sirve017 NCBI Blastigb/AAA20836.1] (859 letters) BLAST! » blastn suite» RID-ZTMBSTC3015 BLAST Results Job ttle: gbAAA20836.1| (859 otters) RID Z7857C2015 (Expires on 11-05 03:28 am) Query 1D 4vA20838.1 Deseription Luxg [Vibrio herveyi] Deseription All no Molecule type amine acd Query Length 859 Now Analyze your query Graphic Summary Database Nam: dant GenBank COs translations POB4SwissProtsPIR¥PRE exclucing Program BLAST 27.1+ SimarsBLAST Putatve conserved domains have been detects, elk onthe Image belw for tated results, Soecitic hits (OSPSCSISSWNT rs ‘Superfanilies Lund-periplasn superfamily | PAS superfamily Distribution of the top 85 Blast Hits on 82 subject sequences Color key for allgnment scores met M40-so— s0-80 0-200 >=200 a8 1 150 300 450 600 750 hips:iblastncb nim nih gowlast oi v6sinn017 NCBI Blastigb/AAA20836.1] (859 letters) Descriptions ‘Sequences prodcing significant algrmenis Description Max Total «== Query, Ident | Accession score score cover «value yatta pron Nedostines ness) a 2 7 tes? 3 wr onsssrit4 yatta presn (Nodostnes ness) 26 26 43% zoss 35% WE oust. yatta poten Nodosines ness) 2 a ses jest at wot7z004404 Hermans ae mesereseensereousor 210 210 41% Gost 6% we_017296755.1 yateti proton Nodostines ness) 00 75 sv sess sok we orrzent774 potter Nodostines neues) a 28 4% toss MP ortszrage stir Knee [Noone noo] 189 199 10% 2ess 00% iP ezeorza864 hypothetical proton Nodoslnes ness) 185 196 ast zee WHR otzariza It cas ee Hrecenpene reer 108 186 a 4oso 30k ot7zan4es1 yatta poe Nodostnes neues) ww 167 oo tess 3% wr onranatzst yatta proton Nodostnen nels) 10 199 2% tse ork or730068441 yatta proton Nodostnes noes) 1m swe as sete 2% 78 yatta presn (Nodostnen ness) 8 1 0% fost 05% WR onrz0z0661 yatta pron Nodosines ness) 88 105 a fois a7 Wotrz0721041 yatta proton (otostnes nels) 108 166 20% fost 3% onrzzzsset patel poten Nafoenes neat] 69 109 8% Yess 20% cas80700L yatta poten Nodostnes ness) 165 18 wm mes nypttacal preter INodotines nla] 168 168 45% sess 29% =P 17200086. two-camponee system snaoristigrekracetespense yep 462 wa gett atu ot raaesant ‘equator Nodostinesnoaloca we ouraesszas sypttaicl proton Nodes nls] se 14 47% sos 3% Ponts 7043.1 nypttatcal proton [Nodoalines nul) 158 158 os goss 33% orranonis2 ypthtcal roan [Nosotinea nsulosa) 1 153 49% to98 28% wp otT297036.1 St naan ttn astnapansa mgr wm 14 20% ese meee otrzarares "Nodeslinea nodules) we ourzeraTes ypothatcalproon Nedtinoa nsulosa] ue 9 46% 9038 30% WP aTtszT2074 hypothetical poor [Nedostins nul) we us om 4008 5% WP ano saso.4 nypthotal proton [Nedostinos nus) ue 14 49% 5096 20% trz9eaes.t hyd sensor hisitneKnashesponse regulr ‘a wwe i jess arm whotraasze.a ‘Nodoslines nals) bed sersor sine Knasalesponee requir ‘ar 1 Redosres roses] a ema yb seesor akin Kaseaesonse raguoe yay i we |Nodosilinga nodulosa) ad * AS coaching sears ns 1 5 a seat 28% ‘pata pean Nedostinsa nesta.) 1 wa a 0 Be ses Hn nae Node rads wT i 2% Yer) at ypatecal proton Nadostnes nestor] 18 v9 2% vert ype sraor tiie Kneseessonse rer 1‘ aor Nodosilinea nadulosa] “ " ms 7 a two-component sateriiaee tine Nacosnea 4 i” aor smacom 6 6 28% 7 s sos Nn nase Nodes rads ‘7 ‘or 2% yexs at sensor iti nas Noda rads} 408 ‘0s 2% mas am Sncgrpret sence Rennes yy et oe soma cara coihieg senor hte nese . INodesnes nodules ve a “ee fay as ost nse Nodes rans wa ms 2% gestae hips:iblastncb nim nih gowlast oisinn017 NCBI Blast gb/AAA20836.1] (859 letters) Description Max Total Quey | E Ident | Accession score score cover._—vallue PAS conan-conainig sensor histane Kinase ns emeeeg m2 ose wm seat sk wotrearre ‘npc pron Nestea notre] saat a6 te seems ype tn Nase oss oro 2% sexo hp onerous ‘ones pan Nessie ness swe 28% eto 208 onzzmeuns ‘opt len Rds etn wos 2% pet) 7a wporrooaee hap doner-comaring se Knaso Wdcalines . . we-onsmeas sas ser ar a pete at str nae econ nodosa soa sm ses weonterores >ypetstal pron Nasties os arr a tet 5% patel psn Neste nossa uo ao 6 terre ype pn Nests sons mo ao a sett ah Inbidemmer iin mnteemereider yap som fot 28% ype rn Neste noses sor at a sors 20 ints seer sine wentepeenreies aay ag 2% to 20% wpotraoaron mye eso hide Knasresons gue INotosire rouse ™ = ae ae ae -nybrd senor histidine kinasaivesponse reguletor 728 "7 38% Ped 23% ‘Wwe 017297171.4 ovosea duos eecmmry sere tise Ks Nodcriin rodes] nena 2% sett ai Iwoconpuneet stern nae Mado an, aa oe uu ‘nodulosa) “ rmptatial eh Nexis rows ne ome 20% fos ae cannes yatta pn dss oss oe oat 2% ter 24 wperToozeas ‘ype ron Nedosinea nots soot 0% sei? aoe erseet Iibcd essen medits agp aa 0% sore tes wporrsoores ‘ypetetal rn Nasal ness os ass % ten 286 ‘estoneegifr Nextnea man saat 1% tei ane >ypatetcal rin Nests cons sor sar 2% veto 2 Da ardraprsstir None ces wm eos wousmonrznases >yptetal pon Naoto sors use an feos ze otrtotaes patel Neste nossa ws as 10% 2e08 SR worrznoomt NAb respore put Noten ase ww a wwe evr rods * “ " See wR ouragssee.s ‘etone epi Nextel os as 1% yoo mw orraotras mye ee hide Kasresane rogue [Nodosines rule we ° ae ae ‘eon egifrNoostnes mass] sas 12% reos 20% wpotTonzuna >ypetstal pn Nason ses m2 aa 18% soot ame otras oNtaSaine apne nee tee ws 19% root cas wonrsoeszs -ypteal pn Nasties wa ton i root zo otzzracas Iida ete enema eis gy agg a roo 368 etree onan respore restr Naecsva . esi ona na ws as wm toot ar OnA-angeapore put Nadosten us ows , cco mete wonraostas odulose) We eee NA emors rept Nogotea “ F 1 we errs oun seas 1% cow a >ypetstea pn Nason esos uss “% cos a borraooans Dang pom pdt Nes mim 9% con ame etree sowaGhAC? tac Nadosea rots] =z % Pe ee hips:iblastncb nim nih gowlast oisirve017 NCBI Blast gb/AAA20836.1] (859 letters) Description Max Total Quey | E Ident | Accession score score cover._—vallue response regulator (Neosines nodosa) 259 29 % 95 soe we o2sorave0 Alignments hypothetical protein Nocoslinsa noduloss) Sequonce ID: WP_083887116.1 Longth: 987 Number of Malchos: 1 “47210838 Range 1 Dar ora(Gta) Te-67%) Compostional navi eda Features: ‘query Sbjct (query Sbjct query sbjct ‘query sb: ‘query Sbjct Query ‘query sbjct ‘query shjct soz an se a0 Bebra oh dedicat evo} eegeip ose ane Becrosatmeraro HERR cclbpeibcbedbon ett entitle eee oe oe ecg ngs EER Seal ie itevinewmadeliurnsioioe cao sor apna. BEC AEE AM arn guettecuet eit feqot tity wetted we hypothetical protein (Nocostnea nodulosa) ‘Sequence 1D: WP_083886991.1 Longth: 647 Number of Matches: 1 ‘31610771, Range * 225 biS(STT) 26-65) Compostional matin eda Features: uery uery ‘query sbi ‘query Sbjct query ‘query shject ‘query shjct a6 oa 496 Expect Mathed denon Positives __ Gaps KnQTDVL.CHSGEHL ARUASadnGiicEFcAveeue IATPInaUserat iter Soehbradtriaestt - 1033 (query $9 VEIFTDQVRLNGLLPNLSMEET?IGS-IRLMAELEGFYGAENSYLWVELIDISZGLE st Sbjct 1034 -ELAMDENDIRDULINLISMAVRFTOASoQUTLAVGUESRE. bnieLsisVEBIGICIA 1090 cue 8 Sg EE Rg vue iy yay Geetst ve rote oe rds SRaMeteLtal vaxcad uceVadretveesscFrvath x350 query 708 og a 76 Query 737. ------VLLYEORNINAPLOAECKXVROMUDNAKOGL DAME SOTIYDLILAEAGLIM 790 Sbjct 1211 quarpLitLVEonaTrvaris$tLtasoval WAKNEQDATECTRTMTPOLILMDION®G 1278 (Query 791 LOGLETIREIRENLALGT-RLVACTADIAKETSDAFRAAGANYONLKELKENAL 843 Sbjct 1271. TOSLEALROLRADGHERDLPVTALTALAMAGORORCLARGASQYLTROVRNRKL 2326 hybre sensor histidine Knaseiresponse regulator (Nodosilinea nodulosa} ‘Sequence 1D: WP_017296755.1 Length: 1581 Number of Matches: 1 Range #11100 7480) Seow Expect Mathod Identities Positives Gaps Frame 240 bis(595) 66-570) Compositional max adust. 13/979(96%) 21O/3TA(55%) 15°975(4%) Features: ancy ss Sc sgporaceonipacgei age corr Sig srmarasigramumcgrersgati ay ne sie ta EncouliniviecinasinitsaiBinreiraasmantiebeceh ue? nn) 7H morronimaageare Puan He hypothetical prow [Nocosiinea nodosa) ‘Sequence ID: WP_017209127-4 Length: 961 Number of Matches: 2 Range #296310 812 Score Expect Mathod dante __Posttves __Gaps___Frame 203 bis(S16) 56-550) Compositional matin adust_ 15N485(99%) ZATIAEH(ES) 954057) Features: query 493 VEQgrWExL TPNLK-waaqcaTLToMWVPTOAKTYRANSPTBVDGDTSGTIVQ----69 457 shjct 362 FTEGonFAVFQLURSPNAENe HT trehalvNcevisrow Mil rBogearTér@svek 422 corey ET Se ETD 8 sbjet 423. BHpiKEAEaQvansserrStanaLataniLiobAWOHATPONSILGTSERLLE 482 curry 53. Sf-apegnay Age eggs 7 Sbjct 483. EVFONLTOR fagelgrLenSceHtCSiINDILDLSKLESERVALSLGSVALDSYCOSSLN 542 Cwory 568. IYQPICTIGVELVIEN|BRW-ETFTROVLNGTL FM VEMMVEETENSSTRLIACLE 626 hips:iblastncb nim nih gowlast oisinn017 NCBI Blastigb/AAA20836.1] (859 letters) Sbjct 543 FYKEQARHKEIQLIVK~-LOPTLSEZEADERRLVOLLVNLLSHAVKFTENGG---AVQLE 597 cies 67. So ET TATU ee cher tiger ior Se Sbjct 598 vanwpLggaberQvTETGIELAPENINATFOPrMVISSLSMNTSTELSLSIIRIVEL 657 query 687 SSKGGGTEVETLBVRORERVLABLEVSQRI-KSEALFD~-ESLCVLLVEDN. 723 Sbjct 658 SELGRESCrTVLEP------wiswopolssPESLPANVETIAVTWEDS 720 (Query 744 HINAFILQAE CKKRNQVOMAKDGLOANELLSOTTYOLTLHDNQLPHLGGEETTHEIEQN 803 Sbjct 711 SPAANQIKRYLAELGATSVIHPVGRGALDUALRVSPDVIVLDVLLPOCSGAEVLSELKSM 770 ‘Query 804 LRLGT-PIYACTADTAKETSOAFHANGANYVMLPIKENALHEA 847 Sbjct 771. sOrgSrbtivrSwookers---Loméarenl C&P saQKe HAL #12 Range 2: 840 to 948 ‘TZaDIs{ITE) 16-130) Compostionel mat adjust 40/705(38%) 61TOS(SB%E) T/T05(0%) Cuery 736 KYLLVEDWTARETL OAFCHAVINgUOMKDS DAMELLSDTTVDLELIBNGLEULGSTE 795 Sbjct ose RULLAEDNCANITILUNHLEsquFQvrLARNSLEAQHAKQWOPDVZL query 796 17M Sbjct soe ata’ cGisSrPinALtTALwpcotenctckowommatie 948 BLAST isa ogitered trademark ofthe Natona Library of Medicine You National Center for Biotechnology Information, U.S. National Library of Moline 8600 Rackvile Pike, Bethesda MD, 20804 USA Paliies and Guideines [Coniadl hips:iblastncb nim nih gowlast oi