Está en la página 1de 176

Literatura I

con enfoque en competencias


Literatura I
Dirección y realización del proyecto
LCC. Gabriel Barragán Cásares
Literatura I
Director General del Colegio de Bachilleres del Estado
de Yucatán

Planeación y coordinación
Lic. Alejandro Salazar Ortega
Director Académico

Metodología y estrategia didáctica


Lic. Lorenzo Escalante Pérez
Jefe del Departamento de Servicios Académicos

Coordinación de la asignatura
Mtra. María Mercedes Rosado Sabido

Colaboradores
LEM. Maricela Campos Canul
LEM. Mariana Olivia Che Molina
LCE. María de Cruz Pech Puc
LE. Juana González Calán

Revisión de la 2a edición
Mta. María Mercedes Rosado Sabido
Lic. Joel Caballero May

2ª Edición
Julio 2011 DERECHOS RESERVADOS
Queda prohibida la reproducción o
Impreso en México transmisión total o parcial del texto de
la presente obra, bajo cualquier forma
electrónica o mecánica, incluyendo fo-
tocopiado, almacenamiento en cualquier
sistema de recuperación de información
o grabado sin el consentimiento previo y
por escrito del editor.
La reforma integral de la Educación Media Superior
La Educación Media Superior (EMS) en México enfrenta desafíos que podrán ser
DWHQGLGRVVyORVLHVWHQLYHOHGXFDWLYRVHGHVDUUROODFRQXQDLGHQWLGDGGHÀQLGDTXH
permita a sus distintos actores avanzar ordenadamente hacia los objetivos pro-
puestos. Es importante saber que la EMS en el país está compuesta por una serie
de subsistemas que operan de manera independiente, sin correspondencia a un
SDQRUDPDJHQHUDODUWLFXODGR\VLQTXHH[LVWDVXÀFLHQWHFRPXQLFDFLyQHQWUHHOORV
El reto es encontrar los objetivos comunes de esos subsistemas para potenciar sus
alcances y de esta manera lograr entre todos reglas claras de operación. Es impor-
tante para el desarrollo de la EMS, que ustedes docentes y estudiantes conozcan
los ejes que la regulan, como opera y los retos que enfrenta en la actualidad
para asumir a partir de dicho conocimiento una actitud diferente que nos permita
coadyuvar en este esfuerzo.
Los diferentes subsistemas de la EMS han realizado cambios en sus estruc-
WXUDVORVFXDOHVSUHWHQGLHURQGDUODSHUWLQHQFLDHÀFDFLD\FDOLGDGQHFHVDULDVSDUD
que la población a la que atiende (jóvenes entre los 15 y 21 años aproximada-
mente) adquiriera conocimientos y habilidades que les permitan desarrollarse de
manera satisfactoria, ya sea en sus estudios superiores o en el trabajo y, de ma-
nera más general, en la vida. En esta misma línea, no se debe perder de vista
el contexto social de la EMS: de ella egresan individuos en edad de ejercer sus
derechos y obligaciones como ciudadanos, y como tales deben reunir, en adición a
ORVFRQRFLPLHQWRV\KDELOLGDGHVTXHGHÀQLUiQVXGHVDUUROORSHUVRQDOXQDVHULHGH
actitudes y valores que tengan un impacto positivo en su comunidad y en el país
en su conjunto.
Es en este contexto que las autoridades educativas del país, han pro-
puesto la Reforma Integral de la Educación Media Superior (RIEMS), cuyos objetivos
consisten en dar identidad, calidad, equidad y pertinencia a la EMS, a través de
mecanismos que permitan articular los diferentes actores de la misma en un Sis-
tema Nacional de Bachillerato dentro del cual se pueda garantizar además de lo
anterior, tránsito de estudiantes, intercambio de experiencias de aprendizaje y la
FHUWLÀFDFLyQGHORVPLVPRV
Lo anterior será posible a partir del denominado Marco Curricular Común
(MCC) de la RIEMS, el cual se desarrolla considerando el modelo de competen-
cias, y que incluye: Competencias Genéricas, Competencias Disciplinares (básicas
y extendidas) y Competencias Profesionales (básicas y extendidas). Esta estructura
permite observar de manera clara, los componentes comunes entre los diversos
subsistemas, así como aquellos que son propios de cada uno y que por consiguiente,
los hace distintos. Lo anterior muestra como la RIEMS respeta la diversidad del nivel
educativo del país, pero hace posible el Sistema Nacional del Bachillerato, confor-
mado por las distintas instituciones y subsistemas que operan en nuestro país.

Bachillerato Universitario Bachillerato General Bachilleratos Tecnológicos


Competencias Genéricas
Competencias Disciplinares Básicas

Competencias Disciplinares extendidas

Competencias Profesionales Básicas

Competencias Profesionales Extendidas Competencias Profesionales Extendidas

III
Una competencia es la integración de habilidades, conocimientos y acti-
WXGHVHQXQFRQWH[WRHVSHFtÀFR(VWDHVWUXFWXUDUHRUGHQD\HQULTXHFHORVSODQHV
y programas de estudio existentes y se adapta a sus objetivos; no busca reempla-
]DUORVVLQRFRPSOHPHQWDUORV\HVSHFLÀFDUORV'HÀQHHVWiQGDUHVFRPSDUWLGRVTXH
KDFHQPiVÁH[LEOH\SHUWLQHQWHHOFXUUtFXORGHOD(06
Nuestro subsistema pertenece al conjunto de los que ofrecen bachille-
UDWR JHQHUDO HO FXDO HQ OD GHÀQLFLyQ GHO 0&& GH OD UHIRUPD LQWHJUDO GHEHUi
desarrollar en los estudiantes capacidades que les permitan adquirir competencias
genéricas, competencias disciplinares básicas y extendidas, además de competen-
cias profesionales básicas.
Las competencias genéricas son las que todos los bachilleres deben estar
HQFDSDFLGDGGHGHVHPSHxDUODVTXHOHVSHUPLWHQFRPSUHQGHUHOPXQGRHLQÁXLU
en él; les capacitan para continuar aprendiendo de forma autónoma a lo largo
de sus vidas, y para desarrollar relaciones armónicas con quienes les rodean, así
FRPR SDUWLFLSDU HÀFD]PHQWH HQ ORV iPELWRV VRFLDO SURIHVLRQDO \ SROtWLFR 'DGD
VX LPSRUWDQFLD GLFKDV FRPSHWHQFLDV VH LGHQWLÀFDQ WDPELpQ FRPR FRPSHWHQFLDV
FODYH\FRQVWLWX\HQHOSHUÀOGHOHJUHVDGRGHO6LVWHPD1DFLRQDOGH%DFKLOOHUDWR$
continuación se listan las once competencias genéricas, agrupadas en sus catego-
rías correspondientes:

Se autodetermina y cuida de sí
1) Se conoce y valora a sí mismo y aborda problemas y retos teniendo en
cuenta los objetivos que persigue.
2) Es sensible al arte y participa en la apreciación e interpretación de sus
expresiones en distintos géneros.
3) Elige y practica estilos de vida saludables.

Se expresa y comunica
4) Escucha, interpreta y emite mensajes pertinentes en distintos contextos
mediante la utilización de medios, códigos y herramientas apropiados.

3LHQVDFUtWLFD\UHÁH[LYDPHQWH
5) Desarrolla innovaciones y propone soluciones a problemas a partir de
métodos establecidos.
6) Sustenta una postura personal sobre temas de interés y relevancia ge-
QHUDOFRQVLGHUDQGRRWURVSXQWRVGHYLVWDGHPDQHUDFUtWLFD\UHÁH[LYD

Aprende de forma autónoma


7) $SUHQGHSRULQLFLDWLYDHLQWHUpVSURSLRDORODUJRGHODYLGD

7UDEDMDHQIRUPDFRODERUDWLYD
8) Participa y colabora de manera efectiva en equipos diversos.

Participa con responsabilidad en la sociedad


9) Participa con una conciencia cívica y ética en la vida de su comunidad,
región, México y el mundo.
10) Mantiene una actitud respetuosa hacia la interculturalidad y la diversi-
dad de creencias, valores, ideas y prácticas sociales.
11) Contribuye al desarrollo sustentable de manera crítica, con acciones
IV responsables.
Las competencias disciplinares son las nociones que expresan conoci-
mientos, habilidades y actitudes que consideran los mínimos necesarios de cada
FDPSRGLVFLSOLQDUSDUDTXHORVHVWXGLDQWHVVHGHVDUUROOHQGHPDQHUDHÀFD]HQGLIH-
rentes contextos y situaciones a lo largo de la vida. Las competencias disciplinares
pueden ser básicas o extendidas.
Las competencias disciplinares básicas procuran expresar las capacida-
des que todos los estudiantes deben adquirir, independientemente del plan y pro-
gramas de estudio que cursen y la trayectoria académica o laboral que elijan al
terminar sus estudios de bachillerato. Las competencias disciplinares básicas dan
sustento a la formación de los estudiantes en las competencias genéricas que inte-
JUDQHOSHUÀOGHHJUHVRGHOD(06\SXHGHQDSOLFDUVHHQGLVWLQWRVHQIRTXHVHGXFDWL-
vos, contenidos y estructuras curriculares; se organizan en los campos disciplinares
siguientes: Matemáticas, Ciencias Experimentales (Física, Química, Biología y Eco-
logía), Ciencias Sociales y Humanidades (Historia, Sociología, Política, Economía,
$GPLQLVWUDFLyQ/yJLFDeWLFD)LOVRItD\(VWpWLFD \&RPXQLFDFLyQ /HFWXUD\([SUH-
sión oral y escrita, Literatura, Lengua extranjera e Informática).
Para la asignatura Literatura I se tienen las siguientes competencias dis-
ciplinares básicas:

Propósito
La guía didáctica de Literatura I fortalecerá y consolidará la lectura en el alumno
DWUDYpVGHVXVHOHPHQWRVEiVLFRV,GHQWLÀFDUiDOD/LWHUDWXUDFRPRXQDH[SUHVLyQ
artística, reconocerá los géneros narrativos, así como los subgéneros. Estudiará la
GLIHUHQFLDHQWUHODIiEXOD\ODHSRSH\DHQWUHODOH\HQGD\HOPLWR$GHPiVFRP-
prenderá las características del cuento y de la novela. Lo anterior, con el objetivo
de que el estudiante tenga herramientas para desarrollarse dentro de la sociedad.

Estrategia didáctica
Para contribuir al desarrollo de las sesiones de aprendizaje en el aula, se estable-
ció una estrategia que permita integrar los elementos del programa de la asignatura,
con los materiales de apoyo y la actividad de docentes y estudiantes.
6H OH GHQRPLQD HVWUDWHJLD HQ HO VHQWLGR GH VX ÁH[LELOLGDG \D TXH QR
pretende ser un algoritmo que el docente deba seguir al pie de la letra, sino que
debe adaptarlo a las características propias del contexto en el que se desarrollan
las sesiones de aprendizaje.
La estrategia consta de siete pasos o etapas, mismas que deberán cono-
cerse en las primeras sesiones, para un mejor desarrollo de las mismas. Los pasos
se listan y describen a continuación:
‡ Dinamización.
‡ Problematización.
‡ Desarrollo de saberes: conocimientos, habilidades, actitudes y valores.
‡ Síntesis de resultados de aprendizaje.
‡ $FWLYLGDGLQWHJUDGRUD
‡ 7DUHDVLJQLÀFDWLYD
‡ Evaluación de la competencia.

V
Dinamización
En el proceso de construcción del aprendizaje, es indispensable para el facilitador
adentre al alumno en la materia y considere que es a partir de actividades que el
estudiante desarrollará nuevos conocimientos.
En el desarrollo de competencias se hace necesario el aprendizaje contextual, es
GHFLUSUHVHQWDUHOHPHQWRVDWUDYpVGHHVFHQDULRVTXHOHVHDQVLJQLÀFDWLYRVDORV
estudiantes. Dichas actividades deberán realizarse al inicio de cada bloque en los
que se organizan los contenidos en los programas de estudio.

Problematización
En el modelo de competencias que la RIEMS establece, el contenido toma un signi-
ÀFDGRSULPRUGLDODODFHUFDUQRVDpODWUDYpVGHVXDSOLFDFLyQHQODYLGDFRWLGLDQD
por tanto la problematización debe estar presente a lo largo de toda la estrategia
en el aula.

Desarrollo de saberes: conocimientos, habilidades,


actitudes y valores
(WDSDHQODFXDOHOIDFLOLWDGRUDSDUWLUGHOD%DVH2ULHQWDGRUDGHOD$FFLyQ %2$ 
facilita el quehacer del estudiante en la adquisición de competencias. En esta
etapa de la estrategia, estudiantes y docentes deben estar pendientes del proce-
so de asimilación. Galperin lo describe como un proceso de etapas y no como un
fenómeno inmediato.
Las distintas etapas del proceso de asimilación que el alumno experi-
menta para desarrollar el aprendizaje son: la etapa de motivación la cual debe
fomentarse y mantenerse durante todo el curso, recordemos que si un alumno no
esta motivado, difícilmente aprenderá. La segunda etapa de este proceso es la
IRUPDFLyQGHOD%2$HVWDLQFOX\HODIRUPDTXHHOIDFLOLWDGRUXWLOL]DSDUDTXHHO
alumno desarrolle una competencia. La RIEMS sugiere la creatividad como método
RIRUPDGHHQVHxDQ]DSDUDFXPSOLUWDOHVÀQHV
/D%2$SXHGHOOHYDUVHDFDERGHYDULDVIRUPDVFXEULHQGRWUHVDVSHFWRV
importantes, la orientación al alumno, que como ya dijimos debe estar precedida
por una buena carga de motivación, dicha orientación puede ser de dos tipos,
completa en la que el maestro le proporciona al alumno todos los aspectos de un
contenido, e incompleta en la cual se dejan ciertos aspectos de un contenido para
que el alumno pueda descubrir o investigar por sí mismo. La generalidad es otro
DVSHFWRLPSRUWDQWHHQODFRQVWLWXFLyQGHO%2$HVWDSXHGHVHUFRQFUHWDRJHQHUD-
lizada, es decir, el docente puede mostrar hechos concretos relativos a algún con-
tenido o puede abarcar el mismo contenido pero por medio de hechos generales,
que tengan alguna relación con el concepto que se expone al alumno.
(OPRGRGHREWHQFLyQHVHO~OWLPRGHORVDVSHFWRVTXHLQFOX\HOD%2$
Este se presenta de dos formas pre-elaborada e independiente. En el primero, el
alumno llega a obtener el aprendizaje de manera conjunta con el facilitador y en
la segunda los alumnos adquieren el conocimiento en forma independiente.

VI
Síntesis de resultados de aprendizaje
$FWLYLGDGTXHSHUPLWHLQWHJUDUORVDSUHQGL]DMHVGHOHVWXGLDQWHDWUDYpVGHHYLGHQ-
cias de conocimiento, desempeño, producto y actitud de manera que el docente
cuente con estrategias para la evaluación formativa logrando involucrar al estu-
diante en procesos de coevaluación.

Actividad integradora
$OWpUPLQRGHFDGDEORTXHHQORVTXHVHRUJDQL]DQODVXQLGDGHVGHFRPSHWHQFLD
en cada asignatura, el facilitador y los estudiantes ante la evidencia recopilada
en la etapa anterior, pueden establecer estrategias que permitan mayor grado de
FODULGDGHQODUHFROHFFLyQGHHYLGHQFLDVHLQFOXVRTXHORVDSUHQGL]DMHVVHDQUHDÀU-
mados por los estudiantes.

7DUHDVLJQLÀFDWLYD
$O ÀQDOL]DU FDGD EORTXH VH HQFXHQWUD XQD RSRUWXQLGDG GH UHODFLRQDU ORV VDEHUHV
con la vida cotidiana del estudiante y se hace referencia a las situaciones en las
cuales estos resultarán útiles prácticamente al estudiante.

Evaluación de la competencia
Para llevar a cabo la evaluación sumativa de las competencias que se indican en
los programas de estudio, se contempla esta etapa la cual debe verse como parte
del proceso, es decir, no debe en ningún momento separarse de la formativa. La
mejor forma de lograr esta unidad será integrando un portafolio de evidencias de
aprendizaje.

VII
Contenido
Bloque I:
,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH 

6HVLyQ$/D/LWHUDWXUDFRPRH[SUHVLyQDUWtVWLFD 

Comunicación literaria 8

Intención comunicativa 8

de los textos literarios 8

Función poética 11

Sesión B: Literariedad y movimientos literarios 13

Marcas de literariedad 15

Presentación del discurso 16

Movimientos literarios 16

Bloque II:
5HFRQRFHVHOJpQHURQDUUDWLYR 

6HVLyQ$(OHPHQWRV\FDUDFWHUtVWLFDVGHOJpQHURQDUUDWLYR 

Orígenes del género épico o narrativo 31

Elementos y características de la narración 32

Sesión B: Subgéneros narrativos 39

Subgéneros menores: la fábula, la epopeya, la leyenda y el mito 41

Subgéneros mayores: el cuento y la novela 41

VIII
Bloque III:
Reconoces las diferencias entre la fábula
y la epopeya 

6HVLyQ$(YROXFLyQ\FDUDFWHUtVWLFDVGHODIiEXOD 

Origen y desarrollo de la fábula 58

Características estructurales 58

Tipos de fábula 59

Los contextos 61

Sesión B: Evolución y características de la epopeya 64

Origen y desarrollo de la epopeya 66

Características estructurales 67

Tipos de epopeya 68

Los contextos 72

Bloque IV:
Reconoces las diferencias entre la leyenda
y el mito 78

6HVLyQ$/DOH\HQGDFRPRUHODWRSRSXODU 

Orígenes y características de la leyenda 83

$VSHFWRVFRQWH[WXDOHV\WH[WXDOHVGHODOH\HQGD 

Sesión B: El mito 89

2ULJHQFDUDFWHUtVWLFDV\FODVLÀFDFLyQ 

&ODVLÀFDFLyQ 

$VSHFWRVFRQWH[WXDOHV\WH[WXDOHVGHOPLWR 

IX
Bloque V:
Comprendes las características del cuento 108

6HVLyQ$(OFXHQWRRULJHQ\FDUDFWHUtVWLFDV 

Orígenes del cuento 114

Características del cuento 115

Estructura del cuento 116

Sesión B: Nivel intertextual y contextual del cuento 120

Nivel contextual 123

Corrientes literarias del cuento 123

Nivel intertextual 125

Bloque VI:
&RPSUHQGHVODVFDUDFWHUtVWLFDVGHODQRYHOD 

6HVLyQ$(VWUXFWXUDH[WHUQDHLQWHUQDGHODQRYHOD 
el contexto y el texto 139

Origen y evolución de la novela 141

Estructura externa: el contexto 143

Estructura interna: el texto 144

Sesión B: Tipos de novela 149

Nivel retórico de la novela 151

Tipos de novela 152

Bibliografía 166

Referencias electrónicas 166

X
Simbología empleada en la guía

1. Dinamización

3UREOHPDWL]DFLyQ

3. Desarrollo de saberes

4. Síntesis

$FWLYLGDGLQWHJUDGRUD\VLJQLÀFDWLYD

(YDOXDFLyQGHODFRPSHWHQFLD

XI
Bloque I:

,GHQWLÀFDV
la Literatura
como arte
Desempeños del estudiante al concluir el
bloque
‡ ,GHQWLÀFDODGHÀQLFLyQGHOLWHUDWXUDFRPRXQDH[SUHVLyQDUWtVWLFDDWUDYpV
de la lectura de diversos textos.
‡ Reconoce la intención comunicativa y la función poética al analizar textos
donde se aprecia el arte de la expresión literaria.
‡ Reconoce los movimientos literarios a través del tiempo.

Objetos de aprendizaje
‡ Intención comunicativa y función poética
‡ Marcas de literalidad:
» Lenguaje literario
» Formas de presentación
‡ Competencia lingüística:
» Manejo del lenguaje
» Presentación del discurso
‡ eSRFDVOLWHUDULDV
» Literatura antigua
» Literatura moderna
» Literatura contemporánea

Competencias a desarrollar:
‡ Es sensible al arte y participa en la apreciación e interpretación de sus
expresiones en distintos géneros.
‡ Sustenta una postura personal sobre temas de interés y relevancia ge-
QHUDOFRQVLGHUDQGRRWURVSXQWRVGHYLVWDGHPDQHUDFUtWLFD\UHÁH[LYD
‡ Mantiene una actitud respetuosa hacia la interculturalidad y la diversidad
de creencias, valores, ideas y prácticas sociales.
‡ ,GHQWLÀFDRUGHQDHLQWHUSUHWDODVLGHDVGDWRV\FRQFHSWRVH[SOtFLWRVH
implícitos en un texto, considerando el contexto en el que se generó y
en el que se recibe.
‡ Expresa ideas y conceptos en composiciones coherentes y creativas, con
introducciones, desarrollo y conclusiones claras.
‡ Valora y describe el papel del arte, la literatura y los medios de comu-
nicación en la recreación o la transformación de una cultura, teniendo
en cuenta los propósitos comunicativos de distintos géneros.
‡ Valora el pensamiento lógico en el proceso comunicativo en su vida
cotidiana y académica.
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

Dinamización
$continuación se muestra la letra de una canción, seguramente la conoces. ¿Cantas?

La fuerza del destino


He imaginado despacio
el ver enlazado, tu nombre al mío en un mismo corazón.

He notado en tus labios,


de pronto un milagro
permita que el sueño... se acabe aquí.

Es que el dolor nos ha traído a este lugar


en el que ya no puedo estar si tú no estás
en mí.

Nada me hace falta, sólo una mirada


que me haga entender qué es lo
que sigo haciendo aquí sin ti.
Sólo una palabra
que salga desde el alma
y que la fuerza del destino
te una a ti de nuevo a mí... por amor.

Es que no ha sido tan fácil, quererte en silencio


vivir desde el miedo
por no saber.

Si es verdad que algún día cuando el tiempo se rinda


la paz de una noche nos verá crecer.
Es que el dolor nos ha traído a este lugar
en el que ya no puedo estar si tú no estás
en mí.

Nada me hace falta, sólo una mirada


que me haga entender qué es lo
que sigo haciendo aquí sin ti.
Sólo una palabra
que salga desde el alma
y que la fuerza del destino
te una a ti de nuevo a mí... por amor.

4
Literatura I Bloque I
Y que ahora sea el mismo amor
el que se encargue de llevarte junto a mí hasta el cielo
más lejano y más azul por puro amor
solos tu y yo....

Nada me hace falta, sólo una mirada


que me haga entender qué es lo
que sigo haciendo aquí sin ti.
Sólo una palabra
que salga desde el alma
y que la fuerza del destino
te una a ti de nuevo a mí... por amor.

Por amor.

¿Cuántas veces has escuchado esta canción? Muchas, seguramente. ¿Te


VLHQWHVLGHQWLÀFDGRFRQDOJ~QIUDJPHQWRFRQDOJXQDIUDVHRFRQWRGDODFDQFLyQ"
Constantemente, cuando seleccionamos la música que oímos lo hacemos en relación
FRQHOLPSDFWRTXHFDXVDHQQXHVWUDVYLYHQFLDVODVFODVLÀFDPRVVHJ~QODHPRFLyQ
que experimentamos al escucharlas y solemos buscar aquéllas que concuerden con
nuestros sentimientos actuales: si estamos tristes, escuchamos las que hablan de
WULVWH]DVLHVWDPRVKHULGRVEXVFDPRVHOGHVDPRU(QÀQODVH[SUHVLRQHVGHRWURV
sirven también para mostrar las nuestras, es decir, experimentamos en “carne pro-
pia” lo que las canciones dicen; imagina entonces lo que una poesía, un cuento o
una novela pueden proyectar en tu vida diaria.
Durante este bloque conoceremos expresiones literarias que nos servirán
para ubicar a la Literatura como un arte que nos ayuda a exponer nuestras emociones.
Para lograrlo, leeremos algunos textos literarios representativos de diferentes con-
textos históricos.

Sesión A: La Literatura
como expresión artística
Proyecto,GHQWLÀFDUORVHOHPHQWRVGHOSURFHVRFRPXQLFDWLYRHQXQWH[WROLWHUDULR
haciendo énfasis en la función poética, para reconocerlo como una obra de arte
en un género determinado.

Criterios
‡ 'HÀQR/LWHUDWXUDXVDQGRPLVSURSLDVSDODEUDV
‡ Reconozco la intención comunicativa y la función poética, tomando en
cuenta los géneros literarios.
‡ Comprendo la Literatura como una forma de expresión artística, en un
contexto cultural actual.

5
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

‡ Integro los elementos del proceso comunicativo con la Literatura para


proyectar emociones en la lectura de textos modelo.
‡ Empleo de manera asertiva las funciones del lenguaje, conforme a la
situación comunicativa que enfrento cotidianamente.

Problematización
$FRQWLQXDFLyQVHWHSUHVHQWDQDOJXQRVWH[WRVHQORVFXDOHVGHEHUiVLGHQWLÀFDUOR
que se te solicita.

Literatura
Julio Torri
El novelista, en mangas de camisa, metió en la máquina
de escribir una hoja de papel, la numeró, y se dispuso
a relatar un abordaje de piratas. No conocía el mar y
sin embargo iba a pintar los mares del sur, turbulentos
y misteriosos; no había tratado en su vida más que a
HPSOHDGRVVLQSUHVWLJLRURPiQWLFR\DYHFLQRVSDFtÀFRV\
oscuros, pero tenía que decir ahora cómo son los piratas;
oía gorjear a los jilgueros de su mujer, y poblaba en esos
instantes de albatros y grandes aves marinas los cielos
sombríos y empavorecedores.
La lucha que sostenía con editores rapaces y con un público indiferen-
te se le antojó el abordaje; la miseria que amenazaba su hogar, el mar bravío.
Y al describir las olas en que se mecían cadáveres y mástiles rotos, el mísero
escritor pensó en su vida sin triunfo, gobernada por fuerzas sordas y fatales, y a
pesar de todo fascinante, mágica, sobrenatural.

Aftermath
Julio Cortázar
Dime por qué todavía te deseo, por qué tu nombre vuelve
como el hacha a la herida en una amarga visitación de la
medianoche,
a la vera de un campo funerario donde larvas se multiplican
húmedas babas, recuento interminable de torpezas,
dime desde esa nada donde ahora te atrincheras, dime por
qué me basta componer un mecanismo elemental de
sílabas, discar en el cogollo de la niebla las cifras de tu
nombre
para que solitariamente
me agobie la esperanza de una menuda migración de dedos
por mi pelo,
de una fragancia donde habita el musgo.
De un silencio más fogoso que todas las vigilias.

6
1)
Literatura I
¢&XiO HV OD LQWHQFLyQ GH -XOLR &RUWi]DU HQ ´$IWHUPDWKµ" ¢4Xp GHVHD
Bloque I
transmitirnos?

2) ¿Qué función lingüística predomina en el microrrelato de Julio Torri?

3) Explica en qué son semejantes y en qué son diferentes estos textos.

4) (VFULEHORVHOHPHQWRVGHOSURFHVRFRPXQLFDWLYRTXHSXHGHVLGHQWLÀFDU
en estos textos.

5) Observa las palabras utilizadas, ¿se parecen a las que usas cotidiana-
mente en tus conversaciones? ¿Por qué?

6) ¿Crees que cualquier persona puede ser un artista? ¿Qué papel juegan
las experiencias personales en la Literatura? ¿Por qué se considera la
Literatura como un arte?

Desarrollo de saberes
Seguramente habrás notado (después del semestre de Taller de lectura y redacción II)
que, desde que iniciaste tu vida escolar, estás en contacto directo con la Literatura.
¿Recuerdas tu libro de “Español lecturas”? Para muchos ése es su primer acerca-
PLHQWRFRQGLYHUVRVWH[WRVOLWHUDULRV$WUDYpVGHOWLHPSRHQGLYHUVRVQLYHOHVKDV
ido profundizando en su estudio y, dependiendo de tu contexto personal y escolar,
desarrollas sensibilidad hacia ciertos tipos de textos; inclusive la proyección de
XQD SHOtFXOD WH PXHYH D OHHU HO OLEUR HQ HO FXDO VH EDVD HVH ÀOPH &RPR YHUiV
la Literatura forma parte de nuestra vida diaria como manifestación de nuestras
emociones.

7
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

Pero, ¿qué es Literatura? El Diccionario de la Real Academia Española


tiene varias acepciones, pero todas giran en torno a un mismo concepto: el arte.

La Literatura es el arte que emplea como medio de expresión una


lengua. Como se ve, el empleo de la lengua es esencial, pero también es un
arte, es decir, el lenguaje utilizado no se estructura de la misma forma como en
cualquier otro texto, sino de una forma bella, particularmente estética. La Lite-
ratura data de hace muchos años, sólo que los mensajes se transmitían a través
de una tradición oral, de generación en generación, por lo tanto, no surge con
la escritura, sino en tiempos más antiguos.
0iVDGHODQWHHQHVWHEORTXHVHHVSHFLÀFDUiQODVFDUDFWHUtVWLFDVSURSLDV
de este arte y podrás percibir las cualidades de los textos literarios y lo placentero
que puede llegar a ser su lectura.

Comunicación literaria
Los elementos del proceso de comunicación son éstos: emisor, receptor, mensaje,
canal, código. En Literatura, dichos elementos crean gran importancia por su sig-
QLÀFDGRDUWtVWLFR
En un texto literario, el emisor indiscutible es el autor, y su mensaje está
lleno de particularidades, las cuales se hacen propias en el momento de leerlo.
El receptor del mensaje es todo aquél capaz de leer y apropiarse del
mensaje que emite una obra literaria. El análisis que hace de la obra lo ayuda a
HQWHQGHUDODXWRU\ORTXHTXLHUHWUDQVPLWLU'DUVHFXHQWDGHODVÀJXUDVUHWyULFDV
usadas, conocer su contexto, comprender su contenido y conectarse con los senti-
mientos del escritor, nos hacen un excelente destinatario.

En la comunicación literaria el mensaje, canal y código se entrelazan


en el lenguaje poético utilizado, es decir, las vivencias y emociones del autor
adquieren una belleza real con el código empleado. Los símbolos y las connota-
ciones le dan realce al escrito. Por lo tanto, la palabra, el tipo de palabras y la
interioridad del escritor componen una gran obra.

Intención comunicativa
de los textos literarios
(QVHPHVWUHVDQWHULRUHVVHKDQHVWXGLDGRGLIHUHQWHVWLSRVGHWH[WRVFX\DFODVLÀFDFLyQ
depende principalmente de su intención comunicativa y su función lingüística; de
tal suerte, se pueden encontrar textos persuasivos, funcionales, personales, expo-
sitivos y recreativos. Si se habla entonces de los textos persuasivos, su intención
cRPXQLFDWLYDSXHGHVHULQÁXLUHQODVSHUVRQDVSDUDPRGLÀFDUVXDFWLWXGVXVHsquemas
mentales e incluso sus conductas; si se trata de textos expositivos, el autor querrá
mostrar una información que considera relevante o simplemente reportar resultados
de alguna encuesta o investigación, por mencionar algunos ejemplos.
&XDQGRVHKDEODGHWH[WRVUHFUHDWLYRVVHUHÀHUHWDPELpQDORVWH[WRV
OLWHUDULRV(VWRVWH[WRVHQSULPHUDLQVWDQFLDWLHQHQODÀQDOLGDGGHUHFUHDUQXHV-
tros sentidos y nuestras mentes, pero si se hace un análisis más profundo, tiene

8
Literatura I
una intención comunicativa más ligada a la interioridad del autor. Un texto lite-
Bloque I
rario expresa sentimientos, emociones y deseos de quien escribe; generalmente
no pretende provocar algún cambio de conducta en el lector, simplemente quiere Hay diferentes
expresar lo que siente y lo que ha vivido, a través de palabras bellas. Lo interesan- tipos de textos cuya
FODVLÀFDFLyQGHSHQGH
te de la Literatura es que nuestras propias experiencias las ligamos con el autor, principalmente, de
SRUTXHVHQWLPRVTXHORVWH[WRVUHÁHMDQQXHVWUDYLGD)LQDOPHQWHODHVHQFLDGHXQ su intención comuni-
texto literario busca la belleza literaria usando un lenguaje que supera el cotidiano. cativa y su función
lingüística; de ahí
Tradicionalmente, la Literatura agrupa las producciones artísticas según que existen textos
ciertas características, entre ellas su forma de presentar el discurso, su intención, persuasivos, fun-
su lenguaje, etcétera. Los grupos que se forman al considerar los aspectos men- cionales, persona-
les, expositivos y
FLRQDGRVVRQOODPDGRVJpQHURVOLWHUDULRV$XQTXHH[LVWHQYDULDVFODVLÀFDFLRQHVGH recreativos.
los textos literarios, nos concentraremos en la siguiente, pues presenta mayor
facilidad en su manejo. De tal suerte, los grandes géneros son tres:

Géneros literarios
Épico Lírico Dramático
Posee una historia que se
Predomina la función
descubre conforme los
UHIHUHQFLDOFX\DÀQDOLGDGHV La expresión de emociones
personajes interactúan. No
relatar una serie de sucesos y vivencias personales es su
existe un narrador, sino que se
ocurridos en un espacio y ÀQDOLGDGIXQGDPHQWDOEXVFD
van presentando las acciones
tiempo determinados. Estos siempre mostrar su yo interno,
de manera directa, a través del
acontecimientos generalmente desconocido, personal.
diálogo entre los personajes.
son externos al autor, aunque
Su elemento más importante
producto de su imaginación. /DÀQDOLGDGSDUDODFXDOVHFUHD
es la subjetividad, es decir, su
es la representación escénica,
Su característica principal es la intimidad.
SRUORWDQWRVHUHÀHUHQDO
presencia del narrador.
drama como sinónimo de teatro.

Según la intención que el emisor de un texto literario posea, será el gé-


nero literario al cual pertenezca. No obstante que la intención de cada grupo es
diferente, todos comparten la esteticidad en el lenguaje.

Actividad de aprendizaje 1
$FRQWLQXDFLyQVHPXHVWUDQDOJXQRVIUDJPHQWRVTXHUHSUHVHQWDQFDGDJpQHUROLWH-
rario. Reúnete con dos compañeros, clasifíquenlos y comenten sus respuestas con
HOJUXSR'LVFXWDQODVUD]RQHVGHVXFODVLÀFDFLyQ

Ejemplo: Género literario Argumentación

&RQÀGHQFLDO0DULR%HQHGHWWL
Fueron jóvenes los viejos
pero la vida se ha ido
desgranando en el espejo
y serán viejos los jóvenes
pero no lo divulguemos
que hasta las paredes oyen.

9
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

Ejemplo: Género literario Argumentación

La Que No Está. Casa de Geishas, Ana María


Shua
Ninguna tiene tanto éxito como La Que No
(VWi$XQTXHWRGDYtDHVMRYHQPXFKRVDxRVGH
práctica consciente la han perfeccionado en el
sutilísimo arte de la ausencia. Los que preguntan
por ella terminan por conformarse con otra
cualquiera, a la que toman distraídos, tratando
de imaginar que tienen entre sus brazos a la
mejor, a la única, a La Que No Está.

Edipo rey. Sófocles (Fragmento)


Sacerdote: Con oportunidad has hablado.
Precisamente éstos me están indicando por
señas que Creonte se acerca.
(GLSR£2KVREHUDQR$SROR£2MDOiYLQLHUDFRQ
suerte liberadora, del mismo modo que viene
FRQURVWURUDGLDQWH
Sacerdote: Por lo que se puede adivinar, viene
complacido. En otro caso no vendría así, con la
cabeza coronada de frondosas ramas de laurel.
Edipo: Pronto lo sabremos, pues ya está lo
VXÀFLHQWHPHQWHFHUFDSDUDTXHQRVHVFXFKH
£2KSUtQFLSHPLSDULHQWHKLMRGH0HQHFHR
¿Con qué respuesta del oráculo nos llegas?
(Entra Creonte en escena.)

Sitio de amor. Jaime Sabines (Fragmento)


En ti creció mi corazón.
En ti mi angustia se hizo.
$PDGDOXJDUHQTXHGHVFDQVR
VLOHQFLRHQTXHPHDÁLMR

La noche / 1. “El libro de los abrazos”.


Eduardo Galeano
No consigo dormir. Tengo una mujer atravesada
entre los párpados. Si pudiera, le diría que se
vaya; pero tengo una mujer atravesada en la
garganta.

10
Literatura I Bloque I
Función poética
Dependiendo de la situación comunicativa a la cual se enfrente un hablante, usará
una función lingüística predominantemente, es decir, si el emisor de dicha situa-
FLyQVHFHQWUDHQOODPDUODDWHQFLyQGHOUHFHSWRU\SHUVLJXHXQDÀQDOLGDGHVWpWLFD
la función que puede utilizar es la poética.

En la función poética el lenguaje adquiere una importancia sustancial.


Para que un texto sea literario es necesario el empleo del lenguaje connotativo
para crear belleza y armonía por medio de las palabras. Por consiguiente, la
Literatura centra su atención en el mensaje y en la forma en cómo éste es
WUDQVPLWLGRHQWRQFHVXVDUiÀJXUDVUHWyULFDVSDUDFRPXQLFDUVHSRUHMHPSOR
metáforas, comparaciones, hipérboles, etcétera.

La Literatura busca tocar el corazón, provocando un forcejeo constante


contra lo corriente y cotidiano, con un lenguaje estructurado y simbólico.
La siguiente actividad busca retomar el proyecto de la sesión, en el cual
se pretende reconocer el texto literario como una obra de arte, tomando en con-
sideración los elementos y características propias de estos textos.

Actividad de aprendizaje 2
Lee el siguiente texto literario y responde a las preguntas que se te plantean a
continuación:

Instrucciones para llorar


Julio Cortázar
Dejando de lado los motivos, atengámonos a la manera
correcta de llorar, entendiendo por esto un llanto que no
ingrese en el escándalo, ni que insulte a la sonrisa con su
paralela y torpe semejanza. El llanto medio u ordinario
consiste en una contracción general del rostro y un soni-
do espasmódico acompañado de lágrimas y mocos, estos
~OWLPRVDOÀQDOSXHVHOOODQWRVHDFDEDHQHOPRPHQWR
en que uno se suena enérgicamente. Para llorar, dirija
la imaginación hacia usted mismo, y si esto le resulta
imposible por haber contraído el hábito de creer en el
mundo exterior, piense en un pato cubierto de hormigas
o en esos golfos del estrecho de Magallanes en los que
no entra nadie, nunca. Llegado el llanto, se tapará con
decoro el rostro usando ambas manos con la palma hacia adentro. Los niños
llorarán con la manga del saco contra la cara, y de preferencia en un rincón del
cuarto. Duración media del llanto, tres minutos.

11
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

1) ¢3RUTXpFUHHVTXH&RUWi]DUHVFULEHVREUHHOOODQWR"¢7HVLHQWHVLGHQWLÀ-
cado con alguna de las situaciones descritas? Explica.

2) Escribe los elementos comunicativos que representa este texto: emisor,


mensaje, receptor.

3) 6HxDODHOJpQHUROLWHUDULRDOFXDOSHUWHQHFH$UJXPHQWDWXUHVSXHVWD

4) Subraya alguna frase que consideres está elaborada con lenguaje que
supere lo cotidiano. ¿Qué tipo de lenguaje es?

5) Explica cuáles son las emociones que transmite esta narración.

6) Explica por qué es una obra de arte.

12
Literatura I Bloque I
Síntesis
Formen equipos de cuatro integrantes, asignen
funciones diferentes a cada uno dependiendo de
las necesidades. Dramaticen una situación don-
de deban explicarle a su mamá cómo se sienten
respecto a las reglas establecidas acerca de la
hora de llegada a casa. Deben tomar en cuenta
las funciones emotiva, referencial y poética. Cada
integrante tendrá una función de un elemento del
proceso comunicativo (emisor, receptor, mensaje,
FyGLJR $OÀQDOL]DUVXVGUDPDWL]DFLRQHVUHDOLFHQ
una plenaria que los ayude a ubicarse respecto a sus aprendizajes adquiridos, basán-
dose en los criterios presentados al inicio de la sesión.

Sesión B: Literariedad y
movimientos literarios
3UR\HFWR$QDOL]DWH[WRVOLWHUDULRVGHGLIHUHQWHVFRQWH[WRVKLVWyULFRVLGHQWLÀ-
cando los elementos de literariedad o competencia lingüística, para reconocer
los diferentes movimientos literarios.

Criterios
‡ ,GHQWLÀFRODOLWHUDULHGDGHQODOHFWXUDGHWH[WRVOLWHUDULRVSHUWHQHFLHQ-
tes a diferentes movimientos literarios.
‡ $QDOL]RODFRPSHWHQFLDOLQJtVWLFD OHQJXDMHOLWHUDULR\SUHVHQWDFLyQGHO
discurso) desarrollada por el autor, en textos literarios de distintas épocas.
‡ 0XHVWURXQDDFWLWXGUHÁH[LYDHQODH[SUHVLyQGHPLVHPRFLRQHVDQWHOD
experiencia del lenguaje literario en diferentes modalidades literarias.

Problematización
$FRQWLQXDFLyQHQFRQWUDUiVGRVWH[WRVFDGDXQRGHpSRFDVGLIHUHQWHVHQODKLVWRULDGH
la Literatura. Léelos y responde a las preguntas que se te plantean con base en ellos.

Fábula
Esopo
Cuentan de un hombre que se decía conocedor del por-
venir que mientras profetizaba en la plaza pública le fue
robado cuanto tenía.
Voló al saber la noticia tan infausta y un ciudadano, con
puntas de socarrón, le salió al encuentro y le dijo:
³$GLYLQR¢FyPRRIUHFtDVSURQRVWLFDUHOIXWXURDORVGH-
más y no supiste lo que te iba a pasar a ti?

13
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

Los años con Laura Díaz


Carlos Fuentes (fragmento)
/DLQDXJXUDFLyQGHOSUHVLGHQWH0LJXHO$OHPiQHQGLFLHP-
bre de 1946 coincidió con un hecho asombroso en la casa
GH OD $YHQLGD 6RQRUD /D WtD 0DUtD GH OD 2 YROYLy D KD-
blar. “Es jarocho. Es veracruzano”, dijo del nuevo joven y
apuesto mandatario, el primer presidente civil después de
la sucesión de militares en el poder.
Todos —Laura Díaz y Juan Francisco, Santiago y
Dantón— se maravillaron, mas no terminaron allí las sor-
presas de la tiíta que se dio a bailar sin ton ni son “La
Bamba” a cualquier hora, a pesar de los tobillos hinchados.
Finalmente, a principios del año nuevo, María
de la O hizo su anuncio sensacional.
—Se acabaron las tristezas. Me voy a vivir a Veracruz. Un viejo novio
del puerto me ha propuesto que nos casemos. Es un hombre de mi edad, aunque
yo no sé cuál es mi edad porque mi mamá no me registró. Quería que creciera
pronto para seguirla en la vida alegre. Vieja pendeja, ojalá se achicharre en el
LQÀHUQR/R~QLFRTXHPHFRQVWDHVTXH0DWtDV0DWDGDPDV³HVHOQRPEUHGH
mi galán— baila danzón como un ángel y me ha prometido sacarme a bailar dos
YHFHVSRUVHPDQDDOD3OD]DGH$UPDV\HQWUHHOS~EOLFR\ODJHQWH
³1DGLHVHOODPD0DWtDV0DWDGDPDV³GLMRHODJXDÀHVWDVGH'DQWyQ
—Baboso —le replicó la tiíta— San Matías es el último apóstol, el que
VXVWLWX\yD-XGDVHO7UDLGRUGHVSXpVGHODFUXFLÀ[LyQSDUDWHQHUFRPSOHWLWDOD
docena. Pa’ que lo sepas.
³$SyVWRO\QRYLRGH~OWLPDKRUD³VHULy'DQWyQ³FRPRVL-HVXFULVWR
fuera un abonero que vende santos más baratos por docena. […]

1) Investiga quién es Esopo, en qué época vivió y cuál es su papel en la


creación de fábulas.
2) Se sabe que Carlos Fuentes escribe en la segunda mitad del siglo XX, ¿a
cuál etapa de la Literatura pertenece su obra?

3) ¿Qué diferencia notas entre los dos textos?

Como puedes darte cuenta, la Literatura es diferente dependiendo del


momento histórico en el cual fue escrita. Los temas, el vocabulario y la forma
varían según las circunstancias que acompañan al autor. Estos detalles son algunos
de los saberes que desarrollaremos en esta sesión.
14
Literatura I Bloque I
Desarrollo de saberes
Ya se había comentado en la sesión anterior que los textos literarios tienen ca-
racterísticas exclusivas que los hacen diferentes, por lo tanto, el trabajo de un
autor literario es especial porque se relaciona con situaciones diversas, las cuales
requieren de dedicación y manejo experto de habilidades verbales; por ejemplo:
el tipo de palabras que usa, sus vivencias, las organización del discurso. Entre las
características propias de estos textos se encuentran la situación comunicativa,
la función poética, el lenguaje connotativo y la forma de presentar el discurso.
Es decir, los autores literarios crean verdaderas obras de arte con el manejo del
lenguaje y la forma de organizarlo en su presentación.
En esta sesión analizaremos diferentes textos literarios para reconocer
las cualidades de las obras literarias, esencialmente la literariedad, descubriendo
esa característica en obras creadas en diferentes momentos de la historia de la
humanidad, en los cuales las producciones literarias dependen en gran medida del
pensamiento predominante de la época.

Marcas de literariedad
Las marcas o elementos de literariedad de una obra son el lenguaje literario y
la forma de presentación. El texto literario tiene como particularidad el manejo
del lenguaje, es decir, las palabras usadas en él no son las mismas que se usan
en otro tipo de textos, en donde el sentido literal o directo es necesario para
GDUOHREMHWLYLGDG(Q/LWHUDWXUDSUHGRPLQDODVXEMHWLYLGDG\ODSOXULVLJQLÀFDFLyQ
ambas necesarias para enfatizar su literariedad.

El autor literario crea un texto que represente sus ideas, su imaginación,


su concepción del hombre, su percepción de la sociedad y sus sentimientos. En
esencia es subjetivo, personal, individual.
Esta subjetividad lleva consigo la búsqueda de la connotación, las pala-
EUDVQRVLJQLÀFDQHQSULPHUDLQVWDQFLDORTXHHVWDPRVDFRVWXPEUDGRVDUHODFLRQDU
sino que representan imágenes alternas a la realidad que le dan una belleza fan-
tástica al texto. En consecuencia, el lenguaje usado es artístico; esas imágenes,
símbolos, adjetivos especiales, forman parte del lenguaje literario.
/DV ÀJXUDV UHWyULFDV FRP~QPHQWH HPSOHDGDV VRQ VtPLO R FRPSDUDFLyQ
epítetos, metáfora, hipérbole. Los símiles o comparacionesVHLGHQWLÀFDQXEL-
cando dos elementos que se hacen semejantes gracias a una frase o adverbio
comparativo: como, semejante, igual, tal como, tanto que, etcétera. Por ejemplo:
“Tu cabello tan brillante como la luz de la luna”, “Me cautivaron sus ojos tan
negros como la noche”.
Los epítetos son adjetivos que describen un personaje, un espacio o una
situación, es decir, un objeto. “Su bella e inocente sonrisa”, “las sábanas blancas
y cálidas”, son ejemplos de epítetos.
En el mismo sentido, si se trata de metáforasODVSRGHPRVGHÀQLUFRPR
la imagen que se crea con dos elementos que se unen en uno solo y que repre-
sentan un sentido alterno al conocido cotidianamente. En la metáfora se puede
LGHQWLÀFDUXQDFRPSDUDFLyQLPSOtFLWDRVHDVHKDFHQVHPHMDQWHVSHURVLQHOXVR
GHXQQH[R(VWDÀJXUDSRVHHXQHOHPHQWRUHDO\RWURQRUHDO FRQQRWDWLYRLPD-

15
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

JLQDULR TXHDOXQLUVHIRUPDQODLPDJHQRVLJQLÀFDFLyQFRQODFXDOHODXWRUEXVFD
realzar o enfatizar una característica. Ejemplo: “… tómame ahora que aún es
sombría esta taciturna cabellera mía” (“La hora” de Juana de Ibarbourou). En este
ejemplo se puede notar el elemento real, la cabellera, y el elemento evocado o
imaginario: sombría, taciturna.
La hipérbole es más frecuente en las narraciones (aunque no exclusivo), y
VHUHÀHUHDODH[DJHUDFLyQGHFXDOLGDGHVRDFRQWHFLPLHQWRVTXHVHQDUUDQRGHVFULEHQ
en un texto literario; por ejemplo: la fuerza extrema de Hércules o la regeneración
diaria de las entrañas de Prometeo, en la mitología griega; el sonido del címbalo
de oro que se oye en toda la tierra al ser tocado por el enano de Uxmal.
Por otro lado, las formas de presentar el texto literario se relacionan con
el modo en cómo están escritos, estas modalidades o formas pueden ser el verso o
la prosa. En el verso, la organización de las palabras se hace atendiendo a ciertas
UHJODVPpWULFDV\GHULPDFDGDIUDVH YHUVR WLHQHXQQ~PHURHVSHFtÀFRGHVtODEDV
\H[LVWHVLPLOLWXGHQWUHVXVVtODEDVÀQDOHV(QFDPELRODprosa sigue la secuencia
QDWXUDO GHO SHQVDPLHQWR GH PDQHUD FRQWLQXD$XQTXH HO YHUVR HV FRP~Q HQ HO
género lírico, también pueden encontrarse narraciones planteadas en esta modali-
dad; de la misma forma, existen textos líricos escritos en prosa.

Presentación del discurso


El discurso es la agrupación de palabras que dan como resultado un prototipo textual.

El diálogo, la narración, la descripción y el monólogo se mezclan en un


texto para lograr efectos literarios, poéticos, estéticos.

Para alcanzar lo que se propone, un autor puede utilizar predominante-


mente un prototipo en particular, según su propio estilo o sus preferencias literarias,
incluso su adhesión a una corriente de pensamiento literario. También se puede
hablar de una presentación directa o indirecta del discurso, cuando el estilo se da
a través del diálogo o cuando interviene un tercero (narrador) que usa el relato,
descripción o monólogo para mostrar la historia.

Movimientos literarios
$WUDYpVGHODKLVWRULDODVFLUFXQVWDQFLDVVRFLDOHVVHPRGLÀFDQHQFRQVHFXHQFLD
las necesidades humanas. Si cambia la historia, por ende, la Literatura también.
Los autores literarios escriben en relación con su propio contexto, siempre desde
XQDYLVLyQSDUWLFXODUSHURLQÁXLGDSRUODVFLUFXQVWDQFLDVKLVWyULFDV/DVSURGXFFLRQHV
literarias varían sus temas, estructura y estilo, en función del momento social que
viven. De este modo, si dios es el centro de las actividades humanas y la Iglesia
determina el contenido social, educativo y político, entonces las obras son teocén-
tricas; si el ser humano quiere desligarse de la opresión del tirano que lo gobierna,
por ejemplo, se basan en temas libertarios, como en el romanticismo. Por lo tanto,
la corriente literaria se relaciona íntimamente con las ideas que “circulan” en la
sociedad que alberga al escritor.
([LVWHQGLYHUVDVFODVLÀFDFLRQHVGHODVFRUULHQWHVOLWHUDULDVVLQHPEDUJR
aquí agruparemos la Literatura en tres movimientos, según la época en la que se
desarrolla: Literatura antigua, moderna y contemporánea.

16
Literatura I
Podemos considerar Literatura antigua a aquellas creaciones surgidas desde
Bloque I
la época antigua, las relativas a Oriente, como China, India, Egipto y Mesopotamia;
y Occidente, así como la Literatura grecolatina. Las obras literarias pertenecientes
a este movimiento sirven como modelo de las siguientes generaciones de autores,
sobre todo la grecolatina, considerada clásica por esa razón. Entre los personajes más
VREUHVDOLHQWHV VH HQFXHQWUDQ +RPHUR 9LUJLOLR 'DQWH$OLJKLHUL 0DTXLDYHOR (VRSR
Esquilo, y otros.
$hora bien, si nos referimos a la Literatura moderna, es la que surge a Literatura antigua,
ÀQDOHVGHOVLJOR;,;\DEDUFDKDVWDODSULPHUDPLWDGGHOVLJOR;;LQFOX\HFRUULHQWHV moderna y contem-
poránea son tres
como realismo, naturalismo y los movimientos de vanguardia, también llamados movimientos repre-
´LVPRVµ$XWRUHVFRPR:LOGH%DXGHODLUH7]DUDVRQFODVLÀFDGRVHQHVWHJUXSR sentativos de la
Literatura, según
En lo concerniente a la Literatura contemporánea, las obras creadas en la época en la que
la segunda mitad del siglo XX hasta nuestros tiempos, pertenecen a esta época. se desarrolla.
Entre las corrientes contemporáneas que destacan se encuentran el existencia-
lismo y el boom latinoamericano. García Márquez, Carlos Fuentes, Octavio Paz y
Hemingway, entre otros, son escritores contemporáneos.
No podemos dejar de mencionar las corrientes consecutivas a la Edad
Media con grandes producciones literarias como el renacimiento, el neoclasicismo
y el romanticismo, las cuales vieron nacer a autores como Shakespeare, Molière,
VRU -XDQD ,QpV GH OD &UX] 9LFWRU +XJR \ (GJDU$OODQ 3RH ODV FXDOHV QR SXHGHQ
ubicarse con precisión en los tres movimientos mencionados aquí, pero de suma
importancia para el estudio de la Literatura.

Actividad de aprendizaje 3
De acuerdo al proyecto presentado al inicio de la sesión B, a continuación se te
presentan algunos textos pertenecientes a diferentes movimientos literarios, para
TXHLGHQWLÀTXHVORVHOHPHQWRVOLWHUDULRVHVWXGLDGRVHQHVWDVHFFLyQ/pHORV\UHV-
ponde las cuestiones que se derivan de ellos.

Canción de otoño en primavera El drama del desencantado La zorra y los racimos de uvas
Rubén Darío (fragmento) García Márquez (microrrelato) Esopo

Juventud, divino tesoro, ...el drama del desencantado que


£\DWHYDVSDUDQRYROYHU se arrojó a la calle desde el décimo
piso, y a medida que caía iba viendo Estaba una zorra con mucha
Cuando quiero llorar, no lloro... a través de las ventanas la intimidad hambre, y al ver colgando
de sus vecinos, las pequeñas de una parra unos deliciosos
y a veces lloro sin querer...
tragedias domésticas, los amores racimos de uvas, quiso
Plural ha sido la celeste furtivos, los breves instantes de atraparlos con su boca.
historia de mi corazón. felicidad, cuyas noticias no habían Mas no pudiendo alcanzarlos,
llegado nunca hasta la escalera se alejó diciéndose:
Era una dulce niña, en este común, de modo que en el instante
de reventarse contra el pavimento —¡Ni me agradan, están tan
PXQGRGHGXHOR\GHDÁLFFLyQ
de la calle había cambiado por YHUGHV
Miraba como el alba pura; completo su concepción del mundo,
VRQUHtDFRPRXQDÁRU y había llegado a la conclusión de
que aquella vida que abandonaba Nunca traslades la culpa a los
Era su cabellera oscura para siempre por la puerta falsa demás de lo que no eres capaz
valía la pena de ser vivida. de alcanzar.
hecha de noche y de dolor.

17
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

1) “Era su cabellera oscura hecha de noche y de dolor”. De acuerdo con el


lenguaje literario, este es un ejemplo de:

2) 3DUDDOXGLUDOPHQVDMHFRQQRWDWLYRODIUDVHDQWHULRUVLJQLÀFD

3) “Los amores furtivos”, “las pequeñas tragedias domésticas”, “los bre-


YHVLQVWDQWHVGHIHOLFLGDGµVRQÀJXUDVUHWyULFDVOODPDGDV

4) ,GHQWLÀFDXQDFRPSDUDFLyQ\HVFUtEHODHQODOtQHD

5) Señala la modalidad de presentación y el estilo del discurso de cada


WH[WR GLiORJR QDUUDFLyQ GHVFULSFLyQ PRQyORJR $UJXPHQWD WX UHV-
puesta.

6) Investiga la época o momento histórico en el que vivieron los autores


de estos textos y determina a qué movimiento literario pertenecen.
$UJXPHQWDWXUHVSXHVWD

Síntesis
Recapitulando, una obra literaria posee ciertas características que la diferencian
de otros textos; el lenguaje usado en ella tiene que ver con la connotación o el
XVRGHÀJXUDVUHWyULFDVFRPRODPHWiIRUDORVVtPLOHVODKLSpUEROH\ORVHStWHWRV
Los textos literarios pueden estar escritos en prosa o verso y sus autores emplean
diferentes formas de organización del discurso.
)LQDOPHQWHOD/LWHUDWXUDVHFODVLÀFDHQGLIHUHQWHVPRYLPLHQWRVRFRUULHQWHV
dependiendo de las ideas predominantes en una época histórica.
Es importante subrayar que las marcas de literariedad y el discurso se
interpretarán erróneamente si no se tiene información sobre el autor y el contexto
de producción que lo rodeó en el momento en el cual escribió su obra literaria.
Cuando nos referimos al contexto de producción estamos hablando de las circuns-
tancias históricas, sociales, políticas y económicas que acompañaron al escritor
literario cuando creó su obra.

18
Literatura I Bloque I
Actividad de aprendizaje 4
Investiguen por equipos, en un libro de Literatura universal, las corrientes literarias
que han surgido a través del tiempo y las características de cada una. Escriban en
un pliego de papel bond un mapa mental acerca de ellas. Traigan un texto represen-
tativo de cada corriente y analícenlo en clase, mostrando por qué pertenece a ese
movimiento literario.

AFWLYLGDGLQWHJUDGRUD\VLJQLÀFDWLYD
Reúnanse en equipos y realicen las siguientes actividades, usando como base el
siguiente texto.

Seis de enero
Luis Bermer
£3RU ÀQ KDEtD OOHJDGR HO JUDQ GtD (O SHTXHxR
$OH[ VH GHVSHUWy PX\ H[FLWDGR FDVL HXIyULFR
durante todo el año había estado acumulando
LQÀQLGDG GH GHVHRV HQ VX SURGLJLRVD PHPRULD
Las dos últimas semanas habían transcurrido
SDUD$OH[HQXQDDWPyVIHUDGHFUHFLHQWHDQVLH-
dad, odiaba tener que esperar; y no cesaba de
contar y recontar los días que faltaban para el
cumplimiento de su sueño, marcándolos con su
rotulador fosforescente en el torturado calendario de la salita de estar. Haciendo
JDOD GH XQD SDFLHQFLD VREUHKXPDQD VX PDGUH YHULÀFDED D FDGD PRPHQWR OD
H[DFWLWXG GHVXVSUHFLSLWDGRVFiOFXORVSHUR$OH[QXQFD HVWDED FRQIRUPHFRQ
aquellas respuestas.
“El tiempo se ha dormido”, pensaba.
La larga espera terminaría por la noche, cuando los misteriosos Reyes
Magos dejaran junto al árbol de navidad sus sueños convertidos en maravillosas
UHDOLGDGHV£4XpQHUYLRVRHVWDED6LHPSUHOHKDEtDQGLFKRTXHGHEtDVHUPX\
bueno y obediente si quería que los Reyes cumpliesen sus deseos, o de lo con-
WUDULRVyOROHWUDHUtDQFDUEyQ/RFLHUWRHVTXH$OH[QXQFDKDEtDYLVWRFDUEyQ
y hasta sentía cierta curiosidad por manipular aquello que tan malo debía ser,
£SHUR QR KDVWD HO SXQWR GH LQWHUFDPELDUOR SRU VXV SUHFLDGRV MXJXHWHV +L]R
memoria sobre su comportamiento durante el pasado año, y no recordó haber
hecho nada malo; aunque su hermana mayor sí guardaba bastantes evidencias
en contra de su inocente benevolencia.
$ODWDUGHFHUVXSDGUHOHLQYLWyDGDUXQSDVHRSRUODVFRQFXUULGDVFDOOHV
de la ciudad, con la esperanza de que la fatiga facilitaría al pequeño conciliar
HOVXHxR+DFtDPXFKRIUtR\ODRVFXULGDGFXEUtD\DHOFLHOR$OH[FDPLQDEDGH
la mano de su padre contemplando el movimiento de la ciudad por el estrecho
espacio que quedaba entre la capucha de su abrigo y su repudiada bufanda roja.
Le encantaba esta época del año, las calles brillaban con luces de innumerables
colores en contraste con el negro vacío de la noche; la atmósfera transmitía una
impresión especial, extraña, una esencia oculta que solamente es visible, en
determinados momentos, a los ojos que aún conservan la inocencia.

19
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

7UDV XQ ODUJR SDVHR YROYLHURQ D FDVD$O HQWUDU XQ GHOLFLRVR DURPD
salió a recibirles. Su madre estaba en la cocina preparando la cena.
³3RGpLVVHQWDURVYDPRVDFHQDUSURQWR³GLMRGLULJLpQGROHD$OH[XQD
cristalina sonrisa.
Esa sonrisa, y la enorme mano de su padre cobijando la suya cuando
paseaban, hacían que se sintiese el niño más protegido del mundo; nada podría
hacerle daño, nada en absoluto.
$OH[IXHHOSULPHURHQWHUPLQDUFRQVXFHQDDQWHODFRPSUHQVLYDPL-
rada de sus padres.
³£3DUHFHVX~OWLPDQRFKHHQOD7LHUUD³ULyVXKHUPDQD
3RFRGHVSXpV$OH[VHPHWLyHQODFDPD
—Que descanses, cariño —susurró su madre mientras apagaba la luz.
Pronto cayó rendido en un sueño intranquilo.
$OH[DEULyORVRMRV7RGRHVWDEDDRVFXUDV\HQVLOHQFLR$~QQRKDEtD
amanecido y sabía que no debía levantarse, pero ¡necesitaba saber si los jugue-
WHVKDEtDQOOHJDGR\D7DQVLJLORVDPHQWHFRPRSXGR$OH[VDOLyGHVXKDELWDFLyQ
Por la puerta entreabierta del salón surgía un pálido haz de luz amarillenta.
Dentro, la voz de sus padres era un débil e inconexo murmullo, apenas audible.
Sus gruesos calcetines de lana amortiguaban el sonido de sus pisadas,
así que, sin poder resistirse a la curiosidad, se acercó hasta el borde de la puerta
para mirar al interior:
Dos enormes gusanos, de un blanco purulento, se encontraban junto al
árbol de navidad, erguidos sobre sus hinchadas colas. Sus cuerpos giraron instan-
táneamente al sentir la mirada del pequeño, mostrando sus rostros deformados,
aunque grotescamente reconocibles, a su hijo:
—Nos has desobedecido, cariño —dijeron al unísono con gorgoteante
YR]JXWXUDO³£12'(%,67(+$&(5/2£12'(%,67(+$&(5/2³FKLOODEDQPLHQ-
tras se abalanzaron girando en espiral sobre él. FIN

1) “Seis de enero” es considerado un texto literario, porque…


a. Expresa las ideas de un pueblo
b. Busca hacerte cambiar de conducta y actitud
c. 8VDXQOHQJXDMHTXHLQFOX\HÀJXUDVUHWyULFDV
d. 1DUUDXQVXFHVRWHUURUtÀFR
2) El género literario al que pertenece este texto es:

3) La corriente o movimiento literario al que pertenece este texto es:

4) Marcar con un plumón amarillo las palabras o frases que demuestren un


lenguaje connotativo o poético y explica qué quiso decir el autor al usar
esas palabras.

20
5)
Literatura I
(VFULEH XQ HMHPSOR GH FDGD ÀJXUD UHWyULFD H[SOLFDGR HQ OD 6HVLyQ %
Bloque I
tomado de “Seis de enero”.
‡ Epíteto:

‡ Metáfora:

‡ Símil:

‡ Comparación:

‡ Hipérbole:

6) Explica brevemente qué experimentaste cuando leíste el texto.

7) (OWH[WRHVWiHVFULWRHQSURVDRYHUVR$UJXPHQWDWXUHVSXHVWD

8) Considerando que eres el receptor del mensaje que envía Bermer, ¿con-
VLGHUDVTXHWXVHPRFLRQHVVHSDUHFHQDODVGH$OH["¢+DVWHQLGRDOJX-
QDH[SHULHQFLDHQODFXDOXQDIHFKDLPSRUWDQWHWHSDUH]FDWHUURUtÀFD"
¿Cuando eras niño, esperabas los regalos de los Reyes Magos?

9) La forma como está presentado el discurso, utiliza el prototipo:

21
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

10) En el siguiente espacio escribe una narración sencilla y breve sobre


un suceso de terror, que hayas experimentado o escuchado. Crea los
personajes y utiliza palabras propias de la función poética. Comparte
tu trabajo con el resto del grupo y comenta las cualidades de las narra-
ciones leídas.

Realimentación
'HVSXpVGHUHVROYHUODDFWLYLGDGLQWHJUDGRUD\VLJQLÀFDWLYDHVQHFHVDULRTXHSODQ-
WHHVXQDVLWXDFLyQPHWDFRJQLWLYDHQODFXDOLGHQWLÀTXHVFXiOHVKDQVLGRWXVDSUHQ-
dizajes adquiridos y cómo los hiciste parte de tus esquemas.
La siguiente tabla muestra los saberes estudiados en este bloque. Marca
con una X la columna que represente tu realidad frente a los aprendizajes.

Saberes Sí No

'HÀQLFLyQGH/LWHUDWXUD

&ODVLÀFDFLyQGHORVJpQHURVOLWHUDULRV

Intención comunicativa de los textos literarios y la


función poética

&ODVLÀFDFLyQGHORVPRYLPLHQWRVOLWHUDULRV

Figuras del lenguaje poético

Modalidades de presentación

$QDOL]DWXVLWXDFLyQIUHQWHDOGHVDUUROORGHFRPSHWHQFLDV\HVWDEOHFHTXp
estrategias seguirás para alcanzar el desarrollo de saberes no adquiridos en este
bloque. Plantéalas al grupo y acuerden cuál es la sugerencia más viable.

22
Literatura I Bloque I
Evaluación de la competencia
Después de socializar los resultados de sus aprendizajes, ubica su nivel de desem-
peño en la adquisición de las competencias relacionadas con esta sesión. Tomando
en consideración el cumplimiento de los criterios presentados al inicio.

Inicial- Básico
Pre-formal Estratégico
Criterio receptivo Resolutivo $XWyQRPR 
 
 
,GHQWLÀFROD ,GHQWLÀFROD Elaboro mi
1RLGHQWLÀFR ,GHQWLÀFROD
'HÀQR/LWHUDWXUD GHÀQLFLyQGH GHÀQLFLyQGH SURSLDGHÀQLFLyQ
ODGHÀQLFLyQ GHÀQLFLyQGH
usando mis Literatura, Literatura y de Literatura,
de Literatura Literatura, de
propias con ayuda de señalo sus usando mis
de un grupo de un grupo de
palabras. elementos elementos propias
conceptos. conceptos.
guía. principales. palabras.
Reconozco
Reconozco Reconozco Redacto un
la intención
la intención la intención texto breve con
No reconozco Reconozco comunicativa
comunicativa comunicativa la intención de
las funciones las funciones y la función
y la función y la función expresar mis
lingüísticas ni lingüísticas y poética en
poética, poética, en un emociones,
la intención la intención textos literarios
tomando texto literario usando un
comunicativa de comunicativa pertenecientes
en cuenta proporcionado lenguaje acorde
los textos. de los textos. a los diferentes
los géneros por el con la función
géneros
literarios. maestro. poética.
literarios.
,GHQWLÀFROD Proporciono
,GHQWLÀFROD
1RLGHQWLÀFR literariedad ejemplos de
literariedad en Elaboro un texto
el lenguaje Explico en qué en la lectura la literariedad
la lectura de que cumpla
literario, así consiste la de textos tomados
textos literarios con las marcas
como el verso y literariedad al literarios de textos
pertenecientes de literariedad
la prosa, como leer un texto pertenecientes pertenecientes
a diferentes en un contexto
elementos de literario. a diferentes a diferentes
movimientos contemporáneo.
literariedad. movimientos movimientos
literarios.
literarios. literarios.
Comprendo Comprendo Leo una obra Me intereso
Comprendo
la Literatura la Literatura literaria de mi en escribir mi
la Literatura No comprendo
como parte como una elección con una propia obra
como una forma la Literatura
de mis forma de actitud positiva literaria como
de expresión como parte de
aprendizajes expresión y recreativa, una forma
artística en los contenidos
personales en artística al reconociendo de expresión
un contexto escolares.
la lectura de leer un texto su aportación artística de mis
cultural actual.
un texto. literario. artística. vivencias.

23
Bloque I ,GHQWLÀFDVOD/LWHUDWXUDFRPRDUWH

Inicial- Básico
Pre-formal Estratégico
Criterio receptivo Resolutivo $XWyQRPR 
 
 
Integro los Integro los
Integro e Integro los
elementos elementos
,GHQWLÀFRORV LGHQWLÀFRORV elementos
del proceso del proceso
1RLGHQWLÀFR elementos elementos comunicativos
comunicativo comunicativo
los elementos del proceso del proceso en la redacción
con la literatura con la Literatura
del proceso comunicativo comunicativo de un texto
para proyectar para proyectar
comunicativo. en un esquema en un texto literario para
emociones en emociones en la
presentado. literario proyectar mis
la lectura de lectura de textos
presentado. emociones.
textos modelo. modelo.
$QDOL]ROD
$QDOL]RXQ
competencia $UJXPHQWROD
texto literario, Redacto mi
lingüística competencia
No explico a señalando propio texto,
(lenguaje Reconozco lingüística
TXpVHUHÀHUH el lenguaje poniendo en
literario y el lenguaje analizada
lenguaje literario literario y práctica mi
presentación literario en en un texto
y presentación la forma de competencia
del discurso) un texto perteneciente
del discurso, en presentación lingüística,
desarrollada proporcionado a una corriente
un ambiente de del discurso adhiriéndome
por el autor, en en clase. literaria
clase. en textos a una corriente
textos literarios HVSHFLÀFDGDHQ
de distintas literaria.
de distintas clase.
épocas.
épocas.
Empleo de Empleo de
manera asertiva ,GHQWLÀFR manera asertiva
1RLGHQWLÀFR Comprendo
las funciones la función Redacto un texto las funciones
las funciones las funciones
del lenguaje, lingüística breve utilizando del lenguaje,
del lenguaje en lingüísticas y
conforme a predominante la función del conforme a un
una situación su relación con
la situación en un texto lenguaje que se texto literario,
comunicativa que una situación
comunicativa literario me indique. en la expresión
se me presenta. comunicativa.
que enfrento presentado. que leo o
cotidianamente. produzco.
Muestro Muestro
$QDOL]RODV
una actitud una actitud
Comprendo la emociones 5HÁH[LRQRVREUH
UHÁH[LYDHQOD UHÁH[LYDHQOD
importancia del autor las emociones
expresión de mis No reconozco el expresión de mis
GHLGHQWLÀFDU en textos que expresa el
emociones ante lenguaje literario emociones ante
las emociones literarios de autor en un texto
la experiencia en un texto y la experiencia
del autor, que diferentes literario y su
del lenguaje su modalidad del lenguaje
predominan modalidades, relación con su
literario en literaria. literario en
en un texto en un contexto personal
diferentes diferentes
literario. ambiente e histórico-social.
modalidades modalidades
cooperativo.
literarias. literarias.

24
Literatura I Bloque I
Carlos Fuentes

25
Bloque II:

Reconoces
el género
narrativo
Desempeños del estudiante:
‡ Reconoce el origen y desarrollo del género narrativo en diferentes textos.
‡ 'HÀQHODVFDUDFWHUtVWLFDVGHOJpQHURQDUUDWLYRDWUDYpVGHODOHFWXUD
‡ ,GHQWLÀFDORVVXEJpQHURVPHQRUHV\PD\RUHVDWHQGLHQGRDVXVFDUDFWH-
rísticas.
‡ &RPSUHQGHODHVWUXFWXUDGHODQDUUDFLyQHLGHQWLÀFDORVWLSRVGHQDUUDGRU

Objetos de aprendizaje:
‡ Género narrativo. » Novela
‡ Subgéneros menores: » Cuento
» Fábula ‡ Estructura de la narración:
» Leyenda » Narrador
» Mito » Ordenación de los hechos
» Epopeya » Personajes
‡ Subgéneros mayores: » Tipos de narrador

Competencias a desarrollar
‡ Escucha, interpreta y emite mensajes pertinentes en distintos contextos
mediante la utilización de medios, códigos y herramientas apropiados.
‡ Evalúa un texto mediante la comparación de un contenido con el de
otros, en función de sus conocimientos previos y nuevos.
‡ Produce textos con base en el uso normativo de la lengua, considerando
la intención y situación comunicativa.
‡ Participa y colabora de manera efectiva en equipos diversos.
‡ Valora el pensamiento lógico en el proceso comunicativo en su vida
cotidiana y académica.
‡ Mantiene una actitud respetuosa hacia la interculturalidad y la diversi-
dad de creencias, valores, ideas y prácticas sociales.
‡ ,GHQWLÀFDRUGHQDHLQWHUSUHWDODVLGHDVGDWRV\FRQFHSWRVH[SOtFLWRVH
implícitos en un texto, considerando el contexto en el que se generó y
en el que se recibe.
‡ $UJXPHQWDXQSXQWRGHYLVWDHQS~EOLFRGHPDQHUDSUHFLVDFRKHUHQWH
y creativa.
‡ Valora y describe el papel del arte, la literatura y los medios de comu-
nicación en la recreación o la transformación de una cultura, teniendo
en cuenta los propósitos comunicativos de distintos géneros.
Bloque II Reconoces el género narrativo

Dinamización
Yucatán tiene una gran aportación legendaria, una de ellas es la que a continua-
ción se te presenta. Léela con entusiasmo para hacerla real y atractiva.

La Xtabay
Se cuenta que en un pueblo de la península de Yucatán vi-
vían dos mujeres. Una se llamaba Xtabay y le decían Xke-
EDQ TXHVLJQLÀFDPXMHUSHFDGRUDRSURVWLWXWD \DODRWUD
le llamaban Utz-Colel, mujer buena, decente y limpia.
La Xkeban era muy bella, pero se daba continua-
mente al pecado de amor. Por esto las personas honradas
del lugar le despreciaban. La Utz-Colel era virtuosa, ho-
nesta y jamás había cometido un desliz ni pecado amoroso
alguno, razón por la cual todo el vecindario la apreciaba.
Xkeban era de buen corazón y bondadosamente
socorría a los humildes, a los desamparados, a los enfermos y a los anima-
OHVTXHDEDQGRQDEDQSRUVHULQ~WLOHVGHVSRMiQGRVHGHODVMR\DV\ÀQDVYHV-
tiduras que le regalaban sus enamorados. Era sencilla de corazón y sufría
UHVLJQDGDPHQWHODVLQMXULDVGHODJHQWH$XQTXHYLUWXRVDGHVXFXHUSROD
Utz-Colel era fría, orgullosa, dura de corazón y le repugnaban los pobres.
Un día los vecinos no vieron salir más a la Xkeban. Pasaron los
GtDV\SRUWRGRHOSXHEORVHFRPHQ]yDHVSDUFLUXQÀQR\GHOLFDGRSHUIXPH
GHÁRUHV$OEXVFDUGHGyQGHYHQtDOOHJDURQDODFDVDGH;NHEDQDTXLHQ
encontraron muerta.
Cuando la noticia llegó a oídos de la Utz-Colel, ésta rió despec-
tivamente, dijo que era mentira, que de un cuerpo vil y corrupto no podía
salir sino podredumbre y pestilencia, que aquello debía ser cosa de los
espíritus malignos, tratando así de continuar provocando a los hombres.
Pero como mujer curiosa quiso convencerse por sí misma. Fue al lugar, y al
sentir el perfumado aroma aseguró: si el cadáver de esta mujer mala huele
tan aromáticamente, mi cadáver olerá mejor.
Unos pocos enterraron a Xkeban, más por lástima y obligación
TXHSRUJXVWR$OGtDVLJXLHQWHVXWXPEDHVWDEDFXELHUWDSRUÁRUHVKHUPR-
sas y delicado perfume.
Cuando murió Utz-Colel todo el pueblo acudió a su entierro. Para
DVRPEURGHOSXHEORVXWXPEDQRH[KDODEDXQÀQRSHUIXPHVLQRTXHD~QFX-
bierta de tierra despedía un hedor intolerable, como de carne podrida. El ve-
cindario lo atribuyó a malas artes del demonio, por lo que llevaron numerosos
UDPRVGHÁRUHVSDUDDGRUQDU\PHQJXDUHOPDORORUTXHSURFHGtDGHODWXPED
/DÁRUTXHQDFLyGHODWXPEDGH;NHEDQVHOODPy;WDEHQW~QXQD
KXPLOGH\EHOODÁRUVLOYHVWUHTXHFUHFHHQFHUFDV\FDPLQRV6XQpFWDUHP-
briaga dulcemente, como debió ser el embriagador amor de Xkeban.
3RUVXSDUWH8W]&ROHOVHFRQYLUWLyGHVSXpVGHPXHUWDHQODÁRUGH
7]DFDPTXHHVXQFDFWXVHUL]DGRGHHVSLQDVGHOTXHEURWDXQDÁRUKHUPRVD
que huele en forma desagradable y al tocarla es fácil punzarse.

28
Literatura I Bloque II
&RQYHUWLGD8W]&ROHOHQODÁRUGH7]DFDPFRPHQ]yDUHÁH[LRQDU
envidiando lo sucedido a Xkeban, y llegó a la errónea conclusión de que
seguramente porque sus pecados habían sido de amor, le ocurrió todo lo
bueno que le ocurrió después de muerta. Y entonces pensó en imitarla
entregándose también al amor. Sin darse cuenta que si las cosas habían
sucedido así, era por la bondad del corazón de Xkeban, quien se entregaba
al amor por un impulso generoso y natural.
Con ayuda de los malos espíritus, Utz-Colel consiguió la gracia de
regresar al mundo cada vez que lo quisiera, convertida nuevamente en mu-
jer para enamorar a los hombres, pero con amor nefasto porque la dureza
de su corazón no le permitía otro.
Pues bien, sepan los que quieran saberlo que ella es ahora la mala
;WDED\ODTXHVXUJHGHO7]DFDPODÁRUGHOFDFWXVSXQ]DGRU\UtJLGRTXH
cuando ve pasar a un hombre vuelve a la vida y lo aguarda bajo las ceibas
peinando su larga cabellera con un trozo de Tzacam erizado de púas. Sigue
DORVKRPEUHVKDVWDTXHFRQVLJXHDWUDHUORVORVVHGXFHOXHJR\ DOÀQORV
asesina en el frenesí de un amor infernal.

Si analizamos la historia de los pueblos, encontraremos que en sus monu-


PHQWRVUXLQDVÁRUHVSiMDURVUtRVYROFDQHVKpURHV\JXHUUHURVVHHVFRQGHHQ
cada una de ellos, una narración sencilla e interesante, ésa es la característica que
da a la Literatura la nominación de arte.
Como yucatecos poseemos un amplio material literario, pues nuestra
riqueza cultural, aunada a la creatividad y fantasía de sus habitantes, han dado pie
DODFUHDFLyQGHKLVWRULDVEHOODVTXHKDQFUX]DGRIURQWHUDV$GLDULRODMXYHQWXG
yucateca es testigo de diversas situaciones de la vida, en unas, experimenta emo-
ciones agradables, sentimientos nobles llenos de amor, ternura y comprensión; en
otras, conoce lo más repugnante de la humanidad. De esas situaciones podemos
FRQVWUXLUKLVWRULDVTXHSDUWHQGHXQDUHDOLGDG\VHGHVDUUROODQFRQODÀFFLyQ7~
como estudiante, ¿eres autor de alguna historia o pensamiento?, ¿qué tipo de his-
WRULDVWHDWUDHQ"¢WHLGHQWLÀFDVFRQDOJXQDKLVWRULDHQSDUWLFXODU"$GHPiVGH´/D
Xtabay”, ¿qué narraciones yucatecas conoces?
(QHOEORTXH,HVWXGLDVWHTXHORVJpQHURVOLWHUDULRVVHUHÀHUHQDODVGLVWLQWDV
formas en que se puede presentar una obra literaria. En Literatura I, por su extensión
y variedad, solamente se analizará el género épico-narrativo; en este bloque cono-
ceremos los elementos y características que lo distinguen de los demás.

Sesión A: Elementos y
características del género
narrativo
Proyecto &RQRFHU ODV FDUDFWHUtVWLFDV GHO JpQHUR QDUUDWLYR H LGHQWLÀFDU HQ
diversos escritos, los elementos que la conforman.

29
Bloque II Reconoces el género narrativo

Criterios
‡ ,GHQWLÀFRHORULJHQGHOJpQHURQDUUDWLYRFRPRDQWHFHGHQWHKLVWyULFR
‡ Reconozco, en un texto, las características del género narrativo.
‡ Muestro disposición para redactar un texto breve en el que incluyo un
WLSR HVSHFtÀFR GH QDUUDGRU SDUD DSUHFLDU ODV FDUDFWHUtVWLFDV GH OD
narración.

Problematización
El diario vivir y las experiencias que se adquieren en los diversos contextos se pueden
traducir en historias con sentido. Cada ser humano es forjador de su propio destino,
es el dramaturgo de su gran producción literaria, es quien entrelaza los aconteci-
mientos de su vida en una historia particular y única.
&RQÀUPHPRV OR DQWHULRU WUDWDQGR GH UHVSRQGHU DOJXQDV LQWHUURJDQWHV
¿quién es la persona idónea para narrar tu vida? (tipo de narrador), ¿quiénes son
las personas que están íntimamente relacionadas con tu vida? (personajes), ¿qué
eventos te han marcado? (acciones), ¿cuáles son los lugares en los que ejecutas tus
DFFLRQHV" HVSDFLRJHRJUiÀFR ¢ODFRPXQLFDFLyQHVÁXLGDRWHUHVHUYDVFRPHQWD-
ULRVTXHUHÁH[LRQDVSHUVRQDOPHQWH" GLiORJRV 
Haciendo referencia a los elementos del género épico narrativo, responde
las siguientes preguntas.
1) ¿Quién es el narrador de la historia?

2) ¿Qué personajes se incluyeron en esta narración?

3) ¿Cuál es el suceso o hecho central que ayuda al desarrollo de toda la


historia?

4) ¿En qué época ubicarías la historia?

30
5)
Literatura I
¿Qué escenarios se utilizaron a lo largo del relato?
Bloque II

6) ¢/D KLVWRULD VH HVWi DFWXDQGR QDUUDQGR R FDQWDQGR" -XVWLÀFD WX UHV-
puesta.

7) Según lo estudiado en el bloque 1, ¿qué modalidad de presentación


maneja el texto?

Desarrollo de saberes
El género narrativo tiene la cualidad de llevar al lector y al escritor a un mundo
ajeno al que vive, y aunque la historia literaria toma sus modelos del mundo real,
las circunstancias llenas de fantasía la hacen diferente e interesante.

Orígenes del género épico


o narrativo
El surgimiento del género narrativo se remonta a la época antigua, desde el mo-
mento en que el hombre sintió la necesidad de expresar lo real de la existencia
e irreal de los sueños que le dan fortaleza. En ese instante surge el género cuya
intención es contar una historia de hechos heroicos o legendarios, su propósito es
convencer a quien lee o escucha sobre la realidad de los sucesos relatados, aunque
ORVHOHPHQWRVVHDQÀFWLFLRVHQWRGRRHQSDUWH
/RVSHUVRQDMHVWDPELpQGHÀFFLyQRUHDOHVSXHGHQDSDUHFHUFRPRVHUHV
KXPDQRVH[WUDRUGLQDULRVDQLPDOHVXREMHWRVSHUVRQLÀFDGRV3RUHMHPSORHQPX-
chas culturas las constantes guerras impulsaron a los hombres al abandono de sus
hogares y a anhelar la compañía de sus seres queridos. Cuando esporádicamente
cesaban los enfrentamientos, los hombres gozaban de escuchar sus propias haza-
xDVDYHQWXUDV\ODYLVXDOL]DFLyQÀFWLFLDGHXQUHWRUQRDUPyQLFRDVXKRJDU
Las primeras grandes narraciones se transmitían de generación en gene-
ración utilizando como herramienta el lenguaje oral. La ausencia de la escritura
impidió en parte el reconocimiento de tantas creaciones artísticas que por des-
gracia se olvidaron; afortunadamente la grafía fue la solución a dicho problema.
Homero con la Ilíada y La Odisea, Virgilio con la Eneida'DQWH$OLJKLHUL\VXDivina
Comedia son algunas creaciones majestuosas que consolidan la narración literaria.

31
Bloque II Reconoces el género narrativo

Por lo anterior, se concluye que nadie puede determinar con exactitud


el momento, el tiempo y espacio en los cuales surge el género narrativo, pero sí
es válido asegurar que la permanencia o ausencia de una historia dependerá de la
habilidad del autor para expresar sus ideas y sentimientos, reales o imaginarias,
buscando ante todo la belleza y originalidad del lenguaje.

Elementos y características
de la narración
Los elementos y características del relato son diversos. En el siguiente cuadro
sinóptico se presentan los elementos y características de la narración, en forma
JHQHUDO$OFRQFOXLUHOFXDGURVHUHDOL]DXQGHVJORVHGHWDOODGRGHOQDUUDGRUGHORV
elementos estructurales, personajes, del tiempo y espacio.
Extradiegético
Intradiegético
Narrador Autodiegético
Omnisciente
Situación inicial
Elementos estructurales Ruptura del equilibrio
Protagonista Resolución del conflicto
Elementos
Antagonista
del Personajes
Incidental
texto narrativo
Ambiental

Lineal Fragmentado
Tiempo y espacio Abierto
Esquema 2.1.

Narrador
El género épico utiliza necesariamente a un personaje que funge como narrador, su
función es contar los hechos que se presentan en la historia. Existen diversos tipos
de narradores que, de acuerdo a la participación que tengan dentro o fuera de la
KLVWRULDRDVXFRQRFLPLHQWRGHODPLVPDSXHGHQFODVLÀFDUVHHQFXDWURWLSRV
D  Narrador extradiegético: el narrador se encuentra fuera de la historia
y generalmente conoce todo acerca de los personajes (omnisciente).
6HLGHQWLÀFDHQXQWH[WRSRUHOHPSOHRGHODWHUFHUDSHUVRQDVLQJXODUR
plural (él, ella, ellos) para referirse a otras personas. Ejemplo: …dudosos
entraron en el cuarto y presenciaron aquel hermoso cuadro familiar.
Sin dudarlo, levantaron los cargos y pidieron disculpas…

32
Literatura I
E  Narrador intradiegético: es aquel que interviene en la historia, las ac-
Bloque II
ciones están en primera persona singular o plural (yo, nosotros). Ejem-
plo: …dudosos entramos en el cuarto y presenciamos aquel hermoso
cuadro familiar. Sin dudarlo, levantamos los cargos y pedimos discul-
pas…
F  Narrador autodiegético: para este tipo de narrador las acciones prin-
cipales son realizadas por él mismo, es decir, es el protagonista de la
historia. Ejemplo: …dudoso entré en el cuarto y presencié aquel her-
moso cuadro familiar. Sin dudarlo, levanté los cargos y pedí disculpas…
G  Narrador omnisciente: este narrador se caracteriza por conocer a la
perfección los sentimientos y pensamientos de los personajes. Ejemplo:
…aunque intentó dormir, despertaba aterrorizado, su interior gritaba
pidiendo perdón. De pronto, aunque no estaba allí, sentía que el mons-
truo se aproximaba a él…
El narrador extradiegético a menudo es omnisciente, pues ambos combi-
nan sus características, se presenta un narrador en tercera persona y además sabe
todo lo que el personaje experimenta en su interior y exterior.

Actividad de aprendizaje 1
En los siguientes recuadros se han anexado breves fragmentos, analiza su contenido
y escribe sobre la línea el tipo de narrador que se empleó en cada fragmento.

Divina Comedia Pasiones


£6R\\R%HUQDUGRVR\\R
Quien desesperadamente acude Sin dirección corrimos a la choza,
Estas personas no han sido la lluvia humedeció nuestras
pecadoras; sin embargo no a ti para sanar mis heridas. Pues
en mi alma está escrito el castigo vestimentas y con los cuerpos
tuvieron el bautismo, ninguno desnudos, el amor hizo lo suyo.
veneró a Dios, entre ellos estaba del cual seré prisionera por
$GiQ$EHO+RPHURHWF siempre.

33
Bloque II Reconoces el género narrativo

Elementos estructurales
En la asignatura de español, que cursaste en la secundaria, seguramente escuchaste
los siguientes conceptos: planteamiento, nudo, clímax y desenlace. Para efectos
de este curso los nombres cambian, pero el contenido sigue siendo el mismo, nos
UHIHULPRVDVLWXDFLyQLQLFLDOUXSWXUDGHOHTXLOLEULR\UHVROXFLyQGHOFRQÁLFWR
En la estructura se aborda la forma como se va desarrollando la historia,
GHXQDVLWXDFLyQWUDQTXLODSDVDDXQPRPHQWRGHWHQVLyQÀQDOL]DQGRHQXQGHVHQ-
lace feliz o trágico. En la situación inicial se presentan los personajes de la obra,
así como sus características de personalidad; puede ser que se incluyan dentro de
ODQDUUDFLyQRGHORFRQWUDULRODGHGXFFLyQGHSHQGHUiGHOUHFHSWRU$GHPiVGHORV
personajes, en la situación inicial se narra el inicio o suceso que desencadena toda
la historia. En el caso de “El abuelo, el nieto y el burro”, la historia empieza con:
“Una mañana el abuelo decidió ir a la feria que se celebraba en la ciudad…”, sin
duda alguna éste es el hecho que origina una serie de situaciones en las que se
desarrolla la historia. Con respecto a los personajes, éstos no se describieron con
exactitud, pero se puede inferir lo siguiente:
$EXHORVHUYLFLDOHGXFDGRFRQOHQWHV\FDEHOOREODQFRQLHWRREHGLHQWH
y tranquilo con pantalones cortos.
La ruptura del equilibrio expone las situaciones de enredo que dan pie
a los problemas de la historia, provocando crisis sucesivas hasta llegar a lo funda-
mentalmente dramático de la obra. En “El abuelo, el nieto y el burro”, las per-
sonas alrededor emitieron una opinión, la cual los llevó a actuar de acuerdo a los
intereses de otros con criterio diferente, a tal grado que todo lo que realizaran era
considerado como malo. La ruptura del equilibrio se da desde que ambos hicieron
caso al primer comentario.
El desenlaceGHODKLVWRULDHVHOÀQ(VODSDUWHGHODDFFLyQGRQGHVHUH-
VXHOYHHOFRQÁLFWR3RUHMHPSORGHFLGLHURQJXLDUVHSRUVXSURSLRMXLFLRDFWXDQGR
siempre con nobleza y honestidad, desenlace de “El abuelo, el nieto y el burro”.

Personajes
Son los seres que llevan a cabo las acciones de la historia, las realizan, quienes
dependiendo del subgénero narrativo pueden ser: personas, seres sobrenaturales,
héroes, objetos o animales. El grado de importancia que adquieran dentro del re-
ODWRGHWHUPLQDVXFODVLÀFDFLyQSURWDJRQLVWDDQWDJRQLVWDVHFXQGDULRRDPELHQWDO
(también llamado incidental). El siguiente mapa conceptual presenta las caracte-
rísticas de cada personaje y muestra su relación.

34
Literatura I Bloque II

Personajes

Protagonista Ambiental
pueden ser

no realizan
realiza las
Antagonista Secundario

Acciones
Acciones
básicas es el su actuación
sólo

en
adversario del mova al caracterizan al
protagonista protagonista medio
toda la
historia
a través del

apoyo
constante

Actividad de aprendizaje 2
(QSDUHMDVLGHQWLÀTXHQORVSHUVRQDMHVGHODOH\HQGD´/D;WDED\µ\HVFULEDQVXV
conclusiones en los espacios correspondientes.
1) ¿Quién es el protagonista?

2) ¿Quién es el antagonista?

3) ¿Quién es el o los secundarios?

4) ¿Quién es el o los ambientales?

$KRUDFRPHQWHQORVUHVXOWDGRVGHODDFWLYLGDGDUJXPHQWDQGRHOSRUTXp
de sus respuestas, y concluyan con el apoyo del profesor.
35
Bloque II Reconoces el género narrativo

Tiempo y espacio
Es el cuándo y el dónde de la narración literaria. Se entiende por espacio los lu-
JDUHV HVFHQRJUiÀFRV GRQGH VH GHVDUUROODQ ODV DFFLRQHV GH ORV SHUVRQDMHV eVWRV
pueden ser de dos tipos: cerrados o abiertos; la calle, el campo, el parque son
DELHUWRV\ODRÀFLQDODFDVDHOVDOyQVRQFHUUDGRV
El tiempo es el lapso en el cual ocurren los hechos o acciones de los per-
sonajes, que puede ser lineal o fragmentado. El lineal sigue una secuencia crono-
lógica y ordenada de los hechos. El fragmentado o anacrónico es el que se presenta
fuera del tiempo en el que se está realizando la narración, es común a través de
recuerdos o visualizaciones futuras.

Actividad de aprendizaje 3
$KRUDTXHFRQRFHVORVHOHPHQWRVGHOJpQHURQDUUDWLYRHVUHFRPHQGDEOHOHHU\DQD-
OL]DUGLIHUHQWHVWH[WRVHLGHQWLÀFDUORVHOHPHQWRVHVWXGLDGRV3DUDLQLFLDUFRQOD
práctica, te presentamos la siguiente historia mitológica. Léela y posteriormente
realiza la actividad presentada.

Las dos montañas: origen del


Popocatépetl
Hace mucho tiempo, los más ancianos conta-
ban que existió un gran guerrero azteca llama-
do Popo que estaba enamorado de una hermo-
sa muchacha llamada Iztla. Desgraciadamente,
estalló una guerra y Popo tuvo que ir a comba-
tir, aunque antes de partir, él y su amada Iztla
VHSURPHWLHURQÀGHOLGDG\DPRUHWHUQR(QVX
misma aldea vivía un hombre malvado y en-
vidioso que siempre había estado enamorado
de Iztla y que se presentó en su choza con un
rostro de falsa tristeza, diciendo que Popo había muerto en el combate.
La pobre mujer lloró durante días y el mal hombre aprovechó para hacerle
regalos y consolarla, hasta el punto que ella terminó consintiendo en ca-
sarse con él. Nada más celebrase la boda, Popo regresó a la aldea buscando
a su amada y al encontrarla casada con otro hombre montó en cólera. La
muchacha, sin poder soportar el dolor de la traición y el desamor, se lanzó
por un acantilado, muriendo al instante. Poco después, Popo, el amante
arrepentido, corrió a buscarla, pero ya era tarde. Viéndola muerta, su
desesperación provocó una tormenta de fuego terrible.
'HVGHHQWRQFHVHQHOYDOOHGH$QiKXDFH[LVWHQGRVPRQWDxDVHO
SHUÀOGHXQDGHHOODVUHFXHUGDDOGHXQDPXMHUTXH\DFHPXHUWD\TXHORV
QDWLYRVOODPDQ,]WDFFtKXDWOTXHVLJQLÀFD´PXMHUGRUPLGDµ\ODRWUDVLPER-
liza al guerrero Popo, quien resguarda la tranquilidad de su amada, al cual
los indígenas llamaron Popocatépetl.

&RQ ORV FRQRFLPLHQWRV TXH KDV DGTXLULGR HQ HVWD VHVLyQ LGHQWLÀFD HQ
“Las dos montañas” las características que conforman el texto narrativo, para lo
cual deberás escribir en los espacios proporcionados los datos que a continuación
se solicitan.
36
1)
Literatura I
¿Cuál es el título del texto que acabas de leer?
Bloque II

2) Tiempo: cronológico o fragmentado

3) Espacio: abierto o cerrado

4) Narrador
a. ¢4XpWLSRGHQDUUDGRUVHXWLOL]yHQHOUHODWR"$UJXPHQWDWXUHV-
puesta.

b. Escribe las frases o palabras en las que se evidencie el narrador.

5) Personajes
a. Protagonista:

b. $QWDJRQLVWD

c. Incidental:

d. $PELHQWDO

6) Elementos estructurales
a. Situación inicial:

b. Ruptura del equilibrio:

c. 5HVROXFLyQGHOFRQÁLFWR

37
Bloque II Reconoces el género narrativo

Síntesis

Figura 2.8

$PDQHUDGHUHVXPHQLQLFLHQHQHTXLSRODUHGDFFLyQGHXQWH[WRQDUUDWLYRWRPDQGR
como referencia la imagen de arriba, utiliza tu creatividad para darle forma a la
KLVWRULD7HVXJHULPRVHPSOHDUXQWLSRHVSHFtÀFRGHQDUUDGRUSDUDSRVWHULRUPHQWH
HVFXFKDUODVFUHDFLRQHVGHRWURVFRPSDxHURVGHFODVHHLGHQWLÀFDUHOWLSRGHQD-
rrador que empleó cada uno en su composición.

38
Literatura I Bloque II
Sesión B: Subgéneros
narrativos
Proyecto: IGHQWLÀFDUORVVXEJpQHURVQDUUDWLYRVTXHLQWHJUDQODFODVLÀFDFLyQPD\RU
\PHQRUUHFRQRFLHQGRODVFDUDFWHUtVWLFDVHVSHFtÀFDV\~QLFDVFRUUHVSRQGLHQWHV
DFDGDXQRHQGLVWLQWRVWH[WRVTXHHMHPSOLÀTXHQORVGLIHUHQWHVVXEJpQHURV

Criterios
‡ Reconozco los subgéneros narrativos, así como algunas características
básicas de cada subgénero mayor o menor en diferentes relatos.
‡ ,GHQWLÀFRFDGDXQRGHORVVXEJpQHURVQDUUDWLYRVHQXQDVHULHGHWH[WRV

Problematización
(QELQDVLGHQWLÀTXHQODVVLJXLHQWHVLPiJHQHVTXHFDUDFWHUL]DQDXQWLSRGHVXEJp-
nero narrativo, comenten el título, el argumento, en caso de conocerlo, y clasi-
ÀTXHQHVFULELHQGRHQHOHVSDFLRFRUUHVSRQGLHQWHVLHVXQFXHQWRQRYHODIiEXOD
OH\HQGD PLWR R HSRSH\D 6L HQFXHQWUDQ DOJXQD GLÀFXOWDG SDUD OOHYDU D FDER OD
DFWLYLGDGSUHJ~QWHQOHDOVLQRGDORPDHVWURSDUDWUDEDMDUHÀFLHQWHPHQWH

¿Qué subgénero representa? ¿Qué subgénero representa? ¿Qué subgénero representa?

39
Bloque II Reconoces el género narrativo

¿Qué subgénero representa? ¿Qué subgénero representa? ¿Qué subgénero representa?

Desarrollo de saberes
En cada etapa de nuestra vida nos relacionamos con distintos tipos de narración.
En el preescolar, nuestra profesora relataba cuentos fantásticos en los que Caperucita
Roja y los tres cerditos destacan como héroes, modelos de valentía y persistencia;
en la primaria los valores se transmiten a través de historias que por sí solas nos
dan una moraleja, es decir, una enseñanza para la vida cotidiana; más o menos por
esa misma edad, en las reuniones nocturnas con nuestros primos y vecinos, escuchá-
bamos de voz de abuelos o tíos historias raras y propias de nuestra región, con un
toque sobrenatural que generan cierta duda de su existencia. Ya en la secundaria
nos enteramos de la existencia de la cultura griega y sus aportaciones literarias,
unas demasiado irreales para el mundo en el cual habitamos y otras con un toque
nacionalista revelando las costumbres de una raza o patria. Por ejemplo, El Inge-
nioso Hidalgo Don Quijote de la Mancha maneja acciones desligadas de la realidad;
sin embargo, toma como referencia las tradiciones de su contexto social.
Todo lo anterior es parte de los subgéneros narrativos que serán analiza-
dos detalladamente en los siguientes bloques, en éste únicamente se describirán
de forma breve cada uno de ellos.
Dado que los textos narrativos manejan una diversidad de historias, per-
VRQDMHV\SURSyVLWRVVHFODVLÀFDQHQFXHQWRQRYHODIiEXODOH\HQGDPLWR\HSR-
peya. El contenido, extensión y complejidad del relato determina la organización
de los textos en mayores o menores.
Se entiende por mayores los géneros narrativos largos y, por ende, más com-
plejos, entre los que se encuentran la novela y el cuento. La fábula, la epopeya, la
OH\HQGD\HOPLWRVRQUHODWLYDPHQWHFRUWRV\SRUHOORVRQFODVLÀFDGRVFRPRPHQRUHV

40
Literatura I Bloque II
Subgéneros menores: la fábula,
la epopeya, la leyenda
y el mito
/DÀQDOLGDGGLGiFWLFDTXHVHREWLHQHGHODVDFFLRQHVGHDQLPDOHVFRQFDUDFWHUtV-
ticas humanas es el toque distintivo de las fábulas. Son narraciones breves cuyo
propósito es dar una enseñanza a través de consejos llamados moralejas. Por su
contenido, las fábulas pueden ser escritas en prosa o en verso.
Mucho se ha comentado que la epopeya es un tipo de novela e incluso
se ha relacionado directamente con la leyenda y el mito, no obstante los cambios
literarios han delimitado cada una de ellas como narraciones independientes. La
epopeya es un poema épico, en él se narran hechos heroicos relacionados con
guerras o hazañas dirigidas por seres extraordinarios, héroes asociados con el origen
o el destino de sus pueblos. Virgilio y Homero son considerados como los máximos
exponentes de este subgénero.
Las leyendas se basan en hechos reales, pero transformados en relatos
maravillosos y sobrenaturales por la imaginación del escritor. Las leyendas antiguas
han llegado a nosotros a través de la comunicación oral, los autores son los pobla-
dores de la región, razón por la cual cada territorio la adopta como suya, dando pie
a la diversidad de versiones que existen sobre una misma leyenda.
Los protagonistas de los relatos mitológicos son dioses. Estos relatos gi-
ran en torno de una historia sagrada que el ser humano ha creado para explicarse
a sí mismo el origen del mundo y la razón de su existencia. Los mitos con más
reconocimiento son los de origen griego; sin embargo, Mesoamérica ha dejado un
legado mitológico de la misma calidad que la de los griegos.

Subgéneros mayores: el cuento


y la novela
El cuento es una narración en prosa, caracterizada por su brevedad y sencillez.
Suele ser un relato alejado de la realidad, aunque basado en ella. La novela es una
QDUUDFLyQH[WHQVDHVFULWDWDPELpQHQSURVDJHQHUDOPHQWHGHÀFFLyQHQODTXHVH
cuenta una o varias historias. Por la variedad de la temática, la novela puede ser
de diferentes tipos, los cuales se analizarán en el bloque VI.
Para ejercitar los conocimientos adquiridos con respecto a los subgéneros
narrativos, se te presenta la siguiente actividad.

41
Bloque II Reconoces el género narrativo

Actividad de aprendizaje 4
Lee los textos que se muestran y posteriormente realiza lo que se te solicita.

Texto A

El Chupacabras
0DUtD$GHO5tR
Un día amanecen muertas varias cabras de un
hato, sin haber sido atacadas por un depreda-
GRUFRP~Q$OGtDVLJXLHQWHUHVXOWDQPXHUWDV
otras de una granja cercana; no hay rastros
de ataque, pero se observan algunas marcas
en el pescuezo de los animales. Los próximos
días se reportan muertes de ovejas y otros
animales en los alrededores; todos parecen
GHVDQJUDGRV$OJXLHQGHFODUDKDEHUYLVWRXQDFULDWXUDH[WUDxDSRUODVFHU-
canías; alguien más sugiere que esa criatura fue capaz de desaparecer
cuando se le acercaron para examinarla y no falta quien diga que a la
misma hora que la criatura era vista en un sitio, estaba atacando animales
en otro muy distante. Cabras, ovejas, vacas, caballos, perros, gallinas y de-
más animales siguen muriendo inexplicablemente, mientras se multiplica
la aparición y desaparición de la extraña criatura que los ataca por tierra y
aire, sin que nadie y nada pueda defenderlos. En la conciencia popular ha
nacido el Chupacabras, animal o criatura sin forma, pero con indudables
propiedades de vampiro, imposible de ubicar y de atrapar, cuyos ataques
han evolucionado hasta convertirlo en una amenaza para las personas,
¿quién será su próxima víctima?, se le ubica en las noches de luna, se le
asocia con sonidos extraños y al parecer le sale fuego por los ojos, tal vez
esté asociada con espíritus malignos.

Texto B

El perro y el pedazo de carne


Esopo
Un perro que llevaba un pedazo de carne
en la boca pasaba por un río, y viendo la
FDUQH TXH OOHYDED UHÁHMDGD HQ HO DJXD
le pareció mayor que la que tenía; abrió
la boca para tomarla y se le cayó el pe-
dazo de carne, se lo llevó el río y quedó
sin el uno y sin el otro.
Siempre pierde el codicioso lo
que tiene en su poder, queriendo tomar
lo ajeno.

42
Texto C
Literatura I Bloque II

Deméter
Deméter era hermana de Zeus y, al igual que otros dioses, fue liberada del
estómago de Cronos. Esta diosa siempre se representa con una corona de
espigas y con una amapola en la mano, porque es la protectora de las co-
sechas de cereal y enseñó a los hombres el cultivo del trigo. Deméter sólo
tenía una hija, llamada Perséfone, por la que sentía un tierno cariño. Un
GtD+DGHVHOUH\GHORVLQÀHUQRVYLRDODPXFKDFKD\OHSDUHFLyWDQKHU-
mosa que cayó enamorado de ella, de modo que abrió la tierra y se la llevó.
Deméter actuó entonces como una madre desesperada y buscó
a su hija durante muchos días con sus noches. Cuando descubrió dónde
HVWDEDEDMyDORVLQÀHUQRVGHVFXLGDQGRVXVODERUHVGHGLRVDFRQORTXH
ODWLHUUDTXHGyVHFD\HVWpULOVLQÁRUHVQLIUXWRV=HXVYLRTXHORVKRPEUHV
necesitaban la cosecha y pidió a Hades que devolviera a Perséfone. Desde
entonces, la muchacha pasa ocho meses al año con su madre y la tierra
ÁRUHFHFRQDOHJUtDSHURGHEHHVWDUFXDWURPHVHVFRQ+DGHVVXPDULGR
y entonces la tierra queda yerma y sin vida, lo que los mortales llaman
invierno.

Texto D

El viejo y el mar
Ernest Hemingway (fragmento)
El viejo pescaba, solitario, en un bote en la corriente del bote
del golfo, y durante ochenta y cuatro días no había obtenido
ni un pez. En los primeros cuarenta un muchacho los había
acompañado, pero después, sus padres le dijeron que el viejo
HVWDEDFRPSOHWD\GHÀQLWLYDPHQWHVDODGRTXHHVODSHRUIRU-
ma de la mala suerte, y el muchacho acató las órdenes de ir a otro bote
que atrapó tres buenos peces en la primera semana. El muchacho se entris-
tecía al ver que el viejo llegaba cada día con el bote vacío y siempre iba a
D\XGDUOR\DIXHVHFRQORVFDUUHWHVGHFXHUGDHOJDUÀRHODUSyQRODYHOD
plegada en torno al mástil. La vela había sido parchada con cuatro costales
de harina y parecía la bandera de una derrota permanente.
El viejo era delgado y desvaído, con hondas arrugas en la nuca. En
las mejillas tenía las manchas color café del benevolente cáncer de la piel
TXHORVUHÁHMRVGHOVROSURGXFHQHQHOPDUWURSLFDO
Las manchas corrían hasta abajo por ambos lados del rostro, y
las manos tenían las cicatrices profundas que causan las cuerdas cuando
se manejan peces grandes. Pero no eran recientes, sino viejas como las
erosiones del desierto.
Todo en él era viejo a excepción de los ojos, del mismo color del
mar, alegres y sin derrotas.

43
Bloque II Reconoces el género narrativo

—Santiago —le dijo el muchacho cuando trepaban a la orilla don-


de habían dejado el bote—. Ya puedo ir contigo otra vez. Tenemos algo de
dinero.
El viejo había enseñado a pescar al muchacho y éste lo amaba.
—No —dijo el viejo—. Ya estás en un bote con suerte. Quédate ahí.
—Pero acuérdate de que una vez pasaste ochenta y siete días sin
pescar y que después durante tres semanas todos los días picaron los peces
grandes.
—Me acuerdo —dijo el viejo—. Ya sé que tú no me abandonaste
porque tuvieran dudas.
—Mi papá me hizo dejarte. Todavía estoy chico y tengo que obedecerlo.
—Ya lo sé —dijo el viejo—. Es muy normal.
—No tiene mucha fe.
—No —dijo el viejo—. Pero nosotros sí, ¿o no?
—Sí —dijo el muchacho—. Te invito una cerveza en La Terraza y
después nos llevamos las cosas.
—¿Por qué no? —dijo el viejo—. Entre pescadores.
Tomaron asiento en La Terraza, donde muchos pescadores se bur-
laban del viejo sin que él se molestara. Los más viejos lo miraban y se en-
tristecían. Pero no lo mostraban y hablaban cortésmente de las corrientes,
de las profundidades en las que había echado sus cuerdas, del buen tiempo
que no cesó y de lo que habían visto. Llegaron los pescadores que habían
tenido suerte ese día; ya había destazado los peces espada y los había lle-
vado, teniendo en dos tablones con la ayuda de dos hombres que se tam-
baleaban por el peso, a la bodega donde un camión refrigerado los llevaría
al mercado de La Habana. Los que habían pescado tiburones los habían
llevado a la planta tiburonera, en el otro lado de la ensenada, donde los
alzaban en el aparejo de poleas, les extraían los hígados, les cortaban las
aletas, los desollaban y rebanaban la carne en tiras para salarlas.
Cuando el viento venía del este de la planta tiburonera, a través
de la bahía llegaba un hedor, pero en esa ocasión sólo había un leve olor,
pues el viento había retrocedido al norte y después se aquietó, así es que
estaba soleado y agradable en La Terraza.
—Santiago —dijo el muchacho.
—Sí —respondió el viejo. Sostenía un vaso en las manos y pensaba
en muchos años antes.
—¿Puedo ir a traerte las sardinas de mañana?
—No. Vete a jugar béisbol. Yo todavía puedo remar y Rogelio ti-
rará la red.
—Quisiera ir. Si no puedo pescar contigo me gustaría ayudarte de
alguna manera.
—Ya me invitaste una cerveza —dijo el viejo—. Ya eres un hombre.

44
Literatura I Bloque II
—¿Cuántos años tenía yo cuando me llevaste por primera vez a pescar?
—Cinco, y casi te mueres porque metí un pescado muy vivo que
casi nos destroza el bote. ¿Te acuerdas?
—Me acuerdo de que la cola golpeaba y latigueaba, que el barco
se rompió y el ruido de los macanazos. Recuerdo que me aventaste a la
proa donde estaban los carretes mojados y yo sentía que el bote temblaba,
te oía dándole de palos al pescado como si cortaras un árbol y el olor dulce
de la sangre me llenó.
—¿De veras te acuerdas de todo eso, o yo te lo conté?
—Recuerdo todo desde que anduvimos juntos.
(OYLHMRPLUyDOPXFKDFKRFRQVXVRMRVDPDEOHVFRQÀDGRVTXH-
mados por el sol.
—Si fueras mi hijo te llevaría, me arriesgaría —dijo—. Pero tienes
tu padre y tu madre, y estás en un bote con suerte…

Teniendo como referencia la lectura de los textos anteriores, llena el


VLJXLHQWHUHFXDGURFRQORVGDWRVHVSHFLÀFDGRV

Subgénero que
Título del texto Argumenta tu respuesta
representa

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7H[WR$BBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7H[WR%BBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7H[WR&BBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7H[WR'BBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB

45
Bloque II Reconoces el género narrativo

Síntesis
En este bloque se analizó todo lo referente al género épico narrativo. Se deter-
minó que es un relato de historias con situaciones reales o fantásticas, en el cual
los personajes adquieren una diversidad de formas que van desde objetos con
características humanas, hasta seres sobrenaturales con poderes dominantes. Una
característica única de este género es el empleo de un narrador que le da fuerza y
realidad a la historia, éste puede ser extradiegético (omnisciente), intradiegético,
o autodiegético, dependiendo de la participación del narrador en el relato de la
historia. La historia misma se desarrolla en una secuencia lógica pasando por la
situación inicial, ruptura del equilibrio y aterriza con el desenlace, el cual puede
VHUIHOL]RWUiJLFRHOÀQDOGHSHQGHUiGHODVDFWXDFLRQHVGHORVSHUVRQDMHVSURWD-
gónicos, secundarios y antagónicos.
El autor de la obra, al momento de estar redactando la historia, toma
como referencia acontecimientos históricos propios de su época, evoca situaciones
que marcaron a la sociedad disfrazando los hechos para hacerlos más ricos en su
producción.
/RVHVSDFLRVHVFHQRJUiÀFRVGHVHPSDxDQXQSDSHOGHVXPDLPSRUWDQFLD
PDQLÀHVWDQODVFRQGLFLRQHVItVLFDVHQODVTXHVHGHVDUUROODQODVDFFLRQHVGHORVSHU-
sonajes, ubican al lector con respecto al contexto social que envuelve la historia.
Los subgéneros narrativos más importantes son la fábula, la epopeya,
OH\HQGDPLWRFXHQWR\QRYHOD/RVFXDWURSULPHURVFODVLÀFDGRVFRPRVXEJpQHURV
menores y los dos últimos como mayores. La temática y la forma, como se aborda
en cada relato, determinan el tipo de narración seleccionada por el autor.
Organicen grupos pequeños, reúnanse después de clase y seleccionen una
KLVWRULD$OÀQDOL]DUODOHFWXUDGHOWH[WRHVFULEDQHQKRMDVEODQFDVHOWtWXORGHOD
obra y el argumento correspondiente, al llegar al salón peguen sus trabajos y anali-
FHQODWDUHDGHORVRWURVJUXSRVLGHQWLÀTXHQHOVXEJpQHUR\HQSOHQDULDFRPHQWHQ
sus observaciones.

Actividad integradora
$ FRQWLQXDFLyQ VH PXHVWUDQ GLIHUHQWHV HVTXHPDV (Q ORV UHFXDGURV EDVH VH KDQ
DQH[DGRWtWXORVGHQDUUDFLRQHVLQYHVWLJDTXLpQHVHODXWRUFODVLÀFDHOVXEJpQHUR
TXHUHSUHVHQWD\GHDFXHUGRFRQODFODVLÀFDFLyQLGHQWLÀFDVLHVPD\RURPHQRU
Escribe los elementos del género narrativo en los espacios correspondientes.
1. Recuadro base:
Subgénero narrativo
Autor: ___________________________
Título: “La cierva
y la viña” Subgénero M o M
___________________________

Elementos del género narrativo


1. Narrador: BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
2. Personajes:BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3. Tiempo y espacio:BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
46
Literatura I
Elementos estructurales
Bloque II

1) Situación inicial:

2) Ruptura del equilibrio:

3) RHVROXFLyQGHOFRQÁLFWR

 Recuadro base:


Subgénero narrativo
Autor: ___________________________
Título: “El nuevo traje
del emperador”
Subgénero M o M
___________________________

Elementos del género narrativo


1) Narrador:

2) Personajes:

47
Bloque II Reconoces el género narrativo

3) Tiempo y espacio:

Elementos estructurales
1) Situación inicial:

2) Ruptura del equilibrio:

3) RHVROXFLyQGHOFRQÁLFWR

3. Recuadro base:
Subgénero narrativo
Autor: ___________________________
Título: “La cierva
y la viña” Subgénero M o M
___________________________

Elementos del género narrativo


1) Narrador:

48
2)
Literatura I
Personajes:
Bloque II

3) Tiempo y espacio:

Elementos estructurales
1) Situación inicial:

2) Ruptura del equilibrio:

3) 5HVROXFLyQGHOFRQÁLFWR

Realimentación
$QDOL]DWXVLWXDFLyQGHDSUHQGL]DMH\XELFDWXVVDEHUHVHQHOVLJXLHQWHUHFXDGUR
Señala la columna correspondiente a tus logros alcanzados.

Saberes Sí No

,GHQWLÀFRORVSHUVRQDMHVHOQDUUDGRUHVSDFLRV

Diferencio los elementos estructurales


&ODVLÀFRWH[WRVHQORVVXEJpQHURVQDUUDWLYRV
Explico los contextos de cada obra

En caso de no haber alcanzado el nivel estratégico, es recomendable


TXHHODERUHVXQDELWiFRUDHQODTXHHVSHFLÀTXHVWXVDOFDQFHV\OLPLWDFLRQHVFRQ
respecto a la competencia de este bloque. Cuando esté lista, acude a tu profesor
para recibir asesorías que te impulsen a llegar al nivel estratégico.

49
Bloque II Reconoces el género narrativo

Evaluación de la competencia
3DUDFHUUDUHOEORTXH,,HLQLFLDUHOVLJXLHQWHHVQHFHVDULRLGHQWLÀFDUHOQLYHODGTXL-
rido en éste. El siguiente recuadro contiene los criterios establecidos en ambas
sesiones, analízalo y lleva a cabo la autoevaluación.

Pre-formal Inicial-receptivo Resolutivo básico Autónomo Estratégico


Criterio
    

Estoy en
,GHQWLÀFR 3XHGRLGHQWLÀFDU
Poseo ideas básicas condiciones de
el origen 1RLGHQWLÀFR el origen
Tengo nociones sobre el origen del argumentar el
del género el origen del género
sobre el origen del género narrativo origen del género
narrativo como del género narrativo como
género narrativo. como antecedente narrativo como
antecedente narrativo. antecedente
histórico. antecedente
histórico. histórico.
histórico.

Reconozco,
Con apoyo
Reconozco, en No reconozco, sin apoyo del
Reconozco del material $UJXPHQWR\
un texto, las en un texto, las material, en
vagamente las ELEOLRJUiÀFR reconozco las
características características un texto, las
características del reconozco las características del
del género del género características
género narrativo. características del género narrativo.
narrativo. narrativo. del género
género narrativo.
narrativo.
Muestro
Reconozco la
disposición Muestro
importancia y
para redactar No muestro disposición para
Muestro poca poseo la habilidad
un texto breve disposición para Muestro cierta redactar un
disposición para de redactar
en el que redactar un disposición para texto breve en
redactar un texto textos breves en
incluyo un tipo texto breve, ni redactar un texto el que incluyo un
breve en el que el que incluyo un
HVSHFtÀFRGH mucho menos breve, pero me es WLSRHVSHFtÀFR
incluyo un tipo WLSRHVSHFtÀFR
narrador, para incluir un tipo difícil incluir un de narrador,
HVSHFtÀFRGH de narrador,
apreciar las HVSHFtÀFRGH tipo de narrador. para apreciar las
narrador. para apreciar las
características narrador. características
características de
de la de la narración.
la narración.
narración.
Estoy en
Reconozco los condiciones
Reconozco Reconozco de
subgéneros No reconozco Soy capaz de de reconocer,
levemente los forma general
narrativos así los subgéneros reconocer los en cualquier
subgéneros los subgéneros
como algunas narrativos ni subgéneros contexto, los
narrativos y narrativos y
características mucho menos sus narrativos y sus subgéneros
algunas de sus algunas de sus
básicas de características. características. narrativos y sus
características. características.
cada uno. características
básicas.
Tengo algunas Fuera del contexto
,GHQWLÀFRFDGD ,GHQWLÀFRFDGD
1RLGHQWLÀFR nociones para He comenzado HVFRODULGHQWLÀFR
uno de los uno de los
los subgéneros realizar la DLGHQWLÀFDUORV con certeza
subgéneros subgéneros
narrativos en LGHQWLÀFDFLyQGH géneros narrativos cada uno de
narrativos en narrativos en
una serie de géneros narrativos en una serie de los subgéneros
una serie de una serie de
textos. en una serie de textos. narrativos en una
textos. textos.
textos. serie de textos.

50
Literatura I Bloque II

Ernest Hemingway

51
Bloque III:

Reconoces
las diferencias
entre la fábula
y la epopeya
Desempeños del estudiante:
‡ Reconoce el origen y desarrollo de la fábula y la epopeya señalando sus
características.
‡ ,GHQWLÀFDODVGLIHUHQFLDVHVWUXFWXUDOHVHQWUHODIiEXOD\ODHSRSH\D
‡ ,GHQWLÀFDODVGLIHUHQFLDVOLQJtVWLFDVHQWUHODIiEXOD\ODHSRSH\D
‡ Produce textos siguiendo los aspectos textuales de la fábula y la epopeya.

Objetos de aprendizaje:
‡ Fábula
‡ Epopeya
‡ Diferencias estructurales entre la fábula y la epopeya
‡ Diferencias lingüísticas entre la fábula y la epopeya

Competencias a desarrollar:
‡ Es sensible al arte y participa en la apreciación e interpretación de sus
expresiones en distintos géneros.
‡ Participa y colabora de manera efectiva en equipos diversos.
‡ Mantiene una actitud respetuosa hacia la interculturalidad y la diversi-
dad de creencias, valores, ideas y prácticas sociales.
‡ ,GHQWLÀFDRUGHQDHLQWHUSUHWDODVLGHDVGDWRV\FRQFHSWRVH[SOtFLWRVH
implícitos en un texto, considerando el contexto en el que se generó y
en el que se recibe.
‡ Evalúa un texto mediante la comparación de un contenido con el de
otros, en función de sus conocimientos previos y nuevos.
‡ Produce textos con base en el uso normativo de la lengua, considerando
la intención y situación comunicativa.
‡ Expresa ideas y conceptos en composiciones coherentes y creativas, con
introducciones, desarrollo y conclusiones claras.
‡ Valora y describe el papel del arte, la literatura y los medios de comu-
nicación en la recreación o la transformación de una cultura, teniendo
en cuenta los propósitos comunicativos de distintos géneros.
Bloque III Reconoces las diferencias entre la fábula y la epopeya

Dinamización
¿Tienes algún amigo que se entretenga observando la naturaleza? Tú mismo segura-
mente te has distraído alguna vez y te ha llamado la atención la forma de sobrevivir
GHDOJ~QDQLPDORLQVHFWR¢+DVYLVWR´$QLPDO3ODQHWDO([WUHPRµ"£4XpLQWHUHVDQWH
La vida de los seres vivos es muy atractiva para conocer, descubres información
que te sorprende, es por eso que muchos animales son usados como personajes en
películas, libros, obras literarias. Para demostrar esto se presenta a continuación
un relato de una joven interesada en la naturaleza. Léelo con atención.

Mariana y la hormiga
María de la Cruz Pech Puc
Mariana es una joven muy soñadora, se distrae con facilidad cuando
ve algún animal en el piso o en la ventana de su casa o escuela. Se
imagina la vida de ese ser vivo como si fuera un ser humano: qué
hace, en qué se divierte, quiénes son sus amigos, cuáles serían sus
travesuras, sus aventuras y los aprendizajes que puede obtener de
cada acción que realiza.
Gracias a esta gran imaginación Mariana crea grandes his-
torias, haciendo a los animales los personajes principales de cada
una. Un día al observar a una hormiga, se imaginó lo siguiente:
La hormiga
Una hormiga muy trabajadora,
día y noche sin cesar,
pasaba sol y lluvia,
todo con tal de almacenar
rica comida, para el invierno aguardar.
Era tanta su preocupación
de que el alimento no pudiera alcanzar,
que en un descuido, de tanta tensión,
al fondo de un hoyo fue a dar
y unas manitas tiernas
sin querer la fue a enterrar,
por jugar distraídas,
en ese mismo lugar.
Moraleja: El trabajo un placer debe ser, para evitar obsesión por él.

Con base en el texto anterior y a tu experiencia de vida, contesta las


siguientes preguntas.
1) 'H DFXHUGR FRQ WX FULWHULR ¢HO WUDEDMR HV EXHQR R PDOR" -XVWLÀFD WX
respuesta.

54
2)
Literatura I
¿Qué problemas puede tener una persona que trabaja en exceso?
Bloque III

Como habrás observado, el texto anterior evidencia una situación re-


ÁH[LYDGRQGHORVSHUVRQDMHVVRQDQLPDOHVTXHUHDOL]DQDFFLRQHVRVHHQIUHQWDQD
situaciones comúnmente humanas, las cuales permiten tomar conciencia de nues-
tros actos positivos o negativos, incluso de nuestra relación con las personas que
nos rodean.
En muchas ocasiones nuestros padres nos insisten en pensar antes de
actuar, pero la edad, el ambiente que nos rodea, las personas que frecuentamos y
la vida tan acelerada que nos tocó vivir, no nos conceden detenernos a pensar al
ÀQDOGHOGtDVLKLFLPRVELHQRPDOVLGDxDPRVDDOJXLHQRQRVLORKLFLPRVIHOL]
Es por eso que a lo largo de la historia de la Literatura han existido dife-
rentes autores que tratan de enseñarnos de manera más divertida cómo debemos
meditar sobre lo que hacemos o simplemente nos relatan los actos heroicos de
otras personas importantes en la historia de la humanidad, de quienes podemos
seguir su ejemplo; todo a través de las fábulas y las epopeyas.
$VLPLVPRORVWH[WRVOLWHUDULRVWLHQHQPXFKDUHODFLyQFRQQXHVWUDVYLYHQ-
FLDVFRWLGLDQDVDOUHÁHMDUVLWXDFLRQHVTXHFRQVFLHQWHRLQFRQVFLHQWHPHQWHSURSL-
ciamos a nuestro alrededor, ya sea con los amigos, conocidos y, por qué no decirlo,
con nosotros mismos. Debemos aprender a reconsiderar las cosas que nos suceden
para determinar bajo qué circunstancias se presentan y así tomar decisiones co-
rrectas sobre las consecuencias de nuestros actos. En este bloque conoceremos los
subgéneros narrativos fábula y epopeya para ayudarnos a generar esta conciencia
de la que hablamos.

Sesión A: Evolución y
características de la fábula
Proyecto: Redactar una fábula tomando en consideración sus características y
estructura, distinguiendo problemas de la sociedad actual.

Criterios
‡ Reconozco el origen, la evolución y las características de la fábula en
textos modelo.
‡ Integro los elementos del análisis literario al realizar la redacción de
una fábula.
‡ Respeto los comentarios expresados por mis compañeros al mostrar sus
opiniones en sus intervenciones en clase.

Problematización
(VFULEDQXQFRPHQWDULRDFHUFDGHODVVLJXLHQWHVIUDVHV$QDOLFHQTXpUHODFLyQWLH-
QHQFRQVXYLGDRODGHDOJ~QFRQRFLGR\SURFXUHQHMHPSOLÀFDUODVLWXDFLyQUHDO
donde vean expresadas las condiciones descritas en cada una.

55
Bloque III Reconoces las diferencias entre la fábula y la epopeya

1) En boca del mentiroso, hasta la verdad se hace dudosa.

2) Lo que es diversión para algunos, puede ser tristeza para otros.

Muchas veces nuestros actos son analizados posteriormente a su ejecu-


ción o cuando vemos la desgracia en otro, lo que provoca que no tomemos con-
ciencia real, porque no nos sucede directamente. Sin embargo, la fábula nos da
OD RSRUWXQLGDG GH UHÁH[LRQDU VREUH ODV FRQVHFXHQFLDV SRVLWLYDV R QHJDWLYDV TXH
pueden ocasionar nuestras acciones antes de realizarlas, al proporcionarnos una
enseñanza implícita o expresa en su moraleja.
$FRQWLQXDFLyQVHWHSUHVHQWDXQDIiEXODDQDOt]DODFRQODLQWHQFLyQGH
GHWHFWDUHQHOODORVYDORUHVRGHIHFWRVKXPDQRVTXHUHÁHMDQORVSHUVRQDMHV\VX
moraleja.

El zagal y las ovejas


Félix María de Samaniego
$SDFHQWDQGRXQMRYHQVXJDQDGR
gritó desde la cima de un collado:
´£)DYRUTXHYLHQHHOORERODEUDGRUHVµ
eVWRVDEDQGRQDQGRVXVODERUHV
acuden prontamente,
y hallan que es una chanza solamente.
Vuelve a clamar, y temen la desgracia;
VHJXQGDYH]ORVEXUOD£/LQGDJUDFLD
Pero ¿qué sucedió la vez tercera?
4XHYLQRHQUHDOLGDGODKDPEULHQWDÀHUD
Entonces el Zagal se desgañita,
y por más que patea, llora y grita,
no se mueve la gente escarmentada,
y el lobo le devora la manada.
¡Cuántas veces resulta de un engaño,
FRQWUDHOHQJDxDGRUHOPD\RUGDxR

56
Literatura I
Responde las siguientes preguntas con base en la fábula de Samaniego.
Bloque III
1) ¢$OJXQDYH]KDVXWLOL]DGRPHQWLUDVFRPRKHUUDPLHQWDSDUDMXVWLÀFDUWXV
errores?

2) Las personas, al descubrir tus mentiras, ¿siguen creyendo en lo que


dices? ¿Por qué?

3) ¿Qué consecuencias ha traído esta situación en tu vida?

4) ¿Consideras que la fábula tiene relación con algún momento en tu vida?

5) ¢&UHHVTXHHOSDVWRUPHUHFtDVHULJQRUDGRSRUORVODEUDGRUHV"-XVWLÀFD
tu respuesta.

Desarrollo de saberes
Desde muy pequeño escuchabas con atención las historias que te contaba tu maes-
tra o tu mamá, quizá tu abuelita. Cuando somos niños es más fácil aprender con
relatos de personajes fantásticos, debido a la concreción de nuestro pensamiento.
Sin embargo, podemos aprender a cualquier edad de la misma forma, siempre
\ FXDQGR YHDPRV UHÁHMDGD QXHVWUD YLGD HQ HVH UHODWR /D IiEXOD SXHGH VHU XQ
excelente medio de aprendizaje, sobre todo divertido, para tener una conducta
moralmente correcta.
En esta sesión conocerás la fábula y sus componentes, sus orígenes, su
evolución y sus características. Pero seguramente ya has escuchado o leído alguna,
tal vez te han contado la historia de la tortuga y la liebre, del perro de las dos tortas

57
Bloque III Reconoces las diferencias entre la fábula y la epopeya

´(OSHUUR\HOUHÁHMRHQHOUtRµ HWFpWHUD3ODWLFDFRQWXVFRPSDxHURVFXiOHVVRQ
las fábulas que conocen y cuéntenlas a su maestro. Te sorprenderás de lo bien
informados que todos están.
Para empezar de lleno en la materia, realiza la siguiente actividad.
Reúnete con otros compañeros y trabajen en equipos.

Origen y desarrollo de la fábula


Las primeras fábulas fueron escritas en Oriente, donde se rendía culto tanto
a animales como a elementos naturales, por eso no es difícil imaginar la exis-
tencia de relatos donde los animales son protagonistas. Tiempo después, Esopo
y Fedro retoman este subgénero y lo utilizan para representar los vicios de la
sociedad de su tiempo. Esos defectos son considerados en las acciones de este
tipo de relato, usando consejos o moralejas.
$ SDUWLU GH OD pSRFD 1HRFOiVLFD VLHPSUH FRQ LQWHQFLyQ GLGiFWLFD ORV
fabulistas muestran predilección por la razón y no por los sentimientos, vuelven
la mirada hacia lo clásico y consideran el aprendizaje como lo más importante.
$XQTXH(VRSRHV
para muchos el inicia- Debido a eso, la fábula toma un gran auge y fue uno de los géneros preferidos en
dor de las fábulas, no esos tiempos.
todos los textos que
se consideran suyos Recientemente, en el siglo XX, con las fábulas de Monterroso vuelve a
lo son, debido a surgir la enseñanza como una necesidad, debido a los cambios sociales que la épo-
que muchos escri- ca trae consigo. En consecuencia este subgénero fue usado como recurso didáctico
WRVQRHVSHFLÀFDQ
su origen.
por excelencia, solamente que la estructura de la moraleja cambia, muestra la
interacción de antivalores, enfatiza más los vicios y defectos humanos.

Características estructurales
Los textos literarios tienen características particulares que los diferencian de otro
tipo de textos. En este caso la fábula también posee ciertas propiedades que la dis-
tinguen de otros subgéneros literarios menores. Dentro de estas cualidades distin-
tivas se pueden encontrar: la estructura, sus personajes, el narrador, el espacio, el
WLHPSRDVtFRPRODVÀJXUDVGHOHQJXDMHDUWtVWLFRPiVFRPXQHV\HOWLSRGHIiEXOD
al que pertenece, según la época en la que fue escrita. Veamos:
Tácito: El mensaje   Estructura: anécdota y moraleja. La fábula es un relato basado en un
se entiende sin hecho breve (anécdota) que representa un problema humano, presen-
necesidad de ser tado de manera chusca. Dicho problema se resuelve a través de un
mencionado.
consejo (moraleja) cuya naturaleza radica en una enseñanza moral, la
cual puede ser expresa o tácita, dependiendo del estilo del fabulista. La
moraleja y los personajes están estrechamente ligados. Una moraleja
se deduce de las acciones de los personajes, según su comportamiento
moral derivado de la anécdota que se narra.
  Personajes. Por ser un relato breve y sencillo, la fábula sólo necesita de
dos a tres personajes para mostrar su enseñanza. Los personajes suelen
ser, como ya se dijo anteriormente, animales u objetos que adquieren
características humanas, según las intenciones del autor.
  Narrador extradiegético-omnisciente. En el caso de la fábula el narra-
dor no forma parte de la historia (extradiegético). Su conocimiento so-

58
Literatura I
bre los personajes y sus acciones es total (omnisciente), debido a que
Bloque III
conoce a la perfección los sentimientos y pensamientos de los mismos.
  Espacio. En las fábulas los espacios dependen de las acciones de los
personajes. Generalmente son lugares cotidianos donde los seres huma-
nos se desenvuelven normalmente o espacios propios del hábitat de los
animales y sus relaciones naturales. Entonces, los espacios pueden ser
la selva, el bosque, el campo y lugares domésticos como la cocina, el
establo, etcétera, donde animales y seres humanos conviven.
  Tiempo. Indica el momento en que se lleva a cabo la acción (mañana,
tarde, noche). En la fábula se lleva a cabo de manera lineal o cronoló-
gica, es decir, la secuencia de las acciones tiene un orden en el tiempo:
LQLFLR GHVDUUROOR ÀQ FRQ OD LQWHQFLyQ GH PRVWUDU OD UHODFLyQ FDXVD
efecto de los acontecimientos.
  Lenguaje artístico. Como ya se había estudiado en el bloque I, se sabe
TXH HO OHQJXDMH DUWtVWLFR VRQ ODV ÀJXUDV UHWyULFDV TXH OH GDQ EHOOH]D
DO WH[WR (Q OD IiEXOD ODV ÀJXUDV PiV FRPXQHV VRQ ORV HStWHWRV \ ODV
comparaciones; no obstante, existen otras que son inherentes a sus pro-
piedades, como la prosopopeya y la hipérbole, las cuales ayudan a la
fábula dando cualidades humanas a los animales u objetos y a exagerar
ciertas virtudes en dichos personajes. Observa los siguientes ejemplos:

D  (StWHWRVKDPEULHQWDÀHUD£/LQGD*UDFLD
E  Símil o comparación: Eres arrojado como toro novel.
F  Hipérbole: El animal era tan bravo, que jamás ladrón alguno se atre-
vió a escalar la cerca de los sembrados.
G  Prosopopeya: El buey, reprochando su equivocada conducta, le dijo:
El Panchatantra,
—Eres un tonto, perro envidioso. Ni comes ni dejas comer. una de las coleccio-
nes más antiguas,

Tipos de fábula
incluye algunas
de las primeras
fábulas.

Como leíste en los orígenes de la fábula, según el momento histórico y el apogeo


GHODIiEXODDVtFRPRVXHVWLOR\HVWUXFWXUDSRGHPRVFODVLÀFDUHVWHVXEJpQHUR
narrativo en varios tipos: Clásica, Neoclásica y Contemporánea. Las fábulas clási-
casVRQDTXHOODVHVFULWDVHQOD$QWLJHGDGVLJXLHQGROtQHDVJULHJDV\URPDQDV/RV
autores más sobresalientes fueron: Esopo y Fedro. La importancia de Esopo en este
grupo se debe a que fue modelo de fabulistas posteriores y porque crea prototipos
conductuales como el zorro, el cuervo y las ranas.
Con el correr del tiempo surge la fábula neoclásica. Este tipo se enfoca
en la razón, haciendo a un lado los sentimientos. Trata de seguir las reglas o idea-
les clásicos, pero con mayor frialdad. Los autores más sobresalientes son: Tomás de
Iriarte, Félix María de Samaniego, Fernández de Lizardi, La Fontaine.
$ÀQDOHVGHOVLJOR;,;\SULQFLSLRVGHOVLJOR;;VHGHVDUUROODRWURHVWLOR
uno más actual, usando ahora la ironía y la burla, además de la línea clásica. Esa
modalidad se llama contemporánea.$XJXVWR0RQWHUURVRHVHOUHSUHVHQWDQWHSRU
excelencia de la época.
El siguiente cuadro muestra un ejemplo de cada tipo de fábula. Observa
con atención cada una. Discutan en clase cuál es la enseñanza moral que dejan y
la situación social expuesta en la anécdota.
59
Bloque III Reconoces las diferencias entre la fábula y la epopeya

Tipo Ejemplo

El perro del labrador


Esopo
Un labriego tenía un enorme perro como guardián de sus extensos cultivos. El animal
era tan bravo que jamás ladrón alguno se atrevió a escalar la cerca de los sembrados.
El amo, cuidadoso de su can, lo alimentaba lo mejor que podía, y el perro,
Clásica
para mostrar su agradecimiento, redoblaba el cuidado de los campos. Cierto día, el
buey del establo quiso probar un bocado de la alfalfa que su amo le guardaba, pero
el perro, poniéndose furioso y enseñándole los dientes, trató de ahuyentarlo. El buey,
reprochando su equivocada conducta, le dijo: —Eres un tonto, perro envidioso. Ni
comes ni dejas comer. Y añadió: —Si el amo destina a cada cual lo que le aprovecha y
la alfalfa es mi alimento, no veo que tengas razón para inmiscuirte en negocio ajeno.
Moraleja: agua que no has de beber, amigo, déjala correr.

El asno y el cochino
Félix María de Samaniego
(QYLGLDQGRODVXHUWHGHO&RFKLQRXQ$VQRPDOGHFtDVXGHVWLQR´<RGHFtDWUDEDMR\
Neoclásica como paja; él come harina, berza, y no trabaja: a mí me dan de palos cada día; a él
le rascan y halagan a porfía”.
$VtVHODPHQWDEDGHVXVXHUWHSHUROXHJRTXHDGYLHUWHTXHDODSRFLOJDDO-
guna gente avanza en guisa de matanza, armada de cuchillo y de caldera, y que con
PDxDÀHUDGDQDOJRUGR&RFKLQRÀQVDQJULHQWRGLMRHQWUHVtHOMXPHQWR6LHQHVWR
para el ocio y los regalos, al trabajo me atengo y a los palos.

La rana que quería ser una rana auténtica


Augusto Monterroso
Había una vez una Rana que quería ser auténtica, y todos los días se esforzaba en ello.
$OSULQFLSLRVHFRPSUyXQHVSHMRHQHOTXHVHPLUDEDODUJDPHQWHEXVFDQGRVXDQVLDGD
autenticidad.
Unas veces parecía encontrarla y otras no, según el humor de ese día o de la
hora, hasta que se cansó de esto y guardó el espejo en un baúl.

Contemporánea 3RUÀQSDUHFLyTXHOD~QLFDIRUPDGHFRQRFHUVXSURSLRYDORUHVWDEDHQOD
opinión de la gente y comenzó a peinarse y a vestirse y a desvestirse (cuando no le
quedaba otro recurso) para saber si los demás la aprobaban y reconocían que era una
Rana auténtica.
Un día observó que lo que más admiraban de ella era su cuerpo, especial-
mente sus piernas, de manera que se dedicó a hacer sentadillas y a saltar para tener
unas ancas cada vez mejores, y sentía que todos le aplaudían.
Y así seguía haciendo esfuerzos hasta que, dispuesta a cualquier cosa para
lograr que la consideraran una Rana auténtica, se dejaba arrancar las ancas, y los
otros se las comían, y ella todavía alcanzaba a oír con amargura cuando decían que
qué buena Rana que parecía Pollo.

60
Literatura I Bloque III
Los contextos
Cuando se trata de analizar una obra literaria de cualquier género, es indispensa-
ble conocer lo que rodea la obra y al autor de la obra. Los elementos contextuales
e intertextuales son fundamentales para recibir el mensaje que el escritor literario
quiere enviarnos. Los primeros se relacionan con las circunstancias al momento de
escribir y de leer la obra (contextos de producción y de recepción); en segundo
OXJDUFRQODHVWUXFWXUD\ORFRQFHUQLHQWHDOWH[WRFRPRWDO HVWUXFWXUD $VtORV
contextos se vuelven necesarios cuando se lee un texto literario. Si se habla de
contexto de producción, es obligatorio conocer acerca de la vida y de la época
en la cual vivió el artista, es decir, el entorno personal, social e histórico que
lo enmarca, toda la información relacionada con al autor del texto literario; en
cambio, el contexto de recepción sirve para involucrar al lector con la obra. Las
experiencias personales, los momentos históricos que vive, la educación recibida,
la personalidad, impactan directamente en la recepción del mensaje literario.

Actividad de aprendizaje 1
$QDOLFHPRVDOJXQDVIiEXODV5HFXHUGDTXHXQDQiOLVLVGHEHLQFOXLUDVSHFWRVHVWUXF-
turales y contextuales. Para lograrlo, realiza la siguiente actividad.
Lee las siguientes fábulas y contesta las preguntas:

Texto 1

La mochila
Jean de la Fontaine
Cuentan que Júpiter, antiguo dios de los romanos, con-
vocó un día a todos los animales de la tierra.
Cuando se presentaron les preguntó, uno por
uno, si creían tener algún defecto. De ser así, él pro-
metía mejorarlos hasta dejarlos satisfechos.
—¿Qué dices tú, la mona? —preguntó.
—¿Me habla a mí? —saltó la mona—. ¿Yo, de-
fectos? Me miré en el espejo y me vi espléndida. En
FDPELRHORVR¢VHÀMy"£1RWLHQHFLQWXUD
—Que hable el oso —pidió Júpiter.
³$TXtHVWR\³GLMRHORVR³FRQHVWHFXHUSRSHUIHFWRTXHPHGLR
ODQDWXUDOH]D£6XHUWHQRVHUXQDPROHFRPRHOHOHIDQWH
—Que se presente el elefante...
—Francamente, señor —dijo aquél—, no tengo de qué quejarme,
DXQTXHQRWRGRVSXHGDQGHFLUORPLVPR$KtORWLHQHDODYHVWUX]FRQHVDV
orejitas ridículas...
—Que pase el avestruz.
³3RUPtQRVHPROHVWH³GLMRHODYH³£6R\WDQSURSRUFLRQDGR(Q
cambio la jirafa, con ese cuello...

61
Bloque III Reconoces las diferencias entre la fábula y la epopeya

Júpiter hizo pasar a la jirafa quien, a su vez, dijo que los dioses
habían sido generosos con ella.
—Gracias a mi altura veo los paisajes de la tierra y el cielo, no
como la tortuga que sólo ve los cascotes.
La tortuga, por su parte, dijo tener un físico excepcional.
—Mi caparazón es un refugio ideal. Cuando pienso en la víbora,
que tiene que vivir a la intemperie...
—Que pase la víbora —dijo Júpiter algo fatigado.
Llegó arrastrándose y habló con lengua viperina:
—Por suerte soy lisita, no como el sapo que está lleno de verrugas.
³£%DVWD ³H[FODPy -~SLWHU³ 6yOR IDOWD TXH XQ DQLPDO FLHJR
como el topo critique los ojos del águila.
—Precisamente —empezó el topo—, quería decir dos palabras: el
águila tiene buena vista pero, ¿no es horrible su cogote pelado?
³£(VWR HV HO FROPR ³GLMR -~SLWHU GDQGR SRU WHUPLQDGD OD
reunión—. Todos se creen perfectos y piensan que los que deben cambiar
son los otros.
Suele ocurrir.
Sólo tenemos ojos para los defectos ajenos y llevamos los propios
bien ocultos en una mochila, a la espalda.

Texto 2

Los jóvenes y las ranas


Esopo
Varios jóvenes, jugando cerca de un estanque, vieron un
grupo de ranas en el agua y comenzaron a apedrearlas.
Habían matado a varias, cuando una de las
ranas, sacando su cabeza gritó:
—Por favor, paren muchachos, que lo que es
diversión para ustedes, es muerte y tristeza para no-
sotras.

1) ([SOLFDFyPRVHSXHGHLGHQWLÀFDUHOWLHPSRHQHVWDVIiEXODV

62
2)
Literatura I
Escribe en las líneas un epíteto y una comparación que encuentres en
Bloque III
alguna de las fábulas.
a. Epíteto:

b. Comparación:

3) ,GHQWLÀFDORVHVSDFLRVHQORVFXDOHVVHGHVDUUROODQODVDFFLRQHVGHODV
fábulas.
a. “La mochila”:

b. “Los jóvenes y las ranas”:

4) ¿Qué enseñanza te dejan las moralejas? Explica cómo podrás aplicarlo


en tu vida.

5) Investiga la biografía de los dos autores de las fábulas anteriores y anó-


talos en tu libreta como parte complementaria del análisis, considerando
que el contexto de producción es importante para la comprensión del
texto.
Después de realizar este análisis, seguramente ya estás listo para crear
tu propia fábula. Sé un artista y muestra de lo que eres capaz en la expresión de
tu interioridad, en relación con el momento social e histórico que vives. Sigue las
instrucciones que se plantean en la siguiente actividad.

Actividad de aprendizaje 2
En equipos, tomen como base el proyecto planteado al inicio de la sesión y redacten
una fábula, considerando los siguientes elementos:
1) /DDQpFGRWDGHEHUHODWDUXQDVLWXDFLyQTXHUHÁHMHXQSUREOHPDTXHOH
suceda o pueda suceder a cualquier persona que te rodea.
2) Los personajes deben ser tres. Pueden ser objetos, animales o insectos.
3) El espacio es un salón de clase.
4) 6HFODVLÀFDUiFRPRFRQWHPSRUiQHD
5) La moraleja debe ser explícita.
6) Recuerda que la fábula es una narración breve y graciosa.
7) 8VHQGLIHUHQWHVWLSRVGHÀJXUDVHQHOOHQJXDMHDUWtVWLFR
8) Ilústrenla con dibujos o recortes.

63
Bloque III Reconoces las diferencias entre la fábula y la epopeya

Síntesis
Para reforzar lo aprendido en esta sesión, busca fábulas y completa el siguiente
cuadro. Para obtener un aprendizaje duradero, selecciona textos que te sean pla-
centeros.

Nombres de fábulas con Características de los Aplicación en la vida


Moraleja
sus respectivos autores personajes cotidiana

En resumen, para diferenciar las fábulas de otros subgéneros literarios es


importante determinar sus características más sobresalientes, de las cuales hemos
hablado a lo largo de esta sesión.

‡ 5HÁHMDXQFRQWHQLGRPRUDOPRVWUDQGRYDORUHV\GHIHFWRVKXPDQRV
en los personajes, empleando una moraleja
‡ Texto breve
‡ Sus personajes son animales humanizados
‡ 5HÁHMDVLWXDFLRQHVUHDOHVFRQEDVHHQODVYLYHQFLDVFRWLGLDQDV
‡ Usa, de manera graciosa, un enfoque para resaltar las cuestiones
conductuales planteadas en la anécdota

Sesión B: Evolución y
características de la
epopeya
Proyecto:,GHQWLÀFDUODVFDUDFWHUtVWLFDV\FODVLÀFDFLyQGHODHSRSH\DHQHODQi-
lisis de obras literarias, estableciendo diferencias con la fábula.

Criterios:
‡ Reconozco la evolución y las características de la epopeya en textos
modelo.
‡ Integro los elementos del análisis literario al realizar la lectura de las
epopeyas.

64
‡
Literatura I
Establezco diferencias estructurales entre la fábula y la epopeya en un
Bloque III
UHJLVWURJUiÀFR
‡ Empleo de manera responsable los rasgos distintivos de diferentes textos
narrativos.

Problematización
$OXGLHQGRDWXDSUHQGL]DMHREWHQLGRHQJUDGRVDQWHULRUHVGLVFXWHFRQWXPDHVWUR
lo que sabes de estos relatos épicos: ¿qué es una epopeya? ¿Has leído alguna? ¿De
qué origen son? ¿Qué tipo de historias narra?
Siguiendo con nuestros recuerdos, hablemos de “El cantar del Mío Cid”,
epopeya incluida en el programa de Español 3 en secundaria, y la temática y
FRQWHQLGR IXHURQ DQDOL]DGDV HQ VX PRPHQWR 9HULÀFD D WUDYpV GH ODV VLJXLHQWHV
preguntas qué tanto aprendiste.
Subraya la opción que complete o responda correctamente cada pregunta.
1) ¿Quién es el autor de “El cantar del Mío Cid”?
a. $QyQLPR
b. El Campeador
c. Homero
d. Valmiki
2) ¿En cuántos cantares se divide “El Mío Cid”?
a. 2
b. 3
c. 4
d. 5
3) ¿Cuál es el primer cantar de “El Mío Cid”?
a. El destierro
b. La afrenta de Corpes
c. La convocatoria a cortes
d. Las bodas
4) ¿De qué origen es “El cantar del Mío Cid”?
a. $OHPiQ
b. Español
c. Inglés
d. Mexicano
5) ¿Quién es el protagonista de “El cantar del Mío Cid”?
a. 'DQWH$OLJKLHUL
b. Miguel de Cervantes Saavedra
c. Rodrigo Díaz de Vivar
d. Roldán
65
Bloque III Reconoces las diferencias entre la fábula y la epopeya

Desarrollo de saberes
Como mexicanos, conocemos sobre los hechos y acontecimientos de nuestra nación.
El bicentenario y centenario, que en esta ocasión forman parte de los festejos del
México independiente y democrático, son reconocidos a nivel mundial gracias a los
avances tecnológicos y a la globalización de la información. En estos tiempos, con el
apoyo de internet podemos viajar a lugares místicos en otros continentes, conocer
su cultura, tradiciones peculiares. Por ejemplo, mentalmente somos capaces de
recrear la estructura de la gran Muralla China, así como la historia que guarda en
sus alrededores.
Hace mucho tiempo la imaginación fue un elemento clave para recrear
y exaltar el espíritu nacional, pues la única referencia con la que se contaba eran
las obras literarias llamadas epopeyas, por consiguiente, únicamente los lectores
entusiastas conocían sobre el acervo cultural de otras naciones o, en su defecto,
la voz de soldados participantes de las luchas entre los pueblos. Básicamente, las
epopeyas fueron creadas para la unidad e identidad nacionales, ya que el conoci-
miento de los acontecimientos históricos hacía más fuerte el sentimiento patrióti-
FRDXQDGRDODPLWLÀFDFLyQGHORVKpURHVQDFLRQDOHV
'HQWURGHOJpQHUROLWHUDULRSRGHPRVHQFRQWUDULQÀQLGDGGHQDUUDFLRQHV
objetivas relacionadas directamente con la vida social de una comunidad. Las que
analizaremos en esta sesión relatan el arraigo cultural dirigido por héroes caracte-
rísticos de una región; a estas narraciones la Literatura las denomina epopeyas y
$OLJXDOTXHODV es importante conocerlas a detalle.
leyendas, las epope-

Origen y desarrollo
yas relatan hechos
históricos reales,
aunque con la
PDJQLÀFHQFLD
necesaria para glo-
ULÀFDUXQSXHEOR de la epopeya
La epopeya se centra en la narración de luchas de naciones para defender su
territorio, su libertad o por simple expansión. Para darle más realce, los pueblos
OH DxDGHQ GHVFULSFLRQHV PtWLFDV R OHJHQGDULDV D ORV UHODWRV PDJQLÀFDQGR ORV
lugares, personajes, héroes. En esencia, busca explicar el origen de los pueblos,
resaltando las cualidades que los caracterizan y los distinguen de otros.
Se deduce que todas las culturas tienen epopeyas, ya que éstas le dan
identidad y sentido patriótico a las generaciones posteriores al establecimiento
GHORVSXHEORV$OLQLFLRODVHSRSH\DVHUDQWUDQVPLWLGDVSRUWUDGLFLyQRUDO/RVLQ-
volucrados directos regresaban de la guerra a contar sus hazañas a los habitantes
de una nación, lo cual exaltaba la grandeza de sus acciones y del pueblo mismo.
La primera epopeya que se conoce por escrito es el Gilgamesh. Los me-
sopotámicos la transcribieron en arcilla para contar su expansión y sus luchas por
el poder; de la misma forma, la India relata su fundación en el Mahabarata y el
Ramayana. Posteriormente, en Grecia, Homero escribe la Ilíada y la Odisea, cuyos
hechos relatan la ocupación de Troya y la emigración de los griegos al ser invadidos
por otros pueblos; de igual modo, en Roma, Virgilio cuenta en la Eneida el origen
divino del pueblo romano.
Más tarde las epopeyas fueron cantadas. La fácil memorización de una
canción hacía más viable su transmisión popular. Los juglares eran los encargados

66
Literatura I
de cantarlas, sustituyendo su escritura; no obstante, alguien se encargó poste-
Bloque III
riormente de escribirlas. Las epopeyas cantadas fueron características de la Edad
Media, servían para informar al pueblo y a las cortes cuál había sido el desenlace
de los enfrentamientos. Los textos que se conocen de esta época son: “El cantar
GHORV1LEHOXQJRVµ´(OFDQWDUGH5ROGiQµ\´(OFDQWDUGHO0tR&LGµGH$OHPDQLD
Francia y España, respectivamente.
$QWH OD LQYDVLyQ GH (VSDxD D $PpULFD ORV SXHEORV FRQTXLVWDGRV \ ORV
conquistadores relatan sus triunfos y derrotas en diferentes narraciones como los
´$QDOHVGH;DKLOµ\ODFUyQLFDGH´&KDF;XOXEµHQWUHPXFKRVRWURV
Se cree que
Establecidas las naciones, las epopeyas perdieron auge y ya no fue nece- Homero era ciego
sario difundirlas con la misma necesidad que al principio de los pueblos. y nunca existió, si
bien el eje de sus

Características estructurales
relatos es real.

Fundamentalmente, la epopeya narra un hecho histórico del cual se derivan ac-


ciones sobresalientes de personajes heroicos, cuya importancia para la nación es
esencial, ayudados por seres sobrenaturales que los elevan como individuos privi-
legiados.
Entre las características que conforman estos poemas épicos, podemos
mencionar:
  Historia. Relata acontecimientos históricos de extrema importancia
para un pueblo, mezclado con acciones maravillosas, las cuales pueden
suceder entre dioses y hombres.
  Personajes. Se centra en un héroe generalmente protegido por las di-
vinidades, lo cual lo hace superior al resto de sus compatriotas. En la
epopeya participan gran variedad de personajes, porque se quiere dar
veracidad al proponer a los participantes de las contiendas nacionales.
/RVDQWDJRQLVWDVKDELWXDOPHQWHVRQDTXHOORVTXHLQWHUÀHUHQFRQHOSUR-
pósito del héroe (puede ser un dios, varios hombres o un pueblo entero).
  Espacio. El lugar en donde se desarrollan las acciones del protagonista son
reales, porque corresponde al país del cual se habla, aunque también
se describen lugares mágicos para resaltar las cualidades semidivinas
del héroe (por ejemplo: el purgatorio, la isla de los cíclopes, etcétera).
  Tiempo6HUHÀHUHDODpSRFDHQODFXDOVXFHGHODGLVSXWDUHDOHOPR-
mento histórico. Como ya has leído, también puede existir un tiempo
irreal, el que sucede cuando se mezcla con los dioses.
  Lenguaje artístico$OVHULQLFLDOPHQWHGHWUDGLFLyQRUDOHVWRVWH[WRV
tienen variaciones en sus traducciones y en su transcripción. Lo que qui-
]iIXHXQDÀJXUDUHWyULFDHQXQSULQFLSLRDOVHUWUDGXFLGRRWUDQVFULWR
pierde esa esencia y se convierte sólo en palabras cultas. Sin embargo
en algunas versiones se pueden observar sobre todo las hipérboles, por
su intención de sublimar; epítetos para describir las cualidades del hé-
roe y comparaciones, que a veces ensalzan lo humano hasta hacerlo
divino.
  Narrador. En esta ocasión se trata de un narrador extradiegético-omnis-
ciente. Es alguien que cuenta las vivencias de otros, de los protagonistas.

67
Bloque III Reconoces las diferencias entre la fábula y la epopeya

Tipos de epopeya
$OJXQRVDXWRUHVFRQVLGHUDQGLYHUVDVFODVLÀFDFLRQHVGHODHSRSH\D\DVHDSRUVX
tradición, si tienen o no autor conocido, o por la época en la cual surgen. De ma-
nera que se puede agrupar en popular, si se desarrolla a partir de la tradición oral,
a través de los cantos, porque se desconoce el autor; y en culta, si fueron escritas
para ser leídas y las escribe un autor conocido, cuya labor es contar la historia de
un pueblo.

También pueden dividirse según la época en la cual surgen o abundan.


Siguiendo este criterio, existen epopeyas clásicas, medievales y renacentistas.
Las primeras, como todo lo clásico, pertenecen a la literatura grecolatina, cuyos
principales representantes son Homero y Virgilio. Las medievales representan el
surgimiento de algunas naciones de Europa. Es quizá la época con producciones
más numerosas y primordialmente anónimas. Finalmente, las epopeyas rena-
centistas buscan narrar los acontecimientos más recientes, aunque no estén
directamente relacionados con la identidad nacional, sino con la necesidad de
contar las hazañas propias de la Conquista, por ejemplo. También han servido
para satirizar las epopeyas antiguas, como lo hizo Cervantes en El Quijote.

Debido a la extensión de las epopeyas, te presentamos sólo algunos frag-


mentos y resúmenes de los textos representativos de cada época:

Texto 1: Clásica

La Ilíada
Homero
&RPLHQ]DFRQODSULPHUDJUDQIXULDGH$TXLOHVSRUTXH
$JDPHQyQUH\GHORVDTXHRV\MHIHGHODH[SHGLFLyQ
griega contra Troya, se ha empeñado en quedarse con
su esclava favorita, Briseida. En señal de protesta,
$TXLOHVFRQVXHMpUFLWRGHPLUPLGRQHVGHFLGHPDQ-
tenerse al margen de la batalla, en su campamento,
junto a las naves griegas atracadas en las playas del
estrecho de los Dardanelos, cercano a Troya. (El estre-
cho de los Dardanelos, Helesponto, es la franja marina
que une el mar Egeo con el mar de Mármara; así como
el mar de Mármara se comunica con el mar Negro por
el estrecho del Bósforo). Esta decisión supone un gra-
ve perjuicio para los aqueos (nombre genérico dado a
los griegos de la época micénica), que son diezmados por los defensores
de Ilión, la acosada ciudad troyana donde residía el rey Príamo, padre de
+pFWRU\GH3DULV $OHMDQGUR HOUDSWRUGH+HOHQDHVSRVDGH0HQHODRHO
KHUPDQRGH$JDPHQyQ
Los pocos días de batallas del décimo año de la guerra contra
Troya que abarca el poema de la Ilíada, van transcurriendo con suerte
alternativa para ambos ejércitos. Los aqueos tratan en varias ocasiones
GH FRQVHJXLU TXH$TXLOHV DEDQGRQH VX SDVLYLGDG \ OHV D\XGH D FRQVHJXLU
la victoria, pero él se mantiene en sus trece hasta que su amado primo y
ayudante, Patroclo, es muerto por Héctor, el líder troyano.
68
Literatura I Bloque III
Los dioses, divididos en dos bandos, y en continuo ir y venir del
Olimpo, contemplaban la batalla desde el monte Ida, situado a unos seten-
ta kilómetros de Ilión, e intervenían en ella de forma encubierta encarnán-
dose en héroes de apariencia humana. Unos apoyaban a los griegos y otros
a los troyanos. Zeus actuaba de árbitro, tomando decisiones en favor de
uno u otro bando según consideraba que debía equilibrar la marcha de la
EDWDOOD$SRORIXHHOGLRVTXHPiVVLJQLÀFyHQHODSR\RDORVWUR\DQRVQR
en balde la leyenda le atribuye la fundación de Troya…
$TXLOHVHQIXUHFLGRSRUODPXHUWHGH3DWURFORPDWDHQXQGXHOR
a Héctor. Los troyanos, ya sin su gran héroe, caen en el engaño del astuto
2GLVHRTXLHQLGHDXQSODQFUHDUXQFDEDOORGHPDGHUDJLJDQWH DÀQGH
dar como ofrenda a los troyanos, pero escondiendo a una élite de soldados
para que entren a la ciudad y abran las enormes puertas y así ingrese el
ejército griego…

Texto 2: Medieval

Cantar de gesta al cabellero de París


Versión de Marie Rojas Tamayo Su trenza habla de noches en
contienda,
Por las calles de La Habana
tormento de dragones
un duende se pasea.
salvador de damiselas,
Bajo el sol o en pos de las estrellas
DPRGHOJULIR\GHODHVÀQJH
se escucha a través de las celosías
glorioso servidor de tantos reyes.
su voz cascada, sin prisas
Sus ojos se pierden más allá de la
cantando sus loas.
mirada,
Su paso incansable
evocando sueños de gloria al des-
golpea los adoquines campado.
con el peso de su historia. 6XDÀODGRSHUÀO
Su andar de mil eras retrato ideal de aquel Hidalgo,
es camino que conduce guarda las claves del misterio.
al reino de la Hidra y de la Sierpe. Su alma noble no conoce el reposo,
Sus manos no imploran, va tras su voz,
regalarle un pan no es dádiva, proclamando su gloria, que ya es
sino premio que otorga nuestra.

desde su antigua dignidad Parte de nuestras evocaciones,

de orate. de nuestros más caros recuerdos,

Sus manos van llenas de regalos: leyenda, aun antes de la muerte,

pajaritas de papel, le miro ahora, hecho estatua,

FRPHWDVÁRUHV« y sé que el caballero no está ahí.

69
Bloque III Reconoces las diferencias entre la fábula y la epopeya

Nadie lo pudo atrapar jamás en jaula alguna.


Caballero del viento,
de la nube, de las aves,
jinete de la lluvia,
de los bancos de los parques,
de las plazas y glorietas.
Paladín de los locos.
De los niños, de los bardos,
del polvo y de la risa.
Sé que vagarás,
cual adalid de lo mejor del alma humana,
más allá del tiempo y del espacio,
hasta desgastar los adoquines
que forman las calles de esta villa
que dio espacio a tus andares
en esta pequeña isla
TXHÁRWDVREUHHOPDU
de la deriva.

Texto 3: Renacentista

Don Quijote de la Mancha


Miguel de Cervantes Saavedra
Capítulo XLIII. De los consejos segundos que dio don Quijote a Sancho
Panza
¿Quién oyera el pasado razonamiento de don
Quijote que no le tuviera por persona muy
cuerda y mejor intencionada? Pero, como
muchas veces en el progreso destaca grande
historia queda dicho, solamente disparaba
en tocándole en la caballería, y en los demás
discursos mostraba tener claro y desenfadado
entendimiento, de manera que a cada paso
desacreditaban sus obras su juicio, y su juicio
sus obras; pero en ésta destos segundos docu-
mentos que dio a Sancho, mostró tener gran
donaire, y puso su discreción y su locura en un levantado punto.
$WHQWtVLPDPHQWHOHHVFXFKDED6DQFKR\SURFXUDEDFRQVHUYDUHQ
la memoria sus consejos, como quien pensaba guardarlos y salir por ellos
a buen parto de la preñez de su gobierno. Prosiguió, pues, don Quijote, y
dijo:

70
Literatura I Bloque III
—En lo que toca a cómo has de gobernar tu persona y casa, San-
cho, lo primero que te encargo es que seas limpio, y que te cortes las uñas,
sin dejarlas crecer, como algunos hacen, a quien su ignorancia les ha dado
a entender que las uñas largas les hermosean las manos, como si aquel
escremento y añadidura que se dejan de cortar fuese uña, siendo antes
garras de cernícalo lagartijero: puerco y extraordinario abuso. No andes,
6DQFKRGHVFHxLGR\ÁRMRTXHHOYHVWLGRGHVFRPSXHVWRGDLQGLFLRVGHiQL-
PRGHVPD]DODGRVL\DODGHVFRPSRVWXUD\ÁRMHGDGQRFDHGHEDMRGHVRFD-
rronería, como se juzgó en la de Julio César. Toma con discreción el pulso
DORTXHSXGLHUHYDOHUWXRÀFLR\VLVXIULHUHTXHGHVOLEUHDDWXVFULDGRV
dásela honesta y provechosa más que vistosa y bizarra, y repártela entre
tus criados y los pobres: quiero decir que si has de vestir seis pajes, viste
tres y otros tres pobres, y así tendrás pajes para el cielo y para el suelo; y
este nuevo modo de dar librea no la alcanzan los vanagloriosos. No comas
DMRVQLFHEROODVSRUTXHQRVDTXHQSRUHORORUWXYLOODQHUtD$QGDGHVSDFLR
habla con reposo, pero no de manera que parezca que te escuchas a ti mis-
mo, que toda afectación es mala. Come poco y cena más poco, que la salud
GHWRGRHOFXHUSRVHIUDJXDHQODRÀFLQDGHOHVWyPDJR6pWHPSODGRHQHO
beber, considerando que el vino demasiado ni guarda secreto ni cumple
palabra. Ten en cuenta, Sancho, de no mascar a dos carrillos, ni de erutar
delante de nadie.
—Eso de erutar no entiendo —dijo Sancho.
Y don Quijote le dijo:
—Erutar, Sancho, quiere decir regoldar, y éste es uno de los más
WRUSHVYRFDEORVTXHWLHQHODOHQJXDFDVWHOODQDDXQTXHHVPX\VLQLÀFDWLYR
y así, la gente curiosa se ha acogido al latín, y al regoldar dice erutar, y a
los regüeldos, erutaciones; y, cuando algunos no entienden estos términos,
importa poco, que el uso los irá introduciendo con el tiempo, que con faci-
lidad se entiendan; y esto es enriquecer la lengua, sobre quien tiene poder
el vulgo y el uso.
—En verdad, señor —dijo Sancho—, que uno de los consejos y avi-
sos que pienso llevar en la memoria ha de ser el de no regoldar, porque lo
suelo hacer muy a menudo.
—Erutar, Sancho, que no regoldar —dijo don Quijote.
—Erutar diré de aquí adelante —respondió Sancho—, y a fe que no
se me olvide.
—También, Sancho, no has de mezclar en tus pláticas la muche-
dumbre de refranes que sueles; que, puesto que los refranes son senten-
cias breves, muchas veces los traes tan por los cabellos, que más parecen
disparates que sentencias.

71
Bloque III Reconoces las diferencias entre la fábula y la epopeya

Los contextos
Los datos contextuales de la epopeya se establecen considerando la nación que
enaltece, el momento histórico que relata y los rasgos culturales que pretende
describir en voz de los personajes reales y fantásticos. Para determinar estos ele-
PHQWRVVHUHTXLHUHLQYHVWLJDUODKLVWRULDGHHVHSXHEORSDUDDVtYHULÀFDUODVED-
tallas libradas, narradas en el relato épico, así como sus costumbres y tradiciones
(de producción).
Por otro lado, el que lee o escucha la narración o canto puede sentirse
LGHQWLÀFDGRFRQORVYDORUHVTXHVHHOHYDQSDUDH[SOLFDUODJUDQGH]DGHOSXHEORTXH
representa la epopeya. Se vale experimentar cierta necesidad de imitar las virtu-
des del héroe para lograr ser reconocido y participar en la historia de su propia
SDWULD$GHPiVODHVWpWLFDWDQSDOSDEOHHQHOWLSRGHSDODEUDVTXHVHXVDQSDUD
describir los lugares, las personas y sus acciones, ayudan a valorar este texto como
una expresión artística que involucra a un pueblo entero. Su carácter popular hace
más preciado su valor artístico (de recepción).
'HVSXpVGHFRQRFHUORVGHWDOOHVHSRSp\LFRVHVWDPRVOLVWRVSDUDLGHQWLÀ-
car las características de este subgénero en un texto literario. Para desarrollar tus
habilidades de análisis, realiza la siguiente actividad.

Actividad de aprendizaje 3
Con base en los ejemplos de epopeyas que se te presentaron en esta sesión (Ilía-
da, “Cantar de gesta”, Don Quijote LGHQWLÀFDFDGDXQRORVHOHPHQWRVTXHVHWH
solicitan. Léelas de nuevo con atención para resolver este ejercicio. Completa el
siguiente cuadro.

Característica
Clásica Medieval Renacentista
Tipo

Historia

Personaje principal (héroe)

Espacios reales

Tiempo

Figuras de lenguaje
artístico

Contexto de recepción

Una vez integrado el análisis, escribe una conclusión de la información


plasmada en el cuadro, estableciendo semejanzas y diferencias entre los tres ti-
pos. En este texto deberás incluir un comentario personal respecto a la lectura de

72
Literatura I
ODVHSRSH\DVGHPDQHUDTXHVHYHDUHÁHMDGDODUHFHSFLyQTXHKLFLVWHGHOPHQVDMH
Bloque III
de cada fragmento.

Síntesis
Con el objeto de integrar los conocimientos y habilidades adquiridos en esta se-
sión, elabora un mapa conceptual que integre cada uno de los apartados vistos
aquí, contemplando las características y estructura de la epopeya para elaborar un
FRPSOHWRDQiOLVLV RULJHQHVWUXFWXUDFODVLÀFDFLyQFRQWH[WRV 

Actividad integradora
Para concretar la competencia del bloque y el proyecto establecido en esta sesión,
las siguientes actividades proponen que pongas en práctica lo adquirido. Después
GHLGHQWLÀFDUODVFDUDFWHUtVWLFDVGHODIiEXOD VHVLyQ$ \GHODHSRSH\D VHVLyQ% 
te encuentras en condiciones para establecer, comparativamente, las diferencias
estructurales y lingüísticas entre ellas; en consecuencia, realiza lo que se te soli-
cita, aprovechando este espacio de manera adecuada.
1) Completa el siguiente cuadro, resaltando las diferencias estructurales y
de lenguaje entre fábula y epopeya.

Características Fábula Epopeya

Historia

Personaje

Tiempo

Espacio

Lenguaje artístico

&ODVLÀFDFLyQ

73
Bloque III Reconoces las diferencias entre la fábula y la epopeya

2) Empleando de manera responsable los rasgos distintivos de la epopeya y


la fábula, redacta una de tus experiencias de vida que te hayan impac-
WDGRVLJQLÀFDWLYDPHQWH3XHGHVXVDUODHVWUXFWXUDGHODIiEXODRGHOD
epopeya. Transcríbelo en computadora e intercambia en clase con otro
compañero. Entre ustedes hagan las observaciones necesarias sobre sus
trabajos.
3) Dibujen en un pliego de papel bond el esquema de abajo. Cada círculo
representa un tipo de texto y la intersección, las características que
comparten; llénenlos con la información de cada sesión. Formen equi-
pos de tres personas para realizar la actividad. Socialicen sus resultados
y coevalúen sus trabajos.

74
Literatura I Bloque III
Realimentación
Es momento de hacer un alto para evaluar nuestro desempeño y el grado de desa-
UUROORGHODFRPSHWHQFLDHQHVWHEORTXH6LUHÁH[LRQDVDFHUFDGHORVVDEHUHVTXH
WHQtDVDQWHVGHLQLFLDUHODSUHQGL]DMH\ORVDGTXLULGRVDOÀQDOGHpVWH¢FyPRWHHQ-
FXHQWUDVUHVSHFWRDHVWR"([SOLFDWXVLWXDFLyQHQORVGRVPRPHQWRVHVSHFLÀFDQGR
lo referente a la fábula y la epopeya.

Saberes Antes Después

Fábula. Qué es, cómo son


sus personajes, los tipos, su
estructura y el tipo de lenguaje
artístico que utiliza

Epopeya. Qué es, cómo son


sus personajes, los tipos, su
estructura y el tipo de lenguaje
artístico que utiliza

El análisis de obras literarias implica tiempo, dedicación y gusto por la


lectura, al mismo tiempo que requiere un análisis profundo de la información que
se nos presente en cada texto proporcionado en la guía.
Con base en lo analizado en el cuadro anterior, ¿consideras que has lo-
grado desarrollar la competencia que da nombre al bloque? ¿Qué estrategias con-
sideras que podrían funcionar para el desarrollo de ésta y otras competencias? Es-
tablece las estrategias que seguirás para alcanzar el nivel de desempeño deseado.

75
Bloque III Reconoces las diferencias entre la fábula y la epopeya

Evaluación de la competencia
Después de socializar los resultados de sus aprendizajes, ubiquen su nivel de desem-
peño en la adquisición de las competencias relacionadas con este bloque, tomando
en consideración el cumplimiento de los criterios presentados al inicio de cada
sesión.

Inicial- Resolutivo Autónomo Estratégico


Criterio 3UHIRUPDO 
UHFHSWLYR  %iVLFR    
Reconozco
Reconozco Reconozco $UJXPHQWR
Reconozco No reconozco el origen, la
el origen, la el origen, la el origen, la
el origen, la el origen, la evolución y las
evolución y las evolución y las evolución y las
evolución y las evolución y las características
características características características
características características de la fábula
de la fábula y de la fábula y la de la fábula de la fábula y
de la fábula y y la epopeya
la epopeya en epopeya entre y la epopeya, la epopeya al
la epopeya en en textos que
textos modelo. un grupo de señaladas en ubicarlas en
textos modelo. propongo para
aseveraciones. textos modelo. textos modelo.
su análisis.
Integro los Integro los
elementos elementos del
Integro los ,GHQWLÀFR
Integro los del análisis análisis literario
elementos del algunos de los
1RLGHQWLÀFRORV elementos del literario en la en la redacción
análisis literario elementos del
elementos del análisis literario redacción de de una fábula
al realizar la análisis literario
análisis literario. en la lectura de una fábula, con que resuelva una
redacción de una en un texto
fábulas. los requisitos situación actual
fábula. literario.
propuestos por de mi entorno
inmediato.
el maestro.
Respeto la gran
Respeto los Respeto en mayoría de los Respeto los
No respeto los Respeto los comentarios
comentarios ocasiones los comentarios
comentarios comentarios expresados por
expresados por comentarios expresados por
expresados por expresados por mis compañeros
mis compañeros expresados por mis compañeros
mis compañeros mis compañeros al dar sus
al mostrar mis compañeros al dar sus
al dar sus al dar sus opiniones en sus
sus opiniones al dar sus opiniones en sus intervenciones en
opiniones en sus opiniones en sus
en sus opiniones en sus intervenciones clase y sugiero
intervenciones en intervenciones
intervenciones intervenciones en clase, cuando información que
clase. en clase.
en clase. en clase. MXVWLÀFDQVXV las complemente.
comentarios.
Integro los
Integro los Integro los Integro los elementos del
elementos 1RLGHQWLÀFRORV elementos del elementos análisis literario al
,GHQWLÀFRORV
del análisis elementos del análisis literario del análisis realizar la lectura
elementos del
literario al análisis literario. al leer una literario al leer de una epopeya
análisis literario originada en mi
realizar la epopeya, con una epopeya
entre un grupo. cultura, que me
lectura de las la guía de un de manera
epopeyas. ejemplo. individual. ayuda a valorar mi
historia.

76
Literatura I Bloque III

Inicial- Resolutivo Autónomo Estratégico


Criterio 3UHIRUPDO 
UHFHSWLYR  %iVLFR    
Establezco Establezco Establezco
,GHQWLÀFR
diferencias 1RLGHQWLÀFR ,GHQWLÀFRORV diferencias diferencias
algunas de las
estructurales los elementos elementos estructurales estructurales
diferencias
entre la fábula estructurales estructurales entre la fábula entre fábula y
estructurales
y la epopeya, de la fábula y de la fábula y la y la epopeya, epopeya, en un
entre la fábula y
en un registro epopeya. epopeya. en un registro JUiÀFRFUHDWLYR
la epopeya.
JUiÀFR JUiÀFR y diferente.
Empleo
Empleo de Conozco Empleo Empleo de manera
los rasgos
manera No conozco los los rasgos los rasgos responsable los
distintivos
responsable los rasgos distintivos distintivos distintivos rasgos distintivos
de diferentes
rasgos distintivos de diferentes de diferentes de diferentes de diferentes
de diferentes textos textos narrativos
textos narrativos. textos textos para
textos narrativos. narrativos en en una redacción.
narrativos. diferenciarlos.
una redacción.

77
Bloque IV:

Reconoces
las diferencias
entre la
leyenda
y el mito
Desempeños del estudiante:
‡ Reconoce el origen y desarrollo de la leyenda y el mito señalando sus
características.
‡ Establece las diferencias estructurales entre la leyenda y el mito.
‡ Determina las diferencias lingüísticas entre la leyenda y el mito.
‡ Produce textos siguiendo los aspectos textuales de la leyenda y el mito.

Objetos de aprendizaje:
‡ Leyenda
‡ Mito
‡ Diferencias estructurales entre leyenda y mito
‡ Diferencias lingüísticas entre leyenda y mito
‡ $VSHFWRVFRQWH[WXDOHVGHODOH\HQGD\HOPLWR
‡ Lugar, época y cultura en que aparece
‡ Características religiosas, sociales, políticas, etc.
‡ $VSHFWRVWH[WXDOHVGHODOH\HQGD\HOPLWR
» Estructura
» Personajes
» Narrador
» Lenguaje

Competencias a desarrollar:
‡ Es sensible al arte y participa en la apreciación e interpretación de sus
expresiones en distintos géneros.
‡ Escucha, interpreta y emite mensajes pertinentes en distintos contextos
mediante la utilización de medios, códigos y herramientas apropiados.
‡ Participa y colabora de manera efectiva en equipos diversos.
‡ Mantiene una actitud respetuosa hacia la interculturalidad y la diversi-
dad de creencias, valores, ideas y prácticas sociales.
‡ ,GHQWLÀFDRUGHQDHLQWHUSUHWDODVLGHDVGDWRV\FRQFHSWRVH[SOtFLWRVH
implícitos en un texto, considerando el contexto en el que se generó y
en el que se recibe.
‡ Evalúa un texto mediante la comparación de un contenido con el de
otros, en función de sus conocimientos previos y nuevos.
‡ Produce textos con base en el uso normativo de la lengua, considerando
la intención y situación comunicativa.
‡ Expresa ideas y conceptos en composiciones coherentes y creativas, con
introducciones, desarrollo y conclusiones claras.
‡ Valora y describe el papel del arte, la literatura y los medios de comu-
nicación en la recreación o la transformación de una cultura, teniendo
en cuenta los propósitos comunicativos de distintos géneros.
Bloque IV Reconoces las diferencias entre la leyenda y el mito

Dinamización
Lee detenidamente los textos que se te presentan a continuación.

El Maquech
Versión de Javier Covo Torres
Esta es la leyenda de una bella princesa que tenía los
cabellos como las alas de las golondrinas; por eso se
llamaba Cuzán, que es el nombre maya de esa ave. La
historia de la belleza de Cuzán se contaba en todo el
reino, más allá de los muros de la ciudad de Yaxchilán.
&X]iQ HUD OD KLMD SUHIHULGD GH$KQ~ 'WXQG-
tunxcaán, el Gran Señor que se Sumerge en el Cielo.
Era alegre y feliz y su rostro brillaba como el sol cuando
su padre ponía a sus pies lo más bello de sus tesoros de
guerra.
Cuando Cuzán tuvo edad para el matrimonio, su padre concertó
la unión con el hijo de Halach Inc, de la gran ciudad de Nan Chan; el prín-
cipe Ek Chapat, el futuro señor del reino. Cuzán aceptó la elección de su
padre.
Un día al regresar de la guerra el rey envió los tesoros del botín
a Cuzán. Cuando la princesa fue a la sala del gran palacio para agradecer-
le a su padre el rico presente, lo halló acompañado de un hermoso joven
llamado Chalpol, Cabeza Roja, porque su cabello era de color encendido.
Sus almas quedaron atrapadas en un lazo de fuego. El corazón
desbocado de la princesa sólo hallaba sosiego en el nombre de Chalpol.
Juraron no olvidarse nunca y se amaron con locura bajo la ceiba sagrada,
donde los dioses escuchan las plegarias de los mortales.
Todos en la ciudad sabían que Cuzán estaba prometida al príncipe
Ek Chapat de la ciudad Nan Chan; por eso cuando el rey supo que Chalpol
HUDHODPDQWHGHVXKLMDRUGHQyTXHIXHUDVDFULÀFDGR&X]iQOHVXSOLFy
que le perdonara la vida, pero todo fue en vano.
El día señalado Chalpol fue pintado de azul para la ceremonia
GHOVDFULÀFLR+DVWDHODWULRGHOWHPSOROOHJDEDHODURPDGHOFRSDOTXHVH
quemaba para expulsar los espíritus.
Con los ojos llenos de lágrimas, Cuzán volvió a pedir a su padre
TXHQRORVDFULÀFDUDSURPHWLHQGRTXHMDPiVORYROYHUtDDYHU\TXHDFHS-
taría con obediencia ser la esposa del príncipe de Nan Chan.
Después de consultar con los sacerdotes, el Halach Uinic le per-
donó la vida, bajo la única condición de que su hija se encerrara en sus
KDELWDFLRQHV6LVDOtD&KDOSROVHUtDVDFULÀFDGR(QODVROHGDGGHVXDOFRED
la princesa entró en la senda del misterio.
En el silencio de la noche, fue llamada a presentarse ante el Ha-
lach Uinic. Cuando llegó a los patios del templo sus ojos buscaron los de su
DPDGR7HPEOyDOSHQVDUTXHORKDEtDQVDFULÀFDGR

80
Literatura I Bloque IV
Le preguntó a su padre, quien sólo sonrió. Un hechicero se le
acercó ofreciéndole un escarabajo y le dijo: “Cuzán, aquí tienes a tu amado
Chalpol. Tu padre le concedió la vida, pero me pidió que lo convirtiera en
un insecto por haber tenido la osadía de amarte”.
La princesa Cuzán lo tomó y le dijo: “Juré nunca separarme de ti
y cumpliré mi juramento”.
El mejor joyero del reino lo cubrió de piedras preciosas y le sujetó
una de sus patitas con una cadenita de oro.
Ella lo prendió a su pecho y le dijo: “Maquech, eres un hombre,
escucha el latido de mi corazón, en él vivirás por siempre. He jurado a los
dioses no olvidarte nunca. Maquech, los dioses no han conocido nunca un
amor tan intenso y tan vivo como éste que consume mi alma”.
La princesa Cuzán y su amado Chalpol, convertido en Maquech,
se amaron por encima de las leyes del tiempo, con un amor colmado de
eternidad.

El texto que acabas de leer cuenta una historia de un amor grandioso que
rebasa los egoísmos y muestra lo que una persona es capaz de hacer por amor. El
protagonista de esta historia se convierte en un maquech, ¿lo conoces? ¿Los has
visto a la venta en alguna tienda de artesanías? ¿Se lo has obsequiado a alguien o te
lo han regalado? Hemos visto los maquech colgados en la ropa de algunas personas
como broches decorativos y a veces nos preguntamos por qué esos insectos tienen
incrustadas esas piedras que los hacen parecer una joya; después de leer este
relato, entendemos por qué se lleva sujeto cerca del corazón y las piedras que lo
adornan. ¿Conocías el relato? ¿Los nombres de los personajes que se mencionan son
FRQRFLGRVSDUDWL"¢9DOHODSHQDVDFULÀFDUVHFRPRORKL]R&KDOSRO"
En nuestra cultura encontramos muchas historias que nos ayudan a
entender lo que nos rodea. Pertenecemos a un pueblo lleno de tradiciones y
legados culturales que los mayas afortunadamente nos han heredado. Seguramente
te sientes orgulloso de ser yucateco y de vivir en la tierra del Mayab. Nuestros
ancestros crearon diferentes narraciones que nos han ayudado a comprender cuál
es nuestro origen y la veneración tan profunda de los mayas a los dioses de la
naturaleza. Estas narraciones de origen popular son los mitos y las leyendas. En
este bloque conoceremos historias fantásticas con cierto toque de verdad, las cuales
sirvieron para explicar el orden natural de las cosas.

Sesión A: La leyenda como


relato popular
Proyecto: Redactar un comentario crítico acerca de una leyenda, como resultado
del análisis colaborativo que considere sus aspectos contextuales y textuales.

Criterios
‡ Comprendo el origen y desarrollo de la leyenda mediante la lectura de
textos modelo.

81
Bloque IV Reconoces las diferencias entre la leyenda y el mito

‡ Integro los aspectos textuales y contextuales en el análisis de una


leyenda mediante la lectura de textos modelo que selecciono.
‡ Muestro una actitud de respeto ante la diversidad de opiniones, surgidas
en la colaboración de actividades de aprendizaje.

Problematización
$FRQWLQXDFLyQVHWHSURSRUFLRQDXQDOH\HQGDGHODFLXGDGGH*XDQDMXDWRGHQR-
minada “El callejón del beso”, por lo que deberás leerla detenidamente y escribir
los acontecimientos dentro de los espacios designados para cada una de las partes
(estructura) que la conforman.

El callejón del beso


Según los lugareños, Carmen era hija única de un padre intran-
sigente y >violento que la tenía casi aislada de la sociedad, a
ÀQGHHYLWDUTXHOHOOHJDUDHODPRU\ODDUUHEDWDUDGHVXODGR
No obstante, en algunas “escapadas” Carmen fue
cortejada por Carlos, un humilde minero con el que se veía
en un templo cercano a su hogar.
$OVHUGHVFXELHUWDWXYRTXHVRSRUWDUHOHQFLHUURDO
que la sometió su padre, bajo la amenaza de enviarla a un
convento y casarla en España con un viejo y rico noble, con
el que, además, acrecentaría el padre su mermada hacienda.
En aquella época todas las doncellas tenían a su
dama de compañía, así que la bella mujer acudió a ella para
pedirle que le entregara una carta a Carlos en la que le revelaba el trágico
suceso. Mil conjeturas se hizo el joven enamorado, pero de ellas hubo
una que le pareció la más acertada. Una ventana de la casa de Carmen
daba hacia un angosto callejón, tan estrecho que era posible, asomado a
la ventana, tocar con la mano la pared de enfrente. Si lograba entrar a la
casa frontera podría hablar con su amada y, entre los dos, encontrar una
solución a su problema. Preguntó quién era el dueño de aquella casa y la
DGTXLULy D ´SUHFLR GH RURµ $Vt ORV HQDPRUDGRV WXYLHURQ ODUJDV QRFKHV
para consumar su amor hasta que un día el padre escuchó los murmullos y
entró a la habitación de Carmen y encontró a la pareja reunida. Enfurecido
\HQJUDQDFWRGHYLROHQFLDFODYyXQDGDJDHQHOSHFKRGHVXKLMD$QWHOD
tragedia, Carlos enmudeció de espanto y dejó en sus manos, tersas y sin
vida, un tierno beso.
El joven no pudo soportar vivir sin el amor de Carmen y desespe-
rado se suicidó, tirándose desde el brocal del tiro principal de la mina de
La Valenciana.
La leyenda se corona con una advertencia: la pareja que visite
HVWHVLWLR\VHGpXQEHVRHQHOWHUFHUHVFDOyQGHHVWHDÁXHQWHDQJRVWROR-
grará su felicidad durante siete años, sin embargo, quien no lo haga y pise
el lugar tendrá siete años de mala suerte. Para las personas que no llevan
pareja no pesa ninguna maldición, pero sí se les recomienda que busquen
pareja rápido y al encontrarla, no duden en visitar juntos este lugar situado
en la bella ciudad de Guanajuato.

82
Literatura I
$KRUD FRQ EDVH HQ OD OH\HQGD ´(O FDOOHMyQ GHO EHVRµ PDUFD FRQ XQD
Bloque IV
equis (x) si contiene las características señaladas.

En la leyenda de “El callejón del beso”, ¿se emplea el lenguaje


popular?
¿El narrador está en tercera persona?
¿Los personajes principales representan valores?
¿El espacio donde suceden las acciones es real?

Desarrollo de saberes
El 7 de julio de 2007 recibimos con alegría la noticia de que la pirámide de Chichén
Itzá fue declarada una de las siete maravillas del mundo moderno; nos sentimos
orgullosos de nuestra herencia cultural, de ser yucatecos.
Después de ese suceso tan trascendente, nuestro estado es ahora más
YLVLWDGRSDUDFRQRFHUSDUWHGHVXFXOWXUD$GHPiVGHVHUUHFRQRFLGRSRUVXVFLX-
dades prehispánicas, por su gastronomía, por la trova, las “bombas”, Yucatán es
reconocido y admirado por la riqueza de su literatura. Muchos visitantes quedan
fascinados al leer u oír nuestras leyendas: “El enano de Uxmal”, “La Xtabay”,
“Nicté-Há”, “Maquech”, entre otras.
Pero no sólo nuestro estado es admirado por la riqueza de su arquitec-
tura, nuestro país cuenta con una gran riqueza literaria. En todos los estados se
cuenta con un bagaje prehispánico y mestizo digno de ser conocido y valorado en
todo el mundo; por ejemplo, entre las leyendas más conocidas destacan “El calle-
jón del beso”, “La llorona”, “El Popocatépetl”, entre otros.
En tu infancia tal vez tuviste la fortuna de convivir con tus abuelitos
o algún familiar que te haya contado en una tarde o noche lluviosa una leyenda
de terror, y seguro al día siguiente te encargaste de relatarla a tus amigos. En el
transcurso de tu vida estudiantil, como hemos insistido en los bloques anteriores,
has trabajado con diversos textos literarios; en el bachillerato continuarás disfru-
tando de la lectura de diferentes textos, pero analizando más a detalle cada uno
de ellos.

Orígenes y características
de la leyenda
La leyenda no tiene un punto de partida concreto, es un relato que surgió para
interpretar la realidad de nuestros antepasados, una realidad cambiante gracias a
las aportaciones de cada generación que intenta conservar ese hecho en la memoria
de su pueblo. De ahí que se convirtiera en una narración maravillosa y fantástica,
pero esencialmente popular, trayendo consigo las ideas, costumbres, tradiciones y
sentimientos de una comunidad, la cual desea explicar el origen de la naturaleza,
de acontecimientos aparentemente sobrenaturales o de sucesos humanos (históri-
cos). Todas las leyendas tienen una base histórica, cuentan un hecho del pasado,
adicionado con eventos que los pueblos van incluyendo a lo largo del tiempo.

83
Bloque IV Reconoces las diferencias entre la leyenda y el mito

La leyenda es un texto literario. Su carácter literario se encuentra en la


función poética que cumple, ese lenguaje artístico o poético hace de la leyenda
una narración extraordinaria. Si bien el lenguaje poético le da la característica
literaria, la leyenda busca adaptarse a ciertas cualidades que comparten también
otros textos literarios.

$VtODOH\HQGDFXPSOHODVVLJXLHQWHVFDUDFWHUtVWLFDV
‡ Es un relato de carácter popular, puesto que no tiene autor y se trans-
mite de generación en generación, quienes le añaden elementos pro-
pios de su momento histórico y social
‡ Puede tener cierta dosis de verdad histórica, porque va recogiendo
las costumbres, tradiciones y creencias de una comunidad. Narra un
suceso estrechamente relacionado con la identidad de un pueblo
‡ Los personajes que en ella intervienen se convierten en héroes o
seres extraordinarios al momento de transmitirse en voz popular (los
personajes humanos muchas veces se convierten en divinidades) y
representan en su lucha, valores y antivalores

Aspectos contextuales
y textuales de la leyenda
Cuando disfrutas la lectura de una leyenda debes tener presente que es importante
VLWXDUHOUHODWRGHQWURGHXQOXJDUGHWHUPLQDGRpSRFD\FXOWXUDHVSHFtÀFDGHOD
misma forma, los elementos que lo integran, tales como personajes, estructura,
lenguaje, son necesarios para su comprensión. Cada aspecto aquí mencionado
corresponde a los elementos contextuales y textuales, respectivamente.
En la leyenda los aspectos contextualesVHUHÀHUHQDOlugar, es decir,
dependiendo de dónde se esté relatando, la leyenda adopta esos espacios o lugares
en los cuales van a actuar los personajes, por ejemplo, zonas arqueológicas, ríos,
montañas o lugares inimaginables; también se relacionan con la época, se remon-
tan por lo general a épocas pasadas (por ejemplo, las leyendas mayas se ubican en
la época prehispánica). Igualmente, la cultura pertenece al contexto, es el grupo
con ciertos rasgos que lo hacen único, representa a una cultura en particular, por
ejemplo, la maya, azteca, griega, romana, etcétera.
Por otro lado, los aspectos textuales representan la estructura lineal, la
cual se centra en la lucha de las fuerzas del bien y el mal (situación inicial, ruptura
GHOHTXLOLEULR\UHVROXFLyQGHOFRQÁLFWR 6HUHÀHUHWDPELpQDORVpersonajes que
intervienen (pueden ser dioses, semidioses, reyes, héroes, monstruos, etcétera);
al tipo de narrador, que generalmente es extradiegético; y al lenguaje artístico,
propio de los textos literarios, resaltando los recursos poéticos de los cuales se
vale el autor para que predomine la calidad estética: epítetos, hipérboles, com-
paraciones o símiles.

Actividad de aprendizaje 1
$FRQWLQXDFLyQWHSUHVHQWDPRVXQDOH\HQGD\XFDWHFDSDUDTXHODDQDOLFHVGHVGHHO
punto de vista contextual y textual. Forma equipos de cuatro personas y asignen
una función a cada integrante. Lean la leyenda y posteriormente realicen lo que
se les solicita:
84
Literatura I Bloque IV
“Nicté Há” (Flor de loto)
Versión de Javier Covo Torres
En lo más profundo de la selva del mayab había un
reino maravilloso. El príncipe de ese reino se llamaba
Chacdziedzib, que quiere decir “pájaro cardenal”, y
estaba enamorado con locura de la hija del guardián
del cenote sagrado, Nicté-Há, TXH TXLHUH GHFLU ´ÁRU
de loto”.
Chacdziedzib, el de la túnica roja, era que-
rido y venerado por su pueblo porque era un guerrero
YDOLHQWH\JDOODUGRTXHQXQFDIDOODEDFRQODVÁHFKDVGH
su arco.
$QWHVGHODPDQHFHUHOSUtQFLSHEXVFDEDDVXDPDGDHQODVRULOODV
del cenote sagrado, y el aire se colmaba con sus palabras de amor a Nicté-
Há, cuando la aurora rompía el cielo con sus rayos de luz.
Un día el gran sacerdote, convencido que Chacdziedzib debía
casarse con una hija de reyes, se opuso a sus amores con Nicté-Há y con-
vocó a los grandes señores, quienes decidieron que la hija del guardián del
cenote sagrado debía morir.
El bufón de la corte había oído todo y, lleno de temor, se lo contó
al príncipe, quien ordenó a su mejor guerrero ir en busca de la princesa y
traerla al palacio real, donde la tomaría por esposa. El noble guerrero salió
a cumplir su misión, pero en la negra oscuridad de la noche unas manos
asesinas le quitaron la vida y arrojaron su cuerpo a la espesura. El bufón
volvió a verlo todo.
Cuando el príncipe del manto rojo se enteró de lo sucedido, tomó
su arco y se dirigió al cenote sagrado en busca de su amada. Esa noche de
luna, veló su sueño bajo las ceibas.
Cuando al amanecer Nicté-Há fue a mirarse en las aguas quietas
del cenote, el príncipe se acercó a ella y la estrechó entre sus brazos. La
DPDEDFRQWRGDVVXVIXHU]DV3HURGHODVRPEUDVDOLyXQDÁHFKDTXHDWUD-
vesó el pecho de la doncella. Su cuerpo frágil y sin vida cayó y se hundió
en las aguas del cenote sagrado, la morada de los dioses. El príncipe vio
desaparecer el cuerpo de su amada. Sólo el vestido de Nicté-Há quedó
ÁRWDQGRHQODVWUDQTXLODVDJXDVGHOFHQRWH6XGRORUHUDSURIXQGR%DxDGR
en lágrimas rogó a los dioses piedad y compasión. Fue tanto su dolor que el
corazón se le hizo pedazos y cayó agonizante al borde del cenote sagrado,
sobre un charco de sangre.
/RV GLRVHV OH HVFXFKDURQ \ HQYLDURQ DO 6HxRU GH ODV$JXDV \ DO
6HxRUGHORV3iMDURV(O6HxRUGHODV$JXDVEDMyDORSURIXQGRGHOFHQRWH\
convirtió el cuerpo inerte de Nicté-Há en un hermoso loto. El Señor de los
Pájaros posó sus manos sobre el corazón del príncipe y lo convirtió en un
hermoso pájaro cardenal, siempre sediento de amor.
Desde entonces, cuando despunta el alba, un pájaro rojo baja
hasta el cenote sagrado para cantar con trinos de amor sobre los abiertos
cálices de los lotos.

85
Bloque IV Reconoces las diferencias entre la leyenda y el mito

1) Una vez efectuada la lectura, responde las cuestiones que se te plan-


WHDQDFRQWLQXDFLyQMXVWLÀFDQGRWXVUHVSXHVWDV
a. La leyenda “Nicté-Há”, ¿qué explicación intenta dar sobre algún
hecho o suceso que vivieron nuestros antepasados? ¿Se basa en
un hecho real?

b. ¿Cuál es el suceso fantasioso que se presenta?

c. ¿Quién es el autor?

d. La leyenda, ¿a qué cultura prehispánica pertenece?

e. 6LJXLHQGRFRQHODQiOLVLVFRQWH[WXDOHVSHFLÀFDODpSRFDHQODTXH
surge este relato.

f. ¢4XpYDORUHV\DQWLYDORUHVLGHQWLÀFDVTXHUHSUHVHQWDFDGDSHUVR-
naje que interviene?

g. /RFDOL]D H LGHQWLÀFD HO OHQJXDMH DUWtVWLFR GH OD OH\HQGD HQFH-


rrando con color rojo los epítetos, con azul las hipérboles y con
morado las comparaciones o símiles.
h. ¿Por qué la modalidad en la que se presenta la leyenda es la
prosa?

i. &ODVLÀFDORVSHUVRQDMHVGHDFXHUGRDVXSDUWLFLSDFLyQHQODOH\HQ-
da, escribe el nombre del personaje protagonista, secundario e
incidental que encuentres.

j. Escribe el tipo de narrador que relata esta leyenda, según lo es-


tudiado en el bloque II.

86
k.
Literatura I
Describe el lugar o espacio donde se desarrollan las acciones,
Bloque IV
usando la forma del texto leído.

2) Retomando el proyecto planteado al inicio de la sesión, redacta un comen-


tario crítico acerca de “Nicté-Há”, como resultado del análisis realizado
en equipos. El texto no debe ser mayor de diez líneas. Socialicen sus re-
sultados ante el grupo, mostrando respeto ante la diversidad de opiniones.

3) En cuanto a los acontecimientos de “Nicté-Há”, resume en los espacios


designados las tres partes que la conforman.
Esquema 4.1

Resolución del conflicto Situación inicial

Leyenda

Nicté-há

Ruptura del equilibrio

87
Bloque IV Reconoces las diferencias entre la leyenda y el mito

Síntesis
1) Con la ayuda de tu facilitador, respondan y comenten de manera cola-
borativa las cuestiones planteadas.
a. ¿Conocen alguna leyenda que forme parte de su cultura? Nárrenla.
Comenten con el grupo las características principales de la leyenda
que trajeron a la clase.
b. Expliquen cómo se considera el nivel contextual de la leyenda
que eligieron.
2) $JU~SHQVHHQSDUHMDV\HQFXHQWUHQODVRFKRSDODEUDVGHOUHFXDGURTXH
se relacionan con la leyenda.

(VWUXFWXUD/HQJXDMH1DUUDGRU/XJDU/H\HQGD3HUVRQDMHeSRFD&XOWXUD

L L S F J K $ G E E

E M $ O S R E P S S

N : L N S R E I F T

G L E Y E N D $ O R

U M R N O C H M L U

$ L $ F S N T S G C

J S N N V M R N S T

E E C T S O S C H U

$ J S U M R $ I M R

L $ M O L C H K P $

U N X Ñ Q T Y S Z X

G O D F K L U Q R Y

$ S N Y E N L R L E

R R R O D $ R R $ N

P E R S E P O C S F

X P C V L $ C O P E

88
Literatura I Bloque IV
Sesión B: El mito
Proyecto: $QDOL]DUXQPLWRHQVXVDVSHFWRVFRQWH[WXDOHV\WH[WXDOHVGLIHUHQ-
ciándolo al mismo tiempo de la leyenda, usando textos de su propio contexto.

Criterios
‡ Comprendo el origen y desarrollo del mito a través de la lectura de
textos modelo.
‡ Integro los aspectos textuales y contextuales en el análisis colaborativo
de un mito, mediante la lectura de textos modelo que selecciono.
‡ Establezco diferencias estructurales y lingüísticas entre la leyenda y el
mito en la redacción de un comentario crítico.
‡ Empleo de manera responsable la información obtenida de la leyenda y
el mito, al establecer diferencia entre ellos.

Problematización
Lee con atención el siguiente texto y responde lo que se te solicita después.

La manzana de la discordia
Cuenta la leyenda que cuando Peleo y Tetis se casaron,
HQYLDURQLQYLWDFLRQHVDODÀHVWDSDUDWRGRVORVGLRVHV
Como no querían tener problemas en un día tan espe-
cial, decidieron que lo mejor sería no invitar a Eris,
conocida como La Discordia.
Eris se enojó tanto que se apareció en el ban-
quete de bodas de todos modos. Furiosa se dirigió a la
mesa donde se encontraban las diosas más hermosas:
+HUD$WHQHD \$IURGLWD \ DUURMy XQD HQRUPH PDQ]D-
na con una inscripción tallada que decía: “Para la más
hermosa”.
+HUDGLMR´'HEHVHUSDUDPtµ3HURDOLQVWDQWH$WHQHD\$IURGLWD
también reclamaron la manzana y pusieron a Zeus como árbitro.
Zeus no quería tomar parte por ninguna de las diosas, ya que
sabía que por lo menos dos de ellas terminarían haciendo reclamos por su
intervención o, lo que es peor, enemistadas con él, y decidió sacarse el
problema de encima.
No se le ocurrió nada mejor que enviar a las tres diosas ante el
joven y hermoso Paris para que él decidiera.
8QD D XQD ODV GLRVDV IXHURQ GHVÀODQGR DQWH pO FXEULpQGROR GH
promesas.

89
Bloque IV Reconoces las diferencias entre la leyenda y el mito

Prometo darte poder y riquezas si me eliges”, dijo Hera.


$WHQHDOHSURPHWLy´6LGLFHVTXH\RVR\ODPiVEHOODWHRWRUJDUp
JORULDHQODVJXHUUDV\IDPDSRUGRTXLHUµ3HURODVHQVXDO$IURGLWDTXHHUD
muy astuta, le ofreció la mujer más hermosa por esposa y esto lo convenció
GHÀQLWLYDPHQWH
$IURGLWDREWXYRODPDQ]DQDGHRUR\GHDOOtHQPiV+HUD\$WHQHD
se convirtieron en sus peores enemigas.
$IURGLWDÀHODVXSURPHVDOHD\XGyD3DULVDFRQVHJXLUHODPRU
de Helena, que se convertiría en el motivo de la famosa guerra de Troya.

(VFULEHGHQWURORVUHFXDGURVODLQIRUPDFLyQTXHVHWHVROLFLWD$UJXPHQWD
tus respuestas.

Mito “La manzana de la discordia” Respuestas


¿Qué tema aborda el mito?
¢4XpOHQJXDMHDUWtVWLFR ÀJXUDVOLWHUDULDV HVWi
presente?
¿Quiénes son los personajes principales?
¿Qué valores y antivalores están presentes en el
mito?
¿Cuál es el papel que desempeña la manzana en el
mito? ¿Qué representa?

Desarrollo de saberes
Imagina que tienes la oportunidad de viajar a un lugar que siempre has deseado
conocer. Ya estando ahí tendrías que socializar con diferentes personas. ¿Crees que
esas personas comparten las mismas costumbres y tradiciones que tú? ¿Te esforza-
UtDVHQWRGRPRPHQWRSRUGHPRVWUDUORPHMRUGHWL"¢7DPELpQUHÁHMDUtDVWXDFHUYR
cultural al comunicarte con los demás? Todos demostramos quiénes somos gracias
a lo que decimos o hacemos. Nuestra forma de hablar, nuestros ritos, nuestras
costumbres, demuestran la cultura a la cual pertenecemos.
Muchas personas de otros países se interesan en nuestro estado. Les atrae
cómo somos y lo que nos pertenece, les gusta nuestra literatura, la gastronomía,
QXHVWURVHGLÀFLRV(VSRUHVRTXHHQHVWDVHVLyQWRFDHOWXUQRDORVPLWRVORVFXDOHV
muestran muchos de nuestros detalles educativos.
$O LJXDO TXH HQ ORV RWURV WLSRV GH WH[WRV QXHVWUR SDtV FXHQWD FRQ XQD
vasta colección de relatos míticos, entre los más conocidos en toda la República
destacan: “El origen de Quetzalcóatl”, “El mito cósmico de Chalco”, “El mito de
ODFUHDFLyQGHOPDJXH\µ\PXFKRVPiV$XQTXHHVWHHVSDFLRUHVXOWDLQVXÀFLHQWH
trataremos de conocer algunos textos de la literatura nacional para ayudarte a
acrecentar aún más tu acervo literario y aprecies lo que nos dejaron nuestros an-
tepasados mayas, aztecas, olmecas, etcétera.

90
Literatura I
Por otro lado, a nivel mundial existen muchos mitos famosos, la mitología
Bloque IV
por excelencia es la mitología griega, son conocidos los mitos como: “La caja de
3DQGRUDµ´(OKHUPRVR1DUFLVRµ´(OWDOyQGH$TXLOHVµ´(ODXGD]YXHORGHÌFDURµ
y muchos más que has de conocer. La mitología griega logra recrear fantásticamen-
te los sucesos naturales y humanos tratando de explicarlos; por lo cual, podemos
encontrar un gran número de historias mitológicas en donde intervienen diversos
personajes mágicos y humanos.

Origen, características
\FODVLÀFDFLyQ
El mito es un relato de carácter asombroso. Surge con el intento del hombre de
explicar cómo se generan o nacen sus dioses, los fenómenos o elementos natu-
rales o la condición humana. Se puede decir que la mitología relata las historias
extraordinarias o fabulosas de las divinidades o deidades, los semidioses y los
humanos convertidos en héroes por sus proezas.

En el comienzo de la historia humana, los primeros hombres sólo podían


HQFRQWUDUMXVWLÀFDFLyQGHOPXQGRSRUPHGLRGHODH[LVWHQFLDGHORVGLRVHVSXHVWR
TXHSDUDHOORVHUDXQJUDQPLVWHULRHORULJHQGHOVHUKXPDQR\HOXQLYHUVR$OQR
entender su propio origen, el hombre crea historias que le ayudan a explicar su
entorno, es así como se originan los mitos.
Las culturas antiguas consideraron a los elementos de la tierra como
sus dioses, debido a que rebasaban su capacidad para comprenderlos y no podían
dominarlos; de ahí que el sol, la luna, la lluvia, fueran convertidos en deidades y En nuestro
HPSH]DUDQDVHUYHQHUDGRV&RQHOSDVRGHOWLHPSRVHGLHURQDODWDUHDGHGHLÀFDU estado, los libros
también a los muertos, aquéllos que habían sido buenas personas en el transcurso del Chilam Balam
de su vida, sabias, guías espirituales y grandes guerreros; como Quetzalcóatl en (sacerdotes mayas)
contienen una
México, Buda en China, Rama en la India, etcétera. Pero cuando el hombre dejó gran colección de
de ser nómada divinizó también a seres que representaban el alimento, como los relatos míticos.
mayas, adoradores del dios Yum Kaax, dios del maíz.
Cada mito es propiedad de la comunidad a la cual pertenece; posee sus
propias divinidades y da explicaciones acerca de su cultura. No obstante, los mitos
comparten elementos comunes, a pesar de ser de países diferentes, porque dan
explicaciones relacionadas con la existencia misma. Cuando surgen los mitos la
gente los concibe como verdades incuestionables, pues dan sentido a su misteriosa
existencia, por consiguiente, los aceptan como realidades, por muy ilógicas que
parezcan.
Si se trata de la mitología maya, el Popol Vuh aborda el origen del mundo,
de los seres humanos, de los animales, etcétera; sin embargo, existen también otros
pueblos poseedores de extraordinarias y fabulosas mitologías, tales como China,
India y la fastuosa Grecia, la cual goza de un gran prestigio literario y artístico
por poseer mitos famosos considerados como clásicos, obligatorios para quien desea
hacerse conocedor de la literatura universal. Entre los mitos griegos se puede men-
cionar la Teogonía (Los trabajos y los días), escrita en los siglos VIII y VII a.C. por el
poeta Hesíodo, y también las 7HRJRQtDVyUÀFDV, del poeta y cantor Orfeo.

91
Bloque IV Reconoces las diferencias entre la leyenda y el mito

&ODVLÀFDFLyQ
'LIHUHQWHVDXWRUHVFRQVLGHUDQGLYHUVDVFODVLÀFDFLRQHVGHOPLWRVLQHPEDUJRDTXt
incluimos la más apropiada. Dependiendo del tema en la historia narrada, los mitos
SXHGHQFODVLÀFDUVHHQWUHVJUXSRV

Cosmológicos: Intentan explicar el origen del universo, así como la


creación de las plantas, animales, naturaleza y también de los seres humanos.
Teológicos:'HPDQHUDHVSHFtÀFDUHODWDQVXFHVRVHQORVFXDOHVGHVWDFDQ
las grandes hazañas que realizan las divinidades o deidades; dioses que crearon
al ser humano, al planeta o mundo y a la misma naturaleza. En esta clase de
mitos generalmente se narra cuando estas divinidades se encargan de premiar o
castigar a aquellos que los obedezcan o desobedezcan.
Antropológicos: se enfocan en las acciones de los seres humanos,
explican las cualidades o defectos humanos que forman parte de su naturaleza.

Actividad de aprendizaje 2
(OVLJXLHQWHPLWRUHSUHVHQWDXQWLSRGHODFODVLÀFDFLyQDQWHVPHQFLRQDGD/pHOR
y descubre cuál es. Comenta con tus compañeros si es cosmológico, teológico o
antropológico, explicando tus argumentos en tu cuaderno.

El género humano
(Mito africano, tribu Mossi)
En el principio, el creador Uendé hizo a tres hombres y tiempo después
comparecieron ante él para exponerle sus necesidades.
El uno dijo: “Quiero un caballo”.
El otro dijo: “Quiero perros para cazar en la espesura”.
El tercero dijo: “Quiero una mujer para regocijar mi vida”.
El dios Uendé les dio todo: al primero, su caballo; al segundo, los
perros, y al tercero, una mujer.
Los tres hombres se fueron y en su camino de regreso cayeron
fuertes lluvias que ocasionaron que estuvieran tres días encerrados en la
cueva de una montaña. La mujer hizo comida para los tres y, visto esto, los
dos hombres que no tenían mujer dijeron: “volvamos ante Uendé”.
Llegaron allá. Entonces le pidieron mujeres. Y Uendé accedió a
cambiar el caballo en mujer, y los perros en mujeres.
Los hombres se fueron. Pero la mujer sacada del caballo era glo-
tona; las mujeres sacadas de los perros eran malas, y la primera mujer, la
que el dios Uendé había dado a uno de ellos, era buena: es la madre del
género humano.

92
Literatura I Bloque IV
Aspectos contextuales
y textuales del mito
/RVDVSHFWRVFRQWH[WXDOHVGHOPLWRVHUHÀHUHQDOOXJDUpSRFD\FXOWXUDGRQGHVH
ubica el relato. En el mito los espacios pueden ser de dos tipos: real,VLVHUHÀHUH
al lugar en donde habita la comunidad o cultura donde acontecen los sucesos; má-
gico,VLVRQORVOXJDUHVGRQGHKDELWDQODVGLYLQLGDGHVHO2OLPSRHOFLHORLQÀHUQR
HWFpWHUD$OLJXDOTXHODOH\HQGDQRVHSXHGHGHWHUPLQDUFRQH[DFWLWXGHOWLHPSR
en el cual suceden las acciones, ya que en este caso el tiempo narra los orígenes
del universo y la humanidad. El mito es represen-
tativo de la religiosi-
En relación con el autor, estos relatos se conectan directamente con la dad de los pueblos,
cultura creadora del mito, es decir, no tiene un autor concreto, sino que el pueblo muestra esa necesidad
de conectarse con
lo crea para explicar el principio de los tiempos, siendo de esta forma de tradición un ser supremo; por
SRSXODU(QHVDWUDGLFLyQVHYHUHÁHMDGDWDPELpQODHVWUXFWXUDSROtWLFD\VRFLDOGH lo tanto, si quieres
una cultura, es por eso que el conocimiento de los mitos se hace tan importante. conocer cómo es
su religión, debe-
$OUHIHULUQRVDORVDVSHFWRVWH[WXDOHV FRPRVHDERUGyHQODOH\HQGD OR rás leer sus mitos.
hacemos con la estructura, personajes, narrador y lenguaje. En la estructura, la
situación inicial suele contener el planteamiento de las condiciones originarias del
mito; la ruptura del equilibrio presenta el enfrentamiento de las luchas opuestas:
HOELHQ\HOPDO\ODUHVROXFLyQGHOFRQÁLFWRÀQDOL]DHOSUREOHPDSODQWHDGRSHUR
propicia el inicio de otro mito, logrando enlazar unos con otros; por lo tanto el
ÀQDOHVDELHUWR

Los personajes son, por lo general, divinidades o seres extraordinarios


que se relacionan con seres humanos. Este elemento contextual se relaciona
directamente con las acciones mágicas del relato, produciendo la totalidad de
eventos fantásticos, aunque se trate de acciones o cualidades verdaderas y exis-
tentes del mundo y el ser humano.

De manera semejante a otros textos (fábula, epopeya, leyenda), el na-


rrador del mito no presenció los hechos, pero los conoce, por lo tanto es extradie-
gético o externo.
Su característica literaria hace de las palabras un lenguaje artístico: con-
tiene epítetos, hipérboles, símiles y metáforas, las cuales sirven para ayudar a la
descripción de lugares, personajes o acciones, produciendo un efecto mágico en
el texto.
En este bloque te presentamos un mito mexica. Es importante presentarte
datos sobre la deidad que interviene para comprender mejor el texto: Mayáhuel
fue la diosa mexica del maguey, de la embriaguez. Se relaciona con la tierra por
ser la representación de una planta, considerada también, diosa de la fertilidad.
Mayáhuel era representada como una joven con el cuerpo pintado de azul
que se asomaba por una penca de maguey, ataviada con una doble cuerda en una
de las manos, el malacate de algodón sin hilar, con manchas amarillas en su cara.
$OJXQDVYHFHVHUDUHSUHVHQWDGDFRQXQDQDULJXHUDGHMDGH\FDUJDQGRXQDYDVLMDGH
barro. Mayáhuel era signo de la mala suerte. Quien naciera en un día relacionado
con esta diosa, seguro habría de terminar mal: el malacate de algodón y las dos
FXHUGDVVLJQLÀFDQDGXOWHULR\SHUGLFLyQDXQDGRDODHPEULDJXH]

93
Bloque IV Reconoces las diferencias entre la leyenda y el mito

Actividad de aprendizaje 3
$KRUDOHHHOPLWRSHURDQWHVGHGDULQLFLRDODOHFWXUDLPDJLQDGHTXpWUDWDHO
texto a partir del título.
¿De dónde crees que sea? Comenta tus respuestas en clase, pide ayuda a
tu maestro si la necesitas.

Mito de la creación del maguey


$QyQLPR
Cuenta la historia de este mito mexicano que
en un principio Mayáhuel era una hermosa
joven que vivía con su abuela, una Tzintzi-
mitl, estrella que intenta impedir que salga el
sol. En una ocasión Quetzalcóatl la convenció
para que bajase a la tierra para amarse con-
vertidos en las ramas de un árbol bifurcado.
Pero cuando su abuela se despertó y no vio a
Mayáhuel, llamó a otras Tzitzimime para que
bajasen a la tierra para ayudarle a buscar a
su nieta.
Cuando se acercaban el árbol se separó en dos, entonces la abuela,
descubriendo a su nieta como una rama, la despedazó y dejó los restos
para que los devorase otra Tzitzimitl. Sin embargo, la rama en que se había
convertido Quetzacóatl permaneció intacta.
Cuando se alejaron Quetzacóatl tomó los restos de la joven vir-
gen y los enterró. De ello brotó la planta del maguey, de la que se extrae
el pulque, usado en las ceremonias como bebida ritual y ofrenda para los
GLRVHV$VtWUDVVXPXHUWH0D\iKXHOVHFRQYLUWLyHQGLRVD

Retomando el proyecto planteado al inicio de la sesión, analiza el “Mito


GHODFUHDFLyQGHOPDJXH\µLGHQWLÀFDVXVDVSHFWRVWH[WXDOHV\FRQWH[WXDOHV2U-
ganícense en equipos para trabajar de manera colaborativa, pero especialmente,
respetuosa. Comenten lo siguiente:
1) El mito que acabas de leer, ¿a qué cultura pertenece?

2) $UJXPHQWDHOWLSRGHPLWRDOTXHSHUWHQHFHVHJ~QVXWHPD

3) Señala cuál es la divinidad que se humaniza.

4) ¿Se presenta la lucha entre el bien y el mal? Explícala.

94
5)
Literatura I
Con respecto al contexto de producción, ¿quién es el emisor; o bien, la
Bloque IV
persona encargada de relatar el “Mito de la creación del maguey”?

6) (VSHFLÀFDODPRGDOLGDGGHSUHVHQWDFLyQGHHVWHPLWR([SOLFDWXUHV-
puesta.

7) 8VDQGR OODYHV PDUFD HO WH[WR SDUD VHxDODU HO LQLFLR HO FRQÁLFWR \ HO
ÀQDOGHOPLWR
8) &ODVLÀFD ORV SHUVRQDMHV TXH LQWHUYLHQHQ EDViQGRWH HQ OD LPSRUWDQFLD
de cada uno.
‡ Protagonista:

‡ Secundarios:

‡ Incidentales:

‡ Personajes humanos:

‡ Personajes divinos:

9) Determina el tipo de narrador de este mito.

10) Escribe si se mencionan espacios reales y mágicos, y cuáles son.

11) En el mito también está presente el lenguaje artístico, que son los recur-
sos literarios que hacen que la redacción sea de gran calidad estética,
por lo que deberán encerrar en el mito de color naranja los epítetos; de
azul las hipérboles; de morado las comparaciones o símiles, y de rosa
las metáforas.
12) El contexto de recepción se relaciona con el lector. Redacta un pequeño
párrafo donde señales los componentes más importantes que llamaron
VLJQLÀFDWLYDPHQWHWXDWHQFLyQFRQODÀQDOLGDGGHLQWHUSUHWDUHOPHQ-
saje del mito.

95
Bloque IV Reconoces las diferencias entre la leyenda y el mito

Síntesis
D  Elabora en el espacio designado un mapa mental que contenga las ca-
racterísticas de la leyenda y el mito. Integra los dos temas en un solo
esquema.

96
Literatura I
E  Resuelve el siguiente crucigrama.
Bloque IV
Horizontales:
1. Son aquellos mitos que intentan explicar el origen del universo.
3. El mito tiene un carácter.
4. Tipo de narrador que está presente en el mito y la leyenda.
6. Tipo de mito que se caracteriza por relatar las acciones que realizan los dioses
o divinidades.
Verticales:
2. Se caracterizan porque en ellos está ausente el término como.
5. Está conformada por situación inicial, ruptura del equilibrio y resolución del
FRQÁLFWR
7. Este tipo de mito relata las grandes hazañas que realizan los seres humanos.
8. En este texto narrativo breve, los personajes humanos se convierten en divini-
dades.

2
1
7

5
4

8
6

97
Bloque IV Reconoces las diferencias entre la leyenda y el mito

Actividad integradora
1) Elabora un esquema (mapa conceptual, mental, de nubes o cuadro
sinóptico) que contenga la información de la leyenda y del mito.

2) $FRQWLQXDFLyQVHWHSURSRUFLRQDQGRVWH[WRVOLWHUDULRVXQDOH\HQGD\
un mito; realiza la lectura de ambas y, posteriormente, haz las activi-
dades que se te solicitan.

LDÁRUGHODKRQHVWLGDG
Leyenda china
Se cuenta que allá para el año 250 a.C., en la China
antigua, un príncipe de la región norte del país iba a
ser coronado emperador y, de acuerdo con la ley, debía
casarse.
Sabiendo esto, él decidió hacer una compe-
tencia entre las muchachas de la corte para ver quién
VHUtDGLJQDGHVXSURSXHVWD$OGtDVLJXLHQWHHOSUtQFLSH
anunció que recibiría en una celebración especial a to-
das las pretendientes y lanzaría un desafío.
Una anciana que servía en el palacio hacía
muchos años escuchó los comentarios sobre los preparativos. Sintió una
leve tristeza porque sabía que su joven hija tenía un sentimiento profundo
GHDPRUSRUHOSUtQFLSH$OOOHJDUDODFDVD\FRQWDUORVKHFKRVDODMRYHQ
se asombró al saber que ella quería ir a la celebración.

98
Literatura I Bloque IV
Sin poder creerlo le preguntó: “¿Hija mía, qué vas a hacer allí?
Todas las muchachas más bellas y ricas de la corte acudirán. Quítate esa
idea insensata de la cabeza. Sé que debes estar sufriendo, pero no hagas
que el sufrimiento se vuelva locura”.
Y la hija respondió: “No, querida madre, no estoy sufriendo y
tampoco estoy loca. Yo sé que jamás seré escogida, pero es mi oportunidad
de estar por lo menos por algunos momentos cerca del príncipe. Esto me
hará feliz”.
3RU OD QRFKH OD MRYHQ OOHJy DO SDODFLR$OOt HVWDEDQ WRGDV ODV
muchachas más bellas, con las más bellas ropas, las más bellas joyas y
las más determinadas intenciones.
(QWRQFHV ÀQDOPHQWH HO SUtQFLSH DQXQFLy HO GHVDItR ´'DUp D
FDGDXQDGHXVWHGHVXQDVHPLOOD$TXHOODTXHPHWUDLJDODÁRUPiVEHOOD
dentro de seis meses será escogida por mí, esposa y futura emperatriz de
China”.
La propuesta del príncipe seguía las tradiciones de aquel pueblo,
que valoraba mucho la especialidad de cultivar algo, sean: costumbres,
amistades, relaciones, etcétera.
El tiempo pasó y la dulce joven, como no tenía mucha habilidad
en las artes de la jardinería, cuidaba con mucha paciencia y ternura de
VXVHPLOODSXHVVDEtDTXHVLODEHOOH]DGHODÁRUVXUJtDFRPRVXDPRUQR
tendría que preocuparse con el resultado.
Pasaron tres meses y nada brotó. La joven intentó todos los mé-
todos que conocía pero nada había nacido. Día tras día veía más lejos su
sueño, pero su amor era más profundo.
3RUÀQSDVDURQORVVHLVPHVHV\QDGDKDEtDEURWDGR&RQVFLHQWH
de su esfuerzo y dedicación la muchacha le comunicó a su madre que sin
importar las circunstancias ella regresaría al palacio en la fecha y hora
acordadas sólo para estar cerca del príncipe por unos momentos.
En la hora señalada estaba allí, con su vaso vacío. Todas las otras
SUHWHQGLHQWHVWHQtDQXQDÁRUFDGDXQDPiVEHOODTXHODRWUDGHODVPiV
variadas formas y colores.
Ella estaba admirada. Nunca había visto una escena tan bella.
Finalmente, llegó el momento esperado y el príncipe observó a cada una
de las pretendientes con mucho cuidado y atención. Después de pasar por
WRGDVXQDDXQDDQXQFLyVXUHVXOWDGR$TXHOODEHOODMRYHQFRQVXYDVRYD-
cío sería su futura esposa. Todos los presentes tuvieron las más inesperadas
reacciones. Nadie entendía por qué él había escogido justamente a aque-
lla que no había cultivado nada. Entonces, con calma el príncipe explicó:
´(OODIXHOD~QLFD TXH FXOWLYyODÁRUTXH ODKL]RGLJQD GHFRQYHUWLUVHHQ
HPSHUDWUL]ODÁRUGHODKRQHVWLGDG7RGDVODVVHPLOODVTXHHQWUHJXpHUDQ
estériles”.

99
Bloque IV Reconoces las diferencias entre la leyenda y el mito

Popol Vuh
Mito maya
En el comienzo no había nada. Todo era vacío
y desolado. El espacio permanecía inmóvil,
y sobre el caos reposaba la inmensidad del
mar. En el silencio de la oscuridad moraban
los dioses Tepeu, Cucumatz y Hurakán, cuyos
nombres entrañan los misterios de los oríge-
nes, de la existencia y la muerte, tanto de la
Tierra como de los seres que la habitan.
Cuando los dioses llegaron al lugar
donde se encontraban las tinieblas, conver-
saron y concertaron en lo que harían. Entonces dijeron:
³$SURSLDGRHVTXHODVDJXDVVHDSDUWHQGHODWLHUUD(QHVRVOX-
gares habrá siembre fecunda, y de los frutos cosechados comerán sus po-
bladores.
'HHVWHPRGRIXHVHSDUDGDHODJXDGHODWLHUUDÀUPH+HFKRHVWR
los dioses declararon:
—Nuestra primera obra está completa, y es bella ante nuestra
mirada.
Enseguida desearon continuar con la creación, y dijeron:
—Las plantas y árboles no deben crecer solos.
Y los dioses hicieron surgir aves y bestias; pero eran torpes e
insensibles, y al recapacitar en ello, declararon:
—Las bestias, según su especie, dormirán en guaridas, andarán en
cuatro patas y doblegarán la cerviz; el ave morará en el árbol y volará con
el viento, y habrán de multiplicar sus generaciones sin cambio a lo hecho.
Las bestias y las aves cumplieron con lo mandado y nuevamente
los dioses se reunieron y declararon:
—Todo ser vivirá sometido a lo dicho, pero ninguno será súbdito
del silencio; el silencio es desolación, abandono y muerte. Por tanto, con
los atributos que le hemos otorgado y de acuerdo a lo que son, digan nues-
WURVQRPEUHV$OFHQVXYR]\DFXGLUHPRV6HDGHHVWHPRGR
Pero las criaturas creadas no hablaron, y los dioses dijeron:
—Por su tonto mutismo, no vivirán más con los privilegios otor-
gados; unos y otros huirán de sus semejantes, y por no haber hablado ni
habernos reconocido como sus creadores, sus carnes serán maceradas y
devoradas, y entre ustedes mismos se devorarán unos a otros.
Dicho esto, los dioses se retiraron, y las bestias permanecieron
ahí, abandonados a su suerte, resignadas y soportando la sentencia dictada.
$Vt ORV GLRVHV SODQHDURQ FUHDU RWURV VHUHV FDSDFHV GH KDEODU
Entonces dijeron:
—¿Qué haremos para que las nuevas criaturas sepan llamarnos por
nuestros nombres y comprendan que deben invocarnos?
100
Literatura I Bloque IV
Conversaron y concluyeron hacer de barro húmedo la carne de los
seres humanos. Los moldearon poco a poco y cuando concluyeron, las criaturas
eran sólo muñecos de barro fresco que no podían sostenerse en pie, y termina-
ban por desmoronarse al poco tiempo. Mas he aquí que podían hablar; pero en
sus palabras no había conciencia, y por ello los dioses dijeron:
—Vivirán en tanto surgen aquellos que les habrán de sustituir.
Y los dioses se preguntaban cómo harían seres que tuvieran con-
ciencia y comprensión, que les invocaran y supieran lo que ellos eran y
siempre serían. Fue así que la luz de un relámpago iluminó la mente de la
nueva creación.
Los nuevos seres fueron hechos de madera. Parecían en verdad
gente, pero pronto no mostraron tener corazón; eran incapaces de com-
prender el sentido y propósito de sus orígenes. Hablaban pero sus palabras
eran vacías, y en su torpeza no reconocieron a sus creadores, dueños de
cuanto crece y respira.
Por tal causa también fueron condenados, y sobre de ellos los
dioses hicieron caer una lluvia de ceniza que terminó con su existencia.
Decepcionados de lo que creaban, los dioses dispusieron que toda
la tierra se inundara y toda creación sucumbiera. Y así sucedió. Durante
muchas lunas la inundación lo anegó todo.
Después los dioses hicieron otros seres, y el hombre fue hecho de
plantas que crecían en los pantanos, y la mujer fue creada de alargadas
espigas (…) Pero estos tampoco fueron lo que sus creadores esperaban, y
por ello el pájaro Xecotcovah se abatió contra sus ojos, y fueron trituradas
sus carnes por el jaguar Cotzabalam. Sin embargo algunos, al huir hacia
cuevas y árboles, lograron salvarse, y acabaron por convertirse en monos,
y por eso los monos recuerdan vagamente el aspecto de los antiguos pobla-
dores de la tierra Quiché.
Una vez más se reunieron los dioses y concertaron la creación de
seres que serían de carne y hueso, de corazón e inteligencia.
$QWHVGHODPDQHFHUEHQGLMHURQORTXHKDEUtDGHVHUHODOLPHQWR
de aquellos seres. De sitios escondidos arribaron el gato, la zorra, el loro
y el cuervo, quienes traían la nueva de que las mazorcas de maíz amarillo,
morado y blanco estaban altas y maduras. Las mazorcas fueron desgrana-
das, y con los granos puestos en agua de lluvia serenada hicieron las sustan-
cias necesarias para la creación y la prolongación de la vida de los nuevos
seres. De esta naturaleza los dioses los formaron y para darles reciedumbre
les pusieron carrizos por dentro.
Estos nuevos seres mostraron de inmediato la calidad de sus con
ciencias. Fueron cuatro estos primeros: Balam Quitzé o Tigre de Dulce Son-
ULVD%DODP$FDER7LJUHGHOD1RFKH0DKXFXWDKR1RPEUH'LVWLQJXLGRH
Iquí Balam o Tigre de la Luna.
$SHQDVVXUJLGRVGHVXVPDQRVORVGLRVHVORVKLFLHURQFRPSDUHFHU
y preguntaron al primero de ellos:
—Dinos por tu propia boca, y por los demás, qué conciencia tienes
de lo que tú y tus hermanos son y del mundo que los rodea.

101
101
Bloque IV Reconoces las diferencias entre la leyenda y el mito

$ORtUHVWRORVQXHYRVVHUHVVHSHUFDWDURQGHTXHVXVVHQWLGRV
HUDQFRPSOHWRV\GHVHDURQH[SUHVDUVXJUDWLWXG$QRPEUHGHORVGHPiV
Balam Quitzé dijo:
³$XVWHGHVGHEHPRVQXHVWURDOLHQWR \SRUQXHVWURVFRUD]RQHV
sabemos lo que sabemos y somos lo que somos. Entendemos así lo que hay
de grande y de pequeño; percibimos dónde se sostienen los puntos cardi-
nales que limitan lo que nos circunda a lo largo y a lo ancho.
Pero los dioses no vieron con agrado esta declaración al ver que
tenían demasiada conciencia, por lo que una vez más conferenciaron entre sí:
—Ellos comprenden —dijeron— en qué estriba lo idéntico y lo
distinto. Puede tal lucidez ser nociva con el tiempo. Es preciso, por tanto,
limitar los alcances de sus conciencias: no deben conocerlo todo porque
VHHQJDxDUtDQFRQHOVHFUHWRTXHWLHQHHORUGHQGHOFDRV$VtKDUHPRVUH-
troceder su soberbia, y la correcta continuidad de la existencia quedará
por cierto asegurada.
Y para que los nuevos seres no se asemejaran demasiado a ellos,
los dioses formaron, con su aliento, una nube sobre los ojos, y así reduje-
ron su visión para que nunca más pudieran ver demasiado.
Hecho lo anterior, los dioses decidieron darles compañeras y
PLHQWUDVGRUPtDQFUHDURQDVXVPXMHUHV&DNL]DR$JXD%ULOODQWH7]XQX-
QLKDR&DVDGH$JXD&KRLPDR$JXD+HUPRVD\&DKD3DOXPDR&DtGDGH
$JXD&XDQGRGHVSHUWDURQODVYLHURQFRQUHJRFLMRSRUTXHGHYHUDVHUDQ
bellas, y al mirarlas tan esbeltas, de piel tan lozana y de aroma tan grato,
llenos de gozo las tomaron como esposas.
Y de estos ocho provino todo el pueblo maya Quiché, y su estirpe
después se propagaría por la tierra que está en la región del Oriente.

D  &RQEDVHHQODOHFWXUDGHODOH\HQGD´/DÁRUGHODKRQHVWLGDGµ\HOPLWR
“Popol Vuh”, escribe dentro de los recuadros en qué son semejantes y
en qué diferentes.

/H\HQGD´/DÁRUGHODKRQHVWLGDGµ\HOPLWR´3RSRO9XKµ
Semejanzas Diferencias

102
Literatura I
E  9HULÀFDVLORVWH[WRVTXHDFDEDVGHOHHUFRQWLHQHQORVHOHPHQWRVEiVLFRVGHO
Bloque IV
mito y la leyenda, marcando con una equis (x) el cuadro correspondiente.

Elementos de la leyenda y el mito Sí Parcialmente No


¿Las historias relatan sucesos reales?

¿Contienen sucesos fantásticos?


¿Los personajes protagonistas de cada historia se convierten en seres
extraordinarios?
¿Los protagonistas poseen valores?
¿El narrador está en tercera persona?
¿Se describen los lugares donde transitan los personajes?
¿Se mencionan espacios mágicos?
¿Se mencionan sitios que existen realmente?
¢6HXELFDQHQXQWLHPSRHVSHFtÀFR"
¢&RQWLHQHQÀJXUDVOLWHUDULDV OHQJXDMHDUWtVWLFR "
¿Tienen un autor determinado?
¿Contienen los tres elementos básicos: situación inicial, ruptura del
equilibrio, desenlace o resolución?

3) En tu libreta redacta un comentario crítico sobre los dos textos pre-


sentados, tomando en cuenta el análisis realizado anteriormente. Para
realizar la actividad te puedes basar en el ejercicio del mito de “La
creación del maguey”, o bien tu facilitador te proporcionará los aspec-
tos a seguir.

103
103
Bloque IV Reconoces las diferencias entre la leyenda y el mito

Realimentación
Es el momento de saber si la información proporcionada y las actividades realizadas
WHKDQVHUYLGRSDUDUHIRU]DU\DFUHFHQWDUWXVFRQRFLPLHQWRV\KDELOLGDGHV$FRQ-
tinuación se te proporciona una tabla, en la cual deberás escribir lo aprendido en
el bloque. Usa los espacios designados para esta actividad. Ubica tu conocimiento
antes y después de este bloque.

Saberes Antes Después

Puedo explicar el origen de la


leyenda y mito.

&RQR]FRHLGHQWLÀFRTXHODV
características de la leyenda y
el mito son similares en cuanto
a la presencia de personajes
protagonistas y la lucha de
valores y antivalores.
Reconozco en la leyenda y
el mito el lenguaje artístico
presente.

Cuando termines de analizar tu situación frente al desarrollo de competencias,


establece de manera responsable qué estrategias emplearás para alcanzar el nivel
de desempeño deseado.

104
Literatura I Bloque IV
Evaluación de la competencia
Después de socializar los resultados de tus aprendizajes, ubica tu nivel de desem-
peño en la adquisición de las competencias relacionadas con esta sesión, tomando
en consideración el cumplimiento de los criterios presentados al inicio.

Inicial- Resolutivo-
Preformal Autónomo Estratégico
Criterio receptivo básico
  
 
Comprendo
y argumento
Conozco, pero Comprendo
Comprendo No comprendo Comprendo el origen y
no comprendo el origen y
el origen y el origen y el origen y desarrollo de
el origen y desarrollo de
desarrollo de desarrollo de desarrollo de la leyenda
desarrollo de la leyenda
la leyenda la leyenda la leyenda mediante la
la leyenda mediante la
mediante la mediante la mediante la lectura de
mediante la lectura de
lectura de lectura de lectura de textos modelo
lectura de textos modelo y
textos modelo. textos modelo. textos modelo. e investigo para
textos modelo. lo esquematizo.
conocer más de
este tema.
Conozco los
Integro algunos Integro con
No integro aspectos Integro los
de los aspectos argumentos
los aspectos textuales y aspectos
Integro los textuales y los aspectos
textuales y contextuales, textuales y
aspectos textuales contextuales textuales y
y contextuales en contextuales pero no los contextuales
en el análisis contextuales
el análisis de una en el análisis integro en el en el análisis
leyenda mediante
de una leyenda en el análisis
de una leyenda análisis de de una leyenda
la lectura de mediante la de una leyenda
mediante la una leyenda mediante la
textos modelo que lectura de mediante la
selecciono. lectura de mediante la lectura de
textos modelo lectura de
textos modelo lectura de textos modelo
que se plantean textos modelo
que selecciono. textos modelo que selecciono.
en clase. que selecciono.
que selecciono.
Muestro una Muestro una
actitud de actitud de
No muestro Muestro una
respeto ante la respeto ante
Muestro una una actitud de Reconozco actitud de
diversidad de la diversidad
actitud de respeto respeto ante la diversidad respeto ante
ante la diversidad opiniones, pero de opiniones
la diversidad de opiniones la diversidad
de opiniones sólo de aquellas surgidas en la
surgidas en la
de opiniones surgidas en la de opiniones
semejantes colaboración
colaboración de surgidas en la colaboración de surgidas en la
a las mías, de actividades
actividades de colaboración de actividades de colaboración de
aprendizaje. surgidas en la de aprendizaje,
actividades de aprendizaje. actividades de
colaboración de cuando el
aprendizaje. aprendizaje.
actividades de maestro me las
aprendizaje. señala.

105
105
Bloque IV Reconoces las diferencias entre la leyenda y el mito

Inicial- Resolutivo-
Preformal Autónomo Estratégico
Criterio receptivo básico
  
 
Comprendo
y argumento
Conozco, pero Comprendo
No comprendo Comprendo el origen y
Comprendo el
no comprendo el origen y
el origen y el origen y desarrollo del
origen y desarrollo el origen y desarrollo del
desarrollo del desarrollo del mito mediante
del mito a través desarrollo del mito a través
de la lectura de mito a través mito a través la lectura de
mito mediante de la lectura de
textos modelo. de la lectura de de la lectura de textos modelo
la lectura de textos modelo y
textos modelo. textos modelo. e investigo para
textos modelo. lo esquematizo.
conocer más de
este tema.
Conozco los
Integro algunos Integro con
No integro aspectos Integro los
de los aspectos argumentos
los aspectos textuales y aspectos
Integro los textuales y los aspectos
textuales y contextuales, textuales y
aspectos textuales contextuales textuales y
y contextuales
contextuales pero no los contextuales
en el análisis contextuales
en el análisis en el análisis integro en en el análisis
colaborativo en el análisis
colaborativo de colaborativo el análisis colaborativo
un mito, mediante de un mito, colaborativo
de un mito, colaborativo de un mito,
la lectura de mediante la de un mito,
textos modelo que
mediante la de un mito, mediante la
lectura de mediante la
selecciono. lectura de mediante la lectura de
textos modelo lectura de
textos modelo lectura de textos modelo
que se plantean textos modelo
que selecciono. textos modelo que selecciono.
en clase. que selecciono.
que selecciono.
Establezco
Establezco
No establezco Establezco Establezco diferencias
algunas
Establezco diferencias semejanzas diferencias estructurales
diferencias
diferencias estructurales estructurales estructurales y lingüísticas
estructurales y estructurales
y lingüísticas y lingüísticas y lingüísticas entre la leyenda
lingüísticas entre la y lingüísticas
leyenda y el mito
entre la leyenda entre la leyenda entre la leyenda y el mito en la
entre la leyenda
en la redacción y el mito en la y el mito en la y el mito en la redacción de
y el mito en la
de un comentario redacción de redacción de redacción de un comentario
crítico. redacción de
un comentario un comentario un comentario crítico,
un comentario
crítico. crítico. crítico. argumentando
crítico.
cada elemento.
No empleo Empleo de
de manera Empleo la manera Empleo de manera
Empleo de manera Empleo la responsable la
responsable la información responsable la
responsable la información información
información información obtenida de información obtenida de la
obtenida de
obtenida de la obtenida de la leyenda obtenida de leyenda y el mito
leyenda y el mito
la leyenda al establecer
la leyenda y el mito al la leyenda
al establecer y el mito en diferencias
y el mito al establecer y el mito al
diferencias entre la lectura de entre ellos y al
ellos. establecer diferencias establecer compararlos con el
textos.
diferencias entre ellos. diferencias entorno.
entre ellos. entre ellos.

106
Literatura I Bloque IV

107
107
Bloque V:

Comprendes las
características
del cuento
Desempeños del estudiante:
‡ 'HÀQHORVHOHPHQWRV\FDUDFWHUtVWLFDVGHOFXHQWR
‡ Distingue la estructura externa e interna del cuento.
‡ Explica el nivel contextual y el nivel intertextual
‡ Crea y redacta un cuento que contemple valores, creencias, y prácticas
sociales de su comunidad, región o país.

Objetos de aprendizaje:
‡ Cuento Contexto histórico, social, cultura, etc.
‡ Estructura externa e interna: ‡ Corriente literaria
» Contexto: aspectos ‡ Nivel intertextual:
externos
» Personajes
» Texto: aspectos inter-
» Narrador
nos
» Espacio
‡ Nivel contextual:
» Tiempo
» $XWRU
» Lenguaje

Competencias a desarrollar:
‡ ,GHQWLÀFDRUGHQDHLQWHUSUHWDODVLGHDVGDWRV\FRQFHSWRVH[SOtFLWRVH
implícitos en un texto, considerando el contexto en el que se generó y
en el que se recibe.
‡ Evalúa un texto mediante la comparación de un contenido con el de
otros, en función de sus conocimientos previos y nuevos.
‡ Produce textos con base en el uso normativo de la lengua, considerando
la intención y situación comunicativa.
‡ Expresa ideas y conceptos en composiciones coherentes y creativas, con
introducciones, desarrollo y conclusiones claras.
‡ Valora y describe el papel del arte, la literatura y los medios de comu-
nicación en la recreación o la transformación de una cultura, teniendo
en cuenta los propósitos comunicativos de distintos géneros.
‡ Es sensible al arte y participa en la apreciación e interpretación de sus
expresiones en distintos géneros.
‡ Escucha, interpreta y emite mensajes pertinentes en distintos contextos
mediante la utilización de medios, códigos y herramientas apropiados.
‡ Sustenta una postura personal sobre temas de interés y relevancia
JHQHUDOFRQVLGHUDQGRRWURVSXQWRVGHYLVWDGHPDQHUDFUtWLFD\UHÁH[LYD
‡ Mantiene una actitud respetuosa hacia la interculturalidad y la diversi-
dad de creencias, valores, ideas y prácticas sociales.
Bloque V Comprendes las características del cuento

Dinamización
Lee el siguiente cuento y platica con tu grupo cuestiones relacionadas con el tema,
la estructura, los personajes, etcétera. Te servirá para empezar a familiarizarte
con estos textos.

El picador de piedra
Marc E. Boillat de Corgemont Santorio
Cuenta la leyenda que un humilde picador de piedra
vivía resignado en su pobreza, aunque siempre anhe-
laba con deseo convertirse en un hombre rico y pode-
roso. Un buen día expresó en voz alta su deseo y cuál
fue su sorpresa cuando vio que éste se había hecho
realidad: se había convertido en un rico mercader.
Esto le hizo muy feliz, hasta el día que co-
noció a un hombre aún más rico y poderoso que él.
Entonces pidió de nuevo ser así y su deseo también
OHIXHFRQFHGLGR$OSRFRWLHPSRVHFHUFLRUyGHTXH
debido a su condición se había creado muchos enemigos
y sintió miedo.
Cuando vio cómo un feroz samurái resolvía las divergencias con
sus enemigos, pensó que el manejo magistral de un arte de combate le
JDUDQWL]DUtDODSD]\ODLQGHVWUXFWLELOLGDG$VtTXHTXLVRFRQYHUWLUVHHQXQ
respetado samurái y así fue.
Sin embargo, aun siendo un temido guerrero, sus enemigos ha-
bían aumentado en número y peligrosidad. Un día se sorprendió mirando
DOVROGHVGHODVHJXULGDGGHODYHQWDQDGHVXFDVD\SHQVy´eOVtTXHHV
superior, ya que nadie puede hacerle daño y siempre está por encima de
WRGDVODVFRVDV£4XLHURVHUHOVROµ
Cuando logró su propósito tuvo la mala suerte de que una nube se
interpusiera en su camino entorpeciendo su visión, y pensó que la nube era
realmente poderosa y así era como realmente le gustaría ser.
$VtVHFRQYLUWLyHQQXEHSHURDOYHUFyPRHOYLHQWROHDUUDVWUDED
con su fuerza, la desilusión fue insoportable. Entonces decidió que quería
ser viento. Cuando fue viento observó que, aunque soplaba con gran fuerza
a una roca, ésta no se movía y pensó: “¡Ella sí que es realmente fuerte:
TXLHURVHUXQDURFDµ$OFRQYHUWLUVHHQURFDVHVLQWLyLQYHQFLEOHSRUTXH
creía que no existía nada más fuerte que él en todo el universo.
Pero cuál fue su sorpresa al ver que apareció un picador de pie-
dra que tallaba la roca y empezaba a darle la forma que quería pese a su
FRQWUDULDYROXQWDG(VWROHKL]RUHÁH[LRQDU\OHOOHYyDSHQVDUTXHHQGHÀ-
nitiva, su condición inicial no era tan mala y que deseaba de nuevo volver
a ser el picador de piedra que era en un principio.

Si quisiéramos entender la historia que acabamos de leer, tendríamos


TXHGLVFXWLUFXHVWLRQHVFRPRODWHPDWL]DFLyQODFODVLÀFDFLyQGHORVSHUVRQDMHV
la secuencia de tiempo, etcétera. ¿De qué habla el cuento “El picador de piedra”?

110
Literatura I
¿Qué sucedió con los deseos del picador de piedra? ¿Cuál crees que es el mensaje
Bloque V
moral que podemos observar en este cuento? ¿Quiénes son los personajes? Esta
historia nos ayuda a comprender cuántas cosas podemos aprender con la lectura.
8Q WH[WR DUWtVWLFR HVWLPXOD QXHVWUD LPDJLQDFLyQ FUHDWLYLGDG \ VHQVLELOLGDG$ OR
largo de este libro, no cesará nuestra insistencia sobre el aprendizaje tan valioso
que nos proporciona el maravilloso mundo literario, todos los espacios, personajes
e historias que nuestra fantasía nos permita encontrar.
Cuando leemos un cuento, un poema, una obra de teatro, involucramos
nuestros sentidos y nuestra imaginación; vamos recreando esa historia en nuestra
mente, percibiendo olores, sabores, conociendo lugares, es decir, vamos creando
imágenes mentales de la historia que nos relata el escritor.
Como estudiantes quizá no hemos descubierto el mundo interno que
encierra la Literatura, por lo tanto, trata de involucrarte en más historias, tal
vez como uno de los personajes, para que de esta manera vayas dando sentido
a lo que lees. Muchas veces el desinterés surge porque no hemos encontrado el
“sabor” a la lectura y fácilmente perdemos el entusiasmo, más si es el maestro
quien nos proporciona los textos o nos instruye sobre cómo y qué hacer con ellos;
ni qué decir si su extensión rebasa la cuartilla (quizás es en lo primero en lo que
QRVÀMDPRV *HQHUDOPHQWHQRVSUHJXQWDPRV¢FXiQWRWLHPSRPHOOHYDUiOHHUXQ
cuento, una novela? ¿Por qué voy a leer? ¿Para qué me va a servir? ¿Tiene dibujos
que me distraigan?
Cuando leemos acrecentamos nuestro acervo cultural, mejoramos nues-
tra escritura y lectura pero, sobre todo, nos ayuda a recrear y desarrollar el pen-
samiento, la imaginación. Te invitamos a participar activamente en este bloque,
SRUTXH DO ÀQDO FRPSUHQGHUiV HVWH IDQWiVWLFR PXQGR GHO FXHQWR \ QRWDUiV FXiQ
diferente y placentero puede ser su análisis.

Sesión A: El cuento: origen


y características
Proyecto $QDOL]DU ODV FDUDFWHUtVWLFDV GHO FXHQWR SDUD GLVWLQJXLUOR FRPR XQD
obra artística, asumiendo una actitud respetuosa y crítica.

Criterios
‡ Comprendo el origen y desarrollo del cuento a través de la lectura de
diversos textos.
‡ Reconozco los elementos y características del cuento como una forma de
expresión artística que me ayude a expresarme y comunicar vivencias.
‡ Reconozco la estructura externa e interna del cuento como una forma
de visualizar los elementos comunicativos en la lectura de diferentes
textos.
‡ $VXPR XQD DFWLWXG UHVSHWXRVD \ FUtWLFD DQWH OD GLYHUVLGDG GH LGHDV
VLWXDFLRQHV\RSLQLRQHVTXHVHYHDQUHÁHMDGDVHQGLVWLQWRVWH[WRV

111
111
Bloque V Comprendes las características del cuento

Problematización
Usa tu imaginación. Escribe un pequeño relato acerca de qué sucedería si el día de
tu examen tuvieras un contratiempo por un accidente que ocurriera camino a la
HVFXHOD¢4XpHVORTXHKDUtDVDOOOHJDU"¢&yPRMXVWLÀFDUtDVWXUHWUDVR"

Con esta actividad podemos darnos cuenta de la capacidad del ser


humano para crear realidades alternas que lo ayuden a sentirse menos preocupado.
En lo sucesivo encontrarás diferentes textos narrativos con los cuales te
relacionarás de manera directa. Para cumplir con ese objetivo es necesario que
OHDVHOVLJXLHQWHFXHQWR6HJXUDPHQWHVHUiGHWXDJUDGR£'LVIU~WDOR

Un rompecabezas
Gabriel García Márquez
8Q FLHQWtÀFR TXH YLYtD SUHRFXSDGR FRQ
los problemas del mundo, estaba resuelto
a encontrar los medios para aminorarlos…
Pasaba días en su laboratorio en
busca de respuestas para sus dudas. Cierto
día, su hijo de 7 años invadió su santuario
GHFLGLGRDD\XGDUORDWUDEDMDU(OFLHQWtÀ-
co, nervioso por la interrupción, le pidió al
niño que fuese a jugar a otro lado. Viendo
que era imposible sacarlo, el padre pensó
en algo que pudiese darle con el objetivo
de distraer su atención.
De repente se encontró con una revista, en donde había un mapa
con el mundo, justo lo que precisaba. Con unas tijeras recortó el mapa en
varios pedazos y junto con un rollo de cinta se lo entregó a su hijo diciendo:
“como te gustan los rompecabezas, te voy a dar el mundo todo roto para
que lo repares sin ayuda de nadie”.
Entonces calculó que al pequeño le llevaría diez días componer el
mapa, pero no fue así. Pasadas algunas horas, escuchó la voz del niño que
lo llamaba calmadamente. “Papá, papá, ya hice todo, conseguí terminarlo”.

112
Literatura I Bloque V
$OSULQFLSLRHOSDGUHQRFUH\yHQHOQLxR3HQVyTXHVHUtDLPSRVLEOH
que, a su edad, hubiera conseguido recomponer un mapa que jamás había
YLVWR DQWHV 'HVFRQÀDGR HO FLHQWtÀFR OHYDQWy OD YLVWD GH VXV DQRWDFLRQHV
con la certeza de que vería el trabajo digno de un niño. Para su sorpresa, el
mapa estaba completo. Todos los pedazos habían sido colocados en sus
debidos lugares. ¿Cómo era posible? ¿Cómo el niño había sido capaz? De
esta manera, el padre preguntó con asombro a su hijo:
—Hijito, tú no sabías cómo era el mundo, ¿cómo lo lograste?
—Papá —respondió el niño—, yo no sabía cómo era el mundo, pero
cuando sacaste el mapa de la revista para recortarlo, vi que del otro lado
HVWDEDODÀJXUDGHXQKRPEUH$VtTXHGLYXHOWDDORVUHFRUWHV\FRPHQFpD
recomponer al hombre, que sí sabía cómo era. Cuando conseguí arreglar al
hombre, di vuelta la hoja y vi que había arreglado al mundo.

Después de haber leído el cuento, responde las siguientes preguntas:


1) ¿Consideras que este relato es un cuento? ¿Por qué?

2) ¢4XpSRGHPRVUHÁH[LRQDUGHHVWHWH[WR"¢(VWiUHODFLRQDGRFRQDOJXQD
situación actual?

3) ¿Quién cuenta la historia?

4) ¿Quiénes son los personajes?

5) ¿Cuáles son las partes o secuencias que componen este relato?

6) ¿Cuál es la forma de presentación del cuento?

7) (OFXHQWRPH]FODGRVWHPDVDOPLVPRWLHPSR-XVWLÀFDWXUHVSXHVWD

113
113
Bloque V Comprendes las características del cuento

8) García Márquez, en su cuento, ¿transmite alguna enseñanza?

Desarrollo de saberes
Hemos visto que la Literatura ha tenido sus inicios desde tiempos antiguos, cuando
se narraban oralmente los acontecimientos de generación en generación, como ya
se analizó en el bloque III y IV.
Seguramente durante tu niñez tuviste la oportunidad de escuchar cuentos
que te relataban tus papás o tus maestros, sentías emoción al escuchar aquellas
KLVWRULDV¢YHUGDG"$KRUDHQWXVSOiWLFDVFRQWXVFRPSDxHURV\DPLJRVVHJXUDPHQWH
hay alguien con la habilidad para contar sus historias o, más bien, sus anécdotas.
Con frecuencia nos encontramos personas especialistas en inventar
UHODWRVGHVGHODMXVWLÀFDFLyQSRUVXLPSXQWXDOLGDGKDVWDHOSUHWH[WRSRUQRKDFHU
la tarea. Cuando escuchamos sus narraciones decimos “es puro cuento”, “es un
FXHQWLVWDµHVWDVDÀUPDFLRQHVODVKDFHPRVJUDFLDVDODJUDQKLVWRULDTXHFUHDQFRQ
tal de evadir sus responsabilidades, pero lo más impresionante es la verosimilitud
del relato. Todo depende de la emoción y la manera cómo cuentan las cosas.
En nuestra vida, al comunicarnos con los demás, narramos lo que nos ocurre.
eVDHVODQDWXUDOH]DGHOVHUKXPDQRVLHPSUHKDEODPRVGHORTXHQRVVXFHGHVHD
bueno o malo. ¿Consideras que esta realidad es inherente al ser humano? ¿Crees
que todo el tiempo contaremos lo que nos acontece? ¿Por qué?
$KRUDELHQVLVHWUDWDGHUHODWRVOLWHUDULRV\WXYLHUDVTXHHVFRJHUHQWUH
un cuento y una novela, ¿qué escogerías? Seguramente el cuento, por su extensión.
Un cuento puede ser leído de una sola vez sin tener que invertir tanto tiempo,
sobre todo si no has tenido un acercamiento a la Literatura. Cuando lo hagas te
darás cuenta que a través de la lectura podemos dejar volar nuestra imaginación.

Orígenes del cuento


El cuento es una narración relativamente breve perteneciente al género épico,
HVFULWRHQ SURVD\GH FDUiFWHU ÀFWLFLR HVGHFLUSXHGH UHODWDU XQ KHFKR UHDO
pero siempre recreado en la imaginación de su autor.
El cuento ha existido desde que el hombre sintió la necesidad de
expresar aquello que observaba, que no entendía, lo que sentía; de ahí que el
cuento sea de tradición oral (cultura popular), como ya analizamos en los blo-
ques anteriores.

Los cuentos se originan a partir de las leyendas, los mitos, las fábulas,
parábolas, las creencias, costumbres y tradiciones de los pueblos, así también
de historias recopiladas de la Biblia o de hechos heroicos. Cada cultura ha arrai-
gado sus costumbres en estos textos. Los primeros cuentos se cree surgieron en
Mesopotamia, Egipto y la India, por ser las primeras civilizaciones en conocer la
escritura.

114
Literatura I
En toda época se perciben cambios, esos cambios se han dado también en
Bloque V
el cuento, por eso han aparecido distintas corrientes literarias que se adaptan a la
gama de estilos y criterios de los cuentistas que, a su vez, se enlazan con los aspectos
morales, históricos, sociales y económicos de la sociedad en la cual viven; pero lo
más importante del género épico es llegar a lo más íntimo de la mente y del espí-
ULWXGHORVOHFWRUHVSDUDUHÁH[LRQDUVREUHVXUHDOLGDGGHXQDPDQHUDDJUDGDEOH
/RVFXHQWRVSURYHQLHQWHVGHODOLWHUDWXUDKLQG~KDQLQÁXLGRHQODQDUUD-
tiva occidental, traducida por los árabes; están reunidos en Las mil y una noches
\ VRQ QDUUDGRV SRU 6KHUH]DGD (QFLHUUD ÀJXUDV H[WUDRUGLQDULDV SURGXFWR GH OD
imaginación y la fantasía, y es considerada la obra más grande de Oriente. En el
Medioevo surgen diferentes estilos; entre los autores más sobresalientes encontra-
mos al inglés Greoffrey Chaucer (Los cuentos de Canterbury) y al italiano Giovanni
Boccacio (El decamerón).
Los cuentos son de diferentes tipos. Tanto los orientales como los cuentos
de hadas tienen su origen en las leyendas y en el folclor de los primeros tiempos.
Los cuentos tradicionales tratan de enseñar y explicar ciertas situaciones de la
vida del hombre; el cuento moderno se da a partir del siglo XIX, cuando se empieza
a reconocer la intención estética, es decir, como una obra de arte del lenguaje;
pero es hasta el siglo XX que se consolida el género a través del cuento contempo-
ráneo. Por tanto, el cuento actual es creado para hacer arte.

Características del cuento


Es importante hacer mención de las características del cuento para distinguirlo
GHORVWH[WRVEUHYHV\DDQDOL]DGRV IiEXODOH\HQGD\PLWR $GLIHUHQFLDGHHVWRV
textos, el cuento es un poco más extenso y presenta las siguientes características:

‡ Narración relativamente corta, sencilla y concisa, dependiendo tam-


bién del tema desarrollado.
En el mundo del
‡ Intervienen pocos personajes, pero cada uno con personalidad de- cuento todo es posible,
mantiene nues-
ÀQLGD \ FRQ XQD SVLFRORJtD FODUD ORV FXDOHV VH SXHGHQ GLIHUHQFLDU tro interés para
claramente uno de otro. descubrir lo que
encierra, predecir
‡ Se utiliza la prosa como forma de presentación, aunque los perso- qué ocurrirá en la
najes en su participación pueden usar o no el verso como forma de historia.
expresión.
‡ (OOXJDUGHODDFFLyQSXHGHVHULGHQWLÀFDEOHIiFLOPHQWHLQWHUYLQLHQGR
varios espacios en la acción.
‡ Tiene una trama sencilla la cual se concretiza con el argumento o
síntesis de los hechos más importantes de la historia.
‡ $ERUGDXQDVRODWHPiWLFDHVGHFLUVHGHVDUUROODXQDVRODOtQHDHQOD
historia, gracias a los personajes que en ella intervienen.
‡ Es una composición literaria completa (situación inicial, ruptura de
HTXLOLEULR\UHVROXFLyQGHOFRQÁLFWR (ORUGHQGHODVHFXHQFLDSXHGH
variar según las preferencias del autor.

115
115
Bloque V Comprendes las características del cuento

El cuento, como hemos observado, es lo que se narra, lo que se relata.


El cuento tiene un amplio margen que permite emplear más personajes y acciones
en la trama. El desenlace no siempre es feliz. Básicamente el cuento cumple con
los elementos de toda narración, sin embargo la complejidad aumenta gracias a la
extensión y a su trama.

Estructura del cuento


/DVHFXHQFLDHVWUXFWXUDOGHOFXHQWRQRVVHUiGHXWLOLGDGSDUDLGHQWLÀFDUODVSDUWHV
TXH FRPSRQHQ HO HVFULWR$OJXQRV FXHQWRV SXHGHQ SUHVHQWDU XQD VHFXHQFLD TXH
incluya las tres etapas, o en ocasiones no utilizar el desenlace. Dependiendo de la
estructura de cada relato, los podemos llamar cerrados o abiertos, si utilizan o no
ODUHVROXFLyQGHOFRQÁLFWR
Recordemos las partes estructurales del texto literario que coinciden con
las del cuento. Por su extensión y complejidad, el cuento caracteriza estas partes
de la siguiente manera:

‡ Situación inicial: es el inicio del relato. Se presentan los personajes,


el lugar donde se realizan las acciones, la situación de la cual se
deriva la trama y los hechos que ocurren.
‡ Ruptura de equilibrio: se va conociendo el carácter de los personajes.
En este apartado se narran los acontecimientos o problemas por los
que atraviesan los personajes, suele llamarse también clímax (mo-
mento más intenso de la obra).
‡ 5HVROXFLyQGHOFRQÁLFWRVHFRQRFHHOÀQDOGHODKLVWRULDVHVROXFLRQDQ
RVHPRGLÀFDQORVSUREOHPDVTXHDFRQWHFLHURQHQHOUHODWR

$OJXQRVDXWRUHVQRSUHVHQWDQVXVREUDVVLJXLHQGRHVWHRUGHQFDGDXQR
tiene un estilo personal que lo distingue, mostrando primero la ruptura de equili-
brio o empezando con el desenlace. También existe una estructura abierta, cuando
HODXWRUQRGDDFRQRFHUHOGHVWLQRGHORVSHUVRQDMHV\GHMDHOÀQDOSDUDODLPDJL-
QDFLyQGHOOHFWRUSDUDTXHGHGX]FDODVXHUWHGHORVDFWXDQWHVeVWHHVXQUHFXUVR
empleado en los cuentos contemporáneos, en el que se pretende que el receptor
del mensaje intervenga en la historia del cuentista.
Lo contrario sucede con la estructura cerrada. En ésta se presenta el
ÀQDOGHODKLVWRULDFRQRFLHQGRODVXHUWHÀQDOGHORVSHUVRQDMHV/DHVWUXFWXUD
cerrada no necesariamente es de manera lineal, los hechos pueden mostrar rup-
turas temporales que permiten a los personajes recordar o soñar y de esta forma
romper con la secuencia cronológica de los hechos.
La estructura externa del cuento está relacionada con el modo de pre-
sentación, la extensión y la presentación del discurso. Estos componentes ayudan
DLGHQWLÀFDUGHPDQHUDPiVFODUDORVHOHPHQWRVFRPXQLFDWLYRVSDUDFRPSUHQGHU
el texto. Dichos elementos son el emisor: autor; el mensaje: tema, ambiente;
receptor: lector. La comunicación literaria colabora en la interpretación de los
sentimientos proyectados en la obra. Si se conocen los detalles del autor, el men-
saje llega claro y completo hasta el receptor.

116
Literatura I Bloque V
Actividad de aprendizaje 1
(VWD DFWLYLGDG SUHWHQGH UHWRPDU HO SUR\HFWR GH OD VHVLyQ D ÀQ GH PRVWUDU WX
habilidad para analizar las características del cuento. Lee el siguiente cuento y
resuelve lo solicitado en los incisos posteriores a él.

Abuelita
+DQV&KULVWLDQ$QGHUVHQ
$EXHOLWD HV PX\ YLHMD WLHQH PXFKDV DUUXJDV \ HO
pelo completamente blanco, pero sus ojos brillan
como estrellas, sólo que mucho más hermosos, pues
su expresión es dulce, y da gusto mirarlos. También
VDEHFXHQWRVPDUDYLOORVRV\WLHQHXQYHVWLGRGHÁR-
res grandes, grandes, de una seda tan tupida que
FUXMH FXDQGR DQGD$EXHOLWD VDEH PXFKDV PXFKt-
simas cosas, pues vivía ya mucho antes que papá y
mamá, esto nadie lo duda. Tiene un libro de cánti-
cos con recias cantoneras de plata; lo lee con gran
frecuencia. En medio del libro hay una rosa, compri-
mida y seca, y, sin embargo, la mira con una sonrisa
de arrobamiento, y le asoman lágrimas a los ojos.
¿Por qué abuelita mirará así la marchita rosa de su devocionario? ¿No lo sa-
EHV"&DGDYH]TXHODVOiJULPDVGHODDEXHOLWDFDHQVREUHODÁRUORVFRORUHV
cobran vida, la rosa se hincha y toda la sala se impregna de su aroma; se
esfuman las paredes cual si fuesen pura niebla, y en derredor se levanta el
ERVTXHHVSOpQGLGR\YHUGHFRQORVUD\RVGHOVROÀOWUiQGRVHHQWUHHOIROOD-
je, y abuelita vuelve a ser joven, una bella muchacha de rubias trenzas y
redondas mejillas coloradas, elegante y graciosa; no hay rosa más lozana,
pero sus ojos, sus ojos dulces y cuajados de dicha, siguen siendo los ojos
de abuelita.
Sentado junto a ella hay un hombre joven, vigoroso, apuesto.
+XHOHODURVD\HOODVRQUtH³£SHUR\DQRHVODVRQULVDGHDEXHOLWD³Vt\
YXHOYHDVRQUHtU$KRUDVHKDPDUFKDGRpO\SRUODPHQWHGHHOODGHVÀODQ
PXFKRVSHQVDPLHQWRV\PXFKDVÀJXUDVHOKRPEUHJDOODUGR\DQRHVWiOD
rosa yace en el libro de cánticos, y... abuelita vuelve a ser la anciana que
contempla la rosa marchita guardada en el libro.
$KRUDDEXHOLWDVHKDPXHUWR6HQWDGDHQVXVLOODGHEUD]RVHVWDED
contando una larga y maravillosa historia.
—Se ha terminado —dijo— y yo estoy muy cansada; dejadme echar
un sueñito.
Se recostó respirando suavemente, y quedó dormida; pero el
VLOHQFLRVHYROYtDPiV\PiVSURIXQGR\HQVXURVWURVHUHÁHMDEDQODIHOL-
cidad y la paz; se habría dicho que lo bañaba el sol... y entonces dijeron
que estaba muerta.

117
117
Bloque V Comprendes las características del cuento

La pusieron en el negro ataúd, envuelta en lienzos blancos. ¡Estaba


WDQ KHUPRVD D SHVDU GH WHQHU FHUUDGRV ORV RMRV 3HUR WRGDV ODV DUUXJDV
habían desaparecido, y en su boca se dibujaba una sonrisa. El cabello era
blanco como plata y venerable, y no daba miedo mirar a la muerta. Era
siempre la abuelita, tan buena y tan querida. Colocaron el libro de cánticos
bajo su cabeza, pues ella lo había pedido así, con la rosa entre las páginas.
Y así enterraron a abuelita.
En la sepultura, junto a la pared del cementerio, plantaron un
URVDOTXHÁRUHFLyHVSOpQGLGDPHQWH\ORVUXLVHxRUHVDFXGtDQDFDQWDUDOOt
y desde la iglesia el órgano desgranaba las bellas canciones que estaban
escritas en el libro colocado bajo la cabeza de la difunta. La luna enviaba
sus rayos a la tumba, pero la muerta no estaba allí; los niños podían ir por
la noche sin temor a coger una rosa de la tapia del cementerio. Los muertos
saben mucho más de cuanto sabemos todos los vivos; saben el miedo, el
miedo horrible que nos causarían si volviesen. Pero son mejores que
todos nosotros, y por eso no vuelven. Hay tierra sobre el féretro, y tierra
dentro de él. El libro de cánticos, con todas sus hojas, es polvo, y la rosa,
con todos sus recuerdos, se ha convertido en polvo también. Pero encima
VLJXHQ ÁRUHFLHQGR QXHYDV URVDV \ FDQWDQGR ORV UXLVHxRUHV \ HQYLDQGR HO
órgano sus melodías. Y uno piensa muy a menudo en la abuelita, y la ve
con sus ojos dulces, eternamente jóvenes. Los ojos no mueren nunca. Los
nuestros verán a abuelita, joven y hermosa como antaño, cuando besó por
vez primera la rosa, roja y lozana, que yace ahora en la tumba convertida
en polvo.

1) Describe en el siguiente cuadro las acciones más importantes, pertene-


cientes a la secuencia estructural del texto literario.

Situación inicial Ruptura de equilibrio Desenlace

2) $QDOL]DORHVWXGLDGRHQHVWDVHVLyQ
‡ $XWRUGHODREUD

‡ Nombre de los personajes que intervienen:

‡ Forma de presentación:

118
‡
Literatura I
Lugar o espacio de la acción:
Bloque V

‡ Temática que aborda:

‡ Tipo de estructura (abierta o cerrada):

3) ¢3RUTXpHOFXHQWR´$EXHOLWDµHVFRQVLGHUDGRFRPRXQDREUDDUWtVWLFD"
-XVWLÀFDWXUHVSXHVWD

4) ¿Qué emociones nos comunica el autor en su obra? ¿Cómo las presenta?

5) ¿Estás de acuerdo con lo que el autor plantea en su obra acerca de la


abuelita? ¿Cambiarías algún valor en el cuento presentado?

6) 6HxDODORVHOHPHQWRVFRPXQLFDWLYRVGHOFXHQWR´$EXHOLWDµPRVWUDQGR
de qué forma el análisis estructural sirvió para la comprensión del mensaje.

Síntesis
Hemos mencionado que el ser humano siempre tiende a contar o relatar todo
aquello que le ocurre. Por ello, realiza el siguiente ejercicio.
Reúnete con un compañero y conversen sobre un acontecimiento que les

119
119
Bloque V Comprendes las características del cuento

haya sucedido, una anécdota inolvidable. Decidan cuál de los “cuentos” pueden
transcribir. Redacten un texto contando principalmente la anécdota elegida, con-
siderando las características y los elementos del cuento (narración sencilla, pocos
personajes, una sola temática, varios espacios), siguiendo también la secuencia
estructural, y con una extensión mínima de una cuartilla. Puedes incluir elementos
fantásticos, producto de tu imaginación. No olvides asignar nombre a tus perso-
najes. Realiza la revisión de tu trabajo, no debe tener faltas de ortografía. Los
PHMRUHVWUDEDMRVVHOHHUiQHQFODVH£e[LWR

Sesión B: Nivel intertextual


y contextual del cuento
Proyecto:5HGDFWDXQFXHQWRTXHUHÁHMHXQDVLWXDFLyQDFWXDOFRQVLGHUDQGRORV
niveles intertextuales y contextuales de la obra literaria, y manteniendo una
actitud respetuosa ante la diversidad de estilos.

Criterios
‡ Integra los elementos intertextuales y contextuales que componen un
WH[WRFRQHOÀQGHLQWHUSUHWDUPHMRUODREUDOLWHUDULD
‡ Fomenta actitudes propositivas y empáticas al redactar sus textos.

Problematización
$FRQWLQXDFLyQWHSUHVHQWDPRVXQFXHQWRGH/HyQ7yOVWRLSDUDTXHOHDV\SHUFLEDV
su carácter literario.

El zar y la camisa
León Tólstoi
Un zar, hallándose enfermo, dijo:
³£'DUpODPLWDGGHPLUHLQRDTXLHQPHFXUH
Entonces todos los sabios se reunieron y
celebraron una junta para curar al zar, mas no en-
contraron medio alguno. Uno de ellos, sin embargo,
declaró que era posible curar al zar.
—Si sobre la tierra se encuentra un hombre
feliz —dijo—, quítesele la camisa y que se la ponga el
zar, con lo que éste será curado.
El zar hizo buscar en su reino a un hombre feliz. Los enviados del
soberano se esparcieron por todo el reino, mas no pudieron descubrir a un
hombre feliz. No encontraron un hombre contento con su suerte.
El uno era rico, pero estaba enfermo; el otro gozaba de salud,
pero era pobre; aquél, rico y sano, quejábase de su mujer; éste de sus
hijos; todos deseaban algo.

120
Literatura I Bloque V
Cierta noche, muy tarde, el hijo del zar, al pasar frente a una
pobre choza, oyó que alguien exclamaba:
—Gracias a Dios he trabajado y he comido bien. ¿Qué me falta?
El hijo del zar sintiose lleno de alegría; inmediatamente mandó
que le llevaran la camisa de aquel hombre, a quien en cambio había de
darse cuanto dinero exigiera.
Los enviados presentáronse a toda prisa en la casa de aquel hom-
bre para quitarle la camisa; pero el hombre feliz era tan pobre que no tenía
camisa.

1) ¿Qué tipo de narrador se utiliza en el cuento?

2) ¿Quién es el protagonista en la historia?

3) ¿Quién es personaje secundario?

4) Existe el personaje ambiental, ¿quién es?

5) ¢&XiOHV VRQ ORV HVSDFLRV" ¢6RQ FHUUDGRV R DELHUWRV"$UJXPHQWD WX UHV-


puesta.

6) ¢(OWLHPSRHQTXHRFXUUHQORVKHFKRVHVOLQHDORDQDFUyQLFR"-XVWLÀFD
tu respuesta.

7) ¿Cómo es el lenguaje que está utilizando el autor?

Este cuento que acabas de leer fue creado en un contexto social y personal.
Para conocerlo y entenderlo necesitamos hacer un recorrido por los elementos
internos y externos del cuento, para así darnos cuenta del impacto del ambiente
HQODVREUDVOLWHUDULDVHQFXDQWRDVXWHPDFRUULHQWHRGLVFXUVR$ORODUJRGH
esta sesión conoceremos los elementos necesarios para apreciar una obra literaria
y captar su mensaje.

121
121
Bloque V Comprendes las características del cuento

Desarrollo de saberes
&RPR KHPRV YLVWR HO FXHQWR HV XQD YtD GH H[SUHVLyQ$O FRQWDU R QDUUDU QXHV-
tras vivencias vamos desarrollando ciertas habilidades para relatar los hechos,
siguiendo un orden cronológico de los acontecimientos. ¿Crees que al relatar tus
anécdotas o vivencias sigues este orden lineal? Seguramente tus relatos siguen
esa secuencia, pero no siempre es así. Muchas veces cuando alguien te cuenta
algo, por ejemplo, alguna historia de una novela o película o alguna anécdota, no
precisamente la cuentas tal y como te lo han narrado al momento de referírselo a
otras personas, ¿no crees? Probablemente incluyas o cambies acciones. Esto sólo
demuestra el estilo personal, una forma de emplear el lenguaje. La riqueza de
analizar los cuentos, entonces, es reconocer el lenguaje artístico de la obra, la
forma en cómo el autor logra recrear una situación sin el apoyo de las imágenes,
solamente con las palabras, palabras artísticas, palabras estéticas.
Pensemos en una situación cotidiana, ¿qué sucedería si en tu primera
cita no le prestas atención a tu enamorado o enamorada cuando está platicando
\SUHÀHUHVHVWDUDWHQWRDRWUDVFRVDV"¢4XpSHQVDUtD"¢&RQVLGHUDVTXHDFHSWDUtD
salir nuevamente contigo? ¿Qué platicarías con ella o él para mantener su interés?
El autor de una obra centra su atención en el propósito que tiene al comunicar su
obra y en el receptor. Lo que pretende es impactar al lector para que entienda e
interprete el cuento de acuerdo con sus intereses, su entorno y sus experiencias.
El valor de un cuento radica en la maestría del autor para hacer creíbles
o reales los hechos que relata, así también como en el manejo del discurso. Se ha
presentado la importancia de reconocer el arte literario, así como las caracterís-
WLFDV \ HOHPHQWRV GHO JpQHUR QDUUDWLYR$KRUD YDPRV D FRQRFHU FyPR LQÁX\H HO
ambiente que nos rodea en nuestras acciones y en lo que somos, de la misma forma
que determina la producción literaria de un escritor.
$OLJXDOTXHORVGHPiVYLYHVHQXQFRQWH[WRSDUWLFXODU&RQWXIDPLOLDWX
grupo de amigos, en la escuela, con tus compañeros, desempeñas diferentes roles
en diferentes contextos, y de cierta manera intervienen en tu personalidad, en
tus cualidades y valores, marcando tu forma de ser. Eso es lo que sucede con los
autores, cada uno vive diferentes situaciones, en diferentes momentos.
En un plano más extenso, cada época social marca una historia, ya sea
SRUORVDGHODQWRVFLHQWtÀFRVRORVDVSHFWRVHFRQyPLFRVSROtWLFRV\VRFLDOHVD\X-
dando a desarrollar una manera de pensar en los sujetos inmersos en la sociedad
cambiante.
Muchas personas se guían por las modas, ya sea en la forma de vestir, de
hablar (regionalismos, modismos, tecnicismos, neologismos), de escuchar un tipo
GHP~VLFDHWFpWHUD'HODPLVPDIRUPDXQFRQWH[WRKLVWyULFRVRFLDOLQÁX\HHQXQ
escritor, al guiarse por la “moda” de una corriente literaria.
Por lo tanto, la importancia de conocer e integrar los elementos de un
cuento reside en la clara interpretación que podemos hacer del mensaje propio de
XQWH[WROLWHUDULR/RVFRQWH[WRVGHXQDREUDOLWHUDULDQRVyORVLUYHQSDUDLGHQWLÀ-
car el mensaje que el autor nos comunica, sino para apreciar la gran obra artística
frente a nosotros.

122
Literatura I Bloque V
Nivel contextual
El nivel contextualVHUHÀHUHDODSDUWHH[WHUQDGHODREUDDORVDVSHFWRVTXH
LQÁX\HQ HQ HO DXWRU \ TXH GH FLHUWD PDQHUD VH YH UHÁHMDGR HQ VX REUD /RV
elementos contextuales están conformados por los aspectos social, político, eco-
nómico, cultural, así como también el psicológico y personal del autor (su biogra-
ItD (ODXWRUGHÀQHHOWHPDGHVXREUD\HOWUDWDPLHQWRGHOPLVPREDVDGRHQODV
experiencias vividas, en todo aquello que haya observado, la corriente literaria
que imperaba en su época (romanticismo, realismo, naturalismo, etcétera), su
concepto de hombre y de sociedad, o sea, el contexto de producción.
6LQHPEDUJRVDEHUGHODXWRUQRHVVXÀFLHQWHORVOHFWRUHVWDPELpQQHFH-
sitamos involucrarnos. En la medida en la cual nos relacionemos directamente con
el mensaje emitido por el autor literario, entraremos en un proceso comunicativo
que nos permitirá interpretar y analizar la obra misma, logrando ser un lector
activo y competente, capaz de percibir el arte en un texto literario. El contexto
de recepción, por lo tanto, es fundamental.
En el caso de “El zar y la camisa”, León Tólstoi nos presenta la importancia
de ser feliz y disfrutar lo que se tiene, sin envidiar las posesiones o la suerte de
otro. Para entender por qué este autor elige estos personajes o este tema sería
conveniente conocer un poco el contexto que lo rodeó cuando decidió escribir su
cuento, necesitamos conocer más sobre su vida.
Tólstoi fue un escritor ruso autor de novelas importantes como Ana Ka-
renina y Guerra y paz. Perteneció a las clases más altas, sin embargo trató de
UHÁHMDUHQVXVREUDVHOLGHDOUXVRGHOFDPSHVLQRSRUORWDQWRWLHQGHDXWLOL]DUOD
corriente realista del siglo XIX, donde intenta describir la sociedad en la que vivió.
En el cuento de “El zar y la camisa” podemos advertir la situación económica en
que se encontraba la mayoría de la sociedad rusa, así como la situación política
(contexto de producción). Es importante destacar el aspecto moral y psicológico
que podemos observar en este cuento, al enfatizar la felicidad basada en lo que se
tiene y no en el interior de cada individuo.
&RQ UHVSHFWR DO FRQWH[WR GH UHFHSFLyQ SRGHPRV UHÁH[LRQDU VREUH
nuestra propia felicidad, sin confundir el conformismo con la aceptación gustosa
de nuestra realidad y nuestra familia. Podemos, gracias a la lectura de este cuento,
valorar y reconocer nuestra “riqueza” personal.

Corrientes literarias del cuento


Las modas artísticas, llamadas también corrientes literarias, nos ayudan a clasi-
ÀFDUWH[WRVGHSHQGLHQGRGHODpSRFDHQODFXDOOHKD\DWRFDGRYLYLUDODXWRUODV
FDUDFWHUtVWLFDVVRFLDOHV\ORVHOHPHQWRVGHODREUD$FRQWLQXDFLyQVHSUHVHQWDQ
las corrientes literarias del cuento, de manera breve.

Romanticismo
(OURPDQWLFLVPRIXHXQDFRUULHQWHTXHVXUJLyDÀQDOHVGHOVLJOR;9,,,HQ$OHPDQLDH
Inglaterra, como reacción contra el clasicismo y el racionalismo. Contrario a los
movimientos antecesores, el romántico busca la expresión de su yo. Por lo tanto,
utiliza como principales recursos los sentimientos y la imaginación, por encima

123
123
Bloque V Comprendes las características del cuento

de la razón. Cansados de seguir reglas que coarten su libertad, los autores de


esta corriente buscan emanciparse, esperanzados en la espontaneidad y la liber-
tad artística y de pensamiento, con el predominio de la subjetividad. Los autores
TXHVREUHVDOHQHQHVWDFRUULHQWHVRQHQ$OHPDQLD6FKLOOHU\*RHWKH-RVHSKYRQ
Eichendorff, los hermanos Grimm; en Inglaterra, Lord Byron, Percy B. Shelley y
-RKQ.HDWVHQ)UDQFLD$OHMDQGUR'XPDV9LFWRU+XJR$OIUHGGH9LJQ\7KpRSKLOH
Gautier y Gérard de Nerval; en España, José de Espronceda, Mariano José de La-
UUD*XVWDYR$GROIR%pFTXHU\-RVp=RUULOODHQ+LVSDQRDPpULFDHQ0p[LFR,JQDFLR
0DQXHO$OWDPLUDQRHQ$UJHQWLQD(VWHEDQ(FKHYHUUtDHQ3HU~5LFDUGR3DOPDHQ
&RORPELD-RUJH,VDDFV\SRU~OWLPR(GJDU$OODQ3RHQDUUDGRU\SRHWDHVWDGRXQL-
dense, con su narrativa psicológica y gótica.

Realismo
El realismo se da en la segunda mitad del siglo XIX en Francia. Como cada corriente,
los movimientos literarios surgen como una propuesta contraria a la anterior, de
tal suerte que el realismo se opone diametralmente al romanticismo. El realista
pretende ver el mundo tal y como es, sin máscaras ni sueños; experimentando
ese contacto con la realidad, sin sentimientos de por medio. El realismo se propone
UHSURGXFLU OD UHDOLGDG FRQ OD PD\RU ÀGHOLGDG FRPR OH VHD SRVLEOH DQVLDQGR OD
mayor verosimilitud, producto de la observación y la objetividad. Esta corriente
trajo consigo grandes transformaciones a la sociedad, la economía y la ciencia de
su tiempo. En esta corriente destacan los autores de Inglaterra: Charles Dickens
\*HRUJH(OLRWVHXGyQLPRGHODHVFULWRUD0DU\$QQ(YDQV(VSDxD%HQLWR3pUH]
*DOGyV/HRSROGR$ODV-RVp0DUtDGH3HUHGD\-XDQ9DOHUDHQ5XVLD$QWyQ&KpMRY
1LNROiL*yJRO\)HGRU'RVWRLHYVNL$UJHQWLQD&DUORV0DUtD2FDQWRV0p[LFR5DIDHO
Delgado, José López Portillo y Rojas, Heriberto Frías, Ángel del Campo “Micrós”,
entre muchos otros autores hispanoamericanos.

Naturalismo
(OQDWXUDOLVPRVXUJHDÀQDOHVGHOVLJOR;,;HQ)UDQFLDFRQVHUYDQGRODVFDUDFWHUtV-
ticas del realismo, pero tratando de explicar la conducta humana, basándose en
KDOOD]JRVFLHQWtÀFRV\H[SHULPHQWDOHV6HUHFRQRFHD$XJXVWR&RPWHFRPRSUHFXU-
VRUGHOSRVLWLYLVPRFRUULHQWHFLHQWtÀFDHQODFXDOVHEDVDHOQDWXUDOLVPROLWHUDULR
Los temas que abordaban los literatos de esta corriente estaban relacionados con
el alcoholismo, la violencia, la prostitución, la pobreza, la enfermedad, etcétera.
Todos estos fenómenos eran considerados como un mal social, por lo cual se emitía
una crítica severa a estos problemas. Entre los autores que destacan encontramos
DePLOH=ROD*X\GH0DXSDVVDQW\$OSKRQVH'DXGHWGH)UDQFLDHQ$OHPDQLD&DUO
y Gerhart Hauptmann; en Italia, Giovanni Verga y Luigi Capuana; en España, Benito
3pUH]*DOGyV(PLOLD3DUGR%D]iQ/HRSROGR$ODV´&ODUtQµ\9LFHQWH%DVFR,EixH]\
por último, en México, Federico Gamboa, Ángel del Campo y Vicente Riva Palacio,
entre otros autores destacados.

Modernismo
(OPRGHUQLVPRVXUJLyDÀQDOHVGHOVLJOR;,;\SULQFLSLRVGHOVLJOR;;HQ+LVSDQRDPp-
rica y España. Se da con un afán de lo novedoso y busca la libertad creadora del
DXWRUSHURVLHPSUHSHUVLJXLHQGRXQWH[WRUHÀQDGRVXJHUHQWHFRQWHPDVVHQVXDOHV
y decadentes. Sus principales elementos provienen de dos escuelas, esencialmente,
el parnasianismo y el simbolismo, donde lo que interesa es la forma y la realidad
alternaTXHVHUHÁHMDHQORVVtPERORV(OPi[LPRH[SRQHQWHGHHVWDFRUULHQWHHV

124
Literatura I
el nicaragüense Rubén Darío. Entre los escritores españoles se encuentran Manuel
Bloque V
Machado, Francisco Villaespesa y Ramón del Valle Inclán. El cubano José Martí; los
argentinos Leopoldo Lugones, Ricardo Jaimes Freire y Julio Herrera; los mexicanos
6DOYDGRU'tD]0LUyQ0DQXHO*XWLpUUH]1iMHUD$PDGR1HUYR/XLV*8UELQDVRQ
WDPELpQJUDQGHVDXWRUHVGHHVWDpSRFD6LQROYLGDUDOLUODQGpV2VFDU:LOGHTXLHQ
logró en sus cuentos hablar magistralmente del amor de una manera diferente.

Vanguardismo
El vanguardismo se da en Europa a inicios del siglo XX. Es un conjunto de movi-
mientos artísticos que pretenden, como todos, oponerse a lo anterior, buscando
proponer nuevas técnicas artísticas. Sobre todo franceses, los vanguardistas sugie-
ren cambios en lo moderno. Su deseo transformador se basa en las vivencias dra-
máticas del momento: es decir, el periodo llamado entreguerras, cuando la gente
necesitaba volcarse en manifestaciones de felicidad o tristeza. Las tendencias
vanguardistas son conocidas como “los ismos”: cubismo, futurismo, dadaísmo,
surrealismo, creacionismo, ultraísmo, estridentismo, las cuales intentan transfor-
mar la realidad para comprenderla mejor, sólo quieren ser creativos y revolucio-
narios, experimentar constantemente. Dentro de la corriente cubista sobresale el
SRHWD*XLOODXPH$SROOLQDLUHGHOIXWXULVPRHOSRHWD)LOLSSR7RPPDVR0DULQHWWL
FRQ HO GDGDtVPR HO SRHWD UXPDQR 7ULVWiQ 7]DUD GHO VXUUHDOLVPR$QGUp %UHWRQ
de la escritura automática y del creacionismo sobresale el poeta chileno Vicente
Huidobro; del ultraísmo, Gerardo Diego, Ramón Gómez de la Serna y Juan Larrea,
así como también Jorge Luis Borges y por último, del estridentismo, tenemos a
0DQXHO0DSOHV$UFH

Actividad de aprendizaje 2
Investiga las características de las vanguardias y elaboren, por equipos, un cuadro
sinóptico con la descripción de cada una y sus elementos principales. Un trabajo enri-
quecedor mostraría también ejemplos de textos literarios propios de cada “ismo”.
En la siguiente clase muestren su trabajo al grupo y comenten sobre el contenido
de la actividad.
Los personajes,

Nivel intertextual
el tipo de narrador,
espacio y tiempo del
relato, el ambiente,
el lenguaje artístico
$XQTXHHOFXHQWRFRQWLHQHORVPLVPRVHOHPHQWRVLQWHUWH[WXDOHVTXHORVRWURVWH[- (connotativo) y
tos literarios, por su complejidad y extensión puede además incluir diversos temas la tematización,
forman parte del
y, en consecuencia, diversos niveles de contenido. Precisamente esa tematización nivel intertextual
propicia un manejo particular de sentimientos y emociones de los personajes que, del cuento.
a su vez, favorecen un ambiente especial en el relato. El cuento nos da la oportuni-
dad de experimentar junto con los personajes esos sentimientos y “engancharnos”
con el ambiente de suspenso, de misterio, festivo, triste, serio, jovial, amoroso,
feliz, etcétera.
El nivel de contenido (relacionado con el tema tratado) puede ser de
tipo social, económico, político, cultural, ético o moral y religioso. Los cuentos
pueden emplear varios niveles de contenido. Este es el caso de “El zar y la ca-
misa”, que utiliza un nivel de contenido social, económico y moral, al hablar de
clases sociales, condiciones económicas y de la felicidad, respectivamente.
Si analizamos el ambiente HQHOFXHQWRGH7yOVWRLSRGHPRVLGHQWLÀFDUOD

125
125
Bloque V Comprendes las características del cuento

tristeza y la incertidumbre, porque el zar estaba muy enfermo (se puede deducir
que la tristeza era su enfermedad); desesperación, por no encontrar a un hombre
feliz; alegría, por haber “encontrado” al hombre feliz, pero sin camisa para ponerse.
$ODQDOL]DUORVHOHPHQWRVLQWHUWH[WXDOHVORVSHUVRQDMHVTXHLQWHUYLHQHQ
VHSXHGHQFODVLÀFDUHQSURWDJRQLVWD HO]DU VHFXQGDULRV HOKRPEUHSREUH\IHOL]
el hijo, los sabios, los hombres rico, sano, sano y rico).
Gracias a estos mismos elementos podemos encontrar diferentes espacios
donde se desarrollan las acciones: el reino, el palacio y la choza pobre. También
se reconoce un narrador extradiegético porque el relato es contado en tercera
persona. En lo referente al tiempo del cuento, las acciones se realizan de manera
lineal, es decir, se presenta una secuencia cronológica y ordenada de las acciones.
Es importante hacer mención de otra alternativa temporal: el tiempo frag-
mentado o rupturas temporales que suceden cuando la cronología no se sigue en
LQLFLRGHVDUUROORÀQ\ODVHFXHQFLDVHLQWHUUXPSHFRQORVUHFXHUGRVRVXHxRVGHORV
personajes (retrospección) y cuando anticipan o predicen su futuro (prospección).

Actividad de aprendizaje 3
,GHQWLÀFDHOOHQJXDMHOLWHUDULRXVDGRHQ´(O]DU\ODFDPLVDµ\HVFUtEHORHQORV
espacios correspondientes.
1) Metáforas:

2) Epítetos:

3) Comparaciones o símiles:

4) Hipérboles:

Actividad de aprendizaje 4
Con el objetivo de demostrar que estamos listos para realizar el proyecto plan-
teado en esta sesión, se propone la siguiente actividad, en la que redactaremos
nuestro propio cuento, considerando los niveles contextuales e intertextuales.
‡ Redacta un cuento breve, teniendo como lineamientos o parámetros a
seguir lo siguiente: tu texto debe de ser mínimo de media cuartilla, en
donde el tema a escoger sea social (familia, amigos, escuela, organiza-
ción en el salón, etcétera), político (ideologías o formas de pensar en

126
Literatura I
las relaciones de poder), religioso (temáticas relacionadas con la fe),
Bloque V
o económico (modos de producción, distribución de bienes, obrero-
patronales, clases sociales).
‡ 5HFXHUGDHOFXHQWRHVÀFWLFLRORLPSRUWDQWHHVKDFHUORFUHtEOHDORV
lectores. Déjate llevar por tu imaginación e inventa tu propio cuento,
empleando tu estilo y originalidad. Sé un artista aprovechando el arte
de la palabra.
‡ Como tú eres el autor del texto, tendrás que escribir una pequeña auto-
biografía para que la clase comprenda mejor el mensaje que escribirás.
‡ Transcríbelo en computadora y entrégalo para tu portafolio de evidencias.

Síntesis
Los cuentos, como hemos visto, requieren de habilidad y competencia lingüística
para poder disfrutar amenamente de ellos. Los niveles de contenido conforman el
eje principal de la obra, porque a partir de ellos podemos analizar los elementos
internos y externos de la obra. El nivel contextual de la obra es sumamente impor-
tante, gracias a él comprenderemos totalmente la obra, al saber los motivos que
incitaron al autor a escribir de esa manera, sobre ese tema, con esos personajes,
HWFpWHUD HV GHFLU FRQRFHPRV VX SHUVRQDOLGDG 'HO PLVPR PRGR LGHQWLÀFDU ORV
elementos del nivel intertextual, nos ayuda a comprender e interpretar mejor el
mensaje del texto.

Actividad integradora
Lean de manera individual el siguiente cuento y respondan en equipos la actividad
posterior.

El corazón delator
Edgar Allan Poe, traducción de Julio Cortázar
£(VFLHUWR6LHPSUHKHVLGRQHUYLRVRPX\QHUYLRVRWHUULEOHPHQWHQHUYLRVR
¢3HURSRUTXpDÀUPDQXVWHGHVTXHHVWR\ORFR"/DHQIHUPHGDGKDEtDDJX-
dizado mis sentidos, en vez de destruirlos o embotarlos. Y mi oído era el
más agudo de todos. Oía todo lo que puede oírse en la tierra y en el cielo.
0XFKDV FRVDV Rt HQ HO LQÀHUQR ¢&yPR SXHGR HVWDU ORFR HQWRQFHV" (VFX-
chen... y observen con cuánta cordura, con cuánta tranquilidad les cuento
mi historia.
Me es imposible decir cómo aquella idea me entró en la cabeza
por primera vez; pero, una vez concebida, me acosó noche y día. Yo no
perseguía ningún propósito. Ni tampoco estaba colérico. Quería mucho al
viejo. Jamás me había hecho nada malo. Jamás me insultó. Su dinero no
PH LQWHUHVDED 0H SDUHFH TXH IXH VX RMR £6t HVR IXH7HQtD XQ RMR VH-
mejante al de un buitre... Un ojo celeste, y velado por una tela. Cada
vez que lo clavaba en mí se me helaba la sangre. Y así, poco a poco, muy
gradualmente, me fui decidiendo a matar al viejo y librarme de aquel ojo
para siempre.

127
127
Bloque V Comprendes las características del cuento

Presten atención ahora. Ustedes me toman por loco. Pero los lo-
FRVQRVDEHQQDGD(QFDPELR£6LKXELHUDQSRGLGRYHUPH£6LKXELHUDQ
SRGLGRYHUFRQTXpKDELOLGDGSURFHGt£&RQTXpFXLGDGRFRQTXpSUHYL-
VLyQFRQTXpGLVLPXORPHSXVHDODREUD-DPiVIXLPiVDPDEOHFRQHO
viejo que la semana antes de matarlo. Todas las noches, hacia las doce,
hacía yo girar el picaporte de su puerta y la abría... ¡oh, tan suavemen-
WH< HQWRQFHV FXDQGR OD DEHUWXUD HUD OR EDVWDQWH JUDQGH SDUD SDVDU OD
cabeza, levantaba una linterna sorda, cerrada, completamente cerrada,
de manera que no se viera ninguna luz, y tras ella pasaba la cabeza. ¡Oh,
XVWHGHVVHKXELHUDQUHtGRDOYHUFXiQDVWXWDPHQWH SDVDEDODFDEH]D/D
PRYtDOHQWDPHQWHPX\PX\OHQWDPHQWHDÀQGHQRSHUWXUEDUHOVXHxR
del viejo. Me llevaba una hora entera introducir completamente la cabeza
por la abertura de la puerta, hasta verlo tendido en su cama. ¿Eh? ¿Es que
un loco hubiera sido tan prudente como yo? Y entonces, cuando tenía la
cabeza completamente dentro del cuarto, abría la linterna cautelosamen-
WH£RKWDQFDXWHORVDPHQWH6tFDXWHORVDPHQWHLEDDEULHQGRODOLQWHUQD
SXHVFUXMtDQODVELVDJUDV ODLEDDEULHQGRORVXÀFLHQWHSDUDTXHXQVROR
rayo de luz cayera sobre el ojo de buitre. Y esto lo hice durante siete largas
noches... cada noche, a las doce... pero siempre encontré el ojo cerrado,
y por eso me era imposible cumplir mi obra, porque no era el viejo quien
me irritaba, sino el mal de ojo. Y por la mañana, apenas iniciado el día,
entraba sin miedo en su habitación y le hablaba resueltamente, llamándolo
por su nombre con voz cordial y preguntándole cómo había pasado la no-
che. Ya ven ustedes que tendria que haber sido un viejo muy astuto para
sospechar que todas las noches, justamente a las doce, iba yo a mirarlo
mientras dormía.
$O OOHJDU OD RFWDYD QRFKH SURFHGt FRQ PD\RU FDXWHOD TXH GH
costumbre al abrir la puerta. El minutero de un reloj se mueve con más
rapidez de lo que se movía mi mano. Jamás, antes de aquella noche, ha-
EtDVHQWLGRHODOFDQFHGHPLVIDFXOWDGHVGHPLVDJDFLGDG$SHQDVORJUDED
contener mi impresión de triunfo. ¡Pensar que estaba ahí, abriendo poco a
poco la puerta, y que él ni siquiera soñaba con mis secretas intenciones o
SHQVDPLHQWRV0HUHtHQWUHGLHQWHVDQWHHVWDLGHD\TXL]iPHR\ySRUTXH
lo sentí moverse repentinamente en la cama, como si se sobresaltara. Us-
tedes pensarán que me eché hacia atrás... pero no. Su cuarto estaba tan
negro como la pez, ya que el viejo cerraba completamente las persianas
por miedo a los ladrones; yo sabía que le era imposible distinguir la abertu-
ra de la puerta, y seguí empujando suavemente, suavemente.
Había ya pasado la cabeza y me disponía a abrir la linterna, cuan-
do mi pulgar resbaló en el cierre metálico y el viejo se enderezó en el
lecho, gritando:
—¿Quién está ahí?
Permanecí inmóvil, sin decir palabra. Durante una hora entera no
moví un solo músculo, y en todo ese tiempo no oí que volviera a tenderse
en la cama. Seguía sentado, escuchando... tal como yo lo había hecho,
noche tras noche, mientras escuchaba en la pared los taladros cuyo sonido
anuncia la muerte.

128
Literatura I Bloque V
Oí de pronto un leve quejido, y supe que era el quejido que nace
GHOWHUURU1RH[SUHVDEDGRORURSHQD£RKQR(UDHODKRJDGRVRQLGRTXH
brota del fondo del alma cuando el espanto la sobrecoge. Bien conocía yo
ese sonido. Muchas noches, justamente a las doce, cuando el mundo entero
dormía, surgió de mi pecho, ahondando con su espantoso eco los terrores
que me enloquecían. Repito que lo conocía bien. Comprendí lo que estaba
sintiendo el viejo y le tuve lástima, aunque me reía en el fondo de mi co-
razón. Comprendí que había estado despierto desde el primer leve ruido,
cuando se movió en la cama. Había tratado de decirse que aquel ruido no
era nada, pero sin conseguirlo. Pensaba: “No es más que el viento en la
chimenea... o un grillo que chirrió una sola vez”. Sí, había tratado de dar-
se ánimo con esas suposiciones, pero todo era en vano. Todo era en vano,
porque la Muerte se había aproximado a él, deslizándose furtiva, y envolvía
DVXYtFWLPD<ODI~QHEUHLQÁXHQFLDGHDTXHOODVRPEUDLPSHUFHSWLEOHHUD
la que lo movía a sentir —aunque no podía verla ni oírla—, a sentir la pre-
sencia de mi cabeza dentro de la habitación.
Después de haber esperado largo tiempo, con toda paciencia, sin
oír que volviera a acostarse, resolví abrir una pequeña, una pequeñísima
ranura en la linterna.
$VtORKLFH³QRSXHGHQLPDJLQDUVHXVWHGHVFRQTXpFXLGDGRFRQ
TXpLQPHQVRFXLGDGR³KDVWDTXHXQÀQRUD\RGHOX]VHPHMDQWHDOKLORGH
la araña, brotó de la ranura y cayó de lleno sobre el ojo de buitre.
Estaba abierto, abierto de par en par... y yo empecé a enfurecer-
me mientras lo miraba. Lo vi con toda claridad, de un azul apagado y con
aquella horrible tela que me helaba hasta el tuétano. Pero no podía ver
nada de la cara o del cuerpo del viejo, pues, como movido por un instinto,
había orientado el haz de luz exactamente hacia el punto maldito.
¿No les he dicho ya que lo que toman erradamente por locura es
sólo una excesiva agudeza de los sentidos? En aquel momento llegó a mis
oídos un resonar apagado y presuroso, como el que podría hacer un reloj
HQYXHOWRHQDOJRGyQ$TXHOVRQLGRWDPELpQPHHUDIDPLOLDU(UDHOODWLUGHO
FRUD]yQGHOYLHMR$XPHQWyD~QPiVPLIXULDWDOFRPRHOUHGREODUGHXQ
tambor estimula el coraje de un soldado.
3HURLQFOXVRHQWRQFHVPHFRQWXYH\VHJXtFDOODGR$SHQDVVLUHV-
piraba. Sostenía la linterna de modo que no se moviera, tratando de man-
WHQHUFRQWRGDODÀUPH]DSRVLEOHHOKD]GHOX]VREUHHORMR(QWUHWDQWRHO
infernal latir del corazón iba en aumento. Se hacía cada vez más rápido,
cada vez más fuerte, momento a momento. El espanto del viejo tenía que
VHU WHUULEOH £&DGD YH] PiV IXHUWH PiV IXHUWH ¢0H VLJXHQ XVWHGHV FRQ
atención? Les he dicho que soy nervioso. Sí, lo soy. Y ahora, a mediano-
che, en el terrible silencio de aquella antigua casa, un resonar tan extraño
como aquél me llenó de un horror incontrolable. Sin embargo, me contuve
todavía algunos minutos y permanecí inmóvil. ¡Pero el latido crecía cada
YH]PiVIXHUWHPiVIXHUWH0HSDUHFLyTXHDTXHOFRUD]yQLEDDHVWDOODU
< XQD QXHYD DQVLHGDG VH DSRGHUy GH Pt £$OJ~Q YHFLQR SRGtD HVFXFKDU
DTXHOVRQLGR£/DKRUDGHOYLHMRKDEtDVRQDGR/DQ]DQGRXQDODULGRDEUt
del todo la linterna y me precipité en la habitación. El viejo clamó una
vez... nada más que una vez. Me bastó un segundo para arrojarlo al suelo
y echarle encima el pesado colchón. Sonreí alegremente al ver lo fácil que

129
129
Bloque V Comprendes las características del cuento

me había resultado todo. Pero, durante varios minutos, el corazón siguió


latiendo con un sonido ahogado. Claro que no me preocupaba, pues nadie
SRGUtDHVFXFKDUORDWUDYpVGHODVSDUHGHV&HVySRUÀQGHODWLU(OYLHMR
había muerto. Levanté el colchón y examiné el cadáver. Sí, estaba muerto,
FRPSOHWDPHQWHPXHUWR$SR\pODPDQRVREUHHOFRUD]yQ\ODPDQWXYHDVt
largo tiempo. No se sentía el menor latido. El viejo estaba bien muerto. Su
ojo no volvería a molestarme.
Si ustedes continúan tomándome por loco dejarán de hacerlo
cuando les describa las astutas precauciones que adopté para esconder el
cadáver. La noche avanzaba, mientras yo cumplía mi trabajo con rapidez,
SHUR HQ VLOHQFLR$QWH WRGR GHVFXDUWLFp HO FDGiYHU /H FRUWp OD FDEH]D
brazos y piernas.
Levanté luego tres planchas del piso de la habitación y escondí
los restos en el hueco. Volví a colocar los tablones con tanta habilidad que
ningún ojo humano —ni siquiera el suyo— hubiera podido advertir la menor
diferencia. No había nada que lavar... ninguna mancha... ningún rastro de
sangre. Yo era demasiado precavido para eso. Una cuba había recogido
WRGR£MDMD
Cuando hube terminado mi tarea eran las cuatro de la madruga-
da, pero seguía tan oscuro como a medianoche. En momentos en que se
RtDQODVFDPSDQDGDVGHODKRUDJROSHDURQDODSXHUWDGHODFDOOH$FXGtD
abrir con toda tranquilidad, pues ¿qué podía temer ahora?
Hallé a tres caballeros, que se presentaron muy civilmente como
RÀFLDOHVGHSROLFtD'XUDQWHODQRFKHXQYHFLQRKDEtDHVFXFKDGRXQDOD-
ULGRSRUORFXDOVHVRVSHFKDEDODSRVLELOLGDGGHDOJ~QDWHQWDGR$OUHFLELU
este informe en el puesto de policía, habían comisionado a los tres agentes
para que registraran el lugar.
6RQUHtSXHV¢TXpWHQtDTXHWHPHU"'LODELHQYHQLGDDORVRÀFLD-
les y les expliqué que yo había lanzado aquel grito durante una pesadilla.
Les hice saber que el viejo se había ausentado a la campaña. Llevé a los
visitantes a recorrer la casa y los invité a que revisaran, a que revisaran
bien. Finalmente, acabé conduciéndolos a la habitación del muerto. Les
mostré sus caudales intactos y cómo cada cosa se hallaba en su lugar. En
HOHQWXVLDVPRGHPLVFRQÀGHQFLDVWUDMHVLOODVDODKDELWDFLyQ\SHGtDORV
tres caballeros que descansaran allí de su fatiga, mientras yo mismo, con
la audacia de mi perfecto triunfo, colocaba mi silla en el exacto punto bajo
el cual reposaba el cadáver de mi víctima.
/RVRÀFLDOHVVHVHQWtDQVDWLVIHFKRV0LVPRGDOHVORVKDEtDQFRQ-
vencido. Por mi parte, me hallaba perfectamente cómodo. Sentáronse y
hablaron de cosas comunes, mientras yo les contestaba con animación.
Mas, al cabo de un rato, empecé a notar que me ponía pálido y deseé que
se marcharan. Me dolía la cabeza y creía percibir un zumbido en los oídos;
pero los policías continuaban sentados y charlando. El zumbido se hizo más
intenso; seguía resonando y era cada vez más intenso. Hablé en voz muy
alta para librarme de esa sensación, pero continuaba lo mismo y se iba ha-
FLHQGRFDGDYH]PiVFODUDKDVWDTXHDOÀQPHGLFXHQWDGHTXHDTXHO
sonido no se producía dentro de mis oídos.

130
Literatura I Bloque V
Sin duda, debí de ponerme muy pálido, pero seguí hablando con
creciente soltura y levantando mucho la voz. Empero, el sonido aumen-
taba... ¿y que podía hacer yo? Era un resonar apagado y presuroso..., un
sonido como el que podría hacer un reloj envuelto en algodón. Yo jadeaba,
tratando de recobrar el aliento, y, sin embargo, los policías no habían oído
nada. Hablé con mayor rapidez, con vehemencia, pero el sonido crecía
FRQWLQXDPHQWH0HSXVHHQSLH\GLVFXWtVREUHLQVLJQLÀFDQFLDVHQYR]PX\
alta y con violentas gesticulaciones; pero el sonido crecía continuamente.
¢3RUTXpQRVHLEDQ"$QGXYHGHXQODGRDRWURDJUDQGHVSDVRVFRPRVLODV
observaciones de aquellos hombres me enfurecieran; pero el sonido crecía
FRQWLQXDPHQWH £2K 'LRV ¢4Xp SRGtD KDFHU \R" /DQFp HVSXPDUDMRV GH
rabia... maldije... juré... Balanceando la silla sobre la cual me había sen-
tado, raspé con ella las tablas del piso, pero el sonido sobrepujaba todos
ORVRWURV\FUHFtDVLQFHVDU£0iVDOWRPiVDOWRPiVDOWR<HQWUHWDQWR
los hombres seguían charlando plácidamente y sonriendo. ¿Era posible que
QRR\HUDQ"£6DQWR'LRV£1RQR£&ODURTXHRtDQ\TXHVRVSHFKDEDQ£6D-
EtDQ\VHHVWDEDQEXUODQGRGHPLKRUURU£6tDVtORSHQVp\DVtORSLHQVR
KR\£3HURFXDOTXLHUFRVDHUDSUHIHULEOHDDTXHOODDJRQtD£&XDOTXLHUFRVD
VHUtDPiVWROHUDEOHTXHDTXHOHVFDUQLR£1RSRGtDVRSRUWDUPiVWLHPSRVXV
VRQULVDVKLSyFULWDV£6HQWtTXHWHQtDTXHJULWDURPRULU\HQWRQFHVRWUD
YH]HVFXFKHQPiVIXHUWHPiVIXHUWHPiVIXHUWHPiVIXHUWH
³£%DVWD\DGHÀQJLUPDOYDGRV³DXOOp³£&RQÀHVRTXHORPDWp
£/HYDQWHQHVRVWDEORQHV£$KtDKt£'RQGHHVWiODWLHQGRVXKRUULEOHFR-
UD]yQ

1) (OFXHQWRGH$OODQ3RHSHUWHQHFHDOJpQHUR

2) El narrador es de tipo:

3) El personaje protagónico se llama:

4) ¿Qué otros personajes encontramos en el cuento?

5) ¿Cuál es el ambiente que se experimenta en este cuento?

6) ¿En qué lugar o lugares se desarrollan las acciones?

131
131
Bloque V Comprendes las características del cuento

7) ¿Cómo es el lenguaje que utiliza el autor? Escribe las frases donde se


SXHGHLGHQWLÀFDUHVWHDVSHFWR

8) ¿Qué niveles de contenido se emplean en el cuento?

9) ¢$TXpFRUULHQWHOLWHUDULDSHUWHQHFHHOFXHQWR"

10) La estructura del cuento ¿es abierta o cerrada? ¿Por qué?

11) ,QYHVWLJDYLGD\REUDGHODXWRU([SOLFDFyPRVXYLGDLQÁX\yHQVXREUD

12) Como lector activo, en tu cuaderno de apuntes efectúa una crítica del
cuento leído, basándote en las siguientes cuestiones. ¿Por qué crees que
el joven mató al anciano? ¿Qué lazo afectivo lo unía a él? ¿Por qué crees
que el cuento se llamó “El corazón delator”? Si pudieras continuar con
la historia, ¿qué situaciones o acciones le agregarías al desenlace?

132
Literatura I Bloque V
Realimentación
$QWHV GH FRQFOXLU QXHVWUR EORTXH HV LPSRUWDQWH TXH VHSDV \ YDORUHV WRGDV ODV
habilidades desarrolladas en el transcurso de éste, por lo que te pedimos que res-
pondas de manera honesta lo que se te solicita en la tabla. Describe tu situación
cognoscitiva antes de estudiar estos saberes y cómo consideras que tus esquemas
mentales han cambiado después de estos.

Saberes Antes Después

Comprender el origen y desarrollo del cuento


como una forma de expresión artística.

Reconozco la estructura externa e interna


del cuento como una forma de visualizar sus
aspectos más importantes.

Integro los elementos intertextual y


contextuales que componen un texto en el
análisis de una obra literaria.

,GHQWLÀFRORVGLYHUVRVPRYLPLHQWRVOLWHUDULRV
del cuento.

Una vez ubicada tu situación frente al desarrollo de competencias, esta-


blece de manera responsable las estrategias que utilizarás para alcanzar el nivel
de desempeño deseado.

133
133
Bloque V Comprendes las características del cuento

Evaluación de la competencia
3DUDFHUUDUFRQHVWHEORTXHHLQLFLDUHOVLJXLHQWHHVQHFHVDULRLGHQWLÀFDUHOQLYHO
adquirido. El siguiente recuadro contiene los criterios establecidos en ambas sesiones,
analízalo y lleva a cabo la autoevaluación.

Criterio Pre-formal Inicial- Resolutivo


$XWyQRPR  (VWUDWpJLFR 
 UHFHSWLYR  EiVLFR 

Comprendo Registro
Comprendo Utilizo el origen
el origen y fácilmente
el origen y No comprendo Conozco y desarrollo del
desarrollo del el origen y
desarrollo del el origen y el el origen y cuento para
cuento a través desarrollo del
cuento a través desarrollo del desarrollo del entenderlo a
de la lectura cuento a través
de la lectura de cuento. cuento. través de la
de diversos de la lectura de
diversos textos. lectura.
textos. diversos textos.
Reconozco los Reconozco los
Reconozco los
No reconozco elementos y elementos y
elementos y
Reconozco los los elementos y características características
elementos y características
características Reconozco los del cuento como del cuento
características del cuento
del cuento elementos y una forma de como una forma
del cuento como como una
como una forma características expresión artística de expresión
una forma de forma de
de expresión del cuento que me ayude artística que
expresión artística expresión
que me ayude artística que como una forma a expresarme me ayude a
artística que
a expresarme me ayude a de expresión y comunicar expresarme
me ayude a
y comunicar expresarme artística. vivencias, y comunicar
expresarme
vivencias. y comunicar utilizando un vivencias,
y comunicar
vivencias. lenguaje no utilizando un
vivencias.
cotidiano. lenguaje poético.
No reconozco
la estructura Reconozco la Reconozco
Reconozco la Reconozco
externa e Reconozco estructura externa la estructura
estructura externa la estructura
interna del la estructura e interna del externa e interna
e interna del externa e
cuento como externa e cuento como del cuento y
cuento como una interna del
una forma de interna del una forma de los argumento
forma de visualizar cuento en la
los elementos visualizar los cuento en la visualizar los como una forma
lectura de
comunicativos elementos lectura de elementos de visualizar
diferentes
en la lectura de comunicativos textos en mi comunicativos los elementos
textos elegidos
diferentes textos en la lectura libro. en la lectura de comunicativos en
por mí.
de diferentes diferentes textos. textos que elijo.
textos.

134
Literatura I Bloque V
Criterio Pre-formal Inicial- Resolutivo Autónomo Estratégico
 UHFHSWLYR  EiVLFR   

Critico de $VXPRXQD $VXPRXQD


$VXPRXQD No asumo manera actitud actitud
actitud ,GHQWLÀFROD
una actitud negativa la respetuosa y respetuosa y
respetuosa y diversidad
respetuosa y diversidad crítica ante crítica ante
crítica ante la de ideas,
crítica ante de ideas, la diversidad la diversidad
diversidad de situaciones
la diversidad situaciones de ideas, de ideas,
ideas, situaciones y opiniones
y opiniones que de ideas, y opiniones situaciones situaciones
que se ven
VHYHDQUHÁHMDGDV situaciones y de distintos y opiniones y opiniones
UHÁHMDGDVHQ
en distintos opiniones en textos, al no cuando estoy que se vean
distintos textos.
textos. distintos textos. coincidir con de acuerdo con UHÁHMDGDVHQ
las mías. ellas. distintos textos.
Integro los
Reconozco elementos
No integro Integro los
Integro los los elementos intertextual y
los elementos Reconozco elementos
elementos intertextual y contextuales
intertextual y los elementos intertextual y
intertextual y contextuales que componen
contextuales intertextual y contextuales
contextuales que que componen un texto
que componen contextuales que componen
componen un un texto FRQHOÀQGH
WH[WRFRQHOÀQ un texto que componen un texto
FRQHOÀQGH interpretar
de interpretar FRQHOÀQGH un texto con FRQHOÀQGH
integrarlos mejor la obra
mejor la obra interpretar ayuda del interpretar
a un análisis literaria,
literaria. mejor la obra maestro. mejor la obra
de una obra argumentando
literaria. literaria.
literaria. su relación
conmigo.
Fomento
Fomento No fomento Fomento Fomento Fomento
actitudes
actitudes actitudes actitudes actitudes actitudes
propositivas,
propositivas y propositivas y propositivas y propositivas y propositivas y
pero no
empáticas al empáticas al empáticas al empáticas en empáticas al
redactar mis experimento redactar mis
redactar mis leer textos de la lectura de
textos. empatía con textos.
textos. otros autores. otros textos.
otros textos.

135
135
Bloque VI:

Comprendes las
características
de la novela
Desempeños del estudiante:
‡ Comprende el origen y desarrollo de la novela como un subgénero mayor
del género narrativo.
‡ 'HÀQHORVHOHPHQWRV\FDUDFWHUtVWLFDVGHODQRYHOD
‡ Distingue la estructura externa e interna de la novela.
‡ Explica el nivel retórico en el texto de una novela.
‡ ,GHQWLÀFDORVWLSRVGHQRYHODVHJ~QVXFRQWHQLGR\WHPD
‡ Interpreta a la novela como una forma de expresión artística-social.

Objetos de aprendizaje:
‡ Novela
‡ Estructura externa e interna de la novela:
» Contexto: aspectos externos
» Texto: aspectos internos
‡ Elementos y características de la novela:
» 3HUVRQDMHVFODVLÀFDFLyQ\FDUDFWHUtVWLFDV
» $PELHQWHHVFHQDULRpSRFD\DWPyVIHUD
» $FFLyQWLHPSRHVSDFLR\UHODFLyQ
» 1DUUDGRUFODVLÀFDFLyQ\FDUDFWHUtVWLFDV
‡ Nivel retórico:
» Figuras literarias utilizadas con frecuencia
» Tipos de novela según su contenido y tema

Competencias a desarrollar:
‡ ,GHQWLÀFDRUGHQDHLQWHUSUHWDODVLGHDVGDWRV\FRQFHSWRVH[SOtFLWRVH
implícitos en un texto, considerando el contexto en el que se generó y
en el que se recibe.
‡ Evalúa un texto mediante la comparación de un contenido con el de
otros, en función de sus conocimientos previos y nuevos.
‡ Produce textos con base en el uso normativo de la lengua, considerando
la intención y situación comunicativa.
‡ Expresa ideas y conceptos en composiciones coherentes y creativas, con
introducciones, desarrollo y conclusiones claras.
‡ Valora y describe el papel del arte, la literatura y los medios de comu-
nicación en la recreación o la transformación de una cultura, teniendo
en cuenta los propósitos comunicativos de distintos géneros.
‡ Es sensible al arte y participa en la apreciación e interpretación de sus
expresiones en distintos géneros.
‡ Escucha, interpreta y emite mensajes pertinentes en distintos contextos
mediante la utilización de medios, códigos y herramientas apropiados.
‡ Sustenta una postura personal sobre temas de interés y relevancia ge-
QHUDOFRQVLGHUDQGRRWURVSXQWRVGHYLVWDGHPDQHUDFUtWLFD\UHÁH[LYD
‡ Mantiene una actitud respetuosa hacia la interculturalidad y la diversidad
de creencias, valores, ideas y prácticas sociales.
Bloque VI Comprendes las características de la novela

Dinamización
En el siguiente recuadro se han anexado títulos de algunas novelas. Formen equi-
pos y comenten brevemente los argumentos de las que conozcan.

Título Autor

1. Ángeles y demonios Dan Brown


2. El código Da Vinci Dan Brown
3. El amor en los tiempos de cólera Gabriel García Márquez
4. Guerra de los mundos +*:HOOV
5. El señor de los anillos Tolkien
6. Harry Potter Joanne Rowlin
7. Misery Stephen King

Cuando el profesor revela el nombre de la obra, cuya lectura formará


SDUWHGHODFDOLÀFDFLyQSDUFLDOODPD\RUtDGHORVDOXPQRV´ODQ]DQHOJULWRDOFLH-
ORµFRQXQURWXQGR´£QRµ/DH[SUHVLyQVHUtDRSXHVWDVLODLQGLFDFLyQFDPELDUD
por una invitación al cine. ¿Qué tiene que ver el cine con la Literatura? Para fortuna
GHORVFLQpÀORV\DOXPQRVTXLHQHVVLHQWHQTXHODOHFWXUDHVDEXUULGD\WHGLRVD
PXFKDVGHODVREUDVOLWHUDULDVKDQWHQLGRXQDDGDSWDFLyQFLQHPDWRJUiÀFDYLVWDSRU
millones de personas que, en varios casos, han superado en número a los conoce-
dores de la obra literaria original. Cuando esto sucede las librerías se llenan con
FRPSUDGRUHV´FRPSXOVLYRVµGLVSXHVWRVDFRUURERUDUODÀGHOLGDGH[LVWHQWHHQWUHOD
representación fílmica y la obra literaria.
$OJXQDVQRYHODVTXHKDQWHQLGRJUDQp[LWRFRPHUFLDO\OXHJRXQURWXQGR
éxito en taquilla generalmente contribuyen a motivar a las personas para acercar-
se a la lectura.
Las novelas del recuadro anterior han sido llevadas al cine con mucho
éxito. Seguramente has visto alguna de esas películas; de no ser así, aprovecha
ODRFDVLyQSDUDUHXQLUWHHQIDPLOLDRDPLJRV\GLVIUXWDUGHHOODV$FXGHDXQDYL-
deoteca y solicita al responsable del establecimiento uno de los títulos listados. El
séptimo arte es una excelente herramienta para acrecentar tu acervo literario y
cultural, porque generalmente una buena película incita a leer el texto literario,
el cual muchas veces supera la adaptación fílmica.
Te proponemos sugerir a tu maestro de literatura ver juntos una de las
películas famosas basadas en una novela, te garantizamos que te divertirás. Poste-
riormente hagan un análisis comparativo de los elementos importantes de la obra
literaria omitidos en la película y los momentos más emocionantes vividos en la
proyección.

138
Literatura I Bloque VI
Sesión A: Estructura externa
e interna de la novela:
el contexto y el texto
Proyecto:$QDOL]DUXQDQRYHODH[SOLFDQGRORVHOHPHQWRVFRQWH[WXDOHVHLQWHU-
textuales como prototipos del contexto cotidiano.

Criterios
‡ $QDOL]RODHVWUXFWXUDLQWHUQD\H[WHUQDGHODQRYHODHQWH[WRVVXJHULGRV
relacionándolos con el contexto particular.
‡ Integro los elementos característicos de la novela, explicando el con-
WH[WRHLQWHUWH[WRHQHMHPSOLÀFDFLRQHVJUiÀFDV
‡ $SUHFLR HO YDORU DUWtVWLFR GH OD QRYHOD LGHQWLÀFDQGR ORV HOHPHQWRV \
características en diferentes tipos de textos correspondientes a este
subgénero literario.

Problematización
Empecemos a relacionarnos con la novela. La siguiente actividad será nuestro con-
tacto con el mundo de los libros. Formemos equipos y trabajemos.
1) En pequeños grupos salgan de forma ordenada del salón dirigiéndose a
un profesor, administrativo, etcétera, para obtener el argumento, per-
VRQDMHV\ORVHVSDFLRVJHRJUiÀFRVHQORVFXDOHVVHGHVDUUROODXQDKLVWRULD
que conozcan. Elijan una novela de su preferencia, una que hayan visto
o leído. Para un mejor control organícense con su profesor.
2) Título de la novela.

3) ¿Cuál es el argumento (breve)?

4) Escribe el nombre de los personajes protagónicos.

139
139
Bloque VI Comprendes las características de la novela

5) Escribe dos espacios o lugares en los que se desarrolla la historia.

Desarrollo de saberes
La constante propaganda visual y auditiva a la que estamos expuestos ha propiciado
una desvaloración de la lectura. Nuestros sentidos nos piden que les proporcionemos
imágenes y sonidos cada vez más intensos. En consecuencia, nuestra imaginación
pasa a un segundo plano, porque lo que nos rodea satisface nuestras necesidades
sensoriales, sin movernos de nuestro lugar de reposo, sin trasladarnos de un lugar
a otro. Sin embargo, todos sabemos que la imaginación ha llevado al ser humano a
ORJUDUFRVDVMDPiVFRQFHELGDVDYDQFHVFLHQWtÀFRVVDOYDUYLGDV/D/LWHUDWXUDORJUD
desarrollar nuestra imaginación, la cual a su vez desarrolla nuestra inteligencia. La
Literatura no sólo es una asignatura académica, es un arte que estimula nuestros
VHQWLGRVDWUDYpVGHQXHVWURVVXHxRVUHÁHMDGRVHQORVVXHxRVGHRWURs.
Quizá hemos tenido malas experiencias con la Literatura, pues en ocasiones
nos han enfrentado a textos alejados de nuestro propio contexto o simplemente
inadecuado para el momento que vivimos. Por eso preferimos ir al cine, ver televi-
sión, navegar por internet, antes que leer un libro. Los empresarios de la comunicación
lo saben y buscan mantenernos frente a la televisión con tal de vender. Las cadenas
televisivas intentan “cultivar” nuestro espíritu adaptando grandes novelas litera-
Creadora del personaje rias a la televisión, promoviendo la difusión del arte a través de los contenidos que
“Memín Pinguín” y escrito- proyectan; no obstante, la lectura de una obra literaria es irremplazable. Un libro
ra de las historias de Lágri- siempre será una gran inversión, en todos los sentidos.
mas y risas.
Muchos han sido los autores que han llevado a la pantalla chica sus
historias. Yolanda Vargas Dulché ha dejado un gran compendio de historietas
que posteriormente rediseñó para convertirlas en novelas, las cuales han sido
adaptadas a la televisión. Por muchos, es considerada una mujer poseedora de
excelencia artística. Sus obras más reconocidas seguramente las has visto por tele-
visión: María Isabel (1966), Rubí (1968), Yesenia (1970), Gabriel y Gabriela (1982),
El pecado de Oyuki, entre otras.
Los medios masivos visuales son un gran negocio. Las televisoras nacio-
nales han creado competencia en las historias que manejan en su programación.
Muchas novelas clásicas han servido de inspiración para la creación de series
televisivas, pero antes que los medios masivos audiovisuales han existido los libros.
¿Qué conocimientos tienes sobre el género novela? ¿Has leído alguna?
¿Las historias que se presentan en la televisión corresponden a este subgénero?
¿Crees que las telenovelas y las novelas literarias tienen alguna relación?
Si lees un libro descubrirás lo cercano que puede encontrarse de tu rea-
OLGDG$OLJXDOTXHODP~VLFDTXHHVFXFKDVFDGDOLEURFXHQWDXQDKLVWRULDTXHOH
ha sucedido a otro y que lo escribe en un libro, pero de una forma maravillosa,
encantadora, artística.

140
Literatura I Bloque VI
Origen y evolución de la novela
La novela, además de ser el género más reciente, actualmente es el más leído
por una gran cantidad de personas de diferentes edades, quienes disfrutan de
historias organizadas en capítulos extensos y abundantes en trama, espacios,
descripciones, personajes.

Las novelas son muy variadas, razón por la cual se maneja pluralidad
HQORVFRQÁLFWRVTXHFRQVWLWX\HQWRGDODKLVWRULD$GLIHUHQFLDGHOFXHQWRHQOD
novela el lector percibe a través de la narración los sentimientos, pensamientos y
evolución espiritual de cada personaje. Por el contenido temático que maneja la
QRYHODODVDFFLRQHVVRQÀFWLFLDVHQWRGRRHQSDUWH\ODPRGDOLGDGTXHXWLOL]DSRU
excelencia es la prosa.
La novela como producción literaria es la más tardía, es la más novedosa
del género épico narrativo. Sin embargo, se toma a la epopeya como el antecedente
más cercano a ella. La majestuosa y extensa forma en la que se presentan los relatos
grecorromanos de Homero y Virgilio son los primeros indicios de la complejidad
que posteriormente darán como resultado la trama novelesca.
Los avances literarios alcanzaron mayor fuerza y dieron origen a un con-
FHSWRHVSHFtÀFRGHQRYHOD/DPRGDOLGDGHQSURVDIXHHOGHWRQDGRUTXHVHOOyOD
GLIHUHQFLDHQWUHODHSRSH\D\ODQRYHOD/DÀFFLyQGHORVHVFULWRVOOHJDURQFRQOD
Edad Media y marcaron el inicio de la novela corta (narración breve intermedia
entre el cuento y la novela extensa), cuando por las circunstancias políticas y reli-
JLRVDVVHGLRXQDWUDVRFLHQWtÀFR\DUWtVWLFR(ORVFXUDQWLVPRIXHHOQRPEUHTXHOH
asignaron a esta época de infertilidad literaria en el Medioevo. Fueron los juglares
y trovadores quienes se encargaron de llevar de pueblo en pueblo las manifesta-
ciones artísticas de carácter popular.

Miguel de Cervantes Saave-


dra (1547-1616), dramaturgo
español, que en 1616, meses
antes de su muerte, envió a
la imprenta el segundo tomo
de El Quijote, con la que
queda completa la obra que
lo sitúa como uno de los más
grandes escritores y funda-
dor de la novela moderna.

Giovanni Bocaccio Maquiavelo :LOOLDP6KDNHVSHDUH


El Renacimiento trajo consigo un nuevo formato de novela, ésta debía ser
entendida como cualquier historia espectacular o reveladora, novedosa en cuanto
DORVKHFKRVTXHHQHOODVHQDUUDQ$~QFDUHQWHGHFODULGDGGHELGRDVXSURFHVR
de transformación, la novela renacentista integra a Giovanni Boccaccio, Geoffrey
&KDXFHU'DQWH$OLJKLHUL0DTXLDYHOR:LOOLDP6KDNHVSHDUHHLQFOXVRD0LJXHOGH
Cervantes, como novelistas de gran calidad. Es necesario aclarar que con el paso
GHOWLHPSRORVGRVSULPHURVKDQVLGRFODVLÀFDGRVFRPRPi[LPRVH[SRQHQWHVGHO
cuento, Boccaccio con El decamerón y Los cuentos de Canterbury, de Chaucer.

141
141
Bloque VI Comprendes las características de la novela

La novela como técnica y género literario se consolida con la obra El ingenioso hi-
dalgo don Quijote de La Mancha. Miguel de Cervantes Saavedra realiza una historia
ejemplar dividida en dos secciones, la primera parte se publicó en 1605 y diez años
después, en 1615, concluye la mejor obra de la literatura universal. El conteni-
do que Cervantes incluyó en su obra dio origen a la primera novela moderna del
mundo. Con El Quijote se innovó todo clasicismo, se crearon nuevas historias con
aventuras epopéyicas, pero modernas, con “héroes” defensores de una ideología
ÀFWLFLD3RUHVRUHSUHVHQWDODSULPHUDREUDTXHVHSXHGHFODVLÀFDUFRPRQRYHOD
Después del legado literario de Cervantes, se anexan magnas obras literarias
DHVWHVXEJpQHUR$OJXQRVDXWRUHVVRQ9LFWRU+XJR)UDQ].DIND2VFDU:LOGH0DU\
Shelley, Jorge Isaacs, Gabriel García Márquez, Jean Paul Sartre, entre otros.

2VFDU:LOGH Victor Hugo

La novela en México
En 1816 México vivió una aparente independencia, la lucha de clases y de poder
fue la temática manejada en todos los ámbitos sociales. En El Periquillo sarniento,
obra del escritor mexicano José Joaquín Fernández de Lizardi, se hace referencia
de forma satírica a ese ambiente de inestabilidad nacional de la época. Por el
contenido artístico de su obra, “El Pensador Mexicano”, seudónimo de Fernández
de Lizardi, ha sido nombrado precursor de la literatura romántica en México y de
toda Hispanoamérica.
0iVDGHODQWHFRQHOSRGHUtRGHOVHxRU3RUÀULR'tD]DUULEDXQDOLWHUDWXUD
FRQHVStULWXQDFLRQDOHQODTXHGHVWDFDQ,JQDFLR0DQXHO$OWDPLUDQRFRQVXQRYHOD
romántica El Zarco, la novela histórica Martín Garatuza de Vicente Riva Palacio y
$XWRU-RVp-RDTXtQ)HUQiQ-
dez de Lizardi el realismo de La guerra de tres años, del escritor Emilio Rabasa.
El modernismo, alentado por un interés de lo novedoso y por un rechazo
a lo antiguo (romanticismo y realismo), surge en nuestro país con el excelentísimo
Manuel Gutiérrez Nájera, quien a pesar de su poca participación en este género
logró con su única obra, La novela del tranvía, ser considerado como el máximo
exponente de la novela moderna.

/RVDEXVRVGHO3RUÀULDWRSURSLFLDURQHOOHYDQWDPLHQWRGHORVWUDEDMD-
dores de las haciendas, quienes fueron reprimidos brutalmente por el ejército.
Esta narración realista forma parte de la obra Tomóchic, de Heriberto Frías. En
1903 Federico Gamboa utiliza la corriente naturalista en su novela Santa, que
con su adaptación fílmica fue la primera película silente mexicana.

(QWUH ODV ÀJXUDV OLWHUDULDV QDFLRQDOHV DFWXDOHV VH HQFXHQWUDQ 0DUWKD


&HUGD   FX\D KDELOLGDG OLWHUDULD VH YH UHÁHMDGD HQ VXV FXHQWRV SRHVtDV \

142
Literatura I
novelas; La señora Rodríguez y otros mundos es una de las novelas con la que
Bloque VI
KDDGTXLULGRUHFRQRFLPLHQWRQDFLRQDO+pFWRU$JXLODU&DPtQ  RULJLQDULRGH
Chetumal, Quintana Roo, ha participado como conductor de programas televisivos
QRWLFLHURV VHGHVHPSHxDFRPRKLVWRULDGRU\QDUUDGRUDXQTXHGHYLYDYR]DÀUPD
que: “Es historiador por accidente y novelista por vocación y decisión”; su novela
más reconocida es La guerra de Galio.
Carlos fuentes (1928) es uno de los escritores mexicanos más reconocidos,
por abordar temas políticos, sociales y económicos de manera directa y sin temor.
Es autor de ensayos y novelas, entre éstas la más controversial es Aura.
La literatura mexicana se encuentra actualmente en una época de agi-
tación por la diversidad de temas y su producción prolifera en todos los géneros.

Estructura externa: el contexto


Como todo texto literario, la novela posee elementos externos que ayudan a su
comprensión. Los contextos de la novela son determinantes para su contenido
y su estructura. En este caso cada vivencia del autor es plasmada en la carac-
terización de los personajes, sus acciones, los espacios.

Por ejemplo, Kafka en La metamorfosis muestra un protagonista víctima


de un padre autoritario, semejante al suyo; Poe describe ambientes lúgubres, de
horror, relacionando su vida de soledad, alcohol y drogas; Cela crea personajes
producto de sus deseos y aspiraciones, basados en sus conocimientos sobre alguna
disciplina.
Ya se ha estudiado el contexto de producción en los bloques anteriores;
en este caso sólo nos compete establecer las corrientes propias de la novela para
completar un ciclo en la narrativa literaria.
Los movimientos literarios coinciden con la época en la que vivió el autor
de una novela, por lo tanto, algunas tendencias de este subgénero coinciden con
las del cuento, pero en tiempos más recientes surgieron corrientes innovadoras y
sui géneris en Hispanoamérica.
La novela romántica, realista y naturalista poseen las mismas caracte-
rísticas descritas en el cuento. Entre los principales representantes se encuentran
Victor Hugo, Dostoievski, Benito Pérez Galdós, Emilio Rabasa, entre otros.
La novela de vanguardia se esmera en una gran complejidad psicológica,
debido a los momentos de guerra que se vivían. Estas narraciones ocupan su
interés en temas exóticos, llenas de imágenes y asociaciones psicológicas o una
sintaxis sin lógica.
El existencialismoVXUJHSULPHURFRPRFRUULHQWHÀORVyÀFDFX\RVWHPDV
de estudio fueron el hombre, la libertad y la muerte, los cuales se trasladan
a la literatura francesa donde se ubican sus inicios, con Sartre y Camus. Entre
ORVSULQFLSDOHVUHSUHVHQWDQWHVOLWHUDULRVGHHVWHPRYLPLHQWRHVWiQ$QGUp0DXURLV
Malraux, Robbe-Grillet, entre otros. En este mismo sentido, nace una variante de
la novela francesa moderna llamada la nueva novela o antinovela, donde el más
destacado es Robbe-Grillet. En la antinovela se suprimen los sentimientos y se
reestructura el tiempo y la acción en la historia.

143
143
Bloque VI Comprendes las características de la novela

La novela de la Revolución describe situaciones propias del movimiento


armado, con una perspectiva objetiva de la situación. Los de abajo, de Mariano
$]XHODHVXQFODURHMHPSORGHHVWHWLSR7DPELpQSRGHPRVPHQFLRQDUD0DUWtQ
Luis Guzmán, Francisco Rojas y Mauricio Magdaleno.
El Boom latinoamericano es una tendencia llamada así por el despunte
de escritores hispanoamericanos con gran éxito internacional: Cortázar, Carpen-
tier, Fuentes, Vargas Llosa, Paz, García Márquez, Rulfo. Hacia mediados del siglo
XX las producciones literarias comienzan a ser reconocidas a nivel internacional,
a recibir premios y traducirse a varios idiomas. Dentro de este marco, la corriente
PiVGLIXQGLGDHQ$PpULFD/DWLQDVHHQFXHQWUDHOrealismo mágico, cuyos grandes
exponentes (García Márquez, Juan Rulfo) logran mezclar los sueños y la fantasía
con una realidad social y personal, consiguiendo una historia misteriosa, imágenes
PDUDYLOORVDVDWUDYpVGHXQOHQJXDMHSRpWLFRPDQHMDGRPDJQtÀFDPHQWH
Existen también autores estadounidenses e ingleses sin una corrien-
WHGHÀQLGDDXQTXHVLHPSUHSHUWHQHFLHQWHVDODQRYHODFRQWHPSRUiQHDGHJUDQ
trascendencia literaria, como Ernest Hemingway, Graham Green, George Orwell.
(OPXQGRFRQWHPSRUiQHRHVUHÁHMDGRHQODVQRYHODVGHORV~OWLPRVWLHPSRV
el sexo, la violencia, la guerrilla, las drogas. La versión de la realidad dependerá
del autor, pero siempre desde una perspectiva fantasiosa.

Estructura interna: el texto


Elementos y características de la novela
Respecto al texto, la forma interna está compuesta por los elementos propios
del análisis de cualquier obra literaria. Sin embargo, por su extensión y marcada
complejidad la novela incluye además ciertas características que la distinguen.
$O HQXPHUDU HVWRV HOHPHQWRV HV QHFHVDULR UHWRPDU ORV FRQWHQLGRV DQDOL]DGRV HQ
el bloque II: las acciones, narrador, personajes, tiempo y espacio, los cuales en
DOJXQRVFDVRVVHLQFOX\HQFLHUWDVPRGLÀFDFLRQHVRDQH[LRQHVQRYHGRVDVGHELGRDOD
estructura de este subgénero.
Las acciones son realizadas por los personajes, todas ellas se van enca-
denando dándole forma y secuencia a la historia; en el ámbito literario también se
les denomina diégesis. Las acciones pueden organizarse en la historia o argumento
cuando se señala las más importantes o que provocan un cambio importante en el
destino de los personajes. Estos acontecimientos se encuentran en las secuencias
EiVLFDV VLWXDFLyQLQLFLDOUXSWXUDGHOHTXLOLEULR\UHVROXFLyQGHOFRQÁLFWR FRPHQ-
tadas en otros bloques.
En este mismo sentido, y producto de la complejidad de de la historia,
existen historias secundarias complementarias a una historia central. Estas histo-
rias cuentan anécdotas que les suceden a otros personajes de manera simultánea
a los protagonistas, como sucede en Cien años de soledad, de García Márquez y
Aura, de Carlos Fuentes.
Otro elemento que se presenta con ciertas variaciones es el narrador,
conocido ya en diferentes momentos a lo largo de este libro. Una inclusión espe-
cial para este componente se hace con el narrador metadiegético, como efecto
GHODQDUUDFLyQGHQWURGHODQDUUDFLyQ\VHGHÀQHGHODVLJXLHQWHPDQHUD´3XHGH
existir un narrador principal y uno o varios secundarios. El narrador de la historia

144
Literatura I
central guarda silencio para que intervenga otro narrador, al cual se le da el nombre
Bloque VI
de metadiegético” (Prado, Gracida, 2009:172).
(QODQRYHODODFODVLÀFDFLyQWUDGLFLRQDOGHORVpersonajes sigue siendo
la misma (protagonista, antagonista, secundario, ambiental, etcétera), la dife-
UHQFLDUHFDHHQODGLYHUVLGDGGHSHUVRQDMHVTXHVHSUHVHQWDQODFODUDGHÀQLFLyQ
psicológica de cada uno y en los tipos de caracterización, que pueden ser: planos y
redondos. En el primero los personajes se comportan de la misma manera en toda
ODKLVWRULDHVGHFLUGHSULQFLSLRDÀQVRQORVPLVPRVVLQQLQJXQDYDULDQWHFRQGXF-
tual. Se le denomina redondos a los que van cambiando conforme se desarrollan
las situaciones que forman el relato.
Los espacios son mucho más ricos y variados en la novela. Los distintos
OXJDUHV HVFHQRJUiÀFRV R JHRJUiÀFRV HQ ORV TXH VH GHVHQYXHOYHQ ORV SHUVRQDMHV
necesariamente tienen que ser descritos para ubicar con mayor precisión al lector,
solamente de esa manera se conseguirá el efecto vívido de la historia. Con res-
pecto al tiempo, son más frecuentes las variaciones de secuencias y las rupturas
temporales, relacionadas directamente con el estilo del autor.
<D VH GLMR TXH ORV SHUVRQDMHV GH OD QRYHOD HVWiQ ELHQ GHÀQLGRV SRU OR
tanto, su estado de ánimo, sus sentimientos, su forma de ser, dan una atmósfera
única a lo largo de toda la historia. La multiplicidad de temas produce diferentes
matices, diferentes ambientes referentes a cada historia narrada.
La temática se centra en un solo contenido, pero derivando otras situa-
ciones enlazadas con el tema central. La diferencia real entre la novela y los otros
subgéneros radica en la tematización, esa variedad de temas que se entretejen
para darle ese toque único a la narrativa novelesca.

Actividad de aprendizaje 1
$ FRQWLQXDFLyQ VH SUHVHQWD XQ IUDJPHQWR SDUD TXH DQDOLFHV FRQ WX JUXSR 5HWR-
mado el proyecto planteado en el inicio de la sesión se te solicita que realices un
análisis de los elementos internos y externos.
Lee el fragmento de la novela de Franz Kafka, titulada La metamorfosis,
posteriormente realiza la actividad, siguiendo las instrucciones expuestas.

La metamorfosis
Cuando Gregorio Samsa se despertó una mañana después de un sueño intran-
quilo, se encontró sobre su cama convertido en un “monstruoso insecto”. Estaba
tumbado sobre su espalda dura, y en forma de caparazón y, al levantar un
poco la cabeza veía un vientre abombado, parduzco, dividido en partes duras
en forma de arco, sobre cuya protuberancia apenas podría mantenerse el
cobertor, a punto ya de resbalar al suelo. Sus muchas patas, ridículamente
pequeñas en comparación con el resto de su tamaño, le vibraban desampa-
radas ante los ojos.
“¿Qué me ha ocurrido?”, pensó.
No era un sueño. Su habitación, una auténtica habitación humana,
si bien algo pequeña, permanecía tranquila entre las cuatro paredes harto
conocidas.

145
145
Bloque VI Comprendes las características de la novela

Por encima de la mesa, sobre la que se encontraba extendida un


muestrario de paños desempaquetados —Samsa era comerciante viajero—,
estaba colgado aquel cuadro, que hacía poco había recortado de una revis-
ta y había colocado en un bonito marco dorado. Representaba a una dama
ataviada con un sombrero y una boa de piel, que estaba allí, sentada muy
erguida y levantaba hacia el observador un pesado manguito de piel, en el
cual cubría todo su antebrazo.
Sintió sobre el vientre un leve picor, con la espalda se deslizó len-
tamente más cerca de la cabecera de la cama para poder levantar mejor
la cabeza; se encontró con que la parte que le picaba estaba totalmente
cubierta por unos pequeños puntos blancos, que no sabía a qué se debían,
y quiso palpar esa parte con una pata, pero inmediatamente la retiró, por-
que el roce le producía escalofríos.
Se deslizó de nuevo a su posición inicial.
“Esto de levantarse pronto —pensó— hace a uno desvariar. El hom-
bre tiene que dormir. Otros viajantes viven como pachás. Si yo, por ejem-
plo, a lo largo de la mañana vuelvo a la pensión para pasar en limpio los
pedidos que he conseguido, estos señores todavía están sentados tomando
el desayuno. Eso podría intentar yo con mi jefe, pero en ese momento iría
a parar a la calle. Quién sabe, por lo demás, si no sería lo mejor para mí.
Si no tuviera que dominarme por mis padres, ya me habría despedido hace
tiempo, me habría presentado ante el jefe y le habría dicho mi opinión con
toda mi alma. (…)
”Bueno, la esperanza todavía no está perdida del todo; si alguna
YH]WHQJRHOGLQHURVXÀFLHQWHSDUDSDJDUODVGHXGDVTXHPLVSDGUHVWLHQHQ
con él —puedo tardar todavía entre cinco y seis años— lo hago con toda
seguridad. Entonces habrá llegado el gran momento; ahora, por lo pronto,
tengo que levantarme porque el tren sale a las cinco”, y miró hacia el des-
pertador que hacía tic tac sobre el armario.
´£'LRVGHOFLHORµSHQVy
Eran las seis y media y las manecillas seguían tranquilamente ha-
cia delante, ya había pasado incluso la media, era casi las siete menos
cuarto. “¿Es que no habría sonado el despertador?”. Desde la cama se veía
que estaba correctamente puesto a las cuatro, seguro que también había
sonado. Sí, pero… ¿era posible seguir durmiendo tan tranquilo con ese ruido
que hacía temblar los muebles? Bueno, tampoco había dormido tranquilo,
pero quizá tanto más profundamente. (…)
¿Qué pasaría si dijese que estaba enfermo? Pero esto sería suma-
mente desagradable y sospechoso, porque Gregorio no había estado enfermo
ni una sola vez durante los cinco años de servicio. Seguramente aparecería
el jefe con el médico del seguro, haría reproches a sus padres por tener un
hijo tan vago y se salvaría de todas las objeciones remitiéndose al médico
del seguro, para el que sólo existen hombres totalmente sanos, pero con
aversión al trabajo. (…)
0LHQWUDVUHÁH[LRQDEDVREUHWRGRHVWRFRQJUDQUDSLGH]VLQSRGHUVH
decidir a abandonar la cama —en este mismo instante el despertador daba
las siete menos cuarto—, llamaron cautelosamente a la puerta que estaba a
la cabecera de su cama.

146
Literatura I Bloque VI
—Gregorio —dijeron (era la madre)—, son las siete menos cuarto.
¿No ibas a salir de viaje?
£4XpGXOFHYR]*UHJRULRVHDVXVWyHQFDPELRDOFRQWHVWDU(VFX-
chó una voz que evidentemente, era la suya, pero en la cual, como desde
lo más profundo, se mezclaba un doloroso e incontenible piar. (…)
Gregorio querría haber contestado detalladamente y explicarlo
todo, pero en estas circunstancias se limitó a decir: —Sí, sí, gracias madre,
ya me levanto.
Probablemente a causa de la puerta de madera no se notaba desde
fuera el cambio de la voz de Gregorio, porque la madre se tranquilizó con
esta respuesta y se marchó de ahí. Pero merced a la breve conversación,
los otros miembros de la familia se habían dado cuenta de que Gregorio, en
contra de todo lo esperado estaba todavía en casa, y ya el padre llamaba
suavemente, pero con el puño, a una de las puertas laterales.
³£*UHJRULR*UHJRULR³JULWy³¢4XpRFXUUH"³WUDVXQRVLQVWDQWHV
LQVLVWLyGHQXHYRFRQYR]PiVJUDQGH³£*UHJRULR*UHJRULR
Desde la otra puerta lateral se lamentaba en voz baja la hermana.
—¡Gregorio, ¿no te encuentro bien?, ¿necesitas algo?
Gregorio contestó hacia ambos lados:
—Ya estoy preparado —y con una pronunciación lo más cuidadosa
posible, haciendo largas pausas entre las palabras, se esforzó por despojar
a su voz de todo lo que pudiese llamar la atención. El padre volvió a su
desayuno, pero la hermana susurró:
—Gregorio, abre, te lo suplico —pero Gregorio no tenía ni la me-
nor intención de abrir, más bien elogió la precaución de cerrar las puertas
que había adquirido durante sus viajes. (…)
7LUDUHOFREHUWRUHUDPX\VHQFLOORVyORQHFHVLWDLQÁDUVHXQSRFR
y caería por sí solo, pero el resto sería difícil, especialmente porque él era
muy ancho. Hubiera necesitado brazos y manos para incorporarse, pero en
su lugar tenía muchas patitas que, sin interrupción, se hallaban en el más
dispar de los movimientos y que, además, no podía dominar. Si quería do-
PLQDUDOJXQDGHHOODVHUDODSULPHUDODTXHVHHVWLUDED\VLSRUÀQORJUDED
realizar con esta pata lo que quería, entonces todas las demás se movían,
como liberadas, con una agitación grande y dolorosa.
“No hay que permanecer en la cama inútilmente”, se decía
Gregorio.
Quería salir de la cama en primer lugar con la parte inferior de
su cuerpo, pero esta parte inferior que, por cierto, no había visto todavía
y que no podía imaginar exactamente, demostró ser difícil de mover, el
PRYLPLHQWRVHSURGXFtDPX\GHVSDFLR\FXDQGRÀQDOPHQWHFDVLIXULRVR
se lanzó hacia delante con toda su fuerza sin pensar en las consecuencias,
había calculado mal la dirección, se golpeó fuertemente con la pata trasera
de la cama y el dolor punzante que sintió le enseñó que precisamente la
parte inferior de su cuerpo era quizá en estos momentos la más sensible.

147
147
Bloque VI Comprendes las características de la novela

$VtSXHVLQWHQWyHQSULPHUOXJDUVDFDUGHODFDPDODSDUWHVXSH-
rior del cuerpo y volvió la cabeza con cuidado hacia el borde de la cama.
Lo logró con facilidad y a pesar de su anchura y su peso, el cuerpo siguió
ÀQDOPHQWHFRQOHQWLWXGHOJLURGHODFDEH]D3HURFXDQGRSRUÀQWHQtDOD
cabeza colgando en el aire fuera de la cama, le entró miedo de continuar
avanzando de este modo porque, si se dejaba caer en esta posición, tenía
que ocurrir realmente un milagro para que la cabeza no resultase herida,
y precisamente ahora no podía de ningún modo perder la cabeza, antes
prefería quedarse en la cama. (…)
´$QWHVGHTXHGHQODVVLHWH\FXDUWRWHQJRTXHKDEHUVDOLGRGHOD
cama del todo, como sea. Por lo demás, para entonces habrá venido alguien
del almacén a preguntar por mí, porque el almacén se abre antes de las
siete”. Y entonces, de forma regular, comenzó a balancear su cuerpo, cuan
largo era, hacia fuera de la cama. Si se dejaba caer de ella de esta forma,
la cabeza, que pretendía levantar con fuerza en la caída, permanecería
probablemente ilesa. La espalda parecía ser fuerte, seguramente no le pa-
saría nada al caer sobre la alfombra. Lo más difícil, a su modo de ver, era
tener cuidado con el ruido que se produciría, pero había que intentarlo.
(…)

1) Investiga la biografía de Kafka y la corriente literaria a la cual se ad-


hiere. Busca los elementos que se relacionan con La metamorfosis y
explica la relación.

2) ,GHQWLÀFDFXiOGHODVDFFLRQHVQDUUDGDVHQHVWHWH[WRVHUHODFLRQDQFRQ
el contexto actual.

3) Tomando como referencia el texto de Kafka, elabora un mapa concep-


tual en tu libreta con los elementos externos e internos de la novela
\HMHPSOLÀFDFDGDXQRGHVSXpVGHOHHUOR6LUHTXLHUHVGHLQIRUPDFLyQ
adicional, consulta el argumento o lee la novela completa si te parece
más atractivo.

148
Literatura I Bloque VI
Síntesis
Realiza un análisis minucioso de las vivencias experimentadas en el transcurso de
ODVHPDQDSDVDGD(OLJHODPiVVLJQLÀFDWLYD\WRPiQGRODFRPRUHIHUHQFLDUHGDFWD
un fragmento de novela. Los personajes, las acciones, el contexto, corriente lite-
raria, etcétera, son elementos básicos que no puedes olvidar.

Sesión B: Tipos de novela


Proyecto: redacta una reseña crítica expresando su opinión a partir del análisis
de una novela, involucrando los diferentes niveles estructurales.

Criterios
‡ ,GHQWLÀFR ODV ÀJXUDV OLWHUDULDV IUHFXHQWHV HQ ORV GLIHUHQWHV WLSRV GH
novelas, a través de la lectura de textos modelo.
‡ Redacto un texto sencillo usando las características de los diferentes
tipos de la novela, según su contenido y tema.
‡ Promuevo valores en sus redacciones cuando me integro en diferentes
equipos y colaboro en la realización de actividades.

Problematización
$FRQWLQXDFLyQVHWHSURSRUFLRQDXQIUDJPHQWRGHODQRYHODMemoria de mis putas
tristes, del escritor colombiano Gabriel García Márquez. Léelo detenidamente y
contesta en tu libreta lo que se te solicita.

Memoria de mis putas tristes


El año de mis noventa años quise regalarme una noche de amor loco con
una adolescente virgen. Me acordé de Rosa Cabarcas, la dueña de una casa
clandestina que solía avisar a sus buenos clientes cuando tenía una nove-
dad disponible. Nunca sucumbí a ésa ni a ninguna de sus muchas tentacio-
nes obscenas, pero ella no creía en la pureza de mis principios. También la
moral es un asunto de tiempo, decía, con una sonrisa maligna, ya lo verás.
Era algo menor que yo, y no sabía de ella desde hacía tantos años que bien
podía haber muerto. Pero al primer timbrazo reconocí la voz en el teléfo-
no, y le disparé sin preámbulos: Gabriel García Márquez reci-
bió el premio Nobel de Lite-
—Hoy sí.
ratura en el año 1982 con la
(OODVXVSLUy$\PLVDELRWULVWHWHGHVDSDUHFHVYHLQWHDxRV\VyOR obra Cien años de soledad.
vuelves para pedir imposibles. Recobró enseguida el dominio de su arte y
me ofreció una media docena de opciones deleitables, pero eso sí, todas
usadas. Le insistí que no, que debía ser doncella y para esa misma noche.
Ella preguntó alarmada:
—¿Qué es lo que quieres probarte?
—Nada— le repliqué, lastimado donde más me dolía, —sé muy
bien lo que puedo y lo que no puedo.
149
149
Bloque VI Comprendes las características de la novela

Ella replicó impasible que los sabios lo saben todo, pero no todo:
los únicos Virgos que van quedando en el mundo son ustedes los de agosto.
¿Por qué no me lo encargaste con más tiempo? —La inspiración no avisa— le
contesté. —Pero tal vez espera, dijo ella, siempre más resabida que cual-
quier hombre, y me pidió aunque fueran dos días para escudriñar a fondo
el mercado. Yo le repliqué en serio que en un negocio como aquél, a mi
edad, cada hora es un año. Entonces no se puede, dijo ella sin la mínima
duda, pero no importa, así es más emocionante, qué carajo, te llamo en
una hora.
No tengo que decirlo, porque se me distingue a leguas: soy feo,
tímido y anacrónico. Pero a fuerza de no querer serlo he venido a simular
todo lo contrario. Hasta el sol de hoy, en que resuelvo contarme como soy
por mi propia y libre voluntad, aunque sólo sea para alivio de mi concien-
cia. He empezado con la llamada insólita a Rosa Cabarcas, porque visto
desde hoy, aquél fue el principio de una nueva vida a una edad en que la
mayoría de los mortales están muertos.
Vivo en una casa colonial en la acera de sol del parque de San
Nicolás, donde he pasado todos los días de mi vida sin mujer ni fortuna,
donde vivieron y murieron mis padres, y donde me he propuesto morir solo,
en la misma cama en que nací y en un día que deseaba lejano y sin dolor. Mi
SDGUHODFRPSUyHQXQUHPDWHS~EOLFRDÀQHVGHOVLJOR;,;DOTXLOyODSODQ-
ta baja para tiendas de lujo a un consorcio de italianos, y se reservó este
segundo piso para ser feliz con la hija de uno de ellos, Florina de Dios Car-
gamantos, intérprete notable de Mozart, políglota y garibaldina, y la mujer
más hermosa y de mejor talento que hubo nunca en la ciudad: mi madre.
El ámbito de la casa es amplio y luminoso, con arcos de estuco y
SLVRVDMHGUH]DGRVGHPRVDLFRVÁRUHQWLQRV\FXDWURSXHUWDVYLGULHUDVVREUH
un balcón corrido donde mi madre se sentaba en las noches de marzo a
cantar arias de amor con sus primas italianas. Desde allí se ve el parque de
San Nicolás con la catedral y la estatua de Cristóbal Colón, y más allá las
ERGHJDVGHOPXHOOHÁXYLDO\HOYDVWRKRUL]RQWHGHOUtRJUDQGHGHOD0DJGD-
lena a veinte leguas de su estuario. Lo único ingrato de la casa es que el
sol va cambiando de ventanas en el transcurso del día, y hay que cerrarlas
todas para tratar de dormir la siesta en la penumbra ardiente. Cuando me
quedé solo, a mis treinta y dos años, me mudé a la que fuera la alcoba de
mis padres, abrí una puerta de paso hacia la biblioteca y empecé a subastar
cuanto me iba sobrando para vivir, que terminó por ser casi todo, salvo los
libros y la pianola de rollos.

1) ¿Por qué crees que el nonagenario quería tener relaciones sexuales con
una joven virgen?
2) ¿Cómo te imaginas a Rosa Cabarcas?
3) Describe al anciano nonagenario.
4) ¿Crees que Rosa Cabarcas pudo “conseguir” a una joven virgen?
5) ¿Cuál crees que es el tema de la novela?
6) 6XEUD\DXQDÀJXUDOLWHUDULDTXHHQFXHQWUHV\QyPEUDOD

150
Literatura I Bloque VI
Desarrollo de saberes
(VWiVHQODUHFWDÀQDOGHOVHPHVWUH\FRPRWHKDEUiVGDGRFXHQWDVLHPSUHKDV
estado inmerso en el mundo literario ya sea de manera directa o indirecta, cuando
decides tomar un libro y leer, o cuando sin proponértelo, estás en contacto con él
al ver una película, por ejemplo.
En esta sesión continuaremos analizando la novela, narración relati-
vamente extensa con gran cantidad de recursos literarios y una estructura más
compleja. Pero más que analizar, en esta sesión tendrás la oportunidad de leer
fragmentos de diferentes novelas, donde podrás apreciarlas como obras de arte,
destacando su estructura y los recursos literarios utilizados, que ayudan a trans-
portarnos a lugares, visualizar personajes, imaginar sucesos descritos de manera
detallada.
&ODVLÀFDUODQRYHODHVGHJUDQXWLOLGDGSRUTXHQRVSHUPLWHLGHQWLÀFDUODV
situaciones relacionadas con nuestras propias circunstancias. Nos ayuda a enten-
der cómo la vida de un autor puede parecerse a la nuestra, en todo o en parte.
Esta conexión de circunstancias nos concede la oportunidad de aprender sobre
cómo orientar nuestros actos y nuestras decisiones con base en lo que les sucede a
otros, en este caso al escritor, a través de los personajes.

Nivel retórico de la novela


En los textos analizados en bloques anteriores tuviste la oportunidad de apreciar
HQODVOHFWXUDVODVGLIHUHQWHVÀJXUDVOLWHUDULDVHQHVWDRFDVLyQHQODQRYHODWDP-
ELpQSRGUiVLGHQWLÀFDUHOQLYHOUHWyULFRSXHVWRTXHSUHWHQGHFDXVDUSODFHUHVWp-
tico a los lectores.
/DVLJXLHQWHWDEODFRQWLHQHODVÀJXUDVOLWHUDULDVTXHVXHOHQHVWDUSUHVHQWHV
en la novela, con sus respectivos ejemplos, tomados de la novela de García
Márquez presentada en la actividad anterior.

Figura literaria Ejemplo


Las pestañas postizas, las cejas y los párpados como ahumados con
negro humo, y los labios aumentados con un barniz de chocolate […]
Símil o comparación
Nunca he pensado en la edad como en una gotera en el techo que le
indica a uno la cantidad de vida que le va quedando. […]
$PHGLGDTXHGLVFXUUtDQHOFRUD]yQVHPHLEDOOHQDQGRGHXQDHVSXPD
Metáfora ácida que me estorbaba para respirar. […]
Desde allí vi la enorme luna de cobre que se alzaba en el horizonte […]
El ámbito de la casa es amplio y luminoso, con arcos de estuco y pisos
DMHGUH]DGRVGHPRVDLFRVÁRUHQWLQRV\FXDWURSXHUWDVYLGULHUDVVREUH
Epítetos
un balcón corrido donde mi madre se sentaba en las noches de marzo a
cantar arias de amor con sus primas italianas.

151
151
Bloque VI Comprendes las características de la novela

Figura literaria Ejemplo


&RQHVDVUHÁH[LRQHV\RWUDVYDULDVKDEtDWHUPLQDGRXQSULPHU
borrador de la nota cuando el sol de agosto estalló entre los almendros
$OHJRUtD GHOSDUTXH\HOEXTXHÁXYLDOGHOFRUUHRUHWUDVDGRXQDVHPDQDSRUOD
VHTXtDHQWUyEUDPDQGRHQHOFDQDOGHOSXHUWR3HQVp$KtOOHJDQPLV
noventa años.
Las chicharras pitaban a reventar en el calor de las dos, y las vueltas
Hipérbole del sol por las ventanas abiertas me forzaron a cambiar tres veces el
lugar de la hamaca.

&RPR KDEUiV REVHUYDGR FDGD ÀJXUD OLWHUDULD WLHQH FDUDFWHUtVWLFDV SDU-


ticulares que las diferencia de otras. Es importante señalar la existencia de otros
elementos retóricos, que por su cantidad es difícil estudiarlos todos en un curso.
Te invitamos a ampliar tus conocimientos en este sentido para procurar una lectura
integral de cualquier obra literaria.

Tipos de novela
Cuando estudiamos el cuento, aprendimos que el tema desarrollado en la historia
es determinante para el nivel de contenido de la obra. De la misma forma, la no-
vela presenta gran variedad de contenidos debido a sus múltiples temáticas. Según
sea el tema prioritario en la narración será el nivel de contenido de la novela:
HFRQyPLFRUHOLJLRVRSROtWLFRDUWtVWLFRPRUDOÀORVyÀFRVRFLDOKLVWyULFR
Si has tenido la oportunidad de leer varias obras literarias te habrás dado
cuenta que cada una de ellas tiene un estilo particular, el estilo del autor. Cada
QRYHOD SXHGH FODVLÀFDUVH VHJ~Q HO WHPD R FRQWHQLGR TXH DERUGH SRU OR WDQWR
existen diferentes tipos:
  Histórica: toma como punto de partida algún acontecimiento histórico
o la vida de algún personaje importante para la historia de un pueblo.
(QHVWHWLSRGHQRYHODVHUHODWDQVXFHVRVÀFWLFLRVSHURIXQGDPHQWDGRV
HQHOHPHQWRVUHDOHVGHODpSRFDDODTXHVHHVWiUHÀULHQGRHOHVFULWRU
:DOWHU6FRWWIvanhoe.
  Costumbrista: describe las costumbres de un grupo social compacto,
determinado por sus valores, moralidad, economía, incluso religión. Se
deriva del realismo. Charles Dickens: Oliver Twist.
  Ideológica o de tesis: con la participación de los personajes se trata
de sostener o defender ciertas doctrinas sociales, religiosas o políticas.
Victor Hugo: Los miserables.
  Psicológica: en estas novelas el autor se enfoca al análisis de los per-
sonajes, sus pasiones, sus más íntimos secretos, sus amores, manifes-
tándolos en sus temperamentos. Dostoievski: Los hermanos Karamazov.
  &LHQFLDÀFFLyQVXVDYHQWXUDVHVWiQEDVDGDVHQVXSXHVWRVDYDQFHVFLHQWtÀ-
cos, proyectando quizá un futuro tecnológico. Julio Verne: Viaje a la luna.
  Terror: se caracteriza por despertar o cultivar el miedo en el lector. Lo
importante es el desarrollo de la obra, donde el lector vive consternado
HQWUHHOWHUURU\HOPLHGR(GJDU$OODQ3RHEl hundimiento de la terri-
ble casa de los Usher.
152
Literatura I
  Picaresca: su protagonista es un pícaro, quien vive una historia llena
Bloque VI
de ingenio y astucia. Lo picaresco radica en la burla constante que el
SHUVRQDMHFHQWUDOKDFHGHODVRFLHGDGGHVGHVXSRVLFLyQtQÀPDGHQWUR
GHODHVWUXFWXUDVRFLDO$QyQLPREl Lazarillo de Tormes.
  De aventuras: este tipo de novelas en todo momento mantiene al lector
a la expectativa de los acontecimientos, ya que predomina la acción de
los personajes, puesto que relata sucesos extraordinarios y episodios
emocionantes o peligrosos en lugares sorprendentes. Mark Twain: Las
aventuras de Tom Sawyer.
  Policíaca: la historia gira en torno al descubrimiento de un hecho de-
lictivo; los personajes se encargarán de analizar a los personajes sos-
pechosos, las causas y consecuencias del suceso delictivo, así como al
FXOSDEOH$UWKXU&RQDQ'R\OHLas aventuras de Sherlock Holmes.
  $XWRELRJUiÀFD: el autor narra su propia vida, sus acontecimientos más $QyQLPRDPHGLD-
importantes, haciendo de cada personaje un elemento trascendente en dos del siglo XVI se pu-
blicó un pequeño libro
VXKLVWRULD$QD)UDQNEl diario de Ana Frank. denominado La vida de
Lazarillo de Tormes y

Actividad de aprendizaje 2 de sus fortunas y ad-


versidades, adquirien-
do gran popularidad
Lee los siguientes fragmentos y realiza lo que se te solicita a continuación. por el lenguaje,
gracia y picardía;
Texto 1 convirtiéndose en
una obra maestra
de la literatura
La vida de Lazarillo de Tormes y de sus universal.

fortunas y adversidades
$QyQLPR
Tratado Cuarto
Cómo Lázaro se asentó con un fraile de la Merced, y
de lo que le acaeció con él
Hube de buscar el cuarto, y éste fue un frai-
le de la Merced, que las mujercillas que digo me en-
caminaron, al cual ellas le llamaban pariente: gran
enemigo del coro y de comer en el convento, perdido
por andar fuera, amicísimo de negocios seglares y vi-
sitar, tanto que pienso que rompía él más zapatos que
WRGR HO FRQYHQWR eVWH PH GLR ORV SULPHURV ]DSDWRV
que rompí en mi vida, mas no me duraron ocho días,
ni yo pude con su trote durar más. Y por esto y por
otras cosillas que no digo, salí dél.
Tratado Sexto
Cómo Lázaro se asentó con un capellán, y lo que con él pasó
Después desto, asenté con un maestro de pintar panderos para
molelle los colores, y también sufrí mil males.

153
153
Bloque VI Comprendes las características de la novela

Siendo ya en este tiempo buen mozuelo, entrando un día en la


iglesia mayor, un capellán de ella me recibió por suyo, y púsome en poder
un asno y cuatro cántaros y un azote, y comencé a echar agua por la ciu-
GDGeVWHIXHHOSULPHUHVFDOyQTXH\RVXEtSDUDYHQLUDDOFDQ]DUEXHQD
vida, porque mi boca era medida. Daba cada día a mi amo treinta marave-
dís ganados, y los sábados ganaba para mí, y todo lo demás, entre semana,
de treinta maravedís.
)XHPHWDQELHQHQHORÀFLRTXHDOFDERGHFXDWURDxRVTXHORXVp
con poner en la ganancia buen recaudo, ahorré para me vestir muy honra-
damente de la ropa vieja, de la cual compré un jubón de fustán viejo y un
sayo raído de manga tranzada y puerta, y una capa que había sido frisada,
y una espada de las viejas primeras de Cuéllar. Desque me vi en hábito de
hombre de bien, dije a mi amo se tomase su asno, que no quería más seguir
DTXHORÀFLR

Texto 2

El retrato de Dorian Gray


Oscar Wilde

El aire de la noche era una delicia, tan tibio que Dorian


Gray se colocó el abrigo sobre el brazo y ni siquiera
se anudó en torno a la garganta la bufanda de seda.
Mientras se dirigía hacia su casa, fumando un cigarri-
llo, dos jóvenes vestidos de etiqueta se cruzaron con
pO\R\yFyPRXQROHVXVXUUDEDDORWUR´eVHHV'RULDQ
Gray”. Recordó cuánto solía agradarle que alguien lo
señalara con el dedo o se le quedara mirando y habla-
UDGHpO$KRUDOHFDQVDEDRtUVXQRPEUH%XHQDSDUWH
del encanto del pueblecito adonde había ido con tan-
ta frecuencia últimamente era que nadie lo conocía.
$ODPXFKDFKDDODTXHFRUWHMyKDVWDHQDPRUDUODOH
había dicho que era pobre, y Hetty le había creído. En otra ocasión le dijo
que era una persona malvada, y ella se echó a reír, respondiéndole que los
PDOYDGRVHUDQVLHPSUHPX\YLHMRV\PX\IHRV£$KVXPDQHUDGHUHtUVH
Era como el canto de la alondra. Y ¡qué bonita estaba con sus vestidos de
DOJRGyQ\VXVVRPEUHURVGHDODDQFKD+HWW\QRVDEtDQDGDGHQDGDSHUR
poseía todo lo que él había perdido.
$OOOHJDUDVXFDVDHQFRQWUyODD\XGDGHFiPDUDHVSHUiQGROR/H
dijo que se acostara, se dejó caer en un sofá de la biblioteca y empezó a
pensar en las cosas que lord Henry le había dicho.
¿Era realmente cierto que no se cambia? Sentía un deseo loco de
recobrar la pureza sin mancha de su adolescencia; su adolescencia rosa y
blanca, como lord Henry la había llamado en una ocasión. Sabía que estaba
manchado, que había llenado su espíritu de corrupción y alimentado de
KRUURUHVVXLPDJLQDFLyQTXHKDEtDHMHUFLGRXQDLQÁXHQFLDQHIDVWDVREUH
RWURV \ TXH KDEtD H[SHULPHQWDGR DO KDFHUOR XQ M~ELOR LQFDOLÀFDEOH \

154
Literatura I Bloque VI
que, de todas las vidas que se habían cruzado con la suya, había hundido
en el deshonor precisamente las más bellas, las más prometedoras. Pero,
¿era todo ello irremediable? ¿No le quedaba ninguna esperanza?
£$KHQTXpPRQVWUXRVRPRPHQWRGHRUJXOOR\GHFHJXHUDKDEtD
rezado para que el retrato cargara con la pesadumbre de sus días y él
FRQVHUYDUDHOHVSOHQGRUHWHUQDPHQWHLQWDFWRGHODMXYHQWXG6XIUDFDVR
procedía de ahí. Hubiera sido mucho mejor para él que a cada pecado co-
metido le hubiera acompañado su inevitable e inmediato castigo. En lugar
de “perdónanos nuestros pecados”, la plegaria de los hombres a un Dios de
justicia debería ser “castíganos por nuestras iniquidades”.
El curioso espejo tallado que lord Henry le regalara hacía ya tantos
DxRVVHKDOODEDVREUHODPHVD\ORVFXSLGRVGHPDUÀOHxDVH[WUHPLGDGHVVH-
guían, como antaño, rodeándolo con sus risas. Lo cogió, como había hecho
en aquella noche de horror, cuando por primera vez advirtiera un cambio
en el retrato fatal, y con ojos desencajados, enturbiados por las lágrimas,
FRQWHPSOyVXVXSHUÀFLHSXOLPHQWDGD(QXQDRFDVLyQDOJXLHQTXHOHKDEtD
amado apasionadamente le escribió una carta que concluía con esta ma-
nifestación de idolatría: “El mundo ha cambiado porque tú estás hecho de
PDUÀO\RUR/DFXUYDGHWXVODELRVYXHOYHDHVFULELUODKLVWRULDµ$TXHOODV
frases le volvieron a la memoria, y las repitió una y otra vez. Luego su be-
OOH]DOHLQVSLUyXQDLQÀQLWDUHSXJQDQFLD\DUURMDQGRHOHVSHMRDOVXHOROR
aplastó con el talón hasta reducirlo a astillas de plata. Su belleza le había
perdido, su belleza y la juventud por la que había rezado. Sin la una y sin la
otra, quizá su vida hubiera quedado libre de mancha. La belleza sólo había
sido una máscara, y su juventud, una burla. ¿Qué era la juventud en el me-
jor de los casos? Una época de inexperiencia, de inmadurez, un tiempo de
estados de ánimo pasajeros y de pensamientos morbosos. ¿Por qué se había
empeñado en vestir su uniforme? La juventud lo había echado a perder.
Era mejor no pensar en el pasado. Nada podía cambiarlo. Tenía
TXHSHQVDUHQVtPLVPRHQVXIXWXUR$-DPHV9DQHORKDEtDQHQWHUUDGR
HQXQDWXPEDDQyQLPDHQHOFHPHQWHULRGH6HOE\$ODQ&DPSEHOOVHKDEtD
suicidado una noche en su laboratorio, pero sin revelar el secreto que le
había sido impuesto. La emoción, o la curiosidad, suscitada por la desapa-
rición de Basil Hallward pronto se desvanecería. Ya empezaba a pasar. Por
ese lado no tenía nada que temer. Y, de hecho, no era la muerte de Basil
Hallward lo que más le abrumaba. Le obsesionaba la muerte en vida de
su propia alma. Basil había pintado el retrato que echó a perder su vida.
Eso no se lo podía perdonar. El retrato tenía la culpa de todo. Basil le dijo
cosas intolerables que él, sin embargo, soportó con paciencia. El asesinato
IXH REUD VHQFLOODPHQWH GH XQD ORFXUD PRPHQWiQHD (Q FXDQWR D$ODQ
Campbell, el suicidio había sido su decisión personal. Había elegido actuar
así. Nada tenía que ver con él.
£8QDYLGDQXHYD(VRHUDORTXHQHFHVLWDED(VRHUDORTXHHVWDED
esperando. Sin duda la había empezado ya. Había evitado, al menos, la
perdición de una criatura inocente. Nunca volvería a poner la tentación en
el camino de la inocencia. Sería bueno.
$O SHQVDU HQ +HWW\ 0HUWRQ HPSH]y D SUHJXQWDUVH VL HO UHWUDWR
habría cambiado. Sin duda no sería ya tan horrible como antes. Quizá, si su
vida recobraba la pureza, expulsaría de su rostro hasta el último resto de

155
155
Bloque VI Comprendes las características de la novela

las malas pasiones. Quizás, incluso, habían desaparecido ya. Iría a verlo.
7RPyODOiPSDUD\VXELyVLJLORVDPHQWHODVHVFDOHUDV$OGHVFRUUHU
el cerrojo, una sonrisa de alegría iluminó por un instante el rostro extra-
ñamente joven y se prolongó unos momentos más en torno a los labios. Sí,
practicaría el bien, y aquel retrato espantoso que llevaba tanto tiempo
escondido dejaría de aterrorizarlo. Sintió que ya se le había quitado un
peso de encima.
Entró sin hacer el menor ruido, volviendo a cerrar la puerta con
llave, como tenía por costumbre, y retiró la tela morada que cubría el cua-
dro. Un grito de dolor e indignación se le escapó de los labios. No se notaba
cambio alguno, con la excepción de un brillo de astucia en la mirada y en la
boca las arrugas sinuosas de la hipocresía. El lienzo seguía siendo tan odio-
so como siempre, más, si es que eso era posible; y el rocío escarlata que le
manchaba la mano parecía más brillante, con más aspecto de sangre recién
derramada. Dorian Gray empezó entonces a temblar. ¿Le había empujado
únicamente la vanidad a llevar a cabo su única obra buena? ¿O había sido
el deseo de una nueva sensación, como apuntara lord Henry, con su risa
burlona? ¿O tal vez el deseo apasionado de representar un papel que nos
empuja a hacer cosas mejores de lo que nos corresponde por naturaleza?
¿O, quizá, todo aquello al mismo tiempo? Pero, ¿por qué era más grande
la mancha roja? Parecía haberse extendido como una horrible enfermedad
sobre los dedos cubiertos de arrugas. Había sangre en los pies pintados,
como si aquella cosa hubiera goteado..., sangre incluso en la mano que
no había empuñado el cuchillo. ¿Una confesión? ¿Quería aquello decir que
iba a confesar su crimen? ¿Qué iba a entregarse para que lo ejecutaran?
6HHFKyDUHtU/DLGHDOHSDUHFLyPRQVWUXRVD$GHPiVDXQTXHFRQIHVDUD
¿quién iba a creerlo? No había en ninguna parte resto alguno del pintor
DVHVLQDGR7RGDVVXVSHUWHQHQFLDVKDEtDQVLGRGHVWUXLGDVeOPLVPRKDEtD
quemado maletín y abrigo. El mundo diría simplemente que estaba loco.
Lo encerrarían en un manicomio si se empeñaba en repetir la misma histo-
ria... Sin embargo, era obligación suya confesar, soportar públicamente la
vergüenza y expiar la culpa de manera igualmente pública. Había un Dios
que exigía a los seres humanos confesar sus pecados en la tierra así como
HQHOFLHOR1DGDGHORTXHKLFLHUDOHSXULÀFDUtDVLQRFRQIHVDEDVXSHFDGR
¿Su pecado? Se encogió de hombros. La muerte de Basil Hallward le parecía
muy poca cosa. Pensaba en Hetty Merton. Porque aquel espejo de su alma
que estaba contemplando era un espejo injusto. ¿Vanidad? ¿Curiosidad? ¿Hi-
pocresía? ¿No había habido más que eso en su renuncia? Había habido algo
PiV$O PHQRV DVt OR FUHtD pO 3HUR ¢FyPR VDEHUOR" 1R 1R KXER QDGD
más. Sólo renunció a la muchacha por vanidad. La hipocresía le había lle-
vado a colocarse la máscara de la bondad. Había ensayado la abnegación
SRUFXULRVLGDG$KRUDORUHFRQRFtD
Pero aquel asesinato..., ¿iba a perseguirlo toda su vida? ¿Siempre
tendría que soportar el peso de su pasado?
¿Tendría que confesar? Nunca. No había más que una prueba en
contra suya. El cuadro mismo: ésa era la prueba. Lo destruiría. ¿Por qué
OR KDEtD FRQVHUYDGR WDQWR WLHPSR"$xRV DWUiV OH SURSRUFLRQDED HO SODFHU
de contemplar cómo cambiaba y se hacía viejo. En los últimos tiempos
ese placer había desaparecido. El cuadro le impedía dormir. Cuando salía

156
Literatura I Bloque VI
de viaje, le horrorizaba la posibilidad de que lo contemplasen otros ojos.
Teñía de melancolía sus pasiones. Su simple recuerdo echaba a perder mu-
chos momentos de alegría. Había sido para él algo así como su conciencia.
Sí. Había sido su conciencia. Lo destruiría.
Miró a su alrededor, y vio el cuchillo con el que apuñaló a Basil
Hallward. Lo había limpiado muchas veces, hasta que desaparecieron todas
las manchas. Brillaba, lanzaba destellos. De la misma manera que había
PDWDGR DO SLQWRU PDWDUtD VX REUD \ WRGR OR TXH VLJQLÀFDED 0DWDUtD HO
SDVDGR\FXDQGRHVWXYLHUDPXHUWRpOUHFREUDUtDODOLEHUWDG$FDEDUtDFRQ
aquella monstruosa vida del alma y, sin sus odiosas advertencias, recobra-
ría la paz. Empuñó el arma y con ella apuñaló el retrato.
6HR\yXQJULWR\HOJROSHGHXQDFDtGD(OJULWRSXVRGHPDQLÀHVWR
un sufrimiento tan espantoso que los criados despertaron asustados y sa-
lieron en silencio de sus habitaciones. Dos caballeros que pasaban por la
plaza se detuvieron y alzaron los ojos hacia la gran casa. Luego siguieron
caminando hasta encontrar a un policía y regresar con él. Llamaron varias
veces al timbre, pero sin recibir respuesta. Con la excepción de una luz
HQXQRGHORVEDOFRQHVGHOSLVRDOWRWRGRHVWDEDDRVFXUDV$OFDERGHXQ
rato, el policía se trasladó hasta un portal vecino para contemplar desde
DOOtHOHGLÀFLR
—¿Quién vive en esa casa? —le preguntó el caballero de más edad.
—El señor Dorian Gray —respondió el policía.
Las dos personas que le escuchaban intercambiaron una mirada
de inteligencia y, mientras se alejaban, había en su rostro una mueca de
GHVSUHFLR8QRGHHOORVHUDWtRGHVLU+HQU\$VKWRQ
Dentro de la casa, en la zona donde vivía la servidumbre, los cria-
dos a medio vestir hablaban en voz baja. La anciana señora Leaf lloraba y
se retorcía las manos. Francis estaba tan pálido como un muerto.
Transcurrido un cuarto de hora aproximadamente, el ayuda de
cámara tomó consigo al cochero y a uno de los lacayos y subió en silencio
las escaleras. Los golpes en la puerta no obtuvieron contestación. Y todo
siguió en silencio cuando llamaron a su amo de viva voz. Finalmente, des-
pués de tratar en vano de forzar la puerta, salieron al tejado y descendie-
URQKDVWDHOEDOFyQ8QDYH]DOOtHQWUDURQVLQGLÀFXOWDGORVSHVWLOORVHUDQ
muy antiguos.
En el interior encontraron, colgado de la pared, un espléndido
retrato de su señor tal como lo habían visto por última vez, en todo el es-
plendor de su juventud y singular belleza. En el suelo, vestido de etiqueta,
y con un cuchillo clavado en el corazón, hallaron el cadáver de un hombre
mayor, muy consumido, lleno de arrugas y con un rostro repugnante. Sólo
lo reconocieron cuando examinaron las sortijas que llevaba en los dedos.

157
157
Bloque VI Comprendes las características de la novela

1) (VFULEHXQHMHPSORTXHHQFXHQWUHVHQORVIUDJPHQWRVGHFDGDÀJXUD
retórica.
a. Comparación

b. $OHJRUtD

c. Metáfora

d. Hipérbole

e. Epítetos

2) (QWXOLEUHWDFODVLÀFDODVQRYHODVDODVFXDOHVSHUWHQHFHQORVIUDJPHQWRV
investigando el argumento de cada una. Explica por qué se considera
en ese tipo.
3) ,QYHVWLJDTXpUHODFLyQWLHQH:LOGHFRQ'RULDQ*UD\DGHPiVGHVHUVX
creador.

Síntesis
La novela puede ser de diferentes tipos según el tema tratado. Existen novelas
SROLFLDFDV SLFDUHVFDV KLVWyULFDV DXWRELRJUiÀFDV FRVWXPEULVWDV GH DYHQWXUDV
entre otros. El arte novelístico puede apreciarse en el lenguaje que usa el autor a
WUDYpVGHORVSHUVRQDMHV(VWHOHQJXDMHXVDÀJXUDVUHWyULFDVODVFXDOHVDGTXLHUHQ
gran importancia por la complejidad y extensión de la novela. Te proponemos
algunos títulos que hemos considerado interesantes para leer:
‡ Cumbres borrascosas (Emily Brontë)
‡ El Periquillo sarniento (José Joaquín Fernández de Lizardi)
‡ El coronel no tiene quien le escriba (Gabriel García Márquez)
‡ Arráncame la vida (Ángeles Mastretta)
‡ Memorias de una geisha $UWKXU*ROGHQ
‡ Marianela (Benito Pérez Galdós)
‡ El código Da Vinci (Dan Brown)

Actividad integradora
1) (ODERUDXQHVTXHPDDXWRELRJUiÀFRFRQORVHOHPHQWRV\FDUDFWHUtVWLFDV
de la novela.
2) Redacta un argumento para una novela, basada en el esquema que rea-
lizaste en el inciso anterior. La extensión máxima es de dos cuartillas.
3) Elabora la reseña de una novela de tu elección, incluyendo los elementos
textuales e intertextuales. Puedes elegir alguna de las novelas enlistadas
en la síntesis de la sesión B. Debes incluir tu opinión acerca del texto leído,
relativo a su contenido artístico-social y su conexión con tu entorno.
158
4)
Literatura I
$FRQWLQXDFLyQVHWHSURSRUFLRQDXQIUDJPHQWRGHODQRYHODÁngeles y
Bloque VI
demonios, del autor Dan Brown; efectúa la lectura y, posteriormente,
realiza las actividades que se te solicitan.

Ángeles y demonios
Dan Brown
Capítulo 91
Langdon y Vittoria corrieron hacia la entrada principal
de la iglesia de Santa Maria della Vittoria, y encontra-
ron cerrada con llave la puerta de madera. La joven
disparó tres veces con la semiautomática de Olivetti y
destrozó la vieja cerradura.
La escena que presenciaron cuando entra-
ron fue tan inesperada, tan extraña, que Langdon
tuvo que cerrar los ojos y volverlos a abrir antes de
que su mente pudiera asimilarlo todo.
La iglesia era de un barroco recargado, con paredes y altares
dorados. En el centro del sagrario, bajo la cúpula principal, habían amon-
tonado bancos de madera, que ahora ardían como una especie de pira
funeraria de dimensiones épicas. La hoguera se alzaba hasta la cúpula.
Cuando los ojos de Langdon ascendieron, el verdadero horror de la escena
descendió como un ave de presa.
En lo alto, desde el lado derecho e izquierdo del techo, colga-
ban dos cables utilizados para balancear recipientes de incienso sobre la
congregación. Sin embargo, los cables no sujetaban incensarios en este
momento. Ni se balanceaban. Los habían utilizado para otra cosa...
Un ser humano colgaba de los cables. Un hombre desnudo. Cada
muñeca estaba sujeta a un cable, y lo habían alzado casi hasta el punto
GHGHVFXDUWL]DUOR7HQtDORVEUD]RVH[WHQGLGRVFRPRFODYDGRDXQFUXFLÀMR
LQYLVLEOHTXHÁRWDUDHQODFDVDGH'LRV
Langdon se sintió paralizado cuando miró. Un momento después
SUHVHQFLyODDERPLQDFLyQÀQDO(ODQFLDQRHVWDEDYLYR\OHYDQWyODFDEH]D
Un par de ojos aterrorizados suplicaron ayuda en silencio. Había un emble-
ma grabado en el pecho del hombre. Le habían marcado a fuego. Langdon
no lo veía con claridad, pero albergaba pocas dudas sobre lo que ponía.
Cuando las llamas lamieron los pies del hombre, la víctima lanzó un grito
de dolor y su cuerpo tembló.
Como espoleado por una fuerza invisible, Langdon corrió por el
pasillo principal hacia la hoguera. Sus pulmones se llenaron de humo al
DFHUFDUVH$WUHVPHWURVGHOLQÀHUQRVHHVWUHOOyFRQWUDXQDPXUDOODGHFD-
lor. Se le chamuscó la piel de la cara y retrocedió, protegiéndose los ojos,
hasta caer sobre el suelo de mármol. Se puso en pie con movimientos tor-
pes y volvió a intentar avanzar, con las manos levantadas para protegerse.
Se dio cuenta al instante. El fuego desprendía demasiado calor.
Retrocedió y examinó las paredes de la iglesia. Un tapiz pesado,
pensó. Si pudiera apagar el... Pero sabía que no encontraría ningún tapiz.
¡Estás en una capilla barroca, Robert, no en un castillo alemán! ¡Piensa!
Se obligó a mirar de nuevo al hombre colgado.
159
159
Bloque VI Comprendes las características de la novela

El humo y las llamas remolineaban en lo alto de la cúpula. Los ca-


EOHVTXHVXMHWDEDQODVPXxHFDVGHOKRPEUHSDVDEDQSRUSROHDVÀMDGDVHQ
el techo y descendían de nuevo hasta abrazaderas metálicas empotradas
a cada lado de la iglesia. Langdon examinó una de las abrazaderas. Estaba
EDVWDQWH DOWR SHUR VDEtD TXH VL SRGtD DOFDQ]DUOD \ DÁRMDU XQR GH ORV
cables, la tensión disminuiría y el hombre se alejaría del fuego.
Una repentina llamarada se alzó más que las demás, y Langdon
oyó un chillido penetrante. La piel de las plantas de los pies del hombre
estaban empezando a cubrirse de ampollas. El cardenal se estaba asando
vivo. Langdon clavó la vista en la abrazadera y corrió.
En la parte posterior de la iglesia, Vittoria aferraba el respaldo de
un banco y procuraba serenarse. La imagen suspendida del techo era horri-
pilante. Se obligó a desviar la vista. ¡Haz algo! Se preguntó dónde estaría
Olivetti. ¿Habría visto al hassassin? ¿Le habría capturado? ¿Dónde estaban
ahora? Vittoria avanzó dispuesta a ayudar a Langdon, pero en aquel mo-
mento un sonido la detuvo.
El crepitar de las llamas aumentaba de intensidad a cada instante,
pero un segundo sonido cortó el aire. Una vibración metálica. Cercana.
(O ODWLGR UHSHWLGR SDUHFtD VXUJLU GHO ÀQDO GH ORV EDQFRV D VX L]TXLHUGD
5HFRUGDEDDOWLPEUHGHXQWHOpIRQRSHURGXUR\SpWUHR$IHUUyODSLVWROD
FRQÀUPH]D\DYDQ]ySRUODÀODGHEDQFRV(OVRQLGRVHR\yPiVDOWR6H
apagaba y encendía. Una vibración repetida.
&XDQGRVHDFHUFyDOÀQDOGHOSDVLOORQRWyTXHHOVRQLGRSURFHGtD
GHOVXHORMXVWRDOGREODUODHVTXLQDGHOÀQDOGHORVEDQFRV$ODYDQ]DUFRQ
la pistola extendida en la mano derecha, se dio cuenta de que también
sujetaba otra cosa en la izquierda, el móvil. Con el pánico, había olvidado
que lo había usado fuera para llamar al comandante... de manera que ha-
bía conectado el vibrador como advertencia. Vittoria se llevó el aparato al
oído. Continuaba sonando. El comandante no había contestado. De repente,
FRQ FUHFLHQWH WHPRU FUH\y VDEHU FXiO HUD HO RULJHQ GHO VRQLGR$YDQ]y
temblorosa.
Toda la iglesia pareció hundirse bajo sus pies cuando vio el cadá-
ver en el suelo. No había rastros de sangre. Tampoco señales de violencia
que tatuaran la piel. Sólo la espantosa simetría de la cabeza del coman-
dante... torcida hacia atrás, en un giro de ciento ochenta grados. Vittoria
intentó no pensar en las imágenes del cadáver de su padre.
El teléfono del comandante estaba apoyado contra el suelo, vi-
brando una y otra vez sobre el mármol. Vittoria canceló su llamada, y el
ruido cesó. En el silencio, oyó un nuevo sonido. Una respiración en la oscu-
ridad, justo detrás de ella.
Empezó a darse la vuelta, empuñando la pistola, pero sabía que
era demasiado tarde. Una ráfaga de calor la taladró de la cabeza a los pies
cuando el codo del asesino golpeó su nuca.
³$KRUDHUHVPtD³GLMRXQDYR]
Después una negrura impenetrable descendió sobre ella.

160
Literatura I Bloque VI
En la zona del sagrario, en el lateral izquierdo de la iglesia, Lang-
don se mantenía en equilibrio sobre un banco y trataba de alcanzar la
abrazadera. El cable se encontraba a unos dos metros sobre su cabeza.
$EUD]DGHUDVFRPRpVWDHUDQFRPXQHVHQODVLJOHVLDV\VHFRORFDEDQHQDOWR
para impedir que las manipularan. Langdon sabía que los curas utilizaban
escalerillas llamadas piuòli para alcanzarlas. Era evidente que el asesino
había usado la escalerilla de la iglesia para colgar a su víctima. ¿Dónde ha
dejado la escalera? Langdon escudriñó el suelo. Creía haber visto una esca-
lerilla en algún sitio. Pero ¿dónde? Un momento después, su corazón dio un
vuelco. Recordó dónde la había visto. Se volvió hacia el fuego. La escalera
se elevaba sobre la hoguera, envuelta en llamas.
Desesperado, inspeccionó la iglesia en busca de algo que pudiera
ayudarle a alcanzar la abrazadera. Mientras sus ojos rastreaban el templo,
se dio cuenta de algo.
¿Dónde demonios está Vittoria? Había desaparecido. ¿Ha ido a
buscar ayuda? Langdon gritó su nombre, pero no hubo respuesta. ¿Dónde
está Olivetti?
Se oyó un aullido de dolor en lo alto, y Langdon intuyó que ya era
demasiado tarde. Cuando sus ojos se alzaron de nuevo y vio a la víctima,
que se iba achicharrando lentamente, sólo pensó en una cosa. Agua. En
cantidades. Apagar el fuego. Al menos, para acortar la altura de las lla-
mas.
³£1HFHVLWRDJXDPDOGLWDVHD³FKLOOy
—Ese es el siguiente —gruñó una voz desde el fondo.
Langdon giró en redondo, y estuvo a punto de caer del banco.
Hacia él avanzaba sin vacilar un monstruo oscuro. Pese al res-
plandor del fuego, sus ojos ardían como carbones. Langdon reconoció la
pistola que esgrimía, la misma que él había guardado en la chaqueta, la
que Vittoria llevaba cuando entraron.
La oleada de pánico inicial dio paso a un frenesí de temores dife-
rentes. Primero, por Vittoria. ¿Qué le había hecho este animal? ¿Estaba he-
rida? ¿O algo peor? En el mismo instante, Langdon reparó en que el hombre
FROJDGRJULWDEDFRQPiVIXHU]D(OFDUGHQDOLEDDPRULU$\XGDUOHHUDLP-
posible. Después, cuando el asesino apuntó la pistola al pecho de Langdon,
éste reaccionó. Se lanzó de un salto sobre el mar de bancos.
$WHUUL]yFRQPiVYLROHQFLDGHODTXHKDEtDLPDJLQDGR\URGySRU
el suelo. El mármol amortiguó su caída con la delicadeza del acero. Oyó
pasos que se acercaban por su derecha. Langdon se volvió hacia la entrada
de la iglesia y empezó a gatear bajo los bancos.
En lo alto, el cardenal Guidera vivía sus últimos momentos de
conciencia. Cuando miró su cuerpo desnudo, vio que la piel de sus piernas
empezaba a chamuscarse y desprenderse. (VWR\ HQ HO LQÀHUQR GHFLGLy
Dios mío, ¿por qué me has abandonado?6DEtDTXHGHEtDGHVHUHOLQÀHUQR
porque estaba mirando la marca de su pecho al revés, y no obstante, como
magia del demonio, la palabra se veía con toda claridad Fire.

161
161
Bloque VI Comprendes las características de la novela

1) ,GHQWLÀFDORVHOHPHQWRV\FDUDFWHUtVWLFDVGHODQRYHODHQHOIUDJPHQWR
de Brown.
a. &ODVLÀFDORVSHUVRQDMHVVHJ~QVXLPSRUWDQFLD

b. (VSHFLÀFDHOWLSRGHQDUUDGRU

c. Menciona los espacios que se describen en el fragmento.

d. Explica si el tiempo tiene una secuencia lineal o fragmentada.

e. Explica cuál es el ambiente que se experimenta en el texto.

f. 6HxDODODWHPDWL]DFLyQHVSHFLÀFDQGRHOWHPDFHQWUDO\ORVDOWHUQRV

g. Menciona cuál es nivel de contenido de la obra.

h. Explica el tipo de novela al que pertenece Ángeles y demonios.

162
i.
Literatura I
¿Cómo se relaciona esta obra con tus sentimientos?
Bloque VI

j. Investiga la biografía de Brown y explica en tu cuaderno cuál de


WRGDVVXVYLYHQFLDVLQÁX\yHQHVWDQRYHOD

Realimentación
(VWiVDSXQWRGHÀQDOL]DUHVWHSDVHROLWHUDULRSRUWDOPRWLYRHVLPSRUWDQWHTXH
sepas y valores todas las habilidades desarrolladas en el transcurso de este bloque,
por lo tanto, te pedimos que respondas de manera honesta lo que se te solicita en
la tabla. Explica tu situación de aprendizaje.

Saberes Antes Después


¢3XHGRLGHQWLÀFDUORVWLSRVGH
novela según su contenido y su
tema?
¿Considero a la novela como una
forma de expresión artística-
social?
¿Conozco los elementos
característicos y los integro en
un análisis?
¿Entiendo los contextos de
producción relacionados con la
obra?

Con base en los textos leídos,


¢SXHGRLGHQWLÀFDUHQODQRYHODHO
nivel retórico?

Una vez ubicada tu situación frente al desarrollo de competencias, es-


tablece de manera consciente y responsable las estrategias que utilizarás para

163
163
Bloque VI Comprendes las características de la novela

alcanzar el nivel de desempeño deseado.

Evaluación de la competencia
Después de socializar los resultados de sus aprendizajes, ubiquen su nivel de des-
empeño en la adquisición de las competencias relacionadas con esta sesión, to-
mando en consideración el cumplimiento de los criterios presentados al inicio.

Inicial- Resolutivo-
Pre-formal Autónomo Estratégico
Criterio receptivo básico
  
 
$QDOL]ROD No analizo $QDOL]ROD $QDOL]ROD
$QDOL]ROD
estructura interna la estructura estructura estructura
,GHQWLÀFROD estructura interna
y externa de interna y externa interna y externa interna y externa
estructura y externa de
la novela en de la novela en de la novela en de la novela en
interna y externa la novela en
textos sugeridos, textos sugeridos, textos sugeridos, textos sugeridos,
de la novela en textos sugeridos,
relacionándolos relacionándolos pero no entiendo relacionándolos
textos sugeridos. argumentando su
con el contexto con el contexto su relación con con el contexto
contenido social.
particular. particular. mi contexto. particular.
Integro los
Integro los No integro Integro los
elementos
elementos los elementos Conozco los Integro los elementos
característicos
característicos característicos elementos elementos característicos
de la novela,
de la novela, de la novela, característicos característicos de la novela,
basados en mi
explicando explicando de la novela, de la novela, explicando
vida, explicando
el contexto e el contexto e explicando explicando el contexto e
el contexto e
intertexto en intertexto en el contexto e el contexto e intertexto en
intertexto en
HMHPSOLÀFDFLRQHV HMHPSOLÀFDFLRQHV intertexto. intertexto. HMHPSOLÀFDFLRQHV
HMHPSOLÀFDFLRQHV
JUiÀFDV JUiÀFDV JUiÀFDV
JUiÀFDV
$SUHFLRHO
$SUHFLRHO No aprecio el valor artístico $SUHFLRHO
,GHQWLÀFRORV
valor artístico valor artístico de la novela, valor artístico
,GHQWLÀFRORV elementos y
de la novela, de la novela, LGHQWLÀFDQGR de la novela,
elementos y características
LGHQWLÀFDQGR LGHQWLÀFDQGR los elementos y LGHQWLÀFDQGR
características en diferentes
los elementos y los elementos y características los elementos y
en diferentes tipos de textos
características características en diferentes características
tipos de textos correspondientes
en diferentes en diferentes tipos de textos, en diferentes
correspondientes a este subgénero
tipos de textos tipos de textos en textos que me tipos de textos
a este subgénero literario, como
correspondientes correspondientes da mi maestro, correspondientes
literario. parte de mi
a este subgénero a este subgénero correspondientes a este subgénero
asignatura.
literario. literario. a este subgénero literario.
literario.
1RLGHQWLÀFRODV ,GHQWLÀFRODV ,GHQWLÀFR\
,GHQWLÀFRODV ,GHQWLÀFRODV
ÀJXUDVOLWHUDULDV ÀJXUDVOLWHUDULDV argumento las
ÀJXUDVOLWHUDULDV Conozco las ÀJXUDVOLWHUDULDV
frecuentes en frecuentes en ÀJXUDVOLWHUDULDV
frecuentes en los ÀJXUDVOLWHUDULDV frecuentes en
los diferentes los diferentes frecuentes en los
diferentes tipos de frecuentes en los los diferentes
tipos de novelas, tipos de novelas, diferentes tipos de
novelas, a través de diferentes tipos tipos de novelas,
a través de la a través de la novelas, a través
la lectura de textos de novelas. a través de la
lectura de textos lectura de textos de la lectura de
modelo. lectura que elijo.
modelo. modelo. textos modelo.

164
Literatura I Resolutivo-
Bloque VI
Pre-formal Inicial-receptivo Autónomo Estratégico
Criterio básico
   

No redacto un Redacto una
Redacto un texto
Redacto un texto texto sencillo Redacto un texto novela corta
Conozco las sencillo usando las
sencillo usando las usando las sencillo usando usando las
características características de
características de características las características características
de los diferentes los diferentes tipos
los diferentes tipos de los diferentes de los diferentes de los diferentes
tipos de la novela, de la novela, según
de la novela, según tipos de la tipos de la tipos de la
según su contenido su contenido y
su contenido y novela, según novela, según su novela, usando el
y tema. tema, basado en mi
tema. su contenido y contenido y tema. contexto social
contexto personal.
tema. actual.
No promuevo Promuevo
valores en mis valores en mis
Promuevo valores Promuevo Promuevo valores
redacciones redacciones
en mis redacciones Promuevo valores valores en mis en mis redacciones
cuando me cuando me
cuando me integro en mis redacciones redacciones y cuando me integro
integro en integro en
en diferentes cuando realizo colaboro en la en equipos de
diferentes diferentes
equipos y colaboro actividades de realización de trabajo con
equipos y equipos y
en la realización de manera individual. actividades en SHUVRQDVDÀQHV
colaboro en la colaboro en la
actividades. equipo. conmigo.
realización de realización de
actividades. actividades

165
165
Bloque VI Comprendes las características de la novela

Bibliografía
‡ $QyQimo. (2004). El Lazarillo de Tormes. Madrid, España. Edimat Libros.
‡ (2008). Antología Narrativa de Literatura I. Dirección Clemente Merodio López. Editorial San-
tillana.
‡ $]FRUUD$OHMRV-HV~V   Diez leyendas mayas. Mérida, Yucatán, México. Maldonado edi-
tores.
‡ Brown, Dan. (2006). Ángeles y demonios. Barcelona, España. Umbriel.
‡ Canseco Romero, M.; García Piñón, O. y Lucero Sánchez, M. (2008). Literatura 1. México: San-
tillana.
‡ Covo, Torres Javier. (2003). Leyendas Mayas. Mérida, Yucatán, México. Editorial Dante.
‡ 'HO5tR0DUWtQH]0DUtD$VXQFLyQ  Literatura 1. México: McGraw-Hill.
‡ García Márquez Gabriel. (2004). Memoria de mis putas tristes0p[LFR(GLWRULDO',$1$
‡ Kafka, Franz. (2007). La Metamorfosis. México: Clásicos escolares.
‡ Montes de Oca, Francisco. (1997). Teoría y técnica de la literatura. México: Porrúa. 17ª Edición.
‡ Oseguera, Eva Lydia. (2006). Literatura 1. México: Cultural.
‡ Oseguera, Eva Lydia. (2008). Compendio de literatura universal. 3ª Edición. Grupo Editorial
Patria.
‡ Prado García, María de Lourdes. (2009). Literatura 1. México: ST.
‡ Ramos Flores, H.; Raygoza Cuevas, K. y Robles Cortez, K. (2008). Literatura 1. México: Thomson.
‡ Rojas Emilio. (1995). Antología 1 y 2. México. Editorial Editer.
‡ Sófocles. (1999). Siete tragedias. México: Porrúa.
‡ Villaseñor López, Victoria Yolanda. (2007). Literatura 1. México: Nueva Imagen, IE.
‡ :LOGH2VFDU  Obras selectas. Madrid, España. Edimat Libros.

Referencias electrónicas
‡ http://www. ciudadseva.com/textos/cuentos/euro/andersen/abuelita.htm
‡ http://www. ciudadseva.com/textos/cuentos/ing/poe/corazón.htm
‡ http://www.ciudadseva.com/textos/cuentos/esp/cortazar/llorar.html
‡ http://www.ciudadseva.com/textos/cuentos/mini/minicuen.html
‡ http://www.cuentosinfantiles.idoneos.com
‡ http://www.edyd.com/Fabulas
‡ http://www.elmundo.es/elmundolibro/microrrelatos/ García Márquez/ Un rompecabezas
‡ http://www.elsiglodetorreon.com.mx/noticia/15194.la-leyenda-del-callejon-del-beso.html
‡ KWWSZZZHVFULWRUHVRUJLQGH[SKSELRJUDÀDVHGXDUGRJDOHDQR
‡ http://www.esmas.com/noticierostelevisa/biografías/369786.htn.
‡ http://www.las9musas.net/siglo19/modernismo/3Rubendario/ard.html
‡ KWWSZZZOLWHUDWXUDRUJ6KXD&*B/D4XH1R(VWDKWPO
‡ http://www.losmejorescuentos.com/cuentos/terror31.php
‡ KWWSZZZPHPEHUVHVWULSRGGH)(/,1$SURWELRPEKWP
‡ KWWSZZZPLWRVODEORJVSRWFRPJXDWHPDODPLWRPD\DRULJHQVHUHVBKWPO
‡ http://www.mitos-mexicanos.com
‡ http://www.poema-de-amor.com.ar/
‡ KWWSZZZSRHPDVGHODOPDFRPPDULREHQHGHWWLFRQÀGHQFLDOKWPO
‡ KWWSZZZYLFWRU\VLOFDQDEORJVSRWFRPOH\HQGDFKLQDODÁRUGHODKRQHVWLdad.html
‡ http://www.vivir-poesia.com/

166

También podría gustarte