenca de Jabón Mayo, provincia de Canas, Cusco, se viene
desarrollando una experiencia importante de desarrollo rural desde las propias
organizaciones sociales, con réplicas en otros ámbitos de Cusco y Puno. La
microcuenca abarca los distritos de Yanaoca, Cecca, Kunturkanki, Lagui, Layo,
Pampamarca, Quehue y Tupac Amaru. Se trata de distritos cuya pobreza va del
78,8% al 83,3% y con una extrema pobreza entre el 20,6% y 14,7%. La excepción
HV3DPSDPDUFDTXHWLHQHGHSREUHV\GHH[WUHPDSREUH]D

Es una zona de sierra, de comunidades campesinas, con productores de


VXEVLVWHQFLD TXH SRVHHQ SHTXHxDV SDUFHODV GH DOUHGHGRU GH  +D FRQ FDVL QXOD
capitalización tecnológica, con depredación del suelo y sobrepastoreo. La producción
agrícola está orientada al consumo, teniendo sus ingresos monetarios por la
producción pecuaria.

2. Proceso social local


2.1 Periodización e hitos claves
/DSURYLQFLDGH&DQDVIXHHVFHQDULRGHODYLROHQFLDSROtWLFDHQORVDxRV\HQ
dicha fase el campesinado organizado en la Federación Departamental de Campesinos
GHO&XVFR\VXÀOLDOSURYLQFLDOYLYLHURQXQDHWDSDPX\GLItFLOSHVHDORFXDOQRVH
desestructuraron.

Pasado este momento, la Federación Campesina, con el apoyo del Instituto para una
$OWHUQDWLYD$JUDULD ,$$ KLFLHURQXQYLUDMHUHVSHFWRDODVODERUHVTXHWUDGLFLRQDOPHQWH
asumen las organizaciones gremiales y empezaron a promover en Jabon Mayo una
propuesta de desarrollo rural sustentado en las organizaciones campesinas.

Una primera etapa de desarrollo de la propuesta ha sido de experimentación y


SURJUHVLYRGLVHxRGHXQPRGHORTXHEXVFDODJHVWLyQLQWHJUDOGHODPLFURFXHQFDFRQ

136
Desafíos de la Democracia Participativa Local en la Descentralización

XQHQIRTXHDJURHFROyJLFRFRQEDVHDODFDSDFLWDFLyQWHFQROyJLFDHLPSOHPHQWDFLyQ
de tecnologías productivas, conservacionistas y de transformación.

2.2 Hechos relevantes


• La primera etapa de H[SHULPHQWDFLyQDSHTXHxDHVFDODSXGROOHJDUDXQDIDVH
GHYDOLGDFLyQKDFLDHODxR
• A partir del 2000, con recursos de la cooperación internacional se ha ido
expandiendo dentro del Cusco y hacia otros departamentos del país.

2.3 Actores fundadores o anteriores


• Federación Departamental Campesina de Cusco
• Instituto para una Alternativa Agraria, IAA
‡ ,QÁXHQFLDGHOPRYLPLHQWRSROtWLFR//DSDQFKLV

2.4 Logros y limitaciones


Se ha planteado la implementación de los Centro Comunal de Seguridad
Alimentaria (CECOSA) como estrategia de desarrollo tecnológico del campo y forma
GHFRPEDWHDODGHVQXWULFLyQGHORVQLxRV/RV&(&26$VHLQVWDODQHQXQiUHDGH
PTXHODFRPXQLGDGFDPSHVLQDFHGHHQXVR\TXHFRPSUHQGHXQFRQMXQWR
GHiUHDVHVSHFLDOL]DGDVXQKXHUWRÀMRDFDPSRDELHUWRXQÀWRWROGRSDUDKRUWDOL]DV
y frutas; un acuitoldo para la crianza de pez carpa; galpón para cuyes y galpón para
conejos; gallinero para gallinas ponedoras; establo para vaca; local con comedor,
FRFLQD\DOPDFpQERPEDPROLQRGHYLHQWRWDQTXHHOHYDGRSDUDDJXDSRWDEOHWHUPD
solar; cocina solar; calefacción solar; red de desagüe, biodigestor; picadora de pasto
y forraje.

&RPRWRGDLQYHUVLyQODSURSXHVWDKDUHTXHULGRGHXQVRSRUWHTXHIXHDVXPLGR
inicialmente por la cooperación internacional y ahora se plantea sea apoyado por
los gobiernos locales y el regional. Los promotores de la experiencia desarrollan
SDUD HOOR XQD DUGXD ODERU GH FDELOGHR 'LFKRV SURPRWRUHV VHxDODQ TXH GH QR
KDEHUUHFXUVRVSDUDWRGRVVHKDUiXQDODERUGHVHOHFFLyQRFRQFXUVRSDUDGHÀQLU
ORVEHQHÀFLDULRV

137
Juan Arroyo y Marina Irigoyen

3. La situación actual
3.1 Condiciones organizativas de la sociedad civil
Las principales organizaciones de la zona son las comunidades campesinas
DÀOLDGDVDOD)HGHUDFLyQ'HSDUWDPHQWDOGH&DPSHVLQRVGH&XVFR )'&& 7DPELpQ
hay comedores populares, comités de vaso de leche y APAFAs.

/DH[SHULHQFLDGHFDSDFLWDFLyQDFDPSHVLQRV\FDPSHVLQDVTXHOD)'&&LQLFLy
KDFHXQRVDxRVFRQUHXQLRQHVPHQVXDOHVSDUDHOORKDWHUPLQDGRGRWDQGRGH
XQ SHUÀO SURGXFWLYR D PXFKDV GH VXV EDVHV \ DVRFLDGRV JHQHUDQGR UHVSHWR SRU
la Federación y propiciando la generación de experiencias microempresariales.
Mensualmente hay asambleas y escuelas de capacitación, con contenidos diversos, con
énfasis en lo productivo. Es característico de la experiencia la existencia de docentes
FDPSHVLQRVORV<DFKDFKLTTXHGDQORVFXUVRVHQORVDVSHFWRVSURGXFWLYRV

3.2 Apertura democrática del gobierno local


Esta no es una experiencia impulsada desde algún gobierno local sino por la
Federación Departamental de Campesinos de Cusco, con apoyo de la ONG Instituto
para una Alternativa Agraria (IAA).

/DSURSXHVWDFRUUHVSRQGHDXQPRGHORTXHVHKDVLVWHPDWL]DGRFRPR´(VFDOHUD
del Progreso”.17 Esta consta de ocho pasos o “escalones”: capacitación básica para
interaprendizaje; instalación de sistemas de riego elemental; ganadería con manejo
VHPLHVWDEXODGRFXOWLYRVFRQFREHUWXUDLQVWDODFLyQGHÀWROGRVPHMRUDJHQpWLFD\DVt
KDVWDOOHJDUDODJHVWLyQGHPLFURFXHQFD$GHPiVKD\XQVRSRUWHTXHHVOD'HPRFUDFLD
Participativa y dos barandas: una, el mercado; y dos, los servicios de educación, salud,
salubridad e infraestructura. La Escalera implica desarrollo de capacidades sociales
\ WpFQLFDV FDSLWDOL]DFLyQ IDPLOLDU PHMRUHV FRQGLFLRQHV GH YLGD GH ORV SHTXHxRV
productores e impulso del mercado local interno y regional.

Por otro lado, postula una acción concertada con los organismos del Estado. El IAA
\OD)'&&EXVFDQTXHODVPXQLFLSDOLGDGHV\HO*RELHUQR5HJLRQDODVXPDQHOPRGHOR\
VXÀQDQFLDPLHQWRHQORVDVSHFWRVGHLQYHUVLRQHVFDVRGHORV&(&26$(QHOFDVRGH
&DQDVWUHVFRPXQLGDGHVORJUDURQTXHVHÀQDQFLHVXV&(&26$FRQUHFXUVRVGHO33

___________________________________________________
17 FDCC. Lineamientos para el Desarrollo del Mercado Interno en Base al Progreso de la Pequeña Producción Campesina, con
Democracia Participativa. Cusco, febrero del 2004.

138
Desafíos de la Democracia Participativa Local en la Descentralización

El objetivo del modelo es “democratizar la realización de la ganancia”, desarrollar


el mercado interno a partir del mercado local y avanzar en una propuesta agro-
ecológica.

3.3 Nivel de participación de la sociedad civil


Las organizaciones sociales particularmente las comunidades campesinas y
federaciones distritales asumen un nuevo interés por organizarse considerando los
DVSHFWRVSURGXFWLYRV\GHVHJXULGDGDOLPHQWDULD6HJHQHUDQSHTXHxDVHPSUHVDVTXH
buscan mercados locales o distritales.

3.4 Calidad de los productos concertados


‡ 6HYDOLGyPiVGHWHFQRORJtDVSURGXFWLYDVTXHHQODFDPSDxD
VHHPSH]yDUHSOLFDUHQGLVWULWRVGH&XVFR(QODFDPSDxDVH
han extendido a 60 distritos.
• A partir de estas tecnologías las familias se capacitan e implementan
WHFQRORJtDVTXHPHMRUDQVXDOLPHQWDFLyQ\QXWULFLyQEDVDGDHQHODXWRFRQVXPR
e incrementan sus ingresos monetarios.
‡ /RV&(&26$6VRQPiVXQPRGHORGHHQVHxDQ]DDELHUWDPHGLDQWHHOHQIRTXH
GHDSUHQGHUKDFLHQGRTXHXQDVROXFLyQSDUDODVHJXULGDGDOLPHQWDULD/D
escala de la producción no hace posible cubrir las necesidades de conjunto.
(QODFRPXQLGDGGH&KROORFDQLSRUHMHPSORODVDFDGHFX\HVSURSLFLDTXH
se alimente a la comunidad alrededor de dos veces por mes, “allí se matan
unos 10 cuyes y se preparan con papitas, con las verduritas del huerto, es
FRPRXQDÀHVWDµVHxDODQ
• Se genera una conciencia colectiva de trabajo por la seguridad alimentaria y
se fortalecen los lazos comunales.

3.5 Efectos del proceso de concertación sobre las


organizaciones en general y de las organizaciones de
mujeres e instituciones
• La FDCC presentó este planteamiento a los candidatos a la Presidencia
HQODVHOHFFLRQHVGHOORTXHIXHUHIUHQGDGRSRU$OHMDQGUR7ROHGR\D
VLHQGR3UHVLGHQWH&RQEDVHDHVWROD)'&&FRQVLJXLyTXHHO3URJUDPD

139
Juan Arroyo y Marina Irigoyen

de Emergencia Social Productiva Rural (PESPR) se reorientara hacia lo


productivo, lográndose construir en 22 distritos reservorios rústicos, riego
por aspersión y pastos asociados cultivados para 500 familias por distrito
DOUHGHGRUGHPLOIDPLOLDVHQWRWDO /XHJRVHORJUyÀQDQFLDPLHQWRSDUD
implementar el proyecto de réplica trienal “Gestión Integral de micro
cuencas” en 12 microcuencas del Cusco y 3 de Puno.18

‡ /DVIHGHUDFLRQHVFDPSHVLQDVGLVWULWDOHVLQÁX\HURQSDUDTXHHQGLVWULWRVORV
PP apoyen proyectos productivos alcanzados por ellas. La propuesta implica
XQÀQDQFLDPLHQWRGHSDUWHGH)21&2'(6\3521$0$&+6DSDUWLUGH
una reorientación de sus fondos en el proceso de descentralización nacional,
con base a concursos y emulación. Es decir la reorientación de recursos hacia
una prioridad productiva. También en esa lógica se está en coordinaciones
con el Gobierno Regional para destinar parte de los recursos provenientes
GHOFDQRQSRUHOJDVGH&DPLVHDDHVWHSDTXHWH19

• Un ejemplo concreto de los impactos en las personas de esta propuesta son


ORVFDVRVGH$ORGLD/D]R\7HUHVD7XSD\DFKLFDPSHVLQDVTXHFRQHODSR\R
de la federación distrital, base de la FDCC, y el IAA aprendieron a trabajar
VXKXHUWRIDPLOLDUGHPKDFHXQRVDxRVFXOWLYiQGRORHQIRUPDQDWXUDO
con una producción para consumo familiar y eventualmente para el mercado
local. Inicialmente el IAA donó las semillas y abono de vacuno pero ahora
ellas compran las semillas para cada temporada y producen su propio abono,
planeando e incorporando nuevas tecnologías.

+R\ HQ GtD HVWDV FDPSHVLQDV VH KDQ FRQYHUWLGR HQ <DFKDFKLT HV GHFLU TXH
HQVHxDQDRWURV\RWUDVORTXHHOODVUHFLELHURQFRPRFDSDFLWDFLyQ7HUHVDKDYLDMDGR
DUHJLRQHVFRPR$\DFXFKR\+XDQFDYHOLFDWUDQVÀULHQGRVXVVDEHUHV\VLQFREUDUSRU
HVWDODERU´HVXQDIRUPDGHGHYROYHUDRWURVORTXHSXGHDSUHQGHUµVHxDOD$ORGLD
GHVGHKDFHGRVDxRVVHFDSDFLWy\HPSH]yODSURGXFFLyQGH\RJXUWPDQMDUEODQFR
mermeladas y otros para la venta local y regional. Una de sus labores, en convenio
con la municipalidad distrital, fue capacitar en el 2003, durante cinco meses, a un
grupo de 28 mujeres y 2 varones en la elaboración de productos lácteos, sin cobrar,
UHFLELHQGRVyORXQFHUWLÀFDGR\FDUWDGHIHOLFLWDFLyQ

Además Alodia ha generado su microempresa de lácteos, con cinco socias


TXHUHDOL]DQODVODERUHVGHDSR\RUHFRJHQODOHFKHODYDQORVVHUYLFLRVSUHSDUDQORV

___________________________________________________
18 FDCC, 2004, ibidem.
19 Entrevista a Carlos Paredes, asesor de la FDCC, noviembre del 2004.

140
Desafíos de la Democracia Participativa Local en la Descentralización

alimentos. La sostenibilidad de la empresa es aún un reto. Abastecer a la municipalidad


distrital con 1.046 litros de yogurt en setiembre del 2004 significó para esta
PLFURHPSUHVDXQDJUDQPRYLOL]DFLyQ\WHQVLyQGHIXHU]DVTXHVLQHPEDUJRFRQODV
MXVWDVOOHJyDFXEULUVXVFRVWRVGLUHFWRVWHQLHQGRTXHVXVSHQGHUODYHQWDSRUDXVHQFLD
de documentación. Sin embargo fue un aprendizaje muy grande en lo referente a
RUJDQL]DFLyQGHOHTXLSRFDOLGDGGHORVLQVXPRV\GHOSURGXFWRJHVWLyQGHORVUHFXUVRV
KXPDQRVHWFODIDOWDGHH[SHULHQFLDHQHOPDQHMRHPSUHVDULDOKDFHTXHD~QQRORJUH
estimar sus costos ni lleve la cuenta de la situación real del negocio. Estas mujeres se
VLHQWHQHPSRGHUDGDVFRPRSHUVRQDVÁXLGDVHQVXGLiORJR\HQVXVUHÁH[LRQHV

• La situación de empoderamiento no parece ser tan amplia en el caso de otras


\DFKDFKLTPXMHUHV\SDUWLFLSDQWHVGHORV&(&26$TXHVRQPX\WUDEDMDGRUDV
SHURFDOODGDV\PHQRVHPSUHQGHGRUDV'HKHFKRKD\VyOR\DFKDFKLTPXMHUHV
y 20 varones en Canas.

‡ 2WURV OtGHUHV FRPR %HQLJQR /XTXH H[ GLULJHQWH FDPSHVLQR \ DOFDOGH


SURYLQFLDO GH &DQDV UHDÀUPDQ VX GHVDUUROOR SHUVRQDO \ SROtWLFR FRQ XQ
HQIRTXHGHGHVDUUROORGHFDSDFLGDGHV\VHUYLFLRDODFRPXQLGDG

3.6 Resultados conseguidos sobre la calidad de vida de la


población
El modelo de la escalera del desarrollo y los CECOSA se implementan
SURJUHVLYDPHQWH DFWXDQGR FRPR VHUYLFLR FRPXQDO D OD YH] TXH FRPR FHQWUR GH
capacitación de las mujeres en tecnologías productivas, conservacionistas y de
WUDQVIRUPDFLyQ HQ EDVH D HQHUJtDV UHQRYDEOHV 6H VHxDOD TXH HQ WUHV FDPSDxDV
agropecuarias, las 18 comunidades campesinas de Huancarani tienen huertos comunales
\  IDPLOLDV FXHQWDQ FRQ KXHUWRV ÀMRV IDPLOLDUHV \ SDUFHODV GH SDVWRV DVRFLDGRV
comercializan sus excedentes de hortalizas y participan de un mercado semanal en
&XVFR3HURHOULWPRGHH[SDQVLyQUHTXLHUHGLPHQVLRQHVGHLQYHUVLyQTXHVyORVHYDQ
ORJUDQGROHQWDPHQWHORTXHHYLGHQWHKDFHTXHORVLPSDFWRVVHDQOLPLWDGRV

3.7 Resultados conseguidos sobre el empoderamiento de la


población, de las mujeres y de los pobres en particular
La metodología de capacitación empleada, de “campesino a campesino”, el
LQWHUDSUHQGL]DMHHOHQIRTXHGH´DSUHQGHUKDFLHQGRµFRQDFRPSDxDPLHQWRWpFQLFR

141
Juan Arroyo y Marina Irigoyen

KDSRVLELOLWDGRXQDDÀUPDFLyQGHORVcampesinos varones y mujeres no sólo por


el uso de tecnologías y nuevas habilidades productivas sino en su valoración como
personas y dirigentes, en la autoestima y sus potencialidades para el desarrollo. Se va
FUHDQGRXQDHVSHUDQ]DHQJUXSRVGLULJHQFLDOHVTXHLUUDGLDDVXVFRPXQLGDGHV

En el caso de las mujeres, destacan lideresas como las mencionadas Alodia y


Teresa, pero sobre todo en el campo productivo y personal. No llegan a integrarse
plenamente a las dinámicas del desarrollo local: “no tuve tiempo de participar en el
33µVHxDODXQD´QRFRQR]FRTXpHVHO&&/µVHxDODRWUD

Acciones como la alfabetización con contenidos apropiados a adultos y


productores están en curso, orientados a mujeres campesinas adultas. La experiencia
no llega a integrar a campesinos varones o mujeres más jóvenes, no hay una estrategia
HVSHFtÀFDRULHQWDGDKDFLDHOORV

142
Desafíos de la Democracia Participativa Local en la Descentralización

LIMATAMBO:
Buscando sostener
el cambio

143
Juan Arroyo y Marina Irigoyen

LIMATAMBO:
Buscando sostener el cambio

1. Condiciones generales del ámbito20


Limatambo se ubica en la provincia de Anta, Cusco, y cuenta con alrededor de
9,200 habitantes, de los cuales el 88,1% está en condición de pobreza y de ellos el
24,8% en pobreza extrema. El 90% de su población es rural. Es una zona de clima
templado, integrada a la cuenca del río Apurímac.

Limatambo ha sido una zona de haciendas basadas en relaciones de servidumbre.


En el pasado se dio una periódica lucha por la recuperación de las tierras de las
comunidades, especialmente desde mediados del siglo XX. A partir de la Reforma
$JUDULDGHLQLFLRVGHORVDxRVDOJXQDVSURSLHGDGHVVHFRQYLUWLHURQHQFRPXQDOHV
Limatambo cuenta hoy con 33 comunidades campesinas. Otras propiedades dieron
origen a cooperativas agrarias de producción.

(OTXHFKXDHVHOLGLRPDSUHGRPLQDQWH6HHVWLPDHQXQHODQDOIDEHWLVPR
y en 40% la desnutrición infantil. Las carencias en términos de servicios es crítica,
HVSHFLDOPHQWHHQHOHFWULÀFDFLyQ\HOFLUFXLWRGHFRPXQLFDFLyQYLDOHVOLPLWDGR

2. Proceso social local


En general la población ha transitado de una situación de desinformación y
marginalidad frente a los asuntos municipales a tener una mayor decisión e ingerencia
en la toma de decisiones locales, a partir de la acción municipal participativa
desarrollada en la etapa 1993-2002.

2.1 Periodización e hitos claves


• Conforme a la información clásica sobre la experiencia de Limatambo
contenida en el libro publicado por DFID sobre cuatro casos de democracia
participativa en los Andes, en este distrito se sucedieron diferentes gestiones

___________________________________________________
20 La presente reseña no enfatizará en la gestión municipal en el período 1993-2002, bastante estudiada, sino en la situación actual. Una
información más completa sobre dicha etapa puede obtenerse en el capítulo “Limatambo: de la exclusión al gobierno. Los logros
de una democracia participativa”, en: DFID, Democracia Participativa en los Andes: La experiencia de cuatro municipalidades
rurales en el Perú. Lima: DFID, 2003.

144
Desafíos de la Democracia Participativa Local en la Descentralización

municipales de corte autoritario y excluyente del campesinado, hasta las


HOHFFLRQHVGHHQTXHJDQyODOLVWDGH:LOEHUW5R]DV8QLGDG&DPSHVLQD
Popular, promovida por la Federación Campesina.
‡ (QVHLQVWDOyHVWDQXHYDJHVWLyQPXQLFLSDOTXHFRPSUHQGLyODVJHVWLRQHV
1993-95, 1996-98 y 1999-2002.
• En las elecciones municipales del 2002 la lista de Unidad Campesina Popular
SHUGLy OD HOHFFLyQ GLVWULWDO GH /LPDWDPER DXQTXH JDQy OD 0XQLFLSDOLGDG
Provincial de Anta.

2.2 Hechos relevantes


• La nueva gestión municipal creó en sus inicios el Consejo Comunal Vecinal
&&9 TXHLQWHJUDEDDODVFRPXQLGDGHV\DORVYHFLQRVGHOSHTXHxRFHQWUR
SREODGRFDSLWDO(VWHWHQtDFRPRDWULEXFLRQHVSODQHDUJHVWLRQDU\ÀVFDOL]DU
la acción municipal, no siendo un organismo meramente consultivo.
• El CCV tenía una Mesa Directiva con un presidente, secretario y tres relatores,
renovable cada tres meses. Además de ella tenía una Asamblea constituida
por 6 delegados por cada comunidad, representantes de las organizaciones
gremiales y sociales del distrito, autoridades municipales y representantes
de instituciones estatales como FONCODES, salud, etc. Las autoridades
conformaban una Coordinadora de Autoridades. Se estimulaba las reuniones
previas de cada comunidad participante.
‡ /DV$VDPEOHDVGHOLEHUDWLYDVGHO&&9IXHURQXQHVSDFLRTXHUHWRPyODSDUWLFLSDFLyQ
FRPXQDOWUDGLFLRQDO\TXHWDPELpQVHUHSURGXFtDQDQLYHOFRPXQDO

2.3 Actores fundadores de la experiencia 1993-2002


• Alcalde Wilbert Rozas
• Federación Campesina Distrital de Limatambo
• Comité Central de Mujeres
• ONG CADEP, Proyecto Especial Plan MERIS

2.4 Logros y limitaciones


La democratización de la gestión edil, a partir de la creación del CCV, fue un
DYDQFH VXVWDQFLDO SDUD /LPDWDPER TXH WXYR FRQ ORV DxRV LQÁXHQFLD HQ PXFKRV
municipios del país. A ello se suma un elemento ampliamente comentado por los
FDPSHVLQRVTXHHV´HOEXHQWUDWRµGHODVDXWRULGDGHVPXQLFLSDOHV

145
Juan Arroyo y Marina Irigoyen

6H DYDQ]y WDPELpQ HQ OD SODQLÀFDFLyQ GH ORV WUDEDMRV FRQ XQ SUHVXSXHVWR
GH VRSRUWH TXH HUD GLVFXWLGR \ ÀVFDOL]DGR SRU OD SREODFLyQ /D SREODFLyQ DQWHV
DFRVWXPEUDGDDQRFRRSHUDUPiVTXHSRUODIXHU]DDVXPLyXQDFRQWUDSDUWHSDUDODV
REUDVTXHVHHMHFXWDEDQ

6LQHPEDUJRKDELHQGRDYDQ]DGRHQORVDVSHFWRVGHSODQLÀFDFLyQSDUWLFLSDWLYD
de obras y en la información y comunicación con los líderes de organizaciones y
SREODFLyQQRVHOOHJyDGLVHxDUQLKDFHUXVRGHXVRGHLQVWUXPHQWRVPiVWHFQLÀFDGRV
TXHSRWHQFLHQODJHVWLyQ3RUHMHPSORQRVHFRQWyFRQXQ3ODQQLYLVLyQGHIXWXUR
(OVXSXHVWRHVTXHSULPDXQDFXOWXUDRUDOGHLQIRUPDFLyQ\FRPSURPLVR(OULHVJR
HV TXH ODV VLJXLHQWHV DXWRULGDGHV PXQLFLSDOHV QR FRQWLQ~HQ HQ HO PLVPR VHQWLGR
como a larga se ha dado.

2.5 Factores internos y externos que incidieron en los logros


y limitaciones
El apoyo de instituciones como CADEP, Centro Bartolomé de las Casas y la
cooperación internacional contribuyeron a potenciar los esfuerzos de la gestión
PXQLFLSDO3HURHOOLGHUD]JRGHODOFDOGHIXHHOIDFWRUGHFLVLYRTXHLQÁX\yHQHOGHVDUUROOR
GHODH[SHULHQFLD$ODYH]DFRPSDxDQGRHVWHOLGHUD]JRQRVHORJUyIRUPDUQXHYRV
FXDGURVQLFRKHVLRQDUXQHTXLSRTXHOHGLHUDFRQWLQXLGDGDOSURFHVR/DDXVHQFLDGH
una generación de recambio, de jóvenes, ha sido un elemento reconocido.

3. La situación actual
3.1 Características y condiciones organizativas de la
sociedad civil
Las principales organizaciones sociales son las comunidades campesinas. A
ellas se suman las organizaciones femeninas y la Federación Distrital de Campesinos,
base de la Federación Departamental del Cusco y de la CCP. La Federación Distrital
se encuentra bastante debilitada luego de la derrota electoral de la lista de Unidad
Campesina Popular en las elecciones municipales.

Las organizaciones no tienen una vida institucional sólida. No se renuevan


ni establecen canales de comunicación con sus bases. No se han creado nuevos
liderazgos, ellos están concentrados en manos de personas mayores y generalmente
varones. Hay una fuerte migración de jóvenes al Cusco.

146
Desafíos de la Democracia Participativa Local en la Descentralización

3.2 Apertura democrática del gobierno local


Luego de la exitosa y aplaudida gestión municipal de Wilbert Rozas, se ha dado
un retroceso en la gestión actual. El actual alcalde ha desconocido muchos de los
DFXHUGRVSUHYLRV\VyORDQWHODDPHQD]DGHXQDUHYRFDWRULDDÀQHVGHODFFHGLy
DUHXQLUVHFRQODSREODFLyQ\UHQGLUFXHQWDV(O&&9VHUHXQLyDÀQHVGHDxR1R
VHKDFRQIRUPDGRHO&&/\HO3UHVXSXHVWR3DUWLFLSDWLYRIXHXQDFWRIRUPDOTXHVH
realizó sin participación.

3.3 Nivel de participación de la sociedad civil


Hoy en día la población no tiene el nivel de actividad anterior y l os nuevos
dirigentes de las comunidades no llegan a conocer ni asumir la experiencia anterior.
La Federación de Mujeres está debilitada.

6L ELHQ VH DYDQ]y HQ PXFKRV DVSHFWRV ÀQDOPHQWH OD SREODFLyQ RSWy SRU HO
cambio en las elecciones del 2002; había un interés en renovar autoridades, no seguir
con el continuismo. Y no llegó a reconocer en los candidatos distritales un nuevo
liderazgo.

3.4 Calidad de los productos concertados


Durante la gestión de Wilbert Rozas se logró avanzar en una mayor integración
vial, articulando las comunidades con el distrito. Se avanzó en los servicios de agua
SRWDEOHGHFDOLGDG\HQODHOHFWULÀFDFLyQDSDUWLUGHODFRQH[LyQFRQODFHQWUDOHOpFWULFD
de Macchu Picchu. También la municipalidad aportó en la mejora de infraestructura
HGXFDWLYD\HTXLSDPLHQWRLQFOX\HQGRXQFRPSOHMRDJURPROLQHUR

Pero en la experiencia de Limatambo no se trabajó una propuesta de desarrollo


económico. Hubo acciones puntuales de corte productivo, como el mejoramiento de
FDQDOHVGHULHJRUHVHUYRULRV\FDQDOHWDV3HUR/LPDWDPERQRGHÀQLyXQSHUÀOSURSLR
GHGHVDUUROORTXHLQFOX\DORVDVSHFWRVHFRQyPLFRVDOJRDVRFLDGRDODDXVHQFLDGH
una visión estratégica de futuro.

El tema del desarrollo de capacidades no fué parte importante de su agenda.


/DGHPRFUDWL]DFLyQGHODLQIRUPDFLyQIXHXQHOHPHQWRTXHFRDG\XYyDOGHVDUUROOR
GHODHTXLGDGSHURUHVXOWyDOÀQDOLQVXÀFLHQWH

147
Juan Arroyo y Marina Irigoyen

3.5 Efectos del proceso de concertación sobre las organizaciones en


general y de las organizaciones de mujeres e instituciones
La experiencia del alcalde Rozas logró el empoderamiento de amplios sectores
de la población llegando a frenar los abusos de autoridades, como las educativas.
$~QVHUHFXHUGDFRPRHQHODxRVHORJUyHOFDPELRGHXQSURIHVRUDEXVLYR
TXHDWHQWDEDFRQWUDODVDOXGVH[XDOGHORVODVHVWXGLDQWHV/DPRYLOL]DFLyQFDPSHVLQD
ORJUyVXFDSWXUDTXHYD\DSUHVR\OXHJRTXHQRUHJUHVDUDDHQVHxDU

La organización de mujeres se creó auspiciada por la gestión municipal de Wilbert


Rozas. Las mujeres llegaban a participar en las actividades deportivas, recreativas y en
HOSURSLR&&93HURHVWDLQWHJUDFLyQUHTXHUtDPXFKRHVIXHU]RSHUVRQDO\GHORVOtGHUHV
$XQTXHVHLQWHQWyIRUPDUOLGHUD]JRVDSDUWLUGHSURJUDPDVGHFDSDFLWDFLyQGHOD)HGHUDFLyQ
Provincial, las precarias condiciones de vida atentaban contra su dedicación. La formación
GHQXHYRVOLGHUD]JRVQRVHDEULyORVXÀFLHQWHFRQORTXHQRVHOOHJyDFRQVWUXLUXQQXHYR
OLGHUD]JRIHPHQLQRTXHFRPSOHPHQWDUDORVHVIXHU]RVPXQLFLSDOHV

3.6 Resultados conseguidos sobre la calidad de vida de la


población
/RVSUR\HFWRVGHVHUYLFLRVGHDJXDSRWDEOHHOHFWULÀFDFLyQ\YLDOLGDGVHLQVFULEHQ
HQODOyJLFDGHHTXLGDG\VXSHUDFLyQGHODSREUH]D/DPHQWDEOHPHQWHODVFLIUDVVREUH
SREUH]D\SREUH]DH[WUHPDGHPXHVWUDQHOSRFRLPSDFWRTXHVHWXYRHQODPHMRUDGH
ingresos y en la lucha contra la desnutrición infantil (40,6%).

3.7 Resultados conseguidos sobre el empoderamiento de la


población, en particular de las mujeres y de los pobres
/RV HQWUHYLVWDGRV LQIRUPDQ TXH DFWXDOPHQWH H[LVWH HQ HO GLVWULWR XQ
comportamiento agresivo del alcalde contra sus opositores y una descohesión de la
oposición, fragmentada ante una autoridad elegida con muy poca legitimidad y escaso
margen: la lista ganadora tuvo una diferencia de 20 votos con la segunda; fueron 12
OLVWDVODVTXHVHSUHVHQWDURQ

6HKDEUtDVHPEUDGRDVtXQDVHPLOODTXHQROOHJDDJHUPLQDUSRUQRWHQHUOLGHUD]JRV
TXHHQFDEHFHQHOSURFHVR+D\VLQHPEDUJRXQHVStULWXGHFRQFHUWDFLyQTXHKR\VHKD
SUR\HFWDGRDODSURYLQFLDGH$QWD\TXHDSDUHQWHPHQWHSXHGHYROYHUDOOHJDUDOGLVWULWR
La gente habla de realizar una revocatoria del alcalde distrital en el 2005.

148
HUANCAVELICA:
La Mesa de Concertación
del Desarrollo de Huancavelica
(MECODEH)
Juan Arroyo y Marina Irigoyen

HUANCAVELICA:
La Mesa de Concertación del Desarrollo de
Huancavelica (MECODEH)

1. Características generales
Huancavelica es un departamento largamente postergado en el Perú. Tiene una
extensión de 22,131 Km2 y está divida en 7 provincias (Huancavelica, Acobamba,
Angaraes, Castrovirreyna, Churcampa, Huaytara y Tayacaja) y 94 distritos. Su
población en el 2004 asciende a 459,982 habitantes, siendo su población rural el
\ODXUEDQDHO ,1(, /DGHQVLGDGGHPRJUiÀFDGH+XDQFDYHOLFDHVGH
20 habitantes/km².

6X VXSHUÀFLH DJUtFROD HV GH  KHFWiUHDV TXH UHSUHVHQWD HO  GH
ODVXSHUÀFLHWRWDO/RVSULQFLSDOHVFXOWLYRVVRQODSDSDODFHEDGDPDt]DPLOiFHR
arveja grano, haba grano, trigo y avena. La población pecuaria es de vacunos, ovinos,
\FDPpOLGRV6HREVHUYDTXHODFULDQ]DGHRYLQRVUHSUHVHQWDHOORVFDPpOLGRV
UHSUHVHQWDQ HO  FRQ UHODFLyQ D OD SREODFLyQ SHFXDULD WRWDO /D VXSHUÀFLH GH
SDVWRV QDWXUDOHV UHSUHVHQWD HO  GH OD VXSHUÀFLH WRWDO \ VH HQFXHQWUD FRQ
sobrepastoreo.

La actividad económica del departamento de Huancavelica se concentra en la


producción agraria; el 73% de la población se dedica a está actividad. La tenencia de
la tierra en el 79% del territorio departamental corresponde a la propiedad comunal
\HODSHTXHxRVSURSLHWDULRVLQGLYLGXDOHVVLQWtWXORGHSURSLHGDG/DSREODFLyQ
rural carece de los medios de comunicación adecuados para el traslado de insumos y
productos al mercado. Las vías de comunicación terrestre, las carreteras, se encuentran
VyORDÀUPDGDV\HQGHÀFLHQWHHVWDGRGHFRQVHUYDFLyQDOSXQWRTXHHQSHUtRGRVGH
lluvia presentan interrupción. Aún no han sido integrados los distritos de Santiago de
&KRFRUYRV&yUGRYD2FR\RTXHWLHQHQFRQH[LyQFRQ,FDORVGLVWULWRVGHO1RUWHGH
Castrovirreyna tienen conexión con Chincha. Adicionalmente muchas comunidades
campesinas carecen de vías de acceso.

El analfabetismo es del orden del 34%, correspondiendo a las mujeres el mayor


porcentaje, especialmente en la población adulta. La tasa de crecimiento poblacional
YLHQHGLVPLQX\HQGRGHHQDHQHOGHELGRDODLQÁXHQFLDGH

150
Desafíos de la Democracia Participativa Local en la Descentralización

SURJUDPDVGHSODQLÀFDFLyQIDPLOLDU\DODPLJUDFLyQ/D+LGURHOpFWULFDGHO0DQWDURVH
localiza en la provincia de Tayacaja y abastece al 48% de energía del territorio patrio;
sin embargo sólo el 50% de las poblaciones del departamento de Huancavelica cuenta
con servicios de energía eléctrica.

(O FXDGUR GH H[WUHPD SREUH]D \ HO SURFHVR GH YLROHQFLD SROtWLFD TXH YLYLy
Huancavelica en la década de los ochenta, han desestructurado el tejido social y
deteriorado el aparato productivo.

2. Proceso social regional


7RGDHVWDFRPSOHMLGDGVRFLDOPRWLYyTXHGXUDQWHHOVHJXQGROXVWURGHORV
se generara en el departamento de Huancavelica una experiencia muy importante
GH PRYLOL]DFLyQ VRFLDO UHJLRQDOLVWD TXH HQ FLHUWD PHGLGD KD PDUFDGR OD YLGD
política y social de Huancavelica hasta ahora. Sus hitos más importantes fueron los
siguientes:

LA MESA DE DESPLAZADOS SURGIDA EN 1995


El primer agrupamiento de este movimiento fue el convocado originalmente en
SRUODHQWLGDGFRRSHUDQWH&RQVHMHUtDGH3UR\HFWRVTXHHPSH]yDJUXSDQGRD
sus ONGs contrapartes en una Mesa de Trabajo sobre Desplazados por la Violencia
3ROtWLFD3RFRDSRFRGLFKD0HVDIXHHQJURVDQGRÀODVFRQWRGRWLSRGHLQVWLWXFLRQHV
y asumiendo otros temas y relaciones.

LA CABALGATA DE LOS ANDES DE 1997


/XHJR GH GRV DxRV GH DFXPXODFLyQ GH IXHU]DV \ ORJUDGD OD LQWHJUDFLyQ DO
PRYLPLHQWRGHODOFDOGHSURYLQFLDO)HGHULFR6DODVTXHWHQtDIXHUWHVOD]RVFRQORV
DOFDOGHV9DUD\RTGHODFRPXQLGDGFDPSHVLQD&KRSFFD²VHFRQYRFyDOD&DEDOJDWD
de los Andes, cuya plataforma fue de tres puntos:

• Declarar a Huancavelica como departamento autónomo y piloto para la lucha


contra la pobreza.
• Obtener regalías por el canon energético, por ser un departamento productor
de energía eléctrica para el Perú.
‡ 2EWHQHUVHUFRQVLGHUDGRGHQWURGHXQ3URJUDPDGH(PHUJHQFLDSDUDHODxR
1998.

151
Juan Arroyo y Marina Irigoyen

El efecto inmediato de la Cabalgata de los Andes fue, por un lado, el


posicionamiento de Huancavelica en el escenario político a nivel nacional e
internacional, y por otro lado, la revaloración de la identidad huancavelicana y la
UDWLÀFDFLyQGHODSDUWLFLSDFLyQVLQpUJLFDGHORVDOFDOGHV\ODVRFLHGDGFLYLOFRPRXQ
poderoso medio de obtención de soluciones.

I FORO HUANCAVELICA SIGLO XXI


En 1998 se realizó el “I Foro Huancavelica Siglo XXI”, con presencia de 450
UHSUHVHQWDQWHVGHSDUWDPHQWDOHVGRQGHVHDFRUGySRUFRQVHQVRTXHHOFDPLQRDOD
VXSHUDFLyQGHODSREUH]DGH+XDQFDYHOLFDUHTXHUtD

‡ TXH +XDQFDYHOLFD VHD FRQVLGHUDGR 5HJLyQ $XWyQRPD \ 3LORWR GH /XFKD


Contra la Pobreza.
• la unidad de todas las instituciones y organizaciones, formalizándose la Mesa
de Concertación Departamental de Huancavelica (MECODEH).
‡ HO 3ODQ GH 'HVDUUROOR ,QWHJUDO \ 6RVWHQLGR GH ODUJR SOD]R TXH OD
MECODEH elaboró, para revertir los problemas de pobreza y exclusión
de Huancavelica.

CONSTITUCIÓN DE LA MESA DE CONCERTACIÓN


DEPARTAMENTAL HUANCAVELICA (MECODEH)
/D0(&2'(+ORJUyXQDUHXQLÀFDFLyQMDPiVYLVWDGHWRGDVODVRUJDQL]DFLRQHV
e instituciones del departamento. 80 alcaldes participaban activamente en la Mesa,
replicando en sus circunscripciones los procesos de concertación, en un contexto
entonces de dictadura nacional y regional, pues se construyó en medio de muchas
PDQLREUDVGHOUpJLPHQIXMLPRULVWDSRUEORTXHDUVXGHVDUUROOR

$ORODUJRGHPiVGHXQDxR\PHGLR0(&2'(+GHVDUUROOyWRGRXQSURFHVR
novedoso de elaboración de Planes de Desarrollo, teniendo como base:

‡ 8QSURFHVRPHWRGROyJLFRSDUWLFXODUTXHFRQVLGHUyGLIHUHQWHVPRPHQWRV\
escenarios para la participación estratégica de los actores:

Primer Momento FDSDFLWDFLyQ D  IDFLOLWDGRUHV TXH OXHJR WXYLHURQ


la responsabilidad de apoyar la formulación de diagnósticos y planes
participativos comunales en todo el departamento.

152
Desafíos de la Democracia Participativa Local en la Descentralización

Segundo Momento: formulación del Plan Departamental, articulando los


diagnósticos situacionales de los niveles distrital y departamental, a través de
cuatro talleres temáticos: Educación, Salud, Pobreza y Medio Ambiente.

• La Mesa de Concertación del Desarrollo se calcula movilizó en este


proceso de formulación participativa del Plan de Desarrollo Regional,
desde el nivel comunal, distrital y provincial, a alrededor de 8,000 personas
GXUDQWHGRVDxRV(O3ODQ(VWUDWpJLFRTXHVXUJLyKDVLGRODEDVHSDUDWRGRV
los planes regionales, provinciales y distritales posteriores, originándose
mesas en todos los niveles. La MECODEH aprobó el Plan de Desarrollo
\DGHPiVFRQVWLWX\yHQODLQVWDQFLDGHÀVFDOL]DFLyQSDUDHOFXPSOLPLHQWR
del mismo.

El Plan de Desarrollo Concertado Departamental, fue el principal producto


de la MECODEH, siendo su aporte peculiar - diferenciado de otras experiencias
participativas locales, como Cajamarca e Ilo – esta formulación de un plan con visión
departamental y la movilización alrededor de ella.

EL II FORO HUANCAVELICA SIGLO XXI DE 1999


El II Foro Huancavelica Siglo XXI, realizado con más de 500 dirigentes de
WRGRHOGHSDUWDPHQWRIXHODLQVWDQFLDÀQDOTXHDSUREyHO´3ULPHU3ODQGH'HVDUUROOR
&RQFHUWDGR\3DUWLFLSDWLYRGH+XDQFDYHOLFD²3/$19,'$',*1$µSURFHVRTXH
tuvo las principales características:

• Participaron más de 8,000 personas (dirigentes y representantes) de 7


provincias
• Se buscó y obtuvo el consenso entre las instituciones, organizaciones sociales,
gremiales, privadas, gobiernos locales y sectores del estado
‡ 6HKL]RXQDDSXHVWDPHWRGROyJLFDLQQRYDGRUDGHPRFUiWLFD\GHE~VTXHGD
de desarrollo consensuado.
• Se contribuyó en el fortalecimiento de diversas organizaciones sociales, en
especial de los productores agropecuarios, de la mujer y la juventud
• Se fortalecieron las capacidades intelectuales locales y regionales.
• Se desarrolló la autoestima y la identidad huancavelicana, valorando el pasado,
ODVSRWHQFLDOLGDGHV\UHFXUVRVFRQORVTXHFXHQWDHOGHSDUWDPHQWR
‡ 6H IRUWDOHFLHURQ OLGHUD]JRV TXH DVXPLHURQ SRVWHULRUPHQWH ORV JRELHUQRV
locales y el Gobierno Regional

153
Juan Arroyo y Marina Irigoyen

LA CABALGATA DE LA ESPERANZA DE 1999


Los productores agropecuarios y dirigentes de comunidades campesinas
GH +XDQFDYHOLFD  TXH OXHJR VH DJUXSDUtDQ HQ OD )HGHUDFLyQ 'HSDUWDPHQWDO GH
&RPXQLGDGHV&DPSHVLQDV )('(&&+ IUHQWHDODFULVLVDJUtFRODGHHVHDxR\HQ
acuerdo de intereses comunes con los alcaldes huancavelicanos, decidieron realizar
OD&DEDOJDWDGHOD(VSHUDQ]DD/LPDFRQODÀQDOLGDGGHUHFODPDUPD\RUHVUHFXUVRV
para Huancavelica.

En ese tiempo una acción de fuerza, como la toma de la hidroeléctrica del Mantaro
por parte de 4,000 a 5000 integrantes de la MECODEH, propició la actual Ley del
Cánon Hidroenergético, mediante la cual los gobiernos locales y regionales reciben una
transferencia económica del gobierno nacional por la explotación de estos recursos.

3. Actores claves del proceso


Participaron en la formación de MECODEH muchos actores, tanto locales
como procedentes de Lima. Enumeramos algunos:

Instituciones y organizaciones:
• CEPRODICA
• CEDINCO
• Productores agrarios y campesinos
• Asociación de Mujeres de Yauli
• Comunidad Europea

Actores individuales:
• Federico Salas, alcalde de Huancavelica
• Diana Ávila, de Consejería de Proyectos
• Martín Soto, asesor del Consejo Nacional de Descentralización
• Oscar Garay, ex alcalde de Castrovirreyna
• Aristión Tinoco, ex alcalde de Julcamarca
‡ $OFDOGHV9DUD\RTGHODFRPXQLGDG&KRSFFD
• Grover Flores, ahora Proyecto Fortalece

Facilitadores/promotores de Lima:
• Carlos Herz, asesor de la Red Perú
• Rodrigo Arce, Red Perú

154
Desafíos de la Democracia Participativa Local en la Descentralización

• Walter Varillas, asesor de la Red Perú


• Carlos Monge, Propuesta Ciudadana
‡ -XOLR9LxDV
‡ 0DGHOHLQH=~xLJD

 /RJURV\GL¿FXOWDGHV
Son varios los logros del proceso:

• La formulación del Plan Integral de Desarrollo, el cual sirvió como


instrumento base para la formulación de los planes futuros en la región.
• La inversión en el capital humano regional realizada por la MECODEH
a través de procesos de capacitación a todo nivel, con efectos positivos
posteriores.
• El impacto sobre toda la región en términos de experiencias participativas
exitosas, como ha venido siendo el caso de los gobiernos locales de Angaraes,
/LUFD\ -XOFDPDUFD \ &DVWURYLUUH\QD TXH SURPRYLHURQ OD LQFOXVLyQ GH OD
sociedad civil en la gestión publica y los PP antes de las leyes nacionales al
respecto.
• El fortalecimiento de la autoestima e identidad huancavelicanas, y la valoración
de la sabiduría y cultura popular andina.
• /DSRVLELOLGDGGHOLQWHUFDPELRGHH[SHULHQFLDVFRQRWURVGHSDUWDPHQWRVTXH
vienen desarrollando experiencias de desarrollo local participativo, sostenido
y descentralista.

(OSURFHVRGHSODQLÀFDFLyQGHSDUWDPHQWDOFRQWyFRQHODSRUWHVLJQLÀFDWLYRGH
LQWHOHFWXDOHVORFDOHV\QDFLRQDOHVTXLHQHVDWUDYpVGHORVIRURV\RWDOOHUHVVXSLHURQ
articular su experiencia y conocimientos con la experiencia y conocimientos de los
DVLVWHQWHVSDUDGLVHxDUORVSODQHVFRPXQDOHVSDUWLFLSDWLYRV

8QD H[SUHVLyQ GH OD LQÁXHQFLD SRVWHULRU GH 0(&2'(+ YLHQH VLHQGR OD
conformación de la coordinadora GESORI (Gestión Social del Riego) en la zona
sur de la provincia de Angaraes, impulsada en su primera fase por Aristión Tinoco,
entonces alcalde de Julcamarca. En GESORI se han reunido como espacio de
concertación los alcaldes de la zona con el objetivo de fomentar la producción
agropecuaria a través de proyectos de riego. Ello ha obtenido ahora ultimo el respaldo
ÀQDQFLHURGHOD&RPLVLyQ(XURSHD\ODFRQWUDSDUWLGDGHO(VWDGR

155
Juan Arroyo y Marina Irigoyen

A pesar de esos logros hubo una dificultad seria para avanzar hacia la
implementación del Plan de Desarrollo Integral, tanto por falta de voluntad política
GHOJRELHUQRFRPRSRUODFULVLVSROtWLFDTXHDWUDYHVDEDHOSDtVHQDTXHOPRPHQWRD
ÀQHVGHORV

5. Finalización de la experiencia
Las autoridades municipales y dirigentes sociales participantes en la MECODEH
WXYLHURQ XQD SDUWLFLSDFLyQ DFWLYD HQ OD PRYLOL]DFLyQ TXH ORV )UHQWHV 5HJLRQDOHV
KLFLHURQKDFLDÀQDOHVGHORVSLGLHQGRHOÀQGHOUpJLPHQIXMLPRULVWD'HLJXDOIRUPD
la experiencia de MECODEH fue clave para la formación de Red Perú pues fueron
VXVGLUHFWLYRVORVTXHFRQMXQWDPHQWHFRQORVDOFDOGHV\OtGHUHVGHRWUDVH[SHULHQFLDV
de concertación en el país, fundaron dicha red en el 2000.

+DFLD HO DxR  OD H[SHULHQFLD IXH OOHJDQGR D VX WpUPLQR (Q HVH DxR VH
dieron las elecciones abiertamente fraudulentas de abril y junio, la Marcha de los 4
Suyos en julio, la fuga de Fujimori a Japón en octubre y la instalación del Gobierno
GH7UDQVLFLyQHQQRYLHPEUH(QHVHDJLWDGRDxRPXFKRVGHORVSURWDJRQLVWDVGHOD
MECODEH estuvieron no sólo asumiendo roles regionales sino nacionales y no
sólo sociales sino políticos, como sucede normalmente en las etapas electorales en el
3HU~TXHVRQORVPRPHQWRVGHODVRFLHGDGSROtWLFD\QRWDQWRGHODVRFLHGDGFLYLO(Q
ese contexto, en enero del 2001, el Gobierno de Transición creó legalmente la Mesa
de Concertación de Lucha contra la Pobreza (MCLP), cuya coordinación encargó al
Padre Gastón Garatea. De esta forma se institucionalizó la experiencia de decenas de
Mesas de Concertación existentes en el país. CARE Perú había promovido 51 Mesas
\ KDEtDQ YDULDV GHFHQDV PiV IRUPDGDV LQGHSHQGLHQWHPHQWH /D ÁDPDQWH 0&/3
HPSH]yDIRUPDUVXVÀOLDOHVGHSDUWDPHQWDOHVHQFDUJDQGRLJXDOPHQWHVXIRUPDFLyQ
\FRRUGLQDFLyQDGLIHUHQWHVSHUVRQDVHQFDGDGHSDUWDPHQWR$OÀQDOHQHOOD
MECODEH en tanto organización se extinguió.

156
Desafíos de la Democracia Participativa Local en la Descentralización

MORROPÓN:
Avances y procesos complejos

157
Juan Arroyo y Marina Irigoyen

MORROPÓN:
Avances y procesos complejos

1. Características generales del ámbito


El distrito de Morropón está ubicado en la provincia del mismo nombre, a
unas tres horas de la capital Piura, contando con cerca de 17 mil habitantes y 8700
electores. “Históricamente está constituido por población vicus y posteriormente
SRUSREODFLyQQHJUDODTXHOOHJySDUDWUDEDMRVGHODVKDFLHQGDVFRQVHUYDQGRHVWD
esencia racial en su vida cotidiana. Morropón es la capital del folklore de Piura, tierra
del tondero y la cumanana, lo cual es un fuerte elemento en la construcción de la
identidad regional.”21

Es una zona agrícola de tierras de muy buena calidad, con condiciones


agroecológicas y climáticas muy favorables y un potencial acuífero subterráneo de
SRFD SURIXQGLGDG OR TXH OH SHUPLWH KDFHU DFWLYLGDG DJUtFROD FRQ HVFDVD DJXD GH
riego por gravedad. Tiene un potencial de aguas subterráneas susceptibles de ser
utilizadas con pozos con bombeo. Por ello desarrolla cultivos rentables como el arroz,
además de maíz, mango y plátanos. Pero hay un desgaste progresivo del suelo por
PDODVSUiFWLFDVTXHYDQSURGXFLHQGRVHGLPHQWDFLyQ\DWHQWDQGRFRQWUDVXFDOLGDG\
productividad. Prima el minifundio.

2. Proceso social local


2.1 Periodización e hitos claves

• Entre 1990 y 1998 asumió la responsabilidad de la gestión municipal


0D[LPLOLDQR5XL]TXHLQQRYyHOHVWLORGHFRQGXFFLyQHGLOLQFRUSRUDQGROD
SODQLÀFDFLyQFRQFHUWDGD
‡ (Q  HQ HO JRELHUQR ORFDO GHO DOFDOGH -XOLR /DP WLSLÀFDGR FRPR GH

___________________________________________________
21 CESIP. Promoción de la equidad de género en el desarrollo local. La concertación entre municipalidad y sociedad civil. CESIP.
2003. Lima.

158
Desafíos de la Democracia Participativa Local en la Descentralización

LQÁXHQFLDIXMLPRULVWDVHIRUPXOyXQ3ODQGH'HVDUUROOR(VWUDWpJLFRSDUD
DxRVGHMDQGRGHODGRHO3ODQFRQFHUWDGR\ODVDFFLRQHVFRQMXQWDV
‡ (Q HO DxR  FRQ HO *RELHUQR GH 7UDQVLFLyQ  VH LQVWDOy OD 0HVD GH
&RQFHUWDFLyQGH/XFKDFRQWUDOD3REUH]D7DPELpQHQHVHDxROD21*
&(6,3GHVDUUROOyXQSUR\HFWRTXHEXVFyFRPSURPHWHUODJHVWLyQPXQLFLSDO
FRQODHTXLGDGGHJpQHUR
• A partir del 2003, con el actual alcalde aprista Carlos Ramos, se retoma el
Plan de Desarrollo y el apoyo a la Mesa de Concertación

2.2 Hechos relevantes


• En una primera fase, a inicios de los 90, se impulsó el Plan de Desarrollo
y acciones de concertación. La gestión municipal facilitó la formación de
líderes varones y mujeres, poniendo énfasis en el aporte y la participación
de la mujer. Así se conformó la Asociación de Mujeres Por la Vida y por la
Paz.
• Con el apoyo de ONGs como el Centro IDEAS y en convenio con CESIP,
a inicios del 2000, se constituyó la Red de Regidoras Mujeres, siendo su
presidenta la teniente alcaldesa. Con ellas se impulsó un trabajo formativo
con regidoras de diferentes regiones incluyendo acciones de corte binacional.
También se impulsó un Comité de Lucha contra la Violencia Familiar y
con los trabajadores de la propia municipalidad se organizaron talleres y
actividades varias de sensibilización en estos temas.
‡ (Q VX SULPHUD HWDSD  OD 0&/3 LQWHJUDED D OD 3DUURTXLD OD
gobernación, sectores como educación y agricultura, representantes de los
SXHEORVMyYHQHVODDVRFLDFLyQGHPXMHUHV TXHDGHFLUGHO3iUURFRHUDQODV
TXHPiVUHFODPDEDQ 6HGLDORJDEDVREUHORVWUDEDMRVTXH)21&2'(6
SUHWHQGtDKDFHUHQOD]RQD´/DPHVDHUDPX\DFWLYDVHxDODHO3iUURFR
actual Presidente de la Mesa. Había reuniones mensuales, talleres, se
organizó el Foro de candidatos a las elecciones. Pero progresivamente las
organizaciones se fueron retirando y la mesa decayó; eso podríamos decir
TXHIXHXQDVHJXQGDHWDSDGHODPHGLDGRVGHOµ
• El actual gobierno municipal, aprista, ha retomado parcialmente el Plan de
Desarrollo Concertado y la mesa de concertación; no creando sin embargo
el CCL.

159
Juan Arroyo y Marina Irigoyen

2.3 Actores fundadores


• (ODOFDOGH0D[LPLOLDQR5XL]HQORVSULPHURVDxRVGHODGpFDGDGHORV
elemento motriz de la experiencia de concertación.
• ,]TXLHUGD8QLGD\HO$35$
• /D21*&,3&$HQODIDVHGHODQ]DPLHQWRTXHWUDEDMyPX\FRRUGLQDGDPHQWH
con el alcalde Ruiz
• /DV 21* &(6,3 \ HO &HQWUR ,'($6 D ÀQHV GH ORV  HQ DVSHFWRV GH
SURPRFLyQGHODHTXLGDGGHJpQHUR

2.4 Logros y limitaciones


(QDxRVGHJRELHUQRPXQLFLSDOGH´L]TXLHUGDµVHORJUyJHQHUDUXQDOyJLFD
de concertación con múltiples actores y una nueva institucionalidad alrededor de un
plan concertado, si bien la lógica de la concertación era más tipo consulta o apoyo
DREUDV\PHWDVPiVTXHXQPHFDQLVPRGHFRQVWUXFFLyQGHFRQVHQVRV\DFXHUGRV
compartidos.

Se contó con una amplia participación de las organizaciones pero este cambio
no atravesó la estructura municipal ni comprometió ampliamente a la población.
&RPR VHxDOD HO PLVPR H[ DOFDOGH 5XL] FRPHQWDQGR HO WUDEDMR GHO &,3&$ HQ ODV
municipalidades distritales de Buenos Aires, Morropón, Vice y Marcavelica, “no
ha sido posible comprometer a todos los actores importantes; siempre se excluyen
DOJXQRVSRUTXHVXVH[SHFWDWLYDVQRVHFXPSOHQHQORVSOD]RVTXHHOORVGHVHDQ\SRUTXH
SUHYDOHFHQDOWRVQLYHOHVGHGHVFRQÀDQ]D«HVWDVLWXDFLyQDWHQWDFRQWUDODVRVWHQLELOLGDG
GHORVSURFHVRV«8QDSUHRFXSDFLyQGHODVDXWRULGDGHVORFDOHVWLHQHTXHYHUFRQ
la debilidad de sus interlocutores y con la necesidad de garantizar canales adecuados
SDUDTXHODVSURSXHVWDV\ORVDFXHUGRVOOHJXHQDORVUHSUHVHQWDGRVµ22 Efectivamente,
pese a todos los esfuerzos, al parecer no se logró superar una relativa desconexión
entre líderes y bases.

8QUHVXOWDGRLQWHUHVDQWHGHHVDHWDSDHVTXHVHOOHJyDIRUPDUXQDJHQHUDFLyQ
de lideres, incluyendo a mujeres, con una perspectiva de cambio y de acercamiento
al desarrollo rural. Se avanzó además en una mayor sensibilización en relación a la
HTXLGDGGHJpQHUR

___________________________________________________
22 Ruiz Maximiliano. La Concertación para el Desarrollo Local y Regional en Piura. En ONG, Concertación y Desarrollo Local.
Lima: CEPES, ALOP, 1999.

160
Desafíos de la Democracia Participativa Local en la Descentralización

En esta experiencia fue clara la influencia y apoyo de diversas ONG,


HVSHFLDOPHQWH GH &,3&$ HQ HO LQWHUpV GH FRQFUHWDU XQ PRGHOR GH SODQLÀFDFLyQ
concertada, conjuntamente con otros distritos y en el nivel regional. En los aspectos
GHJpQHURIXHURQYDULDVODV21*VTXHDSR\DURQHOGHVDUUROORGHOWHPDLQLFLDOPHQWH
el Centro IDEAS con la Red de Promoción de Mujeres, en todo el Valle del Alto
Piura y luego CESIP.

3. La situación actual
3.1 Características y condiciones organizativas de la
sociedad civil
Tradicionalmente Morropón ha sido una zona polarizada entre el APRA y la
,]TXLHUGDIXHU]DVTXHD~QFRQVHUYDQSUHVHQFLDHQHOGLVWULWRVLHQGRVXGLQiPLFD
más activa en la época electoral. En términos organizativos el distrito es de nivel
intermedio; se percibe una disminución de la vida organizacional frente al período 90-
98. Sin embargo aún hoy hay una amplia gama de nuevas organizaciones productivas
y antiguas organizaciones como la de productores, comunidades campesinas, y se
empieza a organizar la zona urbana.

3.2 Apertura democrática del gobierno local


(ODFWXDODOFDOGH&DUORV5DPRV²XQDFWLYRFRPHUFLDQWHORFDOGHÀOLDFLyQDSULVWD
DTXLODWD\UHFRQRFHODH[SHULHQFLDDFXPXODGDGHSODQLÀFDFLyQFRQFHUWDGDSODQWHDQGR
su recuperación. Con motivo del proceso de Presupuesto Participativo planteó revisar
y actualizar los objetivos del Plan. Es un aliado de la Mesa de Concertación y coordina
HVWUHFKDPHQWHFRQOD3DUURTXLDSDUDHOOR

/DDFWXDOYLVLyQPXQLFLSDOLQFRUSRUDXQHQIRTXHGHULHVJRVSUREDEOHPHQWHSRU
ODLQÁXHQFLDGHOSUR\HFWR3'56GH*7=FRQHOTXHVHWLHQHXQFRQYHQLR$KRUD
se está implementando el Plan de Ordenamiento Territorial con apoyo del PDRS
²*7=&21$0-$6$3TXHSODQWHDOD]RQLÀFDFLyQHFROyJLFDSURGXFWLYDWUDWDQGR
de revertir la depredación de áreas agrícolas.

En el marco de la nueva Ley Orgánica de Municipalidades la municipalidad ha


cumplido con impulsar el Presupuesto Participativo en el 2003 y 2004, coordinando
con la MCLP. En referencia a las rendiciones de cuentas, se realizó una primera

161
Juan Arroyo y Marina Irigoyen

Audiencia Pública en mayo del 2003, con cerca de 200 participantes; y la segunda
en enero del 2004, con 300 participantes. Allí informaron de los gastos, recursos
disponibles, obras.

Hacia el 2003 el alcalde y el Párroco se comprometieron en relanzar la Mesa de


&RQFHUWDFLyQGH/XFKDFRQWUDOD3REUH]DHQORTXHVHUtDVXWHUFHUDHWDSDEXVFDQGRUHQRYDU
su accionar como espacio de diálogo interinstitucional. Pero este proceso aún no da frutos.
La Mesa no llega aún a levantar vuelo aparentemente por las múltiples ocupaciones de
ORVDFWRUHVDXQTXHHOSURFHVRHVPiVFRPSOHMRFRPRYHUHPRVPiVDGHODQWH

Todas las actividades han llevado a una cierta saturación de acciones referidas
al planeamiento: se trató de actualizar el Plan Estratégico de Desarrollo, con apoyo
GHOD)XQGDFLyQ(EHUWSHURHOSURFHVRTXHGySDUDOL]DGRSRUTXHVHJ~QVHxDODHO
alcalde, existiría una sobrecarga de tareas fruto del PP y del Plan de Ordenamiento
7HUULWRULDO-XVWDPHQWHH[FXVDTXHQRVHKDIRUPDGRHO&&/SRUTXHKD\PXFKDV
DFWLYLGDGHVTXHKDQFDUJDGRVXGLQiPLFD

3.3 Nivel de participación de la sociedad civil

8QD RUJDQL]DFLyQ TXH HVWDED DSDUHQWHPHQWH IRUWDOHFLGD OD $VRFLDFLyQ GH


0XMHUHVHQ'HIHQVDGHOD9LGDVHKDGHVRUJDQL]DGR(VWDVHFUHyHQHODxR\HQ
sus mejores momentos llegó aglutinar a cerca de 1,500 mujeres en 42 comités de
base; recibía el apoyo de diversas ONG como CIPCA y Centro IDEAS. Coincidiendo
con un apoyo muy limitado de las ONG, en la actualidad tienen muy restringidas
VXVDFWLYLGDGHV´+R\HQGtDQRKD\DVHVRUtDQRKD\DSR\RGH21*µVHxDODXQDH[
GLULJHQWD/DRUJDQL]DFLyQGHPXMHUHV\DQRWLHQHODFRQYRFDWRULDTXHDQWHVORJUDED
VHxDODWDPELpQHODOFDOGHDFWXDODOJXQDVDXWRULGDGHVRSLQDQTXH´HQWUHHOODVQRPiV
rotan los cargos” y por tanto “no hay aceptación de la población hacia ellas”. Sin
embargo tienen un asiento en la Mesa de Concertación.

+D\RUJDQL]DFLRQHVGHOSDVDGRTXHVHUHFXHUGDQFRQQRVWDOJLDR\DQRH[LVWHQ
6HPHQFLRQDTXHHQODpSRFDGH)XMLPRULVHIRUPyHVSRQWiQHDPHQWHXQ)UHQWHGH
'HIHQVDSDUDTXH)21&2'(6FRQWUDWDUDPDQRGHREUDORFDO\TXHORJUyDOJXQDV
reformas en los contratos, pero luego desapareció el Frente. Las organizaciones más
tradicionales de la población no llegan a participar decididamente en las instancias
nuevas y la población rural ha ido dejando la participación en la MCLP. El sacerdote a
FDUJRGHODDQLPDFLyQGHOD0&VHxDODORSDUDGyMLFRGHODVLWXDFLyQVHTXLVRUHLPSXOVDU

162
Desafíos de la Democracia Participativa Local en la Descentralización

ODPHVDFRQODSDUWLFLSDFLyQGHOD]RQDUXUDO\´DOÀQDOHOORVQRYLHQHQ\\DQRQRV
UHXQLPRVµ(OGHFOLYHGHOD0&/3HVH[SOLFDGD´SRUTXHODJHQWHQRJDQD\QRUHFLEH
apoyo por parte de la municipalidad”, lo cual es refrendado por el presidente de las
5RQGDVTXHVHxDODTXHVXUHSUHVHQWDQWHQRDFXGHDODVUHXQLRQHVSRUTXHYLYHOHMRV
Es decir, integrar a la gente de campo supone enfrentar gastos básicos de traslado,
UHIULJHULRVDORMDPLHQWRTXHFXDQGRQRVRQFXELHUWRVGHVDQLPDQODSDUWLFLSDFLyQD
ORTXHKDEUtDTXHDxDGLUTXHODJHQWHGHVHDYHUUHVXOWDGRVFRQFUHWRV

Las rondas campesinas, constituidas en 1985 se mantienen como espacios de


defensa del abigeato y buscando mantener el orden en los propias comunidades. Ahora
se rigen por la nueva Ley de Rondas Campesinas, y coordinan con las autoridades.
3DUDHOORKDQÀUPDGRFRQYHQLRVGHFRRSHUDFLyQDXQTXHQRUHFLEHQQLQJ~QDSR\R
+DFHGRVDxRVVHUHRUJDQL]DURQ(O3UHVLGHQWHGHOD&HQWUDOGH5RQGDVVHxDODTXHVH
agrupa a unos 600 ronderos en 17 comités. Un interesante caso es el la Ronda Piedra
GHO7RURHQTXHKD\XQDDPSOLDSDUWLFLSDFLyQGHPXMHUHVVRQPXMHUHV\YDURQHV
Las mujeres rondan de día, los varones de noche. Preguntado el Presidente de la
5RQGDVREUHODVPRWLYDFLRQHVGHVXODERUVHxDOyTXHODPD\RUtDEXVFDEDVXGHIHQVD
HYLWDU TXH VH JHQHUHQ SUREOHPDV HQ VXV ]RQDV \ TXH QR WLHQHQ QLQJ~Q EHQHÀFLR
material. No obstante ese espíritu altruista, los ronderos se ofrecen para cuidar en
FDVRGHÀHVWDVSDUDHYLWDUSUREOHPDVSHURVLHPSUHSLGLHQGRFLHUWDFRPSHQVDFLyQ
La juventud no se ha integrado a las Rondas, y no hay una estrategia para ello.

$XQTXHQRTXHGDFODURVLIXHSRUDFFLyQGHODPXQLFLSDOLGDGRSRULQLFLDWLYD
propia, se está impulsando desde el 2002 la organización de los jóvenes existiendo
una asociación JORDEPAZ, Jóvenes Organizados por el Desarrollo y la Paz,
DUWLFXOiQGRVHFRQLQLFLDWLYDVGHOD3DUURTXLD1RIDOWDVLQHPEDUJRTXLHQHVRSLQDQTXH
la municipalidad tendría un interés político partidario en esta labor. JORDEPAZ se
organizó en cinco comisiones referidas a educación, deportes y cultura; producción
y servicios; derechos humanos; imagen institucional; salud y medio ambiente.
$FWXDOPHQWHUHFLEHDSR\RPXQLFLSDO\WLHQHSUHVHQFLDHQÀOLDOHVHQORVFDVHUtRVGH
Morropón. A partir de la iniciativa se ha establecido una Mesa de Diálogo Permanente
GHOD-XYHQWXGTXHFRRUGLQDFRQXQD0HVD7pFQLFDGH-XYHQWXGHVDXVSLFLDGDSRUXQ
congresista; no tienen mayores relaciones con otros espacios.23

+D\ SUHVHQFLD GH RUJDQL]DFLRQHV MXYHQLOHV SDUURTXLDOHV \ DVRFLDFLRQHV GH


productores de arroz y de maíz, además de 5 comedores populares.

___________________________________________________
23 Macassi Sandro. Juventud y Gobiernos Locales. Espacios y Mecanismos de Concertación. CONAJU, GTZ. 2004. Lima.

163
Juan Arroyo y Marina Irigoyen

En estos procesos no hay liderazgos contundentes, los ex candidatos no se


LQYROXFUDQ HQ ORV SURFHVRV SDUWLFLSDWLYRV \ HV OD FRQYRFDWRULD PXQLFLSDO OD TXH
orienta el trabajo colectivo. No hay nuevos liderazgos de jóvenes ni se visualizan
OLGHUHVDVHOWUDEDMRFRQMXYHQWXGHVHVD~QLQLFLDO\ORVDYDQFHVTXHVHGLHURQHQ
términos de formación de liderazgos femeninos no han tenido continuidad; en
UHDOLGDGVHYLVXDOL]DTXHQRVHSUHYpODIRUPDFLyQGHXQDJHQHUDFLyQGHUHFDPELR
$SHVDUGHHOORVHREVHUYDTXHKD\PiVDXWRULGDGHVPXMHUHVTXHDQWHVWUHVMXH]DV
y un juez, por ejemplo; y hay menos violencia familiar también por acción de la
DEMUNA.

3.4 Calidad de los productos concertados


El Presupuesto Participativo ha tenido como referente el Plan Estratégico. En
HO33VHDSUREyODUHFRQVWUXFFLyQGHOWHPSORODDGTXLVLFLyQGHXQWHUUHQR
para la UGEL, la ampliación de mercado, energía eléctrica y agua potable. El PP del
2004-2005 evidencia el interés municipal y de la sociedad civil para invertir en obras
TXHEHQHÀFLHQODDJULFXOWXUD(QWUHORVSUR\HFWRVDSUREDGRVGHVWDFDQORVUHIHULGRVDO
PHMRUDPLHQWRGHFDPLQRVSDUDODVDOLGDGHSURGXFWRVDJUtFRODVODHOHFWULÀFDFLyQGH
SR]RVWXEXODUHVTXHSHUPLWDQDFFHGHUDULHJRHQpSRFDGHHVWtRODGHIHQVDULEHUHxD
(con apoyo de GTZ y del Ministerio de Agricultura), el barraje para el mejor manejo
de las aguas del río, etc. En se sentido se está dando la co-inversión, de forma tal
TXHORVDJULFXOWRUHVFRORTXHQXQDSDUWHGHORVUHFXUVRVGHLQYHUVLyQ DUD]yQGH
nuevos soles por hectárea).

6L ELHQ KD\ SHTXHxDV REUDV GHVWLQDGDV DO VHFWRU VDOXG FRPR OD DPSOLDFLyQ
del Centro de Salud, y algunas aulas o servicios higiénicos de escuelas, se reconoce
TXHFRPRSDUWHGHO33RGHRWUDVDFFLRQHVPXQLFLSDOHVQRVHYLVXDOL]DQSUR\HFWRV
con énfasis particular en la mejora de la condición de la mujer ni una preocupación
HVSHFtÀFDVREUHODSREUH]D/DOyJLFDPXQLFLSDOHVTXHDODSR\DUORSURGXFWLYRVH
GLYHUVLÀFDUi \ PHMRUDUi OD DJULFXOWXUD SRU WDQWR VH DWDFDUi OD SREUH]D DO FUHDUVH
nuevos empleos.

La municipalidad ha intentado mejorar la cobertura del Vaso de Leche,


HPSH]DQGRFRQXQDGHSXUDFLyQGHORVSDGURQHV\DTXHVHHQFRQWUyTXHPXFKRV
GHORVEHQHÀFLDULRVHUDQVHFWRUHVTXHWHQtDQHPSOHRSURIHVRUHVIDPLOLDVFRQKLMRV
mayores, etc. Esto conllevó muchas críticas de la población, pero hay interés en
proseguir con estos trabajos.

164
Desafíos de la Democracia Participativa Local en la Descentralización

3.5 Efectos del proceso de concertación sobre las


organizaciones en general y de las organizaciones de
mujeres en particular
Sectores de la juventud han mejorado sus niveles organizativos y empiezan a
tener voz en los espacios públicos; participan también de la MCLP. Por otro lado, la
Asociación de Mujeres no llegan a retomar su espíritu de trabajo colectivo, habiendo
VtOLGHUHVDVFRQQRWDGDVTXHVHDUWLFXODQHSLVyGLFDPHQWHDHVSDFLRVS~EOLFRV

Como consecuencia del PP se han generado reacciones adversas; hay


RUJDQL]DFLRQHVTXHUHFRQRFLHQGRTXHKXERXQDFRQVXOWDPDQLÀHVWDQFUtWLFDVDO
Presupuesto Participativo al no lograr sus objetivos; por ejemplo, la asesora de la
$VRFLDFLyQGH0XMHUHVVHxDODVXGHVFRQWHQWRSRUTXH´QRVHKDDSUREDGROD&DVDGHOD
0XMHU\VtHOPHMRUDPLHQWRGHOD&DVDGHORV%RPEHURVFODURHODOFDOGHHV%RPEHUR«
\ORTXHPiVFyOHUDGDHVTXHKDQVLGRPXMHUHVODVTXHQRDSR\DURQHVWDLQLFLDWLYDµ
7DPELpQHOSUHVLGHQWHGHODFHQWUDOGH5RQGDV&DPSHVLQDVPDQLÀHVWDVXGHVFRQWHQWR
SRUTXHQRVHDSR\yODUHIDFFLyQGHVXORFDODSHVDUTXHVHDSUREyHQODVVHVLRQHVGH
debate del PP; aparentemente no se implementó por falta de recursos.

Estos casos son ejemplos de una forma de pensamiento de muchos delegados


GHRUJDQL]DFLRQHVVRFLDOHVTXHFRQVLGHUDQTXHSRUOOHYDUVXSURSXHVWDHVWDGHEHUtD
VHUDFHSWDGD(OORREHGHFHUtDDTXHQRVHWUDVPLWHFODUDPHQWHODV´UHJODVGHMXHJRµGH
HVWDPRGDOLGDGGHSDUWLFLSDFLyQFRQFHUWDGDRTXHORVUHSUHVHQWDQWHVQROD´DVLPLODQµ
WHQLpQGRVHDOÀQDOXQDOyJLFDGHGHIHQVDGHODSURSXHVWDGHVXRUJDQL]DFLyQGHVX
“parcela”.

(Q HO GLVWULWR QR VH KD OOHJDGR D FRQVWUXLU XQ QLYHO GH FRQÀDQ]D HQWUH ORV
pobladores, salvo en el nivel básico de vecinos muy cercanos. Subsisten rencillas
HQWUHORVOtGHUHV\ODFRQÀDQ]DHQODVDXWRULGDGHVHVUHODWLYD

3.6 Resultados conseguidos sobre el empoderamiento de la


población, de las mujeres y de los pobres en particular

6HSHUFLEHTXHODVPXMHUHVHQJHQHUDOFRQWLQ~DQDVXPLHQGRVXVUROHVWUDGLFLRQDOHV
DXQTXHHQVHFWRUHVGLULJHQFLDOHVKD\FDPELRVHQUHODFLyQDODHTXLGDGGHJpQHUR

165
Juan Arroyo y Marina Irigoyen

En cuanto al empoderamiento poblacional, los mayores cambios se procesan en


ODVDXWRULGDGHV\OtGHUHVTXHYDQDVXPLHQGRXQHVStULWXGHFRQFHUWDFLyQ\GHVDUUROOR
SODQLÀFDGRVLQWRGDYtDHQFRQWUDUFyPRLQYROXFUDUPiVDPSOLDPHQWHDODSREODFLyQ
'H KHFKR QR VH HYLGHQFLD TXH ORV VHFWRUHV PiV SREUHV VH KD\DQ LQYROXFUDGR HQ
HVWRVSURFHVRVGHFDPELRVRQSRFDVODVRUJDQL]DFLRQHVTXHSDUWLFLSDQ\HQHOODVQR
establecen un diálogo o canales de comunicación con sus asociados.

166
Desafíos de la Democracia Participativa Local en la Descentralización

SAN MARCOS:
Pionero de la concertación,
modelo añejo por ajustar

167
Juan Arroyo y Marina Irigoyen

SAN MARCOS:
Pionero de la concertación,
modelo añejo por ajustar

1. Características generales del ámbito


La provincia de San Marcos, ubicada en el departamento de Cajamarca, cuenta
con alrededor de 49 mil habitantes y siete distritos, tres de ellos categorizados en
condiciones de pobreza extrema.24

De clima agradable, templado, seco, está a hora y treinta de la capital Cajamarca,


VLHQGRXQD]RQDDJUtFRODTXHSUHWHQGHVHUHO´*UDQHURGHO1RUWHµSRUODSURGXFFLyQ
de cereales y menestras. A pesar de la pobreza (86% de pobreza, y de ellos 25% en
extrema pobreza) se ha logrado un notable avance en la provisión de servicios de
DJXDSRWDEOH\VDQHDPLHQWRVHHVWLPDTXHHOGHODVIDPLOLDVFXHQWDQFRQDJXD
y desagüe en la ciudad y un 62% en la zona rural.25

Cuenta con alrededor de 78% de productores minifundistas, fruto de la


SDUFHODFLyQGHFRRSHUDWLYDV\6$,6TXHQROOHJDURQDSURVSHUDUHQORVDxRV26 La
zona fué consideraba para refugio y descanso por Sendero Luminoso, viviendo la
población por casi una década en medio de escaramuzas.

2. Proceso social local


2.1 Periodización e hitos claves
• Antecedentes: (Q  OD HSLGHPLD GHO FyOHUD PRWLYy TXH LQVWLWXFLRQHV
públicas y organizaciones sociales converjieran en acciones conjuntas para
enfrentar la epidemia y posteriormente trabajaran acciones preventivas
• Constitución del CINDESAM. El Movimiento Integrador San Marcos
2000 asumió el gobierno local provincial para el período 1993-1995. En
___________________________________________________
24 Según el Mapa de Pobreza de Foncodes, año 2000, tres distritos son de condición de pobreza (incluyendo el distrito capital), uno
muy pobre y tres en condiciones de extrema pobreza.
25 Arteaga J.L., Cerna J., Irigoyen M. “Una década construyendo concertación: Los desafíos”. Centro IDEAS Documento en edición,
noviembre del 2004.
26 Censo Nacional Agropecuario, 1994. Se considera minifundio a las unidades agropecuarias con menos de 5 hectáreas.

168
Desafíos de la Democracia Participativa Local en la Descentralización

VHFRQVWLWX\yHO&RPLWp,QWHULQVWLWXFLRQDOSRUORV1LxRV\HO'HVDUUROOR
GH6DQ0DUFRV &,1'(6$0 (QVHPRGLÀFyHOQRPEUHSRUHOGH
Comité Interinstitucional para el Desarrollo de San Marcos, entendiendo
TXHODVDFFLRQHVLEDQPiVDOOiGHODSURWHFFLyQGHODLQIDQFLDVHOHGRWyGH
personería jurídica.
• Institucionalización de la concertación. Hacia 1994 UNICEF y luego
el Proyecto APRISABAC (Convenio Perú- Holanda – Suiza) apoyaron el
SURFHVRGHFRQFHUWDFLyQFRQYLQLHQGRHQTXHODVDFFLRQHVGHORVSURJUDPDV
GHEHUtDQ VHU FRQFHUWDGDV FRPR FRQGLFLyQ SDUD VX DSR\R ÀQDQFLHUR 8QD
amplia dinámica de coordinación se generó alrededor de los proyectos,
VHDSDUDDVXPLULQLFLDWLYDVFRPXQHVUHDOL]DUFDPSDxDVFRRUGLQDUWUDEDMRV
informar, etc. Se estima en casi un millón de dólares los recursos para
LQLFLDWLYDVFRQFHUWDGDVHQWUH\HODxR
• Referente regional. Progresivamente otras instituciones se incorporaron
al CINDESAM, empezó a tener una vida orgánica estable y su experiencia
fué siendo conocida, visitada y constituyéndose en un referente regional.
• Nuevos retos. Hacia el 2000 APRISABAC culminó su ciclo y se restringió
ODFRRSHUDFLyQTXHUHFLEtDHO&,1'(6$0DODYDOÀQDQFLHURGH81,&()
no se lograron nuevas fuentes cooperantes. Algunas municipalidades dejaron
de participar. Con el PP 2003 se dinamizó luego en algo el CINDESAM;
en el marco de la nueva Ley de Municipalidades se constituyó el CCL
Ampliado.

2.2 Hechos relevantes


• 1992. El Movimiento Integrador San Marcos 2000 asumió el gobierno local
provincial para el período 1993-1995, planteando el fortalecimiento de
capacidades de gestión de las municipalidades y organizaciones de base y la
cooperación interinstitucional.
• En 1993VHFRQVWLWX\yHO&RPLWp,QWHULQVWLWXFLRQDOSRUORV1LxRV\HO'HVDUUROOR
de San Marcos CINDESAM, con cinco socios: Municipalidad Provincial,
Centro de Salud, Educación-ADE, ONGs Centro IDEAS y CEDAS.
• Hacia 1994 UNICEF, con el proyecto PROANDES propuso trabajar
proyectos productivos, de salud, educación y saneamiento básico en función
de convenios concertados entre la municipalidad y la población. Poco
después se sumó a esta lógica APRISABAC, como facilitador de proyectos
de salud, agua y saneamiento, desarrollo de capacidades y fortalecimiento
institucional.

169
Juan Arroyo y Marina Irigoyen

• Progresivamente otras instituciones se incorporaron al CINDESAM:


PRONAMACHS, Asociación de Promotores de Salud, Asociación de
Promotores Agroveterinarios, el propio APRISABAC (hasta 1999),
los institutos ISP (Pedagógico) e IST (Tecnológico); así como las seis
PXQLFLSDOLGDGHVGLVWULWDOHVRWUDV21*(,6$SHTXHxDHPSUHVDGHVHUYLFLRV
CINDESAM centralizaba y avalaba las decisiones sobre los proyectos a
presentar a UNICEF y APRISABAC, y asumía la responsabilidad sobre su
ejecución. Algunos proyectos se realizaban con fondos municipales.
• Hacia el 2000 APRISABAC culminó su ciclo de trabajo y se restringió la
FRRSHUDFLyQTXHUHFLEtDHO&,1'(6$0DODYDOGH81,&()VyORVHORJUDURQ
nuevas fuentes cooperantes de menor cuantía.

2.3 Actores fundadores o anteriores


• Entre los principales actores fundadores de la experiencia ha estado sin lugar
a dudas el regidor y luego teniente alcalde Rosseles Machuca.
• /RV DOFDOGHV -XDQ 0DFKXFD \ 1pVWRU 0HQGR]D GRV YHFHV DOFDOGH  TXH
DÀUPDURQHOSURFHVR
• 81,&()\$35,6$%$&TXHSRUPiVGHFLQFRDxRVDFWXDURQFRPRVRFLRV
DODSDUTXHFRPRLQVWLWXFLRQHVGHFRRSHUDFLyQ
• (O&HQWUR,'($6TXHDSR\yHOSURFHVRGHVGHORVLQLFLRV\FRQWULEX\yDOD
sistematización y difusión de sus experiencias
• El MINSA a través de la Red de Salud ha apoyado decididamente el proceso,
asumiendo también la coordinación de CINDESAM
• (O,67\HO,63TXHDQLPDURQHOSURFHVR

2.4 Logros y limitaciones


San Marcos es un referente en términos de concertación a nivel regional y
QDFLRQDO$QLYHOSURYLQFLDOKDSURPRYLGRTXHFDGDYH]PiVDXWRULGDGHV\IXQFLRQDULRV
municipales y de instituciones públicas así como líderes de organizaciones, se
involucren en la concertación. Fue reconocida como una buena práctica de gestión
ambiental en un Concurso Internacional auspiciado por la Cooperación Holandesa
(IHS-PROA- IPADEL) en 1996.

(QWUH VXV ORJURV WDQJLEOHV ÀJXUDQ ODV PHMRUDV HQ WpUPLQRV GH VDQHDPLHQWR
ambiental en la provincia: agua potable rural, letrinas, procesamiento de residuos

170
Desafíos de la Democracia Participativa Local en la Descentralización

sólidos. San Marcos trabaja en la lógica de Agenda 21 y ha sido socio del Foro Ciudades
para la Vida. Un compromiso ambiental ha ido tomando cuerpo por iniciativa de
ONGs, resaltando la agricultura ecológica, siendo esto compartido progresivamente
por la municipalidad, diversas instituciones y agricultores. CINDESAM ha
contribuido en este aspecto al constituirse como un ente de referencia para trabajos
coordinados, intercambio de información, desarrollo de capacidades, actividades de
difusión, etc.

Desde sus inicios CINDESAM ha logrado una institucionalidad bastante


sólida. Cuenta con personería jurídica, actas al día, reuniones periódicas ordinarias
y extraordinarias, citaciones escritas, etc. Impulsó los planes de desarrollo a nivel
provincia y en todos los distritos, con aportes municipales y de ONG. Estableció
una disciplina de programación anual y evaluación de su accionar.

8QORJURLQVWLWXFLRQDODGHVWDFDUHVTXHORJUyVRUWHDUODFUHDFLyQGHOD0&/3
TXHLQLFLDOPHQWHLQWHQWyHVWDEOHFHUVHHQSDUDOHORHQODSURYLQFLDGHVFRQRFLHQGRDO
&,1'(6$0ÀQDOPHQWHVHLQWHJUyHOWHPDSREUH]DFRPRXQ(MHGH7UDEDMRWHPiWLFR
conjuntamente con los ejes de salud, educación, agricultura, por ejemplo. Esta última
mesa ha sido muy activa.

6XSULQFLSDOOLPLWDFLyQKDVLGRHOQRSRGHUFRQYRFDUVXÀFLHQWHPHQWHDODVRFLHGDG
FLYLOHQXQFRQWH[WRGHHVFDVDRUJDQLFLGDGGHpVWDHQODSURYLQFLD'XUDQWHFDVLGLH]DxRV
de existencia del CINDESAM ha resaltado por su iniciativa la propia municipalidad, las
ONG y las instituciones públicas, siendo destacable la participación de las asociaciones
GHSURPRWRUHV$JURYHWHULQDULRV\ODGH6DOXG5HFLpQKDFHXQSDUGHDxRVVHJHQHUDQ
nuevas organizaciones interesadas en involucrarse en los procesos de participación-
FRQFHUWDFLyQ\TXHSLGHQVXLQFRUSRUDFLyQDO&,1'(6$0RDO&&/

+DVLGRUHODWLYDODDFFLyQUHIHULGDDODSURPRFLyQGHGHUHFKRV\HTXLGDGGH
género. Lo más destacable ha sido el interés y práctica de promoción de mujeres en
ODV-XQWDVGH$JXD3RWDEOHTXHWRGRSUR\HFWRDXVSLFLDGRSRU&,1'(6$0FRQOOHYD
'HVWDFDODIRUPDFLyQGHOD'(081$FRPRVROLWDULDDFFLyQHVSHFtÀFDHQGHIHQVDGH
ODPXMHU\ODIDPLOLDQRKD\DFFLRQHVGLULJLGDVDGHVDUUROODUFDSDFLGDGHVRODHTXLGDG
de género.

(Q 6DQ 0DUFRV VH FRQMXJy XQD UHÁH[LyQ PiV SUiFWLFD TXH WHyULFD VREUH OD
SDUWLFLSDFLyQFRQFHUWDFLyQGiQGRVHODWRPDGHGHFLVLRQHVHQODDFFLyQ6HSHUÀODED
la concertación como necesaria para potenciar recursos, atraer inversiones y la
___________________________________________________
27 Al respecto ver Irigoyen M, Concertación Interinstitucional y Mejoramiento ambiental. En: Miranda L (editora) Ciudades para
la Vida. Experiencias exitosas y propuestas para la acción. DGID, IPADEL, IHS, PROA. Lima. 1996.

171
Juan Arroyo y Marina Irigoyen

cooperación. Poco fue el ejercicio teórico sobre los alcances y límites de la concertación
DXQTXHIXHURQYDULDVODVVLVWHPDWL]DFLRQHVTXHSUHVHQWDQHOSURFHVR27

2.5 Factores internos y externos que incidieron en los logros


y limitaciones
La cooperación internacional, el apoyo de ONG y el liderazgo de autoridades
municipales han contribuido notablemente al éxito de San Marcos. Ello ha ido de la
mano del desarrollo de capacidades de líderes y dirigentes en torno a la participación
y concertación. El tener logros tangibles –proyectos de agua potable, proyectos
productivos, mejoras a centros educativos y material de apoyo- con el aporte de la
FRRSHUDFLyQIXHXQDFLFDWHSDUDTXHPXFKDVPXQLFLSDOLGDGHV\21*VVHSOHJDUDQDO
&,1'(6$0SHURWDPELpQKDVLGRXQHOHPHQWRTXHKDQHXWUDOL]DGRODFRQWLQXLGDG
de éste en el período reciente al bajar sensiblemente el aporte externo. Hoy se está
HQ XQD E~VTXHGD GH VRVWHQLELOLGDG GH ORV HVSDFLRV GH FRQFHUWDFLyQ &,1'(6$0
y CCL potenciando los recursos locales y las alianzas, al crearse la Asociación de
Municipalidades del Corredor Económico Crisnejas (AMCEC).

San Marcos también es asociado de REMURPE y fundador de la Red Perú,


asumiendo el alcalde cargos directivos en estas dos asociaciones; el alcalde recibe de
DPEDVRULHQWDFLRQHVVLJQLÀFDWLYDVSDUDVXJHVWLyQ

3. La situación actual
3.1 Condiciones organizativas de la sociedad civil
La pionera Asociación de Promotores de Salud –con cerca de 200 asociados- ya
tiene casi dos décadas de existencia, y la Asociación de Promotores Agroveterinarios
IULVDHQORVDxRVVXH[LVWHQFLD(VWDVVHLQWHJUDURQDO&,1'(6$0VLHQGRORV
agroveterinarios los más activos. Hay además comedores populares, comités de
Vaso de Leche, las APAFA, organización de regantes y en cada caserío su teniente
gobernador.

Las mujeres se han organizado con los tradicionales comités de Vaso de Leche
por barrio o caserío pero están en proceso de reagrupamiento organizacional y
solicitando capacitación para su desarrollo, también entusiasmadas por la posibilidad
GHSDUWLFLSDUHQHO&&/\HO33HOSUy[LPRDxR/D21*6(5HVWiHPSH]DQGR

172
Desafíos de la Democracia Participativa Local en la Descentralización

D DSR\DUODV HQ HO SURFHVR GH SODQLÀFDFLyQ (OOR FREUD SDUWLFXODU LPSRUWDQFLD
DKRUDTXHODPXQLFLSDOLGDGHVWiGLVHxDQGRXQSURFHVRGHDMXVWHGHEHQHÀFLDULRV
GHSXUDFLyQGHSDGURQHV\GHOUDQJRGHHGDGGHORVEHQHÀFLDULRVTXHREOLJDUtDD
ODVGLULJHQWHVGHO9DVRGH/HFKHDGHÀQLUPHMRUVXFDPSRGHDFWXDFLyQ$GHPiV
ODPXQLFLSDOLGDGHVWiFDPELDQGRODOHFKHSURFHVDGDSRUOHFKHIUHVFDTXHFRPSUD
a los productores locales.

En los últimos tiempos en San Marcos se van generando nuevas organizaciones,


auspiciadas por las ONG o proyectos gubernamentales. Son “organizaciones
LQGXFLGDVµDOGHFLUGHODOFDOGHSURYLQFLDO'HVGHKDFHXQSDUGHDxRVVHGLyFXUVRDOD
Asociación de Productores Ecológicos, de Tara, de Forestales, de Cuyes, de lácteos.
La asociación de productores forestales con 32 asociados, por ejemplo, se originó a
partir de un proyecto apoyado por el Centro IDEAS para la producción y conservación
de especies forestales nativas, con un acceso racional al mercado. La Asociación de
Productores de Tara recibió el apoyo de la ONG Terra en la comercialización. La
municipalidad provincial compra leche fresca a los productores de la zona agrupados
como Asociación Pedro Gálvez y la asociación contribuye a tener la oferta agregada
y competitiva. Hay una Asociación de Artesanos en el distrito de Chancay.

Un nuevo y dinámico actor es la Asociación Juventud Sin Fronteras, incentivada


HQVXIRUPDFLyQSRUXQSUR\HFWRGHO&HQWUR,'($6\TXHOXHJR&DODQGULDDSR\D
(VWDGHVDUUROODXQDVHULHGHDFWLYLGDGHVGHFDSDFLWDFLyQ\FDPSDxDVFRQORVMyYHQHV
de la capital irradiándose a los distritos.

Las Rondas Campesinas están presentes en el imaginario popular, en mérito a su


SUHVHQFLDHQORVDxRV\VXODERUGHFRQWUROGHODELJHDWR6LELHQH[LVWHQDKRUDHVWiQ
GLVPLQXLGDVSRUTXHDDOJXQRVGHVXVOtGHUHVVHOHVDFXVyGHYLQFXODFLRQHVFRQHO057$
y fueron encarcelados. Hay algunas iniciativas para tener Rondas Femeninas.

3.2 Apertura democrática del gobierno local


El gobierno municipal actual sigue abierto a la concertación interinstitucional,
\DOLHQWDHOLQYROXFUDPLHQWRGHODVRFLHGDGFLYLO'HDKtTXHKD\DLQVWDODGRHO&&/
ÁH[LELOL]DQGR ORV UHTXLVLWRV GHPDQGDGRV HQ OD /H\ 2UJiQLFD GH 0XQLFLSDOLGDGHV
como el tiempo de vigencia de las organizaciones sociales.

De otro lado, la actual gestión ha procedido a una reorganización municipal,


FRQYRFDQGRSHUVRQDOPiVHVSHFLDOL]DGR\FRQVWLWX\HQGRGRVJHUHQFLDVTXHDVXPHQ

173
Juan Arroyo y Marina Irigoyen

peso propio: la Gerencia de Desarrollo Humano y la Gerencia de Desarrollo


(FRQyPLFR'HVWDFDHQODSULPHUDXQSHTXHxRHTXLSRGHPXMHUHVSURIHVLRQDOHVFRQ
gran compromiso social y laboral. En otras dependencias municipales el porcentaje
de personal femenino es sólo de 20%, pero es mayor al anterior.

El Gobierno Local tiene un férreo compromiso con CINDESAM. Durante


su primera gestión (1995-1998) el actual alcalde contribuyó notablemente a su
dinamización. El anterior alcalde del Movimiento Vamos Vecinos (1999-2002) intentó
LJQRUDU\QHXWUDOL]DUDO&,1'(6$0SHURODSUHVLyQGHODVLQVWLWXFLRQHVORJUyTXHVH
mantuviera su presencia, si bien disminuida, en un contexto de intento de copamiento
GHORVHVSDFLRVORFDOHVSRU)21&2'(6\GHPHQRUDSR\RGHODFRRSHUDFLyQTXH
antes iba directamente a CINDESAM.

'XUDQWHVXVSULPHURVDxRV&,1'(6$0FRQYRFySULQFLSDOPHQWHDUHSUHVHQWDQWHV
de los sectores Salud, Educación, Agricultura, institutos, ONGs, municipalidades
distritales, y con ellos se debatía, decidía, avalaba, ejecutaba y hacía rendiciones de
ORVSHTXHxRVSUR\HFWRVFROHFWLYDPHQWHWHQLHQGRSHTXHxDVLQ\HFFLRQHVÀQDQFLHUDV
TXHDFWXDEDQFXDOPRWRUHVGHODFRQFHUWDFLyQ7DPELpQ&,1'(6$0KDVLGRXQ
espacio de intercambio y apoyo mutuo de esa institucionalidad en acciones comunes
\FRWLGLDQDVSDUDHOGHVDUUROORGH6DQ0DUFRVHIHFWLYL]DQGRRDSR\DQGRFDPSDxDV
GH YDFXQDFLyQ GH DOIDEHWL]DFLyQ SRU OD PHMRUD DPELHQWDO \ SHTXHxRV SUR\HFWRV
SURGXFWLYRV$XQTXHPiVGHELOLWDGRHQODDFWXDOLGDGVHPDQWLHQHFRPRHVSDFLRGH
coordinación público-privada, siendo hoy día un referente de la concertación. El
alcalde preside CINDESAM.

&,1'(6$0PDQWLHQHVXLQVWLWXFLRQDOLGDG(ODxRSDVDGRLPSXOVyORV33(VWH
DxRHQHOPDUFRGHOD$0&(& SUHVLGLGDSRUHODOFDOGHSURYLQFLDO VHKDQGLQDPL]DGR
los PP en todos los distritos, resaltando el liderazgo de CINDESAM.

3HUR HQ ORV ~OWLPRV PHVHV VH FRQVWDWD TXH KD\ XQ YpUWLJR GH UHXQLRQHV \
DFFLRQHV FRQFHUWDGDV TXH HVWiQ OOHYDQGR D OD VDWXUDFLyQ HQ OD FDSLWDO GLVWULWDO
Todas las semanas las instituciones coordinan tras el izamiento del Pabellón
1DFLRQDOVHxDODFRQRUJXOORHODOFDOGH1pVWRU0HQGR]D(VWRVHKDFHHQVHVLRQHV
DELHUWDVFRQSUHVHQFLDGHFXDOTXLHUFLXGDGDQRLQWHUHVDGR/DVUHXQLRQHVIRUPDOHV
GHO &,1'(6$0 VRQ RWUDV PHQRV IUHFXHQWHV (V SUREDEOH TXH ODV UHXQLRQHV
dominicales puedan afectar la dinámica más institucional del CINDESAM, a lo
TXHVHVXPDHOVXUJLPLHQWRGHO&&/

174
Desafíos de la Democracia Participativa Local en la Descentralización

La conformación del CCL tardó en San Marcos. Recién se constituyó en junio


GHHVWHDxRWUDVPXFKRGHEDWHHQ&,1'(6$0VREUHVXSHUWLQHQFLD\ORVUROHVD
cumplir- y más por la necesidad de cumplir con la LOM en los PP. Se ha considerado
el CCL como una instancia ejecutora de los acuerdos del CINDESAM, como un
brazo ejecutor. La municipalidad ha formalizado la presencia de un representante
de CINDESAM en el CCL. Éste cuenta actualmente con una mayor presencia de
RUJDQL]DFLRQHVVRFLDOHVTXHODGHO&,1'(6$0DOOtHVWiQSUHVHQWHVODVDVRFLDFLRQHV
de productores de tara, de forestales y de cuyes.

Nuevos retos enfrenta hoy CINDESAM al haberse establecido, por ley, el


&&/WHQLHQGRTXHFRPSDUWLUDOJXQDVGHODVIXQFLRQHVTXHDQWHVHMHUFtD$XQTXH
QRHVWiQWRWDOPHQWHFODURVORVPHFDQLVPRVGHDUWLFXODFLyQVHSODQWHDTXHWUDEDMHQ
conjuntamente y se convoca a nuevos actores.

(O33KDVLGRHOHVSDFLRGHWUDEDMRPiVDQLPDGRGHODxR6HWUDEDMy\HQULTXHFLy
el Instructivo del MEF teniendo como criterios de aprobación de proyectos su alcance
así como el aporte de contrapartida.

3.3 Nivel de participación de la sociedad civil


/DVQXHYDVRUJDQL]DFLRQHVVRFLDOHVFUHDGDVHQORV~OWLPRVDxRVKDQFDPELDGR
HO WtSLFR HVFHQDULR VDQPDUTXLQR GH OD VRFLHGDG FLYLO FX\D UHSUHVHQWDFLyQ HVWDED
concentrada en los productores agroveterinarios y en organizaciones de salud. Además
de las nuevas organizaciones, las rondas campesinas se han reactivado y las mujeres
del Comité de Vaso de Leche han decidido agruparse en un comité distrital. Todas
estas organizaciones se han hecho presentes en las recientes convocatorias de PP y
5HQGLFLyQGH&XHQWDVTXHUHDOL]DODPXQLFLSDOLGDGSHURD~QQRHVWiQVXÀFLHQWHPHQWH
preparadas para llevar una posición discutida con sus bases. Aparecen las nuevas
organizaciones productivas ya mencionadas como interlocutoras de un nuevo espíritu
de desarrollo productivo.

Sin embargo, se percibe todavía una distancia entre dirigencia y asociados;


FRPRHQPXFKDV]RQDVQRVHLQIRUPDVXÀFLHQWHPHQWHDODVEDVHVGHORDYDQ]DGR
y debatido en los espacios mayores de participación o concertación. Ello se ve
DJUDYDGR SRUTXH ORV PHFDQLVPRV H LQVWUXPHQWRV GH FRPXQLFDFLyQ HPSOHDGRV
DOJXQRV VSRW HQ 79 R UDGLDOHV  QR VRQ VXÀFLHQWHV SDUD LQIRUPDU \ GHVDUUROODU
capacidades en la población.

175
Juan Arroyo y Marina Irigoyen

3.4 Calidad de los productos concertados


6DQ0DUFRVIXHSLRQHURHQODSODQLÀFDFLyQGHOGHVDUUROOR6XSODQSURYLQFLDO\
ORVSODQHVGLVWULWDOHVTXHDOHQWyKDFLDPRWLYDURQODUHÁH[LyQGHODVDXWRULGDGHV
municipales y los líderes sobre su futuro. Pese a ello, no ha habido una acción
sostenida de trabajo con el Plan como marco y el PP lo toma sólo como un elemento
referencial.

En la acción municipal y en los PP la lógica de los proyectos de combate a la


pobreza se centra en la provisión de servicios de agua y saneamiento, así como en
la mejora de la educación, tanto en infraestructura como principalmente en calidad
GHHGXFDFLyQSDUDORVQLxRVPHQRUHV\PDWHULDOHVHGXFDWLYRV(ODFWXDODOFDOGHKR\
enfatiza los proyectos productivos de desarrollo. Se han aprobado a nivel provincial
ODPLFURSUHVDGH3RWUHULOORODHOHFWULÀFDFLyQUXUDOGHFDVHUtRV\HO0HUFDGRGH
Abastos. Quedaron sin aprobar proyectos para la formación de liderazgos juveniles y la
creación de microempresas procesadoras de cereales, así como para el fortalecimiento
de hábitos de nutrición. Al parecer la forma de trabajo de los funcionarios es muy
UtJLGD \ FRQVLGHUDQ TXH HVWRV SUR\HFWRV QR SXHGHQ VHU SDUWH GHO 3UHVXSXHVWR GH
Inversión.

La municipalidad ha puesto en marcha un proyecto denominado “Inserción de


los productores de la leche fresca de vaca de de las cuencas del Múyoc y La Bachota al
mercado regional” con el apoyo de ITDG y CARE y en esa preocupación habilitó 35
km de carreteras para facilitar el recojo de la leche con los camiones de la leche Gloria.28
Ello ha incidido evidentemente en el fortalecimiento de la asociación de productores
lácteos.

El PP se trabajó en el nivel distrital y provincial. En el PP del distrito capital


Pedro Gálvez, participaron los 8 miembros de sociedad civil del CCL más otras 5
organizaciones (Comité Vaso de Leche, Liga Distrital de Fútbol, entre otros), 50
representantes de los caseríos y de tres barrios. En el PP provincial se convocó a
los alcaldes distritales, el CCL, CINDESAM e invitados de los sectores (Educación,
$JULFXOWXUD6DOXG ´(VGHUHFRQRFHUTXHIXHSRFDODSDUWLFLSDFLyQGHODUHSUHVHQWDFLyQ
IHPHQLQDHQHO33µVHxDODODUHJLGRUD/LO\4XLUR]

Aún no se ha instituido un sistema de seguimiento a los acuerdos del PP. Se


cumple con lo mínimo establecido respecto a la Rendición de Cuentas (una vez por
DxR DXQTXHQRKD\PHFDQLVPRVWDQFODUDPHQWHHVWDEOHFLGRVSDUDHOOR1RVHFXHQWD
___________________________________________________
28 Huber Ludwig. El estado en busca de su sociedad: fomentando la participación ciudadana en San Marcos y Cajabamba. Informe
de la consultoría para Servicios Educativos Rurales. 2004. Cajamarca.

176
Desafíos de la Democracia Participativa Local en la Descentralización

con una política amplia de comunicación municipalidad- población ni con espacios


S~EOLFRVGHGHEDWHGHODVSURSXHVWDVTXHVHOOHYDUiQRDSUREDUiQHQHO33

3.5 Efectos del proceso de concertación sobre las organizaciones


en general, organizaciones de mujeres y capital social
Las recientemente creadas organizaciones productivas no sólo se reúnen y acuden
al CCL o CINDESAM en la expectativa de concertar para un desarrollo general de
la provincia sino pensando en sus intereses gremiales, explorar un mayor acceso a
mercados especialmente, y para ello han aprendido a articularse y conseguir el apoyo
GHSUR\HFWRVHVSHFLDOHV\21*V$VXPHQQXHYRVHQIRTXHVFRPRORVGHFDGHQDV
productivas y mejoran su compromiso empresarial.

Las asociaciones de promotores de salud y agroveterinarios no han logrado


GDUXQVDOWRFXDOLWDWLYRHQHOSURFHVRDXQTXHVHPDQWLHQHQFRPRXQUHIHUHQWHHQVX
campo y participan episódicamente de reuniones del CINDESAM, aducen falta de
tiempo. Los agroveterinarios más capacitados venden sus servicios. De esas canteras
VXUJHQQXHYRVOtGHUHVTXHLQFXUVLRQDQHQODSROtWLFDSRUHMHPSOR

Recientemente se viene apoyando la formación del Comité Distrital del Vaso


de Leche, y se evidencia un interés en fortalecer organizaciones de mujeres; antes no
KDKDELGRLQLFLDWLYDVHVSHFtÀFDV

(Q WpUPLQRV GH FRQÀDQ]D HQ 6DQ 0DUFRV KD\ XQ UHVSHWR EiVLFR SRU ODV
autoridades municipales y de los sectores, pero se perciben problemas de información
sostenida para llevar a cabo una relación más estable. En la ciudad se ve el surgimiento
de pandillas juveniles como una amenaza; las rondas han contribuido a frenar el
DELJHDWR SRU OR TXH JDQDQ UHVSHWR /D SREODFLyQ SRGUtD VHU FDUDFWHUL]DGD FRPR
KRQUDGD\TXHYDJHQHUDQGRXQHVStULWXHPSUHQGHGRUFUHFLHQWH

3.6 Resultados conseguidos sobre la calidad de vida de la


población
El principal efecto tangible de la concertación es la mejora de la salubridad en
la provincia, las condiciones de agua y saneamiento. Ahora se está explorando el
GHVDUUROORHFRQyPLFRORFDO/DVFDUUHWHUDVDORVGLVWULWRV\ODHOHFWULÀFDFLyQKDVLGR
siempre parte de la agenda de preocupación de los actores y a través del accionar
municipal concertado ahora se trabaja en ello.

177
Juan Arroyo y Marina Irigoyen

Hay algunas mejoras en la calidad de la educación y de la atención de la salud, como


IUXWRGHXQDODERUHQODHGXFDFLyQGHQLxRV\QLxDVFRQPDWHULDOHGXFDWLYRHLncentivos
DORVSURIHVRUHVDVtFRPRSRUHOPHMRUHTXLSDPLHQWRGHOVHFWRUVDOXG\FDSDFLWDFLyQ
para la mejor calidad de atención. Subsisten los problemas de malnutrición infantil a
nivel provincial y no se evidencia una acción de impacto al respecto.

3.7 Resultados conseguidos sobre el empoderamiento de la


población, de las mujeres y de los pobres en particular
3RUDxRVFRQVHFXWLYRVFLQFRJRELHUQRVPXQLFLSDOHVFRQGLIHUHQWHVDOFDOGHV
y grupos políticos han considerado CINDESAM como un puntal para el desarrollo.
A partir de la acción concertada se ha logrado atraer la cooperación y los propios
UHFXUVRVORFDOHVSDUDPHMRUDUVLJQLÀFDWLYDPHQWHODVFRQGLFLRQHVGHYLGD7DPELpQ
la cultura de la concertación es crecientemente interiorizada por las autoridades,
líderes y dirigentes sociales, siendo además una de las experiencias de concertación
SURYLQFLDOHVTXHLQWHJUDDVXVGLVWULWRV6LELHQQRWRGDVODVDXWRULGDGHVOHKDQGDGROD
misma fuerza, se reconoce este espacio y se mantiene el espíritu de concertación.

En esta década de participación-concertación en San Marcos, la agenda de


JpQHURGHGHVDUUROORGHFDSDFLGDGHVRGHSUR\HFWRVRULHQWDGRVDODHTXLGDGKDQ
WHQLGRXQSHUÀOEDMR(VPtQLPRHODFFLRQDU\SRUWDQWRORVLPSDFWRVHQHOGHVDUUROOR
GHODVPXMHUHV8QQ~FOHRTXHVtKDSRWHQFLDGRVXVFDSDFLGDGHVHVHOSDUWLFLSDQWHHQ
los procesos de CINDESAM, especialmente el personal de salud o de educación.
3RUWDQWRODSURPRFLyQGHODHTXLGDGGHJpQHUR\HOGHVDUUROORGHFDSDFLGDGHVGH
las mujeres son una agenda pendiente de atención.

178
Desafíos de la Democracia Participativa Local en la Descentralización

SANTA ROSA:
Reinventando un modelo
de participación

179
Juan Arroyo y Marina Irigoyen

SANTA ROSA:
Reinventando un modelo de participación

1. Características generales del ámbito


El distrito de Santa Rosa está ubicado en la provincia de Melgar, en la parte
noreste del departamento de Puno y se encuentra articulado al eje vial Juliaca – Sicuani
²&XVFR3RVHHXQDH[WHQVLyQGH.P\WLHQHXQDSREODFLyQHVWLPDGDDODxR
2000 de 6,555 habitantes de los cuales el 77.3% es rural. Los niveles de pobreza son
altísimos, bordean el 92,8%, y la extrema pobreza es del 59,5%.

La principal actividad económica es la pecuaria (vacunos, ovinos y camélidos9,


DVtFRPRVXVGHULYDGRVSURGXFFLyQGHOHFKHTXHVRÀEUDGHDOSDFDFKDORQD\HO
FKDUTXL7DPELpQFXOWLYDSURGXFWRVQDWLYRVFRPRODTXLQXD\ODNDxLZD'HHVWRV
SURGXFWRVORVTXHWLHQHQPD\RUFRPHUFLDOL]DFLyQVRQHOTXHVRDORVPHUFDGRVGH
6LFXDQL&XVFR\$UHTXLSD\ODFKDORQDDORVPHUFDGRVGH3XHUWR0DOGRQDGR&XVFR
\$UHTXLSD

2. Proceso social local y/o regional


2.1 Periodización e hitos claves
• A mediados de 1999 CARE Puno promovió con la municipalidad y otras
instituciones locales la instalación de la Mesa de Concertación Interinstitucional
(MCI) de Santa Rosa. En ese entonces el alcalde Domisiano Ccama brindó
un apoyo moderado al proceso, a pesar de tener un fuerte apoyo de actores
externos. Pero la crisis de representación debilitó el proceso apenas iniciado.
6H SUHVHQWDURQ GHQXQFLDV FRQWUD OD PXQLFLSDOLGDG DFXViQGROD GH TXHUHU
instrumentalizar la mesa; actores y líderes apelaron a la confrontación y se
produjo cierto estancamiento

• En el proceso electoral del 2002 fue elegido Julián Páucar como alcalde
distrital, de un total de 11 candidatos en el proceso. La victoria fue muy
estrecha en relación al segundo lugar. Es su segunda gestión como acalde,
sin reelección.

180
Desafíos de la Democracia Participativa Local en la Descentralización

• (QHOFRQHVWHQXHYRJRELHUQRGH3iXFDUGHODVÀODVGHO3'5VH
reinstaló la mesa de concertación pero, a exigencia de la población, se
reformuló el nombre y la estructura: se denominó Consejo de Autogobierno
Local (CAL). En realidad la propuesta recoge la experiencia de Limatambo;
la conformación del CAL tiene la inspiración del Consejo Comunal Vecinal
de Limatambo

• Entre 2003 – 2004 se ha actualizado el plan de desarrollo, se han realizado


presupuestos participativos, rendición de cuentas y el inicio de la vigilancia
ciudadana en las obras del presupuesto participativo.

2.2 Hechos relevantes dentro de cada período


'HVGHHODxR6DQWD5RVDIRUPDSDUWHGHOD5HGGH0&,·VGHODUHJLyQ
Puno. Pero en el seno de Santa Rosa existía una polarización entre la autoridad y
ODVRUJDQL]DFLRQHVVRFLDOHV+DVWDHOSURSLRDOFDOGHDFWXDODÀUPDTXHDQWHVVLHQGR
oposición, “jamás dialogaban sino confrontaban”. La no rendición de cuentas por
las autoridades, la no consulta a la población, la utilización de la Mesa conforme a
sus intereses, alentaban esta confrontación con la población.

$ PHGLDGRV GHO DxR  \ FXPSOLHQGR OD SURPHVD HOHFWRUDO GH DEULU OD
participación se implemento el Consejo de Autogobierno Local (CAL). Según palabras
del propio alcalde esta propuesta tuvo reparos por parte de algunas instituciones
´GHELGRDTXHpVWDVIXHURQODVSURPRWRUHVGHODIRUPDFLyQGHOD0&,\SRUWDQWR
responsables de su crisis, junto con la municipalidad”.

7DPELpQ HQ HO DxR  VH IRUPXOy HO SUHVXSXHVWR SDUWLFLSDWLYR )XH XQ
proceso inicial de aprendizaje y se trabajó en función al nuevo marco institucional del
Estado. Para el 2004 se estudió con sumo cuidado cómo se iba a realizar la ejecución
presupuestal participativa. Todo el proceso duró el 2004 desde mayo hasta julio,
ORJUDQGRLQFOXLURUJDQL]DFLRQHVFRQODVTXHQRVHKDEtDFRQWDGRDQWHULRUPHQWH

A mediados del 2003 se dió la revisión del plan de desarrollo concertado, proceso
de consulta masiva a las organizaciones del distrito, implementándose espacios rurales
y urbanos de consulta.

Hasta el momento no se ha implementado el Consejo de Coordinación Local


(CCL), por decisión de la propia población.

181
Juan Arroyo y Marina Irigoyen

2.3 Actores centrales del proceso


• Municipalidad
• CARE Perú
• Central de mujeres
• CCP/ Federación campesina
• Vicaría

2.4 Logros y limitaciones


El logro mayor del proceso es la legitimidad de un espacio de concertación.
En Santa Rosa no hay paralelismos ni contraposición en torno a la participación
FLXGDGDQD6LQHPEDUJRGHEHPRVVHxDODUTXHQRKDLPSOHPHQWDGRVX&RQVHMRGH
Coordinación Local (CCL). Por propia voluntad de la población decidieron no
LPSOHPHQWDUHO&&/\SURPRYHUVXSURSLRPRGHORDGXFLHQGRTXHHO&&/OLPLWDHO
SURFHVR([LVWHODSURSXHVWDGHTXHHO&&/IXQFLRQHDPDQHUDGHFRPLWpHMHFXWLYR
del CAL.

Aún no se da una apropiación plena del proceso por parte de la población y sus
líderes barriales. Como dice el alcalde Paucar, “algunos no lo perciben como suyo y
no participan, sobre todo los barrios. El punto mas crítico fue a mediados del 2003,
cuando se inició el presupuesto participativo y las organizaciones, especialmente las
barriales no participaban. Ahora se tiene conocimiento de los procesos, y por tanto
KD\PD\RULQWHUpVHQSDUWLFLSDUµ'HÀQLWLYDPHQWHODVRUJDQL]DFLRQHVGHOFDPSRVRQ
las más dinámicas.

7DPELpQ VH GDQ OLPLWDFLRQHV FRPXQHV D RWUDV H[SHULHQFLDV TXH VH DVXPHQ
como desafíos según palabras del propio alcalde: “Falta mayor capacitación, mayor
empoderamiento de todos los actores de la sociedad civil, difusión y comunicaciones
de las actividades y promoción de los ciudadanos de menor ingreso y excluidos.”

(QUHODFLyQDOSDSHOGHORVDFWRUHVH[WHUQRVVHREVHUYDTXHDOJXQDV21*VHQ
HVSHFLDO&$5(3HU~KDQWUDEDMDGRIXHUWHHQHOHPSRGHUDPLHQWRGHORVSHTXHxRV
productores y en la participación social. Es este sector, el de los productores, el
foco de atención de las organizaciones no gubernamentales. Se trata de mejorar su
producción en un proceso articulado a la concertación, buscando generar la seguridad
alimentaria del distrito.

182
Desafíos de la Democracia Participativa Local en la Descentralización

3. La situación actual
3.1 Condiciones organizativas de la sociedad civil
Las organizaciones sociales han pasado por un momento de debilitamiento
en los noventas, estando desarticulados a nivel distrital. La cultura política de las
organizaciones sociales tiene aún fuertes herencias de la cultura de confrontación. Si
HPEDUJRKD\XQDIUDQMDGHRUJDQL]DFLRQHVVRFLDOHVTXHDSXHVWDSRUODFRQFHUWDFLyQ
y el dialogo con la municipalidad.

Podemos diferenciar dos tipos de organizaciones, las urbanas y rurales. Las


urbanas, aglutinadas en los barrios, son los actores menos participativos y más
SUHGLVSXHVWRVDODRSRVLFLyQLJXDOTXHHO687((QHOFDPSRODVRUJDQL]DFLRQHV
rurales y comunidades campesinas son más dinámicas, debido al rol municipal y
GHDFWRUHVH[WHUQRVTXHVHUHODFLRQDQFRQHOORVEXVFDQGRHOPHMRUDPLHQWRGHVXV
productos. Apelando a su interés participar o gremial éstas participan y abren el
diálogo con otras instituciones.

(QHOPDSDGHRUJDQL]DFLRQHVVRFLDOHVÀJXUDOD)HGHUDFLyQ&DPSHVLQD9HFLQDO
6DQWD5RVDTXHDJOXWLQDDODV&RPXQLGDGHVFDPSHVLQDVQRH[HQWDGHWHQVLRQHV\
FRQÁLFWRVODFHQWUDOGHPXMHUHVTXHDUWLFXODDWRGDVODVRUJDQL]DFLRQHVGHPXMHUHV
H[FHSWRDODVTXHWUDEDMDQFRQHO3521$$2WUDVRUJDQL]DFLRQHVGHPHQRUHVFDOD
trabajan en la producción de artesanías locales y hace poco han participado en la
“Expo Puno”, espacio donde antes nunca habían trabajado.

/RVSURGXFWRUHVSDUWLFLSDQVLHPSUH\FXDQGRREWHQJDQXQEHQHÀFLRVHDSDUD
colocar sus productos, mejorar sus precios, abrir nuevos mercados, etc. Están presentes
en el presupuesto participativo. En cuanto a la juventud, no se aprecian organizaciones
juveniles participando, salvo para cuestiones deportivas.

3.2 Apertura democrática del gobierno local


El espacio de concertación del distrito de Santa Rosa, denominado Consejo
de Autogobierno Local (CAL), es conocido como el Parlamento Apu Kunurana. Su
composición es de 120 participantes: la abrumadora mayoría (114) son representantes
de la sociedad civil. Ahí se decide el presupuesto participativo y el plan de desarrollo
concertado, teniendo como premisa gastar el 60% del presupuesto destinado a
inversión en proyectos rurales.

183
Juan Arroyo y Marina Irigoyen

Sus funciones son: elaborar el Plan de Desarrollo Concertado, aprobar el Plan


2SHUDWLYRDQXDODSUREDUHO3UHVXSXHVWR3DUWLFLSDWLYRGHFDGDDxRDSUREDU\SULRUL]DU
ODVREUDV\SUR\HFWRVGHFDGDDxRJHVWLRQDUODSDUWLFLSDFLyQGHODSREODFLyQHQOD
ejecución de las obras y promover la rendición de cuentas.

La participación ciudadana se da también en la ejecución de las obras


priorizadas en el presupuesto participativo y aprobadas en el CAL. Por ejemplo
se ha comprado un tractor y el trámite de compra ha sido vigilado por la propia
comunidad. Los procesos son vigilados por el CAL; ellos mismo trabajan y
promueven los comités de vigilancia ciudadana. Además todos los procesos se
inician y terminan con la rendición de cuentas. Hasta el momento se ha realizado
una audiencia de rendición de cuenta a mediados de la actual gestión y se piensa
realizar la siguiente en diciembre del 2004.

(OSUHVXSXHVWRSDUWLFLSDWLYRWLHQH\DGRVDxRVGHH[SHULHQFLD4XL]iVXQDGHODV
FRQFOXVLRQHVVHDODDWRPL]DFLyQGHJDVWRGHELGRD´TXHWRGRVGHVHDQLPSOHPHQWDUOR
todo”. Se inició el 2003 teniendo como objetivo cumplir con lo establecido por
el instructivo del MEF. Fue un trabajo contra el reloj. En el 2004 teniendo más
experiencia, se procesó mejor el proceso, sobre la base de la estructura del CAL. Se
ha destinado poco más del 60% al PP.

$PHGLDGRVGHODxRVHDFWXDOL]yHO3ODQGH'HVDUUROORGHQRPLQDGR3ODQ
(VWUDWpJLFR&RQFHUWDGR6DQWD5RVDDOFRQXQDYLVLyQGHGHVDUUROORDDxRV
FRQ HO DSR\R GH &$5( 3HU~ \EDMR ODGLUHFFLyQGHXQHTXLSRWpFQLFRHQIRUPD
participativa y durante casi toda la segunda mitad del 2003.

A pesar de la obligatoriedad por ley, no se instaló el CCL y se decidió seguir


trabajando en el CAL. El argumento fundamental para la no implementación del CCL
fue la limitada apertura a la participación de la sociedad civil en dicha instancia, limitada
al 40% en contraposición al 92% de sociedad civil en el Consejo de Autogobierno
/RFDO$GLIHUHQFLDGHRWUDVH[SHULHQFLDVTXHEXVFDURQFRPSOHPHQWDU0HVDV\&&OV
Santa Rosa lo dejó de lado.

3.3 Nivel de participación de la sociedad civil


Un mapeo organizacional encuentra en el distrito 7 instituciones privadas,
 LJOHVLDV OD SDUURTXLD GHO GLVWULWR \ ODV LJOHVLDV HYDQJpOLFDV   RUJDQL]DFLRQHV
campesinas, 7 asociaciones de productores, 30 clubes de madres articulados en
la central de mujeres del distrito, 7 organizaciones barriales de vecinos, el SUTE

184
Desafíos de la Democracia Participativa Local en la Descentralización

GLVWULWDO3URJUDPDGHO9DVRGH/HFKHTXHDUWLFXODDGLYHUVRVFRPLWpVODDVRFLDFLyQ
de comerciantes, 2 asociaciones de jóvenes, la central de rondas campesinas y la
asociación de artesanas.

La sociedad civil participa en el Consejo de Autogobierno Local de manera


masiva. Entre sus 120 integrantes, sólo 6 son autoridades, todos del consejo municipal.
Todos los demás son representantes de organizaciones sociales. Para participar
HQ HO &$/ ODV FRPXQLGDGHV FDPSHVLQDV QRPEUDQ D GRV UHSUHVHQWDQWHV TXH VRQ
denominados consejeros; ellos son los responsables de llevar las propuestas de sus
organizaciones y comunidades. Los mismos representantes del CAL son los agentes
participantes del presupuesto participativo.

Un nivel mucho mayor de participación tanto de organizaciones como de


ciudadanos “de a pie” se da en los denominados cabildos abiertos. Es una herramienta
de gestión institucionalizada por la población y de exigencia común. Todos participan
en este proceso, no necesariamente en forma organizada.

3.4 Efectos del proceso de concertación sobre las organizaciones


En este proceso las organizaciones sociales del distrito han logrado un mayor
empoderamiento. Como se explicó antes, es notorio el interés de las organizaciones
productoras en el desarrollo económico local de manera concertada. También
las organizaciones sociales participan en los procesos participativos y tienen sus
representantes en el CAL. A pesar de esta amplia participación se percibe un
LQVXÀFLHQWHGHPRFUDWL]DFLyQGHODVRUJDQL]DFLRQHVVHGLFHTXHQRVHLQIRUPDDODV
EDVHVTXHORVUHSUHVHQWDQWHVVLHPSUHVRQORVPLVPRVOtGHUHV

8QFDPELRVLJQLÀFDWLYRVHSXHGHREVHUYDUHQODVRUJDQL]DFLRQHVGHPXMHUHV
TXHVHKDQRUJDQL]DGRSDUDWHQHUXQDIXHUWHUHSUHVHQWDWLYLGDG7DOHVHOFDVRGHOD
central de mujeres, relacionadas tanto a la seguridad alimentaria como a la producción
GHSHTXHxDDUWHVDQtD

3.5 Resultados conseguidos sobre calidad de vida de la población


+D\ XQ HQWHQGLPLHQWR DPSOLR TXH PHMRUDU OD FDOLGDG GH YLGD HV SURPRYHU
la generación de empleo. En ese sentido si la participación no logra satisfacer la
demanda de la población en el corto y mediano plazo, puede generar desgaste y luego
frustración. La municipalidad es consciente de esto y ha priorizado el trabajo con las
RUJDQL]DFLRQHVGHDJURJDQDGHURVH[SOLFDQGRTXHVXWUDEDMRGHPDQHUDFRQFHUWDGD
FRQODPXQLFLSDOLGDGORJUDPHMRUHVUHVXOWDGRVTXHDLVODGRV

185
Juan Arroyo y Marina Irigoyen

En Santa Rosa hay ahora una actitud más abierta al aprovechamiento de los
mercados. Las mujeres artesanas están logrando vender sus productos en las diversas
IHULDVSURPRYLGDVSRUODPXQLFLSDOLGDGDOJRTXH´MDPiVKDEtDHQHOGLVWULWRµ/RV
SURGXFWRUHVKDQDELHUWRVXVPHUFDGRVIXHUDSRUHMHPSORHOTXHVRVHFRPHUFLDOL]D
HQORVPHUFDGRVGH6LFXDQL&XVFR\$UHTXLSDODVSLHOHVVHGHVWLQDQDODVSHOHWHUtDV
de Sicuani, como materia prima para la confección de casacas, sandalias y colchas; la
SREODFLyQXUEDQDVHGHGLFDDOFRPHUFLRGHOJDQDGRTXHYHQGHHQODVIHULDVJDQDGHUDV
de los domingos. Un 90% de la gente se dedica al ganado.

6HSXHGHREVHUYDUTXHTXLHQHVPiVUiSLGDPHQWHVHLQVHUWDQHQORVSURFHVRVGH
desarrollo local son los de la franja de productores emprendedores, no existiendo
igual involucramiento de los sectores más pobres y excluidos.

3.6 Resultados conseguidos sobre el empoderamiento de la


población y en particular de las mujeres y los pobres
/DSREODFLyQWLHQHFRQRFLPLHQWRGHO&$/GHELGRDTXHVXVUHXQLRQHVVRQPDVLYDV
especialmente para el presupuesto participativo. En el casco urbano la población de los
barrios asocia al CAL como el espacio donde “se pueden solucionar los problemas del
GLVWULWRµ7RPDQGRODVSDODEUDVGHODOFDOGHVLQHPEDUJRD~QHVLQVXÀFLHQWHODSUHVHQFLD
efectiva de la población, “la participación sigue siendo de líderes”.

Ha existido un empoderamiento en las organizaciones sociales y en especial


de mujeres. Algunas lideresas forman parte de los procesos de concertación y están
presentes como representantes de la Federación Campesina y de la Central de Mujeres
TXHVRQODVPiVHPSRGHUDGDV\IRUWDOHFLGDV3HURHOORD~QQRVHUHÁHMDHQVXFDOLGDG
propositiva.

Tomando la palabra de un promotor de CARE, las organizaciones femeninas


“ahora se preguntan y se interesan, como las de las organizaciones de la Central de
0XMHUHVDKRUDHOODVTXLHUHQVDEHUFyPRWLHQHQTXHSDUWLFLSDUFXiOHVVRQORVUHTXLVLWRV
SDUD SDUWLFLSDU \ VH LQWHUHVDQ SRU ODV QRUPDV TXH VH KDQ SURPXOJDGRµ (V FODUR
TXHPXFKDVLQVWLWXFLRQHVKDQWUDEDMDGRFRQRUJDQL]DFLRQHVIHPHQLQDVSDUDORJUDU
desarrollar actividades no tradicionales, pero el proceso es inicial.

6HDSUHFLDVLQHPEDUJRTXHH[LVWHXQFRVWRHQODSDUWLFLSDFLyQ\WRGDYtDH[LVWH
XQDIUDQMDTXHQRSDUWLFLSD\pVWDVHHQFXHQWUDHQODSREODFLyQPiVH[FOXLGDPDUJLQDO
y pobre. Esta población en tanto no organizada, no tiene los canales de representación
y de inclusión en los procesos.

186
SANTO DOMINGO:
Construyendo un modelo
amplio de participación
Juan Arroyo y Marina Irigoyen

SANTO DOMINGO:
Construyendo un modelo amplio
de participación

1. Características generales del ámbito


Santo Domingo está ubicado en la sierra de Piura, a unas cuatro horas de la
capital departamental, Piura, formando parte de la provincia de Morropón. Se ubica
HQWUHODVVXEFXHQFDVGHOUtR/D*DOOHJD\6DQ-RUJHFRQXQDDOWLWXGTXHRVFLODHQWUH
los 300 y 1400 msnm. Tiene alrededor de 10 mil habitantes y un 10% viven en área
urbana. Los niveles de desnutrición infantil bordean el 35% y la pobreza alcanza al
81% de la población.

Su base es la antigua comunidad campesina de Simiris, siendo una zona


caracterizada por el minifundio, ganadería, pastos y producción de maíz y trigo, para
el mercado local, dándose la reciente introducción de otros cultivos como el frijol
FDEDOOHUR\IULMRODOXELD(QWpUPLQRVGHVHUYLFLRVVRFLDOHVVXVGpÀFLWPD\RUHVHVWiQ
en energía eléctrica (más del 90%), alcantarillado y agua potable (85%); además de
la limitada red vial.

2. Proceso social local


2.1 Periodización e hitos claves
• En 1999 asumió Carlos López la responsabilidad de la gestión municipal.
Hoy está en su segundo período municipal.
• En 1999 la municipalidad suscribió un convenio con CIPCA y el Proyecto PAEN-
GTZ-CTAR (de prevención y recuperación de catástrofes naturales) y se constituyó
XQHTXLSRPL[WRSDUDOLGHUDUHOSURFHVRGHSODQHDPLHQWRHVWUDWpJLFR
‡ (QWUH\HOVHDUPyXQDLQVWLWXFLRQDOLGDGUDPLÀFDGDGHFRQFHUWDFLyQ
HO&2'(', &RQVHMRGH'HVDUUROOR'LVWULWDO TXHOXHJRVHWUDQVIRUPyHQHO
CODELCP (Comité de Desarrollo Estratégico y Lucha contra la Pobreza),
las COMUC (Comisiones Municipales de Concertación) y los CODEZO
(Comités de Desarrollo Zonal).

188
Desafíos de la Democracia Participativa Local en la Descentralización

• En el primer período municipal se establecieron relaciones con la cooperación


internacional
• En el 2003 el alcalde Carlos López fué reelecto
• En el 2004 se instaló el CCL distrital

2.2 Hechos relevantes


En el primer período municipal se constituyó el espacio de concertación, se
procesó el diagnóstico participativo y el planeamiento estratégico. Todo ello se hizo
en dos etapas:29

• La primera etapa, de convocatoria a los actores para generar un acuerdo


social y avanzar en el diagnóstico distrital, la visión y los objetivos, retomando
ODPHWRGRORJtDGHO'LDJQyVWLFR5XUDO3DUWLFLSDWLYR6H]RQLÀFyHOGLVWULWR
en 8 zonas. En una convocatoria amplia, el primer taller tuvo cerca de 250
participantes, generando una agenda y un Plan de Acción Concertado por
zonas. Los ejes estratégicos considerados fueron: Desarrollo Agropecuario;
Educación, Cultura y Deportes; Salud y Saneamiento Ambiental;
Infraestructura y Desarrollo Urbano; y Fortalecimiento Institucional.
• La segunda etapa, también denominada de Construcción de Capital Social,30
HQ TXH VH OOHYDURQ D FDER FXDWUR WDOOHUHV GLVWULWDOHV \ HO GLVHxR GHO 3ODQ
Operativo Concertado. El planeamiento fue de la mano y estuvo apoyado
desde el inicio por el Comité de Desarrollo Estratégico Distrital (CODEDI),
como máxima instancia de concertación para el desarrollo, involucrando
al sector público y privado, así como las Comisiones Municipales de
&RQFHUWDFLyQTXHLQYROXFUDURQDDXWRULGDGHVPXQLFLSDOHV\UHSUHVHQWDQWHV
de sectores y organizaciones según cada tema. Las comisiones formularon su
Plan Operativo y la municipalidad destinó algunos recursos para sus acciones.
La Comisión de Salud y la Comisión de Fortalecimiento Institucional fueron
designadas responsables de la vigilancia del Programa Vaso de Leche.
‡ (QHODOFUHDUVHOD0&/3VHPRGLÀFyHOFRPLWpFRQVWLWX\pQGRVHHO
Comité de Desarrollo Estratégico y Lucha contra la Pobreza, CODELCP,
como instancia de cogestión reconocida por ordenanza municipal.
• En el 2004 se constituyó el CCL Ampliado en el marco de la nueva LOM.

___________________________________________________
29 DFID. Democracia participativa en los Andes. La experiencia de cuatro municipalidades rurales en el Perú. REMURPE, CICDA,
Oxfam GB. Agosto 2003.
30 Entrevista con Juan Pérez, asesor municipal.

189
Juan Arroyo y Marina Irigoyen

2.3 Actores fundadores o anteriores


• El alcalde Carlos López
• El Párroco de la Iglesia Católica
• La ONG CIPCA

2.4 Logros limitaciones


(QHOSULPHUPRPHQWRVHJHQHUyXQDGLQiPLFDGHFRQFHUWDFLyQTXHFRQYRFy
P~OWLSOHV DFWRUHV \ OD LQVWLWXFLRQDOLGDG VH GHÀQLy OD ]RQLÀFDFLyQ GHO GLVWULWR  HO
diagnóstico distrital y plan participativo, en una lógica de incentivo a la participación
de las organizaciones sociales. Hubo interés en impulsar la organización de mujeres,
buscando su articulación a lo productivo como proveedoras del Programa Vaso de
Leche. El convenio CIPCA- Proyecto PAEN- GTZ - CTAR contribuyó efectivamente
HQHVWDIDVHTXHDSURYHFKyHOGHELOLWDPLHQWRGHIXMLPRULVPRHQVXUHFWDÀQDO

La opción municipal fue abrir a la toma de decisiones de la población el precario


presupuesto municipal de inversiones (alrededor de medio millón de soles anual)
SDUDVXGHÀQLFLyQHQXQDOJRPX\SRFRSUDFWLFDGRHQHVRVPRPHQWRVOR
TXHIXHGHODPDQRGHXQDDPSOLDODERUHGXFDWLYDSDUDRULHQWDUODSDUWLFLSDFLyQGHOD
población. De esa forma se reorientó la prioridad de inversión y se dio mayor atención
a las zonas rurales. Se empezó también la relación con la cooperación internacional.
/DH[SHULHQFLDHVXQRGHORVDQWHFHGHQWHVPiVLQWHUHVDQWHVDODQRUPDWLYLGDGTXH
reconoce los espacios de concertación y los PP.

8QDVSHFWRTXHKDVLGRPX\GpELOPHQWHWUDEDMDGRHVHOGHVDUUROORGHFDSDFLGDGHV
DVtFRPRODLQYHUVLyQHQHOUXEURIRUWDOHFLPLHQWRLQVWLWXFLRQDOTXHKDEDMDGRHQHO33

2.5 Factores internos y externos que incidieron en los logros


y limitaciones
El liderazgo local del alcalde es innegable, así como su reconocimiento regional
\QDFLRQDO(QHOGHVDUUROORGHODH[SHULHQFLDLQÁX\HQODVUHODFLRQHVFRQRWUDV]RQDV
como el vecino distrito de Morropón, el apoyo de la ONG CIPCA y de la cooperación
internacional. Por otro lado, es también un factor el apoyo de REMURPE (Red de
0XQLFLSDOLGDGHV5XUDOHV TXHDVHVRUD\SURPRFLRQDHOGLVWULWRFRPRXQPRGHOR

190
Desafíos de la Democracia Participativa Local en la Descentralización

Desde la experiencia de REMURPE Santo Domingo ha impulsado el capítulo de


Municipalidades Rurales de la actual Ley Orgánica de Municipalidades.

3. La situación actual
3.1 Condiciones organizativas de la sociedad civil
El distrito es zona de comunidades campesina, siendo la más importante la de
6LPLULVTXHFXHQWDHQJHQHUDOFRQXQDDPSOLDRUJDQLFLGDG+D\QXHYDVRUJDQL]DFLRQHV
FRPRHO&RPLWpGH3URGXFWRUHVGH&DIp\&DxDGH0HQHVWUDVOD$VRFLDFLyQGH
Ganaderos; la Asociación Distrital de Mujeres de Santo Domingo (ADIMUSAD),
TXHUH~QHDXQDVPXMHUHVHO&/$67DPELpQRUJDQL]DFLRQHVPiVDQWLJXDVFRPR
los 43 Comités de Vaso de Leche y las Rondas Campesinas. Una nueva organización
HVHO&RPLWpGH-XVWLFLD\3D]GHOD3DUURTXLDTXHWUDEDMDHQSDUWLFLSDFLyQ\YLJLODQFLD
ciudadana, teniendo un programa radial.

3.2 Apertura democrática del gobierno local


La municipalidad cuenta con un alcalde y cinco regidores, más una municipalidad
de centro poblado. Hay una regidora mujer.

Desde el 2000 están convergiendo diversas formas organizativas de concertación:


el CODELCP, las COMUC, los CODEZO y el CCL. Hay una clara apuesta por la
participación y el fortalecimiento de una nueva institucionalidad de cogestión, pero la
profusión de instancias podría generar superposiciones y agotar a los participantes.

El CODELCP (antes CODEDI) está presidido por el Párroco y tiene al alcalde como
9LFHSUHVLGHQWH/RLQWHJUDQODVLJOHVLDV&RPLWpGH3URGXFWRUHVGH&DxDGH0HQHVWUDV
cafetaleros y de ganaderos, los 43 Vasos de Leche, la Comunidad Campesina de Simiris,
la Asociación de Mujeres (ADIMUSAD), el CLAS, la Agencia Agraria, la Coordinadora
Educativa, el Centro de Salud, juzgado de paz, Frente de Defensa, Central de Rondas
&DPSHVLQDV$VRFLDFLyQGH5HJDQWHV21*VHQWUHRWURV6HFRQVLGHUDTXHHVODPiVDOWD
instancia de la coordinación y concertación interinstitucional, ubicándose en el organigrama
municipal como órgano consultivo; sesiona cada seis meses.

El CODELCP tiene cuatro atribuciones estratégicas: monitorear, evaluar y


ÀVFDOL]DUHOSODQ\ORVSURFHVRVGHSODQLÀFDFLyQ\JHVWLyQDSUREDU\HYDOXDUORVplanes

191
Juan Arroyo y Marina Irigoyen

operativos de la comisiones municipales de concertación; aprobar la propuesta de


SODQGHLQYHUVLyQPXQLFLSDOGHFDGDDxRÀVFDO\FRQYRFDUHQIRUPDFRQFHUWDGDFRQ
ODPXQLFLSDOLGDGDODDVDPEOHDS~EOLFDGHUHQGLFLyQGHFXHQWDVGRVYHFHVSRUDxR

Las Comisiones Municipales de Concertación (COMUC), han sido concebidas


FRPRyUJDQRVFRQVXOWLYRV\GHÀVFDOL]DFLyQ\DFW~DQWDPELpQFRPRLQVWDQFLDVGH
concertación. Corresponden a los Ejes Estratégicos de Desarrollo. Están integradas
SRUXQUHJLGRUTXLHQHVODVSUHVLGHQXQUHSUHVHQWDQWHGHFDGDLQVWLWXFLyQS~EOLFD
relacionada al tema así como uno de cada organización social de base, un representantes
de las organizaciones productivas y un representante de las autoridades políticas. Sus
reuniones son bimensuales.

En el 2003 se conformó el Comité de Desarrollo Zonal (CODEZO), integrado


por 7 representantes de las 9 zonas, es decir una organización con 63 representantes,
buscando descentralizar la gestión municipal. Como la estructura organizativa se
FRPSOHML]yVHIRUPXOyXQ5HJODPHQWRTXHÀMDIXQFLRQHVGHODVGLIHUHQWHVLQVWDQFLDV
\ TXH OOHYD D UHIRUPDV GH ODV GLIHUHQWHV LQVWDQFLDV HVSHUDQGR TXH pVWDV OH GHQ
sostenibilidad al proceso.

Ante la obligatoriedad de conformación del CCL se buscó una formula creativa.


Así, se constituyó el CCL ampliado, con 32 miembros, 10 elegidos democráticamente
(considerando el alcalde, 5 regidores, 1 alcaldesa del CP Simiris, 3 de la sociedad civil), 9
presidentes de los CODEZOS, 9 presidentes de organizaciones sociales y productivas
de nivel distrital, 1 presidente de CODELP y 3 representantes sectoriales.

3RU RWUR ODGR VH SODQWHD OD H[LVWHQFLD GH XQD $VDPEOHD *HQHUDO 'LVWULWDO TXH
reúne a los 32 miembros del CCL-A, los 63 representantes de los CODEZOS y
UHSUHVHQWDQWHVGH&2'(&$6(VWDVWHQGUtDQTXHVRFLDOL]DU\YDOLGDGHO3ODQGH
,QYHUVLyQ0XQLFLSDOHYDOXDUOD5HQGLFLyQGH&XHQWDV\HMHUFHUHOSURFHVRGHÀVFDOL]DFLyQ
y vigilancia ciudadana de la gestión municipal, buscando su transparencia. Esta se reunió
dos veces en el 2004, para instalar el CCL-A y capacitarse en el PP así como para la
Rendición de Cuentas en julio, socializando y validando los acuerdos del PP 2005.

Toda esta organización aspira a democratizar la gestión edil pero a la vez va


formando una pesada carga, con múltiples reuniones y con roles no tan claramente
GHÀQLGRV&XDQGRVHUHYLVDHORUJDQLJUDPDHVWUXFWXUDOGHODPXQLFLSDOLGDGVHREVHUYD
XQDIURQGRVDUDPLÀFDFLyQGHLQVWDQFLDVGHFRQFHUWDFLyQRFRRUGLQDFLyQ$ODGHUHFKDODV
COMUC o comisiones municipales ampliadas; el CCL-A, los CODEZO, los Comités de
'HVDUUROORGH&DVHUtROD$VDPEOHD*HQHUDO'LVWULWDO\DODL]TXLHUGDHO&2'(/&3

192
Desafíos de la Democracia Participativa Local en la Descentralización

En el distrito se da la Rendición de CuentasGRVYHFHVSRUDxRXQDGHHOODVHQ


XQD&HQDGH1DYLGDGTXHVHRIUHFHDPSOLDPHQWH(ODOFDOGHDVXPHODUHVSRQVDELOLGDGGH
ODVUHQGLFLRQHV(O33IXHGHÀQLGRFRQDPSOLDSDUWLFLSDFLyQGHORVYHFLQRV
´KXERFRPRSDUWLFLSDQWHVHQODUHXQLyQGHPD\RµVHxDODHO*REHUQDGRU

La municipalidad y su alcalde son muy dinámicos en términos de redes y


promoción de su labor: Santo Domingo es socia de REMURPE y el alcalde directivo
e impulsor de ella; forma parte y dinamiza la Asociación de Municipalidades de
OD 6XEFXHQFD /D *DOOHJD6LPLULV  SDUWLFLSD GHO FRQMXQWR GH PXQLFLSDOLGDGHV TXH
promueven la articulación de los Planes de Desarrollo Concertados distritales con
la provincial de Morropón-Chulucanas, con la asesoría técnica del Centro IDEAS y
HOÀQDQFLDPLHQWRGHO)&3$OHPiQ

El Párroco es un convencido de la participación y concertación, y no desaprovecha


espacio alguno para llamar a la población a organizarse en lo productivo. Una de
estas oportunidades fue la Misa Solemne con motivo del aniversario distrital el 2004,
HQTXHGHVGHHO3~OSLWRDQLPyDODSREODFLyQDGHVDUUROODUSUR\HFWRVSURGXFWLYRV
FRPRODSDQHODGHMDQGRGHFRPHUHOD]~FDUGHIXHUDDVtFRPRDDSR\DUODÀHVWDTXH
HO&2'(/&3RUJDQL]DEDSURIRQGRVORVPiVSREUHV'HÀQLWLYDPHQWHVHKDJDQDGR
un sitio en el proceso.

Contribuyen al fortalecimiento organizacional y productivo de los agricultores,


SUR\HFWRV H LQVWLWXFLRQHV FRPR *7= TXH DSXHVWD SRU ODV SHTXHxDV XQLGDGHV
SURGXFWLYDV\&(3,&$)(TXHLQFHQWLYDHOFXOWLYRGHOFDIp\DSR\DODSURGXFFLyQ
de panela. Por otro lado, la municipalidad ha auspiciado una Escuela de Educación
Ciudadana en el 2004, con la participación de 45 jóvenes, par tocar temas de desarrollo
local, descentralización y elaboración de proyectos productivos.31

En general la experiencia tiene gran reconocimiento; es frecuentemente visitada,


se organizan pasantías en ella e intercambios de experiencias.

3.3 Nivel de participación de la sociedad civil


Las nuevas organizaciones generadas, especialmente las productivas, participan
WDPELpQHQODVQXHYDVLQVWDQFLDVGHFRQFHUWDFLyQ+D\LQWHUpVGHODVSHTXHxDVRUJDQL]DFLRQHV
SURGXFWLYDVSRUSDUWLFLSDUWHQLHQGRHQPHQWHTXHHVWRVHVSDFLRVOHVIDFLOLWDQLQIRUPDFLyQ

___________________________________________________
31 Municipalidad Distrital de Santo Domingo. Voz Sanqueña. Revista Informativa de Santo Domingo. Piura. 2004.

193
Juan Arroyo y Marina Irigoyen

mercados, apoyos en general. Las Rondas Campesinas gozan de reconocimiento por


su calidad personal (“ellos son rectos” se comenta) y por haber contribuido a reducir el
abigeato. Hay rondas en diversos sectores y en la zona urbana se organizan cuando hay
problemas como robos. Algunas mujeres participan de las rondas.

La fragilidad de algunas de estas organizaciones se ha mostrado en el caso de la


Asociación Distrital de Mujeres de Santo Domingo (ADIMUSAD). Ésta se asentó en
ORVFOXEHVGHPDGUHV\IXHFRQVWLWXLGDDGKRFHQHODxRFRQHOÀQGHHQFDUJDUVH
del abastecimiento del programa de Vaso de Leche. Pero su dinámica propia fue
HItPHUDVyORSXGRIXQFLRQDUDOYHQGHUODOHFKHDODPXQLFLSDOLGDGSRUXQDxR\DTXH
QRORJUyHQIUHQWDUODUHQRYDFLyQOHJDOGHVXGLUHFWLYDDOJHQHUDUVHFRQÁLFWRVLQWHUQRV
WUHVDxRVGHVSXpVHOLPSDVHQRKDVLGRVXSHUDGR\VXYLGDRUJiQLFDHVPtQLPD(QHO
~OWLPRDxRKDQWHQLGRFDSDFLWDFLRQHVVREUHYLROHQFLDIDPLOLDUDXWRHVWLPDGHUHFKRV
KXPDQRVVLQHPEDUJR´/RTXHSDVDHVTXHODDVRFLDFLyQQRVXUJLyFRQEDVHDXQD
QHFHVLGDGµVHxDODXQSURIHVRUGHO,67´HQ6DQWR'RPLQJRODJHQWHVHLQWHUHVDSRU
ODV RUJDQL]DFLRQHV SURGXFWLYDV PiV ELHQµ DxDGH /D $VRFLDFLyQ GH 3URGXFWRUHV
ahora abastece de leche fresca al programa municipal.

En la población es creciente el asumir como algo práctico y provechoso la


concertación y coordinación interinstitucional.

3.4 Calidad de los productos concertados


/DPXQLFLSDOLGDGYDWRPDQGRXQSHUÀOGHSURPRWRUDGHO'HVDUUROOR(FRQyPLFR
/RFDO (OOD KD H[SUHVDGR VX LQWHUpV HQ DSR\DU SUR\HFWRV TXH ODV RUJDQL]DFLRQHV
productivas plantean, disponiendo de un fondo facilitado por un Ayuntamiento
HVSDxRO(QWUHORVSUR\HFWRVDSUREDGRVGHVWDFDODSURGXFFLyQGHODSDQHODHQHO
LQWHUpVGHWHQHUXQSURGXFWRRUJiQLFRDODYH]TXHGDUOHYDORUDJUHJDGRDODFDxD/D
municipalidad además compra la leche a los productores locales organizados, para
el Programa Vaso de Leche. Se apoya a los productores de menestras, promoviendo
el frijol alubia y, por otro lado, se impulsan proyectos viales, genéticos, etc.

Asimismo, entre los proyectos aprobados en el PP está el mejoramiento de los


sistemas de riego; el desarrollo de la ganadería de vacunos, la planta procesadora de
panela, proyectos viales, el mejoramiento de la infraestructura educativa y de agua
potable, el tratamiento de residuos sólidos y la promoción del deporte. Salvo el inicial
LQFHQWLYRDODIRUPDFLyQGHODDVRFLDFLyQGHPXMHUHVQRKD\RWUDVDFFLRQHVHVSHFtÀFDV
RULHQWDGDVDODSURPRFLyQGHODHTXLGDGGHJpQHUR6HPHQFLRQDFRPRXQDYDQFH
GHOSURFHVRGHSODQLÀFDFLyQODDVHVRUtDSDUDHOIRUWDOHFLPLHQWRGHRUJDQL]DFLRQHV
femeninas, desde el nivel de bases hasta el distrital.

194
Desafíos de la Democracia Participativa Local en la Descentralización

(O DOFDOGH /ySH] FRQVLGHUD TXH OD SURPRFLyQ GH SUR\HFWRV SURGXFWLYRV
SRVLELOLWDUi PHMRUDU OD FDOLGDG GH YLGD GH ORV SURSLRV SURGXFWRUHV D OD YH] TXH
brindará empleo a los más pobres. Es la forma como se ha planteado la lucha contra
la pobreza. Mientras tanto, a través de la CODELCP, con amplio respaldo municipal,
VHUHDOL]DQDFWLYLGDGHVYDULDVFRPRÀHVWDVSDUDJHQHUDUUHFXUVRVGHVWLQDGRVDORV
sectores vulnerables, ancianos y enfermos mentales.

3.5 Efectos del proceso de concertación sobre las instituciones,


organizaciones en general y organizaciones de mujeres
Hoy en día hay una mayor valorización de la organización productiva. Con gusto
los líderes se integran a éstas y las dinamizan, asumiendo además responsabilidades
HQ ORV HVSDFLRV GH FRQFHUWDFLyQ D QRPEUH GH VXV EDVHV DXQTXH ORV FDQDOHV GH
comunicación con ellas no sean tan efectivos. En el distrito los partidos existentes,
como el APRA, UN y AP han manifestado su interés de coordinar con los procesos
en marcha y continuar los mismos en una eventual conducción municipal.

Los convenios con las ONG y cooperación internacional han sido decisivos
HQHODSR\RDOSURFHVR\ORVSUR\HFWRVSURGXFWLYRV3RUHMHPSORHQHODxRVH
ORJUyXQÀQDQFLDPLHQWRGHPLOHXURVGHODFRRSHUDFLyQLWDOLDQDYtD&,3&$(Q
HOIXHURQPLODGLFLRQDOHV0RQWRVTXHIUHQWHDOSUHVXSXHVWRPXQLFLSDOGH
obras, son recursos sumamente relevantes. Estos se destinan en función de los ejes
estratégicos, con prioridad a proyectos productivos como la planta de producción
de panela. También PIDECAFE ha invertido en la zona, y la Universidad Nacional
de Piura brinda asistencia técnica; el Gobierno Regional apoya proyectos ganaderos.
Es efectivo el apalancamiento de recursos.

3.6 Resultados conseguidos sobre la calidad de vida de la


población
Aún no son visibles los cambios en la calidad de vida, salvo para sectores como
los productores, en función de convenios con las ONG y cooperación internacional.
&RPRVHxDODHODOFDOGHORVSUR\HFWRVOOHJDQQHFHVDULDPHQWHDSREODFLyQTXHWLHQH
WLHUUDV FDQDOHV JDQDGHUtD OD FRRSHUDFLyQ Vt SXHGH OOHJDU D ORV PiV FKLTXLWRV HO
CODELCP trata de juntarlos para acceder a proyectos.

La vida de las mujeres no ha sufrido mayores cambios en este proceso, persiste


VXH[FOXVLyQDXQTXHGHVGHODVHVIHUDVPXQLFLSDOHV\GHFRQFHUWDFLyQVHSURPXHYH
WHQXHPHQWH XQ GLVFXUVR GH HTXLGDG 'H KHFKR WDPSRFR VRQ YLVLEOHV FDPELRV

195
Juan Arroyo y Marina Irigoyen

VXVWDQWLYRVHQODFDOLGDGGHYLGDODSREUH]DHLQHTXLGDGVDOYRSDUDDOJXQRVFRPR
ORVSURGXFWRUHVTXHPHMRUDQVXVQLYHOHVGHHPSOHR\VXVLQJUHVRV

3.7 Resultados conseguidos sobre el empoderamiento de la


población, de las mujeres y de los pobres en particular
El proceso si bien fomenta una amplia participación social no ha logrado
convocar a los jóvenes. Pese a esto, en el 2004 hubo una reunión con jóvenes de
GLIHUHQWHVPXQLFLSDOLGDGHVHQODSURYLQFLDHQODTXHSDUWLFLSDURQMyYHQHVGHOGLVWULWR
formándose un comité de jóvenes.

Son evidentes los límites de los intentos de organización de las mujeres,


TXL]iVSRUTXHQRUHVSRQGLHURQWDQWRDVXVSURSLRVSURFHVRVGHPDGXUDFLyQVLQR
a la preocupación de los líderes por integrarlas a los procesos en curso. También
la participación de las mujeres es limitada. Su presencia en el CODELCP es
HVSRUiGLFDVHxDODQQRWHQHUUHFXUVRVQLDSR\RDOJXQRH[LVWLHQGRPXFKRLQWHUpVHQ
lo productivo, en tener microempresas; por ejemplo, presentaron una iniciativa de
producción orgánica al PP, pero su propuesta no recibió respaldo. Un comentario
GHXQDHQWUHYLVWDGDVHxDOyTXHHVWDIDOWDRUJDQL]DFLyQHVSRUTXHSULPDXQDYLVLyQ
asistencialista de las mujeres, por las condiciones de analfabetismo de la mayoría y la
falta de incentivos. Aún así hay mujeres destacadas en la vida local, como dos teniente
JREHUQDGRUDV GHHQWRWDOHQHOGLVWULWR FRVDTXHDQWHVQRVXFHGtD

3HUR HQ JHQHUDO KD\ XQ UHFRQRFLPLHQWR TXH OD SREODFLyQ HVWi WHQLHQGR PD\RU
FRQFLHQFLDGHVXVGHUHFKRV\GHODLPSRUWDQFLDGHODFRQFHUWDFLyQ\TXHKD\PiVGLULJHQWHV
capacitados. A la vez, se constata el escaso trabajo con juventudes y cierta confusión sobre
las diferentes instancias de concertación existentes y la proliferación de éstas.

En correspondencia a su trayectoria comunal persiste el trabajo colectivo, las


PLQJDVSRUHMHPSORDVtFRPRODVUHODFLRQHVGHFRQÀDQ]DHQHOVHFWRUUXUDODXQTXH
VHVHxDODHVWiQPiVGHELOLWDGDVTXHHQHOSDVDGR

196
NOR YAUYOS:
Reserva paisajística
y añeja participación
Juan Arroyo y Marina Irigoyen

NOR YAUYOS:
Reserva paisajística y añeja participación

1. Características generales del ámbito


Con una extensión territorial de 6.901,58 km2, la provincia de Yauyos se
encuentra ubicada en la zona sur-este del departamento de Lima. Limita por el norte
con la provincia de Huarochirí, por el sur con el departamento de Ica, por el este con
HOGHSDUWDPHQWRGH-XQtQ\SRUHORHVWHFRQODSURYLQFLDGH&DxHWH

La provincia de Yauyos tiene una población estimada para el 2004 de 62,215


habitantes, viviendo el 83.8% en el espacio rural; el 86.5% de la población se encuentra
en situación de pobreza y 25,1% en pobreza extrema.32

En la provincia de Yauyos hay dos importantes cuencas formadas por los ríos
2PDV\&DxHWH/DFXHQFDKLGURJUiÀFDGHOUtR&DxHWHHVXQDGHODVPiVH[WHQVDVGHO
ÁDQFRRFFLGHQWDOGHORV$QGHV(OUtRUHFRUUH.P'HVGHVXQDFLPLHQWRHQODV
cordilleras del Altiplano Central (a 5,500 metros sobre el nivel del mar, en Ticllacocha,
DOSLHGHOQHYDGRGH7LFOOD KDVWDVXGHVHPERFDGXUDHQHO2FpDQR3DFtÀFR D
.PDOVXUGH/LPD /DVXSHUÀFLHGHHVWDFXHQFDHVGH.PGHORVFXDOHV
.PFRUUHVSRQGHQDODFXHQFDDOWD]RQDHQODTXHVHKDOODXELFDGDODPD\RU
parte del territorio de la provincia.33

2. Proceso social local


2.1 Periodización e hitos claves
• 1994: El instituto ISAT y líderes del distrito de Alis, en el norte de Yauyos,
conforman el Comité de Desarrollo de Alis (CODALIS).
• 1996: Walter Varillas, director de CODALIS, es elegido alcalde de Alis.
• 1997: se dan dos experiencias en el norte de Yauyos, de un lado el trabajo
del Instituto Valle Grande con las comunidades campesinas y del otro

___________________________________________________
32 Fuentes: INEI, Mapa de Pobreza del MEF.
33 www.geocites.com/proyauyos

198
Desafíos de la Democracia Participativa Local en la Descentralización

la conformación de la Corporación del Desarrollo del Nor Yauyos


(CODENY).34
• 1999: los alcaldes del Nor Yauyos son reelegidos en listas fujimoristas, en un
marco general de debilidad del proceso.
• 2001: con la transición democrática del gobierno de Paniagua se da el segundo
impulso a la CODENY. Se trabaja de manera coordinada con la MCLP de
Lima Provincias.
• 2004: la ONG PRO YAUYOS de Walter Varillas le da el soporte técnico a
la CODENY. Esta ONG es la encargada de implementar en cada uno de
los distritos la implementación de los planes de desarrollo concertados, los
presupuestos participativos y los Consejos de Coordinación Locales. Se
percibe una relativa debilidad y dependencia respecto a Pro Yauyos.

2.2 Hechos Relevantes


La experiencia de desarrollo concertado del Nor Yauyos tiene dos periodos
FODUDPHQWH GHÀQLGRV XQ SULPHU PRPHQWR HV OD H[SHULHQFLD GH &2'$/,6 
² HQHOSHTXHxRGLVWULWRGH$OLVDOQRUWHGHODSURYLQFLDGH<DX\RV35 Es el
primer proceso de participación y concertación en la provincia. El segundo momento
OR REVHUYDPRV HQ OD PLFUR FXHQWD GHO UtR &DxHWH TXH DUWLFXOD D  GLVWULWRV GH OD
provincia así como instituciones publicas y privadas. Esta experiencia, centrada en
la Corporación para el Desarrollo del Norte de Yauyos (CODENY), trabaja desde
1997 hasta la fecha y tuvo su hito mas importante en el 2001 cuando se declaró a
Nor Yauyos como Reserva Paisajística. Anteriormente tenia la denominación de área
natural protegida.

En 1994 el Instituto ISAT ejecutó participativamente un proyecto de desarrollo


HQHOQRUWHGH<DX\RVHVSHFtÀFDPHQWHHQHOGLVWULWRGH$OLVSDUDORFXDOVHLPSOHPHQWy
un espacio deliberativo, de diálogo y concertación denominado CODALIS. En ese
HVSDFLRORVDFWRUHVIXQGDPHQWDOHVIXHURQODSDUURTXLDODJREHUQDFLyQ\ODSHTXHxD
comunidad de Alis. Fue notorio el liderazgo de Walter Varillas, sociólogo y facilitador
de estos procesos y en ese entonces, director del instituto ISAT.

En 1996 fue elegido alcalde de Alis Walter Varillas y éste reimpulsó CODALIS y
WUDWyGHDVXPLUHQODSHTXHxD\GpELOVRFLHGDGFLYLOGH$OLVODFRQFHUWDFLyQHLQLFLDWLYDV
ciudadanas. Pero surgieron diferencias de opinión entre los integrantes de CODALIS,

___________________________________________________
 &2'(1<HVWDFRQIRUPDGDSRUGLVWULWRV7RPDV/DUDRV+XDQFD\D9LWLV0LUDÀRUHV&DUDQLD\+XDQWiQ
35 CODENY, Segundo Plan Estratégico del Nor-Yauyos 2002 - 2006. Lima: USAID. 20pp. 2003.

199
Juan Arroyo y Marina Irigoyen

GHUHSHQWHPRWLYDGRVSRUHUURUHVGHOGLVHxRGH&2'$/,6/DRSRVLFLyQSURPRYLy
una denuncia a Varillas sobre mal manejo de los recursos en las obras ejecutadas. Este
KHFKRWUDMRFRPRFRQVHFXHQFLDHOGHELOLWDPLHQWRGHOSURFHVRJHQHUDQGRFRQÁLFWRV
\YLFLDQGRHOWUDEDMRHQFRQÀDQ]D(OORÀQDOPHQWHOOHYRDOFLHUUHGHODH[SHULHQFLD
0DVDGHODQWHGLUi9DULOODVTXHIXHXQHUURUFUHDU&2'$/,6EDMRHVWDDPELJHGDG
de ONG y Mesa de Concertación.

Por otro lado, se empezó a dar un proceso paralelo con otros actores en los
distritos del norte de Yauyos. El trabajo de la ONG Valle Grande, vinculada al Opús
Dei, desarrollaba una experiencia de manera participativa con las comunidades
campesinas, enfocada al asesoramiento agropecuario.

(Q  DPERV SURFHVRV FRQÁX\HURQ SUHYLDV FRRUGLQDFLRQHV \ VH FUHy OD
&RUSRUDFLyQ SDUD HO 'HVDUUROOR GHO 1RUWH GH <DX\RV &2'(1<  TXH DJUXSy D
siete distritos del norte de Yauyos. Su primer gran trabajo fue la formación del plan
estratégico de la micro región.

(VWH SURFHVR WXYR XQ DYDQFH LQHVSHUDGR GHELGR D TXH OD SDUWLFLSDFLyQ GHO
territorio de la microcuenca pasaba por tener gobiernos locales responsables e
inclusivos. Se trabajo en primer lugar con las organizaciones en la formulación e
implementación del Plan de Desarrollo Estratégico de la microcuenca y para esto
la ONG Pro Yauyos (creada en el 1997 por el mismo Walter Varillas) trabajo como
ente asesor de los gobiernos locales y de la propia CODENY.

(O DxR  IXH XQ DxR GH GHELOLWDPLHQWR GH OD H[SHULHQFLD GHELGR D TXH
WRGRV ORV DOFDOGHV TXH SDUWLFLSDEDQ HQ HO SURFHVR RSWDURQ SRU HO IXMLPRULVPR
cambiando su discurso para la reelección y aceptando de manera tácita la política
XOWUDFHQWUDOLVWDGHOJRELHUQR'XURUHYH]DORVSURFHVRVGHODUJRSOD]RSRUTXH
la CODENY, para entendimiento de los alcaldes, no solucionaba los problemas
derivados de la pobreza.

(QHODxRFRQODWUDQVLFLyQGHPRFUiWLFD\HOJRELHUQRGH3DQLDJXDVHGLy
el segundo impulso a la CODENY. El resultado de estos trabajos fué la declaración
del Nor Yauyos como reserva paisajística (el 1 de Julio), si bien ya antes tenía la
categoría de zona reservada.

'HO  D OD IHFKD ORV GLVWULWRV DUWLFXODGRV D OD H[SHULHQFLD KDQ WHQLGR TXH
adecuarse al marco normativo de la participación ciudadana, esto es a la implementación
de los Consejos de Coordinación Local, presupuestos participativos y rendición de

200
Desafíos de la Democracia Participativa Local en la Descentralización

cuentas. La CODENY ha promovido y asesorado a los distritos con el apoyo de


Pro Yauyos. Sin embargo, al no existir voluntad política de los propios alcaldes por
generar una mayor participación, ha habido procesos de PP y CCL formales y en el
FXPSOLPLHQWRDOPtQLPRGHODOH\(VWRPXHVWUDTXHHOSURFHVRSDUWLFLSDWLYRHQ1RU
Yauyos en estos momentos se encuentra débil.

2.3 Actores fundadores de la experiencia


(QODH[SHULHQFLDGH&2'$/,6DxRORVDFWRUHVSDUWLFLSDQWHVHQHOSURFHVR
IXHURQHOPXQLFLSLRODFRPXQLGDGGH$OLVODJREHUQDFLyQODSDUURTXLD\HOLQVWLWXWR
ISAT. El trabajo implicaba la ejecución del proyecto.

(QODVHJXQGDHWDSDGHOSURFHVRTXHVHLQLFLDHQVHIRUPDOD&RUSRUDFLyQ
del Desarrollo de Nor Yauyos – CODENY, instancia micro regional de la cuenca alta
GHOUtRFDxHWH/RVDFWRUHVSULQFLSDOHVHQHVWDVHJXQGDHWDSDUHFD\HURQHQORVGLVWULWRV
GHO1RU<DX\RV7RPDV/DUDRV+XDQFD\D9LWLV0LUDÁRUHV&DUDQLD\+XDQWiQDVL
mismo también participaron las comunidades campesinas, las organizaciones públicas
presentes en los distritos, la ONG Valle Grande y la ONG PRO YAUYOS, como
instancia de asesoramiento técnico.

2.4 Logros y limitaciones


Podemos mencionar como logro más importante de la CODENY la declaración
el 1° de julio del 2001 del NorYauyos como Área Natural Protegida en la categoría
de Reserva Paisajística del Nor Yauyos – Cochas. Para el logro de este objetivo fue
importante el plan de desarrollo estratégico de la micro cuenca, con el cual el estado
constató el proceso participativo y su rol en la constitución de la reserva.36

Si bien es cierto esta experiencia ha promovido el desarrollo, no ha podido


JHQHUDUHPSRGHUDPLHQWRGHODVRUJDQL]DFLRQHVVRFLDOHVTXHSDUWLFLSDURQHQHOSURFHVR
los propios alcaldes son conscientes del hecho y no han logrado superar el proceso
mas allá de la implementación inicial del plan maestro.

___________________________________________________
36 Chávez Achong, Julio y otros. Un paisaje, diversas versiones: acción colectiva, concertación y desarrollo rural en la reserva
paisajística Nor Yauyos-cochas. Lima: Centro IDEAS. 2003.

201
Juan Arroyo y Marina Irigoyen

La CODENY es activada por los recursos técnicos y políticos de actores exógenos.


Pro Yauyos y Valle Grande son las instituciones de soporte y asesoramiento técnico.

Esta debilidad la podemos observar en la implementación de los presupuestos


SDUWLFLSDWLYRV\&&/V8QSURPRWRUGH3UR<DX\RVH[SOLFDTXH´VHKDQLPSOHPHQWDGR
de manera formal los CCLs; ellos han corrido con los tiempos para tener el visto
EXHQRGHO0()µ´/RPDVJUDYHHVODSHUGLGDGHODVH[SHULHQFLDVLQLFLDGDV\DTXHVH
dan procesos participativos pero una vez acabados, estos se detienen y no continúan,
\ORVQXHYRVDFWRUHVJHQHUDGRVQRFRQVLJXHQFRQWLQXDUORVSURFHVRVµVHxDOD

(QVtQWHVLVORVSURFHVRVTXHHQFDPLQDQHOGHVDUUROORORFDOWLHQHQXQLPSXOVR\
dependencia técnica de actores exógenos. En el caso de Pro Yauyos-, se promueve
la democratización de la vida local; en el caso de Valle Grande, se generan procesos
micro de trabajos mancomunados.

3. La situación actual
3.1 Características y condiciones organizativas de la
sociedad civil
Comunidades campesinas: En la cuenca alta o sierra existen 43 comunidades
campesinas, las cuales se agrupan en cinco conjuntos:

Comunidades de pastoreo: están ubicadas en un relieve poco accidentado


y cubierto de extensas praderas y de pastos naturales aptos para la ganadería.
Comunidades de agricultores y ganaderos de altura: controlan amplios pastizales,
tierras agrícolas de uso temporal y tierras de riego para tubérculos y forraje; el riego
sólo se practica después de agosto, para prolongar el humedecimiento;

Comunidades de agricultores de terrazas y pastores de ganado vacuno:


poseen tierras agrícolas con gran variabilidad climática y pendientes suaves; utilizan
HOULHJRSDUDH[WHQGHUHOFLFORDJUtFRODHQFXOWLYRVTXHQHFHVLWDQPiVGHVHLVPHVHV
Tiene andenes, potreros de forrajes y huertos de frutales. En esta zona el manejo y
control comunal de las aguas es muy importante;

Comunidades de agricultores y pastores seminómadas: ubicadas en el


extremo sur de la cuenca alta, estas comunidades están asentadas en zonas donde

202
Desafíos de la Democracia Participativa Local en la Descentralización

ODVOOXYLDVVRQLQVXÀFLHQWHVORVSDVWRVHVWDFLRQDOHV\HODJXDHVFDVD&RQWURODQSRFDV
WLHUUDVHULD]DVHQVXPD\RUSDUWHVREUHODVTXHHMHUFHQXQDDOWDSUHVLyQ

Comunidades de fruticultores: estas comunidades son de reciente formación


y ocupan terrenos estrechos, de clima árido y baja humedad37.

3.2 Apertura democrática del gobierno local


En el escenario actual 2004 la CODENY, luego de 3 generaciones de alcaldes,
VH HQFXHQWUD GHELOLWDGD KD\ SRFD DUWLFXODFLyQ FRQ ORV DOFDOGHV GLVWULWDOHV TXH
KDFHQ XQD JHVWLyQ KDFLD DGHQWUR \ WLHQHQ XQD IXHUWH GHVFRQÀDQ]D HQ HO SURFHVR
de descentralización, principalmente por toda la carga normativa en materia de
participación y concertación. Como consecuencia la implementación del PP y CCL
ha sido formal.

Una mirada rápida a los gobiernos locales de la CODENY en el escenario


DFWXDOQRVPXHVWUDTXHGHORVGLVWULWRVDUWLFXODGRVDOD&2'(1<HOSUHVXSXHVWR
participativo mas optimo ha sido el de Tomas, en donde la población ha decidido
FRPRJDVWDUHOSUHVXSXHVWRDUERULÀFDQGRVXSURFHVRGHFRQFHUWDFLyQGHPDQHUD
WHUULWRULDO-XDQ&DUORV%ODVSURPRWRUGH3UR<DX\RVVHxDODTXH´HQHOSUHVXSXHVWR
participativo de Tomas no se ha valorado la calidad del gasto, si bien se ha demostrado
voluntad democrática”. ¿Y en los demás distritos? Hay una mezcla de debilidad y
formalismo.

En realidad el presupuesto participativo muestra características similares a


RWURV JRELHUQRV ORFDOHV D QLYHO QDFLRQDO ´/D JHQWH DSUHFLD TXH VXV DFXHUGRV QR
necesariamente son formalizados por el consejo municipal. Esto genera frustración
y cansancio de parte de la población. Encima a veces no hay congruencia entre lo
SURJUDPDGR\ORHMHFXWDGRµVHxDODÀQDOPHQWH-XDQ&DUORV%ODV

Respecto al proceso de implementación de los consejos de coordinación local,


ORVVLHWHGLVWULWRVTXHDUWLFXODOD&2'(1<KDQLQVWDODGRVXVCCL pero de manera
formal y ninguno ha abierto la participación a las organizaciones sociales en mas del
40% establecido, como sí ha pasado en muchos otros distritos del país.

___________________________________________________
37 CODENY, Segundo plan estratégico del Nor Yauyos 2002 – 2006. Lima: USAID. 2002. 30Pag.

203
Juan Arroyo y Marina Irigoyen

3.3 Calidad de los productos concertados


(ORUWRGHODH[SHULHQFLDGH&2'(1<VHGLRHQWUHORVDxRV\HO
cuando se procesaron la formulación del plan de desarrollo estratégico del Nor Yauyos
1997 –2002, realizada entre 1996 – 1997; la evaluación de la CODENY y reajuste
de su plan estratégico 1997 – 2002; la evaluación del plan de desarrollo estratégico
GHO1RU<DX\RV²UHDOL]DGRHQHO\ÀQDOPHQWHODHYDOXDFLyQGHO
segundo plan estratégico del Nor Yauyos 2002 – 2006, realizada también el 2001 con
el apoyo de OTI – USAID.38

La CODENY39 ha promovido proyectos de diverso tipo como por ejemplo el


mejoramiento ganadero, con apoyo de la ONG Valle Grande y de las comunidades;
cultivos andinos y plantas de procesamiento de la pallita en el distrito de Alis; la
implementación de módulos de cocinas y comedor; de infraestructura de riego
WHFQLÀFDGR\GHSHULWDMHDPLQDVSDUDHOFRQWUROGHFRQWDPLQDFLyQ&RQHODSR\RGH
PRONAMACHS se realizó el mejoramiento de cuencas, en infraestructura de riego y
cultivos; gestiones de mejoramiento y mantenimiento de carreteras a través del MTC,
CTAR, con apoyo de los municipios; con la ONG PRO YAUYOS y el MINSA se
implementaron planes y comités de salud; con el apoyo de MISEREOR y con apoyo
de Foncodes se implementaron criaderos de trucha en Alis.

Y con el apoyo de la RED PERU y PRO YAUYOS se implemento el primer


programa de formación de líderes y promotores para el desarrollo local.

___________________________________________________
38 CODENY, Segundo plan estratégico del Nor Yauyos 2002 – 2006. Lima: USAID. 2002, pp. 2-3.
 86$,'/DGHPRFUDWL]DFLyQGHODJHVWLyQORFDOHQORVHVFHQDULRVGHODGHVFHQWUDOL]DFLyQ([SHULHQFLDVDSR\DGDVSRUODR¿FLQD
de apoyo a la transición USAID/OTI. Lima: USAID. 194pp.

204
Desafíos de la Democracia Participativa Local en la Descentralización

Lista de entrevistados

EXPERIENCIAS ENTREVISTADOS

1. La experiencia de Azángaro ‡ 3HUF\&KRTXHDOFDOGHGHODPXQLFLSDOLGDGSURYLQFLDO


de Azángaro
• Marcelino Casas, funcionario municipal
• Santiago Aragón, funcionario municipal, secretario
técnico del CCL
• Catalina Sánchez Macedo, representante de la MCI
Azángaro
• Jorge Romero, facilitador del Proyecto Fortalece
• Jesús Betancurt, Responsable de Puno de
REMURPE
‡ 9DOHULR $Ot -HIH 2ÀFLQD =RQDO $]iQJDUR &$5(
Perú

2. La experiencia de Curahuasi • Egidio Huananí, Regidor de Asuntos Comunales


• Celedonia Soto Alfaro, Regidora de Asuntos
Sociales
• Francisco Cuellar, Regidor de Deportes y Cultura.
• Ismael Tacanga. Gerente Municipal
• Luisa Gamarra, Promotora de Vaso de Leche
• Martín Huamán, Trabajador del Programa Vaso de
Leche
• José, John y Ruth, estudiantes del Instituto
Tecnológico.
• Fanny Alfaro, enfer mera, propietaria de
Restaurante
• Margarita Gil, propietaria de bodega, ex presidenta
de la Urbanización Kennedy

3. La experiencia de Huaccana • Guadalupe Hinojosa, CARE Perú


• Carlos Grey Figueroa, consultor proyecto
Fortalece

205
Juan Arroyo y Marina Irigoyen

EXPERIENCIAS ENTREVISTADOS

4. La experiencia de Ichocán • Wilder Castañeda I., Alcalde Municipalidad Distrital


de Ichocán
• VíctorZamora,Tesorero,acargodelaAdministración,
Municipalidad Distrital de ichocán
• Maruja Rojas, Presidenta del Comité de Vaso de
Leche de Ichocán
• Giovanna, Esp. Grupo Productoras de Vino de
Sauco
• Dense, Esp. Grupo Productoras de Vino de Sauco
• Manuel Cosme Rojas Abanto, Gobernador del
Distrito de Ichocán

• Alodia Lazo, productora de la comunidad de


5. La experiencia de Jabon Mayo Pampamarca
• Teresa Tupayachi, productora y campesina,
Yachachiq, de la comunidad de Jilaigua
• Constantina Chamba, Presidenta del Club de Madres
de la Comunidad de Chollocani
• Benigno Luque, ex Secretario General de la FDCC y
de la Federación Provincial de Campesinos de Canas,
ex alcalde de Canas en el período 1990-92.
• Héctor Chunga, promotor del IAA
• Carlos Paredes, asesor de la FDCC

• Marina Carrión, Presidenta del Comité Central de


6. La experiencia de Limatambo Mujeres Campesinas de Limatambo
• Félix Huachuac, trabajador municipal
• Raúl Meza, trabajador municipal
• Zoilo Meza, agricultor, ex regidor municipal y
candidato a alcalde en el 2003
• Wilbert López, ex alcalde distrital 1993-2002, actual
alcalde provincial de Anta

• Martín Soto, asesor del Consejo Nacional de


7. La experiencia de MECODEH Descentralización
(Huancavelica) • Aristión Tinoco, ex alcalde de Julcamarca
• Grover Flores, Proyecto Fortalece
• Javier Ravelo, alcalde de Angaraes
• Edgar Segama, dirigente de la FEDEC
• Ramiro Guzmán, dirigente vecinal en Lircay,
representante social ante el CCL

212
Desafíos de la Democracia Participativa Local en la Descentralización

EXPERIENCIAS ENTREVISTADOS

8. La experiencia de Morropón • Carlos Ramos Arámbulo, alcalde distrital


• Padre Pedro, Párroco del distrito, Presidente de la MCLP
• Felizardo Montenegro Córdova, gobernador y director
del CE
• Francisca Agurto, asesora Asociación de Mujeres en
Defensa de la Vida
‡ 6DELQR 3HxD 3UHVLGHQWH GH OD &HQWUDO GH 5RQGDV
campesinas
• Beatriz, propietaria de bodega

9. La experiencia de San • Néstor Mendoza, alcalde Municipalidad Provincial


Marcos • Lily Quiroz, regidora de la Municipalidad Provincial
• Erika Cerdán, Gerente de Desarrollo Humano de la
Municipalidad Provincial
• Marisa Gordillo, Jefe de la División de Salud y Programas
de Apoyo Social, Municipalidad Provincial
• Martina Rumia, Coordinadora de la Asociación Distrital
de Vaso de Leche de Pedro Gálvez, San Marcos
• Manuel Quiroz, Presidente de la Cadena Productiva de
Cuyes, VicePresidente de la Cadena Productiva de la
Tara
• Germán Rojas, Promotor de Centro IDEAS Cajamarca
‡ 2VFDU 0XxR] *HUHQWH GH OD 5HG GH 6DOXG 6DQ
Marcos
• Verardo Abanto, directivo de la Asociación de Productores
Forestales, Presidente de la APAFA CE&KXTXLDPR

10. La experiencia de Santa Rosa • Julián Paucar, alcalde de Santa Rosa


• Jorge Romero, facilitador Fortalece
• Juan Betancurt, REMURPE

11. La experiencia de Santo • Juan Pérez, asesor de la Municipalidad Distrital de Santo


Domingo Domingo
• Carlos López, alcalde
• Faustino Chang, profesor del Instituto Superior
Tecnológico de Santo Domingo
‡ 6HxRUD /ROD H[ 3UHVLGHQWD $',086$' $VRFLDFLyQ
Distrital de Mujeres de Santo Domingo
• Wilmer Quiroga, Ingeniero del proyecto PDRS-GTZ
• Johnny Rivas, Gobernador, Técnico Agropecuario

12. La experiencia de Yauyos • Walter Varillas Vilches, director de Pro Yauyos


• Juan Carlos Blas, Facilitador de Pro Yauyos
• Ricardo Chirinos, Facilitador de Pro Yauyos

207
TERCERA PARTE

Los Costos de la
Participación Local.
El Caso de Puno-Perú

Juan Arroyo
Ana María Benique
Juan Gonzáles
Marina Irigoyen
Capítulo 1
Construyendo una metodología
de análisis de los costos
de la participación

El presente informe resume los resultados de un estudio cualitativo sobre los


factores que inciden en los costos de la participación social, realizado el año 2007 en
tres distritos de la provincia de Melgar en la región de Puno. Los distritos fueron los
de Ayaviri, Orurillo y Santa Rosa.

El objetivo central del estudio fue captar la percepción de los propios actores de
la participación social sobre los costos que ella le implica. El estudio no se centra por
tanto en la participación misma y sus características sino en los factores que inciden
para que la población se involucre o no en ella.

/DMXVWLÀFDFLyQGHOHVWXGLRQRVSDUHFHUHOHYDQWHSXHVSHUPLWHGHVLGHRORJL]DU
HO WHPD GH OD SDUWLFLSDFLyQ VRFLDO \ FRPHQ]DU D LGHQWLÀFDU ODV YDULDEOHV TXH VHUtDQ
parte de la “función de la demanda de participación”. Esto es, mientras entre los
políticos de cada región y provincia o distrito la participación social es parte de su
acumulación de legitimidad y por tanto suelen estar interesados en la profusión
de instancias de participación y en la movilización permanente de la población, la
percepción que tiene la población de la participación contiene una evaluación intuitiva
GHVXVEHQHÀFLRV\FRVWRVLQFOX\HQGRORV´FRVWRVKXQGLGRVµHQWpUPLQRVGHWLHPSR
desplazamientos, gastos y tensiones, que los políticos no suelen tomar en cuenta. Este
estudio intenta empezar a develar estos costos ocultos, en base a la versión de los
actores de experiencias participativas importantes en Puno.

217
Juan Arroyo y Marina Irigoyen

La oportunidad del estudio nos parece importante pues estamos dándole forma
en el Perú al nuevo Estado descentralizado de los próximos años, en el cual el peso
GHODSDUWLFLSDFLyQVRFLDOHQORVJRELHUQRVUHJLRQDOHV\ORFDOHVHVWiHQUHGHÀQLFLyQ
'HVGHKDFHPXFKRVDxRVODVDXWRULGDGHVORFDOHV\21*V\KDQYHQLGRSURPRYLHQGR
la organización de la sociedad civil, el desarrollo de capacidades y el involucramiento
poblacional en los procesos participativos locales. Sin embargo existen numerosos
HVWXGLRVTXHPDQLÀHVWDQGXGDVVREUHODFDOLGDGGHODSDUWLFLSDFLyQ\ODGHPRFUDFLD
participativa en construcción. El tema de los costos de la participación subyace a esta
problemática y es necesario afrontarlo.

Los resultados del estudio se presentan en seis partes. En el primer capítulo, se


presenta la metodología del estudio. En el segundo capítulo se esboza el marco teórico
GHOHVWXGLRTXHKDRULHQWDGRHOGHVDUUROORGHODLQYHVWLJDFLyQ(QHOWHUFHUFDStWXORVH
presenta la situación del entorno de la participación, reseñando las características de la
provincia de Melgar y de los tres distritos estudiados. En el cuarto capítulo, se resumen
los resultados en cuanto a las características de la participación social en los ámbitos
GHOHVWXGLRFHQWUiQGRQRVHQFLQFRDVSHFWRVORVHVSDFLRVGHSDUWLFLSDFLyQHOSHUÀO
de los actores, las estrategias de participación de los actores, las motivaciones para la
SDUWLFLSDFLyQ\ORVEHQHÀFLRVSHUFLELGRVGHODSDUWLFLSDFLyQ(QHOTXLQWRFDStWXORVH
resumen los resultados sobre los factores que inciden en los costos de la participación.
En el sexto capítulo, se da cuenta de las conclusiones y recomendaciones que se
derivan del estudio.

El estudio se basó en una metodología cualitativa, acorde con el objetivo de


LGHQWLÀFDUORVIDFWRUHVTXHLQFLGHQHQORVFRVWRVGHODSDUWLFLSDFLyQ6LKXELHUDVLGRXQD
PHGLFLyQGHGLFKRVFRVWRVKXELHUDGHELGREDVDUVHHQXQDPHWRGRORJtDFHQWUDOPHQWH
cuantitativa.

(O FRQMXQWR GH OD LQIRUPDFLyQ D UHFRSLODU VH FODVLÀFy HQ WUHV WHPiWLFDV D 
LQIRUPDFLyQVREUHHOHQWRUQRGHODSDUWLFLSDFLyQE LQIRUPDFLyQVREUHODVFDUDFWHUtVWLFDV
GHODSDUWLFLSDFLyQ\F LQIRUPDFLyQVREUHORVFRVWRVGHODSDUWLFLSDFLyQVRFLDO

1.1 Ámbito del estudio


6HVHOHFFLRQyODSURYLQFLDGH0HOJDUHQ3XQRHVSHFtÀFDPHQWHWUHVGLVWULWRVGH
GLFKDSURYLQFLD $\DYLUL6DQWD5RVD\2UXULOOR SRUTXHVHWUDWDGHFLUFXQVFULSFLRQHV
que tiene una trayectoria de incentivo de la participación social, siendo además ámbitos
HQTXH&$5(3HU~HQWLGDGDXVSLFLDGRUDGHOHVWXGLRKDHVWDGRLQWHUYLQLHQGR

218
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

Se consideró pertinente delimitar el periodo del estudio a los últimos tres años,
de tal forma de evitar sesgos de memoria.

1.2 Técnicas de investigación


(OHVWXGLRVHEDVyHQWUHVWpFQLFDVGHUHFRSLODFLyQGHLQIRUPDFLyQD UHYLVLyQ
GRFXPHQWDOE HQWUHYLVWDVDLQIRUPDQWHVFODYHVF WDOOHUHVSDUWLFLSDWLYRV

1.2.1 Revisión documental

6HKL]RXQDUHYLVLyQH[KDXVWLYDGHODLQIRUPDFLyQUHOHYDQWHVREUHODSURYLQFLD
de Melgar y los tres distritos estudiados, procedente de fuentes secundarias de nivel
nacional, regional y local. En la bibliografía se incluye la documentación recogida y
analizada.

1.2.2 Entrevistas a informantes

Se realizó un total de 54 entrevistas individuales a informantes considerados


claves. El criterio central de inclusión que se tomó en cuenta para diseñar el listado de
SHUVRQDVDHQWUHYLVWDUIXHFRQVLGHUDUDSHUVRQDVTXHRFXSHQRKD\DQRFXSDGRFDUJRV
de dirigentes de organizaciones o autoridades locales o que sean socios o socias de las
organizaciones locales.

6HWXYRGRVWLSRVGHHQWUHYLVWDGRV SRUXQODGRORVOtGHUHVVRFLRV\VRFLDV
pertenecientes a las organizaciones de los 3 distritos, buscándose entrevistar a
KRPEUHV\PXMHUHV\DVRFLRVDFWLYRV\QRDFWLYRV\ SRUHORWURDODVDXWRULGDGHV\
o funcionarios de las tres Municipalidades, sean actuales o de los últimos tres años.

219
Juan Arroyo y Marina Irigoyen

Cuadro 1: Organizaciones e Instituciones cuyos dirigentes y socios/as


fueron entrevistados

Distrito Organización/ institución


&HQWUDOGH$UWHVDQDV9LUJHQGH$OWD*UDFLD
Junta de Usuarios del Distrito de Riego Ramis
Asentamiento Humano Pueblo Libre
Asociación de Trabajadoras Unidas del Mercado de Abastos
Asociación de Jóvenes
Ayaviri
Central de Barrios
Asociación de Triciclistas
&RPLWpGH/XFKDSRUHO0HGLR$PELHQWH
Asociación Central de Mujeres Unidas de los Barrios de Ayaviri
Municipalidad Provincial de Melgar
Central de Artesanas Flor de Kunurana
Central de Barrios
Santa Rosa Asociación de Jóvenes
Organización de Ronderos
Municipalidad Distrital de Santa Rosa
Asociación Distrital de Mujeres de Orurillo
Central de Barrios
Asociación de jóvenes
Orurillo
Federación de Comunidades Campesinas
Asociación de Productores de Derivados Lácteos
Municipalidad Distrital de Orurillo

Cuadro 2: Autoridades y/o funcionarios municipales entrevistados


Nº de entrevistas
Municipalidades Ex Autoridad Ex regidor Ex facilitador
TOTAL
alcalde Municipal Varón Mujer Varón Mujer
Municipalidad distrital 0 1 1 0 0 0 2
de Orurillo
Municipalidad distrital 0 1 0 1 1 0 3
de Santa Rosa
Municipalidad 0 3 0 0 1 1 5
Provincial de Melgar
TOTAL 1 5 1 1 2 1 11

220
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

1.2.c. Talleres participativos

El estudio incluyó la realización de talleres participativos, como el realizado con


ORV GLUHFWLYRV \ PLHPEURV GH OD &HQWUDO GH $UWHVDQDV 9LUJHQ GH $OWD *UDFLD GH OD
Provincia de Melgar.

1.3 Instrumentos
Se diseñaron y utilizaron
tres tipos de guías de entrevistas:
una primera orientada a
OR DV  OtGHUHV XQD VHJXQGD
RULHQWDGD SDUD OR DV  VRFLR DV 
y una tercera guía orientada a
las autoridades municipales.
7DPELpQVHXWLOL]yXQDJXtDGHO
grupo focal aplicada a nivel de
OtGHUHV \ VRFLDV 7RGR HOOR KD
sido complementado con la
REVHUYDFLyQ\ÀFKDVGHUHJLVWUR
de la información secundaria.

1.4 Trabajo de campo


El trabajo de campo se realizó entre el mes de junio y el mes de julio del año
3DUDHOHIHFWRVHKL]RXQDSURJUDPDFLyQ\XQDKRMDGHUXWDSDUDLUFRPSOHWDQGR
con el personal de campo, integrado por los investigadores, el número de entrevistas y
WDOOHUHVSUHYLVWR(QORVDQH[RVÀJXUDHOOLVWDGRGHSHUVRQDVSDUWLFLSDQWHVHQHOHVWXGLR
DWUDYpVGHODVHQWUHYLVWDV\WDOOHUHVSDUWLFLSDWLYRV

221
Juan Arroyo y Marina Irigoyen

Cuadro 3: Entrevistas realizadas a informantes según distrito,


organización, género, cargo y nivel de actividad

/,'(5(6 62&,2 $6
varones mujeres varones mujeres
2*$1,=$&,21 Total
no no no no
activos activos activos activos
activos activos activos activos

',675,72$<$9,5,
Central de
Artesanas
0 0 2 1 0 0 2 1 6
Virgen de Alta
*UDFLD
Junta de
Usuarios del
2 0 0 0 0 0 0 0 2
Distrito de
Riego Ramis
Asentamiento
Humano 1 0 1 0 0 0 0 0 2
Pueblo Libre
Asociación de
Trabajadoras
Unidas del 0 0 0 0 0 0 1 0 1
Mercado de
Abastos
Asociación de
1 0 0 0 0 0 0 0 1
Jóvenes
Central de
2 0 0 0 0 0 0 0 2
Barrios
Asociación de
1 0 0 0 1 0 0 0 2
Triciclistas
&RPLWpGH
/XFKDSRU
1 0 0 0 0 0 0 0 1
el Medio
Ambiente

Asociación
Central de
Mujeres Unidas 0 0 1 0 0 0 0 1 2
de los Barrios
de Ayaviri

222
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

/,'(5(6 62&,2 $6
varones mujeres varones mujeres
2*$1,=$&,21 Total
no no no no
activos activos activos activos
activos activos activos activos

',675,726$17$526$
Central de
Artesanas Flor 0 0 2 2 0 0 1 1 6
de Kunurana
Central de
1 0 0 0 0 0 0 0 1
Barrios
Asociación de
1 0 1 0 0 0 0 0 2
Jóvenes
Organización
1 0 0 0 0 0 0 0 1
de Ronderos
',675,722585,//2
Asociación
Distrital de 0 0 3 2 0 0 2 2 9
Mujeres
Central de
1 0 0 0 0 0 0 0 1
Barrios
Asociación de
1 0 1 0 0 0 0 0 2
jóvenes
Federación de
Comunidades 0 1 0 0 0 0 0 0 1
Campesinas
Asociación de
Productores
2 2 2 2 1 1 1 1 12
de Derivados
Lácteos
TOTAL 15 3 13 7 2 1 7 6 54

1.5 Plan de análisis


Para el análisis, se procesó toda la información ordenándola por temas y
FDWHJRUtDVSDUDGHVSXpVSURFHGHUDDQDOL]DUOD6HVLJXLySDUDHOORHORUGHQVHxDODGR
por los ítems de las guías de las entrevistas y talleres.

223
Capítulo 2
Para un marco teórico sobre la
democracia participativa en el Perú

+DFHPXFKRTXHVHGHEDWHVREUHODGHPRFUDFLDSDUWLFLSDWLYDHQHO3HU~\HQHO
PXQGR<VHKDFHFRQSDVLyQ\ODVPiVGHODVYHFHVVLQHYLGHQFLDV(QHVHVHQWLGR
HVWHHVXQHVWXGLRTXHLQWHQWDSRQHUEDVHVREMHWLYDVDHVHGHEDWH1RVHSUHJXQWDSRU
eso, en abstracto, cuál es el mejor modelo de democracia local, sino cuanto le cuesta a
la gente el tipo de democracia participativa local existente y cuánta democracia puede
FRQVWUXLUFRQHVHSXQWRGHHTXLOLEULRHQWUHFRVWRV\EHQHÀFLRV

(O SXQWR GH SDUWLGD GH OD LQGDJDFLyQ HQ 3XQR KD VLGR OD DFWXDOL]DFLyQ GHO
tema de los “costos de la participación social” planteada por Juan Arroyo y Marina
,ULJR\HQ HQ VX UHFLHQWH OLEUR ´'HVDItRV GH OD 'HPRFUDFLD 3DUWLFLSDWLYD /RFDO HQ OD
'HVFHQWUDOL]DFLyQ8QDOHFWXUDDSDUWLUGHGRFHH[SHULHQFLDVµ  1 en cuyo capítulo
VHLVVHDÀUPDTXHH[LVWHXQDIUDQMDGHGHVHPSHxRySWLPRGHODSDUWLFLSDFLyQVRFLDO
según la relación entre resultados, costos y calidad de la participación, y que la demanda
SRUODSDUWLFLSDFLyQSRUWDQWRHVUHODWLYDPHQWHHOiVWLFDDFyPRVHPRGLÀTXHQGLFKDV
variables.

(QGLFKROLEURVHSXVRHQFXHVWLyQTXHIXQFLRQDVHPHFiQLFDPHQWHODIyUPXODGH
´DPiVSREUH]DPiVSDUWLFLSDFLyQµDÀUPDQGRTXHKD\PXFKRVVHFWRUHVSREUHVTXHVH
autoexcluyen de participar justamente por no tener las condiciones socioeconómicas

 $UUR\R-XDQ\0DULQD,ULJR\HQ'HVDItRVGHOD'HPRFUDFLD3DUWLFLSDWLYD/RFDOHQOD'HVFHQWUDOL]DFLyQ8QDOHFWXUD
1

a partir de doce experiencias. Capítulo 6: Demanda participativa elástica e inelástica: la franja de desempeño óptimo
de la participación, pág. 65.

225
Juan Arroyo y Marina Irigoyen

que les permitan asumir el costo de la participación. Se produce así un cálculo de


FRVWRV\EHQHÀFLRVGHODSDUWLFLSDFLyQTXHWDPELpQHVGHLQWDQJLEOHVHVWRHVGHFRVDV
PDWHULDOHVSHURWDPELpQGHJDQDQFLDVDIHFWLYDVRGHFDSDFLGDGHV

La participación, según los autores, tiene un costo para los involucrados y el


SULPHUFRVWRHVHOWLHPSRTXHVHOHGHGLFD/DJHQWHLGHQWLÀFDTXHQRSDUWLFLSDQR
SRUIDOWDGHLQWHUpVVLQRSRUIDOWDGHWLHPSR8QHVWXGLRDXVSLFLDGRSRUHO,QVWLWXWRGH
Estudios Peruanos el 2000 reveló que un 52,5% de los encuestados declaraba que le
JXVWDUtDSDUWLFLSDUPiVHQODVRUJDQL]DFLRQHVSHURHOGHHOORVQRORKDFtDSRU
IDOWDGHWLHPSR 7DQDND\=iUDWH 3HURDGHPiVODGHPDQGDGHSDUWLFLSDFLyQSRU
ODJHQWHGHSHQGHWDPELpQGHODFDOLGDGGHOVLVWHPDSDUWLFLSDWLYR(VWRVLJQLÀFDGHFtDQ
$UUR\RH,ULJR\HQTXHHQQXHVWURSDtVODGHPDQGDGHSDUWLFLSDFLyQQRHVLQHOiVWLFD
sino relativamente elástica a los cambios en los costos y calidad de la participación, esto
es, es muy variable al factor costo-tiempo, al factor calidad-de-la-reunión o al factor
importancia-de-la-agenda o al factor cumplimiento-de-los-acuerdos. Hay una franja
TXHQRSXHGHSDJDUHOFRVWRGHRSRUWXQLGDGGHODVKRUDVUHXQLyQ PiVYLDMHV TXH
VLJQLÀFDSDUWLFLSDU\QRHQWUDDODGHPRFUDFLDSDUWLFLSDWLYD(VWDUHTXLHUHDEDUDWDUORV
FRVWRVGHOHQURODPLHQWRGHHVWDIUDQMDDXVHQWHFRQRWUDVPRGDOLGDGHVÁH[LELOL]DQGR
HOLQJUHVR3HURTXLHQ\DKDSDJDGRHOFRVWRWLHPSRGHLUDODVUHXQLRQHVHVWiDWHQWRD
la calidad de la instancia de participación. Si la reunión es larga, tediosa, desordenada
y sin buenos acuerdos, la demanda de participación se retrae. Si la agenda va a debatir
proyectos que tienen que ver con su vida cotidiana, va a tratar de asistir, pero si asiste
\GHVSXpVQRVHHMHFXWDQDGDYDDVHUPiVGLItFLOYROYHUORDHQURODU6LODHODVWLFLGDG
IXHUDPX\YROiWLOWRGRVVHLUtDQDODSULPHUDSHURIHOL]PHQWHKD\XQVHFWRUGXURTXH
IXQFLRQDFRPRFROFKyQGHOVLVWHPD\TXHSDJDLQFOXVRORVFRVWRVGHORVHUURUHVGH
diseño y ejecución.

El problema de este “sector duro”, militante en la participación, es que a veces


pierde contacto con la realidad y solicita a la gente un compromiso que sería deseable
pero no posible. Este estudio justamente ubica los factores centrales de la “función
de la demanda de participación”, de boca de los propios involucrados en ella, para
facilitar el acceso y mantención de la gente en las democracias participativas locales.

Evidentemente somos conscientes de que esto representa un reenfoque del la


IRUPDFRPRVHKDYHQLGRGHEDWLHQGRHOWHPDGHODGHPRFUDFLDHQHO3HU~SXHVDGPLWH
como necesaria la medición, así fuese aproximada, de cuánto puede dedicarse la gente
a la “administración general de las cosas” y cuánto podría dedicarse más si variaran las
condiciones que determinan el tipo de democracia efectiva y el rango de desempeño
KDELWXDOGHODPLVPDFRPRIRUPDGHJRELHUQR

226
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

(VWRTXLHUHGHFLUHQFRQVHFXHQFLDTXHHQHVWHWHPDKD\GRVGHEDWHVHQWUHFUX]DGRV
3RUXQODGRKD\XQGHEDWHVREUHORVPRGHORVGHGHPRFUDFLDTXHGHVGHPX\DWUiV
KD YHQLGR HQIUHQWDQGR HQ ORV H[WUHPRV D ORV SDUWLGDULRV GH GHPRFUDFLDV FHUUDGDV
VKXPSHWHULDQDV FRQ ORV SDUWLGDULRV GH ´GHPRFUDFLDV FDOLHQWHVµ URXVVHDXQLDQDV
3HURWDPELpQKD\XQVHJXQGRGHEDWHHSLVWHPROyJLFR\PHWRGROyJLFRVREUHFyPR
DSUR[LPDUQRVPHMRUDOHVWXGLRGHODLQVWLWXFLRQDOLGDGGHPRFUiWLFDHQTXHKDSULPDGR
largamente el “pensamiento normativo y ensayístico”, que se limita al planteamiento
GHFyPRGHELHUDQVHUODVFRVDVRDODKLVWRULDGHODVLGHDVVLQGDUOHLPSRUWDQFLDDOD
evaluación concreta, a la experiencia, la medición y el dato.

Este estudio va en sentido contrario a esta última tendencia normativa, aún


dominante, basándose para ello en un marco teórico multidisciplinario que imbrinca
los desarrollos de la economía sobre las instituciones y la política, con los desarrollos
de las ciencias sociales y políticas sobre modelos de democracia y ciudadanía. En
JHQHUDODPERVPXQGRVWHyULFRVKDQHVWDGRGLYRUFLDGRV\KDVWDHQIUHQWDGRVSHURHO
presente estudio busca mostrar la potencia de su articulación.

2.1 Gobierno del pueblo o en nombre del pueblo


¿Cómo debatir el tema de los modelos de democracia para una zona local rural, en
forma no prescriptiva, normativa, en un breve marco teórico que ayude a comprender
mejor el tema de la democracia participativa y sus costos? Evidentemente es todo un
desafío pues la costumbre es contraponer los modelos de democracia, mientras en la
UHDOLGDGSULPDQPiVELHQODVKLEULGDFLRQHV

La primera pregunta es, entonces, ¿en los tres distritos estudiados aparece nítida
la diferencia entre “la democracia como gobierno del pueblo” y “la democracia como
JRELHUQRHQQRPEUHGHOSXHEORµSROpPLFDKLVWyULFDHQHOFDPSRGHODVLGHDVSROtWLFDV
FRPRSDUDTXHHOHVWXGLRSDUWDGHXQVRORPRGHOR"1XQ2 llama a la primera opción
gobierno del pueblo y a la otra, gobierno de los políticos.

Efectivamente el debate entre ambas tradiciones tiene ya varias centurias, por


ORPHQRVGHVGH%XUNHD3DWHQDP+DEHUPDV\0RXIIHSHURORVDFWRUHVFHQWUDOHVGH
los distritos puneños seleccionados para el presente estudio viven una combinación
GHGHPRFUDFLDVGHVGHODFRPXQDOGLUHFWDKDVWDODUHSUHVHQWDWLYDPXQLFLSDOSDVDQGR
por la participativa de los presupuestos participativos y espacios de concertación, y

 1XQ-RVp'HPRFUDFLD¢*RELHUQRGHOSXHEORRJRELHUQRGHORVSROtWLFRV"GD(GLFLyQ0p[LFR)RQGRGH&XOWXUD
2

Económica, 2002.

227
Juan Arroyo y Marina Irigoyen

DHVHPL[LQVWLWXFLRQDOVHOHKDGHQRPLQDGRVLQFUpWLFDPHQWHHQHO3HU~GHPRFUDFLD
participativa.

/D JHQWH KD TXHEUDGR ORV GLTXHV HQWUH ORV WLSRV LGHDOHV R DUTXLWHFWXUDV
LQVWLWXFLRQDOHVPRGpOLFDV6LQTXHHVWRVLJQLÀTXHTXHQRVHLQFOLQHKDFLDDOJ~QODGR
pues las autoridades y líderes campesinos de la provincia de Melgar creen más en la
democracia como gobierno del pueblo, y ello no sólo por formación o doctrina sino
SRUTXHHQODEDVHGHO(VWDGRSHUXDQRpVWHHVPX\GpELO\ODVRFLHGDGHVPiVIXHUWH
y la necesidad de su alianza es evidente y práctica común. Se podría decir que en los
distritos, centros poblados y comunidades rurales del Perú la cogestión en la toma
de decisiones políticas está más al alcance y que conforme se asciende en niveles
HQ HO (VWDGR KDFLD OR SURYLQFLDO UHJLRQDO \ QDFLRQDO VH GHVGLEXMD OD SDUWLFLSDFLyQ
ciudadana directa y la formación de espacios de participación y concertación exige
más convicción y proactividad.

(Q RWUDV SDODEUDV OD WHRUtD PLQLPDOLVWD R SURFHGLPHQWDO GH 6KXPSHWHU WLHQH
menos espacio en la sierra peruana, y en las localidades pequeñas rurales, y más en
los niveles nacionales y regionales. En Ayaviri, Santa Rosa y Orurillo la democracia es
PiVTXHXQPpWRGRSROtWLFR\QRH[LVWHXQDVHSDUDFLyQQtWLGDHQWUHORVSURIHVLRQDOHV
GHODSROtWLFD\VXVHOHFWRUHV'HDOJXQDIRUPDKD\HQYLYRXQDWHRUtDSOXUDOLVWDGHOD
GHPRFUDFLDXQWDQWRGLIHUHQWHDODGH5REHUW'DKO3HQTXHKD\HVYHUGDGP~OWLSOHV
puntos de iniciativa y demandas, gobernando minorías similares a las de la poliarquía,
pero en un entorno poblacional que es convocado periódica y sistemáticamente. El
parecido con el ideal rousseauniano de una democracia se da por el lado de la apelación
SRSXODUSHUPDQHQWH\HOFRQWDFWRFDUDDFDUDSHURDOÀQDOODGHPRFUDFLDUHSUHVHQWDWLYD
pone el armazón de la autoridad legal, el alcalde y su consejo de regidores. Cuanto
más peso en la sociedad, más autogestionario y cogestionario es el mix, y viceversa,
cuanto más peso de los representantes y mayor pasividad de la sociedad, más parecido
el esquema al de las democracias elitistas.

6HHQWLHQGHHQWRQFHVSRUTXpQRVHWUDWDGHGLVFXWLUODVXSHULRULGDGHQJHQHUDOGH
un modelo, sino de analizar las bondades y limitaciones de las variantes democráticas a
ODOX]GHH[SHULHQFLDHQHVWHFDVRODH[SHULHQFLDUXUDODQGLQDHQORFDOLGDGHVTXHFKXDV
VXUHxDV/RVWLSRVLGHDOHVGHFtD:HEHUVRQVyORPRGHORVKHXUtVWLFRV

 'DKO5REHUW/DSROLDUTXtD3DUWLFLSDFLyQ\RSRVLFLyQ0DGULG(GLWRULDO7HFQRV6$
3

228
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

2.2 Las teorías económicas de lo institucional


6LODSDUWLFLSDFLyQFLXGDGDQDVHGDHVWpRQRLQVWLWXFLRQDOL]DGDHQORVGLVWULWRV
UXUDOHVGH0HOJDU\GHEXHQDSDUWHGHODVLHUUDSHUXDQDODSUHJXQWDHV¢SRUTXpQRVH
KDHVWXGLDGRORVIDFWRUHVTXHODSXHGHQDPSOLDURUHVWULQJLUSRUHMHPSORHVWHWHPDGH
“los costos de la participación”?

1XHVWUD LPSUHVLyQ HV TXH OD SHUVSHFWLYD SUHVFULSWLYD D OD TXH DOXGtDPRV KD
bloqueado la operacionalización de los discursos sobre la democracia participativa.
<HVRH[SOLFDTXHGHEDPRVDFXGLUDKRUDDFDQWHUDVGHODHFRQRPtDLQVWLWXFLRQDOSDUD
estudiar el tema de los costos, explorado paradójicamente por quienes no creen tanto
en las agregaciones colectivas sino en las conductas individualistas, como reseñaremos.
/DVWHRUtDVGHODSDUWLFLSDFLyQEDVDGDVHQORVHQIRTXHVGHFLXGDGDQtDKDQSXHVWRHO
peso en la teoría de la agencia, en la iniciativa de los actores, veta importante, pero no
en las condiciones para su despliegue.

&RPRVHVDEHODHFRQRPtDQHRFOiVLFDVDOLyGHORVOLQGHURVGHODHFRQRPtDKDFH
\DYDULDVGpFDGDV\H[SDQGLyHOREMHWRGHVXDSOLFDFLyQDODVLQVWLWXFLRQHV\ODSROtWLFDV
FRQHOQHRLQVWLWXFLRQDOLVPRODHVFXHODGHO3XEOLF&KRLFHODWHRUtDSULQFLSDODJHQWHOD
WHRUtDGHODHOHFFLyQUDFLRQDOODGHORVFRVWRVGHWUDQVDFFLyQ\ÀQDOPHQWHFRQODWHVLV
del capital social.

1RHVGHOFDVRH[SOLFDUHQGHWDOOHDTXtHVWDVWHRUtDVSHURVtHOKLORFRQGXFWRU
TXHKL]RTXHHVWXGLDUDQFRQPiVIXHU]DHOWHPDGHODVPRWLYDFLRQHVVXSHVLPLVPR
VREUH OD SRVLELOLGDG GH OD DFFLyQ FROHFWLYD EDVDGDV HQ OD WHVLV GHO KRPEUH HJRtVWD
UDFLRQDO\PD[LPL]DGRUGHXWLOLGDGHV0DQFXU2OVRQ5RQDOG&RDVH'RXJODVV1RUWK
\ 5REHUW 3XWQDP HQWUH PXFKRV RWURV KDQ SURIXQGL]DGR HQ ORV FRPSRUWDPLHQWRV
sociales centrífugos, que precisamente son propios de países como el nuestro.
1R WRGRV HVWRV DXWRUHV \ HVFXHODV UHSUHVHQWDQ OD PLVPD SHUVSHFWLYD GHQWUR GH OD
economía. Podríamos decir que Mancur Olson representa mejor la economía “dura”
o “economía económica” –contrapuesta a la “economía política” - de la cual surgió
HOSXEOLFFKRLFH\ODWHRUtDGHORVMXHJRVPLHQWUDV+LUVFKPDQ\3XWQDPDOUHYpVVRQ
los más cercanos a las ciencias sociales “blandas”, siendo el neoinstitucionalismo un
enfoque intermedio.

7RGRVHVWRVGHVDUUROORVKDQSDUWLGRHYLGHQWHPHQWHGHODPDWUL]GHODHFRQRPtD
QHRFOiVLFDHFRQyPLFDGH)ULHGPDQ\+D\HNSHURVHKDQGHVDUUROODGRHQFUtWLFDSDUFLDO

229
Juan Arroyo y Marina Irigoyen

a ella. La tesis precursora que enunciara Ronald Coase4 en 1937 sobre la existencia
de otros costos además de los de producción y distribución, referidos a costos de
transacción y costos sociales, permitió abrir las disidencias. En la práctica todos
realizamos un cálculo de los costos de transacción societales para tomar decisiones,
y no sólo de los costos de producción. Este concepto, inicialmente formulado por
Coase, luego desarrollado por Oliver Williamson5\RWURV\DVXPLGRSRU1RUWK6 y
el neoinstitucionalismo contemporáneo, “forma” parte importante de la decisión, al
LJXDOTXHHOFiOFXORGHORVEHQHÀFLRV(OFRQFHSWRGHFRVWRVGHWUDQVDFFLyQDOXGHDOD
estructura institucional necesaria para la realización de las transacciones económicas,
D VL OD LQVWLWXFLRQDOLGDG HVWDWDO HV OLJHUD \ HÀFD] R SHVDGD \ REVWUXFFLRQLVWD 2OLYHU
Williamson, uno de los exponentes del tema, explica que obviamente los agentes
económicos siempre preferirán estructuras de gobierno que minimizen estos costos.
< HVWR SXHGH VHU DSOLFDGR D OD JHVWLyQ S~EOLFD SXHV FDGD VRFLHGDG WLHQH XQ SXQWR
ySWLPRHQWUHGHPRFUDFLD\HÀFLHQFLD

Estas tesis representan evidentemente un cambio respecto a la economía


QHRFOiVLFDRULJLQDOSDUDODFXDOQRVHMXVWLÀFDODH[LVWHQFLDRLPSRUWDQFLDGHOWHUFHUR
HQODVWUDQVDFFLRQHVHO(VWDGRFX\DSUHVHQFLDVHMXVWLÀFDVHJ~QODVYDULDQWHVSRVW
ortodoxas porque el comportamiento de los agentes económicos trata siempre
de alinear a su favor la transacción. Luego el neoinstitucionalismo subsumió los
desarrollos previos sobre los costos de transacción en su preocupación por debatir la
importancia de la institucionalidad y los incentivos para el comportamiento económico
HÀFLHQWH1RUWK7 desarrolló el argumento original de Coase sobre la diferencia entre
los costos derivados de la transformación física de un bien y los costos del bien puesto
HQ HO PHUFDGR KDVWD XQ SXQWR TXH SXGR DQDOL]DU ODV IXQFLRQHV GH FRRUGLQDFLyQ \
cooperación, inentendibles en el enfoque neoclásico.

El problema aplicado a nuestro tema es que si una sociedad es detallista y


burocrática, la estructura de costos de transacción es alto y ello afecta a la economía.
3HURSXHGHH[LVWLUDOUHYpVXQDVRFLHGDGDQyPLFDRGHSUHGRPLQLRGHODVYLRODFLRQHV
de las normas, en que los costos altos no provienen de las normas sino de la cultura
LQIRUPDO (VWH HV HO FDVR SHUXDQR \ HQ PXFKR ODWLQRDPHULFDQR GHO FXDO QR SXHGHQ
KDEODU ORV QHRLQVWLWXFLRQDOLVWDV (Q HVWRV FDVRV HV FRP~Q OD HOHYDFLyQ GH ORV FRVWRV

4
 &RDVH5RQDOG7KH)LUPWKH0DUNHWDQGWKH/DZ&KLFDJR7KH8QLYHUVLW\RI &KLFDJR3UHVV
5
 :LOOLDPVRQ2OLYHU7KH(FRQRPLF,QVWLWXWLRQVRI &DSLWDOLVP)LUPV0DUNHWV5HODWLRQDO&RQWUDFWLQJ1HZ<RUN
)UHH3UHVV
6
 1RUWK 'RXJODVV ,QVWLWXFLRQHV FDPELR LQVWLWXFLRQDO \ GHVHPSHxR HFRQyPLFR 0p[LFR )RQGR GH &XOWXUD
Económica, 1993.
7
 1RUWK'RXJODVVLEtGHP

230
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

GHWUDQVDFFLyQKDVWDXQQLYHOHQTXHEORTXHDQHOLQWHUFDPELRPLVPR\HVWDHOHYDFLyQ
procede no sólo de la presencia del Estado sino de su ausencia. Haciendo un simil
con el tema de la participación social, una democracia participativa bien diseñada e
implementada podría añadirle un valor a la perfomance global local, además de ser una
escuela de ciudadanía, pero si los actores tienen comportamientos centrífugos o si la
institucionalidad participativa es farragosa y complicada, se convierte en un sobre-peso
sobre la sociedad local.

2.3 Los estudios de costos desde el enfoque de la lógica de la


acción colectiva
Una buena parte de estudios sobre las motivaciones en la política y vida
LQVWLWXFLRQDO VH KDQ GHULYDGR GHO HQIRTXH GHO 3XEOLF &KRLFH GH 0DQFXU 2OVRQ la
versión más extrema, pesimista, sobre la posibilidad de la acción colectiva. Hace
PXFKRVDxRV2OVRQH[SOLFyODGLÀFXOWDGSDUDDJUXSDUVHFXDQGRWRGRVTXLHUHQJR]DU
de los bienes públicos pero muy pocos quieren pagar los costos de ese bien colectivo.
eOH[SOLFyTXHODOyJLFDGHODDFFLyQFROHFWLYDFRQWHQtDHVWDWHQVLyQSXHVQRKD\IRUPD
de que las personas no consuman bienes que por su naturaleza son colectivos pero
cuyos costos no se distribuyen por igual entre todos los que los usufructúan. Bajo
HVHHQIRTXHVHIXQGyHOSXEOLFFKRLFH\ODWHRUtDGHORVMXHJRV3DUD2OVRQVyORHUD
posible la acción colectiva en los grupos pequeños, en que existían ciertos contrapeso,
pero no en grupos mayores. Luego seguirían en la misma perspectiva los estudios
LQVWLWXFLRQDOHVGH%XFKDQDQ7XOORFN\'RZQV

2EYLDPHQWHHVWRKDFtDLQFRPSUHQVLEOHWRGDDFFLyQFRRSHUDWLYDHQODVVRFLHGDGHV
TXH HV HYLGHQWH H[LVWH 3HUR HQ OD KLVWRULD GH ORV SDtVHV KD\ PRPHQWRV VLQpUJLFRV
y momentos en que priman los bloqueos por conductas no cooperativas, siendo
SRUWDQWR~WLODSR\DUVHHQODUHÁH[LyQGH2OVRQSDUDHVWRV~OWLPRVFDVRV(QHVWDV
VLWXDFLRQHVGHVXPDFHURÁRUHFHQORV´IUHHULGHUVµ\ODVVRFLHGDGHV\ORVJRELHUQRV
VH HQWUDPSDQ HQ PXWXDV GHVFRQÀDQ]DV ²´GLOHPDV GHO SULVLRQHURµ GLUtD 2OVRQ  (V
HO FDVR SHUXDQR OXHJR GH GRV GpFDGDV GH GHVHVWUXFWXUDFLyQ \ GH DxRV GH FXOWR DO
individualismo posesivo.


 2OVRQ0DQFXU/D/yJLFDGHOD$FFLyQ&ROHFWLYD%LHQHV3~EOLFRV\OD7HRUtDGH*UXSRV0p[LFR(GLWRULDO/LPXVD
1992.

231
Juan Arroyo y Marina Irigoyen

1R HV FDVXDO HQWRQFHV TXH EDMR HO HQIRTXH GH OD DFFLyQ FROHFWLYD ÁRUHFLHVHQ
investigaciones sobre lo institucional. Tuvieron y tienen el sesgo, criticado por
Almond, de trasladar a lo colectivo metodologías individuales, pero para el cálculo
LQGLYLGXDOGHORVFRVWRVKDQPRVWUDGRFLHUWDSRWHQFLD

Uno de estos estudios es el de Pamela Oliver,9 que realizó una encuesta entre
1,456 residentes de Detroit que eran miembros activos, miembros formales o no
miembros de las asociaciones de vecinos y encontró que los miembros activos eran
VLJQLÀFDWLYDPHQWH PiV SHVLPLVWDV TXH ORV QR DFWLYRV VREUH ODV SHUVSHFWLYDV GH OD
DFFLyQFROHFWLYD,JXDOTXHHQQXHVWURFDVRHOODHQFRQWUyWUHVIUDQMDVGHDVRFLDGRV
XQRVTXHQRKDFtDQQDGDRWURVTXHKDFtDQFRQWULEXFLRQHVSHTXHxDVRIRUPDOHV\XQ
WHUFHUJUXSRTXHFRQWULEXtDVXVWDQFLDOPHQWHHQWpUPLQRVGHWLHPSR\HVIXHU]R6HJ~Q
ORV KDOOD]JRV GH OD DXWRUD H[LVWtDQ FXDWUR IDFWRUHV JHQHUDOHV TXH GHWHUPLQDEDQ ORV
niveles de involucramiento en las organizaciones vecinales: los intereses, los costos, la
FRKHVLyQHQWUHORVPLHPEURVGHOJUXSR\ODSUHGLFFLyQVREUHHOFRPSRUWDPLHQWRGH
los demás. Oliver aplicó el marco conceptual de la acción colectiva, encontrando que
PXFKDVSHUVRQDVDFHSWDEDQORVFDUJRVQRSRUSURSLDYROXQWDGVLQRSRUTXHQRKDEtD
TXLpQ ORV RFXSDVH FRQWUDGLFLHQGR DVt OD DVXQFLyQ EDVWDQWH FRP~Q GH TXH OD JHQWH
normalmente desea ser líder en las organizaciones. En relación a nuestro tema, el de los
FRVWRV2OLYHUKDOOyTXHKDEtDXQDFRUUHODFLyQSRVLWLYDHQWUHHOQLYHOVRFLRHFRQyPLFR
y el grado de participación vecinal, explicable por los altos costos de la participación
SDUDORVSREUHV1RVHWUDWDEDGHIDOWDGHPRWLYDFLyQORVSREUHVHUDQFRQYHUWLGRVHQ
“free riders” por estar ocupados en su sobrevivencia.

2WURHVWXGLRLPSRUWDQWHHQHVWHVHQWLGRKDVLGRHOGH7HUU\&RRSHU10 sobre los


costos de la participación a partir de la experiencia de aplicación del programa de
participación ciudadana de la Agencia de Salud del Condado de Los Angeles. El autor
describió primero la nueva estructura ideada para la Agencia y el proceso por el cual se
RUJDQL]y6HWUDWDEDGHXQ&XHUSRGH*RELHUQRFRQVWLWXLGRSRUPLHPEURVGH
ellos designados por la entidad ganadora del concurso para gestionar la Agencia y 15
designados por los supervisores de condados, a elegir en los cinco consejos de subareas,
HQUHSUHVHQWDFLyQGHORVPLOORQHVGHKDELWDQWHVGH/RV$QJHOHVHQWRQFHV&DGD&RQVHMR
tenía 30 miembros, 16 representantes de los consumidores y 14 representantes de los
SURYHHGRUHV \ FDGD &RQVHMR HOHJtD D  UHUHSVHQWDQWHV DQWH HO &XHUSR GH *RELHUQR
central de la ciudad. La implementación del Plan supuso diez reuniones masivas,

9
 2OLYHU3DPHOD,I <RX'RQW'RLW1RERG\(OVH:LOO$FWLYHDQG7RNHQ&RQWULEXWRUVWR/RFDO&ROOHFWLYH$FWLRQ
$PHULFDQ6RFLRORJLFDO5HYLHZ9RO1R2FWSS
10
 &RRSHU7HUU\7KH+LGGHQ3ULFH7DJ3DUWLFLSDWLRQ&RVWVDQG+HDOWK3ODQQLQJ$P-3XEOLF+HDOWK$SULO
  ²

232
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

con 200 a 400 participantes cada una, en que se explicaba la nueva estructura y los
objetivos de la nueva organización. El día de la elección solo votaron 23,495 personas,
compitiendo 1,439 candidatos a los diferentes puestos elegibles. A los cuatro meses
VHLQVWDOyODRUJDQL]DFLyQSHURIXpQRWRULRTXHHQVRORFXDWURPHVHVKDEtDGHFDtGRHO
LQWHUpVGHODJHQWH$SDUWLUGHOHVWXGLR&RRSHUHVWDEOHFLyXQDPDWUL]WHyULFDGHFRVWRV
FRQFRVWRVHVSHFtÀFRVLQKHUHQWHVDOGLVHxRRUJDQL]DFLRQDOFRPRVXFRPSOHMLGDG\VX
escala, y costos introducidos por los procedimientos de implementación, que tenían
TXHYHUFRQODOLPLWDGDLQIRUPDFLyQORVOXJDUHVGHUHXQLRQODVDJHQGDVORVPpWRGRVGH
comunicación, los procesos para la membrecía y el registro complicado de los votantes.
Concluyó que los niveles de participación luego del primer año del programa eran
consistentes con los altos costos de participación de este programa, y que la mayoría
de los 150 elegidos eran “veteranos de la participación ciudadana”.

2.4 La operacionalización de categorías para el estudio


3DUD HO SUHVHQWH HVWXGLR VH KD XWLOL]DGR DGHPiV GHO HQIRTXH DQWHULRU OD
FODVLÀFDFLyQTXHKDFHQ)DELR9HOiVTXH]&\(VSHUDQ]D*RQ]iOHV511 sobre los tipos
de participación social:

• La participación - formalidad, es la participación entendida únicamente


como un requisito de ley que es preciso llenar para cumplir con los parámetros
de la gestión pública.
• La participación sin alas, es aquella que las autoridades locales promueven
siempre y cuando no ponga en cuestión las lógicas y las estructuras de poder
vigentes.
• La participación integración - cooptación, es aquella cuando las
autoridades locales promueven para evitar corrientes de pensamiento y de
movilización ciudadana que actúen en contra de la lógica dominante del
sistema político local. Uno de los instrumentos más importantes para el logro
de su propósito, aunque no el único, es la cooptación de viejos y nuevos
liderazgos por parte de las autoridades locales y sus organizaciones políticas
SDUD TXH DFW~HQ HQ EHQHÀFLR GH ORV LQWHUHVHV SROtWLFRV KHJHPyQLFRV HQ OD
vida local, antes que a favor de las necesidades y aspiraciones de la población
a la que se supone representan.
• La participación - concertación, este concepto busca el acento en la
construcción colectiva de acuerdos en torno a objetivos comunes y a los
medios para alcanzarlos. Dos ideas son centrales en esta noción: el pluralismo
y la intervención directa de la ciudadanía en el análisis de su entorno y

 )DELR 9HOiVTXH] & \ (VSHUDQ]D *RQ]iOHV 5 ¢4Xp KD SDVDGR FRQ OD SDUWLFLSDFLyQ FLXGDGDQD HQ &RORPELD"
11

Colombia, 2003, pp. 149–151.

233
Juan Arroyo y Marina Irigoyen

en la toma de decisiones acerca de cómo actuar para conseguir objetivos


compartidos.
• La participación - modo de vida; aquí la participación no es concebida
como una actividad adicional a la rutina diaria de la gente, como algo que
H[LJHHVIXHU]RVDGLFLRQDOHV\FRVWRV GHWLHPSRGHUHFXUVRVHWF VLQRFRPR
un valor y una norma social interiorizados desde la infancia, que llevan a la
gente a involucrarse en dinámicas colectivas, no tanto para la obtención de un
EHQHÀFLRHVSHFLÀFRDXQTXHHVHDOLFLHQWHSXHGHH[LVWLUVLQRSULQFLSDOPHQWH
SRUTXH HV EXHQR KDFHUOR \ GH HVD IRUPD HO FROHFWLYR VRFLDO VH EHQHÀFLD \
fortalece”.

Para comprender las motivaciones que tiene cada persona para participar, es
GHFLUTXHORVPRWLYDKHPRVXWLOL]DGRODWLSRORJtDTXHKDFH$PDUW\D6HQ12 al respecto,
TXH´HVWDEOHFHXQDFODVLÀFDFLyQSULPHURVHUHÀHUHDFRQGXFWDVUDFLRQDOHVGHFRUWH
egoísta, las cuales se rigen por el egoísmo, es decir, por la búsqueda del máximo
EHQHÀFLRSRUSDUWHGHOLQGLYLGXRDFRVWDGHORVGHPiV3UHYDOHFHVXLQWHUpVLQGLYLGXDO
Esta conducta puede incluso llevar a que el individuo no coopere en una situación
GHWHUPLQDGDSRUTXHQRREWHQGUiORVPi[LPRVEHQHÀFLRVHVSHUDGRV/DRWUDFDWHJRUtD
es intermedia y le denomina simpatía. En este caso a los individuos les preocupa el
bienestar ajeno en la medida en que afecte el suyo. El sujeto coopera siempre y cuando
VHHVWpQDIHFWDQGRVXVLQWHUHVHV\VyORFXDQGRORVGHPiVORKDFHQ(QWHUFHUOXJDU
VHUHÀHUHDODVPRWLYDFLRQHVGHFRPSURPLVRTXHHVWiHQOD]DGDFRQXQDHVWUDWHJLDGH
cooperación incondicional en la que actúa y coopera independientemente de lo que
KDJDQORVRWURV\EXVFDQGRHOELHQHVWDUGHORVGHPiV(VWDPRWLYDFLyQSXHGHWDPELpQ
FODVLÀFDUVHFRPRDOWUXLVWDµ

(QHVWHVHQWLGRWRGDSDUWLFLSDFLyQEXVFDXQEHQHÀFLRTXHVHJ~Q-RVHS5RWD13
SXHGHQVHUGHGRVWLSRV%HQHÀFLRVFROHFWLYRVTXHVRQORVTXHIDYRUHFHQDWRGDXQD
FRPXQLGDG R JUXSR \ ORV %HQHÀFLRV VHOHFWLYRV TXH EHQHÀFLDQ GLUHFWDPHQWH D ORV
individuos que participan.

(VWDV FDWHJRUtDV QRV KDQ SHUPLWLGR HVWUXFWXUDU ORV WLSRV GH EHQHÀFLRV TXH
motivan la participación de los actores, considerando que generalmente la participación
HVWiYLQFXODGDDGHPiVGHYDORUHV\SULQFLSLRVDXQFiOFXORFRVWR²EHQHÀFLRSRUORV
LQYROXFUDGRV$VtFRPRODSDUWLFLSDFLyQJHQHUDEHQHÀFLRVWDPELpQRFDVLRQDFRVWRV
para los que participan y para los que promueven la participación.

12
 $PDUW\D6HQ/RVWRQWRVUDFLRQDOHV(Q+DQK)\+ROOLV0 FRPSLODGRUHV )LORVRItD\WHRUtDHFRQyPLFD0p[LFR
)&(3
13
 -RVHS5RWD&RPXQLFDFLyQJRELHUQR\FLXGDGDQtD3XEOLFDGRHQOD5HYLVWDGHO&/$'5HIRUPD\'HPRFUDFLD1ž
3

234
Capítulo 3
El entorno de la participación

3.1 Geografía
La provincia de Melgar se encuentra en el Altiplano de Puno, Perú, cuya
altitud varía de 3,907 a 5,150 m.s.n.m. Tiene un clima frío y seco: su precipitación
SOXYLDO SURPHGLR DQXDO HV GH  PP \
VX WHPSHUDWXUD RVFLOD HQWUH ž & HQ ODV
QRFKHVGHLQYLHUQRKDVWDž&HQORVGtDV
calurosos.

El distrito de Ayaviri, capital de la


SURYLQFLD GH 0HOJDU SRVHH XQD VXSHUÀFLH
GH  NP2 con una altitud promedio
de 3,907 m.s.n.m.; el distrito de Orurillo por
VXSDUWHSRVHHXQDVXSHUÀFLHGHNP2
FRQXQDDOWLWXGSURPHGLRGHPVQP
mientras que el distrito de Santa Rosa cuenta
FRQXQDVXSHUÀFLHGHNP2 y la mayor
altitud de los tres distritos llegando a los
3,993 m.s.n.m.

235
Juan Arroyo y Marina Irigoyen

Cuadro 4: Provincia de Melgar y sus distritos,


DOWLWXG\VXSHU¿FLH

Departamento, provincia y Altitud 6XSHUÀFLH


distrito PVQP NP
Departamento de Puno* 71,999.00
Provincia de Melgar 3,907 - 5,150 
Distrito de Ayaviri 3,907 1,013.14
Distrito de Orurillo  379.05
Distrito de Santa Rosa 3,993 
,QFOX\HNPGHVXSHUÀFLHLQVXODUODFXVWUHGHLVODVTXHQRIRUPDQ
SDUWHGHORVGLVWULWRVLQVXODUHVGH$PDQWDQL\$QDSLD\NPGHO
/DJR7LWLFDFD ODGRSHUXDQR )XHQWH,1(,

3.2 Demografía
0HOJDUWLHQHXQDSREODFLyQGHKDELWDQWHV ,1(, ORTXHUHSUHVHQWD
HOGHOWRWDOGHSDUWDPHQWDOFRQXQDGHQVLGDGSREODFLRQDOGHKDELWDQWHVSRU
NP(OVHHQFXHQWUDXELFDGDHQ]RQDVXUEDQDV\HOHQ]RQDVUXUDOHV
En los distritos de Orurillo y Santa Rosa la población rural representa el 90%.

Cuadro 5: Provincia de Melgar, población y densidad poblacional


Densidad Pob.
Departamento, provincia y distrito Población
KDENP
Departamento de Puno*  17.30
Provincia de Melgar  13.14
Distrito de Ayaviri 25,346 25.02
Distrito de Orurillo 11,449 30.20
Distrito de Santa Rosa 7,454 9.43
)XHQWH,1(,

/D WDVD GH FUHFLPLHQWR GHPRJUiÀFR SDUD HO SHULRGR  IXH GH 
mientras que la tasa de migración neta, es decir, la diferencia entre el número de
inmigrantes y emigrantes entre la media de la población, fue de -13.6, casi el doble de
la tasa departamental.

236
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

&XDGUR0HOJDUFUHFLPLHQWRGHPRJUi¿FR\PLJUDFLyQ

Tasa de
crecimiento 0LJUDFLyQ HQPLOHV Tasa de
GHPRJUiÀFR migración
QHWD
 1993- Saldo 1993
,QPLJUDFLyQ Emigración
1993 2002 migratorio
Puno 1.6 1.5  136.7 -50 -7.5
Melgar 1.4 1.5 4.2  -4.2 -13.6
)XHQWH318'0DSDGHODV3RWHQFLDOLGDGHVGHO3HU~

3.3 Producción
La mayoría de productores de Melgar y sus distritos está agrupada en
comunidades campesinas y organizaciones de productores individuales, desarrollando
una producción de autoconsumo, siendo pocas las familias que producen para el
mercado.

La producción central en agrícola y pecuaria, desarrollándose un sistema mixto.


La agricultura se basa en especies resistentes al frío, como la papa, cebada, oca, quinua,
FDxLKXD\DYHQD/DFULDQ]DGHDQLPDOHVFRPSUHQGHDYDFXQRVRYLQRV\FDPpOLGRV
y se basa en el pastoreo, siendo alimentados principalmente por pastos naturales y
en algunos casos complementados con forrajes y pastos cultivados. Según el Mapa
GH3RWHQFLDOLGDGHVGHO3HU~ 318' 0HOJDUHVODSURYLQFLDTXHFXHQWDFRQHO
PD\RUQ~PHURDOSDFDV  

La provincia de Melgar tiene pequeñas plantas de elaboración de queso y


PDQWHTXLOODDVtFRPRGHWH[WLOHVWtSLFRV&XHQWDDGHPiVFRQHO&HQWURGH,QYHVWLJDFLyQ
\3URGXFFLyQ&KXTXLEDPELOODFRQXQDH[WHQVLyQGHKHFWiUHDVGHGLFDGDVDOD
FULDQ]D GH JDQDGR YDFXQR SDUD FDUQH \ OHFKH JDQDGR RYLQR PHMRUDGR \ FULROOR \
alpacas y ganado porcino.

Dentro de sus recursos naturales, Melgar cuenta con la Laguna de Orurillo, ideal
para el turismo de aventura o ecológico. Asimismo, en el distrito de Santa Rosa se
HQFXHQWUDHO1HYDGRGH.XQXUDQDRWURLPSRUWDQWHGHVWLQRWXUtVWLFR

237
Juan Arroyo y Marina Irigoyen

3.4 Pobreza y desarrollo humano


6HJ~Q HO ,1(, HO  GH ODV IDPLOLDV GH $\DYLUL VRQ SREUHV HO  GH
6DQWD5RVDLJXDO\HOGHODVGH2UXULOOR(QODV]RQDVXUEDQDVODSREUH]DHV
GHO\HQODV]RQDVUXUDOHVGHO

Este orden de prelación, en que el distrito de Ayaviri es el relativamente mejor y


2UXULOORHOSHRUVHFRQÀUPDFRQHOtQGLFHGHFDUHQFLDVGHO318'$\DYLULHVHO~QLFR
distrito de los tres que no se encuentra en el quintil más pobre.

Cuadro 7: Índice de carencias en distritos de Melgar, Puno

Índice 4XLQWLOGHOtQGLFH
GHFDUHQFLDV GHFDUHQFLDV
0(/*$5 0.5679 2
Ayaviri 0.232036935 2
Orurillo  1
Santa Rosa  1
(VXQYDORUHQWUH\(VWHtQGLFHHVREWHQLGRPHGLDQWHHODQiOLVLVIDFWRULDOSRUHO
PpWRGRGHODVFRPSRQHQWHVSULQFLSDOHV
4XLQWLOHVSRQGHUDGRVSRUODSREODFLyQGRQGHHO 0iVSREUH\HO 0HQRVSREUH
)XHQWHV&HQVRGH3REODFLyQ\9LYLHQGDGHO,1(,&HQVRGH7DOOD(VFRODUGH
²0,1('8

(OLQJUHVRIDPLOLDUSHUFiSLWDVHJ~QHO,QIRUPHVREUHHO'HVDUUROOR+XPDQR
318' HUDGHQXHYRVVROHVPHQVXDOHVSDUDODSURYLQFLDGH0HOJDUHV
GHFLU FLQFXHQWD VROHV PHQRV TXH OD FLIUD UHJLVWUDGD D QLYHO QDFLRQDO  QXHYRV
VROHVSRUPHV /RVGLVWULWRVGH$\DYLUL2UXULOOR\6DQWD5RVDRVFLODURQHQPRQWRV
relativamente cercanos a la media provincial, con 247.6, 224.3 y 239.5 nuevos soles
mensuales respectivamente.

Cuadro 8: Ingreso familiar per cápita en Melgar y sus distritos

,QJUHVRIDPLOLDU
SHUFiSLWD 16PHV
Melgar 235.3
Ayaviri 247.6
Orurillo 224.3
Santa Rosa 239.5
)XHQWH,QIRUPHVREUH'HVDUUROOR+XPDQR3HU~

238
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

En relación al Índice de Desarrollo Humano, la provincia de Melgar tenía el


XQ,'+GHRFXSDQGRHOSXHVWRGHODVSURYLQFLDVGHO3HU~/RV
GLVWULWRVGH2UXULOOR\6DQWD5RVDWHQtDQXQ,'+GH\UHVSHFWLYDPHQWH
con lo que se encontraban por debajo del promedio provincial. Ayaviri, por su parte
UHJLVWUy XQ ,'+ GH  \ RFXSy HO SXHVWR  GH ORV  GLVWULWRV GHO 3HU~
situándose además por encima del promedio provincial.

Cuadro 9: Melgar, índice de Desarrollo Humano


Índice de Desarrollo Humano
,'+ UDQNLQJ
Melgar 0.5263 137
Ayaviri  
Orurillo 0.5112 1423
Santa Rosa 0.5125 1411
)XHQWH,QIRUPHVREUH'HVDUUROOR+XPDQR3HU~

3.5. Servicios
En cuanto al acceso al servicio de agua, la provincia de Melgar posee a más de la
PLWDGGHVXSREODFLyQ  VLQVHUYLFLRGHDJXDSRWDEOH(QHOGLVWULWRGH2UXULOOR
DOFDQ]DHO6DQWD5RVDHO\$\DYLULVyORHO(OSRUFHQWDMHGHSREODFLyQ
sin desagüe y letrina es de 34.7% tanto para la provincia de Melgar como para el distrito
GH2UXULOOR\OOHJDDHQ6DQWD5RVD(Q$\DYLULSRUVXSDUWHHVGH

)LQDOPHQWHHQORTXHVHUHÀHUHDODFFHVRDHOHFWULFLGDGHQODSURYLQFLDGH0HOJDU
el 61.7% de la población no cuenta con ella y en los distritos analizados el patrón
GHDJXD\GHVDJHVHUHSLWH2UXULOORWLHQHFRQODFLIUDPiVDOWDGHFDUHQFLD  
VHJXLGRSRU6DQWD5RVD  \GH$\DYLUL  

Cuadro 10: Melgar, carencia de agua, desagüe y electricidad


% de la población sin:
Agua 'HVDJOHWULQ Electric.
0(/*$5 52.07 34.74 61.7
Ayaviri 29.52  
Orurillo  34.73 92.49
Santa Rosa 57.79 37.09 
)XHQWHV&HQVRGH3REODFLyQ\9LYLHQGDGHO,1(,&HQVRGH7DOOD(VFRODU
GH0,1('8

239
Juan Arroyo y Marina Irigoyen

3.6. Educación
En la provincia de Melgar la tasa promedio de analfabetismo es del 14% y la tasa
GHHVFRODULGDGHVGHO&RQDPERVLQGLFDGRUHVSRGHPRVFRPSUREDUTXH$\DYLUL
tiene una considerable ventaja en el tema de educación con respecto a los otros dos
distritos analizados.

Cuadro 11: Melgar, indicadores de educación


Analfabetismo* Escolaridad**
% UDQNLQJ % UDQNLQJ
Melgar 14 102  
Ayaviri 9.9 622 91 337
Orurillo 17.7   1034
Santa Rosa 17.9 1192  779
3REODFLyQGHDxRV\PiVTXHQRVDEHOHHUQLHVFULELU3REODFLyQWRWDOGHDxRV\PiV
3REODFLyQGHDDxRVTXHDVLVWHDOFHQWURHGXFDWLYR3REODFLyQWRWDOGHDDxRV
)XHQWH,QIRUPHVREUH'HVDUUROOR+XPDQR3HU~

3.7 Salud
En la provincia de Melgar, la esperanza de vida la nacer es de 62.2 años, en Ayaviri llega a los
63.3 años, en Orurillo a los 61.6 y para Santa Rosa es de 61 años.

Cuadro 12: Melgar, esperanza de vida al nacer


Esperanza de vida al nacer
Años 5DQNLQJ
Melgar 62.2 
Ayaviri 63.3 1546
Orurillo 61.6 1677
Santa Rosa 61 1713
)XHQWH,QIRUPHVREUH'HVDUUROOR+XPDQR3HU~

De otro lado, en relación a la desnutrición crónica en menores de 3 años, el sistema


GHPRQLWRUHRGH&$5(3HU~\GHO0,16$LQGLFDTXHHQWUHORVDxRV\
afectaba al 21.9 % de ellos, con implicancias en la vulnerabilidad a las enfermedades
y retardo en el crecimiento.

240
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

/DWDVDGHPRUWDOLGDGJHQHUDOSRUKDELWDQWHVHVGHSDUDODSURYLQFLD
GH0HOJDUVHJ~QHOLQIRUPHGHOD6LWXDFLyQGH6DOXGGH3XQR 0,16$ 6HJ~Q
este mismo informe, la tasa de mortalidad infantil por 1,000 para menores de un año
HVGHFRQYLUWLpQGRVHDVtHQODVHJXQGDPiVDOWDSDUDHOGHSDUWDPHQWRGH3XQR
DQWHFHGLGD~QLFDPHQWHSRU&DUDED\DFRQXQDWDVDGHSRUPLO3RUVXSDUWHODWDVD
de mortalidad en adultos mayores, para personas de 65 años y más años, fue de 299
SRUKDELWDQWHVHQHO

(VHPLVPRDxRODSURYLQFLDGH0HOJDUFRQWDEDFRQFHQWURVGHVDOXG\
puestos de salud, con lo que se ubicaba en el segundo y tercer lugar respectivamente
GHQWURGHOGHSDUWDPHQWRGH3XQR(QFXDQWRDUHFXUVRVKXPDQRVHQVDOXGHO
0HOJDUFRQWDEDFRQPpGLFRVSRUFDGDKDELWDQWHVDGLVWDQFLDGHOSURPHGLR
QDFLRQDOGHPpGLFRVSRUKDELWDQWHV6XVUDWLRVGHHQIHUPHUDVRGRQWyORJRV
\REVWHWULFHVHUDQGH\SRUFDGDKDELWDQWHVUHVSHFWLYDPHQWH

3.8 Género y exclusión


(Q ODV FXOWXUDV WUDGLFLRQDOHV FRPR OD TXHFKXD TXH SUHYDOHFH HQ 0HOJDU OD
GLVFULPLQDFLyQSRUJpQHURHVXQDFDUDFWHUtVWLFD\VHH[SUHVDGHGLYHUVDVIRUPDVHO
FRPSRUWDPLHQWRPDFKLVWDGHORVYDURQHVODGLIHUHQFLDFLyQGHUROHVHQODSURGXFFLyQ
agropecuaria o la valoración diferente del aporte de cada sexo en la sociedad.

6HJ~QHO318'ODSREUH]DHQHO3HU~VHKDIHPLQL]DGR\HVWDPD\RULQFLGHQFLD
de pobreza es producto de las desigualdades en las posibilidades de acceso al trabajo,
del acceso a participar y a tener mejores ingresos. Los varones pueden integrar grupos
cívicos, políticos y profesionales en tanto las mujeres participan en actividades de
apoyo social en organizaciones caritativas, de servicio de salud y educacionales.

En el departamento se registra además un alto número de denuncias por maltrato


físico a mujeres, llegando a las 1,615 el año 2005.

Cuadro 13: Puno, denuncias por maltrato a mujeres, por tipo de


agresión, 2005
Total Físico Psicológico Otros
1,615  452 
)XHQWH3ROLFtD1DFLRQDOGHO3HU~'LUHFFLyQGH3ODQHDPLHQWR'HSDUWDPHQWRGH(VWDGtVWLFD

241
Juan Arroyo y Marina Irigoyen

3.9 Los procesos:1980-2007


6L WUDWDPRV GH SHULRGLÀFDU ORV SULQFLSDOHV VXFHVRV \ DFRQWHFLPLHQWRV TXH KDQ
PDUFDGRODKLVWRULDGHODUHJLyQ\GHODSURYLQFLDFRQVLGHUDPRVWUHVHWDSDV

D  La Primera Etapa, de Violencia Política GHVGH LQLFLRV GHO  KDVWD


1992, que se caracteriza por constituir una fase de crisis y violencia política
que registra la insurgencia armada por parte del grupo terrorista Sendero
Luminoso y su expansión a diversos departamentos del país. En Puno actuó
WDPELpQHO057$OOHYDQGRDPERVPRYLPLHQWRVDUPDGRVDXQDVLWXDFLyQGH
crisis extrema a la vida regional y provincial.
E  La Segunda Etapa, caracterizada por el Autoritarismo, entre 1992 y el
 TXH FRPSUHQGH HO  ÀQ D OD VXEYHUVLyQ SHUR GD SLH DO $XWRULWDULVPR
GXUDQWHHO*RELHUQRGHO3UHVLGHQWH$OEHUWR)XMLPRUL'XUDQWHHVDHWDSDVH
da el autogolpe de estado, la disolución del Congreso, la desactivación de los
gobiernos regionales, la convocatoria de un nuevo Congreso Constituyente
Democrático que reforma la Constitución y prolonga el mandato fujimorista,
KDVWDÀQDOL]DUHQVHWLHPEUHGHOFRQODKXLGD\UHQXQFLDGHO)XMLPRULD
la Presidencia de la Republica. En lo económico, empezó la implementación
de un modelo económico neoliberal que no propició mayor equidad; en
lo social, se agudizó la exclusión social, la pobreza y extrema pobreza,
implementándose frente a ello una serie de programas sociales fragmentados,
con el refuerzo del clientelismo y asistencialismo.
En este contexto se dio la persecución, manipulación y cooptación e incluso
desaparición de dirigentes y lideres, la deslegitimización de los movimientos
sindicales, el desprestigio de partidos políticos, y la primacía de la cultura
GHOVHFUHWR\ODGHVFRQÀDQ]D(QIRUPDSDUDOHODDOJXQRVJRELHUQRVORFDOHV
y la sociedad civil, con el apoyo de entidades promotoras del desarrollo,
promovieron espacios de encuentro entre el estado y la sociedad civil,
como los Consejos de Desarrollo Multisectorial, Mesas de Concertación
,QWHULQVWLWXFLRQDO 0&, &RPLWpVGH*HVWLyQFX\RREMHWLYRFHQWUDOFRQVWLWXtD
la promoción del desarrollo local concertado y participativo, teniendo como
PHFDQLVPRV H LQVWUXPHQWRV ORV 3ODQHV (VWUDWpJLFRV GH 'HVDUUROOR \ ORV
Presupuestos Participativos. Particularmente en el ámbito del Estudio los
gobiernos locales con apoyo de CARE PERU, cimentaron estos procesos
D WUDYpV GH ODV GHQRPLQDGDV 0&,V GH 0HOJDU 6DQWD 5RVD 2UXULOOR /ODOOL
\ 8PDFKLUL LQWHJUDGDV SRU DXWRULGDGHV VHFWRULDOHV \ UHSUHVHQWDQWHV GH
organizaciones productivas, sociales, culturales, etc.

242
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

F  La Tercera Etapa, de Transición Democrática se abrió con el


establecimiento del Gobierno de Transición Democrática  \DEDUFy
la primera fase del quinquenio toledista.
En esta fase se promovieron e institucionalizaron procesos concertados
QRUPDGRVSRUOH\VHFUHyOD0HVDGH&RQFHUWDFLyQGH/XFKD&RQWUDOD3REUH]D
convocando actores públicos y privados; se emitió la nueva Ley Orgánica de
0XQLFLSDOLGDGHV /H\ HLQWURGXMRORV&RQVHMRVGH&RRUGLQDFLyQ/RFDO
Provincial y Distrital y los Planes de Desarrollo Municipal Concertados; se
HVWDEOHFLHURQORVGHUHFKRVGHSDUWLFLSDFLyQ\FRQWUROYHFLQDO(QUHODFLyQDOD
participación ciudadana, se promulgó la Ley de Transparencia y Acceso a la
,QIRUPDFLyQ
Al amparo de este marco legal favorable es que en diferentes distritos y
provincias se dinamizaron diferentes espacios de concertación y participación,
con la participación diferenciada de la sociedad civil, particularmente de las
organizaciones de base.

$QDOL]DUHPRV HO SHUÀO GH OD SDUWLFLSDFLyQ VRFLDO HQ 0HOJDU D SDUWLU GH FLQFR
DVSHFWRV ORV HVSDFLRV GH SDUWLFLSDFLyQ HO SHUÀO GH ORV DFWRUHV LQYROXFUDGRV ODV
estrategias de participación, las motivaciones para la participación y no participación,
\ORVEHQHÀFLRVGHODSDUWLFLSDFLyQ

243
Capítulo 4
Las características de la
participación social

4.1 Espacios de participación


Hay espacios de participación generados por los gobiernos locales, por los
sectores del Estado y desde la población organizada.

4.1.1 Los espacios generados por los gobiernos locales

6RQXWLOL]DGRVFRPRVLVWHPDVGHSODQHDPLHQWRGHOGHVDUUROORORFDOLGHQWLÀFDFLyQ
de propuestas, gestión y ejecución de iniciativas, y seguimiento y monitoreo del
FXPSOLPLHQWRGHDFXHUGRV\UHVSRQVDELOLGDGHVFRQVWLWX\pQGRVHDVtHQPHGLRVSDUD
llegar a consensos en torno a su desarrollo local.

Los espacios existentes en la provincia de Melgar son las Mesas de Concertación


,QWHULQVWLWXFLRQDOGH$\DYLUL\2UXULOORHO&RQVHMRGH$XWRJRELHUQRORFDOHQ6DQWD
Rosa, los Consejos de Coordinación Local, los Presupuestos Participativos, Rendición
de cuentas y cabildos abiertos.

La participación se da en dos condiciones, en primer lugar como representantes


GHODVRFLHGDGFLYLOFRQGHUHFKRDYR]\YRWR\HQVHJXQGROXJDUFRPRDFWRUHVTXH
SDUWLFLSDQSDUDLQIRUPDUVHFRQGHUHFKRDRSLQDUSHURQRDGHFLGLU

245
Juan Arroyo y Marina Irigoyen

La percepción de los participantes entrevistados es que sus demandas e iniciativas


aún no son alcanzadas a estos espacios de decisión pública o no son tomadas en
cuenta. Se percibe la falta de información adecuada, oportuna y permanente sobre
la dinámica de funcionamiento de estas instancias de participación. Los logros y
resultados de estos espacios no son compartidos ni por los representantes sociales ni
por la municipalidad con la población, lo que genera frustración y desencanto.

/RVGLULJHQWHVVRFLDOHVUHFRQRFHQSRUXQODGRTXHHVWRVHVSDFLRVOHVKDQSHUPLWLGR
DFHUFDUVHDODVDXWRULGDGHVHLQVWLWXFLRQHVORJUDQGRXQGLiORJRPiVKRUL]RQWDOSHURVH
VLHQWHQGHVHQFDQWDGRVSRUHOLQFXPSOLPLHQWRGHDFXHUGRV/RVGLULJHQWHVPDQLÀHVWDQ
que quienes disponen de los recursos para implementar los acuerdos no los cumplen
y siguen adelante a partir de sus propios planes. Los espacios de concertación son
UHFRQRFLGDVWDPELpQFRPRXQDRSRUWXQLGDGSDUDUHXQLUVHFRQRWURVUHSUHVHQWDQWHV
de la sociedad civil de manera periódica.

Actualmente la normatividad exige la actualización de los Planes de Desarrollo


como requisito fundamental para elaborar los Presupuestos Participativos, pero la
SHUFHSFLyQTXHKD\GHDPERVSURFHVRVHVTXHODPD\RUtDGHYHFHVVHORVLPSOHPHQWD
por mero cumplimiento de la ley, reduciendo la importancia del planeamiento del
desarrollo local a unos cuantos talleres. Ello, no obstante, se considera que el proceso
GHFRQFHUWDFLyQHQORV~OWLPRVDxRVKDFRQWULEXLGRDXQPD\RUQLYHOGHSDUWLFLSDFLyQ
comparado con años anteriores donde no existían las Mesas de Concertación y las
autoridades tomaban sus propias decisiones sin consultar a la ciudadanía. Asimismo
KDQFRQWULEXLGRDIRUWDOHFHUODSDUWLFLSDFLyQGHODPXMHU\DGDUOHFLHUWRSURWDJRQLVPR
\DTXHRSLQDDSRUWD\KDFHUHVSHWDUVXVGHUHFKRV6LPLODUHVODVLWXDFLyQFRQRWURV
espacios de participación como el Consejo de Autogobierno Local, los Consejos de
Coordinación Local y el Presupuesto Participativo.

Respecto a la participación de la población, los entrevistados perciben que es


variable, pues no solo participan los representantes del CCL –según lo normado por
Ley- sino que se cuenta con la participación de la sociedad civil, lo que contribuye a
su reconocimiento.

“Para mí el presupuesto participativo es presentar lo que queremos, como un local


o una obra, eso nomás es, y vigilancia es ver que está haciendo el alcalde, si esta
cumpliendo o no, pero esto lo hacen los comités de vigilancia, pero nunca se cumplen
los acuerdos, todo es igual que antes.”
Pobladora de Ayaviri

246
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

7DPELpQ FRQVLGHUDQ TXH IDOWD PD\RU LQIRUPDFLyQ D OD SREODFLyQ VREUH HO
SUHVXSXHVWR SDUWLFLSDWLYR  VREUH TXp HV OD SULRUL]DFLyQ GH SUR\HFWRV \ HQ TXH
consiste la vigilancia de la ejecución de los mismos. El principal descontento es por
el incumplimiento de acuerdos y el cambio de los proyectos sin previa consulta a
HOORV$GHPiVODPD\RUtDGHDFWRUHVQRFXHQWDFRQFRQRFLPLHQWRVVREUHTXpHVOD
YLJLODQFLDFRQIXQGLpQGRODFRQODDFFLyQGHÀVFDOL]DFLyQGHOGHVHPSHxRGHODOFDOGH
6RQHVFDVRVORVFRPLWpVGHYLJLODQFLDGHO3UHVXSXHVWR3DUWLFLSDWLYRVHDSRUHOOLPLWDGR
conocimiento sobre su rol, funciones, límites y el poco apoyo de las autoridades
PXQLFLSDOHVHQFXDQWRDODFFHVRDODLQIRUPDFLyQSUHVXSXHVWDO\ÀQDQFLHUD

La mayoría de los lideres que participan en estos espacios tienen secundaria o


primaria incompleta, estando por encima del nivel promedio educativo de la Provincia
de Melgar.

4.1.2 Espacios generados por sectores del Estado

(VWRV HVSDFLRV GHQRPLQDGRV DQWHV 0HVDV GH 'LDORJR R &RPLWpV GH *HVWLyQ
VHKDQLGRGHVJDVWDQGRSRUVXGpELOLQYROXFUDPLHQWR\DUWLFXODFLyQDORVSODQHVGH
desarrollo e inserción a los espacios públicos formalizados localmente.

En el caso del sector salud, la mujer tiene mayor participación como promotoras
GH VDOXG OLJDGDV DO 0LQLVWHULR R D DOJXQD 21*  DOJXQRV YDURQHV VHxDODQ KDEHU
participado no por iniciativa propia, sino por invitación del sector. Señalan como
uno de sus mayores logros la formulación del Plan Provincial de Salud, mediante el
&RPLWp3URYLQFLDOGH6DOXGLQWHJUDGRSRULQVWLWXFLRQHVS~EOLFDV\SULYDGDVDVtFRPR
organizaciones de la sociedad civil.

Similar situación se da en el sector agricultura, en que participan productores


SHFXDULRVSURGXFWRUHVGHTXLQXDOHFKHHQWUHRWURV3RUHOORHOSHUÀOGHORVSDUWLFLSDQWHV
es de personas que están desarrollando una actividad económica o productiva
HVSHFtÀFD/DVUHXQLRQHV\DFXHUGRVQRWLHQHQPD\RULQFLGHQFLDORFDO

Además de ellos existen los Núcleos Ejecutores para la ejecución de obras


ÀQDQFLDGDVSRU)21&2'(6GHFDUiFWHUWUDQVLWRULRFRQHOREMHWLYRGHLQYROXFUDU
a la población en la construcción, mantenimiento y sostenibilidad de la obra. Estos
núcleos están conformados en su mayoría por varones, quienes ocupan los cargos de
presidentes, secretario, vocales; las mujeres ocupan el tradicional cargo de tesoreras,
debido a la percepción de que la mujer es responsable en el manejo económico,
ocultando ello una discriminación contra la mujer.
247
Juan Arroyo y Marina Irigoyen

4.1.3 Espacios generados desde la población organizada

Surgen organizaciones de dos tipos: unas de carácter permanente, formalizadas,


FRQVROLGDGDV SRU HO WLHPSR FUHDGDV FRQ REMHWLYRV HVSHFtÀFRV \ RWUDV GH FDUiFWHU
transitorio.

Los tipos de organizaciones de primer nivel son: las organizaciones barriales,


FOXEHV GH PDGUHV YDVR GH OHFKH FRPXQLGDGHV FDPSHVLQDV DVRFLDFLRQHV GH
productores, comisiones de regantes, rondas campesinas, asociaciones de artesanas,
organizaciones de jóvenes, asociaciones de padres de familia de los colegios,
organizaciones de estudiantes, Juntas Administradoras de Servicios de Saneamiento
-$66 RUJDQL]DFLRQHVGHSRUWLYDVRUJDQL]DFLRQHVGHWUDQVSRUWHGHWULFLFOLVWDV\GH
comerciantes.

Los objetivos de las organizaciones son diversos, pero todos buscan lograr
EHQHÀFLRVFRPXQHVVDWLVIDFHUQHFHVLGDGHVLQPHGLDWDVWHQHUUHFRQRFLPLHQWRVRFLDO
ser parte de un espacio mayor e involucrarse en los procesos de desarrollo de la
localidad.

“Estar en la organización nos ha ayudado a perder el miedo, nos hemos capacitado


en muchas cosas, también en nuestros derechos y obligaciones, además ahora ya
YDPRVDODVRÀFLQDVFRQPDVVHJXULGDGTXHUHPRVVHUYROXQWDULDVDVXPLUFDUJRV
presentar listas, y cada vez que nos reunimos nos aconsejamos y encontramos
solución a nuestros problemas, nos apoyamos entre compañeras”
Mujer artesana de la Central Virgen de Alta Gracia

4XLpQHV DFFHGHQ D HVWH WLSR GH RUJDQL]DFLRQHV VRQ YDURQHV \ PXMHUHV SHUR
las mujeres participan más en organizaciones relacionados a la alimentación o de
artesanas. La participación de las mujeres se asocia a una dinámica de apoyo mutuo,
motivadas por querer estar juntas, compartir con sus compañeras, olvidarse de sus
problemas y el desarrollo de su autoestima, según opinan en las entrevistas. En el caso
de las organizaciones productivas, su dinamismo radica en el desarrollo de actividades
que les pueden generar ingresos, mostrando un mayor desarrollo a pesar de tener
pocos años, en comparación con las otras.

En las organizaciones que participan tanto varones y mujeres, se percibe que el


UROSURWDJyQLFRORWLHQHQORVYDURQHV(OSHUÀOGHORVSDUWLFLSDQWHVHVWiHQHOUDQJR

248
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

de edad de 21 a 50 años, para ambos sexos. En el caso de los dirigentes su edad esta
HQWUH ORV  D  DxRV \ HQ VX PD\RUtD HVWDU FDVDGRV SRQLpQGRVH HQ HYLGHQFLD HO
empoderamiento que da la situación conyugal para poder acceder a cargos, teniendo
estudios de secundaria o superior.

Las organizaciones de segundo nivel se presentan como un medio para organizar


el dialogo y mejorar la capacidad de negociación e incidencia con las autoridades e
LQVWLWXFLRQHV SDUD HO ORJUR GH REMHWLYRV HVSHFtÀFRV 7RGDV EXVFDQ OD DVRFLDWLYLGDG
en el grupo; pueden ser entre organizaciones con agendas similares y objetivos
comunes.

En Melgar existen organizaciones de este tipo como la Central de Artesanas


9LUJHQ GH $OWD *UDFLD GH $\DYLUL OD &HQWUDO GH $UWHVDQDV )ORU GH .XQXUDQD GH
6DQWD5RVDOD)HGHUDFLyQ3URYLQFLDOGH$UWHVDQDVHO&RPLWpGH/XFKDSRUHO0HGLR
Ambiente, la Junta de Usuarios del Distrito de Riego Ramis, la Central de Barrios,
la Asociación de Mujeres de del distrito de Orurillo, la Central de Comerciantes, la
Asociación de Clubes de Madres Unidas de Barrios de Ayaviri y el Frente de Defensa
de los intereses del pueblo, entre otras.

6HYDORUDPXFKRODFDSDFLGDGGHFRQGXFFLyQGHORVOtGHUHVSRUODVH[SHFWDWLYDV
y demandas de los dirigidos. Todos reconocen la potencialidad para incidir en las
políticas locales y regionales, incluso en las nacionales, actuando como una fuerza
social que puede cambiar las condiciones de su realidad. Se dan casos, además, en que
las parejas participan en diferentes o similares organizaciones. La mayoría de líderes y
GLULJHQWHVPDQLÀHVWDQQRWHQHUHODSR\RHFRQyPLFRGHVXRUJDQL]DFLyQSDUDUHDOL]DU
las gestiones.

Los ámbitos donde se desarrollan las reuniones es en las capitales de distrito y


provincia y tienen una periodicidad conocida, cada 15 o 30 días en las de primer nivel,
y mensualmente o bimensualmente en las de segundo nivel.

 3HU¿OGHORVDFWRUHVGHODSDUWLFLSDFLyQ
(OSHUÀOGHORVDFWRUHVGHODSDUWLFLSDFLyQLQFOX\HODHGDGORVQLYHOHVHGXFDWLYRV
y situación conyugal de los involucrados.

249
Juan Arroyo y Marina Irigoyen

Edad

Los representantes y líderes de las organizaciones tienen un nivel promedio de


edad 30 a 50 años. Por lo general tienen ya una trayectoria participativa, que iniciaron
a temprana edad, en forma indistinta en varones y mujeres.

Es nula, como se ve, la participación


de los menores a 21 años, y escasa la de la
franja entre 21 y 30 años. La percepción es
TXHKD\XQQLYHOGHH[FOXVLyQKDFLDORVPiV
jóvenes, que tienen más acceso a cargos
en organizaciones de jóvenes, centros
de educación, clubes deportivos, centros
IRONOyULFRVSHURQRWLHQHQDFFHVRDFDUJRV
en organizaciones barriales, comunidades,
federaciones, club de madres, así como
organizaciones de segundo nivel. Se
HYLGHQFLD WDPELpQ HO UHSOLHJXH SDXODWLQR
de las personas por encima de los 51 años.

Nivel de instrucción

La data recogida muestra que generalmente acceden a los cargos de dirigentes


aquellos que tienen grados de instrucción superior, o secundaria y en algunos
casos primaria, teniendo muy poca oportunidad los que no tienen ningún nivel de
instrucción.

/RV HQWUHYLVWDGRV PDQLÀHVWDQ TXH


los niveles de interacción que demandan
los cargos en espacios de decisión pública,
con instituciones públicas o privadas,
requieren niveles de formación, dándose la
regla de que a mayor preparación, mejores
EHQHÀFLRVREWHQLGRV0HMRUDODFDSDFLGDG
de propuesta, opinión y reclamo de sus
demandas.

250
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

En el caso de las autoridades municipales, el grado de instrucción es importante,


siendo elegidas personas de preferencia con grado de instrucción superior y en menor
medida, con secundaria. Las autoridades sin nivel de instrucción son consideradas por
DOJXQRVVHFWRUHVGHODSREODFLyQFRPRQR´DSWRVRFDOLÀFDGRVµSDUDGHVHQYROYHUVH\
aportar al desarrollo de su localidad.

Entorno familiar

La mayoría de autoridades y líderes


de organizaciones tienen la condición de
casados, lo que podría expresar una mayor
FRQÀDQ]DGHODSREODFLyQHQHOORV/RVTXH
PDQLÀHVWDQVHUVROWHURVVRQUHSUHVHQWDQWHV
de organizaciones juveniles y de centros
HGXFDWLYRVWHQLHQGRpVWDVSRFRSRGHUHQ
la toma de decisiones en espacios mayores
de decisión pública.

Esta condición conyugal otorga


cierto empoderamiento tanto al varón
como a la mujer generándole mayor
seguridad, respaldo y respeto social.

“Antes, yo me sentía discriminada por la comunidad por que no tenia familia,


por lo tanto no tenía derecho a tierras, ni ser comunera, yo quería ser comunera,
y eso que era la hija mayor, recién cuando me casé me aceptaron como socia de la
comunidad”
Mujer de la comunidad de Santa Rosa

Por otro lado, la carga familiar no determina la participación, sin embargo la


PD\RUtDGHPXMHUHVPDQLÀHVWDQTXHFXDQGRVXVKLMRVVRQPHQRUHVGHVHLVDxRVORVOOHYDQ
a sus reuniones, lo cual afectaba su nivel de participación. En el caso de los varones,
PDQLÀHVWDQQRWHQHUHVDGLÀFXOWDGSRUTXHVRQODHVSRVDVTXLHQHVVHKDFHQFDUJRGHORV
KLMRVORTXHUHÁHMDODSHUVLVWHQFLDD~QGHLQHTXLGDGHQORVUROHVGHJpQHUR

$VtPLVPRORVSDGUHV\VXHJURVVRQXQDSR\RHQHOFXLGDGRGHORVKLMRV\VXHOHQ
motivarlos para que participen.

251
Juan Arroyo y Marina Irigoyen

4.3 Tipos de participación


6HDQDOL]DQODVPRGDOLGDGHVGHSDUWLFLSDFLyQDSDUWLUGHODFODVLÀFDFLyQTXHKDFHQ
)DELR9HOiVTXH]\(VSHUDQ]D*RQ]iOHV14

4.3.1 La participación-formalidad, que se da para cumplir un requisito


de ley

Este tipo de estrategia es visible en el funcionamiento de los Consejos de Coordinación


Local, que suelen ser instalados como formalidad. En el caso de Melgar, reciben poco
impulso para su consolidación, por la existencia de espacios de decisión como las Mesas de
concertación y los Consejos de Autogobierno Local, de mayor apertura a la participación.

4.3.2 La participación sin alas, cuando las autoridades tratan de


cortar las iniciativas de la población incumpliendo acuerdos

(VWHPRGHORVHGDPXFKRHQUHODFLyQFRQORV&RPLWpVGH9LJLODQFLDHQTXHVH
señalan que primero se promueve su instalación por las autoridades, pero debido a
la poca claridad en los roles y funciones de sus miembros, las autoridades locales los
SHUFLEHQFRPRHVSDFLRVGHÀVFDOL]DFLyQ\FULWLFDVSHUVRQDOHVGHVXDFFLRQDUJHQHUDQGR
WHQVLRQHV\FRQÁLFWRVSRUORTXHQRVHLPSXOVDVXFRQVROLGDFLyQ

4.3.3 La participación integración-cooptación

Este tipo de participación es utilizada para evitar cuestionamientos y


PRYLOL]DFLRQHVHQFRQWUDGHODVDXWRULGDGHV(VWRVRIUHFHQEHQHÀFLRVSHUVRQDOHVTXH
se expresan en un puesto de trabajo o dinero. Es más frecuente en organizaciones
EDUULDOHVFOXEHVGHPDGUHVYDVRGHOHFKH\HQDOJXQDVRUJDQL]DFLRQHVGHVHJXQGR
nivel. Se da principalmente a nivel de los dirigentes.

4.3.4 La participación-concertación que busca la construcción de


consensos en torno al desarrollo local

En Melgar, uno de los espacios que genera esta estrategia de participación son las
0HVDVGH&RQFHUWDFLyQ,QWHULQVWLWXFLRQDO&RQVHMRVGH$XWRJRELHUQR\3UHVXSXHVWR
Participativo.

 )DELR9HOiVTXH]&\(VSHUDQ]D*RQ]iOHV5,ELGHP
14

252
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

4.3.5 La participación-modo de vida

Cuando los actores participan por una cuestión de convicción, un valor


interiorizado desde la infancia, no siendo un límite los costos, aunque ello puede no
ser sostenible.

Este tipo de participación es representado por los dirigentes, y autoridades


PXQLFLSDOHVPD\RUHVGHDxRVORVFXDOHVKDQHPSH]DGRDSDUWLFLSDUFXDQGRWHQtDQ
HQWUHDDxRVPRWLYDGRVSRUVXVSDGUHVTXHORVOOHYDEDQDODVUHXQLRQHV(VPiV
evidente en dirigentes de organizaciones comunales.

4.4 Motivaciones para la participación y no participación


La subjetividad de los actores es esencial para su participación, siendo una
dimensión que se relaciona con las percepciones, motivaciones y la interacción con
otros actores.

(QHVWDSHUVSHFWLYDORVDFWRUHVKDQPDQLIHVWDGRGLYHUVDVPRWLYDFLRQHVTXHQRV
SHUPLWHQHQWHQGHUORVIDFWRUHVTXHLQÁX\HQSDUDTXHHVWRVGHFLGDQSDUWLFLSDURSDUD
QRKDFHUOR

3DUDFDSWDUHOWLSRGHPRWLYDFLRQHVGHORVDFWRUHVXWLOL]DUHPRVODFODVLÀFDFLyQGH
Amartya Sen15, que señala tres tipos de motivaciones: las motivaciones egoístas, las
intermedias o de simpatía y las de compromiso.

4.4.1 Motivaciones egoístas

“Algunas personas participan y hablan en las reuniones por puro interés personal,
para ser candidatos y cuando no logran nada, desaparecen, se retiran y cuando hay
campaña electoral, otra vez aparecen”
Mujer líder de Santa Rosa

(VODSDUWLFLSDFLyQRULHQWDGDSRUHOEHQHÀFLRSHUVRQDODVXPLpQGRVHXQDFRQGXFWD
XWLOLWDULDGHOHVSDFLRGRQGHVHSDUWLFLSD*HQHUDOPHQWHVHH[SUHVDHQHOSURWDJRQLVPR
político de los que solo participan para poder acceder a un cargo político, utilizando a
ODRUJDQL]DFLyQ\PRYLOL]iQGRODVHJ~QVXVLQWHUHVHV&XDQGRQRORJUDQVXVEHQHÀFLRV

15
Ídem. Amartya Sen.

253
Juan Arroyo y Marina Irigoyen

dejan de participar, siendo frecuente en organizaciones barriales, clubes de madres y


YDVRGHOHFKH(QHOFDVRGHORVDVRFLDGRVDVORVHQWUHYLVWDGRVVHxDODQTXHDOJXQRV
sólo participan por ganar algo, manifestando por otro lado la población que uno de
VXVPRWLYRVSDUDQRSDUWLFLSDUHVTXHQRVHVDFDQLQJ~QSURYHFKRSHUVRQDO

4.4.2 Motivaciones intermedias: las simpatías

“Quería obtener un préstamo, pero no me querían dar porque no aceptaban de


manera individual, por eso me he asociado en la comunidad, ahora soy parte de la
organización y tengo opción a crédito”
Productor quesero de Umachiri

En este caso, como se dijo, a los individuos les preocupa el bienestar ajeno en la
PHGLGDHQTXHDIHFWHHOVX\R(OVXMHWRFRRSHUDVLHPSUH\FXDQGRVHHVWpQDIHFWDQGR
VXVLQWHUHVHV\VyORFXDQGRORVGHPiVORKDFHQ(VWDPRWLYDFLyQHVWiSUHVHQWHHQORV
líderes y participantes de grupos que buscan solucionar sus necesidades inmediatas,
como agua, luz, desague, insumos, equipos productivos, de manera conjunta, debido
a que sus posibilidades económicas no les permite acceder en forma personal. Aquí
VHDFW~DEDMRXQDOyJLFDGH\RFRODERUySRUTXHPHYR\DEHQHÀFLDUGLUHFWDPHQWH
SHURORKDJRVyORVLORVRWURVPLHPEURVORKDFHQ(VWRVHGDFRQPD\RUIUHFXHQFLD
en las comunidades campesinas, barrios, comisiones de regantes, clubes de madres y
asociaciones de artesanas.

4.4.3 Motivación de compromiso

(QHVWHFDVRKD\XQDDFWLWXGDOWUXLVWDVHEXVFDFRRSHUDUD\XGDUDODVPHMRUDVGHO
distrito, contribuir al desarrollo local, a que salga adelante su organización y apoyar a
VXVFRPSDxHURVDV$OJXQRVHQWUHYLVWDGRVPDQLÀHVWDQTXHVXJUDWLÀFDFLyQHVVHQWLUVH
ELHQD\XGDQGRDRWURV(VWHWLSRGHPRWLYDFLyQHVWiSUHVHQWHHQOtGHUHV\VRFLD RV TXH
tienen interiorizada la importancia de participar desde su infancia, y en los dirigentes
campesinos y de los clubes de madres.

“Me gusta trabajar con los jóvenes, pero quiero cambiar lo que nos mira mal por
ser triciclistas, nos aíslan, nos ven como los últimos y ninguna institución apuesta
por nosotros, y yo creo que si puedo aportar en mi organización”.
Líder juvenil – Ayaviri

254
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

4.4.4 Motivaciones para la no participación

/RVHQWUHYLVWDGRVPDQLÀHVWDQODVVLJXLHQWHVPRWLYDFLRQHV
‡ 1RVHORJUDEHQHÀFLRVFROHFWLYRVQLSHUVRQDOHV
• Las reuniones no tienen objetivos precisos que permita llegar a resultados
concretos, tornándose en reuniones prolongadas y poco productivas.
‡ 0XFKRVDFWRUHVQRGLVSRQHQGHWLHPSRSDUDSDUWLFLSDUSRUVXVDFWLYLGDGHV
ODERUDOHVVLHQGRODVUHXQLRQHVHQKRUDULRGHWUDEDMR
• Se siente la utilización de espacios para intereses políticos.
‡ /DGHVFRQÀDQ]DHQORVOLGHUHV\UHSUHVHQWDQWHV
• La exclusión de los más jóvenes, porque los cargos vienen siendo ocupados
por líderes tradicionales.
‡ ,QGLIHUHQFLDDQWHORVSUREOHPDVGHODORFDOLGDG

 %HQH¿FLRVGHODSDUWLFLSDFLyQ
3DUDFRQRFHUHVWRVEHQHÀFLRVVHKDQXWLOL]DGRODVFDWHJRUtDVTXHGHÀQH-RVHS5RWD16:
EHQHÀFLRVFROHFWLYRV\ORVEHQHÀFLRVSHUVRQDOHV$VXYH]KHPRVFODVLÀFDGRHQWUHVORV
WLSRVGHEHQHÀFLRVORVPDWHULDOHVEHQHÀFLRVGHVROLGDULGDG\GHVDUUROORGHFDSDFLGDGHV

 %HQH¿FLRVFROHFWLYRV

%HQHÀFLRVPDWHULDOHV, como locales, servicios básicos, infraestructura y equipamiento


productivo, particularmente en las organizaciones que se vinculan a actividades productivas
FREHUWL]RVSDUDDQLPDOHVHTXLSDPLHQWRGHSODQWDVTXHVHUDVLQVXPRVSURGXFWLYRVWHODUHV
HKLODGRSDUDDUWHVDQtDKXHUWRVIDPLOLDUHV VLHQGRpVWRVORVTXHPHMRUHVUHVXOWDGRVKDQ
WHQLGRHQDSRUWDUDORVLQJUHVRVHFRQyPLFRVGHODVIDPLOLDV7DPELpQVRQODVTXHPHMRUVH
visualizan como resultado de una buena gestión y reconocimiento público.

“Cuando miro mi local, me recuerdo que yo lo he logrado hace 20 años y sigue


funcionando, ahora con el comedor, me siento feliz”
Líder club de madres de Ayaviri

 %HQH¿FLRVVHOHFWLYRVRSHUVRQDOHV

%HQHÀFLRVPDWHULDOHVPHGLDQWHHOÀQDQFLDPLHQWRSDUDDFWLYLGDGHVHFRQyPLFDV
ORVLQFHQWLYRVHFRQyPLFRV\PDWHULDOHV GRFXPHQWRVODQDSDMLOODVGHLQVHPLQDFLyQ

16
Josep Rota, ibidem.

255
Juan Arroyo y Marina Irigoyen

VHPLOODVGHSDVWRVFXOWLYDGRVLQVXPRVHWF (VWRVPRWLYDQDFRQWLQXDUSDUWLFLSDQGR
tanto a líderes como a los ciudadanos y ciudadanas, porque sienten que ayuda a
mejorar sus condiciones de vida.

´(OPHMRUEHQHÀFLRTXHKHORJUDGRHVHOHTXLSDPLHQWRSDUDPLSODQWDTXHVHUDVHPLOODV
de pastos para mis proveedores, y eso nos ayuda a mejorar nuestros ingresos”
Dueño planta quesera – Orurillo

%HQHÀFLRVGHVROLGDULGDGHQHOVHQWLGRGHSHUWHQHQFLDHLGHQWLÀFDFLyQFRQVX
organización, asumiendo que su participación contribuye al progreso y fortalecimiento
GHVXRUJDQL]DFLyQ(VPRWLYDGDSRUIDFWRUHVFRPRODFRQÀDQ]D\UHFRQRFLPLHQWR\
es frecuente en dirigentes y líderes de organizaciones productivas y de jóvenes.

“Antes yo no sabía nada de tejido, y me enseñaron, ahora gano mi propio dinero,


pero la primera producción nos hizo llorar porque no llevábamos bien el tejido. Yo
era la más tímida, ahora bromeo. Antes era bien resentida, lloraba por todo, pero
ahora aprendí a expresarme y ser responsable. Siento que he cambiado”
Socia de la central de Artesanas Virgen de Alta Gracia de Ayaviri

%HQHÀFLRV GH GHVDUUROOR GH FDSDFLGDGHV, relacionados a mejoras de sus


FDSDFLGDGHV D QLYHO GH FRQRFLPLHQWRV GHVWUH]DV \ KDELOLGDGHV SHUVRQDOHV TXH OHV
posibilitan ser candidatos políticos. Esto es más frecuente en líderes con más de 15 años
de trayectoria, y especialmente en las mujeres de organizaciones de segundo nivel.

(O DFFHVR D OD LQIRUPDFLyQ HV HO EHQHÀFLR PiV UHFRQRFLGR SULQFLSDOPHQWH
para las mujeres, no sólo informarse ellas sino compartir con su familia, saliendo
GHODUXWLQDGHOKRJDUTXHVXSXHVWDPHQWHODVDOHMDEDGHVXHQWRUQR(VWHPDQHMRGH
LQIRUPDFLyQKDJHQHUDGRHQHOODVFRQÀDQ]DVHJXULGDGHQVXVFDSDFLGDGHVH[SHULHQFLD
en el ejercicio de liderazgo, elevar su autoestima y cambio en sus relaciones familiares.
<SRUVXSXHVWRHQORSURGXFWLYRPHMRUDVHFRQyPLFDV(OEHQHÀFLRHQHOPHMRUDPLHQWR
de capacidades es valorado tanto por varones y mujeres, como formas efectivas de
promover la participación.

“Mi esposo me dice todas las veces estás gastando, pero yo quiero educarme, no quedarme
solo con quinto de secundaria, cuando me informo y capacito, yo siento que no soy igual
a las otras compañeras, mi pensamiento es diferente porque estoy informada.”
Mujer líder de Santa Rosa

256
Capítulo 5
Los costos de la participación

En este capítulo se aborda los costos de participación agrupándolos en tres


tipos: factores económicos, factores familiares y factores referidos al tiempo.

5.1 Costos económicos


Mientras más costos económicos implica participar, serán menores las
probabilidades de acceso y continuidad. Los entrevistados reconocen que sin
dinero no se llega lejos, porque la participación no es sólo cuestión de convicción,
FRPSURPLVR\UHVSRQVDELOLGDGHVVLQRWDPELpQH[LJHGLVSRQHUGHUHFXUVRVH[SUHVDQ
Pero, peso a ello, los sectores más pobres participan.

En el caso de los ciudadanos y ciudadanas con mejores condiciones económicas,


HOORV KDQ WRPDGR OD GHFLVLyQ GH LQYROXFUDUVH HQ HVWDV LQVWDQFLDV \ OXFKDU SRU VXV
intereses. Sin embargo no es la única vía que emplean para acceder a los círculos de
decisión: en particular los grupos empresariales, o productores medianos emplean la
vía directa para relacionarse con las autoridades locales, especialmente los alcaldes y
los representantes de las instituciones públicas y privadas.

Los costos económicos que implica el participar se diferencian en personales,


familiares, organizacionales e institucionales.

257
Juan Arroyo y Marina Irigoyen

5.1.1 Costos familiares

La mayoría de actores señala que participar les ocasiona un gasto personal,


principalmente en los rubros de alimentación, transporte y gastos en logística
IRWRFRSLDVWUDPLWHGHGRFXPHQWRVWHOpIRQR DSHVDUTXHHQDOJXQDRSRUWXQLGDGORV
UHVSRQVDEOHVGHFRQYRFDUODVOHVRIUHFHQXQUHIULJHULRHOORQRHVVXÀFLHQWH(VWHWLSRGH
gasto es sustentado con sus ingresos propios, provenientes del esfuerzo de su trabajo.

“El ser dirigente ocasiona mucho gasto, en algunos casos he vendido ganado para
mis gastos, en mi casa he dejado de hacer muchas cosas, creo que ser dirigente es ir
al camino de la pobreza, los socios no tienen plata para las cuotas”
Dirigente Campesino de Orurillo

7DPELpQ KD\ FRVWRV GH WUDQVSRUWH FXDQGR VH YLDMD D ODV FDSLWDOHV GH GLVWULWR
provincia y en algunas veces del departamento.

/RVJDVWRVORJtVWLFRVUHIHULGRVHVSHFtÀFDPHQWHDOODPDGDVWHOHIyQLFDV\WUiPLWHV
documentarios, son asumidos exclusivamente por los líderes. Estos costos económicos
QRVRORUHGXFHQVXVLQJUHVRVIDPLOLDUHVVLQRWDPELpQJHQHUDQWHQVLRQHVHQODIDPLOLD
DOKDFHUXVRGHLQJUHVRVIDPLOLDUHV

En el caso de las mujeres que generan sus propios ingresos las tensiones familiares
son mínimas, debido a su independencia económica y social. Pero en las mujeres que
dependen económicamente de sus parejas y que asumen sus costos con los ingresos
GHODIDPLOLDORVFRQÁLFWRVVRQIUHFXHQWHV

Además los costos para el dirigente, especialmente para los de organizaciones


de segundo nivel, se acrecienta, debido a su dinámica de participación. Mientras los
FLXGDGDQRV\FLXGDGDQDVSDUWLFLSDQJHQHUDOPHQWHHQUHXQLRQHVHVSHFtÀFDV\GHQWUR
de su ámbito, los dirigentes participan en diversos espacios, además de las actividades
de coordinación, presentación de demandas, seguimiento de sus gestiones a nivel de
instituciones, siendo las reuniones más prolongadas las que demandan mayores costos
GHDOLPHQWDFLyQSDVDMHV\KRVSHGDMH

3RUHOORPXFKRVGLULJHQWHVSUHÀHUHQTXHODVUHXQLRQHVVHDQHQGtDVGHIHULDV
SRUTXHVHDEDVWHFHQGHDOLPHQWRVUHDOL]DQVXVWUDQVDFFLRQHVFRPHUFLDOHV\DSURYHFKDQ
para quedarse en la reunión, repercutiendo ello en la calidad de las reuniones y de su
participación.

258
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

5.1.2 Costos organizacionales

Los actores indican que son pocas las organizaciones que sustentan los costos
GHVXVUHSUHVHQWDQWHV'HFDGDGLH]VyORWUHVOtGHUHVPDQLÀHVWDQTXHUHFLEHQXQDSR\R
HFRQyPLFRFRQHOFXDOFRVWHDQORVJDVWRVGHDOLPHQWDFLyQKRVSHGDMH\ORJtVWLFD(O
apoyo que casi todos los lideres reciben de su organización es su respaldo moral, pero
como señalan los ánimos no pagan los pasajes, ni la alimentación, y tampoco generan
ingresos para sus familias. En el caso de los que señalan que su organización aporta,
este tipo de aporte es mediante las cuotas mínimas y no cubren los costos, y es difícil
exigir, por las condiciones económicas de las organizaciones. Dos casos particulares se
presentan en las organizaciones comunales y de artesanas: en la primera la comunidad
cuenta con fondos propios provenientes de la venta de ganado y productos agrícolas,
con lo que se cubre los gastos de representación, y en el caso de la central de artesanas,
para sostener los costos se descuenta de cada prenda tejida por las socias un pequeño
SRUFHQWDMHTXHYDDXQDFDMDFKLFD

“Mi esposo me dice cuanto gastas, tienen que reponerte, pero yo se que las socias
QRUHSRQHQDYHFHVVyORORVSDVDMHVSHURWRGDYtDKD\TXHSHGLUFXRWD\MXVWLÀFDU
los gastos en Asamblea”.
Dirigenta Club de Madres de Ayaviri

5.1.3 Costos institucionales

6HJ~QODVSHUFHSFLRQHVGHORVDFWRUHVODV21*\0XQLFLSDOLGDGHVVRQODVTXH
más asumen costos para promover la participación, pero dentro de sus objetivos
\ SUHVXSXHVWRV 3RU OR JHQHUDO VH WUDWD GH JDVWRV GH DOLPHQWDFLyQ JHQHUDOPHQWH
UHIULJHULRV KRVSHGDMHV VLODDJHQGDORGHPDQGD \SDVDMHVHVWR~OWLPRQRHVPX\
frecuente. En los tres últimos años los pasajes son considerados como una condición
de contrapartida o condición para la participación de la organización en el evento.

6H UHFRQRFH TXH ODV 21*V KDQ IDFLOLWDGR FRQGLFLRQHV SDUD TXH ORV DJHQWHV
VRFLDOHVVHGHVDUUROOHQ\KDQWHQLGRXQUROGHIDFLOLWDGRUHVGHSURFHVRVSDUWLFLSDWLYRV
$VtPLVPRKDQ DSRUWDGRHQODSURGXFFLyQ GHPDWHULDOHVFRPR PDQXDOHVFDUWLOODV
JXtDV\XQDDPSOLDGRFXPHQWDFLyQDOVHUYLFLRGHODSDUWLFLSDFLyQ7DPELpQVHGHVWDFD
la participación en la mejora de los canales de coordinación entre representantes y
representados, en el recojo de demandas, iniciativas y propuestas, en la dotación de
facilitadores, capacitadores y pasantías.

259
Juan Arroyo y Marina Irigoyen

Por su parte las Municipalidades asumen costos de alimentación y en algunas


ocasiones el transporte de los líderes que provienen de los lugares más alejados. Se
reconoce que actualmente los presupuestos participativos proveen fondos para mejorar
el nivel de participación de los ciudadanos y ciudadanas, y este presupuesto forma
parte de los presupuestos institucionales en los rubros de desarrollo de capacidades y
fortalecimiento institucional.

5.2 Costos familiares


/RV FRVWRV IDPLOLDUHV UHÀHUHQ D OD UHGLVWULEXFLyQ GH ODV UHVSRQVDELOLGDGHV D
otros miembros de la familia por la participación en eventos o la asunción de cargos
GLULJHQFLDOHV(QDOJXQRVFDVRVVHOOHJDDGHVFXLGDUHOKRJDU

(QHOFDVRGHORVYDURQHVORVHQWUHYLVWDGRVLQIRUPDQTXHODVSDUHMDVVHKDFHQ
FDUJRGHORVKLMRVORTXHFRLQFLGHFRQVXUHVSRQVDELOLGDGWUDGLFLRQDO3HURHQHOFDVR
de las mujeres que son dirigentas o participantes en eventos, tienen tres opciones: o
GHMDUVRORVDORVKLMRVRGHMDUORVFRQRWURVIDPLOLDUHVROOHYiUVHORVDODUHXQLyQ(VWR
último no favorece una buena participación, no se concentran en la reunión, además
de incomodar a otras socias con sus requerimientos.

“Nuestras compañeras vienen con sus hijos algunos son bebés pequeños y otros son
grandecitos y salen a jugar, eso nos distrae en la reunión, pero no tienen con quien
dejarlo en la casa.”
Testimonio del Grupo Focal con Artesanas de Ayaviri

(QHOFDVRGHODVDXWRULGDGHVPXQLFLSDOHVpVWDVVHxDODQTXHGHELGRDVXVIXQFLRQHV
HVWiQIUHFXHQWHPHQWHIXHUDGHVXVKRJDUHV/DVLWXDFLyQHVSHRUFRQORVUHJLGRUHVGH
la capital de provincia provenientes de zonas rurales, que prácticamente abandonan su
KRJDU\VXVUHVSRQVDELOLGDGHVIDPLOLDUHV

(VWRVFRVWRVIDPLOLDUHVRFDVLRQDQFRQÁLFWRVHQHOKRJDUVLHQGRSRUORJHQHUDO
la opinión de sus parejas contraria a la participación, argumentando que dejen de
participar, que renuncien, que otros participen, que no se considera a la familia, que
QRVDFDQQLQJ~QEHQHÀFLR\TXHHOGLQHURGHVWLQDGRDORVJDVWRVGHOKRJDUWHUPLQD
ÀQDQFLDQGRVXVFDUJRV

260
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

5.3 Costos en tiempo


(OWLHPSRTXHVHFRQVXPHHQODVODERUHVGHSDUWLFLSDFLyQDVXPHWUHVIRUPDVD HO
WLHPSRVHJ~QHOQ~PHURGHUHXQLRQHV HYLGHQWHPHQWHORVOtGHUHVGHGLFDQPiVWLHPSR 
E HOWLHPSRVHJ~QODGXUDFLyQGHODVUHXQLRQHV ODVUHXQLRQHVGHPDQGDQGHDKRUDV
PiVWUDVODGRV \F HOWLHPSRSRUORVFRPSURPLVRVDVXPLGRVHQODUHXQLyQ

Este “tiempo de ciudadanía” representa económicamente un costo de


RSRUWXQLGDGXQ WLHPSRHQTXHOD SHUVRQD SRGUtD HVWDU KDFLHQGR RWUDV DFWLYLGDGHV
Toda sociedad tiene una franja de tiempo dedicada a esta función dirigencial o
GH SDUWLFLSDFLyQ \ FRRUGLQDFLyQ SHUR VX XVR HÀFLHQWH \ VX QR FRQYHUVLyQ HQ XQD
sobrecarga sobre los involucrados es un arte.

En relación al número de reuniones, tiene que ver con los espacios donde se
participa y el ámbito donde se realizan. Los actores locales participan en 1 a 7 espacios
HQWUH$3$)$6FOXEHVGHPDGUHV9DVRGHOHFKHFRPXQLGDGDVRFLDFLyQGHDUWHVDQDV
reuniones de Reprosalud, asambleas barriales, organizaciones de jóvenes, gremios de
FRPHUFLDQWHVHWF/DVHQWUHYLVWDVSHUPLWLHURQLGHQWLÀFDUTXHORVHVSDFLRVHQORVTXH
participan no son más de tres, y que el promedio de reuniones mensuales es de tres a
cuatro, y se realizan en el ámbito local. Pero en el caso de los líderes, ellos participan
en más de tres espacios pues están involucrados en organizaciones de primer nivel,
de segundo nivel e instituciones, cuyas reuniones se desarrollan en el ámbito local, el
distrito, provincia y departamento.

“Muchos no participan por que se pierde plata, tiempo y trabajo, por que se
organizan demasiadas capacitaciones y reuniones, y a la mayoría ya vamos solo
por cumplir y no por aprender; por ejemplo, un campesino pierde un día de trabajo
y acaso se lleva algo de dinero a su casa por participar.”
Ex Autoridad Municipal de Santa Rosa

/RV OtGHUHV PDQLÀHVWDQ TXH SDUWLFLSDQ DO PHV HQ SURPHGLR HQ VLHWH HVSDFLRV
sin considerar las gestiones y actividades programadas como parte de sus funciones.
5HÀHUHQTXHVHDXVHQWDQGHVXKRJDUFRPRPtQLPRGRVYHFHVSRUVHPDQD$GHPiV
HQHO~OWLPRDxRKDQSDUWLFLSDQGRHQXQDFDQWLGDGGHUHXQLRQHVTXHYDUtDHQWUHD
100 reuniones, considerando sólo las reuniones formales.

(VWLPDGR HQ WpUPLQRV GH WLHPSR OD SDUWLFLSDFLyQ HQ GLYHUVDV UHXQLRQHV \ OD
DXVHQFLD GRV YHFHV SRU VHPDQD GH VXV KRJDUHV VLJQLÀFD XQD SpUGLGD PHQVXDO HQ

261
Juan Arroyo y Marina Irigoyen

SURPHGLRGHGtDVGHVXWLHPSRHOFXDOSXGRKDEHUVLGRXWLOL]DGRHQRWUDVDFWLYLGDGHV
ORTXHOHVLJQLÀFDGHMDUGHWUDEDMDUSDUDHOVXVWHQWRGHVXKRJDU(OORVPDQLÀHVWDQTXH
ese tiempo ya es perdido, nadie se los reconoce, ni se les retribuye.

6REUHODGXUDFLyQGHODVUHXQLRQHVpVWDVGXUDQHQWUH\KRUDV\DYHFHVVH
DODUJDQSRUIDFWRUHVFRPRODLPSXQWXDOLGDGHOQRUHVSHWRDORVKRUDULRVHVWDEOHFLGRV
HOFHQWUDUVHHQFRQÁLFWRVSHUVRQDOHVDQWHVTXHHQODDJHQGDRHOKDEODUPXFKRGHO
tema sin llegar a ningún acuerdo. En el caso de las capacitaciones, especialmente
en las de desarrollo de capacidades productivas, la mayoría de reuniones pasan las
KRUDVGLDULDVLQFOXLGRHOWUDVODGR/RVFLXGDGDQRV\FLXGDGDQDVH[SUHVDQTXHHVWH
factor tiempo es el principal motivo por el cual algunos no participan debido a que
ODVUHXQLRQHVVHUHDOL]DQHQGtDVODERUDEOHV\HQKRUDULRVGHWUDEDMRSRUODPDxDQDOR
que contradice su rutina diaria.

Para poder participar en reuniones los actores involucrados tienen que buscar
VHUUHHPSOD]DGRVHQVXVODERUHVRSHGLUSHUPLVRHQVXVWUDEDMRVORTXHDOÀQDOVH
convierte en una sobrecarga de trabajo. En el caso de las mujeres, les demanda mayor
tiempo para realizar sus labores, levantándose más temprano para dejar todo listo,
afectando su nivel de atención por el desgaste físico propio de las madrugadas. Esto se
aprecia en las reuniones, en que algunos se quedan dormidos y participan a medias.

 2WURVIDFWRUHVTXHLQÀX\HQHQHODXPHQWRGHORVFRVWRV
/RVDFWRUHVLGHQWLÀFDQWDPELpQRWURVIDFWRUHVTXHLQÁX\HQHQHODXPHQWRGHORV
costos de la participación: la calidad de la participación, la coordinación y consistencia
en las tareas y la diversidad y cantidad de espacios.

5.4.1 La calidad de la participación

Se señalan diferentes aspectos atentatorios contra la calidad de la participación:


D ODPD\RUtDGHUHXQLRQHVQRVRQSURGXFWLYDVE ODLPSXQWXDOLGDGGHORVDVLVWHQWHV
TXHRFDVLRQDHOUHWUDVRGHLQLFLR\DXPHQWDODVKRUDVGHUHXQLyQF HOQRFXPSOLPLHQWR
GHODDJHQGDDFRUGDGDLPSURYLViQGRVHORVWHPDVG HOHVWDEOHFLPLHQWRGHDJHQGDV
SRFRLPSRUWDQWHV\EHQHÀFLRVDVH ODSDUWLFLSDFLyQQRSURSRVLWLYDHQTXHSULPDOD
RSRVLFLyQDWRGRSHURQRVHGDQSURSXHVWDVI ODQRDVXQFLyQGHUHVSRQVDELOLGDGHV
\ OD WHQGHQFLD D OD H[LJLELOLGDG GH GHUHFKRV PiV QR D XQD DFHSWDFLyQ GH GHEHUHV
J ODSUHVHQFLDGHFRQÁLFWRVSHUVRQDOHVL HOSURWDJRQLVPRGHDOJXQRVTXHEXVFDQ
SURWDJRQLVPRDFRVWDGHODVUHXQLRQHV\M HOLQFXPSOLPLHQWRGHDFXHUGRV

262
%HQH¿FLRV\&RVWRVGHOD'HPRFUDFLD3DUWLFLSDWLYD

“Cuando estamos en reunión algunos socios se quejan y no dicen cuál es el problema,


otros no opinan, solo critican, otros salen y entran de la reunión y todavía llegan
tarde, eso baja la moral, además no cumplen lo que acordamos.”
Dirigente Juvenil de Orurillo

5.4.2 La coordinación y consistencia en las tareas

/RVHQWUHYLVWDGRVRSLQDQTXHQRKD\DUWLFXODFLyQHQWUHORVSODQHV\SUR\HFWRV
tampoco es notoria la continuidad de los procesos y ante los cambios se empieza de
FHUR6HGDXQDGpELODUWLFXODFLyQGHODVLQVWLWXFLRQHVTXHRSHUDQHQHOiPELWR

5.4.3. La diversidad y cantidad de espacios

Mientras más espacios existan mayores serán los recursos que se requieran y
se necesitará invertir un mayor tiempo para mantener el “sistema de participación”.
De otro lado la fragmentación en espacios de participación superespecializados
PLFURHVSHFLDOL]DDODSDUWLFLSDFLyQODVHVJDKDFLDLQWHUHVHVSDUWLFXODUHVSULYLOHJLDOR
PLFUR\SURSHQGHDODVDWLVIDFFLyQGHXQDQHFHVLGDGHVSHFtÀFDRHQODVROXFLyQGHXQ
SUREOHPDPX\ORFDOL]DGRSHUGLpQGRVHSUREOHPDVPiVGHODUJRSOD]R

“Hay muchas reuniones y cada una es diferente, la reunión de la comunidad


y del barrio no es igual al de la Mesa de Concertación, en la mesa se participa
con proyectos y en la Comunidad solo se tratan problemas menores. Pero son
demasiadas reuniones, a veces voy sólo por cumplir”.
Dirigente Barrial de Ayaviri

263
5HIHUHQFLDVELEOLRJUi¿FDV

$UUR\R-XDQ\0DULQD,ULJR\HQ
2005 Desafíos de la Democracia Participativa Local en la Descentralización. Una lectura a partir de doce
H[SHULHQFLDV(GLFLyQ/LPD&DUH3HU~²'),'PDU]R

%XFKDQDQ-DPHV 7XOORFN*
1962 The Calculus of Consent: Logical Foundations of Constitutional Democracy. Ann Arbor, University
RI 0LFKLJDQ3UHVV

%XFKDQDQ-DPHV
 From Private preferences to Public Philosophy: The Development of Public Choice7KH(FRQRPLFV
RI 3ROLWLFV/RQGRQ,QVWLWXWHRI (FRQRPLFV$IIDLUV

Coase, Ronald.
 The Firm, the Market and the Law&KLFDJR7KH8QLYHUVLW\RI &KLFDJR3UHVV

Cooper, Terry.
1979 The Hidden Price Tag: Participation Costs and Health Planning $P - 3XEOLF +HDOWK $SULO
  ²

'DKO5REHUW
 La poliarquía. Participación y oposición. Madrid: Editorial Tecnos S.A., .

'RZQV$QWKRQ\
1967 Inside Burocreaucy%RVWRQ/LWWOH%URZQ

1RUWK'RXJODVV
1993 Instituciones, cambio institucional y desempeño económico 0p[LFR )RQGR GH &XOWXUD
Económica.

1XQ-RVp
2002. Democracia. ¿Gobierno del pueblo o gobierno de los políticos? 2da. Edición 0p[LFR )RQGR GH
Cultura Económica.

Oliver, Pamela.
 If You Don´t Do it, Nobody Else Will: Active and Token Contributors to Local Collective Action.
$PHULFDQ6RFLRORJLFDO5HYLHZ9RO1R2FWSS

Olson, Mancur.
1992 La Lógica de la Acción Colectiva. Bienes Públicos y la Teoría de Grupos 0p[LFR (GLWRULDO
Limusa.

Putnam, Robert.
1993 Making Democracy Work&LYLF7UDGLWLRQVLQ0RGHUQ,WDO\8QLWHG.LQJGRP3ULQFHWRQ
University Press.

264
Putnam, Robert.
2000 Bowling Alone7KHFROODSVHDQGUHYLYDORI $PHULFDQ&RPPXQLW\1HZ<RUN6LPRQ 
6FKXVWHU

Rota, Josep.
Comunicación, gobierno y ciudadanía5HYLVWDGHO&/$'5HIRUPD\'HPRFUDFLD1ž

Sen, Amartya.
 Los tontos racionales. En Hanh, F., y Hollis, M. (compiladores). Filosofía y teoría económica0p[LFR
FCE, pp. 172 - 217.

6KXPSHWHU-RVHSK
&DSLWDOLVPRVRFLDOLVPR\GHPRFUDFLD0p[LFR$JXLODU
1965 Tullock, Gordon. The Politics of Bureaucracy:DVKLQJWRQ'&3XEOLF$IIDLUV3UHVV

7XOORFN*RUGRQ
A (Partial) Rehabilitation of the Pubic Interest Theory3XEOLF&KRLFH

9HOiVTXH])DELR\(VSHUDQ]D*RQ]iOHV
2003 ¿Qué ha pasado con la participación ciudadana en Colombia. 1ª. Edición, Bogotá: Fundación
Corona, Junio, pp. 149–151.

Williamson, Oliver.
 The Economic Institutions of Capitalism: Firms, Markets, Relational Contracting1HZ<RUN)UHH
Press.

265
Lista de entrevistados

Ayaviri  ,UHQH+XDPiQ&KRTXHKXD\WD
 /LOLDQ$QJHOLFD5HFKDUWH+XDPDQ 7 Simona Francisca Tuni Mamani
 -XOLD*XWLHUUH]0D\WD  )HOLSD&FXQR$WDMR
 (XVHELD9LOFD4XHQWD  0DUJDULWD<DQD&DQFDSD
4 Jesús Baca Ramos 10 Juan Julio Delgado Apaza
 ,VDEHO&DOGHUyQGH4XLVSH 11 Luis Cruz Martinez
 0LJXHOLQD0DFKDFD$ 12 Pedro Hancco Peralta
 -RVp/XLV$JXLODU9DOHULDQR  (UQHVWR<DQD&KRTXHKXD\WD
 )ODYLR&FDSD\TXH,QIDQ]yQ  0DUWD&RQGRUL3DULFDKXD
 5XEpQ+LODULR/RD\]D,GPH  &ULVWLQD+XDKXDVRQFFR0DPDQL
 *HUDOG%DFD3RQFH  *UHJRULD/ODQSL$QDKXD
11 Maria Mamani Diaz 17 Victoria Puma Aguilar
12 Clotilde Veronica  (GJDU+XDQFD&RQGRUL
13 Pilar Argote Segovia  &ORWLOGHÁRUD&KGH0DPDQL
 $PDQGD%DXWLVWD*XWLHUUH] 20 Epifania Fernández Tito
 ,UPD/XTXH4XLVSH  *RGRIUHGR/ODFVD3DORPLQR
16 Pascual Mullisaca Huallpa  /HRQFLR&KRTXHKXD\WD3HUDOWD
17 Cesar Condori Carbajal
 5RVDULR5HMDV%HUPHMR Santa Rosa
19 Julio Carcausto  1RUPD.DQVD\D&KRTXHPDPDQL
20 Dionicio Llampi Tovar  *ODG\V(VSHULOOD&D\OODKXD
21 Olga Tuni Copa  :LOO\*XLGR(VSHWLD&KXFWD\D
 5XEpQ/DXUD-RYH  :LOO\&KDYH]&RQGRUL
23 Alejandro Ccancapa M.  $OIUHG<DUDWH*RQJRUD
24 Cecilia Soto Manrique  /XFLR(ODGLR4XLVSH&KLSDQD
 <RYDQD$UHQD0D\WD 7 Julia Medina Mamani
26 Valentina Solis Apaza  0DUFHOLQD(VSHULOOD$OYDUH]
 5RVD/XTXH4XLVSH 9 Maribel Pinto Pocoanca
 <ROD0DXUD0DPDQLGH+XLVD 10 Pascual Valdez Medina
 )LOLEHUWR7DFFD1DYDUUR
Orurillo 12 Florencia Condori Pinto
 *XLOOHUPR$QFFR$QFFR  0RGHVWR&XWLSD<XQJD
2 Celso Celestino Mamani Mamani
3 Corina Hilda Huallpatupa Mamani Umachiri
 6HUJLR$JXLODU&KRTXHKXD\WD  -XOLR$UTXH&KXUD
5 Delia Cruz Vilca 2 Marcial Vasquez Condori

266