Está en la página 1de 269

INSTITUTO POLITECNICO NACIONAL

ESCUELA SUPERIOR DE COMERCIO Y ADMINISTRACION

UNIDAD TEPEPAN

SEMINARIO:

LAAUDITORIAINTERNACOMOINSTRUMENTOPARALATOMADEDECISIONES
GERENCIALES.

TEMA:

IMPORTANCIADELCONTROLINTERNOENLASOCIEDADCOOPERATIVATRABAJADORES
DEPASCUAL,S.C.L.

INFORMEFINALQUEPARAOBTENERELTTULODECONTADORPBLICOPRESENTAN:

ALEJANDRAREYESPLATA.
GABINODEJESSORTIZ.
GUADALUPEGONZALEZRAMREZ.
NADIAMELOLPEZ.
ROCOCAMACHOHERNADEZ.

CONDUCTOR:C.P.CARLOSMARTINEZESTRELLA.

MXICO,D.F.

1
AGRADECIMIENTOS.

ALINSTITUTOPOLITECNICONACIONAL.
Por ser una magna institucin, dedicada a crear profesionistas competitivos, capaces de contribuir en el
desarrollodelpas.

ALAESCATEPEAN.
Porsernuestracasadestudio,portodosycadaunodelosespaciosquenosofreci
para alcanzar el conocimiento y permitirnos formar parte de su comunidad
estudiantil.

ALOSPROFESORES.
Porsusenseanzas,criticasyconsejos,portransmitirnos
sus conocimientos, experiencias y formarnos como
profesionistas ya que sin ellos esto no hubiera sido
posible.

2
NDICE.

J USTIFICACIN.

OBJ ETIVOS.

INTRODUCCIN.

CAPITULOIGENERALIDADESDEUNASOCIEDADCOOPERATIVA.

1.1 DefinicindeSociedadCooperativa.......................................................................................... 14
1.2 ClasesdeSociedadesCooperativas........................................................................................... 16
1.2.1 CategorasdelasSociedadesCooperativas............................................................................... 19
1.3 ObjetivosdelaSociedadCooperativa....................................................................................... 20
1.4 CaractersticasdelasCooperativas............................................................................................ 21
1.5 ConstitucinyRegistro.............................................................................................................. 24
1.6 AdministracinyFuncionamientodelasSociedadesCooperativas.......................................... 26
1.7 RgimenEconmicodelasSociedadesCooperativas............................................................... 30
1.7.1 SociosdelasSociedadesCooperativas...................................................................................... 32
1.8 DisolucinyLiquidacindelasSociedadesCooperativas........................................................ 33

CAPITULOIIANTECEDENTESDELAEMPRESASOCIEDADCOOPERATIVA
TRABAJ ADORESDEPASCUAL,S.C.L.

2.1 Origen................................................................................................................................. 37
2.1.1 LaHuelga....................... 38
2.1.2 LaCooperativa........... 39
2.2 Perfildelaempresa.................................................................................................................... 43
2.2.1 ObjetivosdelaEmpresa..... 43
2.2.2 Misin.... 43
2.2.3 Visin..... 43
2.2.4 Filosofa...... 44
2.2.5 Valores....... 44
2.3 Estructura....... 45
2.3.1 EstructuraAdministrativa...... 45
2.3.2 Organigrama....... 46
2.3.3 EstructuraOperativa....... 47

3
CAPITULOIIICONTROLINTERNO.

3.1 ConceptoGenerales....... 52
3.2 EstructuradelControlInterno........ 53
3.3 ObjetivosdelControlInterno......... 53
3.3.1 ObjetivosGeneralesdelControlInterno........ 57
3.4 ElementosdelControlInterno....... 57
3.4.1 Organizacin...... 57
3.4.2 Procedimientos....... 58
3.4.3 Personal...... 59
3.4.4 Supervisin..... 59
3.5 TiposdeControlInterno................................................................................ 64

CAPITULOIVCONTROLINTERNOENLOSCICLOSDETRANSACCIONES.

4.1 CiclodeIngresos................................................... 68
4.1.1 NaturalezadelProcesodeCuentasporCobrar..... 69
4.1.2 ProcesodeCuentasporCobrar..... 74
4.2 CiclodeCompras...... 75
4.2.1 FuncionesBsicas......... 76
4.2.2 Otrosaspectosdeespecialinters..... 82
4.3 CiclodeProduccin...... 83
4.3.1 Naturaleza..... 83
4.3.2 Importancia... 83
4.4 CiclodeInventarios...... 92
4.4.1 Naturaleza..... 92
4.4.2 Elementos...... 97
4.5 CiclodeTesorera......... 102
4.5.1 CaptacindeRecursoseIngresos..... 102
4.5.2 Aspectosespeciales... 107

CAPITULOV.CASOPORACTICO:ELDEPARTAMENTODERECURSOSHUMANOSDELA
SOCIEDADCOOPERATIVATRABAJ ADORESDEPASCUAL,S.C.L.

5.1 Eldepartamentodeadministracindepersonal...................................................................... 125


5.1.1 Importanciadeldepartamentoderecursoshumanos............................................................... 125
5.1.2 Necesidaddeldepartamentoderecursoshumanos.................................................................. 125
5.1.3 Estructuraorgnicadeldepartamentoderecursoshumanos................................................... 126
5.1.4 Objetivosdeldepartamentoderecursoshumanos................................................................... 127
5.1.5 Funcionesdeldepartamentoderecursoshumanos.................................................................. 127
5.2 Planeacindepersonal............................................................................................................. 128
5.2.1 Polticasdepersonal................................................................................................................ 128
5.2.2 reasprincipalesdelapolticageneraldelaempresa............................................................ 129
5.2.3 Sistemadeplaneacindelosrecursoshumanos...................................................................... 129

4
5.2.4 Importanciadeplanearlosrecursos......................................................................................... 130
5.2.5 Procesodeplaneacindelosrecursoshumanos...................................................................... 130
5.3 Suministrodepersonalalaempresa........................................................................................ 131
5.3.1 Procesodereclutamiento......................................................................................................... 131
5.3.2 Procesodeseleccin.... 132
5.3.3 Procesodecontratacin... 134
5.3.4 Procesodeinduccin... 135
5.4 Administracindesueldosysalarios....................................................................................... 136
5.4.1 Problemasderetribucin......... 136
5.4.2 Pagodesueldosysalarios.... 137
5.4.3 Naturalezadelprocesodenmina... 137
5.4.4 Fuentesdeinformacindenminas.... 138
5.4.5 Preparacindelanmina......... 139
5.4.6 Evaluacindelpuesto.. 140
5.5 Capacitacinydesarrollodepersonal......... 142
5.5.1 Objetivosdelacapacitacin.... 142
5.5.2 Tiposdecapacitacin... 143
5.5.3 Procesodecapacitacin... 145
5.6 Evaluacindeldesempeo... 149
5.6.1 Importanciadelaevaluacindeldesempeo.. 149
5.6.2 Objetivosdelaevaluacindeldesempeo.. 149
5.6.3 Normasymedidasdeldesempeo........................... 150
5.6.4 Mtodosdeevaluacindel desempeo.... 151
5.6.5 Diseodelsistemadeevaluacindeldesempeo................................................................... 152
5.7 Higieneyseguridadeneltrabajo..... 152
5.7.1 Higieneeneltrabajo.... 152
5.7.2 Seguridadeneltrabajo..... 153
5.7.3 Objetivosyfuncionesdeldepartamentodehigieneyseguridad..... 154
5.8 ManualdePolticasyProcedimientos..... 154

CONCLUSIONES..................................................................................................................................
BIBLIOGRAFA....................................................................................................................................

5
TEMA:AUDITORIAINTERNAADMINISTRATIVA.

TITULO:

IMPORTANCIA DEL CONTROL INTERNO EN LA SOCIEDAD COOPERATIVA TRABAJADORES


DEPASCUALS.C.L.

OBJ ETIVODEESTUDIO:

ELCONTROL INTERNODELDEPARTAMENTODERECURSOSHUMANOS.

6
J USTIFICACINGENERAL.

Es importante conocer la forma en que la empresa denominada Sociedad Cooperativa Trabajadores de


Pascual, S.C.L. realiz un cambio radical en su estructura administrativa a raz de la huelga de sus
trabajadores.

Esporesoquerealizamosunainvestigacinsobrelanuevaformadeadministrareidentificarlaimportancia
de tener un departamento de auditoria interna dentro de su organizacin destacando en este trabajo al
departamento deRecursosHumanos.

Tomandoenconsideracinlaestructuraoperativadelasociedadesnecesarioconocerlaformadeadministrar
dichodepartamentoascomolacapacitacin,reclutamientoyseleccindepersonal.

7
PLANTEAMIENTODEL PROBLEMA.

TalparecequelamayoradelosproblemasdeunaSociedadestnligadosalaproblemticaquesurgeenel
manejodelaadministracinyalcontrolinternoqueselleveacabodentrodelaorganizacin.

Motivo por el cual consideramos importante analizar el control interno en el departamento de recursos
humanos ya que de este dependen funciones como la administracin de recursos humanos de una entidad,
mencionandoalgunasactividadescomo:lacapacitacin,lasrelacioneslaborales,elpagoderemuneraciones,
laspromociones,laevaluacinyelreclutamientoylaseleccindelpersonal.

8
OBJ ETIVOGENERAL.

Conocer la importancia de una Sociedad Cooperativa, as como sus antecedentes, necesidades y


caractersticas.DestacandoelprocesodecontrolinternoquesellevaacaboeneldepartamentodeRecursos
Humanos ya que este tiene un inters relevante, debido a que esta ntimamente relacionado con todos los
aspectosoperativosdelaorganizacin.

OBJ ETIVOSGENERALES.

v DestacarlaimportanciadeunaSociedadCooperativa.
v IdentificarloselementosdelControlInterno.
v ConocerlosantecedenteshistricosdelaSociedadCooperativaTrabajadoresdePascual,S.C.L.
v Examinar el Control Interno dentro del departamento de Recursos Humanos de la Sociedad
CooperativaTrabajadoresdePascual,S.C.L.

9
INTRODUCCIN.

Lafinalidaddelainvestigacindeestetemanoesprimordialmenteelquererdescubririnformacinsinopor
el contrario se quiere con esto reafirmar una serie de aspectos profesionales que son considerados en el
cotidianodeberdelacarrera.
Sin embargo al mencionar el tema de control interno en el rea de Recursos Humanos de la Sociedad
Cooperativa, nos damos cuenta que no es solo la idea de plasmar datos, frases e investigaciones sino que
tambinconestoaportamoshechosquepuedenservirparadefinirsituacionespersonales.
Ya que el control es un proceso necesario en todo el mbito de la actividad humana dentro de cualquier
organizacinydelapropiasociedadengeneral.
Es importante destacar que las sociedades cooperativas tienen sus inicios en el sistema capitalista con el
objetivo de evitar la desigualdad dentro de la sociedad y sus organismos que buscan satisfacernecesidades
individualesycolectivas,atravsdelarealizacindelasactividadeseconmicas,deproduccin,distribucin
y consumo de bienes y servicios teniendo como caractersticas la identidad, la democracia, la cooperacin
voluntaria, las aportaciones de capital por cada uno de los miembros los rendimientos y por ltimo la
educacinycapacitacinnormalmente.
Al hablar de sociedad cooperativa no podemos dejar de mencionar una de las principales sociedades
cooperativas de nuestro pas, la Sociedad Cooperativa Trabajadores de Pascual, S.C.L., que es una
embotelladora de bebidas naturales dicha sociedad fu creada a finales de los aos 30s por el Sr. Rafael
VctorJimnezZamudio ydebidoalaexplotacinlaboraldelostrabajadoresenelaode1982decidieron
irseahuelga,mismaquedesencadenolanuevacreacindelaCooperativadeTrabajadores,S.C.L.lacualse
trataenelcapituloII.
PorotraparteesimportantemencionarelprocesodeControlInternoelcualesnecesarioemplearloentoda
organizacin,talprocesoseinicioconlaplaneacinyelestablecimientodelosobjetivosdelasociedadpara
llevaracaboelmanejodelosmanualesyprocedimientosyasdisminuirelriesgoaposiblesfraudesomalos
manejosdelainformacin,lacualestarsoportadaporunaestructuraorganizacionalalallegarsederecursos
necesarios incluyendo principalmente al personal, este enfoque es comnmente conocido como Control
Interno,elcualtienelafinalidaddedaraconoceralasociedadlaimportanciaquerepresentacontarconun
adecuadosistemadecontrolparalacorrectatomadedecisiones,porlotantodichocontrolestadivididoen
diferentesciclosloscualessonProduccin,Inventarios,Ingresos,NminayTesoreraloscualesnosayudana
controlarLasnormas yprocedimientosestablecidosencadarearespectivaparatenerunmayorcontrolen
las diferentes operaciones a realizar en virtud de que cada departamento tiene lineamientos diferentes los
cualesdebendellevarseacaboconformeacadaciclocabedestacarquenuestrainvestigacinfueenfocadael
readeRecursosHumanosdelaSociedadCooperativaTrabajadoresdePascualS.C.L.yaqueesunreaque
debemosanalizarparaquellevenacabotodosycadaunodelosmanualesdepolticasyprocedimientospara
evitar problemas con el capital humano siendo la fuente principal de toda organizacin por lo que es
importante destacar los procesos de reclutamiento, seleccin capacitacin, evaluacin del desempeo y la
seguridadehigienedelpersonaldentrodelreadetrabajo.

10
J USTIFICACINCAPTULOI.

Lainvestigacinqueserealizenestecapituloestaenfocadoalosprincipiosdelasociedadcooperativacon
el fin de establecer las generalidades, conceptos, antecedentes, clasificacin e importancia de las de las
mismas,asmismolanormatividadquelasrige.

Por lo anterior conoceremos sus funciones y aplicaciones de cada sociedad cooperativa para que en el
desarrollodenuestrotrabajotengamosunainduccindeltemaapresentarenlossiguientescaptulosyaque
esunabaseindispensablequecadaintegrantedelequipodebeconocerparafamiliarizarseconlostrminos
queseaplicarnalolargodelainvestigacin.

En virtud de que nuestro trabajo de investigacin va hacer enfocado al Control Interno de la Sociedad
CooperativaTrabajadoresdePascual,S.C.L.,enelreadeRecursosHumanosporloquedebemosconocer
las caractersticas que debe de reunir dicha Sociedad, para poder conciliar que el ente est llevando los
acuerdosyrequisitosquelanormatividadestablece.

11
OBJ ETIVOSCAPTULOI.

v ConocerqueesunaSociedadCooperativa.

v MencionarlasclasesexistentesdeSociedadesCooperativas.

v DestacarlascategorasdelasSociedadesCooperativas.

v DescribirlosobjetivosquepretendelaSociedadCooperativa.

v AnalizarlascaractersticasdelasCooperativas.

v Conceptualizarlanormatividadfundamentalquelasrige.

12
CAPTULOI.
GENERALIDADES.

1.1 DefinicindeSociedadCooper ativa.


1.2 ClasesdeSociedadesCooper ativas.
1.3 ObjetivosdelaSociedadCooper ativa.
1.4 Car actersticasdelasCooper ativas.
1.5 ConstitucinyRegistr o.
1.6 Administr acinyFuncionamientodelasSociedadesCooper ativas.
1.7 RgimenEconmicodelasSociedadesCooper ativas.
1.8 DisolucinyLiquidacindelasSociedadesCooper ativas.

13
CAPITULOI.

GENERALIDADES.

1.1.DEFINICINDESOCIEDADCOOPERATIVA.

DeacuerdoaloestablecidoenlaLeydeSociedadesCooperativasdondenosfundamentanlosiguiente.
La sociedad cooperativa es una forma de organizacin social integrada por personas fsicas con base en
intereses comunes y en los principios de solidaridad, esfuerzo propio y ayuda mutua, con el propsito de
satisfacer necesidades individuales y colectivas, a travs de la realizacin de actividades econmicas de
produccin,distribucinyconsumodebienesyservicios.

ParalosefectosdeestaLey,seentiendepor:
I. OrganismosCooperativos:alasuniones,federacionesyconfederacionesqueintegrenlassociedades
cooperativas,y
II. SistemaCooperativo:alaestructuraeconmicaysocialqueintegranlassociedadescooperativasy
susorganismos.ElSistemaCooperativoesparteintegrantedelMovimientoCooperativoNacional.

Las sociedades cooperativas debern observar en su funcionamiento los siguientes principios: Libertad de
asociacinyretirovoluntariodelossocios.

I. Administracindemocrtica.
II. Limitacindeinteresesaalgunasaportacionesdelossociossiassepactar.
III. Distribucindelosrendimientosenproporcinalasparticipacionesdelossocios.
IV. Fomentodelaeducacincooperativaydelaeducacinenlaeconomasolidaria.
V. Participacinenlaintegracincooperativa.
VI. Respeto al derecho individual de los socios de pertenecer a cualquier partido poltico o asociacin
religiosa.
VII. Promocindelaculturaecolgica.

Lassociedadescooperativassepodrndedicarlibrementeacualesquieraactividadeseconmicaslcitas.Las
sociedades que simulen constituirse en sociedades cooperativas o usen indebidamente las denominaciones
alusivasalasmismas,sernnulasdeplenoderechoyestarnsujetasalassancionesqueestablezcanlasleyes
respectivas.1

1
LeyGeneraldeSociedadesCooperativas, Mxico2005,EditorialTalleresGrficosdelaCmarade
Diputados.

14
OtroconceptoimportantedelasSociedadesCooperativasesqueseconsideranorganizacionesdecooperacin
voluntariadiseadascomomodeloalternativoalacompetenciacapitalista. Eltrminocooperativa abarca
unagranvariedaddemovimientosasociativosdecooperacin.Porejemplo,lascooperativasdeconsumidores
estnintegradassloporconsumidoresquedeseanadquirirbienesenmancomunidadparareducirsusgastos
las cooperativas de productores son asociaciones de trabajadores que poseen y gestionan sus propias
empresaslascooperativasdemarketingsonmuycorrientesenlaagriculturayestnformadasporgruposde
trabajadoresdeestesectorlascooperativasdecrditosonasociacionesdeindividuosparticularesqueponen
encomnsusahorros.

Lassociedades cooperativassonorganizacionesdemocrticas.Laadministracin ygestindebenllevarsea


cabodelaformaqueacuerdenlossocios.Todoslosmiembrosdebentenerlosmismosderechosyelmismo
poderdentrodelacooperativayparticiparenlatomadedecisiones

Lasaportacionesdecapital,encasodeestarremuneradas,debenrecibiruntipodeintersreducido(principio
deremuneracinmnimadelcapital).

Los beneficios econmicosque obtengalacooperativapertenecenaloscooperativistasydebendistribuirse


evitandoqueunossociossebeneficienacostadeotros(principiodedistribucinequitativadelosingresos).

Esta distribucin se har de acuerdo con la decisin de los cooperativistas pero respetando los siguientes
criterios:enprimerlugar

v Destinandounapartealdesarrollodelacooperativa
v Reservandootraparteparaprevisindegastosextraordinarios
v Distribuyendo los beneficios entre los cooperativistas en proporcin a sus aportaciones a la
sociedad.

Todas las sociedades cooperativas deben destinar fondos a la formacin profesional de sus miembros y
empleados, as como a la del pblico en general para respetar los principios de cooperacin econmica y
democrtica.Todaslasorganizacionescooperativas,conelfindesertilesalacomunidadenlaqueoperan,
yasussocios,debencooperarenformaactivaconotrascooperativasaescalalocal,nacionaleinternacional

Pr incipios.

Losprincipiosdeunasociedadcooperativason:
v Libreadhesinybajavoluntaria.
v Variabilidaddesociosycapitalsocialapartirdeunmnimoexigible.
v Todoslossociostienenigualesderechos
v Limitacindelintersquelossociospuedenpercibirporsusaportacionesalcapitalsocial.

15
v Participacindecadasocioenlosexcedentesnetos
v Educacinypromocinsocialycooperativa.
v Colaboracinconotrascooperativasparaelmejorserviciodeinteresescomunes.

1.2.CLASES DESOCIEDADESCOOPERATIVAS.

FormanpartedelSistemaCooperativolassiguientesclasesdesociedadescooperativas:

v Deconsumidoresdebienesy/oservicios
v Deproductoresdebienesy/oservicios,y
v Deahorroyprstamo.

Sociedadescooperativasdeconsumidores:sonaqullascuyosmiembrosseasocianconelobjetivodeobtener
encomnartculos,bienesy/oserviciosparaellos,sushogaresosusactividadesdeproduccin.

Sociedades cooperativas de consumidores, independientemente de la obligacin de distribuir artculos o


bienes de los socios, podrn realizar operaciones con el pblico en general siempre que se permita a los
consumidoresafiliarsealasmismasenelplazoqueestablezcansusbasesconstitutivas.

Estascooperativasnorequerirnmsautorizacionesquelasvigentesparalaactividadeconmicaespecfica.

Las sociedades cooperativas de consumidores podrn dedicarse a actividades de abastecimiento y


distribucin,ascomoalaprestacindeserviciosrelacionadosconlaeducacinolaobtencindevivienda.

SociedadesCooperativasdeProductores:sonaqullascuyosmiembrosseasocianparatrabajarencomnen
laproduccindebienesy/oservicios,aportandosutrabajopersonal,fsicoointelectual.Independientemente
deltipodeproduccinalaqueestndedicadas,estassociedadespodrnalmacenar,conservar,transportary
comercializarsusproductos.

Los rendimientos anuales que reporten los balances de las sociedades cooperativas de productores, se
repartirndeacuerdoconeltrabajoaportadoporcadasocioduranteelao,tomandoencuentaqueeltrabajo
puedeevaluarseapartirdelossiguientesfactores:calidad,tiempo,niveltcnicoyescolar.

LasCooperativasdeProductoresy/otrabajadoressonasociacionesqueaportabanelcapitalinicialparaponer
enfuncionamientolacooperativa.Aspues,estaaportacindecapitalpermiteaunmiembroparticiparenla
gestinyadministracindelasociedad.Enestascooperativasesfrecuentequeunosmiembrosaportenslo
capital socios capitalistas y otros aporten trabajo, por lo que se plantea el dilema de s los primeros deben

16
tenerderechoalvotoono.Unavisinalternativadefiendequeslolossociostrabajadoressonmiembroscon
plenoderecho.Segnestainterpretacin,lacooperativapideprestadoelcapitalnecesarioparadesarrollarla
actividad, pero slo puede pagar unos tipos de intersreducidos el riesgo y el control dela cooperativa lo
asumiran los socios trabajadores. Otra interpretacin considera que las cooperativas deben diversificar sus
fuentesderecursos,tantoparaaumentarlacantidaddecapitalsocialcomoparadiversificarlosriesgos,porlo
quelosdefensoresdeestaposturaaceptanconagradolaposibilidaddeadmitirsocioscapitalistasoexternos.
Por supuesto, se puede admitir la posibilidad de que existan socios capitalistas sin derecho a voto, pero el
principio de remuneracin mnima del capital hace que esta posibilidad sea poco prctica al convertir la
aportacindecapitalenunainversinmuypocoatractiva.

Sociedades Cooperativas de Ahorro y Prstamo: son aquellas que tengan por objeto realizaractividades de
ahorro y prstamo, as como las encargadas de fomentar entre sus miembros el espritu de ahorro,
admitindoles imposiciones individuales, premindoseles con un inters que no exceda del legal, favorecer
sus hbitos de trabajo facilitndoles el crdito que fuese prestado por un inters que tampoco exceda del
mencionado,yprestndolestodaclasedeserviciosdecrditoybancaenlasmismascondicionescontalque
el exceso de percepcin se devuelva a los asociados a prorrata del monto y poder reproductivo de las
operacionesquecadaasociadohubieseefectuadovalindosedelaasociacin.1

LaclasificacinquetieneelautorRichartCerdaensulibroRgimenCooperativoeselsiguiente

La clasificacin que de las entidades Cooperativas puede,efectuarse, es muy diferente segnlos diferentes
criteriossustentadosporlostratadistasyporlalegislacinquelasregulaencadapas.

LacausadeestadisparidaddecriteriosdependedelasinnumerablesCooperativasqueseconocen,ypueden
serconcedidas,porquetodaactividadeconmicapuedeafectarlaformacooperativa,yesmuydifcilquerer
establecerunaclasificacinperfectadelasdiferentesmanifestacionesdelaactividadhumana.

As,portanto,lejosdeestablecerseunaclasificacin,loquesehaceesagruparlasracionalmente,por:

Razndelaformadeconstitucin.
v Porelobjetosocial.
v Porlafinalidadperseguida.
v Porlaformaderepartirselosbeneficios.
v Porlaresponsabilidaddelossocios.
v Porlaextensindesusoperaciones.

1
LeyGeneraldeSociedadesCooperativas,Mxico2005,EditorialTalleresGrficosdelaCmarade
Diputados.

17
ClasificacinporlaFormadeConstitucin.
Segn su constitucin,lasCooperativas se dividen en familiares y de ventalibre. Las primeras son las que
limitansusactosdeproduccin,crditooconsumoasussocios,ylassegundassonlasqueextiendensuradio
deaccinalosextraos,perorepartiendosusbeneficiosentrelossocios.

ClasificacinporelObjetoSocial..
Porelobjetosocialseclasificancomosigue:
a) Deconsumo.
b) Deproduccinytrabajo.
c) Decrdito.
d) Mixtas.

SondeConsumo,lasquetienenporobjetosuministrarasusasociadoslosartculosdeprimeranecesidad,en
lasmejorescondicionesdeprecioycalidad.
Son de Produccin, las que operan la transformacin de primeras materias, de productos semiacabados y
acabados, mediante un proceso tcnico industrial, las que acaban productos ya manipulados en un primer
perodo de elaboracin y las que realizan una especialidad de trabajo complementario, comprendido en un
procesocompletodefabricacin.
Son de Trabajo o Profesionales las que emprenden por su propia cuenta o por cuenta de terceros, obras,
trabajos oservicios, ylasqueadquierenencomnydistribuyenalosasociados,losmaterialesyutensilios
parasustrabajoseinstalaciones.
Son de Crdito, las que facilitan a sus asociados toda clase de operaciones que realizan los Bancos
MercantilesyCajasdeAhorro.
SonMixtas lasquerealicenoperacionescomprendidasenlasCooperativasanteriores.

ClasificacinporlaFinalidadPerseguida.
Segnlafinalidadquepersiguenseclasificanen:
a) Popularesodeobreros.
b) Mercantilesodecomerciantes.

Las Cooperativas Populares o de Obreros, son las constituidas por el elemento trabajador que desea
emanciparsedelaclasecapitalista,yportanto,desarrollarsusactividadesconlamsabsolutaindependencia.
Las Cooperativas Mercantiles o Comerciales, son las constituidas por los comerciantes que encuentran en
estaformadeasociacin,elmediomsconvenienteparadarimpulsoasuindustria,yobtenerresultadosms
positivos,delcapitalinvertidoenlosnegocios.2

2
CERDARichar d,Baldomero ElRgimenCooperativo ,editorialUrgel,51BisBarcelona.

18
ClasificacinporlaFormadeRepartirselosResultados..
Sedivideen:
v Colectivas.
v Individuales.
v Mixtas.

EnlasCooperativasColectivas,lasfinalidadespasantodasaunfondodereservacomneinvisible,sinque
ningnsociotengaderechoareclamarpartedelmismo.
Enlas CooperativasIndividuales,seprocedeenformaopuestaalascolectivas,yaquereparteunapartedelas
utilidades,entrelossociosenlaproporcinfijadaenlosestatutos.
EnlasCooperativasMixtas, se dividenlas utilidades endos partes, una para los fondos de reserva y obras
sociales,yotrapararepartirseentrelosasociados.

ClasificacinporlaResponsabilidaddelosSocios..
Porlaresponsabilidadquecontraenlossocios,sedividenlasCooperativascomosigue:
v Deresponsabilidadlimitada.
v Deresponsabilidadsuplementada.
v Deresponsabilidadilimitada.

Las de responsabilidad limitada , son aquellas cuyos compromisos u obligaciones slo responden al haber
social.
Sonderesponsabilidadsuplementada ,aquellasenquelossociospuedenconstituirunaresponsabilidadcon
unmximofijadodeantemano.
Sernde responsabilidadilimitada ,aquellasenlasquecada sociorespondeconlatotalidaddesusbienes.2

1.2.1.Categor asdelasSociedadesCooper ativas.

Seestablecenlassiguientescategorasdesociedadescooperativas:

I. Ordinarias.
II. Departicipacinestatal.ElEstadopodrdarenconcesinoadministracinbienesoserviciosalas
sociedadescooperativas.3

2
CERDARichar d,Baldomero ElRgimenCooperativo ,editorialUrgel,51BisBarcelona.
3
CERDAYRICHART,Baldomero AdministracinyContabilidaddelasentidadesCooperativas ,
EditorialUrgel,51BisBarcelona.

19
Sociedades Cooperativas Ordinarias: son las que para funcionar requieren nicamente de su constitucin
legal.

SociedadesCooperativasdeParticipacinEstatal:sonlasqueseasocienconautoridadesfederales,estataleso
municipales,paralaexplotacindeunidadesproductorasodeserviciospblicos,dadosenadministracin,o
parafinanciarproyectosdedesarrolloeconmicoaniveleslocal,regionalonacional.1

1.3.OBJ ETIVOSDELASOCIEDADCOOPERATIVA.

Lassociedadescooperativaspretendenlogrartrestiposdeobjetivosgenerales:
1. Econmicos.
2. Sociales.
3. Polticos.

Econmicos.
a)Enlascooperativasdeproductores:
v Proporcionartrabajoseguro.
v Darunpagojusto,quecorrespondaaltrabajorealizado.
b)Enlascooperativasdeconsumidores:
v Ofrecerbienesyserviciosbsicosapreciosrazonables.
v Evitarintermediariosinnecesariosyencarecedores.
c)Lograrlaparticipacindelsocioenladireccinyadministracindesusempresas,paraevitarqueelpoder
estenmanosdeunospocos.

Sociales.
a)Organizaralostrabajadoresparaque,juntospuedanresolversuspropiosproblemasylosdesucomunidad.
b)Eliminarlaexplotacindeltrabajo,desarrollandounasociedadmsjusta.
c)Elevarlacapacitacintcnicadelostrabajadores,conelfindequeseencuentrenmejorpreparadospara
resolverproblemasdetrabajoodeconsumo.
d)Proporcionartodoslosserviciosdebienestarsocial.

Polticos.
a) La cooperativa puede ser un instrumento de colaboracin entre los trabajadores urbanos y rurales, para
complementarsusactividadeseconmicasysusluchasporlograrmejoresformasdevida.

1
LeyGeneraldeSociedadesCooperativas,Mxico2005,EditorialTalleresGrficosdelaCmarade
Diputados.

20
b) La cooperativa puede ser un instrumento que facilite la alianza entre los trabajadores y el Estado, para
resolverlosproblemasdelasclasespopulares.
Las cooperativas persiguen objetivos que significan siempre beneficios para los propios socios y para las
comunidades en que se instalan. Las cooperativas, sus objetivos generales contribuyen al desarrollo y
fortalecimientoeconmicodelpas.1

1.4.CARACTERSTICASDELASCOOPERATIVAS.

1.Hay identidadentredueosytrabajadoresascomoconlosclientes.
v Losdueosdelaempresaqueproduceunservicio,sonlosmismosque:losusuariosdelservicio.
v Los dueos de la empresa que produce bienes o servicios, son los mismos trabajadores de esa
empresa.
v Losdueosdeunacooperativadeconsumidores,queofrecebienesyservicios,sonlosmismosque
losclientesqueseabastecenenesaempresa.
v Los dueos de una cooperativa de produccin, son los mismos son los mismos trabajadores de la
empresa.
Porlotanto,eldueocliente,puededecidir:quserviciosnecesitanydequcalidad.Eldueotrabajador,
puededecidir:quproducir,ycmoproducirlo.

2.Lacooperativaesuna organizacindemocrtica, enlaquelossociosintervienendedosformas.


v Eligiendoporvotacinasusdirigentes(consejodeadministracin,devigilanciaycomisiones).
v Participando con iguales derechos enlatoma de decisiones en las asambleas ycomisiones. Todos
tienenlasmismasposibilidadesdediscutirydarsuopinin.Seevitaasqueelpoderestenmanos
deunapersonaogrupo.
v Todoslossociostienenlosmismosderechosyobligaciones.
Enlascooperativas,realmentedebehacerseloque establezcalamayora.

3.Lacooperacinesvoluntaria ysemanifiestaen:
v Ellibreingresoalacooperativa.
v Laposibilidadderetirarsecuandosedesee.
Lascooperativastienenelprincipiodepuertasabiertas,esdecir,todaslaspersonasquerenanlosrequisitos
fijadosyquetengansentidoderesponsabilidad,puedenseradministradoras.Sinembargo,lacooperativano
debeaceptargenteconflictiva:ytieneelderechodeexcluiraaquellasqueactenencontradelosinteresesy

1
LeyGeneraldeSociedadesCooperativas,Mxico2005,EditorialTalleresGrficosdelaCmarade
Diputados.

21
losobjetivosdelacooperativa.Lascooperativasproductorastienenunlmiteparaadmitirnuevossocios.En
cambiolasdeconsumidores,lesconvieneadmitiragrandescantidadesdesocios.

4. Todoslossociosaportancapital.
Elcapitaleselmedioparaalcanzarlosobjetivos.Lacooperativanecesitadineroparafuncionar,cuandolos
sociosaportancapitalmsdelmnimoexigido,estedebeserrecompensadoconelinterslegal.Alformarse
lasociedadcadasociocontribuyeconelvalordeuncertificadodeaportacinporlomenos.
Elpagodeeseintersesunpremioalcapitalaportadoytienelaventaja,deinteresaralossociosenahorrar,
invirtiendoensucooperativa.

5.RepartodeRendimiento.
Losrendimientos,queresultendelasoperacionesdelacooperativa,sernrepartidosentretodoslossocios,
segnlaaportacindecadauno.
Losrendimientossereparten:
v Encooperativasdeproductores:enfuncindeltrabajoaportadoporcadasocio.
v Encooperativasdeconsumidores:enfuncindelvolumendecomprasrealizadoporcadasocio.

6. EducacinyCapacitacinPermanentes.
Lascooperativasdebendesarrollarunalaborpermanentedeeducacinycapacitacin.
En las cooperativas de productores, el trabajador debe estar bien preparado, para poder asumir sus
responsabilidades ysertcnicamentecompetente.Enlascooperativasdeconsumidores,alconsumidorsele
debeproporcionarinformacinparaquecompreloquesenecesitaynoloqueleimpongalapropaganda.

Caractersticasparaintegrarunasociedadcooperativa.

Lascooperativassuelentenerunaseriedenormascomunesatodasellasque,resumidas,sonlassiguientes:

v Controldemocrtico,puescadamiembrotieneunsolovoto,independientementedesuaportacina
lacooperativa.
La pertenencia al movimiento cooperativo es libre, no tenindose en cuenta la raza, el credo, la clase,
profesinoafiliacinpolticadelcooperativista.
v Derechoaobtenercrditoscontiposdeintersreducidos.
v Distribucindebeneficios(quesedenominanretornocooperativo)entreloscooperativistas,quese
realiza en funcin de la aportacin de cada miembro, quedando una parte de los beneficios para
reinvertirseenlacooperativa.
v Siunapersonatrabajaenellasinsermiembrocooperativista,puedeserloreinvirtiendosupartedel
retornocooperativocomoaportacininicial.

22
v Los bienes y servicios que produce la cooperativa se venden enlos mercados, una parte de cuyos
ingresossereservanenfondosdeamortizacinparacubrirladepreciacindelamaquinariayhacer
frentea posiblescontratiempos.
v Otraparteseinvierteencursosdeinformacinyformacinprofesionaldelosmiembros.
v Por ltimo, el trato a todos los miembros debe ser justo e igualitario y todos deben trabajar
coordinados.

As mismo el autor Richart Cerda en su libro el rgimen cooperativo nos menciona que las sociedades
cooperativas,apesardeseragrupacionesdeindividuoscomolassociedadesmercantiles y civiles, yporlo
tanto, estn gobernadas por sus respectivas juntas generales y directivas, y desarrollar actividades de tipo
econmico, tienen caractersticas especiales que las diferencia de aquellas, y por ello, los gobiernos de
diferentespasesdondehasidopermitidoeldesarrollodesusactividades,handictadoleyesonormas,porlo
quehandeseguirseensuconstitucinyfuncionamiento.
Estas caractersticas especiales podemos dividirlas en dos clases: unas fundamentales y otras diferenciales
mencionaremosacontinuacinestasdosclasesdecaractersticas.

CaractersticasFundamentales.
Lascaractersticasfundamentalesdelassociedadescooperativasson:
v Enquetodacooperativaesunasociedaddepersonas.
v Quesuorganizacinyfuncionamientosecentraenelprincipiodelaactividad.
Lacooperativaessociedaddepersonas,porquesucausauorigenestaenlanecesidadsentidaporquienesla
integran,yqueadesercoincidentementeentodoello, yadems,porquedescansanenlamutuaconfianza
quedebedeexistirenlasrelacionessociales.

MencionaremosalgunospuntosdelcarcterpersonaldelasCooperativaslassiguientes:
v Quelossociosentranysalendeacuerdoconelrgimendepuertasabiertas.
v QuelaCooperativaaspiraaasociaramuchaspersonas.
v Queelcapitalsocialnoesfijo,sinovariablesegnaltasybajasdelosasociados.
v QuelaCooperativatieneunabasedemocrticaquesereflejaenlasJuntasGeneralesyRectoras.
v Quelossociostienenlosmismosderechosymismasobligaciones.
LaCooperativacentrasuorganizacinyfuncionamientoenelprincipiodelaactividad,porquenoconsidera
alsocioensituacindeinactivo,enelsentidocorrespondientealasdiferentessociedades cooperativasque
puedenserconstituidas.
Astenemos:
v Cooperativas Industriales, los socios deben trabajar en ella o aportar los elementos de trabajo o
negocioqueaquellasprecisen.
v Cooperativasdecrdito,todoslossociosdebenhacerusodeesteyoperaratravsdeellas.
v Cooperativasdeconsumotodoslossociosdebenadquirirlosproductosquelasociedadofrezca.

23
Porlotantosederivanlassiguientescaractersticas:
v Quelacooperativanoaspiraallucromercantileneldesarrollodesuobjetivosocial.
v Quelacooperativaoperaconsusmismossocios,esdecir,queenlasindustrialeslosproductoresson
ellos mismos, y en las de consumo son los nicos que tienen derecho a adquirir los artculos que
aquellaofrece.
v Quelosresultadoslquidosretornanafavordelosasociados,enproporcinasusactividadesynoen
proporcinalcapitalindividualquehayanaportado.2

1.5.CONSTITUCIONYREGISTRO.

Enlaconstitucindelassociedadescooperativasseobservarlosiguiente:

I. Sereconoceunvotoporsocio,independientementedesusaportaciones.
II. Serndecapitalvariable.
III. Habrigualdadesencialenderechosyobligacionesdesussocioseigualdaddecondicionesparalas
mujeres.
IV. Tendrnduracinindefinida.
V. Seintegrarnconunmnimodecincosocios.

La constitucin de las sociedades cooperativas deber realizarse en Asamblea General que celebren los
interesados,yenlaqueselevantarunactaquecontendr:

I. Datosgeneralesdelosfundadores.
II. Nombres de las personas que hayan resultado electas para integrar por primera vez consejos y
comisiones.
III. Lasbasesconstitutivas.

Lossociosdebernacreditarsuidentidadyratificarsuvoluntadde constituirlasociedadcooperativaydeser
suyas las firmas o las huellas digitales que obran en el acta constitutiva, ante notario pblico, corredor
pblico, juez de distrito, juez de primera instancia en la misma materia del fuero comn, presidente
municipal,secretarioodelegadomunicipaldellugarendondelasociedadcooperativatengasudomicilio.

A partir del momento de la firma de su acta constitutiva, las sociedades cooperativas contaran con
personalidad jurdica, tendrn patrimonio propio y podrn celebrar actos y contratos, as como asociarse
librementeconotrasparalaconsecucindesuobjetosocial.

2
CERDARichar d,Baldomero ElRgimenCooperativo ,editorialUrgel,51BisBarcelona.

24
El acta constitutiva de la sociedad cooperativa de que se trate, se inscribir en el Registro Pblico de
Comercioquecorrespondaasudomiciliosocial.

Las sociedades cooperativas podrn adoptar el rgimen de responsabilidad limitada o suplementada de los
socios.

La responsabilidad ser limitada, cuando los socios solamente se obliguen al pago de los certificados de
aportacin que hubieren suscrito. Ser suplementada, cuando los socios respondan a prorrata por las
operacionessociales,hastaporlacantidaddeterminadaenelactaconstitutiva.

Elrgimenderesponsabilidaddelossociosqueseadopte,surtirefectosapartirdelainscripcindelacta
constitutiva en el Registro Pblico de Comercio. Entretanto, todos los socios respondern en forma
subsidiariaporlasobligacionessocialesquesehubierengeneradoconanterioridadadichainscripcin.

Laspersonasquerealicenactosjurdicoscomorepresentantesomandatariosdeunasociedadcooperativano
inscritaenelRegistroPblicodeComercio,responderndelcumplimientodelasobligacionessocialesfrente
a terceros, subsidiaria, solidaria eilimitadamente, sin perjuicio de laresponsabilidad penal en quehubieren
incurrido.

Sinembargoesimportantedestacarlasbasesconstitutivasdelassociedadescooperativasquecontendrn:

I. Denominacinydomiciliosocial.
II. Objetosocial,expresandoconcretamentecadaunadelasactividadesadesarrollar.
III. Los regmenes deresponsabilidad limitada o suplementada de sus socios, debiendo expresar en su
denominacinelrgimenadoptado.
IV. Forma de constituir o incrementar el capital social, expresin del valor de los certificados de
aportacin,formadepagoydevolucindesuvalor,ascomolavaluacindelosbienesyderechos
encasodequeseaporten.
V. Requisitosyprocedimientosparalaadmisin,exclusinyseparacinvoluntariadelossocios.
VI. Formadeconstituirlosfondossociales,sumonto,suobjetoyreglasparasuaplicacin.
VII. reas de trabajo que vayan a crearse y reglas para su funcionamiento y en particular de la de
educacincooperativa.
VIII. Duracindelejerciciosocialquepodrcoincidirconelaodecalendario,ascomoeltipodelibros
deactasydecontabilidadallevarse.
IX. Formaenquedebercaucionarsumanejoelpersonalquetengafondosybienesasucargo.
X. Elprocedimientoparaconvocaryformalizarlasasambleasgeneralesordinariasqueserealizarnpor
lo menos una vez al ao, as como las extraordinarias que se realizarn en cualquier momento a
pedimentodelaAsambleaGeneral,delConsejodeAdministracin,deldeVigilanciaodel20%del
totaldelosmiembros.

25
XI. Derechosyobligacionesdelossocios,ascomomecanismosdeconciliacinyarbitrajeencasode
conflictosobreelparticular.
XII. Formasdedireccinyadministracininterna,ascomosusatribucionesyresponsabilidades.
XIII. Las polticas y disposiciones necesarias para el buen funcionamiento de la sociedad cooperativa
siemprequenoseopongan.

Encasodequelasbasesconstitutivasquenoseapeguenalodispuestoenlaspolticas,sernnulasdepleno
derecho para todos los efectos legales correspondientes. Las oficinas encargadas del Registro Publico de
Comercio,debernexpediryremitirenformagratuita,alaSecretaradeDesarrolloSocial,copiacertificada
detodoslosdocumentosqueseanobjetodeinscripcinporpartedelassociedadescooperativas,ascomola
informacinquesolicitelapropiadependencia, afindeintegrarymanteneractualizadalaestadsticanacional
desociedadescooperativas.

Sinembargonoseotorgarelregistroalassociedadescooperativasdeparticipacinestatal,silaautoridad
quecorrespondanomanifiestaqueexisteacuerdoconlasociedaddequesetrate,paradarenadministracin
loselementosnecesariosparalaproduccin.

Paralamodificacindelasbasesconstitutivas,sedeberseguirelmismoprocedimientoparaelotorgamiento
delactaconstitutivaydeberinscribirseenelRegistroPblicodeComercio.Lavigilanciadelassociedades
cooperativasestarcargodelasdependenciaslocalesofederalesque,deacuerdoconsusatribuciones,deban
intervenirensubuenfuncionamiento.1

1.6.ADMINISTRACIONYFUNCIONAMIENTO DELASSOCIEDADESCOOPERATIVAS.

Ladireccin,administracinyvigilanciainternadelassociedadescooperativasestaracargode:

A. LaAsambleaGeneral.
B. ElConsejodeAdministracin.
C. ElConsejodeVigilancia.

A.AsambleaGeneral.

LaAsambleaGeneraleslaautoridadsupremaysusacuerdosobliganatodoslossocios,presentes,ausentesy
disidentes,siemprequesehubierentomadoconformealasbasesconstitutivas.

1
LeyGeneraldeSociedadesCooperativas,Mxico2005,EditorialTalleresGrficosdelaCmarade
Diputados.

26
LaAsambleaGeneralresolvertodoslosnegociosyproblemasdeimportanciaparalasociedadcooperativay
establecerlasreglasgeneralesquedebennormarelfuncionamientosocial.Ademsdelasfacultadesquele
concedenalasbasesconstitutivas,laAsambleaGeneralconoceryresolver:

I. Aceptacin,exclusinyseparacinvoluntariadesocios.
II. Modificacindelasbasesconstitutivas.
III. Aprobacindesistemasyplanesdeproduccin,trabajo,distribucin,ventasyfinanciamiento.
IV. Aumentoodisminucindelpatrimonioycapitalsocial.
V. Nombramientoyremocin,conmotivojustificado,delosmiembrosdelConsejodeAdministracin
ydeVigilanciadelascomisionesespecialesydelosespecialistascontratados.
VI. Examendelsistemacontableinterno.
VII. Informesdelosconsejos ydelasmayorascalificadasparalosacuerdosquesetomensobre otros
asuntos.
VIII. Responsabilidad de los miembros de los consejos y de las comisiones, para el efecto de pedir la
aplicacindelassancionesenqueincurran,oefectuarladenunciaoquerellacorrespondiente.
IX. Aplicacindesancionesdisciplinariasasocios.
X. Repartoderendimientos,excedentesypercepcindeanticiposentresocios.
XI. Aprobacindelasmedidasdetipoecolgicoquesepropongan.Losacuerdossobrelosasuntosaque
serefiere,deberntomarsepormayoradevotosenlaAsambleaGeneral.Enlasbasesconstitutivas
sepodrnestablecerlosasuntosenqueserequieraunamayoracalificada.

Lasasambleasgeneralesordinariasoextraordinarias,debernserconvocadasenlostrminosestablecidosen
laconstitucinyregistrodelassociedadescooperativas,porlomenoscon7dasnaturalesdeanticipacin.
La convocatoria deber ser exhibida en un lugar visible del domicilio social de la sociedad cooperativa,
mismaquedebercontenerlarespectivaordendeldatambinserdifundidaatravsdelrganolocalms
adecuado,dandopreferenciaalperidico,cuandoexistaenellugardeldomiciliosocialdelacooperativa.De
tener filiales en lugares distintos, se difundir tambin en esos lugares. Se convocar en forma directa por
escritoacadasocio,cuando aslodeterminelaAsambleaGeneral.

Sinoasistieraelsuficientenmerodesociosenlaprimeraconvocatoria,seconvocarporsegundavezcon
porlomenos5dasnaturalesdeanticipacinenlosmismostrminosypodrcelebrarseenestecaso,conel
nmerodesociosqueconcurran,siendovalidoslosacuerdosquesetomen,siempreycuandoestnapegadas
alasbasesconstitutivasdelasociedadcooperativa.

Serncausasdeexclusindeunsocio:

Desempearsuslaboressinlaintensidadycalidadrequeridas.

27
Lafaltadecumplimientoenformareiteradaacualquieradesusobligacionesestablecidasenlasbases
constitutivas,sincausajustificada.

Infringirenformareiteradalasdisposicionesdelasbasesconstitutivasodelreglamentodelasociedad
cooperativa,lasresolucionesdelaAsambleaGeneralolosacuerdosdelConsejodeAdministracin
odesusgerentesocomisionados.

Al socio que se le vaya a sujetar a un proceso de exclusin, se le notificar por escrito en forma personal,
explicandolosmotivosyfundamentosdeestadeterminacin,concedindoleeltrminode20dasnaturales
para que manifieste por escrito lo que a su derecho convenga ante el Consejo de Administracin o ante la
ComisindeConciliacinyArbitrajedeconformidadconlasdisposicionesdelasbases constitutivasodel
reglamentointernodelasociedadcooperativa.

Cuandounsocioconsiderequesuexclusinhasidoinjustificada,podracudiralosrganosjurisdiccionales.

Lasbasesconstitutivaspuedenautorizarelvotoporcartapoderotorgadaantedostestigos,debiendorecaeren
todocasolarepresentacin,enuncoasociado,sinquestepuedarepresentaramsdedossocios.

Cuandolosmiembrospasendequinientosoresidanenlocalidadesdistintasaaqullaenquedebacelebrarse
laasamblea,estapodrefectuarsecondelegadossocios,elegidosporcadaunadelasreasdetrabajo.

Losdelegadosdeberndesignarseparacadaasambleaycuandorepresentenreasforneas,llevarnmandato
expreso por escrito sobre los distintos asuntos que contenga la convocatoria y teniendo tantos votos como
sociosrepresenten.Lasbasesconstitutivasfijarnelprocedimientoparaquecadaseccinozonadetrabajo
designeenunaasambleaasusdelegados.

B.ConsejodeAdministr acin.

ElConsejodeAdministracinserelrganoejecutivodelaAsambleaGeneralytendrlarepresentacinde
lasociedadcooperativaylafirmasocial,pudiendodesignardeentrelossociosopersonasnoasociadas,unoo
msgerentesconlafacultadderepresentacinqueselesasigne,ascomouno omscomisionadosquese
encarguendeadministrarlasseccionesespeciales.

ElnombramientodelosmiembrosdelConsejodeAdministracinloharlaAsambleaGeneralconformeal
sistemaestablecidoensusbasesconstitutivas.Susfaltastemporalessernsuplidasenelordenprogresivode
sus designaciones, pudiendo durar en sus cargos, s la Asamblea Generallo apruebahasta cinco aos y ser
reelectoscuandoporlomenoslasdosterceraspartesdelaAsambleaGeneralloapruebe.

ElConsejodeAdministracinestarintegradoporlomenos,porunpresidente,unsecretarioyunvocal.

28
Tratndose de sociedades cooperativas que tengan diez o menos socios, bastar con que se designe un
administrador.

Losresponsablesdelmanejofinancierorequerirndeavalsolidarioofianzaduranteelperododesugestin.

Los acuerdos sobre la administracin de la sociedad, se debern tomar por mayora de los miembros del
ConsejodeAdministracin.Losasuntosdetrmiteodepocatrascendencialosdespacharnlosmiembrosdel
propioConsejo,segnsusfuncionesybajosuresponsabilidad,debiendodarcuentadelusodeestafacultad
enlaprximareunindelConsejo.

C.ConsejodeVigilancia.

El Consejo de Vigilancia estarintegrado por unnmero impar de miembros no mayor de cinco con igual
nmerodesuplentes,quedesempearanloscargosdepresidente,secretarioyvocalesdesignadosenlamisma
formaqueelConsejodeAdministracinyconladuracinqueseestablezca.

EnelcasodequealefectuarselaeleccindelConsejodeAdministracinsehubiereconstituidounaminora
querepresente,porlomenosunterciodelavotacindelosasistentesalaasamblea,elConsejodeVigilancia
serdesignadoporlaminora.

LosmiembrosdelascomisionesestablecidasporlaLeydeSociedadesCooperativasylasdemsquedesigne
la Asamblea General, durarn en su cargo el mismo tiempo que los de los Consejos de Administracin y
Vigilancia.Tratndosedesociedadescooperativasquetengandiezomenossocios,bastarcondesignarun
comisionadodevigilancia.

ElConsejodeVigilanciaejercerlasupervisindetodaslasactividadesdelasociedadcooperativaytendr
el derecho de voto para el solo objeto de que el Consejo de Administracin reconsidere las resoluciones
votadas. El derecho de voto deber ejercitarseante el presidente del Consejo de Administracin, en forma
verbaleimplementarseinmediatamenteporescritodentrodelas48horassiguientesalaresolucindequese
trate. Si fuera necesario, se convocar dentro de los 30 das siguientes, a una Asamblea General
Extraordinariaparaqueseavoquearesolverelconflicto.

En todas las sociedades cooperativas, ser obligatoria la educacin cooperativa y la relativa a la economa
solidaria.Paratalefecto,sedefinirenlaAsambleaGenerallosprogramasyestrategiasarealizar.

29
Las sociedades cooperativas tendrnlas reas de trabajo que seannecesarias pararlamejor organizacin y
expansindesuactividadcooperativa.1

1.7.REGIMENECONOMICODELASSOCIEDADESCOOPERATIVAS.

Elcapitaldelassociedadescooperativasseintegrarconlasaportacionesdelossociosyconlosrendimientos
quelaAsambleaGeneralacuerdesedestinenparaincrementarlo,ademsdeconsiderarloestablecidoenla
constitucindelasociedad.

Lasaportacionespodrnhacerseenefectivo,bienes,derechosotrabajoestarnrepresentadasporcertificados
quesernnominativos,indivisiblesydeigualvalor,lascualesdebernactualizarseanualmente.

Lavalorizacindelasaportacionesquenoseanenefectivo,seharenlasbasesconstitutivasoaltiempode
ingresarelsocioporacuerdoentreste y elConsejodeAdministracin,conlaaprobacindelaAsamblea
Generalensumomento.

Elsociopodrtransmitirlosderechospatrimonialesqueamparansuscertificadosdeaportacin,enfavordel
beneficiario que designe para el caso de su muerte. Las bases constitutivas de la sociedad cooperativa
determinarnlosrequisitosparaquetambinselepuedanconferirderechoscooperativosalbeneficio.

Cada socio deber aportar por lo menos el valor de un certificado. Se podr pactar la suscripcin de
certificados excedentes o voluntarios por los cuales se percibir el inters qu fije el Consejo de
Administracin de acuerdo con las posibilidades econmicas de la sociedad cooperativas, tomando como
referencialastasasquedeterminenlosbancosparadepsitosaplazofijo.

Al constituirse la sociedad cooperativa o al ingresar el socio a ella, ser obligatoria la exhibicin del 10%
cuandomenos,delvalordeloscertificadosdeaportacin.

Cuando la Asamblea General acuerde reducir capital que se juzgue excedente, se har la devolucin a los
socios que posean mayor nmero de certificados de aportacin o a prorrata si todos son poseedores de un
nmero igual de certificados. Cuando el acuerdo sea en el sentido de aumentar el capital, todos los socios
quedarnobligadosasuscribirelaumentoenlaformaytrminosqueacuerdelaAsambleaGeneral.

Lassociedadescooperativaspodrnconstituirlossiguientesfondossociales:

1
LeyGeneraldeSociedadesCooperativas,Mxico2005,EditorialTalleresGrficosdelaCmarade
Diputados.

30
v DeReserva.
v DePrevisinSocial.
v DeEducacinCooperativa.

FondodeReserva.

El Fondo de Reserva se constituir con el 10 al 20% de los rendimientos que obtengan las sociedades
cooperativasencadaejerciciosocial.

ElFondodeReservapodrserdelimitadoenlasbasesconstitutivas,peronosermenordel25%delcapital
socialenlassociedadescooperativasdeproductoresydel10%enlasdeconsumidores.

Estefondopodrserafectado cuandolorequieralasociedadparaafrontarlasprdidasorestituirelcapitalde
trabajo,debiendodeserreintegradoalfinaldelejerciciosocial,concargoalosrendimientos.

ElFondodeReservadelassociedadescooperativassermanejadoporelConsejodeAdministracinconla
aprobacindelConsejodeVigilanciaypodrdisponerdel,paralosfinesqueseconsignan.

FondodePrevisinSocial.

El Fondo de Previsin Social no podr ser limitado deber destinarse a reservas para cubrir los riesgos y
enfermedadesprofesionalesyformarfondosdepensionesyhaberesderetirodesocios,primasdeantigedad
y para fines diversos que cubrirn: gastos mdicos y de funeral, subsidios por incapacidad, becas
educacionales para los socios o sus hijos, guarderas infantiles, actividades culturales y deportivas y otras
prestacionesdeprevisinsocialdenaturalezaanloga.Aliniciodecadaejercido,laAsambleaGeneralfijara
las prioridades para la aplicacin de este Fondo de conformidad con las perspectivas econmicas de la
sociedadcooperativa.

Las prestaciones derivadas del Fondo de Previsin Social, sern independientes de las prestaciones a que
tenganderecholossociosporsuafiliacinalossistemasdeseguridadsocial.Lassociedadescooperativasen
general,deberndeafiliarobligatoriamenteasustrabajadores,ysociosqueaportensutrabajopersonal,alos
sistemas de seguridad social, e instrumentar las medidas de seguridad e higiene en el trabajo, as como de
capacitacin y adiestramiento. El Fondo de Previsin Social se constituir con la aportacin anual del
porcentaje, que sobre los ingresos netos, sea determinado por la Asamblea General y se aplicar en los
trminos delartculo anterior. Esteporcentaje podr aumentarse segn losriesgos probables y la capacidad
econmicadelasociedadcooperativa.

31
FondodeEducacinCooperativa.

ElFondodeEducacinCooperativaserconstituidoconelporcentajequeacuerdelaAsambleaGeneral,pero
entodocasodichoporcentajenoserinferioral1%delosexcedentesnetosdelmes.

Lassociedadescooperativas,podrnrecibirdepersonasfsicas ymorales,pblicasoprivadas,nacionaleso
internacionales,donaciones,subsidios,herenciasylegadosparaaumentarsupatrimonio.

Losexcedentesde cadaejerciciosocialanualsonladiferenciaentreactivoypasivomenoslasumadelcapital
social,lasreservasylosrendimientosacumuladosdeaosanteriores,loscualesseconsignarnenelbalance
anualquepresentarelConsejodeAdministracinalaAsambleaGeneral.Igualprocedimientoseobservar
sielbalancemencionadoreportaprdidas.

Cadaaolassociedadescooperativaspodrnrevaluarsusactivos,enlostrminoslegalescorrespondientes.
LaAsambleaGeneraldeterminarconrelacinalosincrementos,elporcentajequesedestinaralincremento
alcapitalsocialyelqueseaplicaralasreservassociales.

Las sociedades cooperativas podrn emitir certificados de aportacin para capital de riesgo por tiempo
determinado.1

1.7.1.SociosdelasSociedadesCooper ativas.

Lasbasesconstitutivasdecadasociedadcooperativa,determinarndeberes,derechos,aportaciones,causasde
exclusindesociosydemsrequisitos.Entodocaso,debernobservarselassiguientesdisposiciones:

v La obligacin de consumir o de utilizar los servicios que las sociedades cooperativas de


consumidoresbrindanasussocios.
v Enlassociedadescooperativasdeproductores,laprestacindeltrabajopersonaldelossociospodr
serfsico,intelectualodeambosgneros.
v Las sanciones a los socios de las sociedades cooperativas cuando no concurran a las asambleas
generales, juntas o reuniones que se establece stas debern considerar las responsabilidades y
actividadespropiasdelamujer.
v Lassancionescontralafaltadehonestidaddesociosydirigentesensuconductaoenelmanejode
fondosqueseleshayanencomendado.
v Losestmulosalossociosquecumplancabalmenteconsusobligaciones.

1
LeyGeneraldeSociedadesCooperativas,Mxico2005,EditorialTalleresGrficosdelaCmarade
Diputados.

32
v Laoportunidaddeingresoalasmujeres,enparticularalasquetenganbajosuresponsabilidadauna
familia.

Lassociedadescooperativasdeproductorespodrncontarconpersonalasalariado,nicamenteenloscasos
siguientes:

I. Cuandolascircunstanciasextraordinariasoimprevistasdelaproduccinolosserviciosloexijan.
II. Paralaejecucindeobrasdeterminadas.
III. Paratrabajoseventualesoportiempodeterminadooindeterminado,distintosalosrequeridosporel
objetosocialdelasociedadcooperativa.
IV. Paralasustitucintemporaldeunsociohastaporseismesesenunao.
V. Porlanecesidaddeincorporarpersonalespecializadoaltamentecalificado.

Cuando la sociedad requiera por necesidades de expansin admitir a ms socios, el Consejo de


Administracintendrlaobligacindeemitirunaconvocatoriaparatalefecto,teniendopreferenciaparaello,
sus trabajadores, a quienes se les valorar por su antigedad, desempeo, capacidad y en su caso por su
especializacin.

Anteunainconformidadenlaseleccin,elefectopodracudirantelaComisindeConciliacinyArbitraje
delapropiasociedadcooperativasiesquelahay,laquedeberresolverleporunescritountrminonomayor
de20dasnaturales,independientementedepoderejercerlaaccinlegalquecorresponda.1

1.8.DISOLUCINYLIQUIDACINDELASSOCIEDADESCOOPERATIVAS.

Lassociedadescooperativassedisolvernporcualquieradelassiguientescausas:

I. Porlavoluntaddelasdosterceraspartesdelossocios.
II. Porladisminucindesociosamenosdecinco.
III. Porquellegueaconsumarsesuobjeto.
IV. Porqueelestadoeconmicodelasociedadcooperativanopermitacontinuarlasoperaciones.
V. Porlaresolucinejecutoriadadictadaporlosrganosjurisdiccionales.

Enelcasoquelassociedadescooperativasdeseenconstituirseenotrotipodesociedad,deberndisolversey
liquidarsepreviamente.

1
LeyGeneraldeSociedadesCooperativas,Mxico2005,EditorialTalleresGrficosdelaCmarade
Diputados.

33
Losrganosjurisdiccionalescomosonlostribunalescivilesyelfuerocomnconocerndelaliquidacinde
lassociedadescooperativas.

En unplazono mayor de treinta das despus de que los liquidadoreshayantomado posesin de su cargo,
presentarn a los Tribunales Civiles y al Fuero Comn un proyecto para la liquidacin de la sociedad
cooperativa.

Los Tribunales Civiles y el Fuero Comn, resolvern dentro de los diez das hbiles siguientes sobre la
aprobacindelproyecto.

Los rganos jurisdiccionales y los liquidadores, que sern considerados como parte en el proceso de
liquidacin,vigilarnquelosfondosdeReserva ydePrevisinSocialyengeneralelactivodelasociedad
cooperativadisueltatengansuaplicacin.

En los casos de quiebra o suspensin de pagos de las sociedades cooperativas, los rganos jurisdiccionales
aplicarnlaLeydeQuiebrasySuspensindePagos.

Cuando dos o ms sociedades cooperativas se fusionen para integrar una sola, la sociedad fusionante que
resultedelafusin,tomarasucargolosderechosyobligacionesdelasfusionadas.Paralafusindevarias
sociedadescooperativassedeberseguirelmismotrmitequeseestableceparasuconstitucin.1

1
Ley GeneraldeSociedadesCooperativas,Mxico2005,EditorialTalleresGrficosdelaCmarade
Diputados.

34
OBJ ETIVOCAPTULOII.

v ConocerlosantecedenteshistricosdelaSociedadCooperativaTrabajadoresdePascual,S.C.L.

J USTIFICACINCAPTULOII.

Laimportanciadelpresentecaptuloradicaenconocerlosorgenesdestaempresa,ascomosuevolucin,
objetivosylafilosofaconquesemaneja.

35
CAPTULOII.
ANTECEDENTESDELASOCIEDADCOOPERATIVATRABAJ ADORESDEPASCUAL,S.C.L.

2.1 OrigenyEvolucin.
2.2 Per fildelaEmpresa.
2.3 Estr uctur a.

36
CAPITULOII.

2.1ORIGENYEVOLUCIN.

La Sociedad Cooperativa de Trabajadores Pascual es una embotelladora de bebidas naturales con una
tradicindemasdemediosigloensuproduccinenMxico,laempresarefrescosPascual,S.A.,sefunda
fines de los 30s, por el Sr. Rafael Vctor Jimnez Zamudio. Sus primeros productos fueron paletas Pascual
posteriormente refrescos pascual y Agua de la mismamarca sta ltima era agua purificada y nicamente
permaneci10aosaproximadamenteenelmercado.

LasprimerasinstalacionesdeRefrescosPascual,S.A.,seubicaronenlacoloniaAnhuacposteriormenteen
lacoloniaSanRafael,finalmenteseestablecieronenlacoloniaTrnsitoyporltimoenCapultitln.
DeacuerdoconSalvadorTorresCisneros,lderdePascual,elxitodelacooperativasebasaenqueesuna
organizacin democrtica, honrada y honesta. "El objetivo principal es conservar el empleo de sus
trabajadores".

UnavezubicadaenlacoloniaTrnsito,aprincipiosdelos50'slaempresaRefrescosPascual,S.A.sacaal
mercado elrefresco LUL y a mediados de esa misma dcada lanza unproducto de cola, llamado MEXI
COLA,elcualpermanecimuypocotiempoenelmercado.Ainiciosdeladcadadelossesentalaempresa
gozabadeungranreconocimientodentrodelaindustriarefresqueramexicana.
Gracias a las habilidades empresariales del Sr. RAFAEL JIMNEZ, Refrescos Pascual contaba con
instalacionesenelinteriordelaRepblicaascomoproyectosdeenvasadorasenU.S.A.yenJAPN.
Amediadosdelossesenta,RAFAELJIMNEZtienecontactoconlaempresasuecaTETRAPAK,S.A.DE
C.V.,firmanuncontratocuyapolticaesrentarsusmquinasenvasadoras.Conbaseenestasnegociaciones,
RafaelJimnezlogrlaexclusividaddelenvasadoTetraPakparaelproductoBOING.

Afinalesdeladcadadelossesenta,"Jimnez"adquierelaPlantaNorte,cuyasinstalacionespertenecanala
empresa refresquera CANADADRY. As mismo, adquiere la franquicia para la elaboracin y
comercializacindelosproductosdelamisma.

TantolaexclusividaddelenvasadoTetraPakcomolafranquiciadeCANADADRYseperdieronen1982,al
darseelmovimientodehuelga.

37
2.1.1 LAHUELGA.

Antecedentesdelahuelga.
A pesar de que la empresa Refrescos Pascual, S.A. tuvo un gran crecimiento, el nivel de vida de los
trabajadores no mejor a la par si no al contrario. Los trabajadores laboraban con demasiadas presiones,
obligadosatrabajarmstiempodeldebido,sinobtenerunpagojusto.LostrabajadoresdePascualpadecanla
explotacin patronalantelaindiferenciadesu sindicato, quien siendo parte de laCTM estaba dellado del
patrndejandoenestadototaldeindefensinasusagremiados.
En diferentes ocasiones los trabajadores de Pascual haban intentado organizarse para hacerle frente a las
injusticias que sufran sin embargo, estos intentos fueron detectados por el patrn quien despidi a los
inconformesinmediatamente.
UnadelascausasporlasquelostrabajadoresdePascualsoportaronesascondiciones,esquelamayorade
losmismos,carecadeestudiosoconocimientosenmaterialaboral,porlotanto,desconocansusderechos.

Elmovimientodehuelga.
Enmarzode1982,bajoelrgimendeLpezPortillo,nuestramonedasufriundeslizamientofrentealdlar
porlocualelgobiernodecretunaumentoemergentealossalarios,lamayoradelasempresasacataronesa
disposicin,noasenRefrescosPascual,dondesenegrotundamenteelaumentoalsalario.
Ante esa negativa, un grupo de obreros de Pascual acudieron a las oficinas del Partido Mexicano de los
Trabajadores,(P.M.T.)enbuscadeasesoraparahacervalersusderechos.
LosdirigentesdelP.M.T.eranelING.HEBERTOCASTILLO(Lderestudiantildel68)yelC.DEMETRIO
VALLEJO. (Lder incorruptible e incansable luchador social quien encabez el movimiento de los
ferrocarrileros)steltimofuequiendirigielmovimientodehuelgadePascualencausndoloallogrodelo
queactualmenteconocemoscomo"CooperativaPascual".
CuandoelP.M.T.accedidarasesoraalostrabajadoresdePascual,inicindoselostrabajosdeorganizacin,
laempresaPascualsepercatdeelloydespidia150deellostratandodeatemorizaralosinconformes.
Sinembargo,estoocasionquelostrabajadoresdecidieranirseahuelga,parandolasdosplantasdelD.F.,el
18 de Mayo de 1982, como respuesta a esta accin, Rafael Jimnez con guardaespaldas y granaderos, se
presentaron el 31 de mayo en las instalaciones de la Planta Sur, donde con su gente asesinaron a dos
compaerosydejandoheridosaotrosdiecisiete.
Estoscrmenesjamsfueroncastigados,yaqueJimnezobtuvounamparodelasautoridades.Porotrolado,
estos hechos pusieron de manifiesto ante la opinin pblica todaslas injusticias que padeca el personal de
Pascual. La lucha de los trabajadores de Pascual, fue larga e intensa hubo momentos claves durante el
transcurso de la misma, por ejemplo: la toma de las oficinas del sptimo piso de la Junta Federal de
Conciliacin y Arbitraje la Formacin del Comit de Lucha de Mujeres, Esposas y Familiares de los
trabajadoresdePascual,laobtencindelaTitularidaddesuContratoColectivodeTrabajo,quitndoselaala
C.T.M.lreconocimientolegaldelahuelga,el24demayode1983,entreotras.

38
Salvador Torres repasa esos momentos: "No fueron fciles, pasaron muchas cosas: represin, marchas,
mtines, desalojos por los granaderos, la toma de la Junta de Conciliacin y Arbitraje para presionar a la
SecretaradelTrabajo.Despusvinieronlostrmitesparaconstituirlasociedadcooperativaqueduraroncasi
un ao. Tuvimos que luchar mucho", Por esa razn, dice Torres Cisneros, los trabajadores de Pascual
recordamos esa poca de batallas y cada primero de mayo participamos en las manifestaciones
independientes para reafirmar nuestro compromiso con la sociedad. Cabe sealar que el movimiento de
Pascual,apartedelaunidadyorganizacindelostrabajadoresydelbuenmanejodelaasesora,semantuvo
graciasalapoyoysolidaridaddeinstitucionesyorganizacionescivilesascomoporelpuebloengeneral.

2.1.2LACOOPERATIVA.

Fueenagostode1984,cuandoenunaasambleapreviaaunaaudienciaqueseibaarealizarconelentonces
presidenteMIGUELDELAMADRID,lostrabajadoresdePascualpropusieronunaalternativaparaacabar
conelconflictodichaalternativaeralasiguiente:"QueseadjudicaranlosbienesdeRefrescosPascual,S.A.
enfavordelostrabajadoresyellossecomprometanatrabajaren"Cooperativa".
Fue esta ltima propuesta la que aceptaron las autoridades, y tras un largo peregrinar de Secretara en
Secretaraytediosasantesalas,lostrabajadoresdePascualseencontraroncomodueosdelaempresa,pero
sincapitalparainiciarlasactividades.

v A pesar de que las autoridades haban asegurado que habra crditos para que la Cooperativa
empezaraafuncionar,stosnuncallegaron,pueselestudiodefactibilidadrealizadoporunBanco,
sealabaque:
1. Serequerantrescientosmilmillonesdepesosparapoderarrancarlasdosplantas.
2. QuelostrabajadoresdePascualnoeransujetosdecrdito,porcarecerdelapreparacin
necesariaparalaadministracindelaempresa.
3. Se otorgaran los crditos con la condicin de que la Cooperativa fuera administrada por
personalcalificadoporelmismoBanco.
Lgicamente,lanegativadelostrabajadoresfuerotundaydecidieronbuscarcrditosyrecursosporotrolado.
ElS.T.U.N.A.M.enungestosolidario,donunmillncuatrocientoscincuentamilpesosalaCooperativa,
estasumafueutilizadaparatramitarlospermisosdelasunidadesdereparto yparaelmantenimientodela
maquinariaquellevababastantetiempoparadayporlotantoestabadeteriorada.
Asmismo,lostrabajadoresrecibieronungranapoyoporpartedelasociedadcivilqueensolidaridadconel
movimientodabadonativoseconmicosyenespecieenboteosybrigadasdeapoyo.
Por fin, el 27 de mayo de 1985, se decide a travs de una asamblea que 176 de los 1100 obreros fueron
escogidosparainiciarlaoperacindelaSociedadCooperativaTrabajadoresdePascual,S.C.L.iniciasus
actividadesconelproyecto"AGUASCALIENTES".ElingresoporlaventadeBoingsedepositenelbanco

39
paracapitalizaralacooperativa.Seismesesdespus, el27denoviembre,laCooperativaarrancasupropia
produccin.Apartirdeesemomentoseempiezanaintegrarlosdemstrabajadores.
Enunprincipio,todoelpersonalpercibaelmismosalariomnimomsel10%desdeelafanadorhastael
presidentedelconsejo,fuehastamarzode1986,cuandoempezafuncionareltabulador.Yenmayodeese
mismoao,contratodaslaspredicciones,seobtuvieronlosprimerosrendimientos.
Todoesolespermiticapitalizarlaempresa.Elprimeraonoserepartieronrendimientosyestablecieronen
losestatutoslaobligacindeinvertirlamitaddelasganancias.Eseeselsecretoqueleshapermitidocrecer
comolohanhecho.

Lacooper ativaysuentor no.


Lacooperativasehadestacadoporsualtoconsumoenfrutas,proporcionandoaselapoyoalcamponacional,
la cual tiene su procedencia en los siguientes Estados: Veracruz, Tabasco, Guerrero, Zacatecas, Nayarit,
Irapuatoentreotros,ascomoelazcardeMichoacn.
Elconsumodefrutasvariadeacuerdoalademandadelosproductos,porejemplo,porloregularelmango
que proviene de Villa Azueta Veracruz, se ha procesado en una cantidad de 4000 a 6000 toneladas la
guayabadeTanguiscuaro,Michoacn,conunaproximadodeproduccinde4000a6000toneladas,lafresa
deMichoacnconproduccinde2000a4000toneladas,eltamarindoprocedentedeGuerrero,de200a800
toneladasylaguanbanaprocedentedeNayaritconunconsumode100a300toneladasanuales.

Pascual empez su apoyo al Ingenio Puruarn en 1998.En solidaridad con lanueva Sociedad Cooperativa
Trabajadores del Ingenio Puruarn, ambos de las cuales duraban aos en lucha contra la dominacin
corporativa,Pascualcompra100%delazcarproducidoporlanuevacooperativadelingenioenelestadode
Michoacn. Los anticipos para la compra de su produccin permiten al ingenio de Puruarn hacer
reparacionesenlafbricaycubrirlossueldosdesus obreros.EstearregloaseguraaPascualunafuentedel
azcarparasusbebidasnaturalesdefrutaygarantizaunmercadoalingeniodePuruarnparasuproduccin.
Distinto de otras bebidas en las cuales se utilizan la alta fructosa del maz en lugar del azcar de la caa,
Pascualutilizasoloazcardecaa.As,elingeniodePuruarnnoseenfrentaalamismaprdidadeaccesoal
mercadocomootrosingeniosasociadosconlasembotelladorasdelasbebidas"colas".

Conloanteriorreafirmanelcompromisoquetienenconlasociedad,mismoquesehacepatenteporunlado
al proporcionar productos de la ms alta calidad y por el otro en la activacin de la economa agraria, al
abastecersedefrutasmexicanasnaturalesprovenientesdelcampoparaelprocesodesusproductos.
Actualmente, la cooperativa enfrenta un problema con los dueos de los terrenos de las dos plantas que
pertenecanapascual,mismosquenofueronotorgadosalostrabajadores,yaquenoestabananombredelex
dueo,debidoaestohabaunclimadeinseguridadentrelostrabajadoresyaqueencualquiermomentolos
terrenosyloqueseencontrabaenellospudohabersidoinvadido.

40
Afortunadamente,yapesardequehubodiversos falloslegalesafavordelafamiliaJimnez,hacealgunos
meseselJefedelGobiernodelD.F.,Lic.AndrsManuelLpezObrador,hizoelfalloparalaexpropiacinde
dichosterrenos,afavordelacooperativa.

NoobstantelacooperativayacuentaconunanuevaplantaenTizayucaquecosto30millonesdedlares.El
proyecto fue financiado en mayor parte por la cooperativay mediante un prstamo blando otorgado por el
BancoFrancsCreditAgricolede10millonesdedlaresacincoaos,seencuentraenelestadodeHidalgoy
mide 52 mil metros cuadrados misma que concentrar parte de su produccin en tal lugar, y la cual fue
inaugurada por el presidente Lic. Vicente Fox, as como por el gobernador del estado de Hidalgo y otras
personalidadesdelapoltica,elmesdejuniodelao2003ycuyaproduccinhaarrancadoenmesdeEnero
del 2004. El presidente se mostr "muy impresionado" con lamoderna planta de 52 milmetros cuadrados.
"Este es un monumento al cooperativismo", exclam. Alrecordar que l "era de la competencia", Fox dijo
que Pascual "es unamuestra clara de lo que significa ese sistema y lo que puede darle al pas" y que "los
cooperativistas con altura demiras, integrados ala economa globalizada, son un verdadero ejemplo". A la
entradaseencuentraelbustoenmemoriadeDemetrioVallejo,elviejolderferrocarrileroquecomoasesor
acompaalostrabajadoresdePascualhastaeldadesumuerte.

Enlarelucientenaveindustrialyconlamodernamaquinariafrancesarecindesempacada,seenvasarleche,
se elaborarn botellas de vidrio y envases de plstico para embotellar Boing, Pascual y Lul. Entre los
futurosplanesdeloscooperativistasestampliarlaplantadeSanJuandelRo(unainversinde8millones
dedlarescondineropropio).Relanzarnsusrefrescosembotellados(PascualyLul),todoundesafopues
el90%delmercadodelrefrescoestbajoelcontroldeempresascomoCocacolayPepsicola.Losdirectivos
dePascualsequejandelacompetenciadeslealdeestasempresaspuesenestadoscomoMoreloseHidalgo,
lasautoridadesestatalesymunicipalesconcedencontratosdeexclusividadalaPepsiyalaCocaacambiode
dineroymaterialesparaimpedirquelosproductosdePascualsevendanenescuelaspblicas,miscelneasy
feriasregionales.LomismoocurrienZacatecasyGuerrero.Alrespecto,SalvadorTorrescomenta:"Nose
valequelasautoridadesapoyenesto,noqueestamosenellibremercado?Paranosotrosesmuyimportante
darlapeleaporqueesnuestrafuentedeempleo,perotambinporquenuestroxitofortaleceelmodelodelas
sociedades cooperativas, que en nuestro pas no se apoya". Es la tercera empresa en importancia en el
segmento de bebidas a base de frutas, donde abarca 26%del mercado con su clsico Boing. Sin embargo,
apenasabarca3%delmercadoderefrescoscarbonatadosembotellados.Sutrayectoriarecienteesnotabley
ampli sus ventas y mercado. El ao pasado vendi 37 millones de cajas y obtuvo ganancias por 2 mil
millonesdepesos(paracomparar,lacooperativadelperidicoExcelsioribaaseradquiridaelaopasadoen
mil500millonesdepesos).Esteaohacrecidomsquelacompetencia.

41
Laempresa" enunbuenmomento" .

La Cooperativa Pascual es una empresa social en varios sentidos: est en manos de sus trabajadores, algo
impensable en estos tiempos de globalizacin econmica su xito econmico es un argumento a favor del
cooperativismo y quienes apoyan a Pascual lo hacen como una forma de ayudar a la economa nacional.
Aunque el ao pasado hubo una campaa a travs de Internetllamando ala solidaridad conla cooperativa
porque, se deca, estaba a punto de quebrar. En su pginade Internet, la directiva agradeci la solidaridad
pero desminti la informacin: "Somos una empresa sana en expansin que se encuentra lejos de una
situacin de quiebra". Salvador Torres asegura que "la Cooperativa Pascual est en un buen momento. A
pesar de la crisis aument sus ventas por encima de la competencia". A pesar de no haber recibido ayuda
gubernamentalensus18aosde existencia,Pascualhalogradounasolidezfinanciera.

Pr oyectodePascual,delasociedadmexicana.
Sielpueblomexicanoesunodelosqueconsumemsrefrescoenelmundo,almenosnosquedaelconsuelo
de que hay una empresa nacional que produce bebidas envasadas elaboradas con frutas naturales, que es
competitiva ymantieneunsentidosocialenelmercadoglobal.Unodelostrabajadoresmsantiguosdela
refresquera,CelerinoTernRosas,diceque"trabajarenPascualesunasatisfaccinenorme.Mifamiliaymis
compaeros de trabajo as lo ven. Fueron aos de lucha y sacrificio, pero valieron la pena". El ahora
presidentedelaComisindePrevisinexplica:"Hoynuestraprincipalpreocupacinnoesganardinero,sino
crearempleosytenerproductosdecalidad".
Enesteesfuerzonohanestadosolos.SalvadorTorres,presidentedelConsejodeAdministracin,refiere:"La
poblacin ha sido el sostn de nuestro proyecto, nos dio apoyo moral y econmico durante nuestro
movimiento dehuelga. Despus nosharespaldado con su preferencia. Por eso decimos que el proyecto de
Pascualesdelasociedadmexicana".
Algunos especialistas empresariales afirman que los logros de Pascual se deben a que su producto es
reconocido,tieneunnichoenelmercado.Peronieganqueestotengaqueverconsusistemacooperativista.
Loscooperativistasporsuparte,loatribuyenalesfuerzocolectivo,alaaltacalidad,alagranaceptacindel
pblicoyalasestrategiasdeventa.SalvadorTorres,aadequeunodelossecretosdePascualhasidoahorrar
y reinvertir la mitad de sus ganancias para ampliar su capacidad de produccin. La Entidad Mexicana de
Acreditacinleotorgenelaodel2002elcertificadoISO9001decalidadencomercializacin,distribucin
yserviciosalcliente,despusdeunareingenieraenventasefectuadaporeldespachoEspondadeCalidady
DesarrolloEmpresarial.
La excelencia de sus productos le ha merecido diversos premios como el de la Excelencia Europea, el
Americano de Calidad y reconocimientos internacionales al prestigio comercial, de bebidas, de marca y
calidad.
Haganadotalprestigio,quelacooperativanegociaprstamosdirectamenteconbancosextranjerosparaabrir
nuevasplantas.

42
Unadelascaractersticasdelaempresaesquebrindalaoportunidadalosestudiantesypblicoengeneral,a
conocersusinstalaciones,procesodeproduccin,elaboracin,ylaextraccindepulpanatural,estocomouna
pruebadelaseguridaddelacalidaddesusproductosybebidasantesusclientesascomoconlafinalidadde
daraconocerloqueeslaorganizacindelacooperativa.

Empleos.
Laempresaensubsquedaincesantedecrecimiento,vaencaminadaaunfindeterminadomuyimportante
para la sociedad del nuevo milenio que es "La Generacin de Empleos". Una de las contribuciones de
CooperativaPascual,eslageneracindeempleos:4500empleosdirectos ymilesdeindirectosatravsde:
Proveedores (Tetra Pak con maquinaria y envases, campesinos, etc.), tiendas de autoservicio, tiendas al
detalle,changarros,entreotros.

2.2PERFILDELAEMPRESA.

2.2.1OBJ ETIVOSDELAEMPRESA.

La Sociedad Cooperativa Trabajadores de Pascual, una empresa 100% Mexicana, dedicada a elaborar y
envasarbebidasnaturalesdefrutas,conlafinalidaddeproporcionarasusclientes(nios,jvenesyadultos)
unproductodelamsaltacalidad,quepuedaserconsumidoydeleitadohastaporelpaladarmsexigente.
Mejorandocontinuamentelacalidaddesusproductos yservicios,afindesatisfacerlasnecesidadesdesus
clientes(internosyexternos).AselPatoPascualcontinahaciendodelassuyasyjuntoconlaLul,ahora
pretendeglobalizarse,esos,conunsentidosocial.

2.2.2MISIN.

Lamisindeestcooperativaes:
Elaborary comercializarbebidasnaturales,saludables ynutritivasenlagamadejugos,nctares,pulpasde
fruta, agua purificada, refrescos y lcteos, con el compromiso de deleitar y satisfacer la sed, de los
consumidoresdetodaslasedadesconlaresponsabilidaddelograrunbienestarsocial.

2.2.3VISIN.

Mejorar la organizacin cooperativa con nuevas plantas de produccin, de la mejor tecnologa y con gran
calidadhumana, que posibilitarhacer un producto y dar un servicio al cliente de mxima calidad. Bajo el
estandartedeLucha,CooperacinySuperacindetodossusintegrantes.

43
2.2.4FILOSOFA.

Sufilosofaestabasadaenlossiguientesvalores:
v Compromiso.
v Lealtad.
v Cooperacin.
v Respeto.
v Disciplina.
v Humildad.
v Responsabilidad.
v Democracia.
v Igualdad.
v Solidaridad.
v Imparcialidad.
v Equidad.
v Honestidad.

2.2.5VALORES.

Logr osyReconocimientos.
v Regresoalmercadodespusdehaberestadoenunalargahuelga.
v Usar tecnologa de punta en la elaboracin de las pulpas lo cual permite su comercializacin y
exportacin.
v Contarconunaadministracinhorizontal.
v Crecimientoconrecursospropios.
v Reconocimientoanivelinternacionalporsucalidad.
v XVTrofeoInternacionaldeAlimentacinyBebidas.
v XXITrofeoInternacionalalPrestigioComercial.
v XXTrofeodeoroalacalidad.
v Trofeoalamejorimagenenmarca.
v Produccinconunaltondicenutricional.
v Lacooperativabrindaelapoyoalasociedadybuscaelmejoramientosocial,porejemplo,convenios
conelD.I.F..,apoyoamovimientossociales,yaluchasdetrabajadores,entre otros.
v Promocindelaunincooperativista.
v Trabajarenarmonaconelmedioambiente.

44
Ar teycultur a.
Sepodranmencionarunainfinidaddecosas,acercadelacooperativa,sinembargo,unadelosaspectosms
importantes para esta, es el bienestar delos trabajadores, por lo cual se cuenta con un centro recreativo en
Acoinian,EstadodeMxico,elcualtienecanchasdeportivas,albercas,juegosinfantiles,entreotros.
Asmismo,lacooperativaimpulsaelarteylaculturaentresustrabajadoresyenelpblicoengeneral,paralo
cualsetienelaFundacinCulturalydelArtedelosTrabajadoresdePascual",quecomenzconun,acervo
de500obras,donadoporunconjuntodepintoresyescultoresderenombrecomoapoyoparaelmovimiento
dehuelga,yquelostrabajadoresdecidieronconservaryaumentar.
Alafecha,lafundacincuentaconunacervode1042piezasquemontaenexhibicionesendiversoslugares.
Asmismo,lafundacintieneacuerdosconteatrosyeventosculturales,paraproporcionaralostrabajadores
descuentosendichoseventos.

La visin denegocio referida por SalvadorTorres,prev una diversificacin bien planeada. En los ltimos
aos hareforzado su inversin en publicidad y ha incursionado como patrocinador en el ftbol de primera
divisin,primeroconelAtlticoCelaya,despusconlosColibresdeMorelos,elClubPachuca,(conelque
fueroncampeonesen2003)yactualmenteconlosfreserosdeIrapuato.

A pesar de todo, Pascual tiene expectativas para ampliar su mercado. En tanto, sigue apoyando lo mismo
huelgas,movimientossociales,organizacionesnogubernamentales,asociacionesciviles,quelasfiestaspara
niosqueorganizalaparejapresidencialenLosPinos.

2.3ESTRUCTURA.

2.3.1ESTRUCTURAADMINISTRATIVA.

La organizacin de la Cooperativa encabezada por una mxima autoridad que es la Asamblea General,
conformadaporlos trabajadores, misma que se distribuye entoda la organizacin, ya que la componen los
socios(veranexoorganigrama).

LaAsambleaGeneral,comomximaautoridad,delegalaresponsabilidaden:

v ElConsejodeAdministracin.
v ElConsejodeVigilancia.
v LaComisindeEducacinCooperativa.
v LaComisindePrevisinSocialy.
v LaComisindeConciliacinyArbitraje.

45
2.3.2.ORGANIGRAMA.

Verarchivode Excel:Organigrama.xls

46
2.3.3ESTRUCTURAOPERATIVA.

Recur sos.
v Cuatroplantasproductivasytresbodegas.
v PlantasurClavijero75,Mxico,D.F.
v PlantaNorteInsurgentesNorte1320,Mxico,D.F.
v PlantaSanJuandelRoAv.Central1cm.48.50SanJuandel RoQuertaro.
v PlantaTizayuca1.
v BodegaIztapalapa.
v BodegaenTultepecEdo.DeMxico.
v BodegaVallejo.
v Sucursales.

Distr ibucin.
Paraladistribucindelosproductoscuentacon:
v 800unidadesdereparto.
v 10unidadesparacolocarelproductoentreplantasproductivas.
v 15 unidades tipo torton para el envo de producto a sucursales y ms de 30 distribuidores
independientesportodalarepblica.
v 58unidadestipotrailerparaenvodeproductoasucursalesyadistribuidoresindependientes.
v UnaasociacincontransportistasexternosdeusoexclusivoparalaCooperativa.

Sucur sales.
v 19sucursalesactuales.
v 31distribuidoresindependientesalacooperativaquecubrengranpartedelterritorionacional.
Cober tur ainter nacional.
Actualmenteseexportaa:
v EstadosUnidos:
Texas,Chicago,CarolinadelNorte,LaFlorida,California,Arizona,NuevoMxicoprincipalmente.
v Canad:
Ottawa,Toronto.
v Centr oamr ica:
Guatemala,Belice,ElSalvador,CostaRica,Jamaica.
v Eur opa:
Francia,AlemaniaeInglaterra(slopulpa).

YactualmenteseestnegociandoparaabrirmsmercadoenEuropa.

47
Pr oduccin.
Considerando las cuatro plantas productivas, cuenta con 40 lneas de produccin para sus marcas Pascual,
LulyBoing,conunacapacidadinstaladadiariaatresturnosde470,917 cajas.
AdemscuentaconsupropioprocesodepulpasatravsdesumquinaRossiCatellicuyacapacidadinstalada
diariaatresturnosesmsde120toneladas.

Desar r olloTecnolgico.
Una de las realidades a las que se enfrenta esta empresa es a la globalizacin, un fenmeno que si bien
presentaoportunidadestambinamenazas.
En este sentido se encuentran fortalecidos, no se debe soslayar el avance tecnolgico donde utilizan
tecnologadepuntaalniveldeempresasdegranimpulsoyrenombre.
En cuanto a sus procesos de fruta, tienen maquinaria con tecnologa sofisticada, la cual les genera mayor
capacidadconrespectoaalgunosaosanteriores,estamoshablandodetecnologaItalianayJaponesa.
EnvasadodeBoing12Onz.
A travs de la mquina "Simonazzi", la cual tiene una velocidad por minuto de 630 botellas (12 onzas),
produciendoalmes921,362cajasde24piezas.
Asmismo,cuentanconequiposautomatizados,losquetambinsonconocidosporsussiglaseninglesP.L.C.
(ControladoresLgicosProgramables),mismosquehangenerandolaautomatizacindesusplantas.
Loanteriorleshapropiciado,nosloserautosuficientesencuantoalabastecimientodesuspropiaspulpas,
sino que les da la capacidad para producir excedentes, venderlos a empresasdelramo y poder exportar las
mismaspulpas.

Innovacin.
Cuentan con un departamento enfocado directamente a la investigacin y desarrollo exclusivamente, en el
cualserealizanproyectosquebuscanmejorarlacalidaddenuevosproductos.

Mer cadotecnia.
Respecto a este departamento tan importante para el establecimiento de la relacin clientecooperativa
cuentancon:
v Investigacionesdemercado.
v Anlisisestadstico(Competenciadeproductosylaqueexisteentrelosmismos).
v Promociones.
v Tendenciasdelmercado.
v Ofertas.
v Campaasdecanjes.
v Materialpuntodeventa.
v Publicidadtantonormalcomolademantenimiento.

48
OBJ ETIVOSCAPTULOIII.

v ConocerqueeselControlInterno.

v MencionarlaestructuradelControlInterno.

v DestacarlosobjetivosdelControlInterno.

v IdentificarloselementosdelControlInterno.

v AnalizarloselementosdelControlInterno.

49
J USTIFICACINCAPTULOIII.

Con la finalidad de tener lasherramientas necesarias parauna buena investigacin, es de vital importancia
conocerloselementosqueintegranelprocesodeControlInterno,dentrodeunaorganizacin.

50
CAPTULOIII.
CONTROLINTERNOENLOSCICLOSDETRANSACCIONES.

3.1 ConceptosGenerales.
3.2 Estr uctur adelContr olInter no.
3.3 ObjetivosdelContr olInter no.
3.4 ElementosdelContr olInter no.
3.5 TiposdeContr olInter no.

51
CAPITULOIII.

CONTROLINTERNO.

3.1CONCEPTOSGENERALES.

Elestudioyevaluacindelcontrolinternoseefectaconelobjetodecumplirconlanormadeejecucinde
trabajo que requiere que: El auditor debe efectuar un estudio y evaluacin adecuado del control interno
existente, que le sirva de base para determinar el grado de confianza que va a depositar en l yle permita
determinarlanaturaleza,extensinyoportunidadquevaadaralosprocedimientosdeauditoria
El control interno comprende el plan de organizacin y todos los mtodos y procedimientos que en forma
coordinadaseadoptanenunnegocioparasalvaguardarsusactivos,verificarlarazonabilidadyconfiabilidad
de su informacin financiera, promover la eficiencia operacional y provocar la adherencia a las polticas
prescritasporlaadministracin.
ElControlInternoeslabasedondedescansanlasactividadesyoperacionesdeunaempresa,esdecir,quelas
actividadesdeproduccin,distribucin,financiamiento,administracin,entreotrassonregidasporelcontrol
interno.
Lafuncindelcontrolinternoesaplicableatodaslasreasdeoperacindelosnegocios,desuefectividad
dependequelaadministracinobtengalainformacinnecesariaparaseleccionardelasalternativas,lasque
mejorconvenganalosinteresesdelaempresa.
El estudio del control interno tiene por objeto conocer como es dicho control interno,no solamente en los
planesdeladireccinsinoenlaejecucinrealdelasoperacionescotidianas.
Laevaluacindelcontrolinternoeslaestimacindelauditor,hechasobrelosdatosqueyaconoceatravs
delestudio,yconbaseensusconocimientosprofesionales,delgradodeefectividadqueesecontrolinterno
suministre.
Plandeorganizacinentrelacontabilidad,funcionesdeempleadosyprocedimientoscoordinadosqueadopta
unaempresapublica,privadaomixta,paraobtenerinformacinconfiable,salvaguardarsusbienes,promover
laeficienciadesusoperacionesyadhesinasupolticaadministrativa.4

Impor tancia.
Unbuensistemadecontrolinternoesimportantedesdeelpuntodevistadelaintegridadfsicaynumricade
bienes, valores y activos de la empresa, tales como el efectivo en caja y bancos, mercancas, cuentas y
documentosporcobrar,equiposdeoficina,reparto,maquinaria,etc.,esdecir,unsistemaeficienteypractico
decontrolinternodificultalacolusindeempleados,fraudes,robos,etctera.

4
SANTILLAN, Gonzlez Juan Ramn Introduccin al Control Interno a travs de los ciclos de
Transacciones ,EditorialEcafsa.

52
Elconceptodecontrolinternorevisteunaimportanciafundamentalparalaestructuraadministrativocontable
deunaempresa.Serelacionaconlaconfiabilidaddesusestadoscontables,conlaconfiabilidaddesusistema
deinformacininterno,consueficaciayeficienciaoperativayconelriesgodefraudes.
DeacuerdoconelautorRubnOscarRusenasensulibroManualdeControlInternonosmencionavarias
definicionesdenuestrotema,acontinuacinmencionamosalgunas:
AUTOR DEFINICIN

Instituto Americano de Contadores Pblicos ElControlInternocomprendeelplandeorganizacin


Diplomados(IACPD) 1948 ytodoslosmtodoscoordinadosymedidasadoptadas
ComitdeProcedimientosdeAuditoria. dentro de una empresa, para salvaguardia de sus
ReglaparaProcedimientosdeAuditoria29. activos, controlar la exactitud y confiabilidad de sus
datos contables, promover la eficacia operativa y
alentar la adhesin a las polticas gerenciales
establecidas.
Luis V. MANRARA GALAN, Sistema de Control El Control Interno consiste en un plan coordinado
Interno,FinanzasyContabilidad,Mxico1944 entrelacontabilidad,lasfuncionesdelosempleadosy
los procedimientos establecidos, mediante el cual la
contabilidad controla, hasta donde sea posible, las
operacionesprincipalesdelnegocio,yeltrabajodelos
empleados se complementa en tal forma que ninguno
tenga el control absoluto sobre alguna operacin
importante, de modo que no pueda existir fraudes ni
errores a menos que se confabulen dos o ms
empleados.
GOMEZ MORFIN, El Control Interno de los El Control Interno consiste en un plan coordinado
negocios, Fondo de Cultura Econmica, Mxico, entrelacontabilidad,lasfuncionesdelosempleados,y
1969 los procedimientos establecidos, de tal manera que la
administracindeunnegociopuedadependerdeestos
elementos para obtener una informacin segura,
proteger adecuadamente los bienes de la empresa, as
como promover la eficiencia de las operaciones y la
adhesinalapolticaadministrativaprescrita.
Instituto Mexicano de Contadores Pblico, En un sentido ms amplio, el Control Interno es el
Examen del Control Interno, Boletn 5 de la sistemaporelcualsedaefectoalaadministracinde
ComisindeProcedimientosdeAuditoria,Mxico, una entidad econmica. En este sentido, el trmino
1957 administracinseempleaparadesignarelconjuntode
actividades necesarias para lograr el objeto de la

53
entidad econmica. Abarca, por lo tanto, las
actividades de direccin, financiamiento, promocin,
distribucinyconsumodeunaempresasusrelaciones
pblicas y privadas y la vigilancia general sobre su
patrimonio y sobre aquellos de quin depende su
conservacinycrecimiento.5

3.2ESTRUCTURADELCONTROLINTERNO.

Laestructuradelcontrolinternodeunaentidadconsisteenlaspolticasyprocedimientosestablecidospara
proporcionarunaseguridadrazonabledepoderlograrlosobjetivosespecficosdelaentidad.Dichaestructura
consisteenlossiguienteselementos:
a) Elambientedecontrol
b) Elsistemacontable
c) Losprocedimientosdecontrol

A)AmbientedeContr ol.
Elambiente de controlrepresenta la combinacin de factores que afectan laspolticas y procedimientos de
unaentidad,fortaleciendoodebilitandosuscontroles.Estosfactoressonlossiguientes:
Actituddelaadministracinhacialoscontrolesinternosestablecidos.
v Estructuradeorganizacindelaentidad
v FuncionamientodelConsejodeAdministracinysusComits
v Mtodosparaasignarautoridadyresponsabilidad
v Mtodosdecontroladministrativoparasupervisarydarseguimientoalcumplimientodelaspolticas
yprocedimientos,incluyendolafuncindeauditoriainterna
v Polticasyprcticasdelpersonal
v Influenciasexternasqueafectenlasoperacionesyprcticasdelaentidad
La calidad del ambiente de control es una clara indicacin de la importancia que la administracin de la
entidadledaaloscontrolesestablecidos.

B)SistemaContable.
El sistema contable consiste en los mtodos y registros establecidos para identificar, reunir, analizar,
clasificar,registraryproducirinformacincuantitativadelasoperacionesquerealizaunaentidadeconmica.
Paraqueunsistemacontableseatilyconfiable,debecontarconmtodosyregistrosque:

5
PERDOMO,MorenoAbraham, FundamentosdeControlInterno, EditorialThomson,NovenaEdicin.

54
v Identifiquenyregistrennicamentelastransaccionesrealesquerenanloscriteriosestablecidospor
laadministracin.
v Describanoportunamentetodaslastransaccioneseneldetallequepermitasuadecuadaclasificacin.
v Cuantifiquenelvalordelasoperacionesenunidadesmonetarias.
v Registrenlastransaccionesenelperiodocorrespondiente
v Presentenyrevelenadecuadamentedichastransaccionesenlosestadosfinancieros.

C)Pr ocedimientosdeContr ol.


Los procedimientos y polticas adicionales al ambiente de control y al sistema contable, que establece la
administracinpara proporcionar una seguridadrazonable de lograrlos objetivos especficos de la entidad,
constituyenlosprocedimientosdecontrol.Elhechodequeexistanformalmentepolticasoprocedimientosde
control, no necesariamente significa que stos estn operando efectivamente. El auditor debe determinar la
manera en que la entidad ha aplicado las polticas y procedimientos, su uniformidad de aplicacin y qu
personalashallevadoacabo,paraconcluirqueefectivamenteestoperando.
Losprocedimientosdecontrolpersiguendiferentesobjetivosyseaplicanendistintosnivelesdeorganizacin
ydelprocesamientodelastransacciones.Tambinpuedenestarintegradosporcomponentesespecficosdel
ambientedecontrolydelsistemacontable.Atendiendoasunaturaleza,estosprocedimientospuedenserde
carcterpreventivoodetectivo.
Los procedimientos de control de carcter detectivo tienen como finalidad detectar los errores o las
desviaciones que durante el desarrollo de las transacciones, no hubieran sido identificados por los
procedimientosdecontrolpreventivos.
Losprocedimientosdecontrolestndirigidosacumplirconlossiguientesobjetivos:
a) Debidaautorizacindetransaccionesyactividades.
b) Adecuadasegregacindefuncionesyresponsabilidades.
c) Diseo y uso de documentos y registros apropiados que aseguren el correcto registro de las
operaciones.
d) Establecimientodedispositivosdeseguridadqueprotejanlosactivos.
e) Verificaciones independientes de la actuacin de otros y adecuada evaluacin de las operaciones
registradas.
Losfactoresespecficosdelambientedecontrol,elsistemacontableylosprocedimientosdecontroldeuna
entidad,debenconsiderarlossiguientesaspectos:
v Tamaode laentidad
v Caractersticasdelaindustriaenlaqueopera
v Organizacindelaentidad
v Naturalezadelsistemadecontabilidadydelastcnicasdecontrolestablecidas
v Problemasespecficosdelnegocio
v Requisitoslegalesaplicables

55
Los establecimientos y mantenimiento de una estructura de control interno, representa una importante
responsabilidad de la administracin, para proporcionar una seguridad razonable de que se logran los
objetivosdeunaentidad.Lagerenciadebervigilardemodoconstante,laestructuradecontrolinterno,para
determinarsistaoperaconloscambiosenlascondicionesexistentes.
Elconceptodeseguridadrazonablereconocequeelcostodelaestructuradecontrolinternodeunaentidad,
nodeberexcederlosbeneficiosesperadosalestablecerla.
La efectividad de la estructura de control interno, est sujeta a limitaciones inherentes, tales como malos
entendidos de instrucciones, errores de juicio, descuido, distraccin o fatiga personales, colusin entre
personasdentroyfueradelaentidadysilagerenciahacecasoomisodeciertaspolticasyprocedimientos.6

3.3OBJETIVOSDELCONTROLINTERNO.

Losobjetivosbsicosdelcontrolinternoson:

v Laproteccindelos activosdelaempresa.
v Laobtencindeinformacinfinancieraveraz,confiableyoportuna.
v Lapromocindelaeficienciaoperativadelnegocio.

Quelaejecucindelasoperacionesseadhieraalaspolticasestablecidasporlaadministracindelaempresa.

Sehadefinidoquelosprimerosdosobjetivos cubrenelaspectode controlescontables ylosdosltimosse


refierenacontrolesinternosadministrativos.

DeigualformaydeacuerdoconelautorPerdomoMorenoAbrahamlosobjetivos yprincipiosdelControl
Internoson:Objetivos:

v Prevenirfraudes.
v Descubrirrobosymalversaciones.
v Obtenerinformacinadministrativa,contableyfinancieraconfiableyoportuna.
v Localizarerroresadministrativos,contablesyfinancieros.
v Protegerysalvaguardad losbienes,valores,propiedadesydemsactivosdelaempresaencuestin.
Losprincipiosdelcontrolinternosoncinco:
1. Separacindefuncionesdeoperacin,custodiayregistro.
2. Dualidadoplurilateralidaddepersonasencadaoperacinesdecir,encadaoperacindelaempresa,
cuandomenosdebenintervenirdospersonas.
3. Ningunapersonadebeteneraccesoalosregistroscontablesquecontrolansuactividad.
4. Eltrabajodelosempleadosserdecomplementoynoderevisin.

6
RUSENAS,RubnOscarManualdeControlInterno EditorialEdicionesMacchi,BuenosAires
ArgentinaFebrero1999.

56
5. Lafuncinderegistrodeoperacionesserexclusivadeldepartamentodecontabilidad.7

3.3.1ObjetivosGener alesdelContr olInter no.

Elcontrolinternocontablecomprendeelplandeorganizacinylosprocedimientosyregistrosqueserefieren
alaproteccindelosactivosyalaconfiabilidaddelosregistrosfinancieros.Porlotanto,elcontrolinterno
contable esta diseado en funcin de los objetivos, para suministrar seguridad razonable de que todos los
controles internos contables pueden considerarse como controles administrativos. Por otra parte, el plan de
organizacin y los procedimientos y registros establecidos por la gerencia para documentar o ayudar su
proceso de toma de decisiones, puede incluir una serie de controles que no existen en el sistema de
contabilidad, al menos directamente. Precisando, se puede sealar como objetivos generales del control
internocontable,losqueacontinuacinsesealan:

Objetivosdeautorizacin.Todaslasoperacionesdebenrealizarsedeacuerdoconautorizacionesgeneraleso
especificacionesdelaadministracin.

Objetivos de procesamientoy clasificacin de transacciones. Todas las operaciones deben registrarse, para
permitirlapreparacindeestadosfinancierosdeconformidadconlosprincipiosdecontabilidadgeneralmente
aceptadosodecualquierotrocriterioaplicableadichosestadosyparamantenerenarchivosapropiadosdatos
relativosalosactivossujetosacustodia.

Objetivosdesalvaguarda fsica. Elaccesoalosactivossolodebepermitirsedeacuerdoconautorizacionesde


laadministracin.

Objetivos de verificacin y evaluacin. Los datos registrados relativos a activos sujetos a custodia deben
compararseconlosactivosexistentesaintervalosrazonablesytomarlasmedidasapropiadasconrespectoa
las diferencias que existan. Asimismo, deben existir controles relativos a la verificacin y evaluacin
peridica de los saldos que se informan en los estados financieros, ya que este objetivo complementa en
forma importantealosmencionadosanteriormente.

3.4ELEMENTOSDELCONTROLINTERNO.
3.4.1Organizacin.

Loselementosdelcontrolinternoenqueintervienelaorganizacinson:
Direccin.Queasumalaresponsabilidaddelapolticageneraldelaempresaydelasdecisionestomadasen
sudesarrollo.

7
SCHUSTER,JosAlberto ControlInterno ,EditorialMacchi.

57
Coordinacin. Que adapte las obligaciones y necesidades de las partes integrantes de la empresaa un todo
homogneo y armnico que prevea los conflictos propios de invasin de funciones o interpretaciones
contrariasalasasignacionesdeautoridad.
Divisin de Labores Que defina claramente la independencia de las funciones de operacin, custodia y
registro. El principio bsico del control interno es, en este aspecto, que ningn departamento debe tener
acceso a los registros contables en que se controla su propia operacin. Bajo el mismo principio, el
departamentodecontabilidadnodebetenerfuncionesdeoperacinodecustodia,sinoconcretarsealregistro
correctodedatos,verificandosusrespectivasautorizacionesyevidenciasdecontrolesaplicables,ascomoa
la presentacin de los informes y anlisis que requiera la direccin para controlar adecuadamente las
operacionesdelaempresa.
Elprincipiodedivisindefuncionesimpidequeaquellosdequienesdependelarealizacindedeterminada
operacinpuedaninfluirenlaformaquehadeadoptarsuregistrooenlaposesindelosbienesinvolucrados
en la operacin. Bajo este principio, unamisma transaccin debe pasar por diversas manos, independientes
entress.
Asignacin de responsabilidades. Que establezca con claridad los nombramientos dentro de la empresa, su
jerarquaydelegue facultadesdeautorizacincongruentesconlasresponsabilidadesasignadas.Elprincipio
fundamental en este aspecto consiste en queno se realice transaccinalguna sino laaprobacin de alguien
especficamenteautorizadoparaello.Debe,entodocaso,existirconstanciadeestaaprobacin,conlaposible
excepcindeactividadesrutinariasdemenorimportanciaenquelaaprobacinclaramentepuedaentenderse
comotcita.

3.4.2Pr ocedimientos.

Laexistenciadecontrolinternonosedemuestrasloconunaadecuadaorganizacin,puesesnecesarioque
sus principios se apliquen en la prctica mediante procedimientos que garanticen la solidez de la
organizacin:
Planeacinysistematizacin,esdeseableencontrarenusouninstructivogeneralounaseriedeinstructivos
sobrefuncionesdedireccinycoordinacin,ladivisindelabores,elsistemadeautorizacionesyfijacinde
responsabilidades. Estos instructivos usualmente asumen la forma de manuales de procedimientos y tienen
porobjetoasegurarelcumplimiento,porpartedelpersonal,conlasprcticasquedanefectoalaspolticasde
laempresa,uniformarlosprocedimientos, reducirerrores,abreviarelperododeentrenamientodelpersonaly
eliminaroreducirelnmeroderdenesverbalesydedecisionesapresuradas.
Registros y formas, un buen sistema de control interno debe procurar procedimientos adecuados para el
registrocompletoycorrectodeactivos,pasivosygastos.
Informes, desde el punto de vista de la vigilancia sobre las actividades de la empresa y sobre el personal
encargado de realizarlas, el elemento ms importante de control es la informacin interna. En este sentido,
desdeluego,nobastalapreparacinperidicadeinformesinternos,sinosuestudiocuidadosoporpersonas
concapacidadparajuzgarlosyautoridadsuficienteparatomardecisionesycorregirdeficiencias.

58
Losinformescontablesconstituyenenesteaspectounelementomuyimportantedelcontrolinternodesdela
preparacindebalancesmensuales,hastalashojasdedistribucindeadeudosdeclientesporantigedadode
obligacionesporvencimientos.
Las actividades de produccin y distribucin pueden vigilarse de cerca mediante informes peridicos,
analticosycomparativos,informesdeventasdecostos,anlisisdevariacionesdeeficienciaytiempoocioso,
etc. Un control interno de tipo ms elevado probablemente incluir informes peridicos sobre capital de
trabajo,origenyaplicacinderecursos,variacionesfinancieraspresupustales,etc.

3.4.3Per sonal.

Porslidaquesealaorganizacindelaempresayadecuadoslosprocedimientosimplantados,elsistemade
controlinternonopuedecumplirsuobjetivosilasactividadesdiariasdelaempresanoestncontinuamente
enmanosdepersonalidneo.
Loselementosdeestareaqueintervienenenelcontrolinternosoncuatro:
Entrenamiento. Mientras mejores programas de entrenamiento se encuentren en vigor, ms apto ser el
personalencargadodelosdiversosaspectosdelnegocio.Elmayorgradodecontrolinternologradopermitir
la identificacin clara de las funciones y responsabilidades de cada empleado, as como la reduccin de
ineficienciaydesperdicio.
Eficiencia.Despusdelentrenamiento,laeficienciadependerdeljuiciopersonalaplicadoencadaactividad.
El inters del negocio por medir y alentar la eficiencia constituye un coadyuvante del control interno. Los
negociosadoptanalgnmtodoparaelestudiodeltiempoyesfuerzoempleadosporelpersonalqueofrecen
alauditorlaposibilidaddemedircomparativamentelascifrasrespectivasdeloscostos.
Moralidad. Es obvio que la moralidad del personal es una de las columnas sobre las que descansa la
estructura del control interno. Los requisitos de admisin y el constante inters de los directivos por el
comportamiento del personal son, en efecto, ayudas importantes el control. Las vacaciones peridicas y un
sistemaderotacindepersonaldebenserobligatorioshastadondelopermitanlasnecesidadesdelnegocio.El
complementodecontrolinternoseencuentraenlasfianzasdefidelidadquedebenprotegeralnegociocontra
losmanejosindebidos.
Retribucin.Esindudablequeunpersonalretribuidoadecuadamenteseprestamejorarealizarlospropsitos
delaempresaconentusiasmoyconcentramayoratencinencumplirconeficienciaqueenhacerplanespara
desfalcaralnegocio.Lossistemasderetribucinalpersonal,planesdeincentivosypermisos,pensionespor
vejez y oportunidad que se le brinda para plantear sus sugestiones y problemas personales constituyen
elementosimportantesdelcontrolinterno.

3.4.4Super visin.

Como ha quedado dicho,no es nicamentenecesario el diseode una buena organizacin, sino tambin la
vigilanciaconstanteparaqueelpersonaldesarrollolosprocedimientosasucargodeacuerdoconlosplanes

59
delaorganizacin.Lasupervisinseejerceendiferentesniveles,pordiferentesfuncionariosyempleados y
enformasdirectaeindirecta.
Unabuenaplaneacinysistematizacindeprocedimientosyunbuendiseoderegistros,formaseinformes,
permitelasupervisincasiautomticadelosdiversosaspectosdelcontrolinterno.
En negocios de mayor importancia, la supervisin del control interno amerita un auditor interno o un
departamentodeauditoriainternaqueactucomovigilanteconstantedelcumplimientodelaempresaconlos
otroselementosdecontrol:organizacin,procedimiento y personal.As,lafuncindeauditoriainternaque
vigilalaexistenciaconstantedelcontrolinterno,esasuvezunelementomuyimportantedelmismocontrol
interno.4

DeacuerdoconelautorAbrahamPerdonoMorenoensulibroFundamentosdeControlInterno noscita
queexistensieteelementosdelcontrolinterno,loscualesseexplicaranunoaunomsadelante.

1. Organizacin.
2. Catalogodecuentas.
3. Sistemadecontabilidad.
4. Estadosfinancieros.
5. Presupuestosypronsticos.
6. Entrenamiento,eficienciaymoralidaddelpersonal.
7. Supervisin.Posteriormenteseestudiarabrevementecadaelemento.

Or ganizacin.

Establecimientoderelacionesdeconductaentretrabajo,funciones,nivelesyactividadesdeempleadosdeuna
empresaparalograrsumximaeficienciadentrodelosplanesyobjetivosestablecidos.
Elementosdelaor ganizacin.

v Establecimientodelaestructuraoptimadelaempresafuncional.
v Coordinacinadecuadadetrabajoyfuncionesdeempleadosporreasafines.
v Divisindecadaprocesoenpartesolabores
v Asignacindelaslaborescorrespondientesacadapuesto.
v Establecimientodeinstructivos.
v Determinacindeautoridadyresponsabilidaddecadanivel.

4
SANTILLAN,GonzlezJuanRamnIntroduccinalControlInternoatravsdelosciclosde
Transacciones ,EditorialEcafsa.
60
Contabilidad.

Concepto de principios de mecanismos tcnicos aplicables para registrar, clasificar, resumir y presentar
sistemticayestructuralmente,informacincuantitativaexpresadaenunidadesmonetarias,delasoperaciones
querealizaunaentidadeconmica.

Car actersticasdelacontabilidad.

Podemosresumirlascaractersticasdelacontabilidadcomosigue:
1. Conjuntodeprincipiosgeneralesaceptadosdeobservanciauniversal.
2. Conjuntodemecanismostcnicosdeobservanciaparticular.
3. Registratodaslasoperacionesenformacronolgicaenlibrosdeprimeraanotacin.
4. Clasificalasoperacionesporconceptosenlibrosdesegundaanotacin.
5. Resumetodaslasoperaciones.
6. Presentainformacinfinancierasistemticayestructuralmente.
7. Lainformacincuantitativaesexpresadaenunidadesmonetarias.
8. Produceinformacinparalaelaboracindeestadosfinancieros.
9. Proporcionaunaimagenclaradelasituacinfinancierayeconmicadelaempresa.
10. Proporcionaunaimagenclaradelosresultadosdelaempresayotrosaspectosfinancieros.
11. Proporciona informacin para el usuario general, es decir, usuarios internos y externos de la
empresa,denominadatambinentidadeconmicaoenteeconmico.

ObjetivosdelaContabilidad.

Losobjetivosdelacontabilidadquedanresumidosenlasiguientemanera:
1. Para conocer la situacin financiera de la empresa, lo que le permitir prever, analizar, planear y
controlarhechosfuturosqueenunauotraformalapuedenafectar.
2. Paraconocerelresultadodesusoperacionesydeterminarutilidadesoperdidasdelaempresa.
3. Paraelaborarestadosfinancieroscapacesdetransmitirinformacinquesatisfagaalusuariogeneral.
4. Paracontrolarlosbienes,recursos,obligaciones,deudasydemsaspectosmonetariosdelaempresa
deunamaneraeficiente.
5. Paratomardecisionesacertadasyalcanzarlasmetaspreestablecidasporlaempresa.
6. Paralaadministracineficienteyoportunadelaempresa.
7. Praledesarrollointegraldelaempresa,etctera.

Clasificacindelacontabilidad.
Entrminosgenerales,podemosclasificarlacontabilidaden:
v Contabilidadfinanciera,

61
v Contabilidaddecostos,
v Contabilidadfiscal,
v Contabilidadadministrativa.

CatlogodeCuentas.
Relacin del rubro de las cuentas de activo, pasivo, capital, costos, resultados y de orden, agrupados de
conformidad con su esquema de clasificacin estructuralmente adaptado a las necesidades de una empresa
determinada,paraelregistrodesusoperaciones.

Pr incipiosdelCatalogodeCuentas.
v Laclasificacindebeestarbienfundada.
v Enlaclasificacinseprocederdelogeneralaloparticular.
v Elordendelrubrodelascuentasdebeserelmismoquetienenlosestadosfinancieros.
v Losrubrosottulosdelascuentasdebensugerirlabasedeclasificacin.
v Debepreverseunafuturaexpansin.
Objetivosdelcatalogodecuentas.
v Registroyclasificacindeoperacionessimilaresencuentasespecificas.
v Facilitarlapreparacindeestadosfinancieros.
v Facilitarlaactividaddelcontadorgeneral,decostos,auditor,etctera.
v Servirdeinstrumentoenlasalvaguardadelosbienesdelaempresa.
v Promoverlaeficienciadelasoperacionesylaadhesinde lapolticaadministrativaprescrita.
ElementosdelCatalogodeCuentas.

Dossonloselementosqueintegranelcontenidodeuncatalogodecuentas:
v Elnumrico.
v Eldescriptivo.

EstadosFinancier os.

Por estados financieros puede entenderse aquellos documentos que muestran la situacin econmica de la
empresa,lacapacidaddepagodelamisma,aunafechadeterminada,pasadaofuturaobien,elresultadode
operacionesobtenidasenunperiodooejerciciopasadoofuturo,ensituacionesnormalesoespeciales.

Pr esupuestosyPr onsticos.

Conjuntodeestimacionesprogramadasdelascondicionesdeoperacionesyresultadosqueprevalecernenel
futurodentrodeunorganismosocialpublico,privadoomixto.

62
Car actersticasdelospr esupuestos.

v Elementodel controlinterno.
v Conjuntodeestimacionesprogramadas.
v Basadassobrebasesestadsticas.
v Decondicionesdeoperacinyresultadosaobtener.
v Enejerciciooperiodosfuturos.
v Dentrodeunaempresapublica,privadaomixta.

Entr enamientodePer sonal.

Elemento del control interno que tiene por objeto que todos los empleados lleguen a poseer preparacin,
conocimientosyexperienciaparaalcanzarlasmetasyobjetivosdelaempresapublica,privadaomixta.
Car actersticasdelentr enamientodeper sonal.

v Elementodelcontrolinterno.
v Elpersonaldebertenerpreparacin.
v Elpersonaldebertenerconocimientos.
v Elpersonaldebertenerentrenamiento.
v Elpersonaldebertenerexperiencia.
v Paraalcanzarlosobjetivospropuestos.
v Enlaempresapublica,privadaomixta.
ElReclutamientodepersonalserealizaatravsde:

v Sindicatos.
v Agenciasdeempleos.
v Bolsasdetrabajo.
v Escuelas.
v Recomendaciones.
v Mediospublicitariosperidicos,revistas,cines,teatros,etctera.
v Puertadelaempresa.
Para una mejor comprensin de los factores que intervienen en el control interno de las empresas a
continuacinsepresentanloselementosqueformanpartedelmismo.
Loselementosdecontrolinternopuedenagruparseencuatrocategoras:

a. Organizacin.
b. Procedimientos.
c. Personal.

63
d. Supervisin.5

3.5TIPOSDECONTROLINTERNO.

Elcontrolinternosedivideen:
Control Administrativo, donde se debe observar y aplicar en todas las fases o etapas del proceso
administrativo.
El control interno administrativo no esta limitado al plan de la organizacin y procedimientos que se
relacionaconelprocesodedecisinquellevaalaautorizacindeintercambios
Entonceselcontrolinternoadministrativoserelacionaconlaeficienciaenlasoperacionesestablecidasporel
ente.

Contr olinter noadministr ativo.Cuandolosobjetivosfundamentalesson:


1. Promocindeeficienciaenlaoperacindelaempresa.
2. Quelaejecucindelasoperacionesseadhieraalaspolticasestablecidaporlaadministracindela
empresa.

ControlFinancieroContable,estaorientadofundamentalmentehaciaelcontroldelasactividadesfinancieras
ycontablesdeunaentidad.
El control interno contable comprende el plan de la organizacin y los registros que conciernen a la
salvaguardadelos activosyalaconfiabilidaddelos registroscontables.6

Contr olinter nocontable. Cuandolosobjetivosfundamentalesson:


1. Proteccindelosactivosdelaempresa.
2. Obtencindeinformacinfinancieraveraz,confiableyoportuna.

DeacuerdoconelautorJosAlbertoSchusterensulibroControlInternoclasificaalcontrolinternode
acuerdoconladefinicindadaporelComitdeNormasdeAuditoriadelInstitutoAmericanodeContadores
Pblicoselcontrolinternoadministrativo,tambinllamadooperativo,incluye,peronoestlimitadoa,elplan
deorganizacinylosprocedimientosyregistrosqueserelacionanconelprocedodedecisinquellevaala
autorizacin de los intercambios. Esta autorizacin es una funcin de la gerencia directamente relacionada
con la responsabilidad de cumplir con los objetivos organizacionales y es el punto de partida para el
establecimientodeloscontrolescontables.7

5
PERDOMO,MorenoAbraham, FundamentosdeControlInterno, EditorialThomson,NovenaEdicin.
6
RUSENAS,RubnOscarManualdeControlInterno EditorialEdicionesMacchi,BuenosAires
ArgentinaFebrero1999.
7
SCHUSTER,JosAlberto ControlInterno ,EditorialMacchi.

64
Siguiendo con lo definido por el Comit de normas de auditoria del Instituto Americano de Contadores
Pblicos,elcontrolinternocontablecomprendeelplandeorganizacinylosprocedimientosyregistrosque
conciernena la salvaguardade los activos y a la confiabilidad de los registros contables y estn diseados
paraotorgarseguridadrazonableque:

a) Losintercambiossonejecutadosdeacuerdoconautorizacionesgeneralesoespecficasdelagerencia
b) Losintercambiossonregistradosparapermitirlapreparacindelosestadoscontabledeacuerdocon
lasnormas contables generalmente aceptadas o a cualquier otro criterio aplicable atales estados y
paramanteneruncontroladecuadodelosactivos.
c) Elaccesoalosactivosestslopermitidomedianteunaautorizacingeneraloespecificaporparte
delagerencia.
d) Losactivosregistradossoncomparadosaintervalosrazonablesconlosactivosfsicosexistentesyse
tomanlasdecisionesnecesariasrespectoacualquierdiferencia.

Comopodemosobservarelcontrolinternocontableserelacionaconloqueenladefinicindecontrolinterno
hemosdenominadosalvaguardarlosactivosyverificarlaconfiabilidadycorreccindelosdatoscontables.
EnellibroManualdeControlInterno delautorRubnOscarRusenasnosmencionaunaclasificacindel
ControlInternoqueacontinuacinmencionamos:

CONTROLINTERNOADMINISTRATICVOUOPERATIVO.

Se designan controles bsicos a aquellos que tienen efecto directo o simultneo sobre la situacin
econmica,patrimonialyfinancieradeunaempresa.

La actividad empresaria busca alcanzar metas u objetivos econmicos y para lograrlo debe tender lneas o
guas de accin que todos sus colaboradores deben conocer. La implementacin de estas guas son las
denominadaspolticas,lascualesasuvezgeneranpautasdeControlInternodecarcteradministrativou
operativo, ya que sirven a un objetivo de tipo operativo y estn llevadas a cabo por sectores ajenos a la
contabilidad.

CONTROLESBSICOSOCONTABLES.

Todas las operaciones o transacciones que tienen efecto financiero, econmico p patrimonial deben ser
registradasy,posteriormente,resumidasocompiladaspara medirlosresultadosdeunaactividadogestinde
un perodo o ejercicio econmico. Se denominan controles bsicos o contables a aquellos mecanismos de
control que aseguran y dan confiabilidad a la sntesis de las operaciones o transacciones realizadas por la
organizacin.

65
OBJ ETIVOSDELCAPTULOIV.

v Conocerlosciclosdetransaccionesdentrodelasdiferentesempresas.
v Detectarlaimportanciadecadaciclodetransaccin.
v Describirlosobjetivosdecadaciclodetransaccin.
v Mencionarlaimportanciaquesetieneencadadepartamento.
v Conocerlosprocedimientosutilizadosporcadaunodelosciclos.

J USTIFICACINDELCAPTULOIV.

En virtud de que nuestro trabajo est enfocado en el control interno, es importante conocer el origen y
aplicacin de cada uno de los ciclos de transacciones para poder tener una visin ms amplia de cmo se
relacionancadaunodeellos,ascomodestacarlaimportanciaquesetieneenunaorganizacin.

66
CAPITULOIV.
LOSCICLOSDETRANSACCIONES.

4.1 CiclodeIngresos.
4.2 CiclodeCompr as.
4.3 CiclodePr oduccin.
4.4 CiclodeInventar ios.
4.5 CiclodeTesor era.

67
CAPTULOIV

ELCONTROLINTERNOENLOSCICLOSDETRANSACCIONES.

4.1ELCICLODEINGRESOS.

Larecepcindedinerocomounafasedelciclodeingresos,puedeserdefinidadediferentesformascomo
mnimo,cubrelaprimerarecepcinacajadesdecualquierpartedelaorganizacin.Consecuentemente,est
relacionadaconelmanejodecajaylaformaenqueserecibeysemueveinternamentedentrodeuncontrol
centralizado. Este procedimiento puede estar sujeto a inevitables superposiciones, razn por la cual se
requiereconsideraralosingresosdentrodelpanoramatotaldelprocesodecaja.Paratalefectoesdeutilidad
describirlosprincipiosfundamentalesdecontrolaplicablesparcialocompletamentealasrecepcionesdecaja.
Estoscontrolessepuedenenfocardesdedospuntosdevista:a)externo,paraasegurarsedequeeldineroque
serecibirealmenteeselquedebihaberserecibido,b)desdeelpuntodevistadelempleado,paraasegurarse
dequeelingresoquerecibenolodesvahaciaotrosfines.

1. La contabilizacin debe efectuarse lo ms rpido posible. Mientras ms rpido se contabilice el


ingreso,mayorserelcontrol.Estapremisasecumplecuandoseestableceelmejortipoposiblede
registrocontableinicial.Unejemplocomn,puedeserlaemisinnumeradaderecibosdecajaque
contengan una copia para el interesado otro, es el uso de caja registradora por ltimo se puede
utilizarciertaclasedevolantesoboletosnumeradosseriadamentecanjeablesporlosingresosacaja.
2. Losregistroscontablesdebenestarorientados,lomsracionalmenteposible,hacialosingresosde
caja.Idealmente,losingresosacaja,queestablecenunacontabilizacininicial,debenestarligadosa
los registros intermedios contable, por ejemplo, los auxiliares de cuentas por cobrar. Otra opcin
puedeserlaventademercancaefectuadacondescargoalosregistrosdeinventariosperpetuos.Un
empleado o empleados de la organizacin deben estar encargados del control y registro de las
contrapartidascontablesdeingresosacaja.
3. Sedebeninstituircontrolesparaasegurarquesecobrenlosservicios.Elprimerrequerimientoes
queelclientepagueporelbienoservicioquerecibi.Enalgunoscasoselcontrolpuedeserlatira
delamquinasumadora,unaremisinsencilladepagado,unboletooticket,etcterasinloscuales
elclientenopuederecibirlamercancaoservicio.Estoscontrolessepuedencomplementarmediante
laproteccinfsicasobrelamercancaorestringirelaccesoalasreasdondeseprestaelservicio,
comoporejemplolasentradasaloscines.Internamente,elcontrolpuederequerirlaasignacinde
responsabilidadesporejemplo,alapersonaquevendelosboletosyalaquelosrecibe.
4. Sedebeutilizar,hastadondeseaposible,uncontroladicional.Enalgunassituaciones,lapresencia
delclientepuedeservirparavigilarlaaccindelempleadoporejemplo,elclientepuedecontrolar
queseancorrectaslascifrasintroducidasalacajaregistradoraporlacajera.

68
5. Conciliar los ingresos a caja. Desde el punto de vista del control el mtodo ms eficaz es la
conciliacin de los ingresos a caja desde los diversos ngulos de la operacin. Adems, la
conciliacinpermitelaseparacinderesponsabilidadesentrelasdiferentespersonasqueintervienen
enlaactividad.Obviamente,estosbeneficiosdebenjuzgarsealaluzdelosserviciosaclientesya
otraspartesinvolucradas.
6. Losingresosacajadebensepararsedelosegresos. Frecuentementeexistepresinparautilizarparte
delosingresosrecibidosparacubrirlosgastosnormales.Bajocircunstanciasnormalessedebeevitar
estaprctica.Esposiblerealizaruncontroleficazyunaclaracontabilizacinsielprocesodeingreso
a caja y el de egresos se manejan completamente por separado y ms an, cuando cada uno es
controladopordiferentesmecanismosopersonas.
7. Losingresosacajadebenpermanecerintactosydepositarsedeinmediato.ntimamenterelacionado
conelprincipioanterioresteldedepositar,otransferir,lomsprontoposible,elingresointactodel
da o periodo especfico por ejemplo, las recepciones del da deben depositarse ntegramente al
cierre de operaciones en esa jornada, o en la maana del da siguiente cuando las condiciones
bancariasaslohaganposible.Estoesimportanteporvariasrazones,laprimeradelascualesesque
unretrasoendepositaresungranriesgoymotivodetentacionessegundo,larevisineseficazenel
momentoynodespusdetranscurridociertotiempotercero,esimportanteestarencondicionesde
identificar un depsito particular por un periodo determinado y, finalmente, un ingreso no
depositadoesunactivoquenocontribuyealmejorutilizacindelosrecursosdelaorganizacin.
8. Deben contabilizarse adecuadamente todas las contrapartidas. Desde que se estableci que la
contabilizacin de los ingresos deben hacerse con una continuidad extrema, es importante que se
contabilicen oportuna y adecuadamente tambin aquellos rubros que representen contrapartidas,
comoenelcasodecuentasporcobrarocuentasporpagar.
9. Losregistroscontablesdeingresosdebenseroperadosdemaneraindependiente.Losregistrosque
seestablezcanparacontabilizarlosingresosacajadebenserelaboradosporpersonasquenotengan
bajo su responsabilidad los libros contables principales. Estas ltimas personas no deben tener
accesoalosregistrosauxiliaresdetalformaquepuedanrelevardesusresponsabilidadesaquienes
manejan stos. Es conveniente que exista rotacin de los empleados que elaboran cheques para
asegurarqueelefectivoesmanejadoycontabilizadocorrectamente.

4.1.1Natur alezadelpr ocesodecuentaspor cobr ar .

El proceso de cuentas por cobrar cubre cualquier tipo de accin de la entidad generado por reclamaciones
contra individuos o personas morales. Por lo general, estos reclamos son contra partes externas de la
organizacin,auncuandoenocasionespuedeninvolucrartambinaempleadosy funcionariosdelamisma.
Las reclamaciones surgen como consecuencia dela fase intermedia o el intervalo para cobrar una cuenta o
algnotrotipodeconsideracin.Mientrasestasreclamacionessepuedenoriginarmedianteunagranvariedad
de formas, la principal categora est relacionada con la venta de productos manufacturados o servicio

69
prestados por la organizacin. A continuacin se expondr primero esta categora, y posteriormente se
analizarnotrasdesegundaimportancia.
Elprocesodecuentasporcobrarrelativoalasventastieneunnmeroimportantederelaciones.Laprimeraes
la inmediata necesidad de contar con polticas que cubran el otorgamiento de crdito y la subsecuente
administracin. Quin debe dar el crdito? Por qu cantidad? Qu nivel de agresividad debe mostrar la
organizacinparapresionarenlasubsecuenterecuperacin?Unsegundotipodeconsideracinestvinculada
conestasactividadesdecuentasporcobrarrelacionadasconlasatisfaccindelclienteyunabuenarelacin
continua, ya que la organizacin inevitablemente est interesada en la forma enque los clientesreaccionan
ante las autorizaciones de crdito, facturacin y cobranza. Por otro lado, la organizacin tambin esta
interesada en lo que puede aprender a travs de sus relaciones de cuentas por cobrar al conocer cmo los
clientes reaccionan hacia sus productos o polticas. Adems, finalmente, la organizacin tiene un inters
especficosobrelaeficienciade lasactividadesdecuentasporcobrarylaeficienciadesucontrol.
El proceso relativo al grupo de cuentas por cobrar consta de tres fases: la primera est vinculada con las
condicionesqueoriginanlaexistenciadeunacuentaporcobrar.Lasegundafasecubrelaadministracinde
estas cuentas y la forma en que fueron creadas. Por su parte, la tercera fase est conformada por los
mecanismosquepermitenquelacuentaseafinalmenterecuperada.Elobjetivoencadacasoescomprenderel
rangogeneraldelosasuntosinvolucradosylaidentificacindelosprincipalesproblemasdecontrol.

Cr eacindelascuentaspor cobr ar .
Debidoaquelascuentasnormalmentesonoriginadasporlaventadelosproductosdelaorganizacinoel
rendimiento de determinar clase de servicio, el primer inters debe estar en el establecimiento de unalnea
directaconesasbuenasbasesdeorigen.Deestaforma,elobjetivosedebeenfocarenelelementooriginador
delacuentaporcobraryelcorrespondientesoportedelembarque delproductoolaejecucindelservicio.Al
mismotiempo,esmenesterasegurarsedequetodaslascuentasporcobrarhansidocorrectamenteregistradas.
Ambosobjetivospuedenserlogradoscuandolacreacindelacuentaporcobrarestligadadirectamentecon
la contabilizacin de un inventario o con el registro de un servicio prestado. Consecuentemente, se debe
estableceestarelacinenunsentidoespecficodeprocedimiento.

Comopreviamentesehahechomencin,lageneracindelacuentaporcobrarinvolucrainmediatamenteotra
cuestin:silaorganizacindeseaexpedirelcrditorequeridoproelclienteparapodercubrirsuoperacin.
Esta determinacin generalmente puede quedar ubicada dentro de la poltica general de crdito de la
organizacin,lacualdebeseraplicadaaunclienteparticularalaluzdelasituacincrediticiadesteyala
experienciadelaentidadconl.Cuandosehadispuestolaaceptacindecrdito,seinicialaventaregulary
elprocesodefacturacincomopartedelcualsepreparaunafacturaqueescargadaenlacuentadelcliente.
Lasprincipalesconsideracionesdecontrolaplicablesalacreacindelacuentaporcobrarsonlassiguientes:

1. Revisinindependienteyaprobacindelcrdito.Cuandoserecibeunasolicituddecrditosedebe
obtenerlaaprobacindelamisma,lacualpuedeserproporcionadaporundepartamentoopersona

70
dentro del marco de referencia establecido por las polticas de la organizacin apoyada en
informacinadecuada acerca del cliente en cuestin. Estaltima informacin presentala posicin
financieradelclienteysucapacidaddeendeudamiento,ascomolaexperienciadelaorganizacin
con el cliente y su actual posicin de cartera. La aprobacin es realizada por individuos
adecuadamente autorizados,deacuerdoconelmontoinvolucradoenlaoperacin.
2. Determinacindeladisponibilidaddelproducto.Todaslaspartidasordenadasporelclientepueden
noestardisponiblesparaserembarcadasenesemomento,yconsecuentementedebenserincluidas
enlafactura.Lasmercancasdisponiblesdebenseridentificadasyempacadasadecuadamente.Otras
que no estn disponibles deben ser cubiertas por procedimientos denominados back order
(pendientesdeenvo),paraposteriorembarque.
3. Autorizacin de precios y trminos. Los precios y trminos de la operacin deben estar
completamente estandarizados para todos los clientes. Sin embargo, en algunos casos los mismos
pueden variar segn los grupos de clientes y las diferentes cantidades que stos puedan comprar.
Paraefectosdefacturacin,lospreciosytrminosaplicablesdebenserproporcionadosconbaseen
polticas establecidas por la organizacin. Adems, la interpretacin de desviaciones especiales
debenseraprobadasporpersonasdebidamentefacultadas.
4. Papeleramulticopiaparapropsitosespecficos.Lasfacturasdebenserpreparadosconsuficiente
nmero de copias que contengan informacin idntica para ser utilizadas en otros propsitos
operacionales.Deestamanera,unadelascopiasautorizael embarque,otraseentregaalcliente,otra
es usada para elaborar estadsticas de venta, mientras que la ltima se enva al departamento de
cuentasporcobrarparasuregistro.Sedebenestablecercontrolesquecubraneltotaldelasfacturas
porunperiododeterminado,porlogeneraldeundadeactividades.

Administr acindelascuentaspor cobr ar .


Lafasedeadministracindelprocesodecuentasporcobrarempiezaenlageneracindelacuenta,pasaasu
manejo y control apropiados, y concluye en el momento que es pagada o liquidada. Las principales
consideracionesdecontrolduranteestanuevafaseincluyen:

1. controlindependientedelosregistrosdecuentasporcobrar.Losregistrosdecuentasporcobraren
algunos casos pueden ser elaborados manualmente en medianas o grandes organizaciones son
manejados por computadora. Los principios fundamentales en todos los casos exigen que estos
registros sean elaborados en forma independiente, con exclusin absoluta de terceras personas,
especialmentedeaquellasquetenganaccesoalacajaoalosclientes.Entodosloscasostambinse
deben tener cuentas de control y, en lo posible, de subcontrol, fundamentadas por cuentas
individualesperfectamentedetalladas.
2. Registro y control. Cualquier cargo a bancos u otra cuenta miscelnea que ocasione una
contrapartidacrediticiaalascuentasporcobrardebeserregistradadiariamenteconobjetodecontar
con informacinactualizada que sirva a las diversasnecesidades operacionales de la organizacin.

71
Simultneamente,sedebetenerlacertezadequeestascuentasporcobrarsonexactasmediantelas
confrontacionesperidicasentreestosregistrosauxiliaresconlascuentasdellibromayor.
3. Oportunoyadecuadosistemadereporte.Ademsdelainformacinquesedebesuministrartodos
los das, es necesario contar con un sistema peridico que reporte los saldos corrientes con su
correspondienteanlisisdedetalles.Esteanlisisdebemostrarlasporcionesopartidasdelacuenta
porcobrarquenohansidopagadasendiversosperiodos,comoporejemplosaldoactual,vencidoun
mes, vencido dos meses, vencido tres meses, vencido ms de tres meses, etctera.Este anlisis es
unaimportantebaseparaadministrarelesfuerzodelarecuperacindecartera.
4. Envodeestadosdecuentadeclientesenformadirectaeindependiente.Unelementobsico,desde
elpuntodevistadelcontrol,consisteenenviarestadosdecuentaalosclientes,locualdebehacerse
demaneradirectaeindependiente,esdecir,sinqueningnelementode laentidadtengaoportunidad
e alterarla,modificarlo o hacerla desaparecer. Este procedimiento hace posible un control cruzado
conelprincipalinvolucradoenlacuenta,oseaelcliente,pero,adems,esunimportantemecanismo
quesirveparaacelerarcobrosretrasados.

Disponibilidaddelascuentaspor cobr ar.


Las cuentas por cobrar representan un activo reclamable a las partes deudoras. Consecuentemente, es muy
importantequeestarecuperacinnopuedaserrelevadasinomedianteunprocedimientoautorizado.Existen
cuatroprocedimientosparaacreditarunacuentaporcobrar,loscualesseexponenacontinuacinjuntoconlas
principalesconsideracionessobrecontrol:
1. Cobranza.Elprocedimientomscomn,esquelacobranzaqueserecibedelosclientessirvepara
liquidar una cuenta por cobrar previamente generada. Las cuentas de control (cuentas del libro
mayor) reciben las concentraciones para efectuar los correspondientes registros sumarios. Aqu se
presenta el problema de lograr un adecuado control sobre los ingresos a caja, en el que se debe
contemplartambinlasrebajasydescuentosotorgados.
2. Devolucin de mercanca. Cuando, por diversasrazones, los productos vendidos son devueltos, es
necesario revertir la operacin original de venta. El primer requisito es que la devolucin est
autorizada.Elsegundo,quelarecepcinfsicasehagaefectivaylamercancaserecibaenbuenas
condiciones. Finalmente, es menester confirmar que el importe a acreditar sea por la cantidad
correcta.Estostrespasos,cuandoestnadecuadamentedocumentados,proporcionanlasbasespara
acreditarunadevolucindemercanca.
3. Ajustes y descuentos. El esfuerzo de control se debe realizar con mayor eficacia cuando existen
polticasespecialesdedescuentosociertotipodeacreditamientoaalgnclienteenparticular.Este
caso puede presentarse en ventas por volumen, la venta de un tipo particular de productos al
consumidoroajustesocasionadospordeficienciasenlosproductos.Cuandolosdescuentosfueron
originadosenalgnarregloespecfico,elcontroldebecentrarseenlaconfirmacindelasbasesde
dichoacuerdo.Sinembargo,enmuchoscasos,laautenticidaddelcrditoestapoyadaenfactoresde
juicioquesonevaluadosporelejecutivoqueaprobelcrdito,dentrodeloslmitesdesuautoridad.

72
4. Cancelacindecuentasmalas. Conciertafrecuenciaesnormalquehayclientesquenocumplancon
susobligacionesyaqueaunqueseapliquetodoelesfuerzodecobropuedenpresentarsesituaciones
tales como quiebra, desaparicin del deudor u otras causas que no dejen ms alternativa que la
cancelacindelacuenta.Porlogeneral,sedebenhacerprovisionesdetipocontablequesirvanpara
lacreacindeunareservaparacuentasmalasoincobrablescontralaquesepuedacargarcualquier
cancelacin de esta naturaleza. El inters especfico de control en este punto es que cualquier
cancelacin debe ser autorizada por un funcionario de alto nivel de la organizacin. El siguiente
inters consiste en mantener el control sobre esas cuentas canceladas para evitar que stas sean
cobradas y no reportadas a la organizacin, o bien estar atentos a cualquier probabilidad de
recuperacin.

Polticasadministr ativasdelascuentaspor cobr ar.


Luegodehaberexpuestoelmarcodereferenciaoperacionaldelprocesodecuentasporcobrar,seanalizarn
cuidadosamentevariaspolticasclaverelacionadasconelmanejodelascuentasporcobrar.
1. Otorgamiento de lneas o niveles de crdito. Una cuestin de poltica es determinar el nivel de
liberalidadquedebetenerunaorganizacinparaotorgarcrdito.Esclaroqueenpocasdecrditos
restringidos disminuye la posibilidad de prdidas por cuentas malas. Sin embargo, el juicio sobre
culessernlaspolticasdecrditoquemejorsirvanalosinteresesdelaorganizacinnosedetienen
ah,yaquelasventasgeneradasporpolticasmsliberadassonelorigendeventasadicionalesque
de otra manera no se hubieran efectuado. Adems, de que estas operaciones puedan producir
utilidades extras y ser beneficiosas para la organizacin, pues un gran volumen de ventas puede
generarreduccindecostosdeproduccindebidoalaabsorcindeloscostosfijos.
Sedebereconocerqueesmuydifcilmedirconexactitudlosbeneficiosdecualquiertendencia,por
locualesmuyimportantereconocertodaslasdimensionesdelproblema,estoes,nonecesariamente
serloptimoparalaorganizacintenerunaspocascuentascanceladasyaquepudieracorrerseel
riesgodequelascancelacionesseanmayorescomoconsecuenciadeunagranutilidadgeneradapor
lavadelasventas.Enresumen,todasituacindebeserexaminadacongrandetalleantesdellegara
unadecisinfinal.
2. Efectos de las relaciones con los clientes en el proceso de cuentas por cobrar. Un aspecto muy
importanterelativotantoalaoperacindeldepartamentodecuentasporcobrarcomoalprocesototal
deestascuentas,eselefectoqueejercensobretodasestasactividadeslasbuenasrelacionesconlos
clientes.Porunlado,essabidoquealaorganizacinleinteresadesarrollareficientesprocedimientos
y operaciones internas, intento durante el cual con frecuencia le es deseable restringir los
procedimientos y, consecuentemente, el grado de contacto personal en el manejo de diversas
situaciones.Porotrolado,elprocesodecuentasporcobrarinevitablementeinvolucrarelacionescon
losclientes.
Portodoloanterior,sehacenecesariomanejarestasrelacionesconlosclientesdelamejormanera
para evitar cualquier asomo de irritacin a efectos de construir una relacin positiva con ellos.

73
Ejemplos de estos contactos pueden ser la aplicacin de las lneas de crdito, claridad de las
facturaciones,procesamientodeacreditamientodeajustesylosdiversosaspectosdecobranza,Una
slida eficiencia se logra con la combinacin de la eficiencia interna y la cortesa y razonable
cooperacinconelcliente.Conmuchafrecuencialosclientesestninsatisfechosdebidoamuchasy
variadas causas (que en ocasiones son completamente independientes del proceso de cuentas por
cobrar), las que se pueden reducir a travs de los contactos de cuentas por cobrar, ya que este
personaltienelaoportunidaddeseruncanaldesolucindelosproblemasqueelclientetengacon
toropersonaldelaentidad.

4.1.2Pr ocesodecuentaspor cobr ar.

Aun cuando las actividades regulares de ventas de la organizacin son el principal origen de cuentas por
cobrar, existen otras actividades que generan ciertos tipos especiales de cobranza, cuyos ejemplos ms
ilustrativossonlossiguientes:

1. Anticiposaempleados.Laventadeproductososerviciosquepresentalaorganizacinnormalmente
debenserincluidosenlascuentasporcobraraclientesadems,existenotrasclasesdeanticiposde
naturaleza similar, como los otorgados para gastos de viaje, para fines especiales de negocios o
prstamos a ttulo personal a los empleados. Este ltimo tipo de cobranza estgarantizada porlos
sueldos ysalariosdelosquerecibenelanticipo y sobrelosquesedebe ejercerunestrictocontrol
Adems, estos anticipos deben estar regulados por polticas perfectamente definidas, mientras que
los casos especiales tienen que ser autorizados directamente por funcionarios de alto nivel de la
organizacin.
2. Depsitos con terceros. En muchas ocasiones es necesario efectuar depsitos con terceros para
garantizar un servicio u otras razones. Estas provisiones pueden ser de naturaleza temporal, o tan
permanentes como el servicio a prestar lo requiera. En este punto es muy importante que en su
registrose asientelapocaderecuperacindeldepsito.
3. Reclamaciones.Enelcursodelasrelacionesconproveedores,transportistasocualquierotrogrupo
deserviciossepuedenoriginarreclamacionesquedebenserregistradasymanejadasporuncontrol
que est atento de su reembolso. Las reclamaciones por concepto de seguros son otras cuentas de
naturaleza similar de este grupo. En ocasiones se plantea la alternativa de registrar o no estas
reclamacionesobviamente,Hacerloeselmejorcontroldeestascuentasporcobrar.
4. Acumulacindeingresos.Untipomuyespecialdecuentasporcobrarseoriginacuandolosingresos
secapitalizanantesdequepuedansercobrables.Enestecaso,elobjetivo,ensentidooperacional,es
reconocerlosingresosenlosperiodosaquerealmentecorrespondanaefectodetenerobjetividaden
laevaluacindelosresultadosoperativo.Tpicodeestecasosonlascuentasporcobrardeventasen
abonos.

74
Aspectosespecialesdelprocesodeotrascuentasporcobrar Envirtuddequelanaturalezayalcancedelas
transacciones y actividades que generan estos tipos de cuentas por cobrar pueden variar enormemente, es
necesario manejar ciertos aspectos de control que seanaplicables regularmentea todas ellas.El primero de
estos aspectos es que las condiciones bajo las que se crea un tipo particular de cuentas por cobrar sean
claramente definidas tanto en el sentido procesar como poltico. El principal objetivo es proporcionar una
adecuadaseguridaddequelacuentaprocobraresregistradaenlibroslomsprontoposible,quelacantidad
es la correcta y con todos los electos que determinaron su creacin. El segundo consiste en establecer los
procedimientos necesarios para revisar peridicamente el estado de todas estas cuentas por cobrar. Sin
embargo, con frecuencia sucede que estas cuentas son atendidas con la adecuada diligencia en el proceso
operacionalregular,porlocualesnecesariotomarprecaucionesespecficasparacombatirtalestendencias.

Pr ocesodedocumentospor cobr ar.

Enciertascircunstanciasaalgunasorganizacioneslesresultaconvenientediferirlarecuperacindelacuenta
porcobraroriginadaporlaventadesusproductososervicios,encuyocasolasoperacionesqueserealicen
deben especificar claramente las pocas de pago. En algunos casos stas se garantizan mediante un
documentoporcobrar.Sinembargo,estosinstrumentostambinoriginanproblemasderecuperacincuando
semezclanconlascuentasporcobrarregularestambinsepresentancircunstanciasespecialescuandoestas
ltimasnosonliquidadasdeacuerdoconelplanoriginal.Yesaqucuandolaorganizacindeseaobtenerun
reconocimiento ms preciso de su crdito cuando sta se encuentra respaldad por un documento. Tambin
debeconsiderarselaposibilidaddecargarinteresessobreestosdocumentos.

Entodaslassituacionesplanteadas,lascircunstanciaspermitendefinirelmanejodelacuentaporcobrar,es
decir, si se documento o no. En el primer caso se presente la necesidad de monitorear esta cobranza en la
fechaespecificada,conlosinteresescorrespondientes,cuandoprocede.Otroproblemasepresentadebidoalo
pococomnqueesdocumentarunacuenta,porlocuallacostumbrehacequeestepapelsemanejeenforma
similar a una cuenta corriente. Para cubrir todas las eventualidades planteadas, se requiere establecer
procedimientosespecficosqueasegurenlarevisinperidicaylaestandarizacindeacciones.4

4.2ELCICLODECOMPRAS.

Elpuntodepartidaenelciclooperativodeunaorganizacineslanecesidaddepreocuparselosmaterialesy
servicios que sern vendidos, ya sea en su forma original o usados, procesados o combinados segn las
necesidadespropiasdelmercado.Estanecesidadpuedeincluirmateriaprima,materialesprocesados,partes,

4
SANTILLAN,GonzlezJuanRamnIntroduccinalControlInternoatravsdelosciclosde
Transacciones ,Editorial Ecafsa.
75
subensambles,servicios,suministros,personalyelmismo dinero.Enmuchasdeestasreasdeprocuracin
existen problemas especiales que requieren, asimismo, habilidades especiales. As por ejemplo, el
reclutamientodeempleadosdebesermanejadoatravsdeundepartamentodepersonal,obien,laobtencin
defondosdecapitalquedebeserdirigidaporuntesorero.
Unagranpartedeestapreocupacin,sinembargo,esnormalmentemanejadaporungrupoespecficamente
establecidoparaestepropsito,pero,comomsadelantesever,lasactividadesdeprocuracindeestegrupo
pueden variar. Por lo general las partidas manejadas incluyen la mayora de los materiales, partes y
suministrosempleadosporlaorganizacin.
Laimportanciadelaactividaddecomprasesmuygrande,yaquelatpicaaccindecomprasconstituyems
de la mitad de los costos incurridos por una organizacin por los productos y servicios que vende.
Consecuentemente,esunaactividadalaquelaadministracindedicaunaltogradodeatencin.Ademses
de una importancia primordial debido a las significativas interrelaciones que guarda con otras actividades
gerenciales, pues lo que compra est directamente relacionado con la eficiencia productiva. Asimismo, el
volumendecomprasestambindeterminantedelosnivelesdeinventarios,ylainversinenstoseselfactor
principal para alcanzar una favorable rotacin del capital invertido. Sumando a todo ello, la funcin de
compras tiene una relacin operacional directa con las actividades de recepcin, almacenes, venta de
desperdicios y cuentas por pagar. Por todas estas razones, el ciclo de compras es una de las reas ms
importantesdeunaorganizacin.

4.2.1Funcionesbsicas.

Enaquellasreasdeprocuracindondelaresponsabilidadhasidoasignadaaldepartamentodecompras,la
funcinbsicaesigualacualquierreadeprocuracin:proveerbuenosproductososerviciosabuenprecio,
enelmomentoylugaroportunos.Eltrminobuenesusadoaqucomosinnimodelomejorposible,en
todoslosaspectosquebeneficienlosinteresesdelaorganizacin.staes,porsupuesto,unadeterminacin
que a menudo no puede ser evaluada con precisin y que por lo tanto involucra una gran dosis de juicio.
Adems,esespecialmenteciertodebidoaquelasprincipalesinterrelacionesconotrasactividadesoperativas
que, a largo plazo, deben ser evaluadas continuamente atendiendo a los tipos especiales de beneficios a
esperardelafuncinbsicadecompras.
Estos conceptos fundamentales de la funcin bsica son al mismo tiempo los objetivos de la actividad de
compras. El inters primordial es que la funcin de compras debe existir en diferentes niveles: en los
inferiores, es la eficiencia con que el personal auxiliar cumple con la parte que le corresponde en los
procedimientos operacionales en el nivel intermedio, existe inters en la eficacia con que las actividades
individualescubrenlosaspectosmsimportantestalescomolaseleccindeproveedoresylanegociacinde
precios por su parte, en los niveles altos, existe preocupacin por el grado en que se puedan percibir las
oportunidadesdelograrmejorescomprasparalasdemsfuncionesgerenciales.

76
Elciclonor maldecompr as.
Lafuncindecompraspuedeservistacomouncicloqueincluyeunaseriedepasosperfectamentedefinidos,
asaber:
1. Determinacin de necesidades. En primer lugar debe de terminarse la necesidad especfica que
requiere ser satisfecha a travs de la accin de preocupacin, es decir, la determinacin de los
productos y sus especificaciones, cantidades, requerimientos de entrega y otra informacin
pertinente.
2. Autorizacin de la compra. Como segundo paso debe existir una autorizacin para proceder a
efectuarlacompra.Algosenecesitayhayquedecidircmoobtenerlo.
3. Efectuarlacompra.Elgrupodecomprasseocupadelocalizarelproveedorqueseconsiderapuede
proporcionarlosartculosbuscadossobrelabasemsventajosaparalaorganizacin.Laseleccin
deproveedordebedecidirseenunacuerdodefinitivodecompra.
4. Seguimiento.Hastaelpuntoqueseanecesariodebehaberunaaccindeseguimientoporpartedel
grupo de compras de igual manera, es necesario asegurar que la entrega de la mercanca que se
requieredebeserrealizadadetalformaquesatisfagalasnecesidadesdelaorganizacin.
5. Completarlaentrega.Enelmomentoenqueseefectalaenterezasedebedeterminarsicumple
conloacordadoosisepresentaalgncambioimprevistosusceptibledereclamo.
6. Liquidacin.Finalmenteseliquidaalproveedor deacuerdoconlasbasesconvenidas,conlo cual
concluye la transaccin de compra, obviamente condicionada a las garantas ofrecidas por el
proveedor.

Estr uctur adecontr ol.


Enrealidadelproblemadecontrolhaquedadocubiertoenlosanteriorespasosoperacionalesqueconforman
elciclodecompras,cuyoanlisiseselsiguiente:

Deter minacindenecesidades.
El control bsico que se requiere durante la determinacin de necesidades, es la medida segn la cual esta
determinacinsobrebasesslidas,adecuadamentecomunicadasalgrupodecompras.Lasfuentestpicasde
estasdeterminacionesson:
1. Lacduladeproduccin,lacual,debidoaquecontemplalasnecesidadesdematerialesidentificalos
requerimientos especficos en trminos de partidas individuales de productos, especificaciones y
condicionesdeentrega.
2. Un sistema de inventarios con niveles predeterminados de existencia de cada producto, el cual
generaautomticamenterdenesderequisicinporcadapartidaindividualcuandollegaasunivel
mnimodeexistencia.
3. Proyectos especiales para cada inversin de capital que incluya requerimientos de materiales y
servicios.

77
4. Otras necesidades operacionales que pueden ser evaluadas en alguna forma y transformadas en
requerimientosdecompras.
Encualquieradeestassituacionessurgendudas,lascualesdebenserconsideradasdemaneraindividual.La
primeradeellasessitienevalidezgeneralciertotipodenecesidadsubyacenteestoincluyetantoelpropsito
por el cual las partidas individuales van a ser usadas, como la solidez del procedimiento por el cual las
necesidadesbsicassetransformanenrequerimientosdefinitivos,ejemplodelocualpuedeserlanecesidad
deunapartidadeterminadaparaexistenciaenelalmacnylaclasedefrmuladedecisinaplicadaparala
determinacindelosrequerimientosdeexistencias.
Ensegundolugardebehaberunamplioanlisisparacomprobarsielsistemadiseadooperaconeficaciay
finalmente,estlacuestindeconocersilanecesidaddeterminadaesadecuadamentetransmitidaalgrupode
comprasenlaformaderequisicinautorizadaoporotradocumentacinvaledera.
Responsabilidadesparaladeterminacindenecesidades.Laformaenquelasnecesidadessondeterminadas
normalmente es responsabilidad de otro personal de la organizacin. Debido a que estas determinaciones
inicianelprocesodecompras,elgrupoencargadodestasnohacemsqueajustarseaellas.Eldepartamento
decomprascontinuamenteestenbuenaposicinparasaberquesloquesucede conelmtodoopoltica
para determinar las necesidades, adems de estar calificado para opinar sobre el suministro de normal de
requerimientos.Elpapeldelafuncindecomprasseextiende,adems,hacialadeterminacindenecesidades
pordiferentescaminos.Elgrupodeadquisiciones,debidoalanaturalezadesusnecesidades,estencontacto
con las condiciones de mercado y preparado para evaluar nuevos desarrollos y tendencias para as evitar
escasezoexcesodeinventarios.Adems,elcomprador,enlo individual,estntimamenterelacionadoconla
situacindelosdiferentesproveedores,especialmenteconlosmsimportantes.
Lo anterior significa que el departamento de compras debe estar dispuesto a hacer una importante
contribucinalaconsejaraotropersonaldelaorganizacinrespectoalosnuevoscambiosydesarrollospara
que stos puedan ser asimilados con oportunidad en condiciones normales. Por tanto, tiene una parte de
responsabilidadenladeterminacindenecesidadesydebeproporcionarsu ayudatantocomoseaposible.
Procedimiento para la determinacin de necesidades. Una vez determinadas las necesidades, deben ser
vaciadas en un formato especial que por lo general es formulario de requisicin u otro similar que debe
especificarlasnecesidadesconsuscaractersticaspertinentes,aprobacionesycualquierotrainformacinque
contribuya a los propsitos de control de organizacin. Dentro de lo posible, debe llegarse a la
estandarizacindecompradeartculoscuyascaractersticasaslopermitan.Debidoaqueunapartesustancial
deesteprocedimientopuedeconvertirseenrutinaenciertotipodesituaciones,puedeexistirdudaencuanto
aseldocumentodeentradaoformatoeseladecuadoparaesteprocesorutinariopngaseelcasodellamadas
requisiciones viajeras que se emplean en situaciones repetitivas para minimizar el exceso de errores
numricosyhumanos.Enestetipodeprocedimientossedebetenermuyencuentalosiguiente:

1. Propiedaddelasaprobaciones.
2. Completartodala informacinqueserequiere.
3. Confiabilidaddelaspectonumrico.

78
Autor izacindelacompr a.
En algunos casos la determinacin de la necesidad es, al mismo tiempo, la autorizacin de la compra. Sin
embargo, no siempre es as, en virtud de que la autorizacin de compra involucra a ciertas cuestiones
adicionalesquegeneralmentenosonresponsabilidadfinaldelaspersonasquedeterminanlanecesidad.Estas
cuestionestpicasson:
1. No est disponible en la organizacin el artculo a comprar? El departamento de compras debe
saber,concerteza,sielartculoqueserequierecomprarnoseencuentradisponibleenalgnlugarde
la organizacin es ms, enalgunos casos es indispensable hacer unainvestigacin especfica para
desecharestaposibilidad.
2. Es factible fabricar el artculo en vez de comprarlo? sta es una cuestin que en ocasiones est
sujeta a una importante decisin. Las condiciones cambiantes tales como el incremento de
dificultades para procurar, el incremento de volumen o de costos pueden despertar el inters de
evaluarcualquieralternativaatravsdeestudiosmsdetallados,losquesepuedenrealizarconlos
recursos tcnicos de la organizacin o por medio de asesora ambas posibilidades deben ser
contempladasyresueltasporelgrupodecompras.
3. Puedeefectuarselacompra? Nuevascondicionespuedensurgirylaspartidasrequeridaspuedenno
habersidocompradas,ysilashayenelmercadonosatisfacenlosrequerimientosdelaorganizacin.
Enestoscasossedebenrealizaranlisisadicionalesconlosclientesdelaorganizacin.
4. Sonlosrequerimientosdeacordesconelpresupuesto? Sinosehaconsideradoestaetapa,deben
adoptarse las medidas necesarias para someter a control presupuestal especial aquellos tipos de
comprasquesonindispensables,noobstantequeexcedanalpresupuesto.
5. Existen problemas financieros? Desde el momento en que se establece la compra se contrae un
compromisofinanciero.
Unsegundotipodedificultadestrepresentadoporlafaltademotivacinparareducircostosencomparacin
con el precio fijo contratado. El tercer problema se presenta cuando se pretende determinar el factor de
utilidad, especialmente para evitarque el porcentaje de utilidad se incrementa paralelamente el aumento de
costos.Detodoloanteriorsepuedeconcluirquesedebeevitarloscontratosdepreciosfijossinembargo,no
existe otra opcin, los mismos se deben manejar con un cuidado extremo. En estos casos, el personal de
finanzas puede ser de gran ayuda para definir estos costos susceptibles de ser reembolsados. Por ltimo,
resultadeespecialrelevanciamonitoreareltrabajoaefectuaryloscostosrelativosenestetipodecontratos.
Procedimientos para efectuar la compra. El procedimiento para manejar esta fase de la transaccin de
comprapuedevariar,peroenunasituacintpicaincluyelosiguiente:

1. Obtenerlaautorizacindecomprayasignarlaaunmiembrodelgrupodeadquisicionesusualmente
llamadocomprador,locualdependedeltamaodelacomprapropuestaydeltipodecompra.Enla
prcticaesnormallaespecializacindeloscompradores,caractersticacondicionadaporelvolumen
decomprasyoperacionesdelaorganizacin.

79
2. Los registros de proveedores normalmente deben contener referencias cruzadas con el tipo de
productosqueofrecenparapoderconsultarlasenelmomentoqueseanecesario.
3. Uncompradorresponsabledebeconsultarconsussuperioresyconelclientedelaorganizacinpara
aclararcualquierdudaquepuedasurgirconrespectoalaprocuracin.
4. Lascotizacionespuedensersolicitadaspormediodeunformatoestndar,auncuandosuelenhacerse
portelfono.
5. Las cotizaciones deben ser recibidas y concentradas en formas estndar, previa determinacin de
cul es la ms conveniente, con base en las razones que influyen en tal determinacin. Si la
recomendacin es hecha sin haber recurrido a la competencia deben adjuntarse los elementos que
fundamentandichadecisin.
6. Larecomendacindelcompradordebeserrevisadaporsusuperior,tantocomoseanecesario.
7. Elregistro de autorizaciones debe ser completado y cruzado con elnmero de orden de compra y
relacionadoenelregistroderdenesdeadquisicinemitidas.
8. Laordendecompradebeserenviadaalproveedor,lacualseledebeexigirquefirmeenpruebade
conocimientoyaceptacin.Luegodebeserdevueltaaldepartamentodecompras.
Laordendecompranormalmenteesundocumentoqueescontroladoporelnmerodefoliosepreparaen
una forma multicopia de tal manera que la informacin que contiene pueda ser seguida por otras reas
operativasdelaorganizacin,comoporejemplolosdepartamentosderecepcin,eldecuentasporpagare
incluso los clientes. Contiene los trminos en que est pactada la transaccin y las correspondientes
autorizaciones. Adems, normalmente incluyen garantas y condiciones para rechazo o reparacin de
mercancaquenosatisfacelasespecificacionespactadasylaindemnizacinpordaosocasionadosporuna
partedefectuosa.
Respectoaloscostosdetransporte,stospuedenserresponsabilidaddelproveedorodelcomprador,locual
incluye el medio de transporte. Por parte, tambin suele contener laruta a seguir, la que por lo general es
prerrogativadelcomprador.

Seguimiento.
Acontinuacineldepartamentodeadquisicionesdebevigilarquelosproductoscompradosseentreguende
acuerdoconlaordenrespectiva.Enmuchassituacioneslarelacinconotrasoperacionesdelaorganizacin
est sujeta a las condiciones de entrega, por lo que deben tomarsetodas las medidas que las circunstancias
requieran. Es aconsejable que el comprador o su representante visiten con frecuencia al proveedor con la
finalidad de vigilar el avance de su pedido, inclusive acompaados de un tcnico o especialista para que
califiqueelaspectocalidad.Estasinspeccionestienenporobjetoqueelcompradortomemedidaspreventivas
paraasegurarsedequesevaacumplirconloacordado.Tambinesnecesariovigilarqueelavanceoperativo
de la organizacin sea concordante con la poca de entrega del producto. Con estas medidas se est en
condiciones de tomar accin inmediata en caso de presentarse algn problema de retraso o cambio de
especificaciones.

80
Aspectosdeprocedimiento.Elalcancedelosprocedimientospuedevariardeacuerdoconlacomplejidadde
lascdulasdeentrega,ascomodelapocaenquestasedebehacerefectiva.Esrecomendableelusodeun
pizarrnouncuadroquesemantengaalavistadelosinteresadosparallevarunbuenseguimientoenespecial
aloreferenteafechas.Cadacomprador esresponsablede monitorearelavancedelasrdenesde compras
quemanejan.Ademsesmuytillaexpedicindereportesregulares.

Entr ega.
Asimismo,porseparado,debehaberunaactividadreferentealaentrega,laquesedebeencargardetodoslos
aspectosrelativosalarecepcindelamercancaylascondicionesdelamisma.Adems,enelcasodeciertos
productos,sehaceabsolutamenteindispensableefectuarunainspeccinparacerciorarsedequesus
Especificacionessonlasrequeridas,aligualqueelniveldecalidad.Msan,enciertoscasosespecialeses
menester efectuar algunas pruebas autorizadas por los ejecutivos de operacin responsables de aceptar el
producto.

En otros casos, pueden ser necesarios rechazar mercanca de la que se tenga duda hasta que la revise el
proveedor para as determinar si sta se debe aceptar o rechazar, o bien proceder a una reclamacin que
incluyaalacompaatransportadora.

Posteriormente se debe establecer un programa que vigile los aspectos de garanta. Y as, se tienen ya
establecidaslasbasesparaprocederaliquidarfinancieramentelaoperacin.

Aspectos de procedimiento. Los principales aspectos de procedimiento radican en que las actividades de
recepcineinspeccinsonorganizacionalmenteindependientesdelgrupodecomprasyquelosregistrosde
esasactividadessontransmitidosdirectamentealafuncindecuentasporpagar.Simultneamente,todoslos
registros de reclamaciones, cualquiera que fueran deben ser establecidos claramente y tambin sern
transmitidosalgrupodecuentasporpagar.Enloreferenteaotrotipoderecepciones,comoporejemploenla
recepcincontinuadeuntipoparticulardemanufactura,sedebedemostrarquelamercancafuerecibidaen
condicionesadecuadas.

Liquidacinfinancier a.
La liquidacin financiera debe efectuarse de forma separada por el departamento de cuentas por pagar. En
esta fase se realiza la revisin final pues se debe cotejar la orden de compra original con los datos de
recepcin,condicionadosobviamenteaposiblesdeduccionesoajustes.Luegosedebeobtenerlaaprobacin
final para su pago y procederse a su distribucin. Lanegociacin de los ajustes normalmente la efecta el
compradorafectado,peroenciertoscasosesnecesariopedirasesoramientoalpersonaldelreadefinanzas.
El principalinters en este punto es reconocer que la liquidacin financiera es el paso final del proceso de
adquisiciones,sobreelcualseledebemantenerinformado,tantocomoseanecesario,algrupodecompras,
peroquenodebequedarbajosucontrol.

81
4.2.2Otr osaspectosdeespecialinter s.

Larevisindelosprincipalespuntosdecontrolrequieresercomplementadaconciertosaspectosimportantes
sisepretendealcanzaruncontroleficazdelciclodecompras.
Situacin organizacional. El primer aspecto de importancia es relativo a la situacin organizacional de la
funcin de compras, pues el volumen e importancia de la mercanca comprada determinan qu es lo ms
importante de dicha funcin y su efecto en la citada posicin organizacional. En este punto es importante
determinar si el grupo de compras ha sido colocado adecuadamente en el nivel de organizacin que le
corresponde. En una situacin tpica es conveniente ubicar al jefe de departamento de adquisiciones en un
niveldevicepresidenciaquedeberestarrelacionadocontodosloselementosoperativosdelaorganizacin.
Enotroorden,eljefede comprasdebeserunapersonade altonivelcapazdelograrparasugrupounalto
grado de independencia y poder, y de establecer relaciones humanas eficaces con los dems miembros del
grupogerencial.Adems,lasresponsabilidadesdelgrupodecomprasnodebenincluiractividadescolaterales
comorecepcin,almacenesypagos.
Centralizacincontradescentralizacin.Unimportanteproblemaorganizacionalesdeterminarsilafuncin
de compras debe ser centralizada o, por el contrario puede ser delegada en niveles de operacin de
subsidiarias,divisionesuotroscentrosdeutilidadesquetengansuspropiasactividadesdecompras.Otro,es
precisarsielpersonaldecompraspuedeestarubicadoenniveles bajosperoque organizacionalmentedeba
responderenformadirectaalgrupocentraldecompras.Enunaltogradolarespuestadependedelaimagen
general que tenga la organizacin con respecto a la descentralizacin. Si se trata de una organizacin
centralista,lgicamentelascomprastendrnestecarcter,perosiestfuertementeorientadahacialoscentros
deutilidadesesdeesperarquecuentecongruposdecomprasautnomosencadaunodesuscentros.Enestos
casos,puedesermuysaludableestablecerungrupocentralizadodecomprasquedesarrolleyapliqueciertas
polticasparacontrolarestasactividades,ademsdeuncentrodedesarrolloqueseenfoqueendeterminadas
especialidades y experiencias. Tambin en muchas situaciones existe la necesidad de contar con una
coordinacinocontrolcentralsobreciertotipodeprocuracionesbsicasparalaorganizacin.Enelcasode
que existan grupos locales de compras, es preferible que se utilice un sistema de reporte de lneahacia su
respectivogerentelocaly,enunsentidofuncionalhaciaelgrupocentraldecompras.Loimportanteeneste
casoesquelasresponsabilidadeshacialosdosnivelesde supervisindebenquedar claramentedefinidas y
establecidas.Siesteobjetivoselogra,esposiblequelasoperacionestotalesdecompraquehagalacompaa
seanefectivasyquecubranrazonablementelasnecesidadestantodeloscomponentesoperacionalescomode
lacorporacinensuconjunto.Elloimplicaqueelgrupocentraldecomprasdebeejercerunadecuadocontrol
sobre cada una de sus unidades de campo, parte del cual consiste en fortalecer da a da las relaciones
operativas,lasquedebensercomplementadasconlarevisindereportesyvisitasperidicasdecampo.
Jurisdiccin de compras. Otro tipo de problema organizacional es el que surge cuando se debe definir y
administrar la jurisdiccin delgrupo de compras. Esteproblema se presenta en grannmero de situaciones
perotalvezlamscomnesladedeterminarqutipodecompradebecanalizarseatravsdeldepartamento
de compras. En algunos casos la conclusin puede ser que sea ms eficiente para cierto grupo operativo

82
satisfacer determinado tipo de necesidades recurriendo a su propio esfuerzo y recursos, de lo cual el
departamento de personal puede ser un caso ilustrativo, mientras que otro ejemplo es el departamento de
publicidad, que obtiene sus espacios publicitarios a travs de unaagencia. Para llegar a una determinacin
oficial de la jurisdiccin, lo fundamental es saber si el grupo de compras puede hacer una contribucin
emanadadesuactualexperienciaenunreadeprocuracindada,oporquedesuenfoqueprofesionalpara
comprarsepuedaesperarqueaportebeneficiosespeciales..

Otroproblemasepresentacuando,noobstantequeladeterminacinseaclaraysuficiente,sepresentancasos
de evasin. Un tipo frecuente de evasin se concreta cuando el usuario puentea al grupo de compras y
efecta investigaciones sobre algn satisfactor y slo acude a dicho grupo para legitimizar su intervencin
como mero formalismo. En estos casos se desestima la posibilidad de contribucin del grupo regular de
compras. La solucin a este problema es que el departamento de compras rechace esta invasin a sus
funciones y devuelva la requisicin, ya que este documento es el instrumento oficial para obtener
autorizacionesyprocederaltrmitedepagoeneldepartamentodecuentasporpagar.4

4.3ELCICLODEPRODUCCIN.

4.3.1Natur aleza.

Eltrminoproduccin,esaplicadoatodasituacindondelosmaterialessoncombinadosomodificadosde
una manera significativa por el personal de una organizacin a travs del uso de diversas instalaciones y
equipo.Esteenfoquedeprocesoproductivo esaplicadotambinalosprocesosdemanufactura.Elciclode
produccincubreunampliorangodesituaciones.Porejemplo,unaorganizacinqueelaboradiversasclases
demanufacturayungrannmerodetiposdeproductosyserviciosdiferentes,deunaideadelamagnituddel
problemayladificultadparapodergeneralizarsobreestetema.Todoloanteriorsesumaalascaractersticas
comn de la materia prima y mano de obra debido al uso de las instalaciones y el equipo. Cuando se
combinantodosestoselementos,elresultadosonproductosqueestarnlistosparasuinternoyparalaventa
alexterior.Laadministracindeestesectoresidentificadacomoelreaogerenciasdeproduccin.

4.3.2Impor tancia.

Laimportanciadelciclodeproduccinvaradeacuerdoconcadaorganizacinenalgunoscasos,comoenel
delascadenasdetiendasdepartamentales,puedesercompletamenteinsignificante,peroentreotros,comoen
el de la manufactura de un automvil o de un producto metlico, las operaciones son muy importantes en
relacinconcostosincurridosylnmerodepersonasinvolucradas.Paralelamenteensugranmayora,estas

4
SANTILLAN,GonzlezJuanRamnIntroduccinalControlInternoatravsdelosciclosde
Transacciones ,EditorialEcafsa.
83
situaciones se complican debido alrango y tipo de actividades que concurren ya que existen, por ejemplo,
actividadesenfocadasenlaobtencinyprocesamientosdemateriales,otrasenlasinstalacionesyequipoque
serutilizado,otrasmasalentretenimientodepersonal,etc.

Desdeelpuntodevistaoperacionalsepresentanmovimientosdemateriales,usodemaquinas,supervisinde
personal, coordinacin de diversas subactividades, necesidad de realizar inspecciones y finalmente, el
empaqueytransferenciadelosproductoselaborados.Yadems,existenproblemasdecoordinacinconotras
importantes actividades de la organizacin, por ejemplo compras, finanzas, personal y mercadotecnia en
funcinaquetodaslasactividadesdeunaentidaddebenserintegradasparaaspiraralarentabilidadtotal.En
conclusin,elciclodeproduccinesvitalparalaadministracincomounapartedelproblemadirectivototal
de una organizacin. Introducirse en estarea es particularmente interesante debido a la grannecesidad de
contarconcontroleseficacessobretodaslasoperacionesdeproduccin.

Elciclodepr oduccin.
Paraserfrentealosdiferentestiposdesituacionesdeproduccin,nosoloentrediferentesorganizacionessino
tambin en una de ellas, se puede identificar un patrn cclico con etapas definidas, las cuales pueden ser
ordenadasdelasiguientemanera:
1. Determinacindelademandadeproductosquepuedengenerarlosprocesosdefabricacin.Estoes,
quesevaaproducirycuando.
2. Planificarquesedebehacerparafabricarlosproductosespecificados.
3. Procurarselosinsumosnecesariosparallevaracabolasactividadesproductivasplaneadas.
4. Recibir,instalaryprobarlosequiposconloscualessellevarnacabolosprocesosproductivos.
5. Procesarlosproductosplaneados.
6. Finalmente,transferirlosproductoselaboradoshacialosusuariosinternosoparaleventadeclientes.
A continuacin se expondr con mayor detalle la naturaleza de estas etapas individuales, otorgndosele
especial importancia al problema de controladems, se cubrirn aspectos complementarios del proceso de
produccinquesecruzanenelciclototalyque,consecuentemente,requierenconsideracionesespeciales.
Determinacin de necesidades de productos. El punto de partida de la actividad de produccin consiste en
determinarlosproductosquedebenserfabricadosycuandoesellonecesario.Estadeterminacinqueincluye
las especificaciones de esos productos y sus cantidades, es una responsabilidad de la administracin que
involucralaevaluacinsimultaneadungrannumerodefactores,entreellostodosloscostosylosintereses
enjuego,locualincluyelosdelpersonalydelosgruposoperativos.
Culeseltamaodelmercado?Cmosevanavenderlosproductos?Qupreciosevanaencargar?Cul
vaaserelcostoelafabricacindelosproductos?Quproblemasdeprocuracinsepresentaran?Quotras
actividadesdesoporteserequieren?
Desdeunpuntodevistaamplioytalveztradicional,laactividaddeproduccinempiezadespusdequeha
concluidoladeterminacindenecesidades.Estoesesencialparaeltipodeproduccinquesevaaponeren
prcticaperonoeselenfoquequedebeutilizarunaadministracinmoderna.Elgrupodeproduccindebe

84
ser una parte integrante de la determinacin de las necesidades. Desde este punto de vista el papel de este
grupoincluye,cuandomenos, losiguiente:
1. Acordarconelgrupodedecisinlafabricacindelosproductosdeseadosentrminosdetiempoy
costodeigualmanera,evaluartodaslasalternativasposibles.
2. Conobjetodepresentarnuevasopcionesdelaorganizacin,sedeberecabarinformacinrespectoa
lasnuevastcnicasquepuedenincrementarlacapacidadoreducircostos.
3. Realizarlosestudioseinvestigacionesdeingenieraenelreadeinstalaciones,procesosydiseode
productosconelobjetodeincrementarlacapacidaddeproduccinoreducircostos.
Lasustanciadeestainterrelacinesqueelgrupodeproduccines,ensimismo,unfactordeinfluenciapara
determinarlasnecesidadesdeproductosquesefabrican.Laprimeracuestinimportantedecontrolesqueel
grupodeproduccindebeaportarlomejordesiduranteleprocesodedeterminacinlasnecesidadesdetal
maneraquestasbeneficienlosinteresesdelaorganizacin.
Planeacindelaproduccinactual. Entantoquelaparticipacindeladeterminacin denecesidades,
es el inicio al proceso de planeacin, la determinacin denecesidades actuales es la base de un
definitivoesfuerzodeplaneacinquedebetomarencuentalassiguientesconsideraciones:

1. Evaluarlacapacidaddela plantaparafabricarlosproductosquesedesean,enelvolumen
necesarioydentrodelosperiodosespecificados.
2. Determinarcomosepuedeemplearlacapacidaddeplantaatravsdeunusomsintensivodel
equipo,equipoadicional,personalextra,tiempoextra,compensaciones,etc.conlasrespectivas
consideracionessobrecostos,tiempoycalidaddeproducto.
3. Construiroadquirirnuevasinstalaciones,consusrelativosfactoresdetiempoycostosenque
lasnuevascapacidadescomiencenafuncionar.
4. Determinarlascaractersticasdelosprocesosdemanufacturaquesernpuestosenpractica,en
relacinconlasopcionesquepermitenlasespecificacionesdelproducto
5. Determinar las necesidades de maquinaria, herramientas y otros equipo programar como
satisfacernestasnecesidades.
6. Determinarlaslocalidadesadecuadasparaalojarelequipo ylosserviciosdesoporte,va
efectodeaseguraruneficienteflujodelaproduccin conbaseenelprocesoplaneado,las
instalacionesyelequipo
7. Determinarlasfuerzasdetrabajoquesenecesitaucontratacinyentrenamiento.
8. Determinar las necesidades de material en coordinacin con el departamento de compras
teniendoencuentadisponibilidadesyeltiempo.
9. Asegurar los servicios de soporte, como por ejemplo calefaccin, refrigeracin, agua y
electricidad.
En esta etapala cuestin esencial de control es el adecuado desarrollo de los planes para cubrir los
aspectosrelativosacadaproductooproductosquesenecesitan.Estasaccionesdesoporteseiniciany
los procedimientos se establecen donde el avance de tales planes puedan ser satisfactoriamente

85
monitoreados. Esta ultima accin es especialmente es en las reas de ingeniera y desarrollo o
requerimientosdeprocurarpartesofasesque,asuvez,sonrequisitosindispensablesparaotrasfases y
queconcatenadamentepuedanserconcluidosenunperiodo determinado.
Procuracin de necesidades de entrada. Una vez que las necesidades iniciales o de entrada han sido
adecuadamente identificadas,la siguiente etapa consiste en procurarlaaccin de lanecesidad misma.En
virtuddequeelgrupodeproduccinnoesresponsabledirectodelaprocuracin,esimportanteque
losotrosgruposquetienenasucargoestasactividadeslasdesarrollenenelmarcodeunaadecuada
coordinacin.Enestecaso,losgruposafectadossoneldepartamentodecomprasporlaprocuracinde
materiales y equipo, el de construccin por cualquier otra instalacin, el cuerpo de ingeniera por los
propiosserviciosespecializados,eldepartamentodealmacnporladisponibilidaddematerialesyelde
personalporelreclutamientoyelentrenamientodelafuerzadetrabajonecesario.
La coordinacin puede incluir los contactos preliminares durante la etapa de la planeacin la
transmisinderequerimientosdefinitivosylarelacincontinuaparasolucionarposiblesproblemasque
puedan surgir durante la actual procuracin.Elinters,desde el punto de vista del control,radica en
llevaracabolasactividadesantesmencionadasdeuna maneraordenadayeficiente.
Recepcin,instalacinyprueba.Lasprocuracionessehanconcretadoyfluyenahorahaciaelgrupode
produccin.Laspartidaspuedenlegardirectamentedelosproveedores,delosalmacenesodecualquier
otra fuente interna de abastecimiento. Estas partidas deben ser adecuadamente inspeccionadas para
determinarsisatisfacenlosdiseosencuantoacantidadyespecificaciones.Enloscasaosquese
requieraninstalacionesespeciales,comoporejemploherramientasyequipo,debenlevarseacaboacciones
complementariasadems,esteequipodebeserprobadoparadeterminarsieselsolicitado.
Enestaetapalosproblemaspuedenvariarengranmedida,deacuerdoconlacomplejidaddelprocesode
produccinosubproduccinparticular.Conmuchafrecuenciaenestafasesedetectanerrorescrticoso
problemas operativos imprevistos que dan oportunidad para una adecuada atencin del caso. En otras
situaciones el problema puede ser el desarrollo de habilidades especiales para elaborar productos de
calidad.Elpuntodecontrolenestaetapaesllevaracaboestasimportantesactividadespreparatoriasde
unamaneracompletayeficiente,puescualquierfallapuedeprovocarcostosexcesivosyseriosretrasos.
Produccin actual. Cuando la procuracin para cubrir las necesidades de entrada de materiales,
instalaciones, equipo, personal y servicio de soporte a quedado concluida, la siguienteetapa tiene por
objetivoapoyarlasactividadesdelaproduccinactual.Estasactividadessonloltimoarealizarenel
periododeplaneaciny,dehecho,enmuchoscasosseentrelazanamedidaqueavanzaelprograma
total de produccin. Estas operaciones involucran un gran nmero de subactividades y funciones
especializadas,talescomo:
1. Manejoyusoeficientedemateriales.
2. Administracinyutilizacineficientedelamanodeobra.
3. Empleoycontroldeserviciosdesoporte.
4. Programacinycontroldelasactividadesindividualesdeproduccin.
5. Inspeccinyactividadesdecontroldecalidadencadaunadelasdiferentesetapas.

86
6. Mantenimientodeplantayequipo.
7. Controldelasactividadesdeproduccinconbaseennivelesdeejecucinfsica.
8. Adecuadocontroldeloscostos.
9. Relacincontinuaconotrasactividadesdelaorganizacinqueproporcionansuministros.
10. Coordinacinconelusuariofinaldelproductoparaavancesydesarrollosespeciales.

Estas diversas actividades continuamente se superponen e interrelacionan en muchos aspectos. Sin


embargo la combinacin de ellas en el proceso aplicable a los suministros dan como resultado un
productodelaformayeltiempodeseadoporlosusuarios.
Producto final. Una vez concluido el proceso productivo, el producto esta listo para ser transferido
directamente alos vendedores, al departamento de almacenes a hacia un rea operacionalajena al
grupo de produccin este producto puede estar listo para la venta al consumidor, puede ser un
componenteparaserincorporadoa otroproducto msgrandeociertotipodematerialqueser
utilizado en otros a procesos operativos externos a la organizacin el producto tambin puede ser
utilizadaenlamismaorganizacin,comoporejemploenergaelctricaproducidaporellamisma.La
lneatcnicadivisoriaquesealadondefinalizaelprocesodeproduccinnosiempreesclaraperopara
lospropsitosdeestaobraestapresentadaporeldiseoorganizacionaldeldepartamentodeproduccin.
Unavezconcluidalaproduccin,lamismaestadisponibleparaunainspeccinfinalysutransferenciaa
quienesseharncargodesucustodia.nuevamentesepresentalanecesidadderealizaruncuidadoso
controlfsicoconrazonableprontitud,locualincluyelaveracidaddelosconteos,pesoyotrasmedidas
aplicablesparaefectosdetransferenciascontablesascomolarecoleccindedocumentacinfuente
debidamente aprobada para su correspondiente contabilizacin y registro. Desde el punto de vista del
control, es fundamental que todas estas actividades se realicen de acuerdo con los estndares diseados
paracadasituacin.

Planeacinycontr oldelapr oduccin.


La planeacin y control de la produccin se inicia con la planeacin bsica y cubre primero la citada
planeacin de la produccin actual, tanto como sea necesario luego la y transmisin de instrucciones al
personaldeproduccinyporltimo,elmonitoreodelasactividadesproductivas.Entotal,esunaactividad
defacilitacinquetienecomoobjetivoincrementarlosnivelesdeeficienciayprogramarelflujodetrabajode
losproductosterminados.Laformaqueseallevadaacaboestafuncindependedirectamentedelaclasede
productos que se van a fabricar y de la forma en que se organicen las actividades de produccin. En una
situacinsepuedepresentarciertaclasedelotesdeproduccinytodaslasactividadesdeprocesoscontinuos
oensambles.Encualquiercaso,elciclodelasoperacionespuedesercortoolargo.
Planeacindelaproduccin.Sepuededecirquelaplaneacindelaproduccinempiezaconladeterminacin
delprograma,puedeserdiario,semanal,mensualotrimestral,segneltipoeproducto.Ladeterminacinde
estos programasnormalmenteinvolucrala participacin de muchas divisiones dela organizacin como por
ejemplomarketing,compras,almacenes,personalyfinanzas.Elpersonaldeproduccin,porsupuesto,esta

87
fuertemente involucrado y en la mayora de los casos su participacin es a nivel de alta administracin,
especialmente para resolver las presiones de los diferentes grupos interesados. Para concretar esta
determinacin, ala cualagrega el grupo de planeacin y control de la produccin, es fundamental calcular
correctamentelascantidades y eltiempodeadquisicindelosdiferentesinsumosqueserequieren,locual
implica el uso de material disponible, las partidas a procurar, las horas o cargas de produccin a incurrir,
cuantificacindetiempoextra,nuevasadquisicionesylosserviciosdesoporte.
Enalgunoscasostambinunadeterminacinsefijaconbaseenlamaquinaradisponibleylasnecesidadesde
otroequipoenestepuntosedebenconsiderarlosahorrosquegeneranlareduccindecostosocasionadospor
grandesvolmenesdeproduccinelaboradosporunamismamquina.Enresumeneltrabajodeplaneacin
delaproduccinconsisteenidentificartodaslasnecesidadesdeentradayatenderlasentodoloposiblecon
objetodeincrementarlaeficienciaentrminosdecostosytiempo.
Control de produccin. En esta fase es necesario que se emitan instrucciones especficas a todas las partes
interesadas para que sepan que e lo que van a hacer, lo cual se realizar por medio de diversos tipos de
documentos y elementos de comunicacin o, cuando es posible, a travs de sistemas computarizados. El
gradodedetalledependedelacomplejidaddelaclaseparticulardeproducciny,obviamente,delgradode
descentralizacin. Sin embargo, siempre se debe proporcionar las bases paralos siguientes controles de las
operaciones. Ahora bien, este control se puede lograr los diversos medios, sin olvidar que su objetivo es
recolectarinformacinsobrelavancey situacinactualdelasactividadesdeproduccindetalmaneraque
losclientespuedanserasesorados,tantocomoseanecesario, yquelasactividadesoperativasquemuestren
retrasosconrespectoalcronogramadeproduccinpuedanserrpidamentedetectadasyatendidas.
En algunos casos el control principal se puede ejercer a travs de rdenes de trabajo o instrucciones que
acompaanaltrabajoindividualyenlasquesonregistradaslasdiferentesoperacionesconcluidas.Enotros
casos el control se puede realizar por medio de registros que se elaboran y conservan en las reas de
supervisin.
Adems,suelenexistirciertostiposcomplejosdecontrolenunaoficinacentral.Elconjuntodelosresultados
alcanzados reflejar lo adecuado del diseo bsico del sistema y la acuciosidad y atencin con que este se
mantenga. Asmismo, estrelacionado con todos los aspectos generales de control operativo que se ejerce
sobrelasactividadesdeproduccin.

Elinters,desdeelpuntodevistadelcontrol,radicaenqueeldiseodedichosistemaestrazonable
conformado de acuerdo con la situacin productiva existente, y que sea eficientemente operado. Con
frecuenciasepresentantendenciasaelevarelniveldecomplejidaddeestossistemas,locualgeneraun
innecesarioyexcesivoesfuerzooperacional.Losproblemasdemantenerlossistemasysolucionarerrores
actualesporlogeneralsonunbueninicioparadetectardeficienciasdesistema.

Contr oloper acional.


Unavezquesehanconsideradolasfuncionesdeplaneacinycontrol,seestencondicionesdeabordar
losproblemasderivadosdelasoperacionesproductivas.Elintersenestecamporadicaenexaminarlos

88
aspectosprincipalesdelasoperacionesactuales,yentendercmosepuedencontrolarmejorparaalcanzar
mejoresresultadosdeproduccin.Estosaspectosoperativosserefierenalautilizacindematerial,el
empleodelamanodeobra,elusodeserviciosdesoporteeficacesyunadecuadocontroldecostos,
elementos que deben de ser considerados de manera integral para su administracin y control.
Utilizacin dematerial.Enlamayoradelassituacionesproductivassegeneraunsignificativoconsumo
demateriales,apesardequeobviamente,puedenexistirgrandesvariantessegncadacaso.Sinembargo,
siemprelamateria,losmaterialesprocesadosoloscomponentesdecualquiertipojueganunpapelmuy
importanteyaqueelobjetivoprincipaldelaentidadesmaximizarsuempleoalmenorcostoposible.
Estosobjetivossepuedenlogrardediversasformas,asaber:

1. Insistirquelosmaterialesqueserecibensatisfaganlasespecificacionesycalidadesrequeridas.
Encasodedetectarsevariantesodesviacionesslosepuedenaceptarconlaaprobacinde
losaltosnivelesadministrativos,conbaseenlasnecesidadesyobjetivosdelaorganizacin.
2. Requerirlosmaterialesencantidadesapropiadasquepermitenunusomseficiente.
3. Llevar un control adecuado de los materiales despus de ser entregados a las reas
productivas:esdecir,cuidarsucomposicinoriginalhastaqueseanutilizados.
4. Procesarcuidadosamentelosmaterialesparaminimizarerroresodeterioros.
5. Cuandolamezcladematerialespermitaciertaflexibilidad,cuidarquelamismaserealicecon
basealabsquedadeahorroscombinandocadaelementoconsupreciocorrespondiente.
6. Establecerunadecuadosistemadereportedeempleodematerialesbasado,hastadondesea
posible,enestndarespreestablecidos.
7. Establecer un eficaz sistema de reporte de material de desecho y deteriorado, basado en
estndarespreestablecidos.
Elobjetivo,desdeelpuntodevistadelcontrol,consisteenevaluarlaformaenquesedeterminolas
necesidadesdematerial,cmosemanejadespusdehabersidorecibido,cmosesoportanlasprdidas
porelconceptodedeterioros,desperdicios,etc.

Utilizacindelamanodeobra.Enestecaso,laproporcindelcostodeproduccintambinpuedevariar
debidoalamanodeobra,lacualnormalmenteesunfactordeprimordialimportancia.Denuevacuenta,el
objetivoconsisteenalcanzarelmximobeneficioalmenorcostoposible,sobrelabasedelnegocioen
marcha.Elempleoeficientedemanodeobraesparticularmentecomplejodebidoalhechodequesetrata
deunfactorhumano.Msan,lacomplejidadseacentadebidoaquetodaslasaccionesrelativasala
manodeobratienensignificativasconsecuenciasalargoplazo yconfrecuenciaesmuydifcilestimarsu
efectoentodassusdimensiones.Elempleodemanodeobrapuedeincluir:

1. Elcuidadoconelqueseplaneenlasnecesidadesdemanodeobraacordesconlosprogramasde
produccin.

89
2. Elreclutamientooportunodepersonalysucorrespondienteentrenamientoparahacerfrentea
losrequerimientosdeasignacionesespecficas.
3. Lacomodidaddelascondicionesdetrabajoeinstalacionesparaempleados.
4. Distribucindetrabajoenlaformamsradicalposible.
5. Calificarmritosmediantelacomparacindelosresultadosconlosobjetivos.
6. adecuadasupervisincombinandocompetenciaparatrabajarconadecuadasrelacionespersonales.
7. Compararesultadosdetrabajoconestndaresoportunayadecuadamentedeterminados.
8. Transferenciasordenadasycontroladasentreprocesosproductivos.
Los aspectos de control en los centros de uso de mano de obra en relacin con los requerimientos de la
mismaestndefinidosporlaeficaciaconquesonadministrados.Enlamayora deloscasos,elaspecto
tcnicohasidopreviamentedeterminadoatravsdecuidadososestudiosdeingenieraysuutilizacin
puedeserevaluadadeunamanerarazonablesatisfactoria.Tambinenmuchasocasiones,yenlos
principalesprocesos,existeladudadsobreculeselniveldeeficienciadelasrelacioneshumanas.
Serviciodesoporte.Enunasituacinnormaldeproduccindebehaberunimportantegrupodeservicios
de soporte relacionado con el costo y su contribucin entre los resultados finales de produccin. El
objetivo en esta actividad consiste en lograr los resultados deseados de la manera ms eficiente y al
menorcostoposible.
Lasreastpicasdeintersincluyen:

1. En el caso de suministros de importancia para manufactura, son aplicables las mismas


indicacionesqueparalosmateriales.
2. Elusoprudentedeenerga.
3. Adecuadailuminacinparlacorrectaejecucindeoperacionesproductivasindividuales.
4. Competenciadelpersonalquemanejamateriales.
5. Instalacionesadecuadasparacomedordepersonal.
6. Baos,serviciossanitarios,lockers,etc.,cmodosehiginicos.
7. Eficientemantenimientodelaplanta.
Costosycontroldecostos.Apesardequeenprimerainstanciaelcontroldebeserejercido,tantocomo
seaposible ypractico,sobreunabasecuantitativao fsica,enalgunasetapasserealizaatravsdelos
costos.Enunltimoanlisis,tambinsepuedeevaluarlaactividadtotaldeproduccinsobrelabasedel
culeselcostodeproducirartculoscondeterminadasespecificacionesycalidades.Loscostossirvenpara
ungrannmerodepropsitos ypuedenserdesarrolladosacordeconcadaunodeellos.Paraefectosde
tratamiento de este tema, el enfoque se concentrar enlos costos de los controles operacionales y en
funcinaestepropsito,seorientarhaciaelcumplimientodeciertoscriterios,asaber:
1. Unaclaraidentificacindeloscostosycomoseincurreporejemploelcostodelafuerzamotrizyla
fuerzaqueseempleaencadaactividad.
2. Fijar la responsabilidad de costos sobre la base del control que se ejerce igual que en el ejemplo
anterior,elempleodelafuerzamotrizdeterminaelcostoyquienesel responsabledelmismo.

90
3. Elagrupamientodecostosdebeestarracionalmenterelacionadoconlaejecucinoperativa.Como
eselcasodeloscentrosdecostos.
4. Laimplantacindeestndaresadecuadosy/uotrosobjetivosqueinvolucradocostos.
5. Realizaroportunosreportesderecursoscomparadoscomolosestndares.
6. Anlisisdevariacionessobrelabasedeaccincorrectivaoportuna.
7. Examencuidadosodeloscostosindividualesparadeterminarsugradodevariabilidadendiferentes
condicionesoperativas.
8. Basesequitativasparaelprorrateodeloscostosindirectos.

Casisiempreexistenalgunoscompromisosque estnrelacionadosconlos criteriosarribamencionados.En


talessituacionessedebeaserunesfuerzo,enprimerlugarparallevarestoscompromisosaunniveldondeno
pueden reducir de manera significativa el esfuerzo total de control en segundo, se debe hacer el mximo
esfuerzoparaprorratearloscostosindirectossobreunabaserazonable.

En algunos casos tambin se puede utilizar precios de mercado pararealizar transferencias internas, con la
cual se obtienen mejores medios para efectuar tanto el suministro de materiales como la actividad de
recepcin. De esta manera los precios de mercado deben ser utilizados para controlar el costo de la fuerza
motriz y su correspondiente prorrateo. Un problema que existe continuamente es que el alcance de
alojamiento de costos implica complicados prorrateos que suenan interesantes para el contador, pero que
tienenmuypocoonulovalordesdeelpuntodevistadecontroldelasactividadesproductivasindividuales.
Portanto,elpuntodeatencinesasegurarsedelaracionabilidaddecadaenfoque.

Reporteyanlisisdelcomportamientodeloscostos.Unavezquesehaimplantadoelplanparaidentificary
medir los costos, la eficiencia del control de los mismos es en gran parte determinada por los reportes
subsecuentesyporlarevisindeloscomportamientosdeloscostos.Losaspectosmsimportantesincluyen:
1. Rapidezyseguridadenlapreparacindereportes.
2. Frecuenciadelosreportesyunacoberturadetalladadestinadaalniveldirectivoquetieneasucargo
laresponsabilidadycontroldirectodeloscostos.
3. Reportesconsolidadosquecubrangrandesperiodosyqueestnorientadoshacialosaltosnivelesde
responsabilidadgerencial.
4. Oportuna revisin de desviaciones significativas e investigacin de las causas de las mismas por
mediodelanlisisdirectoconlossubordinadosresponsables.
5. Minuciosa evaluacin de las causas que originan un pobre comportamiento de los costos, e
implantacindeprogramasyaccioneseficacesparaenfrentarlas.4

4
SANTILLAN,GonzlezJuanRamnIntroduccinalControlInternoatravsdelosciclosde
Transacciones ,EditorialEcafsa.
91
4.4CICLODEINVENTARIOS.

4.4.1Natur aleza.

Losmaterialesrecibidospuedenserenviadosdirectamentehacialosprocesosproductivos oconvertirseen
parte de un inventario de espera debe ser utilizados. Estos inventarios son comnmente conocidos como
almacenes. Los materiales, que pueden sermaterias primas,refacciones, partes, subensambles, etc., quedan
para su utilizacin posterior en alguna fase del proceso de manufactura, mantenimiento de alguna otra
actividadoperacionaloparasuventanaalconsumidor.
Deigualmanera,losinventariospuedenprovenirdealgnproveedor,encuyocasosoncaptadosatravsdel
departamento de recepcin o ser resultado de los procesos de manufactura de la organizacin. La
caractersticacomnesquepasaranunperiododeesperaantesdequeseanrequeridosparaalgnuso,porlo
cual, debe ser conservados en, los almacenes durante ese lapso. Las actividades en los almacenes estn
relacionadasconungrannmerodeoperacionestalescomorecepcin,inspeccin,mantenimiento,yventas.
La funcin de esta actividad es mantener los materiales correspondientes en buenas condiciones y
disponiblesenelmomentoenqueserequieran.

El ciclodelcontr oldelpr ocesodealmacenes.


Lafuncindeinventariosenalmacenesestarelacionadaconunampliocampodeactividadesoperativasen
consecuencia de nueva cuenta es necesario dividir el proceso en los pasos especficos que comprende esta
tpicafuncin.Estoscasospuedensersumariadoscomosiguientes:

1. Ladeterminacindeltipoycantidaddematerialesquesevanamoverdentrodelosalmacenes.
2. Laaceptacindelosmaterialesporlosalmacenes.
3. Elalmacenamientodelosmismosdetalmaneraqueseencuentrenadecuadamentesalvaguardadosy
disponiblescuandosenrequeridos.
4. Larecoleccinydistribucindematerialesespecficosbajorequerimientodebidamenteautorizado.

Determinacindenecesidades.Esposiblequeelalmacenamientodematerialessehagasinprevioanlisisde
las situaciones y condiciones en que se desenvuelva la empresa. Tal seria el caso, por ejemplo, en que un
clienteounusuariointernodevuelvanmercanca,ocuandounacorridadeproduccinesexcesiva.
Normalmenteladeterminacindevolumenqueingresaalosalmacenessedeterminademaneradeterminada.
Ilustrativo de ello puede ser cualquier juicio gerencial, del usuario o del departamento de almacenes, que
indicaunacantidadespecificadeltipodematerialesquevananecesitar,detalmaneraqueenfuturopuedan
estarsegurosdelvolumendeinventariosparacubrirunanecesidadposterior.
Elproblemaprincipalenestecasoescomosevanadeterminarycomosevanacubrirlasnecesidadesde
operacin.

92
Encadacaso,ladeterminacinnormalmenteinvolucraungrannmerodefactoresenconflicto,ademsde
quelasdospartesencuestinestninevitablemente,enaltogradointerrelacionadas.Porejemplosesabeque
se necesitara un par derepuestos, pero es incierto cuando se van a utilizar, por lo cual se debe tomar en
cuentaelefectoquesecausarasilapartenoestadisponiblecuandoselerequiere,cuantotiempoinsumeel
procesodecompradereposicinyloscostosdelamisma.Adems,incidenotrosfactorestalescomoelnivel
desupervisinalosobreros,elmantenimientodelasmaquinasylosestndaresdeinspeccin.Enestoscasos
laexperienciaesmuyimportante,porlocualsedeberecurriralasestadsticas,ademsdeunagrandosisde
juicio,paradeterminarnecesidadesfuturas.
A continuacin el departamento de almacenes debe estimar la demanda y determinar como se puede
mantenerunniveleconmicodeinventariosparaproporcionarunbuenservicio.Laprimeracuestinquese
debetomarencuentaeseltiempoquesenecesitaparareponercadapartidadeinventarios,esto es,cuanto
tiempotranscurrirdesdequese ordenaserecibehastaquesepuedadisponerdeella.Lasegundacuestin
esta relacionada con los diferentes tipos de costos tales como el de procesar cada orden individual, el de
mantenerinventarios,esdecir,costodealmacenamiento,interesesobrelainversin,seguros,obsolescencia
etc.Porultimo,nohayqueolvidarlareduccindecostos generadaporlacompradegrandesdotes,locual
tambinafectaaloscostosdetransporte.

La combinacin de todos estos factores permite laborar un juicio sobre el mnimo y necesario nivel de
inventariosyelpuntodereordenaque,desdelaperspectivafinanciera,convienemasalaorganizacin.Estas
determinacionessepuedenoptimizarconelauxiliodeformasmatemticaslascualesnoseexplicaneneste
texto pues ello no corresponde al tema que s esta tratando. Es conveniente mencionar que la eleccin de
modelos matemticos debe ser muy cuidadosa, tanto como la determinacin de la diversa informacin de
entradaalosmismos.Sobretodo,nosedebeolvidarque,enestasdecisionesnoexisteningnsustitutodel
buenjuicio.
Importanciadedeterminarlasnecesidades.Existenseriasdificultadesparadeterminarlasnecesidades,pero
esnecesarioevaluarlasyaquesonlabaseparaemitirnuevasordenesqueafectaranlosingresosdemateriales
en los almacenes por consiguientes, el punto de control radica en tomar todas las medidas posibles para
asegurasedequeseestndeterminandoloquerealmentesenecesita.Acausadelorepetitivodelanaturaleza
delproblemasurgelanecesidaddedarseguimientoaciertaclasededecisinconsideradaderutina.
Ademsesparticularmentequeestadecisinseaimplantadayevaluadasconperiodicidadalaluzdenuevas
experiencias aplicndolas sobre la base de una partida individual dirigiendo el esfuerzo principal hacia
aquellasdemayorvaloroimportanciaoperacional.
Laresponsabilidaddeestaimportantefaseescompartidacomoelusuarioeldepartamentodealmacenes,ya
quepuedehabervariosusuariosdelamismapartida.
Normalmenteserequierelaayudadeespecialistas,porejemplodeldepartamentodefinanzas.
Aceptacindematerialesporeldepartamentodealmacenes.Elmaterialquehasidoordenaoproducidopor
laorganizacinllegaaldepartamentodealmacenes.

93
Elagotamientodeexistenciaesunasealdealerta,especialmenteenaquelloscasosquehanexistidoretrasos
enelsurtimientodepedidos.Elalmacnentreeldepartamentoderecepcinyeldecomprasconotrasfuentes
debeestarenordenesencialmentelarecepcinsecircunscribealconteodelaspartidasyaqueserecibenya
unasomerainspeccinquecompruebequelosmaterialesllegaronenbuenascondiciones.Porlogeneral,la
aceptacindebecomprobarsepormediodeunafirmayaseaenelordendecompraoenlacopiadelreporte
derecepcin.Existeotrotipodereciboreferenteamaterialesquepreviamentefueronalmacenados,peroque
pordiversasrazonesnoseutilizaronysondevueltosalalmacn.Laaceptacininvolucradesdeelpuntode
vistacontable,laexpedicindeuncrditoparadescontaruncargopreviolarecepcindelaspartidasfsicas
con su correspondiente documento soporte, es normalmente la ocasin para dar entrada a estas mismas
partidas en los registros contables y en el control de inventarios. Este registro de inventarios comnmente
llamado el kardex, por lo generalmaneja cantidades no descarta la posibilidad de incluir precios, lo cuales
deben ser determinados con base en los costos de la orden de compra, o en el caso de productos
manufacturadosporlaorganizacin,enlosregistrosuhojasdecostos.Elpropsitodeestosvaloresestenera
lamanolospreciosqueservirnparacuantificarenelmontntotaldeinventarios.Porlogenerallossaldos
deestosregistrosserepresentanencantidadesconobjetodetenerinformacininmediata.As,enelmomento
enquesenecesiteelimportetotaldeesapartida,solose hacelaextensinmdica.Escomnquetodo el
inventariooalgunapartedeleseacontroladaporsistemascomputarizadosenestoscasos,elobjetodecontrol
es asegurarse de que la aceptacin fsica de los materiales a sido rpida, ordenada y correcta y que los
aspectosrelativasaprocedimientorespetadoyaceptados.
Almacenamientodelosmateriales.Elalmacenamientodecadaunodelosmateriales,esunapartedeldiseo
totalydelaterminacindellugarendondelasdiferentespartidasdebernserfsicamenteacomodadastanto
comoexistenciascomoparasertransferidasaotrasactividadesoperacionales.Elespaciodisponiblepararea
dealmacenamientoes,porsupuestolaprimerarestriccinconsecuentemente,debehaberdiferentesmedios
parautilizarelespacioaefectosdeaspiraralmximodeficiencia.Algunasconsideracionesincluyen:
1.Almacenarlaspartidasvoluminosasenlasreasmsremotas
2.Ampliamenteadecuado.
3.Usoeficientedeanaquelesy depsitos.
4.Prevernecesidadesdepasillos
5.Preverflexibilidadparavariacionesdelosnivelesdeinventariosdedeterminadaspartidas.
6.Utilizacindeconvoyocarrossobrerieles.
7.Clarasidentificacionesdelocalizacin.
Cuandolaspartidassoncolocadassegncaractersticasfsicas y frecuenciademovimientolaexistenciade
una identificacin para localizarlas facilita llegar a ellas para cubrir cualquier periodo. Todo lo referente a
estas necesidades debe serrealizado de manera ordenada y sistemtica. Las localizaciones asignadas deben
anotarseenlosregistrosindividualesdelkardex.
Recoleccinyentregademateriales.Laentregaseiniciaapartirdealgntipodedocumentoautorizado,que
puedeserunaforma derequisicindeusointernoounaordendeembarqueenelcasodeunaventaaclientes.
En todos los casos, el documento de autorizacin debe ser elaborado de manera correcta y contar con la

94
aprobacindepersonasdebidamenteautorizadas.Enocasiones,estosdocumentostambinsonutilizadospara
recolectarpartidasespecficas.Enalgunoscasosdondelarecoleccinesdispersasehacenecesarioelusode
formasintermediasparacadaunodelaspartesdondesevaarecolectar.Noobstantequeestaaparenteseruna
operacin simple y sencilla, existen grandes posibilidades de error por lo cual debe ejecutarse con mucho
cuidado. Por lo general las partidas recolectadas son colocadas en vehculos que las transportaran al rea
donde sern entregadas si deben ser embarcadas la actividad de embarque debe ser considerada como
adyacentealaqueestaseestatratando.
Elmanejodelkardexdeinventariospuedevariarenalgunosaspectos.Ascuandoserecibeneldocumento
de autorizacin puede ser conveniente evaluar las disponibilidades antes de dar instrucciones de hacer la
entrega fsica de los materiales. Si se aplica este procedimiento, se puede detectaraquellos materiales cuya
existencia se hareducido base para determinar unnuevo proveedor o a los departamentos productivos. En
cualquier evento, las partidas recolectadas deben ser registradas en el kardex al igual que los crdito
peridicamente deben efectuase algn control cruzando informacin con los registros, con objeto de
cerciorarsedequelosmovimientosenelkardexsoncontempladosendichosregistros.Estaesotraformade
estaralertarespectoalascondicionesdelinventarioparaasinvertiroportunamente.
Elprincipalintersdecontrolnuevamentesecentraenlaeficienciadelmanejodelosaspectosfsicosdela
recoleccin y entrega as como la eficiencia de los procedimientos de soporte que incluyen entre otros la
preparacindelasdiversasformasyelmantenimientodelosregistrosdeinventarios.

Consider acionesor ganizacionales.


Lanaturalezadelaresponsabilidaddeldepartamentodealmacenesparalacustodiadelosmaterialesexiste
suindependenciadelasactividadesdequienesrecibenoentreganmateriales.Ademsdequedebencargar
conpartetodalaresponsabilidaddelosnivelesdeinventarios ylaeventualobsolescenciadelmismo,debe
estarubicadoenunaltonivelorganizacionalparaasparticiparconunelevadogradodeinfluenciaenestas
determinaciones. En las operaciones del departamento de almacenes existe la excelente oportunidad de
asignarresponsabilidades que generan un eficaz controlinterno. Aspor ejemplo las personas que manejan
fsicamentelasexistenciasnodebenteneraccesoalacontabilizacinenelkardexdeinventarios.
Mater ialesobsoletos.
Esinevitablequecualquieractividaddealmacenesexistenmaterialesdaadosuobsoletos.Enestoscasosla
primeraexigencia,antelafaltadeempleoregulardealgnmaterial,esquedebeserremovidodelreanormal
de almacenamiento. Simultneamente, el departamento de almacenes debe notificar este cambio para los
efectoscontablescorrespondientes.Quehacerconestaspartidasespartedelgranproblemadedesperdicios
y materiales sobrantes. El segundo ms importante requisito es investigar las causas de daos u
obsolescenciaspareadeterminarquesepuedehacerenfuturaparaminimizarestaclasedeproblemasqueen
algunoscasospuedenserocasionadosporlasactividadesoperativasdeldepartamentodealmacenesperoen
otroshanprovocadoporotrosgruposoperativosquecalcularonmalsusnecesidades.

95
Consider acionesrespectoalasinstalaciones.
Yasehahechoalgunareferenciasobrelasinstalacionesylasdiversasetapasqueincidenenciclooperativo
delosalmacenes.Sinembargo,esnecesario,destacarlaimportanciadeinstalacionesadecuadasalrespecto,
larelevanciadelreatotaldealmacenamientoesprimordialparacontarconunabodegaconadecuadoacceso
quepuedaalbergartodoslosmaterialesnecesarios.Elsegundoespectodeimportanciaeslaseguridad,porlo
cual debe hacerse la subdivisin que exija las necesidades y habilitar una sola puerta de acceso al rea, al
mismo tiempo su puede tomar medidas para controlar todas las medidas y entregas de materiales para
prevenirhurtos.Sinembargosedebeevaluarelcostobeneficiodecontarconelalmacenistaoinstalaciones
cerradasylaimportanciadetenerunfcilaccesoalosmaterialescuandoellosserequieran.Tambinsedebe
implantaradecuadasmedidasparaprotegeralosalmacenesensituacionesclimatolgicas.Lasinstalaciones,a
dems, deben contar con las cantidades necesarias, depsitos y reas especiales restringidas hacia como
equipo para mover materiales y colocarlos en el lugar asignado. Finalmente, debe haber sistemas contra
incendios el ms recomendable de los cuales es el denominado tipo sprinkler (a base de regaderas que se
colocan en las partes altas de las bodegas) todo lo anterior apoya el enfoque de una eficacia activada de
almacenamientoseiniciaconinstalacionesadecuadas.

Usosdealmacenespblicos.
Enalgunasocasiones,lafaltadesuficienteespacioparaalmacenamientohacenecesarioquelaorganizacin
alquilealmacenespblicos.Confrecuenciaestaopcinimplicaaltoscostosporlocualsedeberesolvereste
problemamediantelautilizacindelasinstalacionesdelaorganizacin.Lasegundacuestinserefiereala
medida de control que se tienen que sacrificar al utilizar los almacenas pblicos, especialmente en lo que
respectaadisponerdematerialesenelmomentoqueseannecesarios.Lasdificultadesquesepresentanpara
la coordinacin operativa y el manejo optimo de materiales es un argumento de peso para eliminar el uso
continuodealmacenespblicos.Noobstante,cuandosepuedeeliminarestapractica,sedebelimitarsoloa
tiposhomogneosdematerialescuyomovimientoseamsrestringido.

Inventar iosdisponibles.
Paraefectosdecontrolyadministracindeinventariosesnecesariocontarconlainformacinconfiablesobre
los mismos. Adems, estos inventarios son indispensables para preparar los estados financieros ya que la
constanciafsicadesuexistenciaeslabasedelainformacinconsignadaentalesdocumentos.Asmismo,
sirvecomounaslidabaseparatomardecisionesdecompraeinclusive,paramedirvolmenesdeproduccin
yfundamentalmenteenindustriasextractivas,comoeselcasodelapetrolera.
Elniveldeadecuacindelsistemadeubicacindematerialessepuedeevaluardurantelatomafsicadelos
inventarios,enlacualsedebeverificarsiexistenmaterialesalmacenadosenformaduplicadabajodiferentes
descripciones, a s como la existencia de material obsoleto o de lento movimiento. Adems, es importante
asegurarse que los conteos sean confiables, e inclusive explorarla posibilidad de realizar muestreos
estadsticoscuandolosconteosseefectansobrelabasedepruebas.

96
Las diferencias entre las existencias fsicas y los registros en los libros son importantes indicadores de la
eficienciaoperacionaldelsistemadecontroldeinventarioselanlisisdelascausasqueprovocaronajustesa
los inventarios puede indicar fallas en el proceso de computo, inadecuadas medidas de seguridad, errores
humanosderegistrooinadecuadosprocedimientosdeconteosfsicos.Laadministracindebeinteresarseen
explicarlascorreccionesalcontroldeinventarios.

Natur alezadelacontabilidaddecostos.
Las empresas comerciales, industriales y de servicios tienen en comn que depende de los ingresos
provenientesdelaventadesusartculos,productososervicios.
Sin embargo, las compaas comerciales venden los artculos tal como los compran en tanto que las
manufactureras adquieren materias primas las transformas en productos terminados y las venden. As, por
ejemplo la industria textil compra el algodn, lo convierte en hilo, lo teje, y genera una tela que se tie o
estampapara,finalmente,ponersealaventa.Porsuparte,lascompaasdeservicioscontratanmanodeobra
especializada,adquiereninsumosyprestanyvendenelservicioquedemandansusclientes.
Ladiferenciabsicaentrelascontabilidadescomercialeindustrialestribaenqueelcomerciantecompralas
mercancasenelmismoestadoenquelasvender,porlocualpuededeterminarconfacilidadelcostodelas
mismas.Ellonoocurreenelcasodelfabricanteodelprestadordeservicios,quedebenacumularenregistros
contablesespecialescontabilidaddecostoslasmateriasprimas,materialesoinsumos,lamanodeobraque
requiri para la transformacin o presentacin del servicio y los gastos indirectos colaterales y
complementarios necesarios para llevar a cabo los procesos productivos o de servicios todo ello para
determinarelcostodelosartculosquefabricaodelosserviciosquepresta.
La contabilidad de costos, que se puede considerar como una extensin de la contabilidad financiera se
utilizaparaotorgaralaadministracindeunaentidadunpanoramacompletoyanalticodelosrecursosdela
mismaquesonutilizadosparalafabricacindeproductos oprestacindeserviciosadems,enunsentido
contable,esunconjuntodeprocedimientos,cuentasyregistrosdiseadosespecialmenteparaesefin,conel
objetodedeterminar,acumulareinformarsobreelcostounitariodeproduccinoservicios.
Por lo anteriorla contabilidad de costos consiste en la planeacinpredeterminacin, acumulacin,registro,
distribucin,determinacin,informacin,controlyanlisiseinterpretacindeloscostosdefabricacinode
loscostosdeservicios.

4.4.2Elementos.

Mater iasprimas.
Lasmateriasprimassonlosbienesqueseutilizandirectamenteparalafabricacindeunproductoyforman
parte de l. Cuando se tratan de empresas de servicios, suelen denominarse con el nombre genrico de
insumos.Sonmateriasprimasparaunfabricantedezapatoselcueroylosforros,porejemploalasmaterias
primas tambin suelen llamarse materiales directos, puesto que se convierten en productos terminados. El
costodelosmaterialesdirectospuedeserfcilmenteidentificadoconlasnecesidadesdeproductoolotesde

97
produccin,ycargadodirectamenteaambos,sinecesidaddeutilizarprocedimientosarbitrariosdeprorrateo,
sujetosadiversoscriterios.
Los materiales directos deben ser diferenciados de los indirectos, como es el caso de aceites, lubricantes,
artculosdelimpieza,etc.Estosnosonfcilmenteidentificablesconlasunidadesespecficasoloslotesde
produccin,porloqueseconsiderancomopartedelosgastosdefabricacinocostosindirectos.
Comoquedosealado,alosmaterialesbsicosqueempleaunfabricanteselesdenominamateriasprimas,
sinqueestoimpliquequenecesariamenteseencuentrenensuestadonatural,como,porejemploelcasodeun
industrialdelaramatextilqueiniciasuprocesofabrilconeltejido,sinnecesidaddehilarelalgodn.En
este ejemplo, el algodn ser lamateria prima del fabricante o productordehilo mientras que este ser la
materiaprimadelfabricantedetelas.

Manodeobr a.
Confrecuencia,lamanodeobraesdescritacomoeltrabajodelaspersonasquetransforman,conmaquinaria
yherramientas,directamente,losmaterialesenproductosterminados.
Enelcasodelaindustriadeservicios,lamanodeobraesloqueseaplicaparaprestarunservicio.Portantoel
costo de la mano de obra directa puede fcilmente identificarse y cargarse a las unidades o lotes de
produccinaloscualesseaplico.
En la produccin es necesario distinguirlamano de obra directa de la mano de obra indirecta, esta ltima
incluye el trabajo de los supervisores, ingenieros y otros trabajadores que no trabajan directamente en los
productosquesemanufacturan.Ademssirvedeayudaalaproduccinalacualfacilitaperonotransforma
directamenteelproducto.Alamanodeobraindirectaseleclasificadentrodelcostoindirectodefabricacin.

Gastosdefabr icacin.
Los gastos de fabricacin, con frecuencia tambin llamados costos indirectos o gastos indirectos, incluyen
todosloscostosygastosnecesariosqueseincurrenenunprocesofabrildetransformacinodeprestacinde
serviciosdistintosdelamateriaprimadirectaylamanodeobraindirecta,yquepuedenincluir,enunciativa
mente, los siguientes conceptos materiales indirectos, mano de obra indirecta, reparaciones seguros,
impuestos sobre los materiales y mano de obra indirecta, electricidad y combustibles, depreciaciones y
amortizaciones,arrendamientos,equipo,grasasylubricantes.

Registr oycontr ol.


Cuandonosecuentaconunsistemadecostos,lostreselementosqueincidenenelcostodefabricacinson
materiaprima,manodeobraygastosdefabricacinsonllevadosdirectamentearesultadosenlacontabilidad
general al cierre del ejercicio o periodo por el que se desea determinar el costo de ventas se levanta un
inventario fsico de materias primas, produccin en proceso y artculos terminados. Este inventario se
comparaconsusmildeiniciodeejerciciooperiodoyladiferenciasellevaaresultados.Esteprocedimiento
esconocidocomomtodoglobalparadeterminarelcostodeventaporcomparacindeinventarios,sistemas

98
de alto riesgo ya que no permite un control eficiente, por lo cual se desconoce el costo unitario de los
productosfabricadososerviciosprestados.
La contabilidad de costos implica cargas a la cuenta de activo circulante, produccin en proceso, los tres
elementos del costo: materia prima, mano de obra y gastos de fabricacin amedida en que se incurren, se
conocenosedevengansucargadebehacersealassubcuentasosubsubcuentasqueespecficamentesehayan
definido.Adems,atravsderegistrosadecuadamentediseadossedebenacumularloscostos ygastos,de
talmaneraquecuandoconcluyaelprocesoproductivo yelartculoseatransferidoalalmacndeproductos
terminados, simultneamente se debe hacer el movimiento contable de cargo a inventarios de productos
terminadosconabonoaproduccinenproceso.
Unbuensistemadecostosesunadelasherramientasmseficacesenmateriadecontrolconquepuedecontar
unaorganizacin.

Objetosdelacontabilidaddecostos.

Asignar a los productos fabricados o a los servicios prestados los costos y gastos que se incurren en sus
respectivosprocesosparacompararlosconelingresoqueresultedesuventa.Determinarelcostounitariode
los productos manufacturados o de los servicios prestados,para poder obtener elementos de control enla s
reas de produccin y vetas as como para recabar informacin que facilite la toma de decisiones y la
competitividadenelmercado yprecisarcon mayorcertezalaplaneacinfinanciera,tantodelapolticasde
precios y produccin como las de inversiones en inmuebles maquinaria y equipo. Ser un elemento
insustituibledelcontrolinterno.

Finalidadesdelcontr oldelacontabilidaddecostos.

Determinar razonablemente los costos unitarios de produccin o servicios de los artculos o servicios en
proceso, semielaborados, terminados y vendidos y de los inventarios respectivos. Correlativamente,
determinarlautilidadperidicadesdeestepuntodevistaunsistemadecostos,solopuedecalificarsecomotal
cuando permita la obtencin de costos unitarios y elimina los mtodos globales de toma y valuacin de
inventariosfsicosparaladeterminacinperidicadecostosdeventaydelasutilidades.
Internasopreventivas.Controlquedebeaportarlacontabilidaddecostossobremateriaprima,manodeobra,
gastos indirectos, produccin en proceso, artculos terminados, inmuebles, maquinaria y equipo y gastos de
investigacinydesarrollo.

De accin ulterior o ejecutiva. Elementos materiales: tpicos y caractersticas, reas fsicas, naves,
departamentos,secciones,maquinariayequiporeasderesponsabilidad:directivos,nivelesdesupervisin,
responsables directos causales de problemas: faltas de materiales, problemas con la mano de obra
descomposturademaquinariayequipomantenimientopreventivocorrectivo.

99
Planeacindeutilidadesinterdependenciaentrecostosvolmenesdeproduccinyventayutilidades:tcnicas
de punto critico, del de equilibrio y del punto optimo y de sus modalidades: seleccin y jeracquizacin de
productos y lneas de productos: sin mas factores restrictivos que el mercado con un factor restrictivo
preponderante:condosfactoresrestrictivossimultneosconvariosfactoresrestrictivosyunelevadonumero
deproductos,opcionesdecompraoproduccinsustitucindetrabajomanualporautomatizadooviceversa
alternativas u opciones de inversin enmaquinaria y equipo seleccin de proyectos menores seleccin de
proyectosmayores,alternativasuopcionesdeinversionesenplantasyunidadesfabrilesdecisionesdecierre
temporal o definitivo de reas de produccin y servicio evaluacin de decisiones en funcin de factores de
incertidumbre.

Orientacindelaspolticasdepreciodeventa.Naturalezainterdependenciaentrecostoypreciodeventade
polticasdeventaacortoyalongoplazo.Elementosaconsiderar:elasticidaddelademandaytendenciasdel
mercado,sensibilidaddelclienteoconsumidoralprecioyalvolumenevaluacindelentornoeconmico.
Vinculacinconlatcnicapresupuestal.Presupuestointegraldeoperaciones:ventasnivelesdeinventarios,
inmuebles, maquinaria y equipo: otras inversiones amortizables, compras, materiales utilizados, mano de
obra, gatos de fabricacin, costos de produccin y venta gastos de venta y promocin, gastos de
administracin,gastosfinancieros:otrosgastosyproductos,cuentasporcobraraclientesestadosfinancieros
pro forma. Reproyecciones peridicas presupuestos especiales, en especial proyectos de inversin.
Independientemente de la mecnica o rutina de contabilizacin de los costos y gastos de fabricacin que
requierendeunanlisisexhaustivoydetalladoquerebasalasintencionesdeestetexto,entodoloanteriory
msdebecoadyuvarlacontabilidaddecostos.

Contabilizacindeinmueblesmaquinar iayequipo.
Las expresiones inmuebles, maquinaria y equipo, altamente vinculadas con el ciclo de produccin,
genricamente llamada activo fijo, se refiere a los activos que a adquirido una entidad econmica para
utilizarlosensusactividadesproductivasdurantemsdeunperiodosinintencionesdevendelos.Enelcaso
deempresasmanufactureraslosinmuebleslamaquinariayelequiposeutilizaparagenerarinventarios,queal
venderseproduceningresosconrespectoalasorganizacionesdeservicios,estosactivossonrecursossonlos
quesepresentanlosserviciosestosactivossonlosquedanrazndeseralaempresaylespermitecumplirlos
objetivosypropsitosparalosquefueroncreados.
En general, una organizacin no debe tener la intencin de adquirir inmuebles maquinaria y equipo para
venderlos,salvoqueesteseasugiroencuyocasoseriainventariosdeproductosvendibles,nodeactivofijo.
Demodoqueuninmueblemaquinariayequipolleguavendersenicamenteporrazonesfinancieras,cuando
pordiferentesrazonesnoloutilizaocuandoelcostodereparacinymantenimientoessuperioralosingresos
quepuedegenerar.
Laimportanciayutilidaddel activofijosebasaenelhechodequesinestosrecursosnosepodrproducirlos
inventariosoprestarlosserviciosobjetodelaentidad.

100
Activos tales como una planta abandonada o un terreno o socio que se adquiri como inversin o para
eventualcrecimientonodebenserconsideradoscomoactivosfijos,puessolosoninversiones.

Objetivosdecontabilizacin.
1. Comprobarquelosinmuebles,maquinariayequiposeanpropiedaddelaentidadquelospresentaen
subalance,yquesonlabaseparaalcanzarlosobjetivosypropsitosparalosquefuecreada.
2. Conocer, mostrar y revelar en balance o a travs de notas a los estados financieros, cualquier
limitacinogravamensobreesapropiedad.
3. Registrarestosbienesenlacontabilidadasucostodeadquisiciny noalterardichoregistrodurante
la vida del negocio en marcha. Cuando se trata de mejoras o adiciones a los mismos, realizar su
contabilizacin de acuerdo con lo que establezcan los principios de contabilidad generalmente
aceptados.
4. Computarladepreciacinsobrebasesrazonables,congruentesconelejercicioanteriorydeacuerdo
conlosmtodosaceptadosparacalcularla.
5. Registrarconoportunidadlasaltasybajasdelosbienesaqueserefiereesterubro.

Adquisicin.
Porlogeneral,cuandosecompra uninmueble,maquinariaoequiposeproduceunaseriededesembolsos.As
por ejemplo, un inmueble, adems del precio pactado y pagado, debe incluir gatos colaterales como los
honorarios notariales, impuestos, derechos y registro, corretaje, adaptaciones. La maquinaria y equipo debe
englobar gastos fletes y derechos aduanales, instalaciones y seguros de transporte adems del pago por la
propia adquisicin. La regla es que todos estos desembolsos adicionales deben acumularse al costo de
adquisicin,conacepcindelimpuestoalvaloragregadoquelefuetrasladadoaladquiriente,susceptiblede
serrembolsadoocompensadocontrafuturospagosdeesteimpuestoacargodelaentidad.

La aplicacin de la regla aludida se apoya en que todo desembolso en bienes capitalizables, inmuebles,
maquinariayequipoquebeneficiarnaperiodosfuturos,laamortizacindelainversinintegradatotal,debe
hacerseenesosmismostrminos.Pararesolvercualquierdudaoaclaracinsobreesteparticularincluyendo
los criterios a adoptar en el registro de mejoras, adiciones o adaptaciones a estos activos se recomienda
recurriraloestablecidoenlosboletinesdeprincipiosdecontabilidadgeneralmenteaceptadosemitidosporel
institutomexicanodecontadorespblicosascomoalalegislacinfiscalaplicable.Gastosdeconservacin,
mantenimientoyreparacin.Cuandolosdesembolsosqueseefectentengancomopropsitomantenerestos
activos en condiciones de uso, es decir para retardar su natural deterioro y envejecimiento, se deben
considerar como gastos aplicables al periodo en que sucedieron. Esta clase de desembolsos son necesarios
paralaoperacinactualyparalapreservacinpotencialdebeneficios futurosysobretododebidoaquese
efecten de manera regular, no deben ser capitalizados como activo. Estos gastos, cuando se destinan a
activosutilizadosparapropsitosproductivosformanpartedelosgastosdefabricacin.

101
Depr eciacin.
Loscostosygastostotalesdeadquisicindeinmuebles,maquinariayequiposeregistrarenlibroscomotal
por que benefician a periodos futuros. La distribucin de esa inversin en periodos futuros se llama
depreciacin,excepcinenelcasodelosterrenosquelegosdedepreciarseincrementansuvalorconelcorrer
deltiempo,salvoocasionesextraordinariasdeperdidadevalorcomercialporrazonesdeafectacin,invasin
ocolindanciasnegativas.Porloregularlosedificios,maquinariayequiposedesgastanoseconsumenenle
transcurso de lapsos diferentes, deterioro que generalmente es provocado por le uso o la obsolescencia. La
depreciacinesconcomitanteconlaperdidadelvaloropotencialdelusodelactivofijo.Ademssiunactivo
participo en la generacin de utilidad gusto es que esa utilidad absorba parte de la amortizacin de la
inversinquecoadyuvasugeneracin.Cadaactivofijoesunapartidaindividualqueesafectadadedistinto
modo por el uso y la obsolescencia. Tngase presente, por ejemplo el caso de terminado equipo para la
industriadelaimpresinque,noobstantecontarcondiezomsaosdeuso,todavaprestaservicioyestil
en determinados procesos. Por le contrario, el equipo y el sistema de computo utilizados en la misma
industria,modernizadacaeendesusopordesgaste,deteriorouobsolescenciaconunarapidezimpresionante.
Esmuycomnconocerdecasosquealcavodedosatresaosdeusolosreferidosequipos ysistemasson
desechados.Portanto,noesraroqueexistandiversosmtodosdedepreciacin:enlnearectaaplicandotasas
ocuotasuniformessobrelasmismasbasesfiscales:porunidadesdeproduccindecrecientesenfuncinasu
potencialdeusoestimadaenfuncinalavidaprobabledeusooservicio.4

4.5CICLODETESORERIA.

La funcin o ciclo de tesorera. Se encarga del establecimiento de controles en materia de captacin de


recursos,sumanejo,custodiayprogramarlosegresos,estambinresponsabledelcorrectoyeficienteflujode
fondos,laspolticasdetesoreraestnsupeditadasalaspolticas,criteriosydecisionesemanadasdelreao
direccindefinanzasdelaorganizacin.

4.5.1CaptacindeRecur sosoIngr esos.

Las fuentes de recursos financieros de que dispone una organizacin, son internos o propios y externos,
dentro de los primeros se encuentran las aportaciones de los socios o accionistas, la recuperacin de las
cuentasporcobrar,algunasventasdeactivosdiferentesalosdelgirodelaentidad.,encuantoalosrecursos
externosseencuentranlaobtencindetodotipodecrditosyfinanciamientosy eventualmentecualquierotro
tipo de apoyos gubernamentales recibidos de diversa ndole, como pueden ser subsidios, exenciones de
impuestosetc.

4
SANTILLAN,GonzlezJuanRamnIntroduccinalControlInternoatravsdelosciclosde
Transacciones ,EditorialEcafsa.
102
Apor tacionesdeaccionistas.

Comprende este rubro los pagos por el compromiso contrado de una persona moral o fsica de aportar
recursos financieros en efectivo o en especie para la constitucin y puesta en marcha de una sociedad para
llevaracabounobjetivoconunfinlicito,esfuncindeltesorerovigilarquelasaportacionespactadasseden
en el tiempo y forma preestablecidos. Cuando la organizacin esta ya operando de manera regular como
negocioenmarchayllegaraanecesitarmasrecursoslquidosparasuoperacinobienparafinanciarplanes
oproyectosdeexpansinocrecimiento,laprimerfuentealaquedeberecurrirsonalaaportacinadicional
de los accionistas, una opcin podra ser la invitacin y la inclusin de nuevos accionistas ajenos a los ya
existentes,ydeestaformareforzaralasociedadconcapitalpropioparaevitaraumentarpasivos enbasea
crditosyfinanciamientosqueaumentaranlacargafinancierayrepresentanunriesgoodependenciadelos
acreedores. El proceso de cuentas por cobrar cubre principalmente lo relativo a las ventas de productos
manufacturados o servicios prestados, pero tambin cubre cualquier tipo de accin de la organizacin
generado por reclamaciones de diversa ndole contra individuos o personas morales, las cuales son
principalmente contra partes externas de la organizacin aunque en algunas ocasiones tambin pueden
involucraraempleadosyfuncionariospormuyvariadasrazones.

Elprocesodecuentasporcobrarrelativoalasventasdeproductosyserviciostieneunnumeroimportantede
relaciones, como son la necesidad de polticas que cubran el otorgamiento de crdito y su subsiguiente
administracin,sedebenconsiderarfactorescomoQuiendebedarelCrdito?CantidaddelCrdito?Qu
polticas se deben establecer para la recuperacin del Crdito?, as mismo se debe tomar en cuenta la
satisfaccindelclientealestablecerlaspolticasymantenerunabuenarelacinconelmismoyaqueparala
organizacin es muy importante estar enterada de la reaccin de los clientes a las polticas de crdito en
cuantoautorizacin,facturacinycobranza,laorganizacintambinestainteresadaenloquepuedeaprender
atravsdelarelacindelascuentasporcobrarparasaberlareaccindelosclientesasuspolticasyconocer
laeficienciadelasactividadesdecuentasporcobrarylaefectividaddesucontrol.

Cr eacindelascuentaspor cobr ar .

Normalmente las cuentas por cobrar se originan por la venta de los productos de la organizacin o por la
ventadedeterminadaclasedeservicio,elestablecimientodelasmismasestaenfocadohaciaelelementoque
origino la cuenta por cobrar y al correspondiente soporte del embarque del producto o la ejecucin del
servicio,esnecesarioasegurarsedequelascuentasporcobrarhansidodebidamenteregistradas.

Ambosobjetivospuedensersatisfechoscuandolacreacindelacuentaporcobrarestaligadadirectamentea
lacontabilizacindeuninventariooconelregistrodeunserviciorendido,estaligasedebeestablecerenun
sentidoespecficodeprocedimiento.

103
La cuenta por cobrar involucrainmediatamente la cuestin de sila organizacin desea expediral cliente el
crditorequerido,estadeterminacinpuedequedarubicadadentrodeunapolticageneraldecrditoexpedida
porlaorganizacinlacualseraplicadaacadaclienteenparticulardeacuerdoasusituacincrediticiayala
experienciaconelcliente,unavezquesehadeterminadoestasituacinseinicialaventaregularyelproceso
defacturacinysurespectivacontabilizacinconcargoalacuentadelcliente.

Sonaplicablesalacreacindeunacuentaporcobrarlassiguientesconsideracionesdecontrol:

1. RevisinIndependiente yAprobacindelCrdito.Cuandoserecibeunpedidosedebe obtenerla


aprobacin de crdito, esta aprobacin puede ser proporcionada por un departamento o persona
independiente dentro del marco de referencia establecido, se deber tomar en cuenta para dicha
aprobacin las condiciones financieras del cliente de acuerdo al monto del crdito solicitado as
como la experiencia que se tenga con el mismo en operaciones anteriores y su situacin actual en
cartera.
2. DeterminacindelaDisponibilidaddelProducto.nicamentesedebenfacturarlosproductosque
se tengan en existencia ya que puede ocurrir que no todos los que el cliente solicita se le puedan
embarcardeinmediato,porloquesedebendeconsiderarcomopendientesdeenviparaembarque
enunafechaposterior.
3. Autorizacin de Precios y Trminos. Los precios y trminos de la operacin deber estar
estandarizadosparatodoslosclientes,enalgunoscasospuedehaberexcepcionesdependiendodelos
gruposdeclientesydelosvolmenesquesepuedanvenderaellos,paraefectosdefacturacinlos
precios y trminos aplicables deben ser proporcionados con base en polticas establecidas por la
organizacin, cualquier modificacin especial como por ejemplo precios especiales para ganar
mercadoalacompetencia,deberseraprobadaporpersonaldebidamenteautorizado.
4. Papelera Multicopia para fines especficos. Las facturas deben contener el suficiente numero de
copias las cuales deben contener informacin idntica para ser usadas con otros propsitos
operacionales. De esta forma una copia puede servir para autorizar el embarque, otra para ser
entregadaalcliente,otraparalaestadsticadeventas,otraparalacreacindelacuentaporcobrar,
etc.asmismosedebenestablecercontrolesquecubraneltotaldelafacturacinporunperiodode
tiempodado,usualmenteesundadeactividades

Administr acindelascuentaspor cobr ar.

La administracin de las cuentas por cobrar empiezadesde la generacin de la cuenta, pasa a sumanejo y
control propio y concluye en el momento de ser pagada o liquidada. Las principales consideraciones de
controlduranteestanuevafasesonlassiguientes:

104
1. Controlindependientedelosregistrosdecuentasporcobrar.Losregistrosdecuentasporcobraren
algunos casos pueden ser manejados manualmente en organizaciones pequeas ya que las
organizaciones grades generalmente los manejan por sistemas computarizados, los principios
fundamentalesentodosloscasossonquelosregistrosseanmanejadosenformaindependienteyno
sujetosalalcancedeterceraspersonas,especficamenteporaquellosquetenganaccesoalacajaoa
los clientes mismos, debern tenerse cuentas de control y si es posible cuentas de subcontrol que
contenganlascuentasindividualesperfectamentedetalladas.
2. RegistroyControl.Cualquiercargoabancosyotracuentamiscelneaquetengacomoorigenuna
contrapartidadecrditoalascuentasporcobrardeberegistrarsediariamenteconelfindecontarcon
la informacin actualizada que sirva de base para las necesidades operacionales, se debe tener
tambin la certeza de que estas cuentas por cobrar estn correctamente registradas mediante
confrontacionesperidicasentrelosregistrosauxiliaresylascuentasdemayor.
3. Oportuno y Adecuado Sistema de Reporte. Adicionalmente del reporte diario de las cuentas por
cobrar, se debe contar con un sistema de reporte peridico de saldos corrientes con un anlisis
detallado el cual mostrara la situacin de los saldos como por ejemplo saldos vencidos y no
liquidadosvencidounmes,dosmeses,tresmesesetc.locualserunaherramientadecontrolmuy
valiosaparalarecuperacindecartera.
4. EnvideEstadosdeCuentaaClientesenformadirectaeindependiente.Elenvidebeserdirecto
sinquehayaningunaintermediacin,paraevitaralgunaposiblealteracin,modificacinoextravi
poralgnelementodelaorganizacin,conesteprocedimientosehaceposibleunchequeocruzado
delainformacinconelclienteysirvetambinparaaclararlasinconformidadesenalgunossaldos.

Disponibilidaddelascuentaspor cobr ar.

Comolascuentasporcobrarrepresentanunactivoreclamablealaspartesinvolucradas,esmuyimportanteno
revelaresta recuperacinsinonicamentemediantelosprocedimientosautorizadoscomolossiguientes:

1. Cobranza. La forma ms comn de recibir la cobranza es por medio de los clientes los cuales a
travsdesupagoliquidanunacuentaporcobrarpreviamentegenerada,sedebertenerencuentasu
correcta contabilizacin en las cuentas respectivas as como la consideracin de los descuentos y
rebajassiesqueestosexisten.
2. DevolucindelaMercanca. Silosproductosvendidossonregresadosporalgunaraznsetiene que
verificarqueladevolucinesteautorizadaparacancelarlaoperacinoriginaldeventa,verificando
previamente la devolucin fsica de la mercanca y que esta se regrese en buen estado, se deber
verificartambinquelacancelacincontablesehagaporlascantidadescorrectas.
3. Ajustes y Descuentos Especiales como pueden ser el caso de algn cliente en particular, por
volumen,oalgndeterminadoproducto,enmuchosdeloscasos estosdescuentos seapoyanenla
decisindealgnejecutivoconautoridadsuficienteparaestoscasos.

105
4. Cancelacin de cuentas malas. En algunos casos existen clientes que no cumplen con sus
obligacionesdepago yaunqueseapliquetodo elesfuerzoparaelcobro existensituacionesenlas
quenoesposibleefectuarlo,comopuedenserlas,quiebras,ladesaparicindeldeudoruotrascausas
que no dejan otra alternativa que cancelar la cuenta, Usualmente se hacen provisiones para estos
casoscreadoreservasparacuentasmalasoincobrables.

ElControlespecficoenesteaspectoesquelacancelacindelacuentadeberserautorizadaporfuncionario
con jerarqua suficiente para estos casos, as mismo se debe llevar un control de cuentas canceladas para
evitarqueestasseancobradasynoreportadasalaorganizacinobienestaratentosacualquierposibilidad.

Polticasadministr ativasdelascuentaspor cobr ar.

Laspolticasclaverelacionadasconelmanejodelascuentasporcobrarsonlassiguientes:

1. Otorgamientodelimitesonivelesdecrdito.Sedebetenerencuentaquetanliberaldebeseresta
poltica ya que si el crdito es muy restringido puede ocasionar un bajo nivel de ventas y en
consecuencia afectar las utilidades de la organizacin, pero por otra parte si el crdito es muy
flexibleestepuede originarungrannumerodecuentasincobrables yafectartambinlasutilidades
delaorganizacin,porloqueesnecesarioexaminaradetalleestassituacionesantesdetomaruna
decisin.
2. Impactodelasrelacionesconlosclientesenelprocesodecuentasporcobrar.

Un aspecto muy importanterelativo tanto a la operacin como al proceso total de cuentas por cobrar es el
impactoquetienenestasactividadesenlasbuenasrelacionesconlosclientesdebidoaqueenocasionesalas
empresas les interesa desarrollar eficientes procedimientos y operaciones internas y con frecuencia en este
intentolosprocedimientosreducenelgradodecontactopersonalconlosclientes,porloquesehacenecesario
manejar de la mejor manera las relaciones con los clientes para evitar cualquier sntoma de irritacin
tendiendosiempreaconstruirunarelacinpositivaconellos,comoejemplodeestoscontactospuedenserla
aplicacindelneasdecrdito,claridadenlafacturacin,procesamientodeacreditamientos yajustes ylos
diversos aspectos de cobranza. Se debe combinar la eficiencia interna con una adecuada cortesa y una
razonablecooperacinhacialosclientes.

Pr ocesodeotr ascuentaspor cobr ar.

Aunquegeneralmentelasactividadesregularesdeventasdelaorganizacinproveenlasprincipalesfuentes
de cuentas por cobrar, existen otras actividades que originan ciertos tipos especiales de cobranza como
ejemplosdeellosonlossiguientes:

106
1. Anticipos a empleados. La venta de productos o servicios que presta la empresa se debern
considerarenlascuentasporcobraraclientes,ademsexistenotraclasedeanticiposcomosonlos
anticipos para gastos de viaje o algunos otros fines especiales del negocio, prestamos a titulo
personal de los empleados a cuenta de sueldos y salarios, este tipo de prestamos deber de estar
estrictamente controlado por polticas perfectamente definidas y algn caso especial deber ser
autorizadoporfuncionariodealtonivelenlaorganizacin.
2. Depsitos con terceros. En algunas ocasiones se requiere efectuar depsitos con terceros para
garantizarunserviciouotrasrazones,estosdepsitospuedensertemporalesopermanentes,comoel
servicio a prestar lo requiera, se debe tener en cuenta queel registro contable registre la poca de
recuperacindeldeposito.
3. Reclamaciones. En algunos casos existen reclamaciones, con proveedores, transportistas, o
cualquierotroconcepto,estasdebenserregistradasypasadasaunregistroparaestarpendientesde
sureembolso.
4. Acumulacindeingresos.Untipomuyespecialdecuentaporcobrarseoriginacuandolosingresos
secapitalizanantesdequepuedansercobrables.Elobjetivoaquesdeunsentidooperacional,yes
reconocerlosingresosenlosperodosaquerealmentecorrespondanconobjetodetenerobjetividad
enlaevaluacindelosresultadosde operacin,como ejemplolascuentasporcobrardeventasen
abonos.

4.5.2AspectosEspeciales.

En virtud de que la naturaleza y alcance de las transacciones y actividades que presentan estos tipos de
cuentasporcobrarserequierenciertosaspectosdecontrolaplicablesregularmenteatodasellas.

Elprimeroesdefinirclaramentelascondicionesbajolascualessecreoeltipodecuentaporcobrarqueestn
claramente definidas tanto por procedimiento como por poltica teniendo como principal objetivo la
salvaguardadelacuentaporcobrarregistrndolaenlibroslomasprontoposibleenlacantidadcorrectaycon
todosloselementosquedeterminaronsucreacin.

ElsegundoAspectodecontrolconsisteenestablecerlosprocedimientosnecesariosparalarevisinperidica
delestadodetodasestascuentasporcobrar.

Pr ocesodedocumentospor cobr ar.

LosDocumentosporCobrarsonttulosdecrditoquerepresentanderechospersonalesdecobroenvirtudde
letrasdecambio ypagaresaceptadososuscritosporclientesodeudoresdelaentidad.

Enalgunoscasoslasorganizacionesquierenrespaldarsuscuentasporcobrarcondocumentosasufavor,lo
cual los ayuda a controlarlas pocas de pago, en estos casos se debe considerartambinla posibilidad del

107
cobrodeinteresesenestosdocumentos,elproblemaadicionalquetienenlosdocumentoseseldesucustodia
y el correcto procedimiento de su contabilizacin, se deben establecer procedimientos que estandaricen las
accionesy asegurensurevisinperidica.

Ventadeactivosdiferentesalosdelgir odelaentidad.

Enocasioneslasempresasvendensusinmueblesmaquinariayequipocuandoestnenposibilidaddeadquirir
otro ms moderno, ms rpido o ms productivo y estar actualizados con las innovaciones tecnolgicas.
Tambin en ocasiones venden sus inmuebles cuando el costo de su mantenimiento excede a los beneficios
derivadosdesuusoconstante.

Encasodeventadeuninmueblesedeberseguirtodounprocesoformaly jurdico,cerrandolaoperacin
ante un notario publico, cuando se trate de mobiliario maquinaria y equipo, la entidad vendedora deber
expedir factura que ampare la operacin y sus caractersticas, por ningn motivo se debe de incidir en la
practicadeendosarfacturas,porqueelloimplicaquedareneldesamparofiscalalnocontarconeldocumento
originalqueamparaladeducibilidaddeladepreciacincorrespondiente.Unavezefectuadalaventadeber
darsedebajatantoelactivocomoladepreciacinacumulada,elefectonetoalsercomparadocontralaventa
darcomoresultadounautilidadoprdidaquedeberserllevadadirectamentearesultados.

Recur sosexter nosacor toplazo.

Pr oveedor es.

Eldiferimientodepagoaproveedoresconstituyeunadelasfuentesmsimportantesderecursosexternosa
corto plazo para una entidad ya que se allega de recursos materiales indispensables para la marcha y
operacindelaentidadquealnoserpagadosenefectivoalmomentodesuadquisicinseconstituyenenuna
importantefuentederecursosfinancierosenellapsocomprendidoentresucompraysupago.

Eltesorerodebeactuareficientementeencoordinacinconlafuncindecomprasparalaobtencindelplazo
decrditomsfavorableparalascondicionesdelaorganizacinsinqueestoafectesubuenamarcha.Inters
muyespecialdebedeserobjetolaatencindelosaspectosderebajasydescuentos:

Una rebaja es producto de una accin comercial por ejemplo rebajas por compras en volumen, tambin
denominadaseconomasdeescala.

Undescuentoesunanegociacinfinanciera,porejemplodescuentosporprontopago.

108
Cr ditosbancar iossingar anta.

Los bancos representan para las empresas una de las fuentes de recursos a corto plazo por medio de
prestamos, los cualesnormalmente se obtienen en base a la buenarelacin y a la experiencia que el banco
tieneconelsolicitante,estoscrditossonutilizadosparacubrirnecesidadesperidicasdeunaempresacomo
pueden ser las motivadas por una recesin, una recuperacin de cartera inferior a la pronosticada, las
expectativasdepagodeestoscrditosdebenserencuantoseregularicenlassituacionesquelosoriginaron.

Estos tipos de crditosregularmente se concentran alamparo de un pagareatravs de una lnea de crdito


concedidaalacreditadoypormediodeconveniosdecrditorevolvente.

Los crditos bancarios a corto plazo singaranta proporcionan el beneficio de larapidez en sutramitacin,
pero debe tenerse en cuenta que es el medio de allegarse recursos a corto plazo mas caro en el mercado
debidoalasaltastasasdeinters,ademsdequedeterminadoporcentajedelcrditosedebedejarintocable
en la cuenta de cheques, en calidad de reciprocidad, y el cobro de intereses por anticipado, adems de sus
respectivascomisionesbancarias.

Cr ditoscongar anta.

Lasfuentesmscomunesdeallegarsefinanciamientoderecursosexternosacortoplazosonlassiguientes:

Factor aje.

Tambin conocido como descuento de cartera, es un prstamo que otorga una empresa de factoraje a su
acreditado sobre la cartera (facturas a cargo sus clientes por cobrar que en si constituyen la garanta). El
vencimiento de este crdito se da simultneamente cuando vence la obligacin de pago de las facturas por
partedelosclientesdelaempresaacreditada.

Elpagodelacreditadoalaempresadefactorajesedaendosmodalidades:

1. Alafechadevencimientodelafacturaydelcrdito,elacreditadopagaelprstamoyleesdevuelta
sucartera.
2. Laempresadefactorajeseencargadelcobrodelasfacturasylecobraalacreditadounacomisino
tarifa por este trabajo y se queda con el dinero cobrado dndose as por pagado por parte del
acreditado aquellas facturas que no logra cobrar la empresa de factoraje, se las devuelve al
acreditado,quiendeberpagarelimportecorrespondientealaempresadefactoraje.

109
Cr ditoscongar antacolater al.

Mediante este tipo de crdito el acreditado obtiene un prstamo amparado con un pagare a favor de la
institucinacreditante.Aestepagareseleadosaunpagareofactura(debidamenteendosadocomogaranta
colateral)acargodelclientedelaempresaacreditada,lagarantaquehabitualmenteseexigeesde2a1en
estetipodecrdito.

Las garantas que se dan en este tipo de crdito permiten prever que si el acreditado no cumple con la
obligacin de pago, la institucin de crdito acreditante puede ejercer su derecho de garanta y cobrar el
pagareofacturasafavordelaempresaacreditada.

Cr ditocongar antadeinventar ios.

Enestamodalidaddecrditoelacreditadoofrececomogarantadepagosusinventariosloscualespuedenser
de materia prima, de productos terminados, enalgunos casos los de produccin en proceso, la garanta que
comnmentesemanejaenestoscrditosesde2a1.

Encasodequeelacreditadonocumplaconsuobligacindepago,lainstitucinacreditantepodrejercersu
derechodegarantadelarelacinde2a1,ademscomolosinventariosdeproductoterminadoseofrecena
preciodecosto,existeunagarantaobeneficioadicionaldepoderserrealizadosapreciosdeventa.

Recur sosexter nosalar goplazo.

Lasopcionesmscomunesdeallegarserecursosexternosalargoplazoparaunaentidadsonlassiguientes:

Cr ditosbancar ios.

Con frecuencia las empresas recurren a las instituciones de crdito para allegarse recursos financieros
pagaderosaplazosmayoresqueunao,estosrecursossonempleadosprincipalmenteparafinanciarcapital
detrabajo,adquirirmaquinariayequipo,obienparaconsolidarpasivos.

Contablemente estos prstamos se debenregistrar dentro del pasivo a largo plazo (tambin llamado pasivo
consolidado) al llegar el momento de las amortizaciones o pagos dentro del lapso de un ao posterior a la
fecha de elaboracin de los estados financieros, dicha proporcin deber reclasificarse al rubro del pasivo
flotanteodecortoplazo.

110
Car actersticasr estr ictivasdeloscr ditosalar goplazo.

Los contratos por este tipo de crditos especifican clusulas restrictivas aplicables al acreditado como una
forma de garanta de seguridad para el acreditante de recuperar el importe del crdito otorgado, dentro de
estasclusulassepuedenencontrarentreotraslassiguientes:

1. Mantener el acreditado un nivel mnimo de capital neto de trabajo que garantice la liquidez
financieraenbeneficiodelnegocioenmarcha.
2. Laabstencindecontratarotroscrditos,dandocomogarantalascuentasporcobrar,losinventarios
olosactivosfijos.
3. Subordinarseelacreditadoanoobtenerotroscrditos(exceptoproveedoresregulares)sinocuenta
conlaautorizacinpreviaporpartedelacreditante,incluyendoelarrendamientofinanciero.
4. Nopuedeentrarelacreditadoenprocesosdefusionesocombinaciones.
5. Elacreditadodebemantenerlossueldosdesupersonaldentrodelosparamentosdefinidos.
6. Elacreditadodebemantenerdentrodeloposibleasushombresclave.
7. Nodeberepartirdividendoselacreditadoobiendecretarelpagodeestosenporcentajediferenteal
previamenteacordadoconelacreditante.
8. Utilizarnicayexclusivamentelosfondosobtenidosparalosfinessolicitados.

Fondosguber namentales.
Con el fin de fomentar la actividad econmica, en determinadas zonas o regiones del pas los gobiernos
federales,estatalesymunicipalestambinparticipanotorgandoapoyocrediticioalasempresas,estosapoyos
tambininsertanensuscontratosclusulasespecialessimilaresalosotorgadosporlaBancaComercialyse
dangeneralmenteentresvertientesquesonlassiguientes:
1. ComoprstamosenlasmismascondicionesquelaBancacomercial.
2. AceptandodescuentosdecarteraafavordelaBancacomercial.
3. Ingresandocomoaccionistasalaempresaacreditada,conlaobligacindequepasadociertoplazo
losaccionistasdelaempresaapoyadacomprenlasaccionesdeacreditado.

Ar r endamientofinancier o.
El arrendamiento financiero es la operacin mediante la cual una empresa de arrendamiento financiero
(arrendador)adquiereparasibienesdecapitalparadarlosenrentaauncliente(arrendador)elcualseobliga
al pago de una renta efectuando de esta manera una amortizacin a la inversin del inmueble o equipo
arrendado.Llegadoelplazodevencimientodelcontrato,elarrendatariosileconvienepuedepagarelsaldo
previamentepactado,(Comnmentellamado"valorderescate")yadquierelapropiedaddefinitivadelbieno
puedenoejercerdichaopcinsinningunaobligacindesuparte.

111
Esta modalidad de obtencin de recursos no es nada ms que un prstamo a largo plazo con garanta
prendara,yaquesielarrendatarioincumpleconelpagodelasrentasalarrendadoresteltimosequedara
conelbienarrendado.

Emisindebonos.
Unbonoesundocumentomedianteelcualunaempresacertificaquehatomadoenprstamociertacantidad
de dinero que proviene de personas fsicas o morales y que se compromete a pagarlo en un futuro
determinadodeacuerdoconlascondicionespreviamenteestablecidasenlaqueseestipulantambinelpago
de intereses. Las emisiones de bonos estn sujetas a la regulacin y vigilancia de las autoridades
gubernamentales para proteger los intereses del pblico inversionista y garantizar el pago del bono al
vencimientoascomoelcumplimientodetodaslasobligacionesofrecidasporelemisor.

Pr ocesodecaja.
LaCajaeselconjuntodemedioslegalesdepago,representadospordinero,girospostales,telegrficos,etc.
dedisposicinlibreeinmediata.Bancoses elconjuntode medioslegalesdepagosustitutosdeldineroque
estnrepresentadosporsaldosdisponiblesencuentasdechequesodepsitosalavistaqueseconviertenen
dinero a su presentacin. La caja reviste un especial inters desde el punto de vista de control contable y
financieroyaquelacajaeselconceptobsicoydemayortransferenciaydesdeelpuntodevistaderiesgoes
elaspectomsvulnerable,debidoprincipalmentealosriegosinvolucradosporloquesurgelanecesidadde
suproteccinycontrol,sehacenecesarioreduciralmnimoelusodecajaparaminimizarlosproblemastanto
comoseaposible,yalmismotiempodarunbuenusoal dinerodelamejorformaylamsefectivaposible
Elprocesodecajaseiniciaconunaidentificacindedonde,comoyporquefuncionaencadaorganizacinen
particular,sedeberdetomarencuentasielfuncionamientoactualdelacajaeseladecuadoosiexisteuna
mejorformadeoptimizarsuactividad.Porejemploesrealmentenecesarioqueunvendedoraceptecobros
declientes?,Siloshaceesadecuadoelprocedimientoparaelenviodepositooportunodeldinero?Talvez
esta poltica tendr como objetivo acelerar la cobranza encuyo caso se debe de evaluar y determinar si se
justifica este procedimiento. En la mayora de las situaciones los recursos financieros se amplan por si
mismoshaciaotrotipodecontroles,estoscontrolesseextiendenhaciaestimacionesdedineroquesedeben
recibirdedistintasfuentesylaformadecmosedisponedelestonoserefierealosaspectoscontablesque
controlanlosingresosylosegresosacaja,comoeselcasodecuentasporcobrarylascuentasporpagarysus
registros complementarios, la referencia es hacia los ingresos a caja y los egresos que tienen origen en
determinados periodos de tiempo, en aquellos casos en donde el nivel de control sea bajo deber tenerse
mayorcuidadoencorregirlos.
LoscontrolesdeCajapuedenenfocarsedesdedospuntosdevista,unodesdeelpuntodevistaexternopara
asegurarsequeeldineroqueseharecibidoesrealmenteelquedebirecibirseyelotroesdesdeelpuntode
vistadelempleado,paraasegurarsequeelingresoqueestarecibiendonoloestadesviandohaciaotrosfines,
paralocualsedebentenerencuentalosiguiente:
1. LaContabilizacindebeefectuarselomsrpidoposible.

112
2. Losregistroscontablesdebenestarorientadoslomaspracticoposible
3. Sedebeninstituircontrolesparaasegurarsedequesecobrenlosservicios
4. Sedebeutilizarhastadondeseaposibleuncontroladicional
5. Conciliarlosingresosdecaja
6. Separarlosingresosdecajadelosegresos
7. Losingresosdecajadebenpermanecerintactosydepositarsedeinmediato
8. Debencontabilizarseadecuadamentetodaslascontrapartidas
9. Losregistroscontablesdeingresosdebenseroperadosdemaneraindependiente.

Contr olesbsicosdecaja.
Existenalgunoscontrolesbsicosenelmanejodecajaparalainterrelacindelasactividadesdeingresos y
egresos,sinembargoexistenciertoscontrolesadicionalesbsicosquesepuedenconsiderarbajoelconcepto
demanejoycustodiadelacajaentrelosqueseencuentranlossiguientes:
1. LaSalvaguardaFsicadebeserAdecuada.Estodependerdelacantidaddedineroquesemaneje
normalmente y de los riesgos involucrados. En ciertos casos un simple gabinete puede cubrir la
necesidad,habr otros en que se requiera una pequea caja fuerte y si la necesidad as lo amerita
habrdepensarenunabvedadeseguridad.
2. AseguramientodeValores. Esnecesarioqueeldineroestecubiertocontrariesgoscomoelrobooel
fuegoporlotantosedeberestablecerunapolticaquecubraestosriesgosenunniveladecuado.
3. El Dinero en Caja debe mantenerse en los niveles mnimos posibles. Tener una gran cantidad de
dineroenunlugarimplicaungranriesgodeperdidahablandoenunsentidofsico,ademseltener
muchodineroociosoreduceelpotencialderendimientoalnoutilizarloefectivamente,porlotanto
mantenerunnivelmininoadecuadodedineroencajaesunacontribucinimportantealosintereses
delaorganizacin
4. DentrodeloPracticosedeberealizarcualquierpotencialdeutilidades.Envirtuddequeltermino
decajaseutilizaparadesignareldinerodisponiblequeseencuentraalamanoascomoelquese
encuentradepositadoencuentasbancarias,esnecesarioreconocerlasutilidadespotencialesquese
puedenrealizardentrodelopracticoatravsdelmanejodeldineroenfondosdeinversinuotros
arreglossimilares,sedebedetomarencuentatambinquesedebenmantenernivelesadecuadosde
saldos en las chequeras de los bancos los cuales en ocasiones sirven como referencia para la
obtencindecrditouotrosserviciosbancariosenundeterminadomomento,elobjetivoesexplotar
almximoposibleestospotenciales.Enalgunoscasosesrecomendablemantenersolamentesaldos
deloschequesentransito.
5. Afianzar a los Empleados. La prudencia normal en todos los negocios requiere que se tengan
afianzadosatodoslosempleadosqueparticipenenalgunapartedelprocesodecajadeestapoltica
se derivan beneficios tales como la proteccin de la organizacin en caso de algn desfalco o uso
indebidodefondosdesupropiedad,otroeselaspectopsicolgicodelosempleadosporejercerun

113
alto cuidado e integridad. Para cumplir con este propsito se requiere hacer publicidad de esta
poltica.
6. Mxima explotacin de los recursos mecnicos. Actualmente se han desarrollado un considerable
numeroderecursosmecnicosquesirvenparacubrirdiversasfasesdelprocesodecaja,comoson
registroscontables,proteccinfsica,mejorcontrolyeficienciaensumanejo.Lascajasregistradoras
modernassonejemplodecmoprotegeneldineroatravsderestringirelaccesoal,establecenun
registro base para la contabilizacin y motivan a un buen control a travs de registros visibles de
transacciones.Losbeneficiosespecialesdelamayoradelosrecursosmecnicosesqueaseguranel
manejouniformedealgunosaspectosoperativosyaunniveldecontroldeseado,sedebendetomar
encuentatodaslasoportunidadesysaberlasexplotaradecuadamente.
7. MantenimientodeRegistrosActualizadosyReporteOportuno.Esmuyimportantequeentodaslas
partes del proceso de caja todos los registros estn actualizados de tal manera que sirvan de
referencia en el momento que se requieran y para la preparacin oportuna de reportes peridicos.
Simultneamentesepresentaunaimportantemotivacinpsicolgicahaciaelpersonalqueparticipa
en el proceso de caja y es la relativa a la necesidad del especial cuidado. Cualquier retraso en el
desarrollodevariaspartesdelprocesodecajapuedegenerargrandesriesgosfsicosyrestricciones
paraunaeficienteutilizacindelosrecursosdecaja.
8. ControldeChequesenBlanco yOtrosSuministros.Unadecuado controldecheques y formases
muyimportanteentrminosdeproteccinfsicayusoeficiente.Enelcasodelprocesodecajaeste
controlrevisteespecialimportanciaenvirtuddequeciertasformascomoloschequesenblancose
debenprevenirlosusosindebidos.
9. Conciliacin Independiente de Las Cuentas Bancarias. La conciliacin peridica de las cuentas
bancariasrepresentaunimportantepuntodecontroltantosobrelasrecepcionesdecajacomosobre
lasactividadesdelosegresos,esmuyimportantequeestasconciliacionesseanhechasporpersonal
independientealdelasoperacionesregularesdeingresos yegresosdecaja.Los estadosde cuenta
bancariosdebernserobtenidosorecibidosdirectamentedelBancoparaasegurarsedequenohan
sidoalteradosporalgunaotrapersonaintermediaria.Lasconciliacionesbancariasademsproveenla
oportunidadderevisarvariosaspectosdecmosonmanejadoslosingresosylosegresosyadems
ayudanacorregirsituacionespocousuales.

Manejoycustodiadevalor es.
El manejo y custodia de valores representa un especial problema de control que es muy importante,
especialmenteparalasinstitucionesfinancierascomolosbancosocompaasdeinversin.Enelcasodeuna
entidad tpica elmanejo de valores se puede delegara una institucin financiera. Esmuy comn que en la
contratacin de valores sea cuestionada su adquisicin por ejemplo el importe y tipo de valores. La
responsabilidadenestoscasosrecaeeneldirectordefinanzasnoeneltesoreroyaquesuresponsabilidadse
circunscribealmanejoentrminosdecustodiaycontrol.

114
Paraestablecerprocedimientosquegaranticenunaadecuadacontabilizacinysalvaguardadelosvalores,los
requerimientosoperacionalesaquincluyenlarecepcindelosvalores,elaccesoaellosysudisposicinenel
momentoadecuadoparaefectosdeventauotropropsitoautorizado.

Recepcindevalor es.
Los valores comprados pueden ser nominativos a la organizacin o al portador. Aun cuando estos ltimos
tienencomoventajasufcilaccesoparacubrircualquiereventootransferencia,tieneunriesgomuygrande
de robo. Sin embargo tratndose de valores usados como garanta colateral y por algn otro propsito
especificodelosclientesuotraterceraparte,laorganizacinnotieneeleccinenlaformadeestosvalores.
Encualquiercasolarecepcindevaloresporpartedealgnfuncionariooempleadodela organizacinasume
concomitantementeunaresponsabilidadquedebeserregistradayreconocidaporlapropiaorganizacinpor
loquesedebenestablecercontrolescontablesyfacilidadesfsicasqueasegurenunaadecuadaproteccinen
elmanejodevalores.
En todos los casos se debern contabilizar y en los mismos registros definir claramente que persona es
responsableporlacustodiadevaloresylaaceptacinimplcitadeestaresponsabilidadporpartedeella,una
buena medida de control interno es aquella que adems de los registros contables se lleve un registro
extralibros,poralguienindependientealencargadodelacustodiadevalores.
Losregistrosaqumencionadosdebenconsideraralvalorensideloscuponesparapagodelosdividendos
interesesetc.yaqueestoconsideraelestaralpendientedelcobrooportunodeestoscupones.

Manejodevalor es.
Existeotroproblemaadicionalyeslreferenteaqueotraspersonasademsdelaresponsableporlosvalores,
requieran acceso a los mismos, un control efectivo para estas circunstancias, necesitan primeramente que
estasotraspersonasestndebidamenteautorizadasparateneraccesoalosvalores,unsegundorequerimiento
esquelainspeccindelosvaloresseallevadaacaboconjuntamenteentreelcustodianteylasotraspersonas.
Enelcasodecuponespordividendosointeresesresultaserbuenprocedimientoacudiraunainstitucinde
crditoyencargarleelcobrorespectivo,paraefectosdecontrolsimultneamente,alaentregaalainstitucin
se debercrearunacuentaporcobrarenlosregistrosdelaorganizacin.
Enresumenlasconsideracionesdesdeelpuntodevistadecontrolsonlaadecuadaproteccinfsica,registros
contables clara y adecuadamente establecidos y el acceso a los valores debe ser sobre una base dual un
requisitobsicoadicionalesafianzaralpersonalquemanejaotieneaccesoalosvalores.

Egr esos.
Elobjetivodelosegresosesqueseanvalederosyparapropsitosdelaentidad,queseanrazonablesconel
beneficiorecibido yquelacuantificacindeesaserogacionesseacorrectaentrelosprincipalesaspectosde
controlseencuentranlossiguientes:

115
1. Separacin de la Funcin de Egresos. Las recepciones a caja y los egresos de caja, en el proceso
totaldecajadebendeestarseparadostantocomoseaposible,elingresorecibidosedebecanalizaral
reacentraldedepsito,yelegresodebesermanejadoycontroladoporseparado.
2. DocumentacinSoporteparalaLiquidacindeCuentasporPagar.Enlamayoradelasempresas
lasoperacionesfinancierasylosprincipalestiposdegastossonmanejadosatravsde cuentaspor
pagar, las cuales son liquidadas va egresos de caja, simultneamente el egreso debe ser revisado
paravalidarelconceptoapagarylapocadepago.
3. FondosdeCajaChica.Losfondosdecajachicasirvenparacubriralgunosgastosoimprevistosque
requieren pago inmediato y que son en cantidades pequeas, porlo que no justificanlaaplicacin
formaldelprocedimientodeegresos,lacajadebeestarpreparadaparacubrirestasnecesidades,las
cuales se pueden cubrir por medio del establecimiento de un fondo fijo revolvente, bajo este
procedimiento se designa una cantidad fija contra la que se efectan gastos menores que
peridicamentesereembolsaranexactamenteporlamismacantidaddelogastadoparaasvolvera
tener el fondo con lamisma cantidad de dinero asignado de origen, los documentos recibidos que
soportenelingresoindividualsernlabasedelrespaldodocumentalparaelreembolsodelfondo.
4. La cantidad asignada deber ser suficiente para satisfacer el pago de los gastos que se tengan que
erogar,sedebetomarencuentatambineltiemporequeridoparasureposicin,paraevitarqueun
momentodadonopuedadarseelservicioenestetipodepagosporhabersepresentadoelproblema
dequeelfondoesteagotadoyelreembolsoesteentramitedereposicin.Elniveldelfondopuede
ser cambiado en cualquiermomento de acuerdo conlasnecesidades que se vayan presentado y de
acuerdoalasnuevasexperienciasycondiciones.Algunosaspectosimportantesrelacionadosconel
manejo de los fondos de caja chica para poder satisfacer la evidencia que soporte el gasto, si la
evidencia no esta disponible en forma de factura, tira de maquina registradora o remisin, ser
necesarioqueelreceptordeldineropreparey firmeundocumentoespecial,mismoquedebe estar
autorizadoporunfuncionariocompetente,asmismoladocumentacinsoportedebesercanceladaal
momento de su pago para evitar que se vuelvana usar. Continuamente se tienelatentacin deno
preocuparseporobtenerladocumentacinadecuada,setienetambinlatentacindeusareldinero
encajaparapropsitosindebidos,comosonlosautoprstamos,ladocumentacindebeserrevisada
enelmomentodelreembolsoysedebenpracticarcontinuamentearqueosdecajaparadetectaralgn
usoindebido.
5. Uso de Fondos para Anticipo. En algunas situaciones se presentan necesidades de proporcionar
anticipospormediodechequesparaalgngasto,enestoscasossonaplicableslosmismosprincipios
enunciadosenelprrafoanteriorparaelmanejodeladocumentacinsoporte,elusodelfondoyla
cantidadasignadaparaelfondo.
6. ControldeFirmasdeCheques.Enlamayoradelassituacionesesrecomendablequeserequieran
dosfirmasenloscheques(Mancomunadas),locualsirvecomochequeocruzadoentreunapersonay
otra,esteprocedimientoestilparaprevenirfraudesyerroresascomoparatenerunbuencuidadoy
juiciosobreloqueseestaejerciendo,existentambinsituacionesendondeenvesdefirmaseusaun

116
fascmil,enestecasoelpuntomasimportantedecontrolconsistirenlasalvaguardadelfascimily
lascondicionesparasuuso.
7. Designacin de Beneficiarios de Cheques. Todos los cheques que se emitan deben ser pagados a
individuosespecficosoempresasdelasqueseobtuvierenlosbienesoservicios.Sedebendeevitar
los pagos en efectivo y la emisin de cheques al portador, estas prcticas jams debern ser
adoptadasporlaorganizacinparaevitarunmalusodeldinero.
8. MximaSeparacindeDeberesyResponsabilidades.Esmuynecesarioqueenelprocesodecajase
establezcaladivisindefuncionesylaasignacinderesponsabilidadesalpersonalinvolucradoen
su manejo, por ejemplo una persona revisa la documentacin otra prepara el cheque, una tercera
revisa la propiedad de la documentacin soporte, una cuarta proporciona la primera firma y una
quintalasegundafirma,deestaformacadaactividadseconvierteenchequeodelaotra.

Natur alezadelpr ocesodecuentaspor pagar .


Laoperacindecualquierorganizacinrequierenecesariamentequehayagastos,los cualespuedenserpor
materiales, productos, equipos, sueldos y salarios y servicios de diversa naturaleza. Todos estos gastos
involucranlacreacindeobligacionesparalaorganizacin,algunasdebernliquidarsedeinmediatoyotras
posteriormenteaunafechadeterminada.
Elprocesodeestascuentasestarelacionadoconelreconocimientodetodaslasobligacionesyelsubsecuente
control y manejo de ellas, cuando estas obligaciones son liquidadas, elproceso de cuentas por pagar surge
conjuntamenteconelprocedimientodeegresosyacomentado.
Deestamanerasegeneraelprocesodecuentasporpagarporlasactividadesoperativasdelaorganizaciny
enfocado principalmente al proceso total de control financiero. El control financiero esta conectado con la
rapidezyseguridadconquetalesobligacionesseanformalmentereconocidas,lalegitimidadypropiedadde
esasobligacionesylosprocedimientosestablecidosparasuliquidacin.
Elprocesodecuentasporpagarinvolucraactividadesquecaendentrodegruposperfectamentedefinidos.
Laprimeratienequeverconlacreacindelacuentaporpagar,elcontroldelacantidadapagarycomose
determinaralavalidezdelpasivo.
Elsegundogrupoinvolucravariasactividadesreferentesalaadministracindelascuentasporpagaryque
clasedeproblemasespecialesseencontraranentrminosdesuregistroycontrolyfinalmentelareferenciaes
hacialosprocedimientosporloscualesunacuentaporpagarindividualespreparadaparasupago,incluyendo
laemisindelchequequecubrasuliquidacin,elproceso depago bajolos conceptosantescitadosserel
siguiente:

Cr eacinde lascuentaspor pagar .


Existeunagranvariedaddecausasquepuedenoriginarunacuentaporpagar,normalmenteylaquegenerael
mayorvolumeneslaquesurgedelacompradeproductosyserviciosatravsdeldepartamentodecompras,
estos productos pueden ser comprados para su venta o para ser usados en la elaboracin de productos y

117
serviciosparaservendidosporlaorganizacin.Adicionalmentemuchascomprasdeproductosyserviciospor
diversas razones pueden ser procurados por personal de la misma organizacin que este involucrado
directamenteenactividadesdelalneaostaff.
Entrminosdeimportanciaeconmicalacomprapuedefluctuardesdeunvalorinferiorhastalacomprade
bienesdecapitaldeunaltocosto,entodosloscasoselcontrolbsicoestribaenquetodaslasobligacionesse
incurransolamentedentrodeloslimitesautorizados.
Estoslmitesdeautorizacindebernincluirlaclasedegasto,ellmitedelgastoylaincurrencaindividualde
cada obligacin en particular. Se debe tener muy en cuenta en estos casos la delegacin y autoridad para
realizar este tipo de gastos vigilando que se haya respetando los niveles de autoridad asignados para cada
caso. En aquellos casos en los que se hayan tomado decisiones por circunstancias emergentes habr que
cerciorarsequeverdaderamentefueronemergenciaynonicamentepretextosparatomarseatribucionesque
nolescorresponden.
Elementos que constituyen la Validez de una Cuenta por Pagar, en lo relativo al origen de una cuenta por
pagar, desde el punto de vista de control financiero, existe cierto tipo de objetivos comunes a todo tipo de
cuentasporpagarentreloscualesseencuentranlossiguientes:
1. EsRazonableelTipodeGasto.Esteobjetivopersiguequeelgastosearazonabledependiendode
las operaciones de la organizacin, normalmente esta relacin en si misma es evidente, pero en
algunos casos pudiera ser parcial o totalmente obscura, en cuyo caso cualquier duda requiere ser
probada con una razonable explicacin, el alcance en estos casos depender de la jerarqua del
funcionarioinvolucrado.
2. Son Excesivas las Cantidades? Aqu la pregunta es si el gato es de una magnitud razonable en
trminos de cantidades y volmenes comprados. Las presiones de los altos niveles pueden ser
obtenerbajospreciososimplementeallegarsedebuenosvolmenesdereservaparalasnecesidades
operacionales, en cualquier caso esta en juego un buen nivel de juicio que estar sujeto a una
razonable evaluacin, la desviacin causada por el exceso sobre los niveles normales debe ser
enjuiciadaorechazadaporlosfuncionariosquetienenasucargoestegastoenparticular.
3. Estn Correctos Los Precios y Trminos? En este aspecto los precios y trminos tienen dos
enfoques. Uno esta relacionado con la correccin en trminos de los acuerdos previos acerca del
costo de los gastos. El otro serefiere a la forma de obtencin de estos precios y trminos, en este
casonadasepuedehacercuandounacuentaporpagarestadefinida,perosisirvedebaseparagastos
futuros. Los precios y trminos incluyen listas de precios, descuentos, poca de pago, fletes,
garantasetctera.
4. EsApropiadoelValorRecibido?Lareferenciaenestacasoeshacialapropiedaddelbienquese
esta adquiriendo: Por un lado habr de cerciorarse que los servicios facturados realmente se estn
recibiendo,porelotrosedebe verificarquelos servicios omercancastenganlasespecificaciones
correctas, as como las condiciones y calidad obteniendo la evidencia adecuada de que se estn
cubriendoestosaspectos,silacuentaporpagarsevaavalidarantesdelarecepcindelvalorenla
forma antes descrita, de nueva cuenta se requerir la aprobacin de un funcionario autorizado,

118
ademshabrlanecesidaddeimplementarcontrolescomplementariosquesirvanparachecarquese
cumplaconesterequerimiento.
5. SonAdecuadaslasAprobaciones yEvidenciasdeSoporte?Paravalidarlascuentasporpagarse
requieredeunaadecuadaevidenciadocumentalquelassoporte.Estaevidenciapuedeconsistirenla
documentacin base como es la orden de compra y los reportes de recepcin, incluir tambinlas
aprobaciones especificas debidamente otorgadas por funcionarios calificados Estas aprobaciones
especificascubrendiversosaspectosrelativosalavalidacinyencadacasoserequierepreguntarsi
lapersonaqueapruebatienelaautoridadsuficienteyelniveldeautorizacinesadecuado.

Administr acininter mediadelascuentaspor pagar.


Enalgunoscasoslaadministracindelascuentasporpagarsecubreautomticamenteenlafasedeegresos.
Enotroscasoslascuentasporpagarvalidadasestncondicionadasaunaposteriorliquidacin.Desdeelpunto
devistadecontrolesesdeseablereconocerformalmenteelpasivolomsprontoposible.Sinembargopuede
sermseficientelograrsucontrolatravsdemecanismosdearchivoydiferirelreconocimientoformalhasta
el momento de su pago, o bien hasta el fin del periodo contable lo que suceda primero, bajo estas
circunstanciasexistenvariosasuntosquesedebenmanejarcomosonlossiguientes:
1. CoordinacinyControldeDocumentosdeEntrada.Enunadecuadosistemadecontrolinterno,los
diversospapelesrelacionadosconlascuentasporpagarenloindividualfluyendirectamentehaciael
departamento de cuentas por pagar. Estos papeles incluirn una copia de la orden de compra, el
reporte de recepcin del departamento correspondiente, formas de reclamaciones por faltantes o
deficienciasdecalidad,cargosportransportacinpagadaporcuentapropia,yeloriginalycopiasde
las facturas enviadas por el proveedor. Todos estos documentos debern ser archivados
adecuadamentedeformaquefacilitensuintegracincomosoportedelpagofinal.
2. Distribucin Contable. Todos los egresos deben ser cargados a su cuenta de resultados
correspondiente o de balance de acuerdo a como lo estipulen las polticas y procedimientos
establecidos,enalgunoscasostambinsedeberhacerelcorrespondientemovimientopresupuestal.
Elanlisis de la distribucin correctarequiere unadecuado conocimiento dela estructura contable
total,ladistribucinpuederequerirformasypapelescomplementarios.
3. Cuentas de Control en el Libro Mayor. Una vez que las cuentas por pagarhan sido formalmente
reconocidas,sucontroltotalsepuedelograrpormediodecuentascontrolenellibromayorelcual
debechecarseperidicamenteparadeterminarquelasumadelaspartidasindividualescoincidecon
el saldo de la cuenta control, cualquier error que se detecte en estas cuentas deber ser checado y
conciliadoconelproveedor.
4. Programacin de Pagos. En esta etapa se deben establecer controles adecuados para aprovechar
algunosbeneficioscomosonlosdescuentosporprontopagoytenerunbuencontrolsobrelasfechas
depagoyprocurarmantenerbuenasrelacionesconlosproveedoreslocualdependeenbuenaparte
dequelospagossehaganoportunamenteenlascondicionesyfechaspreviamenteestablecidas.

119
Revisinfinaldepago.
Estaeslafasefinaldeunacuentaporpagarqueconsisteenlapreparacindelacuentaparaprocederasu
pagocorrespondiente,losprincipalespuntosenestaetapaincluyen:

1. Integracin y Cheque Final de la Documentacin Soporte. Toda la documentacin soporte


pertinentecomoeslaordendecompra,elreportedelarecepcin,lafacturaetc.debernserreunidas
yrevisadasdesdeelpuntodevistanumrico,administrativoyenloaplicablefiscal.Elconjuntoas
integrado(fsicamente)serlabasepararequerirlapreparacindeunchequeporpagar.
2. DeduccindeReclamaciones.Losprocedimientosdecontrolenestecasodebernestarenfocados
paraidentificar toda clase de reclamaciones que se pueden hacer a un proveedor determinado con
objetodededucirlasparasuprximopago.Enalgunoscasoshabrconceptospendientesdededucir
hastahacer unainspeccin o periodo de prueba, lo que se requiere en este punto es estaratento a
efectuarlasdeduccionesaquehayalugar.
3. PreparacindelCheque.Larequisicindelchequesoportadaconelpaquetedecomprobantesantes
mencionado,sesujetaraaunarevisinindependienteyunavezaprobadaporunapersonaautorizada
seturnaraaaquellaspersonasquepreparenfsicamenteelcheque.
4. RevisinFinalyEntrega.Elchequeyladocumentacinsoportefinaldelacuentaporpagarestn
yaahoraencondicionesdeserrevisadasporunrevisorindependiente.Estosrevisoressernlosque
proporcionen la primera firma del cheque o los que den la autorizacin inicial para que un
funcionario lo firme, Si un cheque ha sido firmado en forma mecnica la aprobacin validara tal
accin,enestaetapalosrevisoresyfirmantessonresponsablesdequeladocumentacinsoporteeste
completaycerciorarsedequelavalidacinseacorrecta.
Una vez que esta fase concluye, el cheque y la documentacin que lo soporta debern ser cancelados de
alguna forma que prevenga un nuevo uso y el cheque deber ser enviado o entregado directamente al
proveedor.

Separ acinder esponsabilidades.


El proceso de cuentas por pagar puede variar en muchos aspectos dependiendo de las necesidades y
caractersticasdecadaorganizacinydecadasituacinenloindividual,especialmenteenelcasodesistemas
computarizadosdebedehabermuchasydiferentesclasesdeprocedimientos,encualquieradeestosarreglos
por procedimientos el aspecto mas critico desde el punto de vista de control financiero es que la diversas
actividadesdeprocedimientosseanasignadasseparadamenteaindividuosdiferentes,laseparacinresultante
ylaindependenciasonfactoresdesumaimportanciaparaefectosdechequeocruzadoyasasegurardeesta
maneralacorreccindelegreso,loanteriorsirveparaprevenirmanipuleosentrelosindividuosquecreanel
egreso o relevan de la obligacin de pagar y pueden as obtener alguna utilidad, este criterio es tambin
aplicablealaseparacindepersonasquecontabilizan.

120
Pr ocesodeotr ascuentaspor pagar.
Existen otro tipo de actividades operacionales que tambin generan cuentas por pagar, no obstante que
algunasdeestasseenfocanprincipalmentealproceso operacional,entrelasmscomunesseencuentranlas
siguientes:

Gastosdeviaje.
Este tipo de cuentas por pagar reviste caractersticas muy especiales como son las obligaciones que se
incurren por concepto de gastos de viaje. La secuencia usual es entregar anticipos a las personas de la
compaaqueviajanyacreditarcontraestosanticiposcuentasdegastosperidicasdebidamenteautorizadas,
lanaturalezabsicaesqueestetipodecuentasporcobrardebeserconsideradentrodelascuentasporpagar,
debido al hecho de que los anticipos con frecuencia crean un problema operativo adicional cuando son
desviados de su propsito original cuando las personas que los reciben los utilizan para cubrir otro tipo de
necesidadesdetipopersonal,enotroscasoseldineropuedeserusadolegtimamenteperoenformaindebida,
en ocasiones los viajeros se demoran en la presentacin de sus cuentas de gastos para relevarse del
compromisoquetienenreflejadoenlacontabilidad,porloqueesnecesariollevarunseguimientosistemtico
paraobtenerregistrosyreportesoportunosdelascuentasdegastos.
Los problemas mas comunes que se presentan en la validacin de la propiedad de los gastos para su
reembolsooamortizacincontralosanticipossonlossiguientes:
1. Elviajeropuedehaberincurridoengastosatravsdelosnivelesestablecidosporlaorganizacino
enausenciadetalesnivelessehaexcedidodelosnivelesprudentes.
2. Lareclamacindepartidasquenoestndebidamentedocumentadasydejanlaposibilidaddequelas
partidasestnalteradas.
3. Losgastosderepresentacinpuedenhabersidoenbeneficiodepersonasajenasconlosnegociosde
laorganizacinobienqueestosgastosseandudosos
4. Losgastosnocuentanconlaaprobacindelossupervisoresresponsables.

El manejo de estas cuentas es especialmente difcil cuando la naturaleza de los gastos se somete a algn
juicio:Porloqueesnecesarioestablecerpolticasquecubranlosdiversostiposdegastos,losprocedimientos
deben ser monitoreados continuamente. Esto significa que las dudas deben surgir cuando las polticas
establecidas son violadas indebidamente, o cuando la evidencia no es lo suficientemente clara, Se deben
requerir las facturas y notas de alimentos, hoteles tanto como sea practico y posible, los controles son
necesariostantoparapromoverelsoportequerequierenlosgastosdelacompaacomoparaminimizarlos
riesgoscomosonlatentacinlatentedeusareldineroenusospersonalesdistintosalosdeviaje.

Actividadesfinancier as.
Las actividades financieras tambin originan la creacin de cuentas porpagar y el control financiero de su
proceso,lasactividadesfinancierassepuedendividirendosgruposdiferentesperointerrelacionadosentresi

121
de acuerdo a sus necesidades. Uno es el que se refiere a los propsitos a corto plazo el cual incluye
principalmentelosprstamosobtenidosdelosbancosyotrosfinanciamientossimilares.
La otra clase de actividades financieras esta relacionada con las necesidades a largo plazo. Esta ltima
necesidad puede ser resuelta por la va de aumento de capital, emisin de acciones o contratacin de
prstamosalargoplazo.Enelcasodeemisindeaccioneslosprocedimientosadetallesonmanejadosporlas
instituciones de crdito que actan como agentes. Los procedimientos de control mantenidos por la
organizacinnodebensertansofisticados,auncuandosidebenconsiderarcuandomenosbuenainformacin
respectoalosmontosapagarincluyendolosinteresesapagaralafechadepago.

Gastosacumulados.
El objetivo desde un punto de vista operacional es el determinar el desarrollo financiero a travs del
reconocimientodelosgastosaplicablesacadaperiodoyqueestnpendientesdeprocesarcomounacuenta
por pagar normal. Estos gastos son de hecho un reconocimiento preliminar de obligaciones que
posteriormente tendrn un completo reconocimiento y pasaran a su correspondiente liquidacin, entre este
tipodegastosseencuentranlosinteresesendocumentosporpagar,impuestos,sueldosysalarios.Elobjetivo
de control consiste en reconocer todas las acumulaciones pertinentes y contabilizarlas de la manera ms
prcticaposible.

Documentospor pagar .
En muchas situaciones el proceso de cuentas por pagar puede ser cubierto mediante la aceptacin de
documentos por pagar. En este caso el tratamiento que se adopta usualmente cuando se trata de periodos
largosdepagoydondeseestipulaninteresesdepormedio.Elproveedorporsupartepuededeseardisponer
deestrosdocumentosparadescontarlosenalgunainstitucindecrditoousarloscomogarantacolateral.En
otras situaciones los documentos por pagar vienen a sustituir a las cuentas por pagar cuando estas no son
liquidadasoportunamente.Desdeelpuntodevistadecontrol,elinterssedirigirhacialascondicionesen
que se creo el pasivo y los procedimientos que aseguren un pago oportuno de la suerte principal mas los
intereses,sehacenecesariocontarconregistrosdetalladosdesoporteparaefectosdereferenciaycontrol.4

4
SANTILLAN,GonzlezJuanRamnIntroduccinalControlInternoatravsdelosciclosde
Transacciones ,EditorialEcafsa.
122
OBJ ETIVOSDELCAPTULOV.

v DaraconocerelfuncionamientodelreadeRecursosHumanos.
v EstablecerelManualdeldepartamentodeRecursosHumanos.
v Mencionarlossistemasdecapacitacin.
v Verificarqueseestnllevandoacabolaspolticasdeseguridadehigiene.
v Destacarlaformaderemuneracindelostrabajadores.
v Determinarquesellevenacabolaspolticasestablecidasporlaempresa.

J USTIFICACIN.

LaprcticaqueserealizenlaSociedadCooperativaTrabajadoresdePascual,S.C.L.,nosmostrelcontrol
internoquesellevaacabodentrodelreadeRecursosHumanosascomosufuncionamientodelosdiferentes
departamentos.

Porlotantoesimportantedestacarlaspolticasyprocedimientosquetienenimplantadosparaelmanejodel
personalylaformadecapacitacinseguridadeincentivosqueselesdaasustrabajadoresdentrodelreade
trabajo.

123
CAPTULOV:CASOPRCTICO.
ELDEPARTAMENTODERECURSOSHUMANOSDELASOCIEDADCOOPERATIVA
TRABAJ ADORESDEPASCUAL,S.C.L.

5.1 ElDepar tamentodeadministr acindeper sonal.


5.2 Planeacindeper sonal.
5.3 Suninistr odeper sonalalaempr esa.
5.4 Administr acindesueldosysalar ios.
5.5 Capacitacinydesarr ollodeper sonal.
5.6 Evaluacindeldesempeo.
5.7 Higieneysegur idadeneltr abajo.
5.8 Manueldepolticasypr ocedimientos.

124
CAPITULOV:CASOPRACTICO.

5.1.DEPARTAMENTODEADMINISTRACINDEPERSONAL.

5.1.1.Impor tanciadelDepar tamentodeRecur sosHumanos.

Algunos de los objetivos primordiales de la cooperativa, son entre otros proporcionarle a la sociedad un
producto de excelente calidad, obtenerremanentes por estos logros, y satisfacer lasnecesidades de todo su
personalenltimotrmino,elxitodeestosesfuerzosestcondicionadoensumayorparteporlosesfuerzos
de personal. Este punto de vista hace nfasis en la importancia de dar el debido reconocimiento al
departamento de recursos humanos y, por consecuencia, es de gran importancia que los gerentes de rea
reconozcanalrecursohumanoenlasoperacionesdiariasdelaempresa.

Lafuncindelpersonaldirigesuatencinalreconocimientodelosproblemasadministrativosdesdeelpunto
devistadelosr ecur soshumanos.Subrayalaefectividaddelpersonalensustrabajoscomoclaveparasu
xitoadministrativo.
Una cooperativa necesita personal para diversos niveles: operativos y personal de apoyo, personal
administrativoydirectivo,paracompletartodaunagamadeobjetivosyactividades.Eldotaralaempresade
personalesfundamentalparaelxitodeestporlotanto,eltrabajodeldepartamentoderecursoshumanos
revisteunagranimportancia.

Cuando se crea el departamento de personal de la sociedad, en un inicio fue pequeo y dependa de un


ejecutivoadministrativodenivelmedio.Peroamedidaquecrecieronlasexigenciasquerecaansobredicho
departamento, ste aument su importancia y complejidad. Para afrontar el crecimiento y las nuevas
demandaselpersonalderecursoshumanostuvolanecesidaddeelevarsuniveldeespecializacin.Conforme
estedepartamentocontinucreciendo,sedioalatareadeorganizarseenseccionesmuyespecializadas.

5.1.2.NecesidaddelDepar tamentodeRecur sosHumanos.

Lafuncindelpersonalesdevitalimportanciaenlaadministracindelacooperativa,yaquedeelladepende
en gran medida que todas las actividades que se realizan diariamente en la empresa sean llevadas a cabo
graciasaldesempeodesustrabajadores.Hayvariosfactoresquedemuestranlaimportanciadecontarcon
dichodepartamentodentrodelaempresa,destacandoentreotros:

v Complejidaddepuestosdeger entesderea.Enfrentarsearesponsabilidadesadicionalesrequiere
quesebusquenayudasparalaresolucindesusproblemasmssustantivosyaqueestosproblemas

125
sondenaturalezadelosrecursoshumanos,losgerentesderearecurrenaespecialistasenlamateria,
contribuyendodeestemodoalestablecimientoydesarrollodeldepartamentodepersonal.
v Influencias exter nas. stas han contribuido ms al desarrollo de la funcin de personal. La
aprobacin de leyes y reglamentos (La ley Federal del Trabajo, Ley del Seguro Social) crea la
necesidad de gente que pueda interpretarlos y elaborar programas que aseguren su cumplimiento.
Ademsdelossindicatos,lainfluenciadelmercadodetrabajotambinharepresentadounpapelde
importanciaenlascontribucionesparaeldesarrollodelafuncindepersonal.
v Necesidad de congr uencia. Confiar exclusivamente en el criterio de los gerentes de rea en las
decisionessobrepersonalconduceinvariablementeenunincongruentetratamientodelosempleados.
v Necesidad de pericia. Esta complejidad requiere pericia para tratar con ellas y, en consecuencia,
casitodaslasactividadesrequierenpersonasexperimentadas paraadministrarlas.
v Impor tanciadelosr ecur soshumanos.Laempresafuereconociendocadavezmsqueelinsumo
laboral(losrecursoshumanos),sondevitalimportanciaparaelxitodelaorganizacin.

5.1.3.Estr uctur aOr gnicadelDepar tamentodeRecur sosHumanos.

El departamento de personal o de recursos humanos de una empresa grande como lo es una cooperativa,
emplea un porcentaje tan alto de su tiempo en el rea de recursos humanos que es adecuado denominarlo
departamentodepersonaloderecursos humanos.
La estructura organizacional formal de la cooperativa define la autoridad, las responsabilidades y las
funcionesquedebenserejecutadasencadapuestodelaempresa.
Sin embargo, sabemos que adems de la estructura formal, los grupos de personas que trabajan en la
organizacin,influyensobrelaadministracindepersonal.
Paraubicardemaneracorrectalaposicinjerrquicaqueocupaeldepartamentoderecursoshumanosdentro
delacooperativa,hayquerecurrirprimeroalaestructurageneraldelaempresa(organigramageneraldela
empresa),paradarnoscuentadelaimportanciayelniveljerrquicoqueocupaestedepartamentodentrodela
sociedad cooperativa, para ello basta verificar que se encuentra ubicado dentro de la Coordinacin de
Administracin y Finanzas al lado de otros departamentos como son el de Contabilidad, Presupuestos,
Impuestos y Normatividad Informtica, Liquidaciones y Crdito y Cobranza. Para establecer la estructura
organizacional la empresa requiri de la identificacin de las condiciones estratgicas, tecnolgicas y del
medio ambiente que son especficas para la organizacin, y seleccionar el tipo de estructura organizacional
bajoesascondiciones.
Eldepartamentodepersonaldentrodelacooperativa,ocupaunlugarimportanteyunciertoniveljerrquico,
porlasrazonesqueacontinuacinseexponen:
a) Enordendeimportancia,eldepartamentodepersonalconformeavanzaelprogresoindustrialy
tecnolgico del pas, cobra mayor influencia, por lo que deber ubicarse al nivel de las otras
funcionesoperacionalesbsicas.

126
b) Porqueesunafuncinoperacionalintegradora,esdecir,prestaservicioyasesoraenmateriade
personalatodoslosdepartamentosdelaorganizacin,requiriendounniveldeautoridadamplio.
LaestructuracinorgnicadeldepartamentoderecursoshumanosdelaCooperativaPascual,reflejanoslo
lasfuncionesasignadasal,sinotambineltamaodelaorganizacin,lacomplejidaddesusoperacionesy
elpotencialproductivoquetienelaempresa.

5.1.4.ObjetivosdelDepartamentodeRecur sosHumanos.

Elobjetivoprimordialdeldepartamentoderecursoshumanosdelasociedadconsisteencaptarymanteneral
personalenlaempresatrabajandoydandoelmximodes,conunaactitudpositivayfavorable.Lafinalidad
es proporcionar a la cooperativa fuerza laboral eficiente. Para lograr esto, el departamento de recursos
humanosplanea,evalaydesarrollaprogramasquelepermitanalasociedaddisponerdemejormaneradesu
personalascomolascantidadescorrectasentodossusdepartamentos.
Enlaprcticaeldepartamentoderecursoshumanosalcanzasuxitopormediodellogrodesusobjetivos y
stossederivandelosobjetivosdelaempresatalesobjetivosdebenexpresarseporescrito.Losobjetivosdel
departamentodepersonalsirvencomogua,enlaprctica,parafijarlasfuncionesprincipalesdeste.
Losobjetivosdeldepartamentoderecursoshumanosdelasociedadsonlossiguientes:
v Proporcionaralacooperativalafuerzalaboraleficienteparaalcanzarlosobjetivosorganizacionales,
yaconsejaradecuadamenteaotrosdepartamentos.
v Planearlosrecursoshumanosparaasegurarunacolocacinapropiadaycontinuaentodosycadauno
delosdepartamentos.
v Mejorar la calidad de los recursos humanos mediante programas de capacitacin y desarrollo para
lograrunamejoreficaciadestos,entodoslosnivelesdelaempresa.
v Crear,mantenerydesarrollarcondicionesorganizacionalesdeaplicacinparalograrunasatisfaccin
plenadelpersonaly desusobjetivosindividuales.
v Alcanzareficaciaadministrativaconlosrecursoshumanosdisponibles.

5.1.5.FuncionesdelDepar tamentodeRecur sosHumanos.

Entrelasprincipalesfuncionesquerealizaeldepartamentodepersonaldelacooperativaseencuentran:
v Planearlosrecursoshumanos,asegurandounacolocacincorrectaentodosycadaunodelosdems
departamentosenlacantidadyenlosperfilesadecuados.
v Suministrarpersonalidneoatodoslosdepartamentosdelasociedadenformaeficiente.
v Realizar una adecuada contratacin e induccin del nuevo personal, para lograr una buena
adaptacinasuslaboresloantesposible.
v Establecer un adecuado sistema de remuneracin justa, para alcanzar niveles de desempeo
esperados.

127
v Elaborarprogramaspermanentesde capacitacinydesarrollodepersonalqueeleve sudesempeo
laboral.
v Ejercer una adecuada administracin del contexto colectivo de trabajo y lograr un ambiente de
cordialidadydeadecuadasrelacioneslaboralesdentrodelasociedad.
v Lograr junto con el sindicato, la promocin de programas de higiene y seguridad dentro de la
sociedad.
v Establecer adecuadas comunicaciones y relaciones humanas entre los trabajadores a todos los
niveles.
v Brindarservicioatodoelpersonalqueaslorequiera.

5.2.PLANEACINDELPERSONAL.

La planeacin de recursos humanos en la cooperativa y en cualquier empresa es un proceso utilizado para


establecerlosobjetivosdelafuncindepersonalyparadesarrollarestrategiasadecuadasparaalcanzartales
objetivos.Puedetenermayorimportanciaenciertosnivelesdelaempresaqueenotros.Ademsunaempresa
que no hace su planeacin de personal en forma adecuada, no podr llegar a satisfacer adecuadamente sus
requerimientosdepersonalnisusobjetivosorganizacionales.

5.2.1.PolticasdePer sonal.

Esimportantemencionarqueexistenpolticasdepersonalparalogrardichaplaneacinasmismosefijauna
normadeaccingeneral,paraimpulsar,interpretarycontrolarlaeficienciadelasociedad.
Aunquelaspolticasseasemejanalasreglasenqueambassonnormasdeaccin,defierenenquelaspolticas
requierenladecisindeunjefeinferiorparapoderseraplicadas.
Sinembargoexistennumerosaspolticasquetienenvigorenlasociedadapesardenohabersidoestablecidas
por los socios como son: la legislacin del trabajo, la contratacin colectiva y aun la mera costumbre
establecedistintoscriteriosenladireccindepersonal,acercadeprestaciones,premios,dasdetrabajo.
LaspolticasdepersonalestablecidasenlaSociedadCooperativa sondedostipos:
v Detipogeneral.
v Detipoparticular.

Lapolticageneralesimportante,especialmenteporquerepercutedirectamenteentodaslasdemspolticas
particularesdelpersonal(seleccin,contratacin,induccin,etc.),ascomoenlasdiversasreasfuncionales
delasociedadcomoproduccin,comercializacin,finanzas,etc.

128
5.2.2.reasPrincipalesdelaPolticaGeneraldelaEmpr esa.

En la cooperativa como en cualquier empresa las actividades de personal y relaciones laborales pueden
resumirseencuatroreasqueconformanlapolticageneraldepersonal.Cadaunadeestasreasdefineuna
de las principales tareas de la administracin de personal, que la direccin superior de la empresa debe
atender.
Influencia delempleado. Los socios o accionistas debende decidir que tantaresponsabilidad,autoridad y
poderdebedelegarvoluntariamenteyaquelatareaesdesarrollarsuspropiaspreferenciasdepoltica,respecto
a la cantidad de influencia que tienen los empleados con relacin a asuntos tan diversos como objetivos
organizacionales,sueldosysalarios,seguridadenelempleo,olatareaens.Lasdecisionesrealizadasconla
influencia de los empleados son, por tanto, decisiones criticas de la direccin superior sea que se tomen
explicitaoimplcitamente,comosueleserlossistemasdetrabajo.
Sistemas de Tr abajo. En todos los niveles de la cooperativa los gerentes de rea deben enfrentarse a las
tareas de acomodar a las personas, la informacin, las actividades y la tecnologa. Es decir, deben definir,
analizarydiseareltrabajo.
Flujo de los r ecur sos humanos. Esta rea tiene que ver con la responsabilidad compartida por todos los
miembros de la sociedad para manejar el flujo de personas en todos los niveles, deben trabajar de mutuo
acuerdo,paraasegurarqueelflujodepersonalsatisfagalosrequisitosestratgicosacorto,medianoylargo
plazosdelaorganizacinrespectoalacantidadcorrectadepersonalydelacombinacindehabilidad.Las
decisiones de seleccin, contratacin, promocin y despido, tambin deben satisfacer las necesidades de
seguridadeneltrabajodelempleado,desarrollodelacarreraprogresoyuntratamientoequitativo,satisfacer
lasnormaslegalesdelasociedad.
Las r ecompensas. stas pueden ser tanto financieras como de otra ndole para atraer, motivar y retener,
satisfaceralosempleadosentodoslosniveles.
Losgerentestienenquedisearmecanismosparaformularunapolticageneraldepersonal,queindiqueguas
afindeorientarlaaccinsobreasuntosyproblemasdepersonalquesurgenconfrecuencia.

5.2.3.SistemadePlaneacindelosRecur sosHumanos.

Unfactorimportanteenlaefectivaadministracindelosrecursoshumanosdelacooperativaeselprocesode
planeacindepersonalsteincluyeunanlisisdelosgradosdecapacidadentodoslosnivelesdelaempresa,
unanlisisdevacantesactualesoesperadasyunanlisisdelflujodepersonalenlosdiversosdepartamentos.
Esimportantemencionarquelacooperativaseabastecede personalpormediodeunaagenciaexterna,ala
cualleenvalosperfilesdeloscandidatosquenecesitayelpuestoquevanaocupar,deestmanera,alhacer
una buena planeacin asegura en gran medida que el personal que ingrese a la empresa cumple con los
requerimientosquenecesitaparacadapuesto.Deahderivalaimportanciaquetieneunabuenaplaneacinde
personalparalaempresa.

129
5.2.4.Impor tanciadePlanearlosRecur sos.

Laplaneacindelosrecursoshumanostieneunpapelmuyimportanteenelxitodelasociedadparaprever
lo que va a suceder en el futuro, es decirladireccin superior debe anticiparse a los acontecimientos y as
programarsuproduccin,presupuestarsusgastos,estimarelnmeroytipocorrectodepersonal.

Esimportanteindicarquealiniciarlaplaneacinderecursoshumanos,debemosestarconcientesquetantola
planeacindelaorganizacin,comolaplaneacindepersonal,estantimamenterelacionadas,atalgradoque
nopuedenirseparadas.

Lasociedadrealizaunaplaneacindepersonalparamejorarsueficienciayeficaciaparaunlargoperiodopor
lo tanto es necesario que el reclutamiento y seleccin de personal se tomenlasprecauciones posibles, para
asegurarlosobjetivostrazadosamedianoylargoplazo.

Podemos concluir que la importancia de la planeacin del departamento de recursos humanos recae en lo
siguiente:

v Adecuareficientementelasactividadesdelpersonalconlosobjetivosorganizacionalesfuturos.
v Mejorarlautilizacindelosrecursoshumanos.
v Lograreconomasencontratacindenuevosempleos
v Ampliar la informacin de la administracin de personal para ayudar a otros departamentos y en
otrasactividadesdepersonal.
v Efectuarunademandaimportantesobreelmercadodetrabajo.
v Coordinardiferentesplanesyprogramasdepersonaltalescomolaplaneacindecarreras,planesde
capacitacinydesarrollo.

5.2.5.Pr ocesodePlaneacindelosRecur sosHumanos.

Elprocesoutilizadoporlasociedadcooperativadetrabajadoresenelreaderecursoshumanosconsisteen
planearobjetivosparallegaralasmetasestablecidasconsiderandopronsticosparatenerunaideadelosque
estaocurriendoenelflujodepersonal,desarrollandoplanes yprogramasdeaccinloscualessonguasde
actitudesdeldepartamentodepersonalhaciaellogrodesusobjetivos,unavezformuladosdichosplanesel
departamentodepersonaldeberponerenejecucinlasaccionesparaalcanzarlosobjetivos,loscualestienen
como propsito el cambiar las actividades de planeacin de recursos humanos de un campo intangible y
conceptual a un campo tangible y operacional por lo tanto el control se encarga de realizar ajustes a los
eventosnoplaneados,paraeldepartamentodepersonal,afin demantenersusactividadessobreelobjetivo
fijadoytenerunabasededatosparahacermejorasensuspronsticosyplanesfuturos.

130
5.3.SUMINISTRODEPERSONALALAEMPRESA.

Elrecursomsimportantequetienenoslolacooperativa,sinocualquierempresa,eselrecursohumano.Por
ello es importante el proceso de suminnistro de recur sos humanos apr opiados, este trmino se refiere a
aquellosempleadosquerealizanunacontribucinvaliosaallogrodelosobjetivosdelaempresa.Tambines
importante mencionar que la dministracin de recursos humanos, se relaciona con todas las funciones
operacionalesydemanejodepersonaldelaempresa.Incluyendolasfuncionesdedeterminarnecesidadesde
recursos humanos de la misma cooperativa, llevar acabo el proceso del suministro de personal, capacitar,
remuneraryasesoraraotrosdepartamentos.
Lafuncindeproporcionarlosrecursoshumanosapropiadosesdegranimportanciaparaeldepartamentode
personal, ya que la productividad de la empresa se determina por la forma en que los recursos humanos
interactanysecombinanparalautilizacindelosdemsrecursosconquecuentalasociedad.

5.3.1.Pr ocesodeReclutamiento.

El hallazgo de nuevos empleados para la cooperativa y para cualquier organizacin, resulta un desafo
continuoparalamayoradelosdepartamentosdepersonal.Enmuchasocasiones,lanecesidaddecontarcon
nuevostrabajadoresseconoceconanticipacin,cuandosetienenestablecidosplanesdetalladosderecursos
humanossinembargoenotras,eldepartamentodepersonalseenfrentaapeticionesurgentesdereemplazo,
que deben cubrirse con tanta rapidez como sea posible. En cualquiera de estas situaciones, para el
departamentodepersonal,encontrarsolicitudescompetentesesuntrabajoarduoycrucial.

RequisitosPr eviosalReclutamiento.
Generalmente en la cooperativa como en cualquier empresa, el proceso de reclutamiento y seleccin de
personal comienza cuando existe el puesto vacante, ya sea de nueva creacin, o bien, resultado de alguna
promocininternaparacubrirenformaadecuadaesavacante,debenexistirpreviamenteciertosrequisitos
traducidosenlineamientos,polticasquedebenseguirseduranteelprocesodesuministrodepersonalestos
requisitos previos tienen como objetivo principal orientar al responsable de esta funcin sobre el tipo de
conductaquedebeaportaralrespecto.
Losrequisitospreviossonlossiguientes:
v Larequisicinosolicituddeldepartamentodepersonal.
v Polticasdepersonal.
v Anlisisdepuesto.
Requisicinaldepartamentodeper sonal. Esundocumentoquecontienedatosimportantessobreelpuesto
la unidad orgnica, edad del candidato, grado mnimo de estudios, experiencia, salario, entre otros. La
requisicindelpersonallaenvaaldepartamentosolicitantealjefededepartamentoderecursoshumano,con
elpropsitodequeeltiempojusto y conbasealasnecesidadesespecficasselessuministredelpersonal
necesario

131
Polticas del per sonal. Poltica es una orientacin permanente que proporciona guas generales para
canalizarlaaccinadministrativaendireccionesespecficas.
Cuando no existen polticas a seguir la gente estar expuesta a cometer ciertos errores que fcilmente se
podraevitarteniendopolticasclarasyprecisas.
Anlisisdepuestos.Esunprocedimientoquetienecomofinalidaddeterminarlasactividadesqueaplican
enelpuesto yquetipodeindividuodeberadesercontratadoparaejecutareltrabajo,porlotantoes
documentofuente deinformacinparaplanearelproceso.

ReclutamientodePer sonaldentr odelaCooper ativa.


Elreclutamientoeselprimerpasoparaproporcionarrecursoshumanosapropiadosalaempresaunavezque
seaabiertaunavacante.
Prctica de reclutamiento. El reclutamiento se practica de manera directa e indirecta. Es directa cuando la
empresarealizaelreclutamientoporsupropiacuantaesdecir,loscandidatosvanalaorganizacinparahacer
sus trmites. Es indirecta cuando la empresa acude a alguna oficina de colocacin, para que esta le
proporcioneelpersonalyaseleccionado.
El proceso de reclutamiento y de seleccin comienza cuando existen vacantes, ya sea de nueva creacin, o
bien, resultado de alguna promocin interna para cubrir adecuadamente esa vacante, la cooperativa elige
dentrodesupersonalinternoaposiblescandidatosquepuedancumplirconlosrequerimientosqueexigeel
puesto, de no encontrar algn candidato la empresa enva el perfil del puesto que solicita a una agencia
externaespecializadaenlacolocacindepersonal,lacualseencargadeevaluaralcandidatoyenviarloala
empresaparaverificarquerealmentecumplaconlosrequerimientosquenecesita.
El proceso de reclutamiento que lleva acabo el departamento de personal de la cooperativa en forma
sistemticaeselsiguiente:
1. Algn departamento de la empresa soclicita al departamento de recursos humanos, personal para
algnpuesto.
2. Seeligedentrodelpersonalinternoalgnposiblecandidato.
3. Si los candidatos internos no cumplen con los requerimientos del puesto, se enva el perfl a la
agenciaexterna.
4. Laagenciaenvaalosposiblesprospectosalaempresa(previaevaluacin).
5. Eldepartamentoderecursoshumanosentrevistayevaluaalosposiblescandidatos.
6. Sellevaacaboelprocesodeseleccin.

5.3.2.Pr ocesodeSeleccin.

Paralasociedadyengeneralparacualquierorganizacin,laseleccindepersonalesmuyimportante,yaque
enellarecaelaimportanciadehacerunabuenaeleccinycomoconsecuenciaabastecersedetrabajadoresque
cumplanconlosrequerimientosquestanecesita.

132
Es un proceso importante para integrar un grupo adecuado de solicitantes, por medio de reclutamiento,
comienzaelprocesodeseleccindepersonal.Esteprocesoincluyeunaseriedeetapasqueagregantiempoa
la decisin de contratacin consiste en varias tcnicas de divulgacin para escoger a los candidatos que
posean los requisitos mnimos para ocupar el puesto vacante mientras que la tarea de seleccin es la de
escoger entre los candidatos que se han reclutado, aquel que tenga mayores posibilidades de ingresar a la
organizacin.

Las exigencias de seleccin se apoyan en las exigencias propias de las especificaciones del puesto, cuyo
propsitoeseldedarmayorobjetividadyprecisinalaseleccindelpersonalparadesempearlo.

Laplaneacindepersonalindicaalosgerentesdepersonalquevacantestienenprobabilidadesdepresentarse.
Los planes permiten que la seleccin se lleve a cabo de manera lgica y eficaz. La informacin para el
anlisisdepuestosproporcionadescripcionesdelastareas,especificacioneshumanasynormasdedesempeo
querequierecadapuestofinalmente,serequierencandidatosparaqueelgerentedepersonaltengaungrupo
decandidatosentreloscualesescoger.

ObjetivosdelProcesodeSeleccin.

v Escogeralaspersonasconmsprobabilidadesparatenerxitoenelpuesto.
v Hacerconcordarlosrequisitosdelpuestoconlascapacidadesdelaspersonas.

Estosobjetivosbeneficianalaempresaconunamenorrotacindepersonal,menosausentismosyunestado
denimomsalto,alavezquelapersonaderivamayorsatisfaccineneltrabajo.

EtapasdelPr ocesodeSeleccin.

Recepcin de solicitudes. La seleccin se inicia con una visita al departamento de personal o con una
peticin por escrito parauna solicitud de empleo. La manera en que se maneje estarecepcin inicial es la
basesobrelacualempiezaaformarselaopininqueloscandidatostienendelaorganizacin.
Entr evistapr eliminar.Esunprocedimientoquesirveparadarmayorimportanciaalasrelacionespblicas.
Tambin ayuda al departamento de personal a excluir a las personas claramente inadecuadas y obtener
informacinbsicasobreloscandidatospotenciales.
For masdesolicitud.Consisteenestudiarlassolicitudes,lashojasdedatospersonales,losantecedentesde
trabajo,escolaridadyotrasfuentes,paradeterminaralascaractersticas,lashabilidadesyrendimientoprevio
delapersona.Enestaetapa,sedebenseleccionarcuidadosamentelosdatosdelrendimientodelapersona
ysuspuestosanteriores:rapidezdepromocin,experienciaadquirida,frecuenciayrazonesparadejarotros
empleosysuhistorialdesalarios.
Pr uebasdeempleo. Sontilesparaobtenerinformacinrelativamenteobjetivaquesepuedecompararcon
los otros candidatos y los trabajadores actuales las pruebas de empleo son dispositivos que evalan la
probableconcienciaentreloscandidatosylosrequisitosdelpuesto.Laspruebaspsicolgicassirvenpara

133
medirlapersonalidad.Ladeconocimientossonmsfidedignasporqueproporcionaninformacinsobre
losconocimientoslaspruebasdedesempeomidenlacapacidaddeloscandidatospararealizaralgunaspartes
deltrabajoalqueaspiran.
Entr evistas.Seutilizanparaeliminarsolicitantesineptososinintersquehanpasadolafasepreliminarde
seleccinporlogenera,estentrevistaesmanejadaporunespecialistaysueleserexploratoriaotropropsito
es explicar todo lo que es el trabajo y sus requisitos y contestar toda pregunta del candidato en cuanto al
puestoylaorganizacin.
Investigacin de la histor ia anter ior. Esto se suele hacer para obtener una evaluacinms objetiva de la
persona la mayora de las organizaciones se ponen en contacto con las fuentes de referencia durante el
procesodeseleccintalverificacinabarcatrescategorasdereferencias:personales,acadmicosyempleos
anteriores.
Laminuciosidaddelacomprobacindelasreferenciasdebedependerporelpuestoporocupar.Losempleos
anterioressonlafuentemsutilizadayestnencondicionesdedarlainformacinmsobjetiva.
Seleccin pr eliminar enel depar tamento de per sonal. En el caso de la seleccin toda lainformacin de
pruebasdeempleoydeverificacindereferenciasobtenidasenlasetapasanteriores,seutilizanparasaber
silapersonaeslamejorymsaptaparaelpuesto,llegandoasuseleccinpreliminar.
Seleccinfinalpor elsuper visor .Seacostumbraqueeljefequetieneunpuestovacanteensudepartamento
entrevistaaloscandidatosseleccionadosdemanerapreliminarporeldepartamentoderecursoshumanoslos
jefesosuperioresdebenparticiparenladecisinfinaldeseleccinconfrecuencia,eljefe puedevaluarmejor
lasaptitudestcnicasdeloscandidatos.Tantosilatomadedecisinesporeljefeoporeldepartamentode
personal,ladecisinmarcaelprocesodeseleccin.
Examen mdico. Despus de que el candidato a empleado a pasado las etapas anteriores, muchas
organizacionesrequierenunexamenmdicoelcualserealizanosoloparadeterminarlacorrectaeleccindel
solicitanteparaelsegurodevidadegrupo,desaludydeinvalidez,sinotambinparadeterminarsitienela
capacidadfsicaparadesempearelpuesto.

5.3.3.Pr ocesodeContr atacin.

Laseleccinylacontratacindepersonalsepuedenconsiderarcomoprocesosinterrelacionados,yaqueuna
personaporloregulanolacontrataunaempresaantesdeconsideraralpuestoquevaaocuparmediantela
seleccin.
La seleccin describe el enfoque de contratacin de personal en todos los niveles de la organizacin. La
contratacinsedebeconsiderarunprocesocontinuoenvezdeunaactitudaislada.
El proceso de contratacin incluye una serie de etapas que consideran las disposiciones legales sobre la
decisindecontratarpersonalparalaorganizacin.
La funcin de requisitar el expediente del trabajador es un medio de control de personal. Esta fase le
informara al jefe de personal si ha seguido correctamente los pasos del procedimiento de contratacin y,
adems,sitodorealizcomoseplaneo.

134
Los elementos de control que contiene el expediente, son los documentos que ha acumulado el trabajador
duranteelprocesodeselecciny,adems,losinstrumentosquedebaproporcionarcomocomplementodela
ampliainformacinrequeridaporeldepartamentodepersonal.Dentrodeestosdocumentosestn:
v Lasolicituddeempleo,porserelprimertestimonioformalquepresentelinteresado.
v Loscomprobantesdelasentrevistas,delaspruebas,losdocumentoscomprobatorios,ascomolos
resultadosdelexamenmdico.
v Documentos como acta de matrimonio de nacimiento, certificados e estudios realizados,
antecedentespenales.

5.3.4. Pr ocesodeInduccin.

Lasexperienciasinicialesqueviveuntrabajadorenlaorganizacinvanainfluirensurendimientoy
adaptacindeahlaimportanciadelprocesodeinduccin.

ObjetivosdelaInduccin.

Elprocesodeinduccintienediversosobjetivossobrelosmssobresalientesestnlossiguientes:
v Ayudaralosempleadosdelaorganizacinaconocer yaauxiliarelnuevoempleadoparatenerun
comienzoproductivo.
v Estableceractitudesfavorablesdelosempleadoshacialaorganizacin,suspolticasysupersonal.
v Ayudar a los nuevos trabajadores a desarrollar y sentimiento de pertenencia y aceptacin para
generarentusiasmoyunaaltamoral.

ProcesodeInduccin.

El proceso de induccin en la cooperativa, incluye una serie de etapas que consideran la induccin al
departamentodepersonalylainduccinalpuestoenparticular.
a)Intr oduccinaldepar tamentodeper sonal.
A parte de las ayudas tcnicas que se le pueden dar al nuevo trabajador corresponde al departamento de
recursoshumanosdarleinformacinsobreaspectosgeneralescomo:
v Historiadelaorganizacin.
v Polticasgeneralesdepersonal.
v Indicacionessobredisciplina,esdecir,loquedebehaceryloquedebeevitar.
v Prestacionesalasquetienederecho,porejemplo,cajadeahorros,despensa,deportes,promociones,
etc.
b)Intr oduccinalpuesto.Otraetapadelprocesodeinduccineslareferentealaintroduccinalpuestoa
desempear,lacualrepresentadeterminarelpuestoapropiadoparaunempleadorecincontratado.

135
Lainduccinincluyeorientacingeneralatodoelambientedetrabajo.Alguiaralnuevotrabajadorhaciasu
puesto,sedanlasrecomendacionessiguientes:
v Que el nuevo trabajador sea personalmente llevado y presentado con el que habr de ser su jefe
inmediato
v Eljefeinmediatoasuvezdebepresentarloconsuscompaerosdetrabajo
v El jefe explicar en que consistir su trabajo, para ello se auxiliar de la descripcin del puesto,
entregndoleunacopiaparaqueloleacondetalle.
v Debemostrarlelossitiosgeneralescomoeslugardecobro,deabastecimientodematerial,comedor,
etc.

5.4.ADMINISTRACINDESUELDOSYSALARIOS.

La cuestin de la remuneracin probablemente sea la funcin ms difcil y compleja con que tiene que
enfrentarse el departamento de personal. Aunque los sueldos y los salarios deben tener una base lgica y
defendible,comprendenmuchosfactores.
Laremuneracinesmuyimportanteparacadaunodelosempleados,porqueesunamedidadesuvalorpara
s mismos para los compaeros de trabajo, para las familias y para la sociedad. As, el nivel absoluto de
ingresodelosempleadosdeterminasuniveldevida,ysuingresorelativodeterminalacondicin,prestigioy
vala.
Cuando la cantidadtotal o absoluta del ingreso es demasiado baja, los empleados no podrn satisfacer sus
necesidadesfisiolgicas ydeseguridad.Unacausamuycomndefaltadesatisfaccin,sesitaenelpago
relativo,queeselsueldodeunempleadoencomparacinconeldelosotrostrabajadores.

5.4.1.Pr oblemasdeRetr ibucin.

Laadministracindesueldosysalariosseocupadelosproblemasquepuedenoriginarseporsituaciones
comolassiguientes:

v Ladeltrabajadorquedeseacobrarms,porquerealizatareasquenoaparecenenladescripcinde
supuesto.
v Ladelempleadoqueaunenperiododeformacin,esperaaumentodesueldocada6o12meses.
v Ladelsupervisorcuyosubordinadolabor14horasextraslasemanapasadapercibiunaretribucin
mayorqueladel.
v Ladeldirectivoquepretendequepartedesuretribucinseadiferida,hastaencontrarseenunnivel
inferiorparaefectosdelimpuestosobrelarenta.
v Ladelsindicatoquepretendelograrmayoressalarios,paraincrementarelpoderadquisitivodelos
trabajadores.

136
v La de los responsables de establecer polticas salriales, considerando variables, tales como: la
estabilidaddeprecios,elcrecimientodelaeconomaylacapacidadparacompetirenelmercadode
trabajo.

5.4.2.PagodeSueldosySalarios.

Lapreparacindelanominasegnelprocedimientoanteriormentedescrito,llevaalacuestinsobrelaforma
en que debe hacerse el pago y la correspondiente preparacin de los cheques a empleados, recibos y otra
documentacinpertinentedeacuerdoconlapolticadelaorganizacin.Loidealenestaoperacinespagara
cadaempleadopormediodechequeotarjetadedbitoyaqueelloreduceelriesgodemanejodeefectivoy,
ademsproporcionaregistroautomticodeloquecadaempleadorecibe.Sinembargoenalgunassituaciones
sehacenecesariopagarenefectivo,mientrasqueenotrasloschequesdebenutilizarsesimultneamentecon
unserviciodecambioefectivo.

Los documentos para la preparacin de la nomina normalmente deben interrelacionar las polticas de la
organizacinylosrequerimientosqueserepresentanenlapracticaparalapreparacindeloschequesolos
depsitos en tarjeta de crdito. En aquellos casos en que existen posibilidades de pagar en efectivo es
convenienteprepararunchequeporeltiempototaldelanomina. Laplizadecontabilizacindebeconsiderar
loscrditosaaquellascontracuentasqueregistranlasdeduccionesrealizadasmediantelanomina,loscuales
proporcionanloselementosparalaposteriorpresentacindedeclaracionesanteorganismosdelgobierno.

Luegoseentregaacadaempleadoatrabajadorelcheque,depsitootarjetadedebitoy/oefectivoaqueseha
hechoacreedorporsusserviciosrendidos.Unimportanteelementodecontroleslaentregaquesehaceconel
concurso de varios individuos, de tal manera que se impida cualquier componente o manipulacin entre el
pagador y el receptor. Siempre que sea aplicable, ste debe identificarse en el momento de cobrar. Contra
entregadesueldoosalariosedeberecabarelrecibocorrespondiente.Enloscasosenqueelpagosehaceen
efectivo,esconvenientequesetomenadecuadasmedidasdeproteccinfsica.Enlaeventualidaddequelos
empleadosotrabajadoresnoseencuentrenenelmomentodelpago,elefectivoochequenocobradosdeben
serguardadosenlacajafuerteobvedadelaentidad.

5.4.3.Natur alezadelPr ocesodeNomina.

Por lo general, las erogaciones por concepto de sueldos y salarios representan una gran parte del costo de
operacindelasociedadcooperativa.Estosgastosinvolucrangenteyenconsecuencia,inevitablesproblemas.
Elcicloquecomprendeelprocesodenominaeseldeunintersrelevanterelacionadocontodoslosaspectos
operativosdelasociedadcooperativaysuesfuerzoporlograrunaeficienteutilizacindelamanodeobra.Un

137
aspectopordemsrelevantesurgedelasconsideracionesdetipolegalquesedebentomarencuentacomo
sonlaLeyFederaldelTrabajo,I.M.S.S.,INFONAVITyelS.A.R.
Asloscostosdelanminaseconviertenenunodeloselementosmsimportantesdelasoperacionestotales
delaorganizacin.Elenfoqueenestepuntosecentrarenlosmecanismosquedancomienzoalacreacinde
la nomina y cmo sta es subsecuentemente procesada. Adems, se tiene un especial inters en lograr un
controladecuado,locualesdeespecialrelevanciadebidoalosfrecuentescasosdefrauderelacionadoscon
lasactividadesdenmina.

RelacinconelDepar tamentodePer sonal.

Eldepartamentodepersonalestaencargadodeungrannumerodeactividadesrelativasalaadministracinde
las relaciones con el personal. Por lo tanto sus registros constituyen la principal fuente de informacin y
autoridad sobre las operaciones de nminas, ya que es en l donde se conservan las contrataciones y las
condicionesdelasmismas.Posteriormenteseproducirnloscambiosenelestadodecompensacindecada
individuo dentro de la organizacin. La administracin de estos conceptos puede ser total o parcial
finalmente,losregistroscubrenladeterminacindelasrelacionesdetrabajoconlaorganizacin.
Desde el punto de vista del control todos estos registros constituyen la principal fuente de informacin
autorizadadelaorganizacinconrespectoasupersonalesimportanteprotegerlaindependenciadetodaslas
operaciones relativas al proceso de nminas, las cuales por lo general deben ser efectuadas por un grupo
operacionalajenoaldepartamentodecontabilidad.

RelacinconlaComputacinElectr nica .

La preparacin de las nominas es una situacin tpica involucra un gran nivel de detalle y actividad en
oficinas. Como consecuencia de ello se produjo un gran avance de los sistemas computarizados para el
procedimiento de esta informacin, ya que las computadoras tienen gran capacidad para manejar muchos
detallesdeclculosysumarizaciones.Enestepuntoelinterssecentrarenlosproblemasbsicosrelativosa
lasnminasylosmecanismosquesirvenparasuproceso.

5.4.4.FuentesdeInfor macindeNminas.

En virtud de que laactividad de nminasrelacionada con los empleados y su compensacin por el trabajo
realizado, el punto de partida de la misma es la autorizacin para trabajar que se le otorga a determinado
individuoelcualdebeseroficialmentecontratado.Estasituacinporsupuesto,estsujetaaunaverificacin
independiente a travs del departamento de nminas.El segundo requisito es el de la evidencia del trabajo
desarrollado.Enelcasodeempleadosasalariados,ladocumentacindesusactividadespuedevariarsegnlas
polticas particulares de la organizacin y el nivel organizacional del empleado. As por ejemplo en los

138
estratos inferiores por lo general existen tarjetas de tiempo preparadas para cada individuo bajo el
procedimientodeunrelojchecador.Enotroscasospuedenexistirregistradosbajoelcontroldesupervisores
dediferentesniveles.Normalmente,enlosestratosaltosdecontrolesformal,yaquedependebsicamentede
lacalidadeintegridaddelindividuo.
Lossueldosasignadosemanarandelosregistrosdelempleadoexistenteseneldepartamentodepersonal,ya
queenlresidelaautoridaddemayorconfianzaeindependenciaparamanejaresteaspecto.Enloscasosen
queseanecesariopagarcompensacionesportiempoextra,sedebecontarconregistrosycontrolesadicionales
enpoderdelossupervisoresyconunadecuadoniveldeaprobacin.
Por lo general, en el caso de personal que trabaja por horas, la relacin es manejada de forma ms
sistematizada,puescuandomenosincluyeunrelojchecadorysuscorrespondientestarjetasparacomputarel
tiempodepermanenciaenlaplanta.
Enmuchoscasostambinesnecesariocontarconinformacinadicional,talcomoeltiempoqueinviertenen
un proyecto individual, cuando las tareas se realizan por orden de trabajo u otra asignacin especificas
similares.Talesregistrospuedenserpreparadosporlosmismosempleados,peroluegodebenserrevisadosy
aprobadosporsussupervisores,oinclusoserpreparadosporstos.
Cuandosecuentaconestosregistroscomplementariosexistelaoportunidaddehaceruncontrolcruzadoentre
lostiposderegistrosparavalidareltiempocorrectoapagar,locualincluyeasegurarseenellugardetrabajo,
informacindesumautilidadparaefectosdecontabilidadindependientedelosregistrosdeldepartamentode
personal. Tambin existe el problema de aquellas personas que trabajan en distintos sitios y desarrollan
diversasactividadesqueestnapoyadasendiferentesbasesdecompensacin.Enestecasoladificultadser
elmanejodelasituacinysabersiestamanodeobraesutilizadaeficientemente.Paraefectosdenominala
autorizacindelsuperiorresponsableeslaclavedecontrol.

5.4.5.Pr epar acindelaNmina.

Elpersonaldecadacategorarecibesucompensacinsobrelabasedediferentesperiodos:lamanodeobra
asalariadanormalmenteesrecompensadasobreunabasesemanal,aciertotipodepersonaladministrativose
le paga por quincena, mientras que a determinado tipo de funcionarios se les remunera mensualmente. Al
finaldecadaperiododepagoeldepartamentodenominaesresponsabledelapreparacindelanomina,lo
cualimplicadeterminarqueesloquesedebepagaracadaempleadodeacuerdoconeltrabajodesarrollado
durante dicho periodo. Los aspectos principales de esta preparacin del pago de nomina suelen ser los
siguientes.
v Obtencindeevidenciadetr abajo:Esnecesarioimplantarelempleodetarjetasde tiempoyotros
registros bsicos que comprueben las actividades desarrolladas. Para ello, en primer lugar, es
necesarioquelafuentedeinformacinseanumricayadministrativamenteconfiable.Enaquellos
casos en que se detecten datos errneos, stos deben ser corregidos y actualizados de inmediato.
Tambin se deben realizar sumarizaciones por departamentos y/o por cada componente
organizacional,cuyaconfiabilidadaquienhizoesetrabajo.Paracomprobarsiestosempleadosson

139
honestos, se puede recurrir al cruzamiento de referencias entre los registros del departamento de
personalylainformacinmencionadaalinicioesesteprrafo.
v Aplicacin de tar ifas: El trabajo desarrollado debe ser compensado con remuneraciones
apropiadas. Las tarifas aplicables son establecidas a travs de los contratos colectivos de trabajo
celebradosconlossindicatosyporotrasaccionesdelaorganizacinquesereflejanenlosregistros
del departamento de personal, una vez que se ha establecido adecuadamente laautoridad de estas
tarifas,sedebenefectuarlosclculoscorrespondientes,cuyosresultadosdebensersumarizados.
v Distr ibucincontable:Losimportespagadosporserviciosprestadosdebenserregistradosdentro
de sus propias actividades operativas, y en concordancia con los requerimientos contables
establecidos por la organizacin, entre ellos aqullos relativos a la contabilidad de costos. En la
medida de las posibilidades que en ocasiones se convierten en verdadera necesidad no se debe
diferirladeterminacin deestasdistribuciones:lascondicionesaquconsignadasdebencumplirse
delamaneramsexpeditayprcticaposibledebidoasualtovalorcomoreferenciaparacruzarla
conlaconfiabilidaddelospagosrealizados.
v Aplicacindededucciones:Esnecesariorealizardeduccionesporungrannmerodecausas,entre
ellaslasreferentesalascuotasdelsegurosocial,cuotasalsindicato,planesdepensineimpuestos
sobrelarenta.Loscargosporcadadiferentepropsitodebenefectuarsealamparodesuscontroles
respectivosyaplicarseacadatrabajadorafectado.
v Deter minacindelpagoneto:Finalmente,ladiferenciaentrelacompensacinbsicaalcanzaday
lasdeduccionesindicanelpagonetoquedeberealizarsealempleado.Enestepuntonuevamentese
debeefectuarsumarizacionesquetendrnquecruzarseconlosnetosdetalladosencadacaso.

5.4.6.EvaluacindelPuesto.

Como las personas estn en el centro de todos los puestos ya sea en las percepciones de los otros o en las
descripciones escritas de los puestos que se derivan de las observaciones de cmo se desarrollan, la
evaluacin en una actividad humana, no un tipo de acto empresarial. Este es el primer problema de
mediacin:eselproblemadelasubjetividadinherentecontenidaenlosjuiciosdiscriminativosdeltrabajode
losotros.Otroproblemademedicinsurgeaqudebidoaqueelcriterioopuntodereferenciasobreelcualse
hace la evaluacin, se basa en aspectos de accin humana. Esto se puede ilustrar al pensar en el grado de
discriminacinimplicadaencualquierpuesto.
Laevaluacindepuestosrequiereaceptarlasuposicindequeexistesuficienteregularidadenlamaneraen
queeltrabajadorlorealizaparahacercomparacionesdelvalordelospuestosentregrupos.
Lasdiferenciasentrelaspersonasylasconsecuenciasencuantoalaformaenquesehaceeltrabajo,puedeno
sersignificativa.
Hastaqueserealizaunaevaluacindepuestos,sepuedeverificarcualessonlasdiferencias.
Las actividades cambiantes de una organizacin se tienen que poner en un contexto ordenado para los
propsitos de pago. El cambio destaca la necesidad de conducir la evaluacin, sobre un programa de

140
remuneracincontinuo,paraactualizarlosincentivos ymantenerelbalancedeestosenladireccinen que
mejorselogrenlosobjetivosorganizacionales.
Losobjetivosutilizadosporlasociedadcooperativadetrabajadoresson.
v Proporcionarbasestcnicasparalograrunaeficazadministracindesueldosysalarios.
v Implantar datos precisos para alcanzar una correcta planeacin y control sobre costos de recursos
humanos.
v Crearunabaseparanegociarcuotasdetrabajoconelsindicatooconotrasautoridades.
v Reducirlarotacindepersonal.
v Motivaralpersonalenlarelacinconsusobjetivos.
v Mejorarlaimagenexternadelaorganizacin.
Dichos objetivos considerar la valuacin de puestos como un prerrequisito de cualquier estructura de
remuneracin mediante la evaluacin de los puestos, los resultados del personal, por lo menos la porcin
relativaal sueldoo salario puedenrelacionarse demanerams equitativaalinsumo que el puesto exige de
ellos.Sinembargosialtrabajadorselereconocentodaslasactividadesdescritasenunanlisisdepuestoysi
esas actividades y responsabilidades son valuadas adecuadamente con el grado de eficiencia con que las
desempeapodrtenerunamejorremuneracin.

ManualdeValuacindePuestos.
Este manual es un medio de comparacin o norma entre los diferentes grados de puesto y su factor
relacionadoconelmanual,evaluamoslospuestosparallegaraunvalornumricocompuestoparacadacargo.
Setomacadafactorysecomparanconeldetodoslospuestosanotandoelgradoynumerodeplazadecada
unosinembargosisesiguelospasossiguientes.

v Estudiarlospuestosquesernvaluados ydeterminarfactores ycaractersticasparamediarelvalor


deellos.
v Determinarlosgradosynivelesnecesarios,paramediarlapresenciadecadafactorencadaunosde
losdiferentespuestos.
v Hacerladefinicindefactores.
v Asignarpuestosygradosenproporcinasurelativaimportancia.

CalificacindeMritos.
Unadelaspruebasdesuficienciadeunaescaladesueldosesigualalahabilidad,elpotencialyeldesempeo
conremuneracionessatisfactorias.Paraconservaralpersonal,elreconocimientodesudesempeodebesera
tiempo y estar en equilibrio con su propio sentido de los que es justo. De acuerdo con las ideas
cooperativistas.
La calificacin de los mritos es una tcnica que sirve para calificar la actualizacin o la conducta del
personal individualmente respecto a un puesto o a sus objetivos operacionales en un periodo de tiempo
determinado.

141
Unadelascaractersticasimportantesdelacalificacindemritosesqueserefierenicamenteaunapersona
determinada,contrariamentealoquesucedeconelanlisislavaluacindepuestoporquedescribenymiden
launidadimpersonaldetrabajo.
Engeneralenlasociedadcooperativadetrabajadoressuutilizalacalificacindemritoscuando:
v Sedebedecidirquienesdebenserascendidosyaquienesselesdebehaceraumentosdesueldo.
v Las distinciones son equitativas hay mayores probabilidades de ser aceptadas por el personal
sindicalizadocalificadoyporelpersonaldeconfianza.
v Elsindicatoaceptalavariacindeltabuladorsalarial.
v La prctica de supervisin es de un grado equilibrado, es decir, semimoderada y de buenas
relaciones.
Procedimientoparacalificarelmeritodeuntrabajador.
v Comprendepreferentementelaestructuraylasdimensionesdelaescala.
v Pensarcuidadosamenteenquegradodecadacaractersticaseencuentrajustamentecalificado.
v Decidiryasignarlelospuntoscorrespondientes,registrndolosenlaformadiseadaalrespecto,ala
alturadelacaractersticaquesetrate.
v Agruparlospuestosycolocarelpuestodelapersonacalificadaenelgrupoquelecorresponda
v Realizarlasumadepuntosfinales.

5.5.CAPACITACINYDESARROLLODEPERSONAL.

En larevisin de los manuales pudimos percatarnos de que el rea de capacitacin es de gran importancia
para la sociedad cooperativa de trabajadores pascual ya que estimulan la destreza, conocimientos y las
habilidades que cada empleados posee para realizar adecuadamente sus actividades cotidianas dentro de la
organizacin ya que sirve como programa de medicin para promociones, transferencias y separaciones, la
dinmica de capacitacin de la empresa intensifica su actividad hacindose necesaria para los programas
formalesquerigedichaentidad.
Sin embargo es importante mencionar que las actividades de capacitacin y desarrollo de personal son
nicamenteresponsabilidaddeldepartamentodepersonalydeljefeinmediatodecadasubordinado.

5.5.1.ObjetivosdelaCapacitacin.

Entodaorganizacin,esnecesariounesfuerzocontinuodeeducacin,derenovacin ydeactualizacinde
conocimientosyactitudesportalmotivolacapacitacindelpersonalbuscalograrciertosobjetivos.
Sinembargoelobjetivogeneraldelacapacitacinalosempleadoseslograrlaadaptacindelpersonalparael
ejerciciodedeterminadafuncinoejecucindeunatareaespecificadentrodelreadetrabajoteniendoaslos
mismoobjetivosparticularesparaincrementarunamejorcolaboracindelossubordinados,dichosobjetivos
son:
v Incrementarlaproductividad.

142
v Promoverlaeficienciadeltrabajadorseaobrero,empleadoofuncionario.Proporcionaraltrabajador
unapreparacinquelepermitadesempearpuestosdemayorresponsabilidad.
v Promoverunambientedemayorseguridadenelempleo.
v Ayudaradesarrollarcondicionesdetrabajomssatisfactorias,mediantelosintercambiospersonales
sugeridosdentrodelacapacitacin.
v Promoverelmejoramientodesistemasyprocedimientosadministrativos.
v Contribuirareducirlasquejasdelpersonalyproporcionarunamoraldetrabajomaselevada.
v Facilitarlasupervisindelpersonal.
v Promoverascensossobrelabasedelmeritoalpersonal.
v Contribuiralareduccindelmovimientodelpersonal,comorenuncias,distincionesyotros.
v Evitaraccidentesdetrabajo.
v Contribuiralareduccindeloscostosdeoperacin.
v Promoverelmejoramientodelasrelacioneshumanasenlaorganizacinydelacomunidadinterna.

La capacitacin de personal, es un proceso que se relaciona con el mejoramiento y el crecimiento de las


aptitudes de los trabajadores y de los departamentos dentro de la organizacin. La importancia de la
capacitacindepersonalnosepuedesubestimar.Confrecuencialosdirectivosloconsideranundetallequese
favoreceentiemposdebuenaeconomaperorpidamentesereduce o eliminacuandolaeconomaesmala
ocasiona que las organizaciones sufran las consecuencias a largo plazo con esto se quiere decir que la
capacitacin es una herramienta que favorecer a largo plazo a la organizacin para una creciente
remuneracineconmica.

Estoradicarasisecumplenconlossiguientesparmetrosdecapacitacinqueson:
v Ayudaalaorganizacin.Conduceaunamayorrentabilidad yaptitudeshacialaorientacindelos
objetivosorganizacionales.
v Ayudaalindividuo.Mediantelacapacitacinyeldesarrollo,seinteriorizanyponenenpracticalas
variablesdemotivacin,realizacincrecimientoyprogreso.
v Ayudaalasrelacioneshumanasenelgrupodetrabajo.Fomentalacohesinenlosgruposdetrabajo
mediantelamejoradelascomunicacionesentregruposeindividuos.

5.5.2.TiposdeCapacitacin .

Capacitacinpar aeltrabajo.Estadirigidaaltrabajadorquevaadesempearunanuevafuncinporserde
nuevoingresoporpromocinoreubicacindentrodelamismaorganizacin.
v Capacitacin de preingreso. Se realiza con fines de seleccin concentrndose en proporcionar al
nuevopersonallosconocimientosnecesariosydesarrollarsushabilidadesodestrezasnecesariaspara
laejecucindelasactividadesdelpuesto.

143
v Induccin.Consisteenunconjuntodeactividadesqueinformanaltrabajadorsobrelaorganizacin
losplaneslosobjetivosylaspolticasparaapresurarsuintegracinalpuesto,algrupodetrabajoya
laorganizacin.
v Capacitacin promocional. Conjunto de acciones de capacitacin que dan al trabajador la
oportunidaddealcanzarpuestosdemayorniveldeautoridad,responsabilidadyremuneracin.

Capacitacineneltrabajo.Laconformandiversasactividadesenfocadasadesarrollarhabilidadesymejorar
aptitudes del personal, en las tareas que realiza en ellas se conjugan la realizacin individual con la
consecuenciadelosobjetivosorganizacionales.
v Adiestramiento. Consiste en una accin destinada al desarrollo de las habilidades y destrezas del
trabajador,conelpropsitodeincrementarlaeficienciaensupuestodetrabajo.
v Capacitacinespecificayhumana.Consisteenunprocesoeducativoaplicadodemanerasistemtica,
a travs del cual las personas adquieren conocimientos, aptitudes y habilidades en funcin de
objetivosdefinidos.

Desar r ollo.Estecomprendelaformacinintegraldelindividuoyespecficamentelaquepuedellevaracabo
laorganizacinparacontribuiralosbeneficiostantodeltrabajadorcomodelasociedad.
v Educacinformalparaadultos.Sonlasaccionesllevadasacaboporlaorganizacinparaapoyarala
personalensudesarrolloenelmarcodelaeducacinescolarizada.
v Integracin de la personalidad la forman los eventos organizados para desarrollar y mejorar las
aptitudesdelpersonal,haciasimismosyhaciasugrupodetrabajo.
v Actividadesrecreativasyculturales.Serefierenalasaccionesquesedanalostrabajadoresencuanto
al esparcimiento necesario para su integracin con el grupo de trabajo y su familia as como su
desarrollodesusensibilidadycreacinintelectualyartstica

Capacitacin en clase. Consiste en seguir el ejemplo de la educacin tradicional, el tipo ms obvio de


capacitacinenlaclase.
v Capacitacinfueradeltrabajo.Sepuedehacerpormediodecursos especialmentepreparadospara
lasnecesidadesdelaorganizacin.

Capacitacinenser vicio.Laimparteunsupervisoraunprincipiantedevezencuandohacealgunacrticao
recomendacin.Tambinpuedeasignarseaunempleadoconexperienciaparaqueinstruyaalprincipiante.
v Capacitacininformal.Duranteestetipodecapacitacin,esposiblequeelsupervisorhagapasaral
empleadopordistintastareasafindedarleunaexperienciaamplia.

Combinacin.Enocasionesladireccintratadecombinarelrealismodelacapacitacinenservicioconla
reduccindepresionesparaobtenerdeinmediatolosbeneficiosdeloscursosexternos.

144
v Capacitacindeantesala.Estaesdeseablecuandoelpuestoesdifcilcuandoloserroresolalentitud
perjudican gravemente los programas y los mtodos de produccin o cuando se requiere una
enseanzamuyespecial.
v Capacitacin trabajando como aprendiz de un maestro. Esto es parecido a los programas
universitariosdetrabajoyestudio,enquelaenseanzaenclasesecomplementaconlaexperiencia
real y en el trabajo. Como este tipo de capacitacin ofrece oportunidades de aplicar casi de
inmediato,lateoraestimulalamotivacinyelaprendizaje.

5.5.3.Pr ocesodeCapacitacin.

Esimportantemencionarquelasociedadcooperativadetrabajadorespascualsigueunprocesoparacapacitar
a su personal y as lograr elevar la productividad de los individuos en su trabajo, influyendo sobre su
comportamientointernocomoexterno.
El primer paso del proceso de capacitacin consiste en determinar las necesidades que existen en una
organizacin,dichasnecesidadessonlasreasdeinformacinodehabilidaddeunindividuoascomodeun
grupo que requiere un mayor aprendizaje para aumentar la productividad en la sociedad cooperativa de
trabajadores pascual S.C.L. Sin embargo para poder determinar las necesidades dentro de dicha sociedad
debenutilizartrestiposdeanlisiscomosonelorganizacional,defuncinydepersonas.
Elanlisisor ganizacional.Secentraprincipalmenteenladeterminacindelosobjetivos organizacionales,
sus recursos y localizacin y sus relaciones con los objetivos. El anlisis de objetivos organizacionales,
estableceelmarcodentrodelcualpuededefinirseconmayorclaridad,lasnecesidadesdecapacitacin.
El anlisis de funciones. Se enfoca sobre la tarea o el trabajo, sin tomar en cuenta el desempeo del
empleadoenelmismo.Esteanlisisincluyeladeterminacindeloquedebehacereltrabajador,siserequiere
queeltrabajoserealiceenformaeficaz.Aquseconcentralaatencinsobrelatareaynosobreelindividuo
quelodesempea.
La determinacin de las necesidades de capacitacin, sobre la base del anlisis de funciones, revela las
capacidades que debe tener cada individuo dentro de la organizacin en trminos de liderazgo, motivacin,
comunicacin, dinmica de grupo, resolucin de conflictos e implantacin de cambios adems de muchas
habilidades tcnicas y de toma de decisiones, dichas necesidades no solo se descubren analizando las
actividades que abarca cada trabajo, sino tambin proyectando creativamente los requerimientos del
desempeoptimo.
El anlisis de per sonal. Examina el conocimiento, las actitudes y las habilidades del individuo que ocupa
cada puesto, y determina que tipo de conocimiento, actitud o habilidades debe adquirir as mismo las
modificaciones que debe tener su comportamiento, para poder contribuir satisfactoriamente al logro de los
objetivosorganizacionales.
Sinembargodespusdelanlisisseprocedealadeterminacindelasnecesidadesquecadaindividuodebe
adquirirparalocualsenecesitanseguirdospasosqueson:

145
NecesidadesparalaElaboracindeunProgramadeCapacitacin.
Primero.Mediantelaplaneacinformaldelasnecesidadesdelreaderecursoshumanossepuededeterminar
cuantas personas adicionales se van a requerir en el periodo que cubra la planeacin, en que fechas
aproximadasyconquecaractersticasdeaptitudes,paraestosedebeconsiderarlasnecesidadesderivadasde
los nuevos proyectos que esta formando la sociedad cooperativa, as como las necesidades derivadas del
propiocrecimiento.
Segundo.Atravsdeinformacinquepuedemanejarsecomoindicadordelasnecesidadesdecapacitacin,
tales como solicitud de la direccin, planeacin estratgica, entrevista, anlisis de actividades, encuestas,
calificacindemritos,observacionesdirectasdelossupervisores,pruebasoexmenes,reunionesdegrupos
yregistrodelpersonal.
Por lo antes mencionado nos percatamos que la sociedad cooperativa de trabajadores pascual S.C.L. divide
susnecesidadesencuatrosaspectosmuyimportantesqueson.

1. Necesidadesmanifiestas.
v Personasdenuevoingreso.
v Ascensostemporalesodefinitivos.
v Permutas.
v Ampliaciones.
v Cambios.
2. Necesidadesdestacadasporproblemasenproduccin.
v Periodosdeociosidad,seguidosdeperiodosdesobrecarga.
v Necesidadesdesupervisinconstanteodemasiadodirecta.
v Tiemposexcesivosenlaejecucindetareas.
v Bajacalidaddelostrabajosrealizados.
v Desperdicioyfrecuenteperdidademateriales.
v Necesidadesdemantenimientoconstante.
3. Necesidadesdestacadasporproblemasdeubicacin.
v Trabajadoresnopreparadosparaasumirmayoresresponsabilidades.
v Deficienciasdemritosdeprocesoysistemadetrabajo.
v Pocaversatilidaddemanodeobra.
4. Necesidadesdetectadasporproblemasocasionadosporlaactituddeltrabajador.
v Prdidaydesperdiciodematerialesconmuchafrecuencia.
v Materiales,herramientasyequipomalcuidado.
v Rupturaydescomposturadeherramientasyequipo.
v Bajamoraleinsatisfaccinprofesional.
Una vez conocidas cada una de las necesidades especificas de capacitacin para cada persona o grupo, la
siguiente fase de este proceso ser la elaboracin de uno o varios programas de capacitacin planeados
especialmenteparaestasnecesidades.

146
ElaboracindelProgramadeCapacitacin.
Para poder iniciar la elaboracin de un programa de capacitacin se deber determinar el objetivo del
programa,siendoquelosobjetivossonlasmetasquesedebenalcanzar,esdecirlasexperienciasclarasdelos
propsitos.
Losobjetivosdebenserexpresadosentrminosquepuedansercomprendidosporlosparticipantes,afinde
quesepanloqueseesperadeellosestosdebenexponerseporescrito,enterminodedesarrollodehabilidades,
conocimientos, comprensin, apreciacin y aptitudes ya que al exponer por escrito se deben utilizar los
trminoscomoresolver,identificar,listar,comparar,quedenlaideadeconductacuantificableuobservables
asimismo, se deben tener objetivos generales para todo el programa y especficos para cada seccin, los
objetivosayudantambinaprepararunapresentacinlgicadelprograma.
Porlotantoelcontenidodelprogramadebeestarbasadoenladeterminacindelosobjetivoscomoes.
v Seseleccionanyjerarquizanlospuntosqueeltrabajadordeberaprender.
v Seprogramanlasactividadesqueelinstructorytrabajadorllevaranacabo.
v Setomanencuentatodosaquellosrecursosyayudastcnicaseducativas.
v Seestablecenlosmediosylastcnicasquepermitanevaluarelaprendizajeobtenido.
Eldiseodelprogramadebehacerseenfuncindelobjetivodelacapacitacin,tomandoencuentaaquiense
va ha capacitar aplicando los principios del aprendizaje para trabajadores: este concepto puede entenderse
como la adquisicin de nuevos modos de conducta y nuevas posibilidades de comportamiento tomando en
cuentalossiguientespuntos.

v Sedefinenlostemasomateriasdeestudio.
v Seagrupanlostemasenunidadesdeestudio.
v Seordenanlasunidadesensecuenciascronolgicas.
v Seseleccionanlastcnicasdeenseanzayladuracindelasunidades.
Siendoimportantelapreparacindelprogramadentrodelasociedadcooperativadetrabajadoresparaayudar
a:
v Lograrlosmximosbeneficiosparalosparticipantes.
v Darlealprogramaunamayorimportanciayvalidez.
v Darlealostrabajadoresmsseguridadensimismos.

EjecucindelProgramadeCapacitacin.
Unavezquesedeterminanlasnecesidadesdecapacitacinysehaespecificadoelprogramaadesarrollar,la
fase siguiente consiste en ejecutar el programa de capacitacin. Existen diferentes enfoques respecto de la
ejecucindelacapacitacincomosonlossiguientes.
1. Elsupervisor.Elsupervisortienetodalaresponsabilidadsobrelacapacitacin.
2. Elsupervisordelegaaunasistente.Elasiste ejecutacompletamentelacapacitacinporcuentasuyao
conayudadelsupervisor.

147
3. El supervisor orienta. Ya que asigna la supervisin de capacitacin dndole esta responsabilidad,
peroofrecindoleunaadecuadainstruccinparaqueorienterespectoaltrabajorespectivo.
4. Elsupervisorasesora.Sedelegaalsupervisorlafuncindeentrenarperoleofrecenlosserviciosde
asesoraconespecialistasexpertos.
DesarrollodelPrograma.
Dentro del dominio de programas formales los directores de capacitacin tienen dos opciones bsicas:
desarrollarprogramasinternosoutilizarprogramasexternosprofesionales.
Desar r ollodepr ogr amasinter nos:Lasociedadcooperativadetrabajadorespascualencuentraconveniente
desarrollarprogramasinternoscuando.

v Hayunvolumenimportantedeactividades.
v Los objetivos de capacitacin permiten a los ejecutivos desarrollar programas intensivos y
extensivos.
v Las tcnicas especiales y otros temas relacionados requieren el uso de especialistas de la propia
sociedad.
v Noexistendespachosexternos.
v Lacapacitacinpuedesermseconmica.

Uso de pr ogr amas exter nos: Los instructores y consultores externos de capacitacin se emplean con
frecuenciaparadisear,estableceryoperarprogramasinternosdentrodelasociedad.xitoenlaejecucinde
unprogramadecapacitacin.
El proceso de ejecucin del programa de capacitacin se desenvuelve as en primer termino, se fijan los
objetivoseducacionalesysedeterminaelcontenidodelprogramaacontinuacinsedecidesobrelosmtodos
ytcnicasdecapacitacinyfinalmentetienelugarlacapacitacin.
Sinembargoelxitodelacapacitacindependerdelosfactoressiguientes:
v Adecuacindelprogramaalasnecesidadesdelasociedad.Lanecesidaddeestablecerdeterminados
programas de capacitacin dependiendo del inters de preparar a determinados empleados pare
mejorarsuniveldeeficiencia.
v Calidaddelmaterialdecapacitacinpresentado.Elmaterialdeenseanzadebesercuidadosamente
planeadoparallevaracabolacapacitacin.
v Cooperacin de los jefes y directivos de la sociedad. La capacitacin debe hacerse con todo el
personal de la empresa, en todos los niveles y funciones para ello es necesario contar con la
cooperacin yelapoyodelosdirectivos yaquetodoslos jefes ysupervisoresdebenparticiparde
maneraefectivaenlaejecucinelprograma.
v Calidadypreparacindelosinstructores.Elxitodelaejecucindependerdelinters,lacalidady
lacapacidaddelosinstructores.Porelloesimportanteelcriterioalseleccionaralosinstructores.
v Calidaddelosaprendices.Aparentemente,lacapacidaddelosaprendicesinfluyesustancialmente,
enlosresultadosdelprogramadecapacitacin.

148
Losencargadosdelasdecisionesde capacitacin,debenequilibrardiversos factoresdelasrelacionescosto
beneficioentreellosestimacionesdelxitoprobabledelprograma,exigenciasdelosgerentesynecesidades
delosempleados.
El contenido del programa se refiere al material que se va a incluir en un programa de capacitacin de
personaly endondeesapropiadalasecuenciaenlacualdebenpresentarse,elcontenidodelprogramaest
determinadobsicamenteporloquesedebeaprender.

5.6.EVALUACINDEDESEMPEO.

5.6.1.Impor tanciadelaEvaluacindelDesempeo.

Alhablar de la evaluacin del desempeo, cabe mencionar que es unproceso mediante el cual la sociedad
evala el merito de cada trabajador alrealizar susactividades dentro de la organizacin es decir califica la
calidaddesudesempeo,enlaobtencindelosresultadosquesondesuresponsabilidad.
Siendo importante evaluar el desempeo ya que proporciona ciertas ventajas para mejorar el rendimiento
dentrodelasociedadentreellasestn.

v Proporciona juicios sistemticos a fin de fundamentar los incrementos salariales, promociones y


transferencias.
v Proporciona un medio para indicarle al subordinado como es su rendimiento y sugerir cambios
necesariosenlaconducta,aptitudes,habilidadesoconocimientosdetrabajo.
v Proporciona una base para el asesoramiento y la consultora del trabajador por parte del jefe
inmediato.

5.6.2.ObjetivosdeEvaluacindelDesempeo.

Es importante mencionar que para poder evaluar el desempeo debemos de contar con objetivos generales
comoparticulares.

Objetivosgener ales.
v Daralosempleadosretroalimentacinadecuadaacercadesudesempeo.
v Servir de base para un cambio de actitudes, con el fin de lograr prcticas efectivas dentro del
trabajo.
v Ofrecer los datos necesarios para la concesin de compensaciones, promociones y aumentos de
salario.

149
Objetivospar ticular es.
v Mejorar el desempeo. La retroalimentacin del desempeo permite al personal directivo
principalmenteparaintervenirconaccionesadecuadasparamejorareldesempeo.
v Ajustes de compensaciones. Las evaluaciones ayudan a los responsables de rea a determinar
quienesdebenrecibirincrementosdesueldo.
v Disponibilidaddecolocacin.Parapoderascenderotransferirsedebenbasareneldesempeodel
pasadoyelesperado.
v Necesidades de capacitacin y desarrollo. Un mal desempeo puede indicar una necesidad de
capacitacin y un buen desempeo puede indicar potencial desaprovechado, que debera
desarrollarse.
v Planeacinydesarrollodecarreras.Laretroalimentacinsobreeldesempeogualasdecisionesde
carreraparalastrayectoriasespecficasquedebeninvestigarse.
v Deficienciasenelprocesodecoberturadepuestos.Unbuenomaldesempeoimplicapuntosfuertes
ydbilesparalosprocesosdecoberturadevacantesdeldepartamentodepersonal.
v Inexactitudesdelainformacin.Unmaldesempeopuedeindicardeficienciasenlainformacinde
anlisis de puestos, los planes de personal y otras reas para el sistema de informacin de
administracindepersonal.
v Errores de diseo de puestos. Un mal desempeo puede ser sntoma de diseos de puestos mal
concebidos.Lasevaluacionescontribuyeneneldiagnosticodeesoserrores.
v Igualdad de oportunidades de empleo. Las evaluaciones precisas que miden el desempeo
relacionadoconlospuestosparaasegurarquelasdecisionesinternasseanadecuadas.
v Desafosexternosaveces,influenciasexternasafectaneldesempeoydebenserdescubiertasestas
paraqueeldepartamentoderecursoshumanosproporcioneayuda.
La evaluacin del desempeo ofrece un marco de referencia preciso del desempeo de un empleado. En el
trabajo,sinembargoparapoderlograrlosobjetivos,lossistemasdeinformacindebenestarrelacionadoscon
eltrabajo,comoson:

5.6.3.Nor masyMedidasdelDesempeo.

Normasdedesempeo.Sonlosnivelesquesirvenparamedirlosresultadosdeseadosencualquierpuesto.No
sepuedenestablecerarbitrariamentelosconocimientossobreesasnormasyaqueseacumulanpormediodel
anlisisdedesempeo,analizadoeldesempeodelostrabajadoresexistentes.

Apartirdelosdeberesylasnormasqueseincluyenenladescripcindelpuesto,elanalistapuededecidirque
conductas son crticas y se deben evaluar. Cuando esta informacin no exista o bien, sea poco clara se
elaborandichasnormasapartirdelaobservacindeltrabajooenrevisionesconlosjefesinmediatosobien
conlossupervisoresdecadareadetrabajo.

150
Medidas del desempeo. La evaluacin del desempeo requiere de medidas confiables. Para que estas
medidasseandeutilidad,debenserfcilesyclarasdeutilizar,confiableseindicarlasconductascriticasque
determinan el buen desempeo. Por ejemplo, los supervisores de la sociedad cooperativa de trabajadores
debenobservarcondetallecomoprocesanlosproductosparallegaraunbuencontrol
Medidas objetivas del desempeo. Son las indicaciones del rendimiento del trabajo, que otros pueden
verificarporejemplosidossupervisoresobservaneltrabajodelossubordinadospuedendecirquefallashan
tenido. Por lo tanto los resultados sern objetivos y verificables ya que cada supervisor obtendr el mismo
criteriodeprecisinenlasfallasquehantenidolossubordinados.
Medidassubjetivasdeldesempeo.Sonlascalificacionesquenopuedenserverificadasporotraspersonas
por lo general, esas medidas son las opiniones personales del evaluador. Por ejemplo la evaluacin de los
modales de los obreros se realizara subjetivamente ya que los supervisores deben utilizar sus opiniones
personalesconrespectoalosbuenoymalosmodales.Puestoquela evaluacinessubjetiva,laprecisinsuele
ser baja, a un que el supervisor observe directamente la de los empleado por lo anterior siempre que sea
posiblelosespecialistascorregirnsusmodales.

5.6.4.MtodosdeEvaluacindelDesempeo.

Laevaluacindeldesempeopuederealizarsepormediodetcnicasquevarandentrotelaorganizacinya
queseenfocaadeterminadosobjetivosfijadosyapoyadosporunapolticadeaplicacindelpersonal,esas
como estas polticas varan de acuerdo a cada departamento dentro de la sociedad cooperativa como a
continuacinsemencionan.
v Evaluacindeldesempeodepersonalejecutivocomosonlosgerentesderea,subgerentesyjefes
dedepartamentos.
v Evaluacindeldesempeodepersonalaniveldesupervisor.
v Evolucindeldesempeodepersonalaniveloperativo.
Cada uno de los sistemas de evaluacin atiende a determinados objetivos especficos y a determinadas
caractersticasdelasdiversascategorasdepersonal.
Esimportantemencionarqueunodelosmtodosutilizadosporlasociedadcooperativadetrabajadoresesel
deevaluarengrupoyaquepermitequeotraspersonasademsdelossupervisoresinmediatosparticipenenla
evaluacin de los trabajadores como pueden ser los gerentes y jefes de departamento que conocen al
empleado,incluyendoasusupervisorinmediato yaquese renenenconferenciasconuncoordinadorcuya
funcin principal es mantener la objetividad en la evaluacin, es donde discuten la evaluacin que ha sido
preparada previamente por el supervisor, despus de tener una entrevista con cada uno de los empleados
respectodelosrequisitosdelpuesto.Despus elsupervisortieneotraentrevistaconelempleadoenlacual
comentalasnormas,eldesempeodelempleadoy cualquieraccindedesarrollorequeridaparamejorarel
desempeo,yaqueconestoleayudaatomardecisionesrelativasaaumentosdesueldospormritos,ascensos
yrecompensasdentrodelasociedadcooperativa.

151
v Elprocesodeestablecimientodeobjetivoscomienzaenlacimaconunenunciadoclaroy conciso
delobjetivocentral.
v Seelaborarobjetivosalargoplazodelaorganizacin,conlabaseenloanterior.
v Losobjetivosalargoplazo,conducenalestablecimientodeobjetivosderendimientoalargoplazo.
v Sederivanobjetivosparacadadivisinodepartamentoprincipal.

5.6.5.DiseodelSistemadeEvaluacindelDesempeo.

Esta etapa debe cubrir el inters y valor, tanto para la organizacin como para los empleados cuyo
rendimientoesevaluadoporellos.
Para la sociedad cooperativa de trabajadores la evaluacin del desempeo humano es un sistema de
informacin administrativa para los empleados, pero tambin es un sistema de retroalimentacin que sirve
paraorientarlaspromocionesylosaumentosdesueldosysalarios.

Implantacindelsistemadeevaluacin.
Cuando el sistema de evaluacin del desempeo este bien planteado, coordinado y desarrollado, genera
beneficiosacorto,medianoylargoplazo,losprincipalesbeneficiossonlosempleados,jefesyenslamisma
sociedadcooperativa.

5.7.HIGIENEYSEGURIDADENELTRABAJO.

Todas las actividades dentro del mbito organizacional son importantes para obtener y mantener las
habilidadesylasactitudes,capacesdeasegurarlaeficienciaylaeficaciaorganizacionalsinembargoexisten
otras actividades paralelas igualmente necesarias para asegurar la disponibilidad de las actividades de las
habilidadesylasactitudesdelafuerzadetrabajo,losprogramasdeseguridadydesaludconstituyenalgunas
deestasactividadesparalelas,esencialesparaelmantenimientodelascondicionesfsicas ypsicolgicasde
lostrabajadores.

5.7.1.LaHigieneenelTr abajo.

Serefiereaunconjuntodenormasyprocedimientosqueprotegenlaintegridadfsicaymentaldeltrabajador
preservndolo de los riesgos de salud inherentes a las tareas del cargo y al ambiente fsico en donde son
ejecutadas. La higiene en el trabajo est relacionada con el diagnostico y con la preservacin de las
enfermedadesocupacionalesapartirdelestudiodedosvariableselhombreysumedioambientedetrabajo
sin embargo para poder cubrir adecuadamente la higiene en la sociedad cooperativa esta implanta ciertos
objetivoscomoson.
v Eliminacindelascausasdeenfermedadesdentrodelreadetrabajo.

152
v Reduccindelosefectosperjudicialesgeneradosporeltrabajo,enpersonasenfermasoportadoras
dedefectosfsicos.
v Prevencindelempeoramientodeenfermedadesodelecciones.
v Mantenimientodelasaluddelostrabajadores yaumentodelaproductividad,medianteelcontrol
delambientedetrabajo.
Dichosobjetivossepodrnlograrcon.
v La educacin de los operarios, supervisores y jefes que indique los peligros existente y enseen
comoevitarlos.
v Elconsistenteestudiodealertacontralosriesgosexistentes
Plandehigieneeneltr abajo.
Los principales apartados de un plan de higiene en el trabajo en la sociedad cooperativa son los que a
continuacinsedetallan.
v Planorganizadoqueincluyelosserviciosmdicos,yaseadetiempointegraloparcialdependedel
readetrabajo.
v Servicios mdicos adecuados. Incluye el botiqun de emergencia y los primeros auxilios, si es
necesariotalesfacilidadesdebenincluir.
v Exmenesmdicosdeadmisin
v Cuidadoseficientesdeheridas,provocadaspormolestias.
v Serviciosdeprimerosauxilios.
v Eliminacinycontroldelasreasinsalubres.
v Registrosmdicosadecuados.
v Supervisinadecuadaencuantoahigieneysalud.
v Exmenesmdicosperidicosderevisin.
v Serviciosadicionales.Comopartedelapolticasanitariadelaorganizacinparaconelempleadoy
lacomunidad.

5.7.2.Segur idadenelTr abajo.

Es el conjunto de medidas tcnicas, educacionales, medicas y psicolgicas, empleadas para prevenir los
accidentes, eliminar las condiciones inseguras del ambiente, e instruir o conservar a las personas sobre la
implantacindemedidaspreventivasdentrodelasociedadcooperativa.
Plandeseguridadeneltrabajo.
El plan de seguridad parte de principios de que la prevencin de accidentes es alcanzar la aplicacin de
medidas de seguridad adecuadas y que solo pueden aplicarse de manera eficaz con un trabajo de equipo
dichosplandebeabarcarlossiguientesaspectos.
v Laseguridadesresponsabilidaddeldepartamentodepersonal.
v Lascondicionesdetrabajo.

153
v La seguridadno debe quedar restringida solamente para el rea de produccin sino para todos los
departamentosdelasociedadcooperativa.
v Losproblemasdeseguridadperjudicanlaadaptacindeltrabajadordentrodelaorganizacin.
v La seguridad en el trabajo se encarga de dar capacitacin al personal para cumplir las normas de
seguridadimplantadasenlasociedad.
Dichaseguridadeneltrabajotienetresreasbsicasdeactividadquesonlassiguientes.
Pr evencindeaccidentes.Consisteenminimizarlosaccidentesdetrabajopormediodesuprevencin.
Pr evencin de r obo. En la sociedad tiene un servicio de vigilancia con caractersticas propias, control de
entradaysalidadevehculos,registrodemaquinariayregistrodetransportedemercancaentreotras.
Pr evencin de incendios. Se da principalmente en el rea de produccin ya que es donde se encuentra la
maquinariaparaprocesarlaproduccin.

5.7.3.ObjetivosyFuncionesdelDepar tamentodeHigieneySegur idad.

Objetivopr incipal.
Trabajar en forma coordinada con las unidades de operacin para lograr seguridad e higiene en todas las
operaciones.
Funcionesprincipales.
v Concentrarlaatencinsobrelasventajasdeseguirunasprcticassegurasydeevitareldesperdicio.
v Lograr que todos los trabajadores se den cuenta de lanecesidad de la seguridad en el trabajo y el
mantenimientodelasdebidascondicionessanitarias.
v Estar alerta para implantar nuevos dispositivos y salvaguardas que mejoren las condiciones aun
cuando por el momento esas condiciones parezcan satisfactorias con relacin a las tcnicas
conocidas.

5.8EJ EMPLODEMANUALDEPOLTICASYPROCEDIMIENTOSDEUNDEPARTAMENTO
DERECURSOSHUMANOS.

Objetivosdeautor izacin
Objetivosespecficos Tcnicasdecontr ol Riesgosdeincumplimiento
1.Elpersonaldelasociedaddebe Polticas por escrito para la La sociedad puede contratar
contratarse de acuerdo a polticas seleccin y contratacin de personalquenoseaelapropiadoo
establecidasporlaCooperativa personal. autorizado, es decir, empleados
sin preparacin adecuada
huelgas costos innecesarios de

154
relocalizacin irregularidades o
conflictos de intereses faltas
excesivas al trabajo debidas a
poca salud mental o fsica altos
costos de jubilacin servicios
mdicos y otros planes de
prestaciones al personal multas o
penalidades por omisin de
requisitoslegales.

Bases de datos como archivo La empresa puede tener un


maestrodepersonal,relacionesde personalinadecuadooexcesivo.
funcionariosydirectivos,etctera.

Procedimientos especficos para


aadir, cambiar o eliminar
informacindelasbasesdedatos.
Tcnicas para probar la
confiabilidaddelasbasesdedatos
tales como especificar que los
cambios en archivos sean
aprobados por escrito, por
personal autorizado uso de
formas prenumeradas para
documentar los cambios a las
bases de datos de personal,
controlesfsicossobreelaccesoa
dichas formas y conciliacin de
las formas autorizadas con los
cambios realmente efectuados
revisin y aprobacin, pro
personal autorizado, de los
informes de cambios a las bases
dedatosverificacinperidica,
por una persona independiente al
proceso, que el personal
registradoenlasbasesdedatosse

155
el autorizado, y que las polticas
de seleccin sean las aprobadas
porlaadministracin.
Revisar peridicamente que los
cambios a la base de datos se
hicieroncorrectamente.
Conciliacin de las cifras de
control con los registros de la
computadora.
Limitacin del acceso a la
informacin contenida en las
basesdedatos.
2. Los tipos de retribucin y las Polticas por escrito donde se Pueden pagarse al personal
deducciones de nmina deben expongan claramente los criterios cantidades no autorizadas e
autorizarse de acuerdo con de nminas, como son: pago inaceptables para la
polticas establecidas por la semanal a obreros y quincenal o administracin, lo cual ocasiona
cooperativa. mensualaempleadosyejecutivos, costos excesivos de nminas
los sueldos deben ser aprobados infracciones en caso de salario
por personal autorizado polticas mnimo, contratos colectivos,
depagodetiempoextraaobreros etctera,estructurassalarialesque
y compensaciones al personal de causen descontentos o huelgas
supervisinodirectivolosajustes cuentas de anticipo a empleados
peridicos que se efecten a los que resulten incobrables
sueldos deben ser aprobados por irregularidades en el manejo de
personal facultado para ello los nminas.
anticipos deben estar limitados a
cantidades predeterminadas
procedimientos para participar de
las prestaciones al personal, las
retenciones opcionales (caja de
ahorros, seguros, comidas,
etctera.)debenseraprobadaspor
personal autorizado y por el
interesado determinacin por
personal autorizado de los pagos
por tiempo extra, enfermedades,
etctera.

156
Basesdedatos,como eselcasode Las provisiones para pensiones,
archivos maestros de personal, vacaciones, gratificaciones,
horario autorizado, das festivos, etctera, pueden calcularse
retenciones,deducciones,etctera. incorrectamente, lo que puede
crear pasivos no registrados o
excesivos.
Procedimientos establecidos para Pueden infringirse leyes o
aadir, cambiar o eliminar disposiciones laborales que
informacindelasbasesdedatos, generen multas o pasivos
comoporejemplo: contingentes.
comparacin de totales de
informacin sobre nminas
producidos mediante la
computadora con registros
colectivos o individuales con los
archivos maestros de personal
revisin peridica de la
informacincontenidaenarchivos
maestrosdepersonalporpersonal
autorizadodenminas.
Procedimientos y requisitos Pueden distraerse efectivo
documentados para la retenidoaempleados.
actualizacin peridica de
sueldos.
Comparacin peridica de los Puede retenerse al personal
archivosmaestrosdepersonalcon cantidades por conceptos no
los importantes de las nminas autorizados.
por parte de personal
independiente de la funcin de
pagosdenminas.
Comparacin peridica de los
importantes individuales de las
nminas con los tabuladores de
sueldos o contratos colectivos
celebrados.

157
Anlisis de las variaciones
importantes en las nminas as
comoinformesrelativos.
Comparacin peridica de los
sueldos promedio pagados en el
mercado con los sueldos pagados
porlaCooperativa.

3. Las distribuciones de cuentas, Exposiciones claras de los Lascuentasde nominapuedenser


los ajustes a los desembolsos de criteriosypolticasestablecidas. presentadas incorrec6tamente
efectivo y cuentas de personal, como consecuencia de ajustes o
pagos anticipados y pasivos reclasificacioneserrneas.
acumuladosdebenserautorizados
de acuerdo con polticas
establecidasporlaadministracin.
Aprobacin y uso de formas Pueden aprobarse ajustes que no
prenumeradasestndarparallevar son aceptables para la
acabolosajustesdesueldos. administracin.
Investigacin de ajustes que Pueden procesarse ajustes no
excedan una cantidad autorizados para aumentar o
determinada. disminuir cantidades pagadas al
personal.
Informes regulares y anlisis Pueden efectuarse pagos
peridicosdelastendenciasdelas duplicados.
cantidadesytiposdeajustes.

Revisin, por funcionario


autorizado de que se hayan
tomadolosdescuentosrelativosal
prepararloscheques.

Aprobacin de los cargos a las


cuentasporpagaralpersonal,por
un ejecutivo independiente al
manejo y control de dichas
cuentas.

158
Conciliacin de las cifras
manualesdecontroldelosajustes
aprobados con los totales segn
informes de ajustes procesados
porlacomputadora.
Empleo de contraseas en las
terminalesparalimitarelaccesoa
losarchivosdelacomputadora.
Comprobacin de validez de los
campos (de computo) de datos
importante y verificacin de
lmites en cuanto a importes y
nmerodeajustespreparados.
Firmas manuscritas en los
cheques no preparados por la
computadora.
4. Todos los pagos de nmina Usodefirmasmancomunadas. Puedenefectuarsedesembolsosde
deben efectuarse de acuerdo a efectivoalpersonalporcantidades
polticas establecidas por la equivocadas o en forma
administracin. fraudulenta.
Segregacin de las funciones de Puedenhacersepagosduplicados.
preparacinyfirmadecheques.
Poltica para evitar la firma de Pueden alterarse los cheques en
chequesenblancooalportador. formafraudulenta.
Designacinporpartedelconsejo Puedenefectuarsedesembolsosde
de administracin, del personal efectivosinelconocimientodela
autorizadoparafirmarcheques. administracin.
Utilizacin de cuentas bancarias
paraelusoespecficodenminas.
Utilizacin de servicios bancarios
para el ensobrado y pago de
nmina.
Apertura de cuentas bancarias o
tarjetasdedbitoalpersonalpara
el depsito de sus ingresos por
nmina.

159
Afianzar al personal que
interviene en el proceso de
nminas.
Establecer lmites para elimporte
de loschequesdenmina.
Los procedimientos del ciclo de Clara exposicin de los Pueden producirse
nminasdebenestardeacuerdoa procedimientos a travs de reorganizacionesycambiosenlas
polticas establecidas por la manuales de polticas, manuales asignaciones del personal de los
administracin. de procedimientos, rutinas de departamentos, de tal manera que
entrenamiento, requisitos de reduzcan la segregacin de
supervisin, documentacin de funciones.
sistemasyprogramas,etctera.
Verificacin peridica de las Pueden realizarse modificaciones
aprobaciones requeridas por la a los programas para nulificar
gerencia y usuarios para nuevos controles, cambiar las polticas
sistemas y procedimientos, y contables,oreducirlasalvaguarda
cambios en los sistemas, fsicadelosactivos.
procedimientosyprogramas.
Verificacin peridica de las Pueden efectuarse alteraciones en
pruebas, aprobaciones y el flujo de la informacin para
documentacin de los cambios a ocultar datos a las personas que
losprogramasdecmputo. deben recibirlos, o bien facilitar
estos datos a personas que no
debenteneraccesoaellos.
Comparacin peridica de los Pueden perderse datos cuando se
procedimientos de procesamiento llevan a cabo conversiones a
decmputoconladocumentacin nuevossistemas.
ylaautorizacinrespectiva.
Pruebas peridicas de Pueden no procesarse
razonabilidad que comparen los transacciones.
resultados del procesamiento de
cmputo con resultados de
antemano.
Acceso restringido a las reas de Las transacciones pueden ser
procesamiento electrnico de procesaras incorrectamente por
datos, a los programas y a la una persona a quien no
documentacindelosmismos. correspondedichafuncin.

160
Segregacin de funciones entre Pueden no realizarse
los operadores de computadora y procedimientosdecontrol.
los programadores de sistemas y
aplicaciones.
Procedimientos documentados y
polticas obligatorias de las
pruebasquedebenefectuarsealos
programasyalossistemas.
Procedimientosquerequieranque
los programas de computadora y
todos los cambios sean
autorizados, revisados y
aprobados por el gerente de
procesamiento de datos y el jefe
deldepartamentousuario.
Sistemas programados en la
computadoraquelimitenelacceso
a los programas nicamente a
personas autorizadas, y que
registren e informen sobre todos
loscambiosalosprogramasauna
persona independiente de la que
efectaelcambio.
Revisin peridica de los nuevos
sistemasdecmputo.

6. Slo deben aprobarse aquellas Procedimientos documentados Lautilizacindelamanodeobra


solicitudesdeutilizacindemano para iniciar, revisar y aprobar puede oponerse a planes de corto
de obra que se ajusten a las solicitudes de uso de mano de plazo o a las polticas
polticas establecidas por la obra establecidas.
administracin.
Uso y control de formas Puededisponersedemanodeobra
prenumeradas. confinesnoautorizados.
Archivos de firmas autorizadas Puede utilizarse mano de obra en
para abordar la utilizacin de formaineficiente.
manodeobra.

161
Inspeccinperidicadelasformas Puede emplearse mano de obra
utilizadas para comprobar que para proyectos capitalizables,
estncompletasyautorizadas. mantenimiento y reparaciones no
autorizados.
Aprobacin por funcionario
autorizado de cada una de las
diferentes aplicaciones de mano
deobra.
Designacin por parte de la
administracin o consejo de
administracin de las personas
que pueden firmar ciertos
documentos a nombre de la
empresa, como es el caso de
contratos de trabajos individuales
ocolectivos.
Comparacin con polticas
establecidasporlaadministracin,
de los detalles de cada uso de
mano de obra que se propone.
Esta comparacin puede hacerse
manualmente o con tcnicas de
validacin de computadora, por
ejemplo: comparacin de ordenes
de produccin con el archivo
maestro de productos antes que
comience la produccin, o
comprobacinmediantereferencia
a la orden de produccin para
determinar si el tipo de mano de
obra.

Verificacin interna de
documentacin soporte para tener
la certeza de que se procesan las
transacciones y archivos maestros
apropiados.

162
Limitacin de acceso a los
archivos o datos de personal
basadoenlacomputadora.
Informes por excepcin de los
usos de mano de obra propuestos
que nosonaceptados.
Disposicin del trabajo de modo
que permita visibilidad mxima a
lossupervisores.
Supervisin estrecha de
empleadosyarchivos.
Revisin, por parte de abogados
consultores, de convenios y
contratosimportantes.
Relaciones de control de
asistencia.
Informesdetiempoimproductivo.

Sistemas de programacin de
actividadesdelpersonal.
Anlisis de variaciones
presupuestarias por departamento
y de variaciones de eficiencia de
manodeobra.
Utilizacin de rdenes de trabajo
especficas para labores de
mantenimientoyreparacin.
7.Lamanodeobrautilizadadebe Informesdetiempoyasistencia. Puede pagarse a los empleados
informarse con exactitud y en por horas no trabajadas o
formaoportuna. produccinnorealizada.
Supervisin adecuada de la Puedenopagarsealosempleados
utilizacindelamanodeobra,ya horas trabajadas o produccin
seaporhoras,dasopiezas. efectuada.

Aprobacin previa del tiempo Puede no reconocerse el


extra, cambios de turno, de diferencial por horas de tiempo
departamento,etctera. extraoporcambiodeturno.

163
Entrenamientodelpersonalenlos Pueden manejarse
procedimientos de control de incorrectamente los cortes de
tiempos. distribucin de nmina y las
acumulaciones de nmina al final
delperiodo.
Conciliacin de las horas de La administracin puede tener
asistenciaconlashoraslaboradas, informacin inadecuada para
ya sea por empleado o por evaluar el trabajo y eficiencia de
departamento. losempleados.
Conciliacindelashorasdemano
de obra estndar para las piezas
producidas con las informadas en
losreportesdetiempo.
Observacin del registro de la
entrada y la salida de los
empleados para prevenir que se
procesen tarjetas de tiempo de
empleadosausentes.
Revisin y seguimiento de los
informes por excepcin de horas
pagadasperonocargadas.
Revisin y seguimiento de las
variaciones con el presupuesto de
gastos de mano de obra,
especialmente en las cuentas de
gastosindirectosdefabricacin.
Uso de dgitos de verificacin
computarizados sobre los cdigos
de los empleados, de los
departamentos, horas trabajadas,
claves de los productos,
cantidadesproducidas,etctera.
Controldedatosdemanodeobra
que registran simultneamente la
mano de obra de la produccin y
el tiempo trabajado para efectos
delaelaboracindelasnminas.

164
Limitacin del acceso a la
informacin contenida en las
bases de datos de la computadora
mediante el uso de contraseas o
controles fsicos sobre las
terminalesenlnea.

Tarjetas de mano de obra o de


trabajo a destajo prenumeradas y
controladas para comprobar su
incorporacinenlanmina.

Revisin y aprobacin por el


supervisor encargado del rea de
produccin, de los cargos
efectuados por concepto de mano
deobra.

Anlisis de las variaciones de la


mano de obra con relacin a los
costosestndar.

Formasdecontrolparareprocesar
unartculo.
Aprobacin por escrito de las
horas de tiempo extra como una
condicin para el procesamiento
delanmina.
Verificar que las tarjetas de
control de tiempo de los
empleados sean entregadas en
cadaperiododenmina.
Preparacin y revisin de
informes de eficiencia, de los
informes de reproceso, gastos de
mantenimiento y mano de obra
indirecta.

165
8. Los montos adecuados al Procedimientos documentados de Puede pagarse a un empleado el
personal, as como la distribucin distribucindecuentas. tiempotrabajadoporotrapersona.
contablededichosadeudos,deben
calcularse con exactitud y
registrarsecomopasivosenforma
oportuna.
Tablas actualizadas de impuestos Pueden calcularse errneamente
sobresueldos. losreembolsosdegastos.

Conciliacindelashorasapagar, Puede omitirse el registro de


segn las tarjetas de registro de pasivos por impuestos sobre
asistencia, con los registros sueldos, o que tales impuestos se
cronolgicos de asistencia, planes calculendemaneraincorrecta.
deoperacin,etctera.
Inspeccin peridica del registro Pueden presentarse
denminaydeladocumentacin incorrectamente los inventarios,
originalconexa. las propiedades y los gastos
debidoaladistribucinincorrecta
de la nmina y los gastos
relativos.
Revisin y seguimiento de los Pueden pagarse o tomarse
informes por excepcin de horas vacacionesnoautorizadas.
de nmina pagadas pero no
cargadas.
Polticas establecidas para el Existen, adems, los mismos
reembolsodegastosdeviaje yde riesgos de incumplimiento
representacin. contemplados en los objetivos
especficosdecontrolinterno.
Establecimiento de polticas para
informar y controlar el tiempo de
vacaciones.
Aprobacin por funcionarios
responsables de los pagos de
incentivosygratificaciones.
Pruebas en busca de tarjetas
duplicadas de registros de
asistencia.

166
Verificacin de lmites,
comprobacin de larazonabilidad
de horas trabajadas en exceso,
tiposdesalarios,msaltosquelos
esperados y deducciones que
excedan al pago bruto o a cierto
porcentajedelmismo.
Establecer procedimientos para
aadir, cambiar o eliminar
informacindelasbasesdedatos,
ascomotcnicasparaprotegerla
informacin contenida en las
basesdedatos.
Se aplican adems las mismas
tcnicasdecontrolmarcadasenel
objetivo especfico de control
internonmero7.
9. Todos los pagos relacionados Uso de formas prenumeradas y Pueden efectuarse desembolsos
con la nmina deben basarse en controladas. por cantidades equivocadas o en
unpasivocalculadoconexactitud. formafraudulenta.
Cancelacin de la documentacin Puedenhacersepagosduplicados.
original para prevenir pagos
duplicados.
Establecer procedimientos para Pueden alterarse los cheques en
anularcheques. formafraudulenta.
Uso de mquina protectora de Pueden efectuarse desembolsos
cheques. porserviciosnorecibidos.
Comprobacin del importe del
chequeconlacuentaporpagar.
Verificar que el importe del
cheque coincida con
documentacin congruente entre
s.
Implantacin de un programa de
computadora que informe por
excepcin cheques cuyos montos
excedanaunacifradeterminada.

167
Verificacin de la distribucin
contabledelanmina.

Observacin peridica y por


sorpresa del pago fsico de la
nmina.
Controlcontablesobrelossueldos
nocobrados.
Conciliacin del total de los
chequesfirmadosconeltotalneto
a pagar segn el registro de
nminas.
10. Los importes adeudados al Procedimientos documentados de El registro en las cuentas de
personal deben ser clasificados, proceso, corte y cierre de fin de mayor puede ser incompleto o
concentrados e informados con periodo. inexacto.
exactitudyenformaoportuna.
Clasificacin de cuentas Pueden presentarse problemas de
documentadas. registroycontroldetiempo.
Comparacin de los resultados Losinformespuedenserinexactos
reales con los presupuestados y con respecto a la clasificacin de
anlisisdelasvariaciones. lastransacciones.
Arqueos peridicos de formas
prenumeradas y su conciliacin
conloscontrolesestablecidospara
talefecto.
Revisin y seguimiento de los
informes regulares de datos
pendientesdeprocesar,comoesel
caso de las tarjetas de registro de
asistencias.
Conciliacin de las horas y
cantidadesapagarconlashorasy
cantidades distribuidas
contablemente.

Conciliacin de las cuentas


bancariasdenmina.

168
Investigacin de los cheques
pendientes de cobro muy
antiguos.

Conciliacin del efectivo


desembolsado con el pago
efectuado.
Sistemas de procesos simultneos
o sistemas comparables en la
computadora en que se preparan
al mismo tiempo un cheque de
nmina,elregistroenauxiliaresy
el registro en los mayores
respectivos.
Totalizar por lotes y registrar los
documentos de entrada (nmero
de documentos de nmina e
importes) y conciliacin de los
totales de nmina o archivo
actualizado.
Investigacin de las
interrupciones en la secuencia
numricadelasformasesenciales
quesepreparan.
Para concentracin, como es el
caso de las tarjetas de registro de
asistencia y los cheques de
nmina.
Conciliacin de las formas
importantes utilizadas con su
registro de control
correspondiente.
Revisin y seguimiento de los
archivos de cuentas en suspenso
que controlan los datos
rechazados hasta que se subsanan
yselesdanuevaentrada.

169
Fechas predeterminadas para
controlar la oportunidad y los
cortes del procesamiento y
produccin de informes
peridicosenlacomputadora.

Totalesdecontroleidentificacin
de las fechas, encabezados,
etctera,enlosinformes.
Cduladeinformesdeproduccin
y registros cronolgicos de la
computadora.

11. Los pagos y los ajustes Se aplican nuevas tcnicas de Existen los mismos riesgos de
relativos a nminas deben ser control sealadas en el objetivo incumplimiento sealados en el
clasificados, concentrados e especfico del control interno objetivo especfico de control
informados con exactitud y en nmero10. internonmero10.
formaoportuna.
12. Los pasivos incurridos, los Conciliacin en forma regular y Los movimientos pasados a los
pagos efectuados y los ajustes peridica de los saldos auxiliares registros auxiliares pueden no
relativos deben aplicarse con de nminas con los saldos del concordar con los movimientos
exactitud y oportunamente a las libro mayor u otros totales de pasadosallibromayor.
cuentasapropiadasdelpersonal. control.
Revisindelaaplicacincorrecta Las operaciones con el personal
deloscdigosenlosdocumentos pueden ser registradas
fuente. incorrectamenteenlosauxiliares.
Revisindelaaplicacincontable Pueden tomarse decisiones
a las cuentas correctas del indebidas en base a informacin
personal. incompleta o inexacta que se
encuentraenunregistroauxiliar.
Rotacin de labores del personal
decontabilidad.

Pruebas de validacin
computarizadaparacomprobarlos
asientos contables que afecten
cuentasrelacionadasconnminas.

170
Formarlotesyconciliarlostotales
de entrada como por ejemplo los
totales del registro de nmina y
los cheques de nmina emitidos
con los totales del procesamiento
ylosnuevossaldos.
Controles de los programas de
computo para prevenir o detectar
el pase de transacciones
duplicadas y omisin de
transaccionesaceptadas.
Rutina de comprobacin de
etiquetas de archivos de
computadora (fecha y versin)
para reducir la posibilidad de
pasarlaversinequivocadadeun
archivo maestro o usar el archivo
deactividadeserrneo.
Revisin de los informes de
nmina y de la situacin de las
cuentasauxiliares.
13. Deben prepararse asientos Preparacin de un catalogo de Los estados financieros podran
contables,encadaperiodoporlas cuentas que contenga una no ser preparados en forma
cantidadesadeudasalpersonalpor descripcindecadauna,ascomo oportuna.
los pagos efectuados y por los instrucciones de qu conceptos
ajustesrelativos. debenafectaralasmismas.
Procedimientos escritos para Los estados financieros pueden
solicitar y aprobar cambios en la presentarse incorrectamente
clasificacindecuentas. debido a uno o ms de los
siguientes factores: omisin en el
registro de transacciones o en las
concentracionespararespaldarlos
asientos contables, omisin en el
registro de un asiento contable,
codificaciones incorrectas,
asientos contables duplicados,
cortesincorrectos.

171
Presupuestar e informar de Puede debilitarse o anularse el
acuerdo con la misma control presupuestal sobre las
clasificacindecuentasyanalizar operaciones.
las variaciones importantes entre
los saldos reales y los
presupuestados.

Procedimientosescritosdecortey
cierredeperiodo,expresando,por
funcin, las cuentas que deben
utilizarse para preparar los
asientos contables, cortes a
efectuarse, acumulaciones que
deben hacerse y quin es
responsabledecadatarea.

Comparaciones entre periodos de


los montos de asientos contables
recurrentes.
Revisin y aprobacin de cada
asiento contable por personal
supervisor que no tenga
participacin activa en sus
preparaciones.

Registro de asientos contables


uniformes y otro control que
pueda proporcionar certeza
razonable de que se prepararon
todos los asientos contables
requeridos.

Uso de formas prenumeradas de


asientos contables y la
verificacin correspondiente de
que todos los asientos fueron
registradosenelperiodo.

172
Conciliacin de los registros
cronolgicos manuales con los
asientoscontablesproducidospor
lacomputadora.
Comparacin de los nmeros de
cuentas en cada asiento contable
con el archivo maestro
automatizadoyrechazoeinforme
deerroresdetectados.
Comprobacin mediante la
computadora de las partidas
duplicadas.
Preparacin automatizada de los
asientos contable por un sistema
basadoenlacomputadora.
Comprobacin de la validez y/o
verificacin de los campos de
datosdecadaasientocontable.
14. Los asientos contables de Seaplicanlasmismastcnicasde Existen los mismo riesgos de no
nmina deben concentrar y control sealadas en el objetivo cumplimiento sealados en el
clasificar las transacciones de especfico de control interno objetivo especfico de control
acuerdo con polticas establecidas nmero13. internonmero13.
porlaadministracin.
15. La informacin para Procedimientos documentados Usar datos errneos en los
determinar bases de impuestos parapreparar,concentraryreparar clculosdelosimpuestos.
derivadas de las actividades de la informacin requerida de
nminas deben producirse con impuestos.
exactitudyenformaoportuna.
Revisin de las transacciones Pagarmultasyrecargos.
importantesporpersonasexpertas
enmateriafiscal.
Catlogo de cuentas, instructivo Pagarimpuestosenexceso.
para su manejo y otros criterios
para facilitar la clasificacin,
concentracin,obtencinoportuna
y adecuada de la informacin
requeridadeimpuestos.

173
Polticas por escrito relativas a la
documentacin requerida
fiscalmente para soportar los
gastos.

16.Debenverificarseyevaluarse Manuales de procedimientos y Los informes preparados para la


enformaperidicalossaldos polticas,grficasdeorganizacin administracin pueden presentar
registradosdelascuentas. y otra documentacin que informacinerrnea.
contengan las cuentas, informes,
actividades, polticas y
procedimientos que deben
verificarse y evaluarse, cundo
van a ser verificados y por quin
sersupervisadalaactividad.

Conciliacin de saldos y Las decisiones importantes que


movimientos informados por pueden tomar la administracin
terceros, como es el caso de las podran basarse en informacin
conciliaciones bancarias de las errnea.
cuentasdenminas.

Actuacin oportuna sobre las Errores e irregularidades en la


quejasdelpersonal. salvaguarda fsica, autorizacin y
procesamiento de transacciones
podran pasar inadvertidos y no
sercorregidos.

Conciliacin de los saldos del


libro mayor con los auxiliares ya
sea manualmente o a travs de la
computadora.

Verificacin peridica de los


registros de nminas con la
documentacinderespaldo.

174
Comparacin de los importes
contabilizados con transacciones
posteriores o con importes
preestablecidos, como por
ejemplo, examen de pagos
posterioresenbuscadepasivosno
registrados, comparacin de los
pagos reales con los
presupuestados,etctera.

Verificacin peridica de los


saldos en libros mediante
confirmacionesconelpersonal.

Anlisis de ndices, tendencias y


variaciones.

Comparacin de los resultados y


anlisis de las tendencias de la
industriaenmateriadesueldos.

17. El acceso a los registros de Cajas fuertes, gabinetes cerrados Los registros y archivos pueden
personal,nminas,formasy conllave,bibliotecasegurade destruirseoperderse,locual

documentosimportantesylugares cintas y discos magnticos, podraimposibilitarlapreparacin


de proceso deben permitirse almacenaje externo de reserva deinformesfinancierosconfiables
nicamente de acuerdo con para registros y archivos de la e incapacidadpara efectuar pagos
polticas establecidas por la computadora as como programas al personal por la prdida de las
administracin. yotradocumentacinrelativa. cuentasporpagarohacersepagos
enformaindebida.

Custodia controlada y Los registros y archivos podran


prenumeracin de formas ser utilizados en forma indebida
importantes, incluso la rendicin por personal no autorizado en
de cuentas peridicas del uso de detrimento de la empresa o de su
dichas formas por personal personal.
independiente.

175
Segregacin de responsabilidades Losprogramasdelacomputadora
y restricciones al acceso de las podranseralteradosporpersonas
funciones de administracin de noautorizadas.
personal con las funciones de
pago y contabilizacin de
nminas de las actividades de
preparacin, firma y enva o
entrega de cheques acceso
restringido a los archivos de la
computadora mediante el uso de
contraseas o cerraduras en las
terminales.

Losprogramasparaelprocesode
Seguros y fianzas de fidelidad, informacin, particularmente los
incluyendolaprdidaderegistros de la computadora podran
ydocumentos. perderse o destruirse, lo cual
podra generar incapacidad para
informar o distorsionar las
actividadesinformadas.

Archivos de firmas del personal


autorizado.

Disposicin de lugares de trabajo


que permitan la visibilidad
mximadelossupervisores.
Tomar precauciones para la
proteccin razonable contra
incendios, explosin y la
destruccin de mal de de los
registros y las instalaciones de
procesamiento.
Losprogramasdelacomputadora
podranseralteradosporpersonas
noautorizadas.

176
MANUALDEPOLITICASYPROCEDIMIENTOSDERECLUTAMIENTOY
SELECCINDEPERSONAL.

Fechadepublicacin:31deener ode1995.

Nmer oderevisin: 5

Responsable:Lic.Lour desMendozaEstr ada.

CONTENIDO.

INTRODUCCIN.

1.OBJETIVO.

2.ALCANCE.

3.POLTICAS.

4.PROCEDIMIENTOS.

5.DESCRIPCINDEACTIVIDADES.

177
INTRODUCCIN.

Con el objeto de establecer el marco de referencia, la normatividad, la secuencia cronolgica de las


actividades, la vinculacin de los departamentos, la participacin de los empleados y su grado de
responsabilidadenelproceso,sediseoconbaseenlaexperienciayenlaobservacindeltrabajodiarioel
procedimientodeReclutamientoySeleccindePersonal.

En el contenido de este documento se describen en forma sistemtica el objeto, alcance, polticas,


procedimientos,descripcindeactividadesydiagramasdeflujoqueintervienenenelproceso.

Este procedimiento pretende servir de gua de consulta, en primera instancia, para el responsable de su
regulaciny operacinyensegundotrmino,paraelusuarioquetienelanecesidaddeconocerelproceso
paraincidirenl,deacuerdoasusnecesidades.

EnlamedidaqueelprocedimientodeReclutamientoySeleccindePersonaldrespuestasatisfactoriaa
las demandas de servicio de los usuarios, se podrn afirmar que se ha logrado el objetivo establecido las
desviacionesal finesperado,sernlasealparamodificar,ajustaroactualizarensucaso,elcontenidodel
documento,deacuerdoaladinmicaadministrativaquelaoperacinrequiere.

1. OBJ ETIVO.

Realizar la seleccin del personal idneo que cubra los requisitos del perfil de puesto de acuerdo con las
plazasvacantesquegenerenlosserviciosdelaempresa,tomandocomobaselosanlisisdepuestoasimismo,
llevaracabounprogramadecapacitacinadministrativaparaeldesarrolloydesempeodelostrabajadores,
conelfindeelevarlacalidaddelaempresa.

Determinarlaspolticas,normasylasecuenciadeoperacionesquesedebernllevaracaboparaeleficiente
reclutamiento y seleccin de los candidatos a incorporarse a la Sociedad Cooperativa Trabajadores de
Pascual,S.C.L.

2. ALCANCE.

La aprobacin oficial del presente manual la hizo el Subdirector Administrativo la Lic. Lourdes Mendoza
Estrada.

La responsabilidad de este procedimiento recae en la Agencia Externa de Reclutamiento y Seleccin de


Personal.

178
Para su actualizacin, este procedimiento deber ser revisado por el Gerente de Recursos Humanos por lo
menosunavezalao.

Elmbitodelpresentemanualabarcaraldepartamentodepersonal.

Elmanualcontieneseisapartados,estemanualdebermantenerseactualizadoydevolverlocuandodejende
prestarsusserviciosalaorganizacin.

3. POLTICAS.

LacreacindenuevasplazasdeberseraprobadasporelDirectorGeneral.

1. Derequisicin.

a) Toda solicitud de personal, deber canalizarse por escrito a la Gerencia de Recursos


Humanos,medianteunarequisicindepersonaladjuntandoelperfildepuesto,ystaserla
encargadadehacerlallegaralaagenciaexternadecolocacindepersonal.
b) La autorizacin de la requisicin de personal, corresponder a la Subdireccin
Administrativa,basndoseenlaplantilladepersonalautorizado.
c) La Supervisin del Departamento de Contratacin y Reclutamiento debern mantener
actualizadalacartadecandidatosaocuparplazasvacantesodenuevacreacin.
d) La Agencia Externa de Recursos Humanos emitir un informe de los resultados de los
candidatos enviados por al agencia, previa evaluacin y lo enviar para su conocimiento al
reasolicitante.

2. Dereclutamiento.

a) nicamentela Supervisin de Contratacin y Reclutamiento, est autorizado parareclutar


personal.
b) Se procurar promover al personal de la empresa hacia puestos vacantes de mayor nivel,
antesderecurrirafuentesexternasdereclutamiento.
c) Para ocupar plazas vacantes o de nueva creacin se dar preferencia al personal de la
empresa,siempreycuandorenanlosrequisitosdelpuestoyapropuestadeljefeinmediato.
d) Losaspirantesqueseinteresenporelpuestosolicitadodeberncumplirconlosrequisitos
bsicos que se requieran segn el perfil de puesto, presentando solicitud de empleo con
fotografaycurrculum.
e) Todosloscandidatospropuestosparaserincorporadosalorganismofiscalizadordebernde
presentarlosexmenespsicomtricos,deconocimientosymdicoscorrespondientes.

179
f) Todoprocesoquetengaqueverconelreclutamiento yseleccinsedebersercontrolado
por medio del formato de Hoja de aprobacin, previamente firmado por la persona que
apliquecadaexamenylafirmadelresponsable.

3. Deseleccin.

a) Sedeberseleccionaralpersonalqueseapeguealperfildelpuestorequerido.
b) LaaceptacindefinitivadeloscandidatoscorrespondealGerentedeRecursosHumanos.
Elinformedelosresultadosyelexpedientedelcandidato,debernserentregadosporelreasolicitante,en
unlapsonomayordetresdashbilesasurecepcin.

4. PROCEDIMIENTOS.

1. Atencin a los aspirantes de funcin de: recepcin y orientacin de aspirantes, revisin de


documentos, programacin de citas, entrevistas psicolgicas, exmenes de conocimientos (terico
prctico),exmenespsicomticosymdicos.
2. Emisinyenvodelahojadeaprobacinconlosresultadosobtenidosenlasevaluacionesrealizadas
(adecuado,noadecuado,adecuadocondicionalydesertor).
3. Archivodeexpedientesconcluidosdecadaaspirante.
4. Realizarreunionesdetrabajoparahacerlosdiagnsticosfinales.
5. Difundirinformacinquetenganqueverconelpersonaldelreaatravsdeoficios,circulares,etc.
6. Informacinyevaluacinderesultadosmensualytrimestral.

5. DESCRIPCINDEACTIVIDADES.

Elprocedimientoseiniciaconlaexistenciadeunaplazavacanteodenuevacreacin.

RESPONSABLE N ACTIVIDAD

REASOLICITANTE 1 Solicita a la Subdireccin Administrativa, por medio del


formatoderequisicinyloenva.

SUBDIRECCIN 2 Recibeyrevisaelformatoderequisicin,posteriormentelo
ADMINISTRATIVA. turnaalreadeRecursosHumanos.

180
RESPONSABLE N ACTIVIDAD

GERENCIADERECURSOS 3 Coteja con su control de plazas vacantes y de proceder


HUMANOS. enva para su tramite el departamento de contratacin y
reclutamiento.

Procedeelreclutamiento?

4 No, lo informa el rea solicitante y da por terminado el


procedimiento.

5 Denoencontrarunposiblecandidatodeentrelosmismos
empleados de la cooperativa, enva el perfil del puesto
solicitado a la agencia externa de colocacin de personal,
paraqueleenviposiblesaspirantes.

AGENCIAEXTERNADE 6 Unavezquerecibelarequisicinconelperfildeseado,sta
COLOCACINDE se encarga de enviar los posibles candidatos (previa
PERSONAL evaluacin.)

REASOLICITANTE 7 Recibe expediente, analiza curriculum vitae y la solicitud


deempleo.

Renelosrequisitosnecesariosparaingresarasta?

No, remite aviso de noaceptacin a la Gerencia de


RecursosHumanos.
9

S, remite solicitud de alta a la Subdireccin


Administrativa.

SUBDIRECCIN 10 Recibe comunicacin de aprobacin del candidato, la


ADMINISTRATIVA solicituddealtadelcandidatoyautorizaelmovimiento.

181
RESPONSABLE N ACTIVIDAD

GERENCIA DE RECURSOS 11 Integraexpedienteyprocedeadardealta.


HUMANOS
12 Promuevelaplazavacanteodenuevacreacinpormedio
de las diversas fuentes de reclutamiento externo, recluta
candidatos,concertarcitaylessolicitasepresentenconsu
curriculumvitaeyunafotografatamaoinfantil.

13 Entregaa los candidatos que se presenten con la solicitud


deempleoparaquelallenenyselesrequieresucurriculum
vitaeyunafotografatamaoinfantil.

GERENCIADERECURSOS 14 Registran los datos del candidato y lleva a cabo la


HUMANOS entrevistainicial, para verificar lainformacin presentada,
y le informa las caractersticas y condiciones generales de
laempresa.
15 Evala y califica inicialmente las caractersticas del
candidatoenrelacinconelperfildelpuesto.
Cubreelperfilrequeridoporelpuesto?
16 No, integra expediente en cartera interna y regresa a la
actividadanterior.
17 S, lo enva al Departamento de Contratacin y
Reclutamientoaentrevistayexamentcnico.
18 Recibealoscandidatosylosentrevista.
19 Renenlosrequisitosnecesariosparaingresarasta?

No,remitecomunicacinyexpedienteparaqueseintegrea

20 lacarterainterna.

Si,seaplicaexamentcnico.
21
Calificdentrodelrangorequerido?
22
No,envaexpedienteparaarchivarencarterainterna.
Si,envaresultadoyexpedientealaGerenciadeRecursos
23
Humanos.
24
Aplicaexmenes.
Calificaydictamina.

182
RESPONSABLE ACTIVIDAD
GERENCIADERECURSOS 25 Informaresultados.
HUMANOS Recibedictamenyselecciona.
26 Fueseleccionado?
No,envaexpedienteparaarchivarencarterainterna.
Si, formula y enva oficio de autorizacinacompaado de
lasolicituddealta.
27 Integra expediente con los resultados y dictamen del
personal seleccionado y archiva en cartera interna los
28 expedientes de los candidatos que no cubrieron los
requisitos.

29 Findelprocedimiento.

183
MANUALDEPOLTICASYPROCEDIMIENTOSDECAPACITACINYDESARROLLODE
PERSONAL

SOCIEDADCOOPERATIVATRABAJ ADORESDEPASCUAL,S.C.L.

________________________________________________________________________________________

SOCIEDADCOOPERATIVATRABAJ ADORESDEPASCUAL,S.C.L.

MANUALDEPOLTICASYPROCEDIMIENTOSDE
CAPACITACINYDESARROLLO
DELPERSONAL.

Fechadepublicacin:Ener o2002

Nmer oderevisin:4

Responsable:Lic.RaquelMarchaEspinoza.
Subdir ectorAdministr ativo.

184
CONTENIDO.

INTRODUCCIN.

1. OBJ ETIVO.

2. POLTICAS.
3. NORMAS.

4. ELABORACINDELPROGRAMASEMESTRALDECAPACITACIN.

PARTICIPACINDELPERSONALENEVENTOSDECAPACITACIN
CONTROLDEEVENTOSDECAPACITACIN.

5.DESCRIPCINDEACTIVIDADESYDIAGRAMASDEFLUJ O.

5.1 ELABORACINDELPROGRAMASEMESTRALDECAPACITACIN.

5.2.PARTICIPACINDELPERSONALENCURSOSDECAPACITACIN.

5.3.CONTROLDEEVENTOSDECAPACITACIN.

5.4.DIAGRAMASDEFLUJO.

_________________O________________

INTRODUCCIN.
Con el objeto de establecer el marco de referencia, la normatividad, la secuencia cronolgica de las
actividades,lavinculacindelasgerencias,laparticipacindelosempleadosysugradoderesponsabilidad
enelproceso,sediseoconbaseenlaexperienciayenlaobservacindeltrabajodiarioelprocedimientode
CapacitacinyDesarrollo.

En el contenido de este Manual se describen en forma sistemtica el objeto, polticas, procedimientos,


descripcindeactividadesydiagramasdeflujoqueintervienenenelproceso.

Este procedimiento pretende servir de gua de consulta, en primera instancia, para el responsable de su
regulaciny operacinyensegundotrmino,paraelusuarioquetienelanecesidaddeconocerelproceso
paraincidirenl,deacuerdoasusnecesidades.

185
EnlamedidaqueelprocedimientodeCapacitacinyDesarrolloderespuestasatisfactoriaalasdemandas
deserviciodelosusuarios,sepodrnafirmarquesehalogradoelobjetivoestablecidolasdesviacionesalfin
esperado, sern la seal para modificar, ajustar o actualizar en su caso, el contenido del documento, de
acuerdoaladinmicaadministrativaquelaoperacinrequiera.

1. OBJ ETIVO.

Elevar los conocimientos, habilidades administrativas y tcnicas del personal que integra Sociedad
CooperativaTrabajadoresdePascual,S.C.L.atravsdediversoscursosdecapacitacin,paracontribuirasu
superacinyproporcionarunamayorproductividadeneldesarrollodelasfuncionesytareasquerealicenlas
decadarea.

Tratarqueelcolaboradordelaempresallegueasuautodesarrollo,recibiendoinstrumentosparamejorarsus
aptitudesyrendimientos,aportealtrabajoloquehaaprendido,incrementndoloconsucreatividaddeeste
modo se logra eliminar la resistencia a la innovacin (al cambio) y se evita el envejecimiento de los
conocimientos,quecadavezdebensermsactualizados.

Determinarlaspolticas,normasysecuenciadeoperacionesquesedebernllevaracaboparaaumentarlas
aptitudes, tcnicas econmicas y administrativas de cada trabajador para la eficiente administracin en el
desarrollodelaempresaSociedadCooperativaTrabajadoresdePascual,S.C.L.

2. POLTICAS.

1. La capacitacin es una responsabilidad compartida por los Gerentes de Sociedad Cooperativa


TrabajadoresdePascual,S.C.LCadaunodeellosseobligaadetectarlasnecesidadesdepreparaciny
actualizacin de sus subordinados, facilitar e impulsar el proceso de capacitacin y convertirse en el
principal promotor de la formacin de los recursos humanos a su cargo. Por su parte, el rea de
Capacitacin y Desarrollo es responsable de apoyar y coordinar la preparacin e imparticin de los
cursos.
2. En el programa semestral se elaborar con base en la deteccin de necesidades de capacitacin y
desarrollo del personal de las diferentes reas de la empresa, misma que estar a cargo del rea de
Capacitacin y Desarrollo, conforme al presupuesto autorizado y considerando la opinin de dichas
reas.
3. Para la deteccin de necesidades de capacitacin se tomarn en cuenta los requerimientos tcnicos de
cadaunodelospuestosqueintegranlasreasylasnecesidadesdelocupanteenfuncindelosfinesdela
empresa, con objeto de que la capacitacin redunde directamente en el desarrollo eficiente de las
funcionescorrespondientes.

186
4. Ladeteccindenecesidadesdecapacitacinseharmediantecuestionariosqueelaborarydistribuira
lostitularesdecadarea.
5. Los cursos de capacitacin estarn diseados especficamente para incrementar la productividad y
mejorarlosresultadosdelasreasconformealoscriteriosynormasqueseestablezcanalrespecto.
6. Loscursos,seminarios,conferencias,talleres yeventosrequeridosparaeldesarrollodelpersonaldela
empresa debern ser incluidos preferentemente en el Programa Semestral de capacitacin y para su
desarrollorequierecontarconlaautorizacindelDirectorGeneral.
7. ElreadeCapacitacinyDesarrolloproporcionaracadaGerenciaunejemplardebidamenteautorizado
delProgramaSemestraldeCapacitacinyDesarrollo.
8. Cualquiercurso,seminario,conferenciayeventoquenoestnconsideradoenelprogramasemestralde
capacitacinydesarrollo,debercontarconlaautorizacinexpresadelSubdirectorAdministrativo.
9. El cupo de los cursos de capacitacin ser limitado, a fin de proporcionar a los capacitados una
instruccinindividualizadayejercerunmayorcontrolsobresuavance.
10. El personal propuesto para acudir a los cursos de capacitacin deber asistir a ellos, en caso de no
presentarseporcausasdefuerzamayorsetendrquejustificarlaausenciaplenamente.

3. NORMAS.

ELABORACINDELPROGRAMASEMESTRALDECAPACITACIN.
1. El rea de Capacitacin y Desarrollo ser responsable de elaborar el Programa Semestral de
Capacitacin, cuyos perodos sern de enero a junio y de julio a diciembre, el cual deber turnarse al
Director General dela empresa para su autorizacindurante el mes de diciembre del ao anterior a su
ejecucinyduranteelmesdejuniodelaodeejecucin.

2. ElProgramaSemestraldeCapacitacindebercontenerlasiguienteinformacin:

v Nombredelcurso.
v Especificacindelpersonalalquevandirigidosloscursospornivel.
v Laduracindecadacursototalizadoenhoras.
v Sedesdecapacitacin.
v Descripcingeneraldeloscursos.
v Dasyhorariosenquehabrndeimpartirseloscursos.
v Inscripciones.
v Programacindeloscursos.
v ProgramacinyControldeparticipantes.
3. ParaelaborarelProgramaSemestraldeCapacitacin,elreadeCapacitacinyDesarrolloenviaralas
Gerencias los Cuestionarios para la Deteccin de Necesidades, uno por cada Gerencia, para que
registrenloscursosqueconsiderennecesariosparasupersonal.

187
4. El rea de Capacitacin y Desarrollo deber informar oportunamente a los gerentes, lo referente a la
cancelacinoreprogramacindeloseventosdecapacitacinenlosqueseinscribasupersonal,afinde
quetomenlasmedidaspertinentes.

PARTICIPACINDELPERSONALENCURSOSDECAPACITACIN.
1. ElreadeCapacitacinyDesarrollodeberinformaralosGerentescon10dasdeanticipacin,acerca
de cualquier evento de capacitacin que este por efectuarse y los requisitos que deben cubrir los
aspirantes.Asimismo,lessolicitarqueenvendentrodeloscincodashbilessiguientes,lascdulasde
inscripcin debidamente requisitadas, acompaadas de la relacin de candidatos para asistir a dicho
curso.
2. ElreadeCapacitacinyDesarrolloelaborarlalistadefinitivadelosparticipantesacualquiercursode
capacitacindeacuerdoconlacduladeinscripcin,autorizadaporelSubdirectorAdministrativo.
3. El rea de Capacitacin y Desarrollo, informar con tres dashbiles antes de la fecha de inicio a los
titularesdelasreas,acercadelpersonalasucargoquedeberasistiralcursodecapacitacinenelque
estinscrito.
4. ElreadeCapacitacinyDesarrolloinformarcondosdasdeanticipacinalpersonalqueparticipar
en el curso de capacitacin en que est inscrito, indicndole: el nombre del curso, fecha de inicio y
trmino,horario del curso,lugar en que se efectuar y nombre de la institucin o delinstructor que lo
impartir.
5. ElreadeCapacitacinyDesarrollo,serresponsabledeinscribiralpersonalquedebaparticiparenlos
cursos de capacitacin, de acuerdo con la relacin de candidatos autorizada por el Subdirector
Administrativo.
6. Todo empleado deber asistir a los cursos de capacitacin en que est inscrito en caso contrario su
inasistenciaseconsiderarcomofalta.
7. Elempleadonopodrfaltaralcursodecapacitacinenelquesehayainscrito,salvoporcausasdefuerza
mayoryconladebidaautorizacindesujefeinmediatosuperior,quiendeberinformaroportunamentey
porescritoalreadeCapacitacinyDesarrolloparaquetomelasmedidasdelcaso.

CONTROLDECURSOSDECAPACITACIN.
ElreadeCapacitacinyDesarrollo,pormediodesuasistente,registrarlaasistenciadelpersonalqueest
inscritoenloscursosdecapacitacin.
Cada instructor determinar el nmero de evaluaciones que considere necesarias realizar para conocer el
avance de los conocimientos adquiridos durante el curso, as como llevar un control de asistencia por
cadacurso.
LosinstructoresdebernenviaralreadeCapacitacinyDesarrollo,elltimodadelcurso,losresultados
delasevaluacionesefectuadasduranteeldesarrollodelmismo.

188
5.DESCRIPCINDEACTIVIDADESYDIAGRAMASDEFLUJO.

5.1ELABORACINDELPROGRAMASEMESTRALDECAPACITACIN.

RESPONSABLE N ACTIVIDAD
REA DE CAPACITACIN Y 1 EnvaalosGerentes,pormediodeoficioloscuestionariospara
DESARROLLO la deteccin de necesidades de capacitacin para que sean
contestadosporlosSupervisoresderea.
GERENTE 2 Entrega a cada Supervisor de rea un cuestionario para que
anoteenlloscursosqueconsiderenecesariosparasupersonal.
SUPERVISORDEREA 3 Contesta el cuestionario anotando los cursos que considere
necesariosparasupersonaldeacuerdoconlosrequerimientosde
lospuestos,lorubricaylodevuelvealGerente.
GERENTE 4 Firmacadaunodeloscuestionariosdebidamentecontestados y
losdevuelvealreadeCapacitacinyDesarrollo.
REA DE CAPACITACIN Y 5 RecibeloscuestionarioscontestadosporlasGerencias.
DESARROLLO.
6 Analizalainformacincontenidaenloscuestionarios yelabora
elProgramaSemestraldeCapacitacin.
DIRECTORGENERAL 7 Recibe el Programa Semestral de Capacitacin, lo analiza y
autoriza.

REA DE CAPACITACIN Y 8 Recibe el Programa Semestral de Capacitacin firmado por el


DESARROLLO DirectorGeneralyenvaalasGerenciasunejemplardeste.

GERENCIAS 9 Recibe el Programa Semestral de Capacitacin autorizado y lo


conserva.

FindelProcedimiento.

189
5.2PARTICIPACINDELPERSONALENCURSOSDECAPACITACIN.

RESPONSABLE N ACTIVIDAD
REA DE CAPACITACIN Y 1 InformaalasGerenciasacercadeloscursosdecapacitacinque
DESARROLLO estn prximos a efectuarse, enva cdulas de inscripcin y les
solicitalarelacindecandidatosparaasistiradichocurso.

GERENCIAS 2 Llena las cdulas de inscripcin y elabora la relacin de


candidatos para asistir a los cursos de capacitacin que estn
prximos a efectuarse y la enva al rea de Capacitacin y
Desarrollo
REA DE CAPACITACIN Y 3 Elaboraymodifica,sieselcaso,larelacindeloscandidatosy
DESARROLLO laenvaparalaautorizacindelSubdirectorAdministrativo.
SUBDIRECTOR 4 Revisalarelacindecandidatosyfirmadeautorizacin.
ADMINISTRATIVO
REA DE CAPACITACIN Y 5 Recibe la relacin de candidatos autorizada por el Subdirector
DESARROLLO Administrativo..
6 Inscribealpersonalconformealarelacineinformaalasreas
involucradas sobre el personal adscrito a sta que asistir al
cursodecapacitacin.
GERENCIAS 7 Recibe la informacindel rea de Capacitacin y Desarrollo y
leinformaalpersonalasucargoqueestinscritoenelcursode
capacitacin.
PERSONAL 8 Asistealcursodecapacitacinenelqueestinscrito ycumple
conlosrequisitosdelcurso.

190
5.3CONTROLDELOSEVENTOSDECAPACITACIN.

RESPONSABLE N ACTIVIDAD
REA DE CAPACITACIN Y 1. Registralaasistenciadelpersonalqueestinscritoenelcursode
DESARROLLO capacitacinqueseimparteyleinformadeelloalinstructor.
INSTRUCTOR 2. Imparteelcursodecapacitacinyevalaeldesempeodecada
unodelosasistentesalcurso.
3. EntregaalreadeCapacitacinyDesarrolloelresultadodelas
evaluaciones efectuadas al personal participante en el curso de
capacitacin,ascomouncontroldeasistencia.
REA DE CAPACITACIN Y 4. Aplicaalosasistentesalcursodecapacitacin,uncuestionario
DESARROLLO paraevaluareldesempeodelinstructor.
5. Revisa las listas de asistencia y los resultados de las
evaluacionesdelosasistentesalcursodecapacitacin.
6. Analiza los cuestionarios sobre el desempeo del instructor y
registraelresultadoparaposteriorescursos.
7. Verifica que el instructor haya impartido completamente el
curso.
8. Enva a la Gerencia de Recursos Humanos relacin de
participantesylosresultadosdelasevaluacionesparaelregistro
enexpedientesdelpersonal.
GERENCIA DE RECURSOS 9. Registralaintervencindelpersonalparticipanteenloseventos
HUMANOS ylacalificacinobtenida.

10. Expideconstanciaalpersonalsobreloseventosdecapacitacin
en que particip y enva copia al rea de Capacitacin y
Desarrollo.
REA DE CAPACITACIN Y 11. Archivacopia
DESARROLLO

FindelProcedimiento

191
5.4DIAGRAMASDEFLUJO.

ELABORACINDELPROGRAMASEMESTRALDECAPACITACIN.

READE GERENTE SUPERVISORDE SUBDIRECTOR


CAPACITACINY REA ADMINISTRATIVO
DESARROLLO.

INICIO

2 3
1

ENVIA ENTREGAACADA CONTESTAEL


CUESTIONARIOS SUPERVISORDEAREA CUESTIONARIO
PARA LA DETECCIN UNCUESTIONARIO ANOTANDOLOS
DE NECESIDADESDE PARADETECTARLAS CURSOSQUE
CAPACITACIN. NECESIDADESDE CONSIDERE
CAPACITACINDEL NECESARIOS
PERSONAL
CUESTIONARIOS
CUESTIONARIOS
CUESTIONARIOS

5
4
FIRMACADAUNODE
RECIBE LOSCUESTIONARIOS
CUESTIONARIOS DEBIDAMENTE
DEBIDAMENTE CONTESTADOS
CONTESTADOS.

CUESTIONARIOS
CUESTIONARIOS

7
6

RECIBEEL
ELABORAEL PROGRAMA
PROGRAAMA SEMESTRALDE
SEMESTRALDE CAPACITACINY
CAPACITACIN. LOAUTORIZA

PROGRAMAAUT.
PROGRAMA

RECIBEEL RECIBEEL
PROGRAMA PROGRAMA 9
SEMESTRAL SEMESTRALDE
AUTORIZADO CAPACITACIN
8 AUTORIZADO
FINDEL
PROCEDIMIENTO.

192
PARTICIPACINDELPERSONALENEVENTOSDECAPACITACIN.

READECAPACITACIN GERENCIAS SUBDIRECTOR PERSONAL


YDESARROLLO ADMINISTRATIVO

INICIO

2
1

INFORMAALASREASLOS LLENALASCEDULAS
CURSOSDECAPACITACIN DEINSCRIPCINY
PROXIMOSAEFECTUARSE, ELABORALA
ENVIACDULASDE
INSCRIPCINYSOLICITA
RELACINDELOS
RELACINDECANDIDATOS CANDIDATOS.
CURSOS
RELACIN.

CEDULAS
CEDULAS

3
REVISALARELACIN
ELABORAOMODIFICA,SIES DECANDIDATOSY
ELCASOLARELACINDE
AUTORIZA
TODOSLOSCANDIDATOSYLA
ENVIAAFIRMADEL
SUBDIRECTOR
ADMINISTRATIVO RELACIN

RELACIN

RECIBELARELACINDE 5
CANDIDATOS,
AUTORIZADAPOREL
SUBDIERCTOR
ADMINISTRATIVO
8
RELACIN
ASISTEAL
CURSODE
CAPACITACIN.

7
INSCRIBEAL 6
PERSONALCONFORME
ARELACIN RECIBELA
INFORMACINDE
CAPACITACINE FINDEL
INFORMAAL PROCEDIMIENTO.
PERSONAL
RELACIN
193
ADSCRITO.
ESTUDIOGENERAL.
J ulio2005.

GRANGYASOCIADOS,S.C.
Contador esPblicos.

CUESTIONARIODEINVESTIGACINPRELIMINARARECURSOSHUMANOS

INSTRUCCIONESPARARESOLVERELCUESTIONARIO
DEINVESTIGACINGENERAL.

El presente cuestionario esta preparado con el objeto de abarcar los principales aspectos y situaciones
necesariasparaconocerenformagenerallasoperaciones,sistemas,rutinasyvolmenesdeunaempresaque
hasolicitadopor pr imeraveznuestr osser vicios.

Elconocimientodesusoperacionesnospermitirpoderpresentarleunapropuestadeserviciostcnicamente
elaboradaendondedestaqueeltrabajoadesarrollary unaestimacindetiempoyhonor ar iosadecuada.

Lacontestacindelpresentecuestionariodebehacerseenformaclarayespecifica,contandosiempreconla
colaboracin del contador y/o gerente administrativo o equivalente de la empresa, pero no debemos
concretarnos ainterrogaral contador o funcionario de la empresa, sino que debemos comprobarrealmente,
hastadondenos sea posible, en cada caso, las contestaciones que nos proporcionen. A tal efecto, debemos
prepararenloscasosqueseanecesario,memorandumssobrelacontestacindealgunospuntosimportantesy
sealaraquellosquenosonaplicables.

Normalmente debe consultarse con el socio responsable, si conjuntamente con este cuestionario debemos
contestareldeRevisindeControlInternoyProcedimientosdeContabilidad.

194
GENERALIDADES.
Concepto RespuestayComentar ios

1.Nombredelaempresa. Sociedad Cooperativa Trabajadores de Pascual,


S.C.L.

2.DomicilioyTelfonos. ClavijeroNo.75Col.TrnsitoDel.Cuauhtmoc
C.P.06820Mxico,D.F.
Tel.51320843

3.ObjetodelaCompaa. Ventadebebidasrefrescantes.

4.Fechadeterminacindesuejerciciofiscal. 31dediciembrede2004.

5.Nombredelosprincipalesaccionistas. SociosMayoritarios.

6. Nombre de los principales funcionarios y nombre Lic.JorgeEnsastigan.


especifico a quien debamos dirigir nuestra carta
propuesta.

7.DatosFiscalessobre:
RFC. SCT8411179Q4
IMSS B081754310
Otros.

8.Nmerodeempleadosyobrerosaproximadamente. 1,100sociosy3000empleadosyobreros.

9. Indicar problemas especiales importantes que la Existe una rotacin de personal muy frecuente
cooperativa haya tenido durante los ltimos tres aos, debidoalbajosueldoyaloshorariosdetrabajo.
tales como huelgas, situaciones criticas por falta de

195
crditos o mercados, revisiones efectuadas por
autoridades fiscales (Tesorera del D.D.F., o del Estado
aplicable,IMSS.,INFONAVIT,etc.).

10. Que relaciones ha tenido la empresa con otros No se han solicitado servicios externos hasta la
despachos de contadores pblicos? Indicar que clase de fecha ya que se cuenta con un Departamento de
servicios ha recibido y de que despacho o contador AuditoriaInterna.
pblico.

11. Revisar Dictmenes, Informes y/o Cartas de Noexisten.


sugerenciaspreparadasporotroscontadorespblicoscon
motivodesusintervenciones

12. Existe realmente una divisin adecuada de Si, en la actualidad se tienen bien definidos las
atribuciones de mando y responsabilidades y esta atribucionesde mandoyresponsabilidad.
definida claramente por medio de grficas, manuales,
etc.?

13. Los mtodos de registro utilizados, son los Se esta evaluando la implantacin de un nuevo
adecuados para la obtencin de informacin financiera sistema contable y de almacn ya que el que se
oportuna,verazyconfiable? tieneyanoessuficienteparalasoperacionesque
serealizanenlaactualidad.

14.Lainformacinqueseproporcionaalagerenciaes Si
la adecuada para la toma de decisiones y se prepara
oportunamente y a travs de procedimientos que
asegurensucorreccin?.

15.Sealarqueclasedeinformacinrecibenlosniveles
directivosyconqueperiodicidad.

196
a)Plantilladepersonal. GerenciadeRecursosHumanos.

b)Liquidacionesdepersonal. GerenciadeRecursosHumanos.

c)LitigiosoDemandas. GerenciadeRecursosHumanos.

d)Calculodebasesparaimpuestos. GerenciadeRecursosHumanosyContabilidad.

e)Organigrama GerenciadeRecursosHumanos.

f) Anlisis de las principales cuentas en la nmina GerenciadeRecursosHumanos.


llevadaaresultados.

g)Listadodetrabajadoresdeconfianza. GerenciadeRecursosHumanos.

h) Informe de movimientos de bancos por pago de GerenciadeRecursosHumanos.


nmina.

i)Informedemovimientosdepersonal. GerenciadeRecursosHumanos.

j)Sugerenciasdeauditoresinternosodeldepartamento GerenciadeRecursosHumanosyContralora.
de contabilidad para mejorar los procedimientos o
rutinasestablecidas.

k) Informe de Declaraciones de impuestos presentadas Gerencia de Recursos Humanos, Contralora y


antelaSHCP. Tesorera.

l) Informe de obligaciones a corto plazo y cuentas por


pagar. GerenciadeContabilidadyTesorera.

16. Es el personal de la compaa suficiente y


adecuado para llevar a cabo el cumplimiento de las Si.
practicasypolticasestablecidas?

197
17. Se dispone de auditores internos o al menos Si.
empleados responsables que revisen la observancia de
los procedimientos y polticas, funcionarios
independientes de quienes deban aplicar dichos
procedimientos?.

18. Que horario, turnos, etc., tiene implantado la Semana Inglesa 8:00 a 16:00 con una hora de
cooperativaparatodaslasclasesdepersonal? comida.

19. Visitar las instalaciones, planta y oficina principal Serealizaranvisitas alasinstalacionesparapoder


delacompaa. verificar algunos procedimientos, as como
realizaralgunasentrevistas.

20. Crditos bancarios o de cualquier otra ndole que Si.


hayaobtenido.

21. Listarloslibrosdecontabilidadenuso. LibroDiario.


LibroMayor.
Auxiliares.

22. Cmo se lleva a cabo el registro de las Lasoperacionesseregistranatravsdeequipode


operaciones?. computo.

24. Obtener del personal de departamento de recursos Se realiza la requisicin de personal, recursos
humanos y otros que intervengan en el registro de humanos realiza el reclutamiento y procede a la
operaciones de la nomina un detalle de las labores que seleccindepersonaldespusconlacontratacin
realizanyformasqueusa. dondesehaceunexpedientedelnuevointegrante
delaempresa.

25. Existeunsistemadefinidodenomina? Si.

198
26. En caso de ser afirmativa la pregunta anterior SeutilizaelNOI(nominaintegral).
sealarbrevementedequclasedesistemasetrata.

27. Laplantilladepersonalestaactualizada? Si.

28. Sealar las clases de registro que elabora (el Expedientes de reclutamiento, expediente de
departamento de recursos humanos) y forma de archivo trabajadores.
deestas.
ContabilidaddelaNmina.

29.Indicarsiladocumentacinqueoriginalosasuntos Si, se tiene un buen expediente por cada


delanominasearchivaordenadamenteenrecopiladores empleado.
(documentacin anexa o separada de las plizas), si su
localizacin es accesible y si los recopiladores se
encuentranarchivadosenformaordenada.

30. Se concilian los auxiliares contra la cuenta de Si.


mayor?

34. Sepreparanrelacionesanalticasdelosauxiliares? Si.

35. Listar las cuentas de bancos que maneja la HSBC.


cooperativa. Bamamex.
Banorte.

36. Existensaldosacargodeempleados? Si.

37. Cul es el mtodo seguido para la valuacin de


personal?

199
38. Se tienen expedientes que contengan la Si.
documentacinoriginalporcadaempleado?

39.Enquemomentoseregistraelpasivoporfacturasa Enelcasodecompras,cuandoentrenlasfacturas
revisin? entren a revisin deben llevar toda la
documentacin como entrada al almacn por lo
que el pasivo se registra inmediatamente, en el
caso de otro tipo de proveedores deben llevarla
autorizacin.

40. Se sigue la poltica de registrar mensualmente No.


reservas de pasivo (como pueden ser de, PTU,
gratificaciones,sueldos,impuestos,etc.?).

41. Existe un adecuado control sobre acumulaciones nicamentelosqueemiteelsistema.


paraefectosdelclculomensualyanualdeISRporlos
sueldos, salarios y dems prestaciones pagadas al
personal?sealarelsistema.

42. Asimismo, existe un adecuado control sobre los Si.


conceptosenacumulacindelossalariosparaefectosdel
pagodelascuotasobreropatronalesalIMSS.

43.Igualmentesetieneelcontrolsobrelossalariosdel Si.
clculo bimestral y anual de aportaciones al
INFONAVIT?

44. Setienenexpedientesdelpersonal? Si.

200
45. Todo el personal se encuentra inscrito en el RFC, Elpersonaldenominaseencuentraregistradoen
IMSSyenelSAR. el IMSS y SAR, se tienen algunos personas de
honorariosquenoentreganfacturasyaqueotros
selasprestan.

FISCAL

46.Setieneimplantadouncalendariodeobligaciones Si.
fiscales?

47. A qu tipo de obligaciones fiscales (federales y AlpagodeIVA,ISR,IVAretenido,ISRretenido


estatales), se encuentra sujeta la cooperativa como pagodeIMSS,eINFONAVIT.
causanteyretenedor?

48. Se celebran operaciones con partes relacionadas? No


en caso afirmativo contestar cuestionario anexo, en la
parte correspondiente. la compaa tiene operaciones e
inversionesenelextranjero?encasoafirmativocontestar
cuestionarioanexoenla partecorrespondiente.

49. La compaa a obtenido en el actual y anterior


ejercicios, subsidios, estmulos o exenciones de No.
impuestos?

50.Lasdeclaracionesinformativassehanpresentadoen
mediosmagnticos? Si.

PreparNadiaMeloLpez. Revis:Lic.JorgeEnsastigan.

FECHA31DEJULIODE2005.

201
SOLICITUDDESERVICIO.

Mxico,D.F.,a1deJuniode2005.

SociedadCooper ativaTrabajador esdePascualS.C.L


Clavijer oNo.75
Col.Trnsito
PRESENTE:

Conrelacina la solicitud de la Auditoria operacionaladministrativa que se practicar ennuestra empresa


Sociedad Cooperativa Trabajadores de Pascual, S.C.L. a efecto de conocer el estado en que se encuentra
nuestroDepartamentodeRecursos Humanosporelperiodocomprendidodel1demayoal28deagostode
esteaotodavezquenosproporcionensuscondicionesyformasdetrabajoquenospresentarnmediantesu
cotizacin,dondenosdesplieguelascondicionespropuestasporustedes,elcostototaldesushonorariosyel
tiempoestipuladoparadicharevisin.

Sinmasporelmomento,muyatentamente.

___________________________
Lic.ManuelMorelosPrez
DirectorGeneral

202
CONTRATODEPRESTACINDESERVICIOS.

GRANGYASOCIADOS,S.C.

Mxico,D.F.,a18deAbrilde2005.

SOCIEDADCOOPERATIVATRABAJ ADORESDEPASCUAL,S.C.L.
ATN:Lic.MANUELMORELOSPEREZ.

Pormediodelapresentetenemoselgustode confirmarlesnuestraaceptaciny entendimientodelasbases


sobrelasquesedesarrollarnuestrotrabajo,ascomolosserviciosquehabrnderecibirdenuestraparte,con
el propsito de emitir nuestra opinin en relacin con la Auditoria Operacional y Administrativa al
DepartamentodeRecursosHumanosdelaSociedadCooperativaTrabajadoresdePascual,S.C.L.,delperodo
comprendidoentreel1demayoal28deagostode2005,queustedesdeseanquellevemosacabo.

Auditor iaOperacionalyAdministr ativadeRecur sosHumanos:

Nuestro trabajo consistir en examinar el control y procedimientos, as como los efectos que generan el
desarrollo de la compaa. Por consiguiente, examinaremos sobre bases selectivas la documentacin y
registrosexistentesparasucontrolquesoportanlosinformes yrelevacionesdecadacontrol,evaluandolos
mtodosyprocedimientosestimadosporlaadministracin.

Nuestra Auditoria se llevar a cabo de acuerdo con las Normas de Auditoria Generalmente Aceptadas,
emitidas por el Instituto Mexicano de Contadores Pblicos, A.C. y por lo tanto, incluir pruebas de los
registrosycontrolescircunstanciales.

En relacin con nuestro examen, efectuaremos un estudio y evaluacin de la estructura de control interno
hastaelgradoqueseanecesarioparadeterminarlanaturaleza,alcancey oportunidaddelosprocedimientos
deAuditoriaqueaplicaremos.

Esteestudioyevaluacinimplicaunanlisisdetalladodelcontrolinterno,quenospermitaemitirunaopinin
sobrelaefectividaddelaestructuradelmismo.

203
Lossociosnodebernlimitarelalcancedenuestrosprocedimientos,yaqueelloimplicaraquenotuviramos
lasbasessuficientesparasustentarnuestroinforme.

Los papeles de trabajo preparados en relacin con nuestro examen, son propiedad de nuestra firma,
comprenden informacin confidencial y sern retenidos por nosotros de acuerdo con nuestras polticas y
procedimientos. Sin embargo, nos pueden solicitar la presentacin de dichos papeles de trabajo ante el
ConsejoDirectivoycualquierautoridadqueaslorequiera.Siestosucediera,elaccesoanuestrospapelesde
trabajoseproporcionaranbajonuestrasupervisin.Asimismo,enelcasoenquesenosrequieraproporcionar
copia de algunos papeles de trabajo, los mismos seran sellados con la leyenda Para uso confidencial y
restringido,proporcionadoporlafirmadeauditores.

Laadministracintambinesresponsabledeteneranuestradisposicin,conbaseanuestrasolicitud,todos
los manuales y procedimientos administrativos e informacin general y contable correspondiente en
originales y copias de la Sociedad para su cotejo, as como designaral personal quenos atienda en forma
directa.

Como resultado de la Auditoria que practiquemos, emitiremos un informe sobre el funcionamiento y


operacionesdeRecursosHumanosdelasociedad.Comoconsecuenciadelestudio yevaluacindelsistema
decontrolinternomencionadoconanterioridadydelresultadodelaaplicacindenuestrosprocedimientosde
Auditoria, podramos determinar debilidades importantes en dicho sistema,las cuales seran comunicadas a
ustedesencartaporseparado.

Esperamos cooperacin completa de su personal y confiamos en que se nos proporcionarn los registros,
documentacin y otra informacin que se requiera para formar parte integrante de nuestra revisin en el
transcursodenuestraAuditoria.

Otr osser vicios:

Cualquier otro servicio profesional que ustedes requieran de nuestra firma, estar sujeto a un acuerdo por
separado.

Pr ogr amacindeltr abajo:

Estimamos el siguiente calendario de actividades para la ejecucin de nuestro trabajo y la entrega de los
informessolicitados,porlosquelesinformaremosoportunamentedecualquiercambionecesario:

204
Fechasclave Actividades.
15/07/2005 Iniciodeltrabajodecampo.
01/07/2005 Visitaalasinstalaciones.
15/07/2005 Recepcindedocumentacinsolicitadaaliniciodelavisita.
15/09/2005 Conclusindeltrabajodecampo.
25/09/2005 EntregadenuestroinformeoriginalydefinitivodelaAuditoria.

Cuandoeneltranscursodenuestrotrabajonos enfrentamosahechosocircunstanciasquenonospermitan
desarrollarloenlaformainicialmentepropuesta,selosinformaremosinmediatamenteporescrito.

Infor mesapr esentar :

Comoresultadodenuestroexamendeloscontrolesinternos,prepararemoslossiguientesinformes:
1. Cartadeobservaciones.
2. Cartadesugerencias.
3. Informefinal.

Nuestraresponsabilidadparaexpresarunaopininprofesionalylaformaenqueseexpresedependerdelos
hechosycircunstanciasprevalecientesalafechadelosinformes.Sinuestraopinintuvieraalgunalimitacin,
lasrazonesdeelloseranexplicadasennuestroinforme.

Honor ar ios:

Estimamos que nuestros honorarios por el examen de los controles internos de la compaa, calculados en
atencinalnivelde experiencias yaltiempoporinvertirdenuestropersonal, y otrosgastosincurridos,los
cualesascenderna$250,000.00.msIVA.

Proponemosquedichomontosefacturecomosigue:
$125,000.00enchequenominativoparagastosoriginadoseneltrabajodecampo.
$125,000.00enchequenominativocomoconclusindeltrabajo.

Formadepago:
50%elda 15dejulio yel50%restanteeldaqueseentregueelinforme.

Asmismo,lesavisaremosinmediatamentedecualquiercircunstanciaquepuedaalterarestascifras.

205
Deseamos agradecer esta oportunidad de servir a la compaa y les aseguramos que este trabajo recibir
nuestra mayor atencin, esperando que el contenido de esta carta merezca su aprobacin, y de ser as, le
rogamosdevolvernosunacopiafirmadadeconformidad,aunodenuestrosrepresentantes.

MUYATENTAMENTE

C.P.Car losMar tnezEstr ella C.P.EstelaCasasHer nndez

Acepto las condiciones de esta carta como un acuerdo de voluntades entre la Sociedad querepresento y la
firma de auditores que practicarn la Auditoria antes citada. La he ledo y entiendo plenamente las
condicionesydisposicionescontenidas.

Lic.MANUELMORELOSPEREZ
Cargo:DirectorGeneral

Fecha:01deJ uniode2005.

206
CUESTIONARIOAPLICADOALDEPARTAMENTODERECURSOSHUMANOSDELA
SOCIEDADCOOPERATIVATRABAJ ADORESDEPASCUAL,S.C.L.

AplicadoporC.P.GabinodeJessOrtiz. ContestadoporGerenciadeRecursosHumanos.
CUESTIONARIODECONTROL Fechadeaplicacin: Per odo: Hoja
INTERNO:
GERENCIADERECURSOSHUMANOS 12dejuliode2005 Primersemestre2005. 1de6

PREGUNTA SI NO N/A COMENTARIOS


1.Cmoestaestructuradalacooperativa? AsambleaGeneral.
Consejode
Administracin.
ConsejodeVigilancia.
Comisiones.
Coordinaciones.
Gerencias.
(Verorganigramadela
empresa).
2.Lacooperativayenespeciallagerenciaderecursos X Todoslosdepartamentos
humanoscuentaconmanualesdepolticasy tienenbiendefinidossus
procedimientosbiendefinidos? manuales.
3.Secuentaconunorganigramaenlaorganizacin? X (Verorganigramadela
empresa).
4.Secuentaconunorganigramadelagerenciade X Gerentedepersonal.
recursoshumanos? Subgerencia.
Encargadodesueldosy
salarios.
Supervisordenminas.
Responsableseguridad
social.
Auxiliares.
5.Secuentaconplantilladepersonaldetodalaempresa? X
6.Qutipodeinformessehacenparadaraconocerlas Seleproporcionatodala
polticasyprocedimientosdecadapuesto? informacinenla
induccin.
7.Existerotacindepersonalenlagerenciaderecursos X
humanos?

207
8.Essuficienteelpersonalconelquesecuentapara X
realizarsutrabajo?
RECLUTAMIENTOSELECCINYCONTRATACIN.

9.Existeunesquemadeorganizacinqueindiquelos X Secontrolaatravsde
puestosquerequiereorequerirlaempresa? organigramay
plantillasysihace
faltasesolicita.
10. Existeuncatlogodepuestosbiendefinidos? X
11. Existenperfilesdepuestos? X

12. Existeunprogramaestablecidoparaelreclutamientoy X Estolohaceuna


seleccindepersonal? agenciaexterna
especializada.
13. Existenprocedimientosbiendefinidosparael X
reclutamientoyseleccindepersonal?
14. Quinestaacargodelreclutamientoyseleccinde Estosehaceatravs
personal? deunaagencia
externa.
15. Cmosellevaacaboelreclutamientoyseleccinde Semandaelperfil
personal? requeridoylaagencia
externaseencargade
enviarlo.
16. Conoceelprocedimientoparalograrlaautorizacinde X Cuandosurgeuna
plazas? vacanteparaalgn
Descrbalobrevemente puesto,seanalizaa
travsdelcomit,se
notificaarecursos
humanosysesolicitaa
laagencia.
17. Secuentaconestudiodeanlisisyevaluacinde X
puestos?
18. Qufuentesdereclutamientoseutilizannormalmente? Sepromueveal
Personal personalinternoysi
Agenciasdeempleo nohaycandidatosque
Bolsadetrabajo cumplanconelperfil
Peridicoyrevistas sesolicitaalaagencia.

208
19. Existeunformatoespecficoparaelreclutamientode X Laagenciaexterna,es
personalenelquelosaspirantesconsignensusdatos laencargadadehacer
personalesylosrelativosalaescolaridad,especializacin, lasevaluaciones
experienciayreferenciasdetrabajo? pertinentes.

20. Existencriteriosparalaseleccindepersonal? X
21. Culeselprocedimientoquesesigueparala Laagenciaenvaal
contratacin? candidato,se
entrevista,seevalay
sicumpleconlos
requerimientosse
contrata.
22. Severificanlosdatosdelasolicitudyreferenciade X Laagenciaexterna.
empleosanteriores?,YQuinlosrealiza?
23. Evalanconpruebasprcticasalosposibles X Previaevaluacindela
candidatos? agencia.
24. Serealizanpruebaspsicometrcas? yApartirdeque X Laagenciaexterna,es
nivel? laencargadadehacer
lasevaluaciones
pertinentes.
25. Seotorgancontratosdetrabajoeneltiempoestablecido X
porlaLey?
26. Cuantostiposdecontratosmanejalaempresa? Eventualyde planta.
27. Todoslosempleadosestnincluidosenlanmina? X
28. Existenempleadosporhonorariosasimilados? X
29. Existeinduccinalosnuevoscolaboradorestantoala X
empresacomoalpuestoquevanadesempear?
30. Existeunperododecapacitacinparaambientarseal X Loquedurala
puestoyalaempresa?yEnquetiemposeda? induccin.
31. Quinesautorizanlascontratacionesdenuevoingreso? Eldepartamentode
recursoshumanosa
travsdelaagencia.
32. Quinesactualizanyautorizansueldosytiempoextra Elrepresentantede
oalgnotroincentivoeconmico? rea
Comisindecontrol
tcnico
Consejode

209
administracin.
33. Quinesactualizanlostabuladoresdesueldoycada Comitdetabuladory
cuando? sehacecadaao.
34. Losexpedientesdepersonalseencuentran X
debidamenteintegradoscon:antecedentes,justificacindela
contratacin,salarios,perododecontratacin,movimientos
anteelIMSS,INFONAVIT,SAR,etc.?
35. Elpersonalsedesarrollapormedioderotacinen X
variospuestos?
36. Secuentaconexpedientesdelpersonaldebidamente X
integradosyactualizados?

CAPACITACINYDESARROLLO.
37. Tieneestablecidounprogramaanualdecapacitacin, X Lollevaacabola
adiestramiento ydesarrollodepersonal? Comisinde
Educacin.
38. Sedancursosdecapacitacinalosempleadosdetodos X
losniveles,tantomandosmedioscomooperativos?
39. Sedancursosdecapacitacinalosempleados X
susceptiblesdeocuparnivelesjerrquicosmsaltos?
40. Estnestablecidosalgunosdelossiguientesprogramas
decapacitacinyperfeccionamiento?:
Cursossobresureadetrabajo X
Seminarios X
Practicasinternasoimpartidasporinstituciones X
especializadas X
Cursossobremedidasdehigieneyseguridad
41. Secuentaconpersonalespecializadoparadarlos X Lollevaacabola
cursosdecapacitacinenlaempresa? Comisinde
Educacin.
42. Laempresaimpartecursosdecapacitacinfuera desus X Alosempleadosde
instalacionesalosempleados?yaqueempleados,cada todoslosniveles,
cuando? segnla
canledarizacindel
readerecursos
humanos.

210
43. Cadacuandoprogramanloscursosparalos Recursoshumanos
administrativosyoperativos? elaboraunprograma
anual,segnsus
necesidades.
44. Cadacuandoprogramanloscursosparalosmandos Recursoshumanos
mediosydealtagerencia? elaboraunprograma
anual,segnsus
necesidades.
SEGURIDADEHIGIENE.
45. laempresacuentaconserviciomdico? X
46. Setieneuncontroldeaccidentesysuscausas? X
47. Conocetodoelpersonallasinstruccionesencasode X Mediantecursosde
accidentesocontingencias(temblor,incendios,etc.)? personalespecializado.
48. Existencomitdeseguridadehigiene? X
49. Existepersonalcapacitadodesignadocomobrigadista X
paraauxiliarencasodecontingencias?
50. Secuentaconunprogramaanualdeseguridade X
higiene?
ADMINISTRACINDEPERSONAL.
51. Sedisponedeplantillaactualizadaporcadareadela X
empresa?
52Secontrolalaentradaysalidadelpersonal?yCmo? X Atravsdetarjetas
checadorasypasesde
salida.
53. Secontrolaelregistrodevacaciones,inasistencias, X Atravsdeuncardex
faltas, incapacidades,etc.?yCmo? individual(manualy
porsistema).
54. Secapturaenformaoportunalosreportes X Todoaldayde
correspondientesparalasmodificacionesennminascomo acuerdoalaley,las
son:altas,bajasmodificacionesalsalario,tiempoextra, altasybajaslohacela
retardos,permisos,etc.?YCmo? agencia.

55. Sonindependienteslaspersonasquepreparanla X
nminadeaquellasquehacenlacontratacindelpersonal?
56. EncasodepermisosyvacacionesSeotorganprevia X
autorizacin?

211
57. Dentrodelanminadepersonalsecontemplaalgn X
casodepensinalimenticia,severificaqueseapeguealas
disposicioneslegalesyjurdicascorrespondientes,setiene
copiadelamisma?
58. Secuentaconpolticasparaestablecereltiempolmite X Seaplicanlaspolticas
deretardodelosmandossuperiores? generales,semanejan
premiospor
puntualidad.
REMUNERACIONESALPERSONAL.
59. Existepersonalquelaboremediotiempo oconpermiso X
parasalirconstantemente?
60. Secuentaconautorizacinencasodeincidencias? X 3daspor
alumbramientoy3por
fallecimiento,porcitar
ejemplo.
61. Elpersonalqueapruebalanminaesdistintodequien X
laprepara?
62.Existealgncontrolsobreellmitemximoestablecido X Seencargaelreade
paraqueelpersonalfirmelanmina fondosyvaloresa
travsderecibosde
cobro.
63. Existeelpagointerbancarioenlaempresaosepaga X Todoesvanmina.
conchequesoefectivo?
64. Sobrequebasesseproporcionanlosbonos, Bonode
gratificaciones,incentivosuotrotipodegratificaciones? productividad.
Valesdedespensapor
puntualidad.
Bonosemestral.
Bonoanual.
Premiosemestral
65. Conquperiodicidadserevisanlostabuladoresde Anualmente.
sueldosparalosincrementossalariales?
FINIQUITOS.
66. Encasodequesecobrenfiniquitosconcartapoder X Slolopuedecobrarel
pidenalgunosrequisitosycualesson? trabajador.
67. Serequieredeidentificacinparaentregarchequesa X
losbeneficiariosdelosmismos?

212
68. Sedepositaelfiniquitosinhabercorroboradolanmina X
actual?
69. Tienenalgncontrolsobreloschequesnocobradospor X
elextrabajadoreneltiemporequerido?
70. Existealgnpasivogeneradopordeudasde X Sellevauncontrol.
trabajadoresquerenunciaronynocubrieronsusdeudas?
71. Sehantomadomedidasdecontrolparaverificarqueel X
personalquerenunciecompruebeyensucaso,yliquide
adeudosalaempresa?

213
PLANEACINDERECLUTAMIENTOYSELECCINDEPERSONAL.

GRANGYASOCIADOS,S.C.
AUDITORIAOPERACIONALADMINISTRATIVA
PLANEACIN.

RECLUTAMIENTOYSELECCINDEPERSONAL.

ACTIVIDADES CDULADE
REFERENCIA
I.Pr ocesodereclutamientoyseleccindeper sonal.
1.1 Verificarlosmediosqueseutilizanenelprocesodereclutamientoyseleccin
depersonal.
1.2 Evaluar y analizar el procedimiento que se utiliza en el reclutamiento y
seleccindepersonal.
1.3 Analizar y verificar que exista la descripcin de puestos predefinidos para
iniciarlaprecontratacin.
1.4 Analizar y evaluar que los contratos que se elaboran cumplan con todos los
requisitoslegales.
1.5 Investigarsicuentanconlosdiferentestiposdeexmenesdereclutamiento y
seleccin.
1.6 Investigarqueelpersonalseaacordeconelpuestoqueocupa.

II.Contr oldecontr atosymovimientosafiliator iosenelsistemadelIMSS.


2.1. Comprobar que los contratos contengan todos los datos requisitados por la
sociedadyverificarquienautorizalacontratacin.
2.2. Verificar que las fechas de alta coincidan con el inicio de checada en las
tarjetasyquelasbajascoincidanconlaultimachecada.

III.Ar chivodedocumentosdeempleado
3.1. Verificarqueexistaunadecuadocontroldelarchivodeexpedientes.
3.2. Investigarquieneselencargadodeadministrarestosarchivos.
3.3. Verificar que todos los archivos cuenten con su documentacin completa
cotejndoloconnuestrolistado.

214
PLANEACINDECAPACITACINYDESARROLLO.

GRANGYASOCIADOS,S.C.
AUDITORIAOPERACIONALADMINISTRATIVA
PLANEACIN.
CAPACITACINYDESARROLLO.

ACTIVIDADES CDULADE
REFERENCIA

I.Capacitacinydesar r ollo.
1.1. Verificarcuantostiposdecapacitacinexisten.(Internosyexternos).
1.2. Verificarsihayprogramasformalesdecapacitacin.
1.3. Relacionaralaspersonasqueseencuentranenalgncursodecapacitacin
externo.
1.4. Comosecontrolaalpersonalyquienautorizadichacapacitacin.
1.5. Existealgnfondodestinadoacapacitacinydesarrollo.

215
PLANEACINDESEGURIDADEHIGIENE.

GRANGYASOCIADOS,S.C.
AUDITORIAOPERACIONALADMINISTRATIVA.

PLANEACIN.

SEGURIDADEHIGIENE.

ACTIVIDADES CDULADE
REFERENCIA
I.Segur idadehigiene
1.1. Verificarqueelpersonalcumplaconlaspolticasestablecidasporlaempresa.
1.2. Analizar los procedimientos que implanta el manual de procedimientos de
seguridadehigiene.
1.3. Verificar que el personal de seguridad cumplan con sus actividades
apegndosealaspolticasinternas.
1.4. Verificarquetenganenordenyactualizadostodotipodetrmitesylicencias
manifestadasantelasSecretarascorrespondientes.
1.5. Verificarqueexistanprogramadeseguridadehigieneyqueseanllevadosa
cabo.
1.6. Verificar que las instalaciones cuenten con sealamientos de evacuacin y
zonadeseguridad.
1.7. Verificarquelosextintoresestnenlugaresvisiblesyenbuenestado.
1.8. Realizarrecorridos fsicos para constatar que las instalaciones estn en buen
estado.
1.9. Verificarlasactasderecorridosdeseguridadehigienedentrodelaempresay
queaccionestoman.
1.10. Verificarlostiemposqueseestablecenparasimulacrosycomoloscoordinan.
1.11. Verificar si todo el personal tiene conocimiento de las acciones a tomar en
casodecontingencias.

216
PLANEACINDENMINA.

GRANGYASOCIADOS,S.C.
AUDITORIAOPERACIONALADMINISTRATIVA.
PLANEACIN.
NMINAS.

ACTIVIDADES: CDULADE
REFERENCIA
1. Presenciarlaentradadelpersonalalasucursal,comprobando.
v Queingresenportandoelgafetedeidentificacin.
v Queregistrennicamentesutarjetadeasistencia.
2. Imprimir el reporte general de empleados y cotejar las tarjetas de asistencia
contraelinformegeneraldeempleados.
3. Recabarlastarjetasdelpersonalquenohayaregistradosuasistenciaysolicitar
la documentacin que soporte la inasistencia de los empleados que no
registraronlamisma.
4. Revisarlastarjetasdeasistenciaverificandoqueaparezcanlosregistrosdelas
entradas y salidas en todos los das,incluyendo los permisos, cursos y nuevo
ingresoenelreportedeausenciasporempleado.
5. Solicitar el ltimo reporte de nmina quincenal pagado, as como solicitar el
reportedeincidencias.
6. Revisarqueaparezcaenelreportedenminaquincenaleltotaldeincidencias
reflejadasenlastarjetas.
7. Revisarlosrecibosdenminaentregadosalpersonal,verificandoquelafirma
delempleadoregistradaenlosmismossealamismadelatarjetadeasistencia.
8. Revisarqueladocumentacinseencuentrearchivadaadecuadamente.
9. Solicitaraljefedepersonallaslistasdeasistencia.
10. Comprobarqueenlaslistasdeasistencia,aparezcanlosregistrosdeentraday
salida de todos los das, incluyendo los descansos, vacaciones, salidas
tempranoylosdasquenohayregistroenhorario.
11. Verificarquelaslistasdeasistencianopresentencorrecciones,nialteraciones
deningn tipoenlosregistrosdeentradaysalidadetodoslosdas.
12. Cotejarelreportedecontroldeasistenciacontralaslistasdeasistencia.
13. Verificarasistenciadeljefedepersonal.

217
EJ ECUCINDELTRABAJO.

GRANGYASOCIADOS,S.C.

NDICES.

RUBRO CUENTA NDICE


TIPO
ACTIVOCIRCULANTE
CAJAYBANCOS.
FONDOFIJO. A
BANCOS. B
REVISINCORTESDECAJA/COB. AB

INVERSIONES.
INVERSIONESENRENTAFIJA. C

INVENTARIOS. D

CUENTASPORCOBRAR.
CLIENTES. E
DEUDORESDIVERSOS. F
FUNCIONARIOSYEMPLEADOS. G
DOCUMENTOSDEVUELTOS. H
DOCUMENTOSPORCOBRAR. I
RESERVA PARA CUENTAS DE
COBRODUDOSO. J
DEUDORES DIVERSOS TARJETAS
DECRDITO. K

IMPUESTOSAFAVOR. L

ACTIVOFIJO. M

218
ACTIVODIFERIDO. N

OTROSACTIVOS. O

PASIVO. P
PROVEEDORES. AA
ACREEDORES. BB
PRESTAMOSBANCARIOS. CC
ANTICIPOACLIENTES. DD
IMPUESTOSPORPAGAR EE
I.S.R.IMPAC.PTU. FF
PASIVOSDIFERIDOS. GG
OTROSPASIVOS. HH
CUENTASPORPAGAR. II
CAPITAL. KK

RESULTADOS. VENTAS. 10
COSTOSDEVENTA. 20

GASTOS. NMINA. 30
INSUMOS. 40
ARRENDAMIENTOHONORARIOS. 50
DEPRECIACIONES. 60
AMORTIZACIONES. 70
PUBLICIDAD. 80
FINANCIERO. 90
OTROS.

OPERATIVOS.
ENVOSCENTRODEDISTRIBUCIN. a
ALMACNCENTRODEDISTRIBUCIN b
SERVICIO. c
TALLERMECNICO. d
CONTROLDEREQUISICIONESY e
FACTURACIN.
CONTROLDEPUERTAS. f

219
ALMACNYCONTROLDEREFACCIONES g
RECIBODEMERCANCA. h
ENTRAGADEMERCANCIA. i
RECURSOSHUMANOS. j
PAPELERAYCONSUMIBLES. k
MANTENIMIENTO. i
CONMUTADOR. m
SERVICIOSEXTERNOS. n

220
INDICESYMARCAS.
GRANGYASOCIADOS,S.C.
AUDITORIAOPERACIONALADMINISTRATIVA.
MARCAS.

CUMPLECONATRIBUTO.

NOCUMPLECONATRIBUTO.

NOAPLICA.

COTEJADOCONTRARELACINDEFACTURASENTREGADAS.

COTEJADOCONTRACOPIASDEFACTURAS.

COTEJADOCONTRAPAUTAS.

COTEJADOCONTRAESTADODECUENTABANCARIO.

COTEJADOCONTRAVALESDEPLANOGRAFA.

VERIFICADOFSICAMENTE.

COTEJADOCONTRAFICHASDEDEPSITO.

COTEJADOCONTRAREPORTESDENMINA.

COTEJADOCONTRATARJETASDEASISTENCIA.

COTEJADOCONTRARECIBOSDENMINA.

COTEJADOCONTRAKARDEX.

@ VERIFICADOENSISTEMA.

221
CUESTIONARIODERECLUTAMIENTOYSELECCINDEPERSONAL.

GRANGYASOCIADOS,S.C.
CUESTIONARIO.

1.Existeundocumentodeplanificacinderecursoshumanossobrenecesidadesdereemplazodepersonaly
otras? S

2. Se proyectan las necesidades del personal con suficiente tiempo para disminuir el reclutamiento de
urgencia? S

3.Recibeninstruccioneslosnuevosempleadosalospocosdasdeentraralaempresa? S

4. Se hace un verdadero esfuerzo para llenar los puestos con empleados preparados de la propia
cooperativa,antesde contratarapersonasajenasalacompaa? S

5. Hay algn procedimiento para aprobar (certificar cuando sea necesario) la seleccin de los nuevos
empleados? S

6.Eslamismapersonaoagencialaqueponetodoslosanunciosdereclutamientodespusdeexaminarlos
encuantoasucontenidoyforma? S

7. Seespecificanclaraylgicamentelasobligacionesdelospuestosalhacerseentrevistasalossolicitantes?
S

8. Cumplenlosreglamentosdegobiernolasformasdesolicitud? S

9.Requierensuficienteinformacinlassolicitudesacercadelosantecedentesdetrabajo yotrosdatos,de
manera que las calificaciones y los riesgos de empleo se manifiesten en forma clara y pueda hacerse una
buenaseleccininicial? S

10. Emplea la cooperativa alguna forma de test de aptitudes como parte del proceso de seleccin y
colocacin? S

11.Silacontestacinesafirmativa,cumplelafuncindeestablecercalificacionesnecesarias?(esdecir,
hasidoaprobado?). S

222
12.Siseconsideralacontratacindemenores,Existeunprocedimientoparaasegurarelcumplimientocon
los requisitos legales de permisos de trabajo, registro de horas, perodos de descanso, trabajo aprobado y
avisos? NO

13.Seconcentralaresponsabilidaddecisivade contratarodespedirenunasolapersona,comoel jefede


departamentodepersonal,enlugardeestarampliamentedistribuida? NO

14.Setomainformacinminuciosadelhistorialdesaludfsicaysellevanacaboexmenesadecuadospara
protegerlasalud delempleadocomolosriesgosdelosempleados? NO

15. Tienenunperododepruebalosempleadosporhora,seguidodeunaevaluacin,cuandoselescontrata?
S

16. Sehaestablecidoelprocedimientoparaobligaralusoefectivodelperododeprueba? S

17.Setrataconcortesaalossolicitantes?esdecir,Selesrecibecorrectamenteyselesdalainformacin
adecuada acerca de la empresa y las oportunidades de trabajo, as como una explicacin lgica de sus
posibilidadesparaobtenerel empleo? S

18. Hacebuenaimpresinlaoficinadeempleoalossolicitantes? S

19. Severificanycompletanconcienzudamentelasreferenciasantesdecontrataralossolicitantes? S

20.Sedicealosempleadosrecincontratadosculessernsusobligacionesyresponsabilidadesefectivas?
S

21. Se tiene el cuidado de aclararles a los empleados su potencial de sueldos, beneficios marginales y
condicionesdetrabajoantesdeemplearlos? S

22.Mantienelaempresaregistrosadecuadosdelpersonalesdecir,Semantieneunregistroactualizadoy
amplioporcadaempleado(incluidostodoslosdatosimportantesyresultadosdelaevaluacin)? S

23. Hay una poltica de conservacin de los registros de personal para llenar los requisitos prcticos y
legales? S

223
ANLISISDEPUESTO.
ANLISISDEPUESTOS:

PUESTO: GERENTEGENERAL

UBICACIN: SociedadCooperativaTrabajadoresdePascual,S.C.l.

DEPARTAMENTOSCONTROLADOS: Finanzas.
Comercial.
Produccin.
RelacionesPblicas.
Personal.
JEFEINMEDIATO: DirectorGeneral.
EMPLEADOSASUSORDENES: GerenteComercial.
GerentedeProduccin.
EncargadodePublicidad.
Contador.
Cajera.
Secretarias.
A TRAVS DE SUS AgentesyDistribuidores.
COLABORADORESINMEDIATOS: SupervisoresdeFbrica.
Obreros.
PersonaldeOficina.
CONTACTOSPERMANENTES:
Internos: ComitCoordinador
GerenteGeneral
Externos: Clientesespeciales.
Bancos.
Autoridades.
ProfesionistasyAsesores.

ANALIZ:
REVIS:
AUTORIZ:

224
DESCRIPCINGENRICA.
EsresponsableanteelGerenteGeneral,delaeficienteadministracindelaadministracindelaempresa.
Para ello, programa, organiza, integra, dirige y controla, con la sola limitacin de las polticas y normas
fijadaspreviamente,lasactividadesdetodoslosdepartamentos,auxilindoseensucasodelosGerentesde
stos.
SeencargadirectamentedelasactividadesdeFinanzas.ConducelasRelacionesPblicas.

FUNCIONESBASICAS:

ADMINISTRACIN
GENERAL:
1.Previsin: Pr evisindeVentas:
Realizalasprevisionesdemercadotecniayventasparalaempresa,ayudndose
en su caso de tcnicos especialistas o del personal de la misma, en la
investigacinyformulacinperidicadeestudiossobre:
1. Mercadosactualesypotenciales.
2. Diseodeproduccin.
3. Empaquesmsconvenientes.
4. Proyectosdepublicidad.
5. Pronsticosdeventas,etc.
Pr evisionesdefabr icacin:
1. SupervisalosestudiosdelGerentedeProduccin,paraintroducirsistemas
ymtodosqueaumentenlaproductividad,talescomo:
1.1.1. Simplificacindeprocesos.
1.1.2. Aprovechamientooreduccindedesperdicios.
1.1.3. Mejoramientodelacalidad.
1.1.4. Posibilidadtcnicadefabricarnuevosproductos.
1.1.5. Aprovechamientointegraldelamaquinariaexistente.
1.1.6. Estudiosdetiemposymovimientos.
1.1.7. Sistematizacindeprocesos,etc.
2. Aprueba los programas de produccin, sistemas y mtodos que parezcan
msoportunosparalograreseaumentodeproductividad,siemprequeno
sesalgandelapolticaynormasfijadasporlaDireccin,osolicitadesta
lasmodificacionesqueconsiderenecesarias.
Pr evisinfinancier a:
Analiza e interpreta los diversos Estados Financieros de la empresa,
examinando los distintos renglones de los mismos (prstamos, costos,

225
inversiones, crditos otorgados, etc.) con el fin de decidir las medidas
necesariasparamantenerymejorarlaposicineconmicadelaempresa,salvo
loscasosexpresamentereservadosalaDireccin,aplicacindeutilidades.
Pr evisineconmica:
Realiza estudios econmicos de ndole general, leyendo al efecto folletos,
estadsticas,etc.,obienencomiendaatcnicosespecialistaslaformulacinde
estudiosconcretosquerequieralaempresa,sobretemaseconmicostalescomo
niveldesalarios,costosdelavida,endeterminadaregin,etc.
Planeacin: Polticas.
Formula y revisa peridicamente las polticas generales y departamentales en
materia de produccin, ventas, publicidad, finanzas, personal, etc., buscando
lograr la unidad de accin entre las diferentes funciones y actividades en la
empresa.
CuidadeobteneroportunamentesuaprobacinporelDirectorGeneral.
Planesconcretos.
Formula por escrito, basndose en las previsiones realizadas y con la mayor
precisin posible, los diferentes planes que se deben seguir para impulsar y
desarrollarenformaadecuadaeltrabajodelaempresa,depreferenciafijando
cursosalternativos.
Pr ogr amasypresupuestosgener ales.
Traduce,siemprequeseaposible,losresultadosqueobtieneenlosdospasos
anteriores,aprogramasypresupuestos,tantoacortocomoacortoplazo.
Somete a la aprobacin de la Direccin General todos los programas y
presupuestosdeduracinanualomayor.
Pr ogr amasypresupuestospar ticulares.
ConlaaprobacinomodificacioneshechasporlaDireccinGeneral,formula
los programas y presupuestos particulares o de duracin menor de un ao,
(semestrales, cuatrimestrales, trimestrales y mensuales), los que deben slo
conformarsealospresupuestosgeneralesyanualesaprobados.
Organizacin: Estr uctur adelaempr esa.
Estudiayrevisaconstantementelaorganizacindelaempresa,paradecidiry
llevaracabolasmodificacionesyampliacionesqueasujuicioserequieranen
la estructura de aquella, creando, modificando o suprimiendo puestos,
ajustandolosgradosdeautoridadyresponsabilidaddelegadas,etc.,conelslo
lmitedenosalirsede laspolticas,programasypresupuestosaprobados.
Funciones.
Cuida de que los diversos jefes ajusten sus actividades a las funciones que

226
tcnicamente les han sido fijadas en los anlisis de puestos respectivos, en
forma de que no existan duplicidades de mando, ni fuga de obligaciones,
resolviendoloscasosnoprevistosenaquellos.
J er ar quas.
Vigilaqueenelejerciciodelaautoridadencadaniveljerrquico,noseejerza
dicha autoridad fuera de los lmites sealados en las polticas, normas, etc.
Fijadasacadajefe.
Obligaciones.
Exigequecadajefeoempleado,cubraneficazmentetodaslasactividadesque
les han sido encomendadas, y que se les provea para ello de los medios
necesarios.
Tcnicasdeor ganizacin.
Procura,paralogrartodoloanterior,queseformulenymantenganalcorriente
todos aquellos instrumentos tcnicos de organizacin, que mejor ayuden a
perfeccionar o adaptar sta a las necesidades, como cartas de organizacin,
anlisisdepuesto,
Integracin: Seleccindejefes.
Selecciona a los jefes y funcionarios de los diversos departamentos de la
empresa, determinando antes si poseen las capacidades tcnicas y
administrativasnecesarias.Decidesobrelacontratacinprovisionalydefinitiva
de dichos jefes. Vigila igualmente el retiro, cambios o aumento del mismo
personaladministrativo.
Seleccindeper sonal.
Cuida de que los encargados del reclutamiento, seleccin y acomodacin del
personal de la empresa apliquen los procedimientos que mejor realicen la
polticadeobtenerquelapersona adecuadaocupesiempreelpuestoadecuado.
Adiestr amientoycapacitacin.
Vigilaqueeladiestramientoycapacitacinquesedenalostrabajadorestanto
enlosaspectosdeltrabajo,comosociales,serealicendemodoqueseobtenga
lamayoreficienciay colaboracindelpersonal.
Desar r ollodeejecutivos.
Cuidadeirbuscandoydesarrollandoenlosactualesempelados,lascualidades
yconocimientosnecesarios,paracontarmstardeconejecutivosadecuados.
Direccin: Delegacininmediata.
Delegaoportunayadecuadamentelaresponsabilidadyautoridadquerequiera
cada uno de sus colaboradores inmediatos, cuidando de que ambas tengan la
debidacorrespondenciaydequesefijenloslmitesparaejercerlasegunda,y

227
los controles necesarios paramantenersesiempre informado del ejercicio que
sehagadelamismaautoridad.
Delegacinmediata.
Cuida de que sus colaboradores inmediatos deleguen a su vez autoridad
recibidacuandoseanecesario,peroenformasimilaralasealadaantes.
Decisiones.
Tomatodaslasdecisionesdecarctergeneralparalaempresa,obienlasque
no estn expresamente encomendadas a sus colaboradores inmediatos,
excepcin hecha de las que tambin en forma expresa se ha reservado la
Direccin General, como se en cada uno delos niveles jerrquicos detallados
enlaespecificacindelpuesto(autoridad).
Coor dinacin.
Establece constantemente la mejor coordinacin posible entre todos los
departamentos. Secciones, niveles, jefes y empleados de la empresa. Cuida
especialmente de coordinar la accin de sus colaboradores inmediatos,
celebrandoparaellojuntasperidicas,plticasinformales.
Super visin.
Supervisalaactuacindesuscolaboradoresinmediatos,tantopormediodela
revisindecontroleseinformesordinarios,comopersonalmente,paraorientar,
mejorar,ajustar,etc.,todaslasfuncionesyactividades.
Comunicacin.
Cuidadeestablecerentodalaempresaunaadecuadacomunicacin,paraque
losobjetivos,polticas,normas,etc.,seansiempreoportunamenteconocidosy
debidamenteinterpretados,ytratadefomentarporesemedioylosdemsque
estimeapropiados,elespritudecolaboracinyentusiasmoentodoelpersonal.
Remuner acin.
Cuidadequelossistemasderemuneracinaempleados,obreros,vendedores,
etc., logren estimular del mejor modo posible al personal a prestar su plena
colaboracin y que al mismo tiempo se eviten en lo posible descontentos,
rotacininnecesaria,etc.
Control: Suestablecimiento.
Cuida de que se establezcan los sistemas de reportes o informes de
contabilidad, estadsticas, etc., ms adecuados, con el fin de obtener
informacin precisa, sinttica y oportuna, de las diferentes actividades de la
empresa.
Contr olesdepr oduccin.
Requiereperidicamentedelgerentedeproduccininformesrelativosa:

228
1. Cantidadyritmodelaproduccinenelmes.
2. Resultadosdelcontroldecalidad.
3. Gastosdecomprasalmes.
4. Nmerodehorasextraspagadaalosobreros,etc.
Contr oldeventas.
Requiereperidicamentedelgerentedeventasinformesrelativosa:
1. Volumendeventasefectuadas.
2. Rendimientodelosagentes.
3. Opinionesdelosconsumidores.
4. Gastosdelosagentes,etc.
Contr olescontablesyfinancier os.
Requiere peridicamente del contador la presentacin de los documentos
contables,talescomo:
1. Estadosfinancierosde laempresa.
2. Costosdeproduccin.
3. Costosdeventas.
4. Comprobantesdepagosfiscales,etc.
Contr olesdeper sonal.
Requiere del gerente de produccin, la presentacin peridica de informes
acercade:
1. Horasextrastrabajadas.
2. Ausentismoenelpersonal.
3. Sugestionesoquejasimportantesdelpersonal.
4. Accidentesdetrabajoyenfermedadesprofesionales.
Inter pretacinyapr ovechamiento.
Estudia e interpreta todos estos controles, con el fin de medir y calificar los
resultadosqueseobtienenenlasdiferentesactividadesdelaempresa,controlar
laaccindesuscolaboradoresinmediatosydemssubordinadosyaprovechar
todosestosmediosparaelprocesodeprevisinsealadoalprincipio.
FINANZAS:
Presupuesto: Elaborarelpresupuestoanualdeingresosyegresos,ylopresentaaladireccin
generalparasuaprobacin.
Elaborayapruebalospresupuestosmensualesde:
Gastos de compras de materias primas, materiales menores y
herramientas, basndose en los datos proporcionados por la gerencia
deproduccin.
Gastosdeventa,basndoseenelcriteriodemesesanterioresyenlas

229
necesidadesexpresadasporlagerenciacomercial.
Gastos de publicidad, basndose en los proyectos presentados por el
publicista.
Gastosdecomprasdeoficina,basndoseenlosdatosproporcionados
porelcajero.
Gastosdeadministracin,talescomoluz,renta,contribuciones.
Caja. 1. Controlarlos pagos hechos por la empresa,revisando para ello pliza de
caja.
2. Cuidadequeserevisendetalladamentelasfacturaspresentadasacobroen
laempresa.
3. Controlar los depsitos hechos en el banco por el cajero, revisando las
fichascorrespondientes.
Prstamos. 1. Gestiona oportunamente prstamos en los bancos, segn las necesidades
quesepresentenydentrodelaspolticasestablecidas.
2. Procuralaobtencindefondosprovenientesdedocumentosafavordela
empresa,descontndolosenelbancopormediodelcajero.
Crditoycobranzas. 1. Autorizacrditos,bonificaciones,etc.,aclientes,dentrodelaspolticasy
normasfijadasalrespecto,ycancelaensucasolosotorgados.
2. Cuidadequesecubreoportunamenteaclientesydeudores,utilizandopara
ello,elcontroldevencimientosdedeudoreselaboradoporelcontador.
3. Cuida de que se efecte oportunamente los pagos requeridos, utilizando
paradichoefecto,elcontroldevencimientosdeacreedoreselaboradopor
elcontador.
Costos. 1. Lleva un control estadstico de los costos de produccin y ventas, por
mediodelaencargadadelacontabilidad.
2. Interpreta el control mencionado y los estados financieros relativos, a
efecto de estudiarla conveniencia de aumentar o disminuir los renglones
correspondientes,yaplicarlasmedidasqueconsiderenecesarias.
Contadura. Cuidaqueserealicenperidicamenteauditoriasinternasyexternas.
Pagosfiscales. 1. Cuidalacorrectaelaboracinypresentacinoportunadelasdeclaraciones
necesariasparaefectuarlospagosfiscales.
2. Requierealcontadorlaentregapuntualdelosrecibosdedichospagos,a
findearchivarlosypoderllevaruncontroladecuadodelosmismos.
Serviciosdeoficina. Supervisaycoordinalostrabajadoresdeoficinaengeneral.
Cuidaatravsdelencargadorespectivo,elcorrectofuncionamientodelarchivo
generaldelaempresa,procurandodeterminar:
Losdocumentosquesedebenarchivar.

230
Losdocumentosquesedebendesechar.
El tiempo que deben conservarse los papeles y documentos
archivados.
Lanormalizacindeformasinternasdelaempresa.
Elsistemadeclasificacinmsadecuado.
RELACIONES 1. Representaordinariamentealaempresa,salvoindicacionesdeladireccin
PBLICAS: general.
2. Mantiene las mejores relaciones pblicas de la empresa con las
autoridades.
3. Atiende a los clientes, visitantes y proveedores que visitan las
instalaciones, procurando crear en ellos una actitud favorable hacia la
empresa.
4. Procuraespecialatencinalasrelacionesconlacompetencia,paralocual
asiste a juntas peridicas que se celebran, en las que se busca lograr la
coordinacindeactividadescomunes.
5. Mantiene contactos y membresa con las organizaciones patronales, con
finesderelacionespblicasybuscando,almismotiempo,aprovecharlos
serviciosquestasofrecen.

DESCRIPCINESPECFICA.
ACTIVIDADES 1. Revisaasuntospendientesylosordenasegnsuimportanciaafindedesahogarlos
DIARIAS: enelcursodelda.
2. Revisayestudialacorrespondenciarecibida,turnandoalosjefesrespectivoslaque
ellosdebancontestar,conlasinstruccionesapropiadas.
3. Contesta de inmediato la correspondencia que amerite que l personalmente lo
haga,dictandoasusecretaria.
4. Atiende o hace llamadas telefnicas sobre asuntos muy diversos con clientes
especiales, competidores, asesores, etc., con miras principalmente de relaciones
pblicas.
5. Celebra acuerdos con sus colaboradores a finde dar y recibirinformacin, tomar
decisiones,resolverdudas,etc.
6. Estudiaproblemasdemuydiversandole,solicitandoparatalefectolainformacin
queconsiderenecesaria.
7. Autorizadocumentos,crditos,etc.,dentrodelasnormasypolticasprefijadasal
respecto.
8. Recibepblicoqueacudeasuoficinaatratarasuntosvarios,cuandolandolede
stosloamerite.
9. Revisayfirmalacorrespondenciaqueseoriginaenlosaltosnivelesdelaempresa.

231
ACTIVIDADES 1. Acuerda con el director general para recibir instrucciones, aprobar planes,
PERIODOCAS: presupuestos,etc.,ascomoparaproporcionarinformesycomentarreportes.
2. Tomaparteenlasreunionesdelcomitcoordinador.
3. Acudealasjuntasdelconsejodeadministracin.
4. Trabajaenlaelaboracindepresupuestosyrevisaestadosfinancieros.
ACTIVIDADES 1. Participa en congresos, convenciones, asambleas, etc., que considere ventajosas
EVENTUALES: paraaumentarelprestigiodelaempresa.
2. Prepara informes sobre asuntos especficos encomendados por el consejo de
administracin.

ESPECIFICACINDELPUESTO.

CONOCIMIENTOS Y 1. Tenerttuloenlacarreradeadministracin,contadoruequivalente.
EXPERIENCIAS: 2. Requieretenerconocimientos,porlomenosadquiridosenlaprctica,
en tcnicas de administracin general, contabilidad, ventas y
relaciones humanas, que son equivalentes a una carrera mnima de
cuatroaos.
3. Requiere saber ingls (80%), al menos para poder leer artculos de
intersquesepublicanenfolletosyrevistastcnicas.
4. Debe poseer una experiencia mnimade dos aos en las funciones y
actividades que se realicen en la empresa a efecto de desarrollar
eficazmentelaadministracingeneraldelamisma.

RESPONSABILIDAD 1. Es responsable en general de los resultados finales, favorables o


ENTRMITES: desfavorables de la empresa, para lo cual recibe plena autoridad de
decisin,limitadaporlaspolticas,normas,presupuestosyprogramas
anualesaprobadosporladireccingeneral.
2. Responde en particular del correcto desarrollo de todos los trmites
financieros.
3. Responder en particular de la buena conduccin de las relaciones
pblicas.
4. Es responsable de elaborar, fundamentar y presentar oportunamente
anteladireccingeneraltodaslassugerencias,problemas,etc.,enque
serequieralaintervencindelasupremaautoridad,enformadeque
puedantomarseeficazmentelasmedidasnecesarias.
5. Debe rendir informes por lo menos mensualmente a la direccin
general,concisos,perodetalmaneracompletosydocumentados,que
esta autoridad pueda conocer con detalle la posicin econmica,
financiera, en ventas, produccin, etc., de la empresa. Debe tener

232
preparadosparapresentarlosasolicituddelamismadireccin,datos
mscompletosydetallados.
6. Es responsable de exigir a los departamentos comercial y de
produccinelexactocumplimientodelosprogramasmnimosquese
les hayan sealado, as como de coordinar adecuadamente su
actuacin. Debe resolver los casos que no queden expresamente
comprendidos entrelas facultades encomendadas o los jefes de estos
departamentos.
RESPONSABILIDAD 1. Tienecontacto peridico con las empresas competidoras,a travs de
ENCONTACTOS: juntas que celebra con ellas, en las que se compromete a respetar
conveniosenmateriadeprecios.
2. Tiene contacto frecuente con funcionarios bancarios, a efecto de
gestionarprstamosydescontardocumentos.
3. Procuradaratencinadecuadaalcontactoconautoridades,aefectode
mantenerlasmejoresrelacionesposibles conlasmismas,ylograrde
estemodounasolucinrpidayfavorablealosasuntosquepresenta
anteellos.
4. Cuidadelaatencin debidaalcontactoquetieneconproveedores, y
clientesespeciales,parafinesdecompras,pagos,promocindeventas
yrelacionespblicas.
5. Tiene contacto con profesionistas, como abogados, notarios, tcnicos
en organizacin y ventas, etc., para la solucin eficaz de problemas
especialesquerequierenlaintervencinoportunadedichaspersonas.
6. Procuraatencinespecialaloscontactosqueocasionalmentetiene,al
fungir como representante de la empresa en eventos sociales,
culturales o de otra ndole, y al hacer las declaraciones a que haya
lugar.
AUTORIDAD: Normasgenerales.

Lecorrespondentegramenteentodaslasfunciones,niveles y camposde
la empresa, con excepcin de los que a continuacin se sealan, los
cualescorresponden,enrazndesutrascendenciaaldirectorgeneral:
Destinosfinalesdelaempresa.
Fijacindeobjetivosypolticasgenerales.
Aprobacindepresupuestosanualesomayoresdeunao.
Aplicacindelsupervitdelejercicio.
Erogacionesespecialesnoestipuladasenlospresupuestosaprobados.

233
Gestindecrditossuperioresaunmillndepesos.
Las dems limitaciones que resulten de este anlisis, de las polticas
generalesoqueexpresamentelesealeladireccingeneral.
Normalmentenoejercelaautoridadquehadelegado,sinoenloscasos
deexcepcinenqueestimeindispensablehacerlo.
Presupuestos.

1. Solicita del director general la aprobacin de los presupuestos anuales


relativosa:
1.1. Gastosdeproduccin.
1.2. Gastosdeventa.
1.3. Gastosdecompra.
1.4. Gastosdepublicidad.
1.5. Gastosgenerales.
2. Decide en la formulacin y aplicacin mensual de los presupuestos
aprobadosporeldirectorgeneral.
3. Autorizacualquiercambioenlaaplicacindedichospresupuestos.
4. Solicita autorizacin para cualquier gasto de carcter especial, no
estipulado, al menos globalmente, en los presupuestos aprobados por la
direccin.
Produccin.

1. Aprueba el programa de produccin mensual, basndose las sugerencias


del gerentede produccin y en lasnecesidades expresadaspor el gerente
deventas.Autorizacualquieramodificacinenelmismo.
2. Decide sobre la introduccin de nuevos sistemas de produccin, para
simplificar y reducir costos en la misma y obtener un aumento en el
rendimientodelasmquinas.
3. Decidelasmedidasqueconsideranecesariasparabajarloscostosdemano
de obra, materia prima y gastos indirectos de produccin, tomando en
cuentalassugerenciasquepresenteelgerente.
Ventas.

1. Cuida de que se establezcan y revisen peridicamente las polticas y


normas relativas a sistemas de ventas, canales de distribucin, sueldos y
comisionesaagentes,
2. Fija las metas del departamento comercial, basndose en los estudios de
mercadoyenlospronsticosdeventas.

234
3. Aprueba, o modifica el programa de ventas elaborado por el gerente del
departamentocorrespondiente.
4. Autorizaelmontoyformadeotorgarcrditos,descuentosybonificaciones
alosclientes.
5. Autoriza, en su caso, los proyectos de sistemas de pago y comisiones a
agentesygerentes,presentadosporelgerentecomercial.
6. Autorizalaformaytiempoderealizarlapublicidadypropaganda,dentro
delospresupuestosyprogramasaprobados.
Personal.

1. Tieneautoridadparaseleccionarycontrataralpersonalquevaaocuparlos
puestosnuevos.
2. Decidelossueldosqueconsideranecesariospagaralosempleados,dentro
delospresupuestosaprobados.
3. Autoriza aumentos de sueldos a los empleados, prestaciones, etc.,
atenindosealaspolticasfijadasporladireccin.
4. Delegaeladiestramientodelosnuevosempleadosalpersonalque,segn
sucriterioseamasadecuadoparaello.
5. Autorizalasvacacionesalpersonalbajosusrdenes,enlaformaytiempo
queconsideremsadecuados,enformadenointerrumpir,niretrasar,las
actividadesnormalesdelaempresa.
Costos.

Decide sobre las medidas que considere ms adecuadas para reducir los
costos originados en ventas, publicidad, produccin, salarios y horas
extras,gastosgenerales,etc.
Pagos.

1. Autoriza, en forma general o especial, el pago de las facturas y otros


documentospresentadosacobroenlaempresa.
2. Autoriza el pago de los impuestos causados, revisando previamente la
declaracinrelativa,elaboradaporelcontador.
Prstamos.

Gestiona prstamos especiales en los bancos, cuando se requieren para


cumplir o ampliar algn presupuesto, atenindose a las polticas
fijadasporladireccin.

235
PUESTO: SECRETARIA
UBICACIN: SociedadCooperativaTrabajadoresdePascual,S.C.L
Gerencias.
Oficinasdelaempresa.
Departamentos.
JEFEINMEDIATO: DirectorGeneral.
GerenteGeneral.
EMPLEADOS A SUS Mensajeros.
ORDENES:

ANALIZ:__________________________
REVIS:____________________________
AUTORIZ:_________________________

236
DESCRIPCINGENRICA.
Auxilia al jefe del departamento asignado tomando dictados, haciendo transcripciones mecanogrficas,
llevando el archivo, recibiendo personal y recados, contestando telfonos, coordinar la agenda de trabajo
consujefeasignado.

DESCRIPCINESPECFICA.
Servicios Contestacorrespondenciasencillaqueseleencomienda,copiaartculosoestudiosque
estenogrficos: selesealen,etc.
Utilizacopiadoraparaboletines,circulares,oficios,cartas,etc.,ordenadosporeljefey
entregaalmensajeroparaqueseanenviadosasudestinatario.
Despacha oportunamente la correspondencia revisando previamente direcciones y
franqueopostal.
Archivo: 1. Abre expedientes a cada uno de los clientes o proveedores segn sea el caso del
departamento y concentrar oportunamente en ellos todos los documentos
sealados.
2. Proporcionadeacuerdoconlasinstruccionesdeljefe,losexpedientesdelarchivo
que puedan requerir otros departamentos, anotando los documentos que se
extraigandelenformaespecialdecontrol.
3. Archiva la correspondencia del departamento, llevando minutario y registro del
mismo.
Comunicacin: 1. Atiendealaspersonasquesepresenteneneldepartamentopidindolessusdatos,
nombre,asunto,etc.,antesdepasarlasconeljefetomandosusrecadosenformas
especialesenloscasosdequestenopuedarecibirlosoestausente.
2. Atiende las llamadas telefnicas, tomando nota de los recados cuando su jefe no
puedecontestarlas,ycomunicaasteconlaspersonasqueleindique,acuyoefecto
mantendraldaeldirectoriodecontactosdeldepartamento.
Obligaciones 1. Realizacualquierotraactividaddeservicio,similaroconexa,encolaboracincon
generales: eljefedepersonal,oqueleencomendareste.
2. En su ausencia, cuida de recabar los acuerdos del gerente de la empresa en los
casosmsurgentesydevigilarqueseejecuten.

ESPECIFICACINDELPUESTO.

CONOCIMIENTOS Y 1. Secundaria como mnimo y dos aos de estudios comerciales que


EXPERIENCIAS: comprende secretariado, taquigrafa, mecanografa, gramtica,
correspondencia,documentacin,archivo.
2. ManejodecomputadoraOffice2000,programasbsicoscomoWord,
ExcelyPowerPoint.
3. Conocimiento de ingls de acuerdo al departamento en que se va a

237
desempearmnimo30%.
4. Experiencia mnima de 1 ao, que le permita precisin, limpieza y
rapidezenlosdictadosycapturadedocumentos.
5. Facilidad de palabra y trato directo con las personas que acudan al
departamentoyalcontestarllamadastelefnicas.
RESPONSABILIDAD 1. Es responsable de la presentacin de trabajos encomendados por el
ENTRMITES: jefe.
2. Turnaroportunamenteladocumentacinquesenecesiteentiempo y
forma.
3. Dar seguimiento a los trabajos pendientes que se tengan que realizar
eneldaregistrndolosenlaagendarespectiva.

ANALIZ:__________________________
REVIS:____________________________
AUTORIZ:_________________________

238
CONTRATOINDIVIDUALPORTIEMPODETERMINADO.

CONTRATOINDIVIDUALPORTIEMPODETERMINADO.
Celebrandoporunaparteporel(la)C.
Porsupropioderechoyporlaotra:SociedadCooperativaTrabajadoresdePascual,S.C.l.representadapor:
Esintencindelaspartesfacilitarlainterpretacindeestepacto,porloquehacenlassiguientes:
Declaraciones
I. Declarael(la)c.
Queenlosucesivoenelcuerpodeestecontratosedenominartrabajadorque:
a) Esoriginariode:
b) Naciel:
c) Denacionalidad:
d) Estadocivil:
e) Sexo:
f) Condomicilio:
II. DeclaralaSociedadCooperativaTrabajadoresdePascual,S.C.L.queenlosucesivoenelcuerpode
estecontratosedenominarpatrn,que:
A. Esunasociedadcooperativalimitada,debidamenteconstituidadeconformidadalasleyesmexicanas.
B. Quetienensudomicilioen:ClavijeroNo.75Col.TrnsitoDel.CuauhtmocC.P.06820Mxico,D.F.
C. Queentresusactividadesestn:
Envirtuddelodeclaradoyparaellogrodelasfinalidadesdelaspartes,proponenelcontratoindividualde
trabajoPORTIEMPODETERMINADO,losujetanaltenordelassiguientes:
CLAUSULAS
PRIMERA.Loscontratantessereconocenexpresamentelapersonalidadconqueseostentan,paratodoslos
efectoslegalesquehayanlugar.
SEGUNDA. El trabajador manifiesta bajo protesta de decir verdad, que tienen los conocimientos y
capacidades suficientes, as como la prctica e inters necesarios para el desempeo del trabajo que ha
solicitado.
TERCERA. El trabajador declara y manifiesta bajo protesta de decir verdad, que no trabaja, ni pretenda
trabajar, en tanto dure estarelacinlaboral, en otra empresa de igual giro comercial,ni servicio de entrega
rpida, nicamente en el rubro de ______. En caso contrario, el patrn queda facultado para dar por
rescindidoestecontratolaboral sinconsecuenciaslegalesparalaempresa.
CUARTA. El PATRN manifiesta por su parte, tener las facultades legales para obligarse, celebrando el
presentecontrato.
QUINTA.EstecontratosecelebraporTIEMPODETERMINADO y solopodrmodificarse,rescindirseo
terminarse,enloscasosestablecidosenlaLeyFederaldelTrabajo.
SEXTA. LaspartesacuerdanestablecerpormediodeesteContratounperiododepruebadeTREINTAdas,
duranteelcual,elPATRNpodrrescindirlosinresponsabilidadalguna.El TRABAJADORquedaobligado

239
asometersealaspruebasoexmenesnecesarios,duranteesteperiodo.Entrminosdelosestablecidoporla
FraccinIdelArtculo47delaLeyFederaldelTrabajo.
SEPTIMA.ELTRABAJADORseobligaaejecutarsutrabajopersonal,conlanecesidad,cuidadoyesmero
apropiados SEGN LAS NECESIDADES DE LA EMPRESA, bajo su direccin dependencia y
subordinacin,ascomocumplirlasordeneseinstruccionesquerecibaentodoloconcernientealtrabajoque,
precisamenteconsistircomo:
OCTAVA.ELTRABAJADORYELPATRNconvienenenqueestecuentaconlafacultaddecambiaral
TRABAJDORdelugaroactividad,siempreycuandoselerespetecategoraysalario.ElTRABAJADORse
comprometeaejecutarsuslaboreseneldomiciliodelaEmpresaoenaqueldondellegaraacambiarse,sise
tratadeunamismaEntidadFederativa.
NOVENA. La duracin de la jornada de trabajo ser de 8 horas de LUNES A SABADO (DA DE
DESCANSO VARIABLE). Queda expresamente facultado el PATRN. Para que de acuerdo con sus
necesidades cambie el horario, la jornada o el da de descanso semanal, previo aviso con una semana de
anticipacin,siendoestasujetasegnlacargadetrabajo.
DECIMA.Cuandolajornadadetrabajodebaprolongarseporcircunstanciasespeciales,elTRABAJADOR
se obliga a laborar tiempo extra en los trminos del Artculo 66 de la Ley Federal del Trabajo, en la
inteligencia que solo se considerarn y pagarn como horas extraordinarias las que exceden del tiempo
semanal pactado en este contrato y que hayan sido autorizadas en forma escrita por el PATRN o sus
representantes,yaqueentodosloscasosquedaexpresamenteprohibidoalTRABAJADORquelaboretiempo
extrasalvoquecuentenconpermisodelapersonaautorizada.
DCIMA PRIMERA. EL TRABAJADOR se obliga a checar tarjeta o a firmar las listas de asistencia
respectivasalaentradaysalidadesuslabores,enincumplimientodeesterequisitosecomputarcomofalta
injustificadaparatodoslosefectoslegalesaquehayalugar.
DCIMA SEGUNDA. EL PATRN se obliga por los servicios personales y subordinados del
TRABAJADOR, pagarla a este la cantidad MENSUAL DE $ 1,600.00 (UN MIL SEICIENTOS PESOS
00/100M.N.)
ElpagodelsalariosehareneldomiciliodelaEmpresalosdas15yltimodecadamesyenmonedadel
cursolegal.
DCIMATERCERA.Laspartesestarndeacuerdoyporlotantoconvienenqueenelsalarioestipuladoen
laClusulaqueantecede,seencuentraincluidoelpagocorrespondientealsptimoda.
DCIMACUARTA.ELTABAJADORtendrundadedescansoporcadaseisdetrabajo,convinindose
quedichodasercualquieradesignadoporlaDIRECCINGENERAL.
DCIMAQUINTA.Sondadedescansoobligatorio:el1deenero,5defebrero,21demarzo,1demayo,
16 de septiembre, 20 de noviembre, y el 11 de diciembre de cada seis aos, cuando corresponda a la
transmisindelpoderEjecutivofederalyel25dediciembre.

240
CONTRATODESERVICIOSPROFESIONALES.

CONTRATODEPRESTACIONDESERVICIOSPROFESIONALES.

CONTRATO DE PRESTACION DE SERVICIOS PROFESIONALES QUE CELEBRAN, POR UNA


PARTE SOCIEDAD COOPERATIVA TRABAJADORES DE PASCUAL, S.C.L A LA QUE EN LO
SUCESIVO SE LE DENMINARA LA EMPRESA, Y POR OTRA PARTE:
___________________________, A QUIEN EN LO SUCESIVO SE LE DENMINARA COMO EL
PROFESIONISTA, CONFORME AL TENOR DE LAS SIGUIENTES DECLARACIONES Y
CLAUSULAS:

DECLARACIONES:

Y.DECLARALAEMPRESA:

1. Que con fecha __________________ LA EMPRESA celebr con__________________ un contrato


para___________________________________________________.
2. Que requiere para la realizacin del contrato sealado en la declaracin anterior, los servicios de EL
PROFESIONISTAparallevaracabolasaccionesmateriadeestecontrato,consistentesen______________
_______________________________________________________________.
3.Quesealacomodomicilio,paraefectosdeestecontratoen____________________________________.
II. DECLARAELPROFESIONISTA:
1. Que cuenta con los conocimientos profesionales, tcnicos y la experiencia necesaria para realizar las
laborescontenidasenestecontrato.
2. Que ostenta ttulo de con nmero de cdula profesional, expedida por la Direccin General de
Profesiones, el da _______ del mes de _______________ de 19_____, documentos de los cuales exhibe,
originalesyanexafotocopiascomoparteintegrantedelpresentecontrato.
3.Serdenacionalidad________________yqueparaefectosdeestecontratosealacomosudomicilioel
ubicadoen______________________________________________________________.
4. Estar empadronado en el Registro Federal de Contribuyentes, bajo el nmero de registro exhibiendo el
originaldesucduladeidentificacinfiscalyanexandocopiadelamismacomoanexodelpresentecontrato.
Expuestoloanterior,laspartes secomprometenaloestablecidoenloquesecontieneenlassiguientes:
CLAUSULAS:

PRIMERA.ELPROFESIONISTAseobligaaprestaraLAEMPRESA,susserviciosprofesionalescon
elobjetoderealizarlasactividadesquedemaneraenunciativasemencionanacontinuacin:

241
SEGUNDA. EL PROFESIONISTA se obliga a desarrollar las actividades mencionadas en la clusula
primera con toda diligencia a efecto de dejar plenamente satisfecho a LA EMPRESA establecindose
comoparmetrosdecumplimientoypericialosqueregularmentesemanejanenelmercado,obligndosea
aportartodasuexperienciaycapacidad,dedicandotodoeltiempoqueseanecesarioparadarcumplimientoal
presentecontrato.

TERCERA. EL PROFESIONISTA, se obliga a informar a LA EMPRESA del estado que guarde su


labor,cuantasvecessearequeridoparaello,ascomoarendiruninformegeneralaltrminodelcontrato,y
no ceder los derechos y obligaciones derivados de este contrato sin consentimiento expreso de LA
EMPRESA.

CUARTA.Elpresentecontratoestarvigentedelda______delmesde_______de19___alda_____del
mesde_________de19_____.

QUINTA. EL PROFESIONISTA recibir por concepto de honorarios, la suma de $_________


distribuidos en percepciones mensuales de $_______________, de conformidad con los trminos que le
concedeLAEMPRESA,pararealizarestosservicios.

SEXTA.ELPROFESIONISTAconvieneenquelasremuneracionesquepercibaporlarealizacindelos
serviciosmateriadeestecontrato,sernnicas.

SEPTIMA. LAEMPRESAseobligaapagarloshonorariosdeELPROFESIONISTA,previaentregade
los recibos o comprobantes respectivos, los cuales debern reunir los requisitos fiscales que marca la
legislacinvigenteenlamateria.

OCTAVA.ELPROFESIONISTAaceptayconvienequeenelcasodeomitirelavisoydeclaracinpara
efectosfiscales,aqueserefierelaclusulaanterior,facultaaLAEMPRESAparaqueleretengalospagos
asufavor,hastaentantosecumplatalesomisionesfiscalesasucargocomocausante,enlostrminosdelas
leyesaplicables.

NOVENA. Concluidalavigenciadelpresentecontrato,nopodrhaberprrrogaautomticaporelsimple
transcursodeltiempoyterminarsinnecesidaddedarseavisoentrelaspartes.

DECIMA.ParaelcasodequeLAEMPRESA,tuvieranecesidaddecontarnuevamenteconlosservicios
deELPROFESIONISTA,serequerirlacelebracindeunnuevocontrato.

DECIMA PRIMERA. Queda expresamente convenido que cuando EL PROFESIONISTA, se apoye en


personalauxiliarenelejerciciodesusactividades,atendiendoeltrabajoqueseleencomienda,dichopersonal

242
depender exclusivamente de l, sin que se establezca ningn vnculo entre LA EMPRESA y el mismo,
quedandoacargodeELPROFESIONISTA, todaslasresponsabilidadesprovenientesdelautilizacinde
losserviciosdelpersonalqueleapoye,yquenoseapuestoasudisposicinporLAEMPRESA.

DECIMA SEGUNDA. El presente contrato podr darse por terminado a voluntad de cualquiera de los
contratantes,previoavisoquedalotrocondiezdasdeanticipacin,conelpropsitodequeduranteese
lapso haya posibilidad de concluir los trabajos pendientes y de que, en todo caso LA EMPRESA tenga
oportunidaddedesignaraquiensustituyaa ELPROFESIONISTA.

DECIMA TERCERA. Queda expresamente convenido que la falta de cumplimiento a cualquiera de las
obligaciones que aqu se contraen, y aquellas otras que dimanan del Cdigo Civil vigente para el Distrito
Federal,sermotivoderescisin delpresentecontrato, ygenerarelpagodelosdaos yperjuiciosqueel
incumplimientocausealacontrapartecumplida.

DECIMACUARTA.Paralainterpretacinycumplimientodelpresentecontrato,laspartessesometenala
jurisdiccinycompetenciadelostribunalesfederalesdelaCiudaddeMxico,DistritoFederal,ascomolas
disposiciones contenidas en el Cdigo Civil vigente para el Distrito Federal, renunciando expresamente al
fueroquepudieracorresponderlesenrazndesudomicilioactual ofuturo.

Ledoquefueelpresentecontratoyenteradaslaspartesdelcontenidoyalcancesdetodasycadaunadelas
clusulasqueenelmismoseprecisan,lofirmanporcuadruplicadolostestigoscuyosnombresydirecciones
constan al calce, en la Ciudad de Mxico, D.F. a los __________________del mes de
dedosmil________________.

LAEMPRESA.ELPROFESIONISTA.

243
CUESTIONARIODE CONTROLINTERNO.

GRANGYASOCIADOS,S.C.

CUESTIONARIODECONTROLINTERNOALREADECAPACITACINYDESARROLLO.

READECAPACITACINYDESARROLLO.

NOMBRE:DAMIANOSCARLPEZCASTRO.

CARGO:SUPERVISORDECAPACITACINYDESARROLLO.

FECHADEELABORACIN:9DEAGOSTODE2005DEAGOSTODE2005.

1.Sealesuspr incipalesfunciones,enrelacinconlaCapacitacinDesar r ollo.

Preparar el programa semestral de curso de acuerdo a las necesidades del personal y conforme al
presupuestoautorizadoyconsiderandolaopinindedichasreas.
ProporcionaralosGerentesloscuestionariosparadetectarlasnecesidades.
Eliminarlistadeparticipantesparaelcursodecapacitacin.
Inscribiralpersonalaloscursospormediodecdulasdeinscripcin.

2.Expliqueelpr ocedimientoparalaelabor acindelospr ogr amasSemestr alesdeCapacitacin.

SeenvaalasGerencias,loscuestionariosparaladeteccindenecesidadesdecurso.

ElGerentefirmaloscuestionariosylosdevuelveaestarea.

Seanalizayelaboraelprogramasemestraldecapacitacin.

ElSubdirectorAdministrativorecibeelProgramaSemestraldeCapacitacin.

Yaquefueautorizadaseenvaacadareaunejemplar.

244
3. Cundoseleinfor maalasr easdeloscur sosaimpar tir se?

SelesinformaalosGerentescon10dasdeanticipacin.

4. Concuantosdasdeanticipacinselesinfor maalosaspir antespar aeliniciodecadacur so?

Selesinformaunoodosdasantesaliniciarseelcurso,indicndoleelnombredelcurso,fecha
deinicioytermino,horariodelcurso,lugarenqueseefectuaryelnombredelainstitucin

5.Qusucedeconelper sonalquenoasisteasuscur sos?

SeconsideracomofaltayestareainformaralaGerenciadesuadscripcin.

6. Quinr egistr ala asistenciadelper sonalqueasistealoscur sos?

Elasistentedeestrea.

7. Cmoseevalanalosinstr uctor es?

Se aplica al personal que participe en los en los cursos de capacitacin, un cuestionario para
determinareldesempeodelosinstructoresqueimpartieronloscursos.Afindedecidirsison
consideradosparaocasionesposteriores.

8. Seleentregaalgnreconocimientoalper sonalqueasistealcur so?

SlaSubdireccinAdministrativa,porconductodelaGerenciadeRecursosHumanos.

9. Quinautor izalascdulasdeinscr ipcinaloscur sos?

ElSubdirectorAdministrativoeslanicapersonaquepuedeautorizarlascdulas.

10. Cmoselesinfor maalosempleadoslaasignacindesuscur sos?

Deformaverbal,pormediodesujefeinmediato.

11. Seelabor ancuestionar iosdedeteccindenecesidadesparalacapacitacindelper sonal?


No,seelaborancuestionariosporfaltadetiempo.

245
12. Existenalgnfondodestinadopar alaCapacitacinyDesarr ollo,yacuantoasciende?

Siasciendea150,000.00anuales.

13. Por quseautor izelPr ogr amadeCur sosfuer adetiempo?

Porcargadetrabajo.

PORGRANGYASOCIADOS,S.C. PORSOCIEDADCOOPERATIVADE
TRABAJ ADORESDEPASCUAL,S.C.L.

C.PNADIAMELOLOPEZ DAMINOSCARLPEZCASTRO
AUDITORINTERNO. SUPERVISORDECAPACITACIN.

246
CEDULAANALTICADELMANUALDECAPACITACINYDESARROLLO.

GRANGYASOCIADOS

ELABOR:ARP
SUPERVIS:DLC

EMPRESAAREVISAR:SOCIEDADCOOPERATIVATRABAJ ADORESDEPASCUAL,S.C.L.
TIPODEAUDITORIAOPERACIONAL.
ADMINISTRATIVACDULAANLITICADELMANUALDEPROCEDIMIENTODE
CAPACITACINYDESARROLLO.

OBJ ETIVO:

IdentificarlasPolticasyNormasdelManualdeProcedimientosdeCapacitacinyDesarrollodelPersonal.

DESARROLLO:

SesolicitoalSupervisordeCapacitacinelManualdeProcedimientodeCapacitacinyDesarrollo,para
identificarelobjetivo,susprincipalesPolticasyNormas.

RESULTADOS:

Delanlisisalmanualseidentificlosiguiente:

ElobjetivodelManualeselevarlosconocimientos,habilidadesadministrativas ytcnicasdelpersonalque
integralaSociedadCooperativaTrabajadoresdePascual,S.C.L.atravsdediversoscursosdecapacitacin,
paracontribuirasusuperacinyproporcionarunamayorproductividadeneldesarrollodelasfuncionesy
tareasquerealicenlasdecadarea.
Tratarqueelcolaboradordelaempresallegueasuautodesarrollo,recibiendoinstrumentoparamejorarsus
aptitudesyrendimientos,aportealtrabajoloquehaaprendido,incrementndoloconsucreatividaddeeste
modo se logra eliminar la resistencia a la innovacin (al cambio) y se evita el envejecimiento de los
conocimientos,quecadavezdebensermsactualizados.

247
POLTICAS:

LacapacitacinesunaresponsabilidadcompartidaporlosGerentesdeSociedadCooperativaTrabajadoresde
Pascual,S.C.L.Cadaunodeellosseobligaadetectarlapreparacinylaactualizacindesussubordinados,
facilitaeimpulsaelproceso de capacitaciny convertirseenelprincipalpromotordelaformacindelos
recursoshumanosasucargo.

Enelprogramasemestralseelaborarconbaseenladeteccindenecesidadesdecapacitacinydesarrollo
del personal de las diferentes reas de la empresa, misma que estar a cargo del rea de Capacitacin y
Desarrollo,conformealpresupuestoautorizadoyconsiderandolaopinindedichasreas.
Ladeteccindenecesidadesdecapacitacinseharmediantecuestionariosqueelaborarydistribuiralos
titularesdecadarea.

Loscursosdecapacitacinestarndiseadosespecficamenteparaincrementarlaproductividadymejorarlos
resultadosdelasreasconformealoscriteriosynormasqueestablezcanalrespecto.
Los cursos seminarios, conferencias, talleres y eventos requeridos para el desarrollo del personal de la
empresadebernserincluidospreferentementeenelProgramaSemestraldecapacitacinyparasudesarrollo
requierecontarconlaautorizacindelDirectorGeneral.

ElreadeCapacitacinyDesarrolloproporcionaracadaGerenciaunejemplardebidamenteautorizadodel
ProgramaSemestraldeCapacitacinyDesarrollo.
Cualquier curso, seminario, conferencia y evento que no est considerado en el programa semestral de
capacitacinydesarrollo,debercontarconlaautorizacinexpresadelSubdirectoradministrativo.

Elcupodelos cursosdecapacitacinserlimitado,afindeproporcionaraloscapacitadosunainstruccin
individualizadayejercerunmayorcontrolsobresuavance.
Elpersonalpropuestoparaacudiraloscursosdecapacitacindeberasistir,aellos,encasodenopresentarse
porcausasdefuerzamayorsetendrquejustificarlaausenciaplenamente.

NORMAS:

ELABORACINDELPROGRAMASEMESTRALDECAPACITACIN.

El rea de Capacitacin y Desarrollo serresponsable deelaborar el Programa Semestral de Capacitacin,


cuyosperiodosserndeeneroajunioydejulioadiciembre,elcualdeberturnarsealDirectorGeneraldela
empresaparasuautorizacinduranteelmesdediciembredelaoanteriorasuejecucinyduranteelmesde
juniodelaodeejecucin.

248
ElprogramaSemestraldeCapacitacindebercontenerlasiguienteinformacin:

Nombredelcurso.
Especificacindelpersonalalquevandirigidosloscursospornivel.
Laduracindecadacursototalizadoenhoras.
Sedesdecapacitacin.
Descripcingeneraldeloscursos.
Dasyhorariosenquehabrndeimpartirseloscursos.
Inscripciones.
Programacindeloscursos.
Programacinycontroldeparticipantes.

Para elaborar el Programa Semestral de Capacitacin, el rea de Capacitacin y Desarrollo enviar a las
GerenciaslosCuestionariosparalaDeteccindeNecesidades,unoporcadaGerencia,paraqueregistren
loscursosqueconsiderennecesariosparasupersonal.

PARTICIPACINDELPERSOANALEN CURSODECAPACITACIN.

El rea de Capacitacin y desarrollo deber informaralos gerentes con 10 das deanticipacin, acerca de
cualquier evento de capacitacin que este por efectuarse y los requisitos que deben cubrir los aspirantes,
Asimismo, les solicitar que enven dentro de los cinco das hbiles siguientes, las cdulas de inscripcin
debidamenterequisitazas,acompaadasdelarelacindecandidatosparaasistiradichocurso.

Todoempleadodeberasistiraloscursosdecapacitacinenqueestinscritoencasocontrariosuinstancia
seconsiderarcomofalta.

Elempleadonopodrfaltaralcursodecapacitacinenelquehayainscrito,salvoporcausasdefuerzamayor
yconladebidaautorizacindesujefeinmediatosuperior,quiendeberinformaroportunamenteyporescrito
alreadeCapacitacinyDesarrolloparaquetomenlasmedidasdelcaso.

249
CEDULAANALTICADEATRIBUTOSDELAINTEGRACINDEEXPEDIENTES.

GRANGYASOCIADOS

ELABOR:GGR
SUPERVIS:DLC

EMPRESAAREVISAR:SOCIEDADCOOPERATIVATRABAJ ADORESDEPASCUAL,S.C.L.
TIPODEAUDITORA:OPERACIONALADMINISTRATIVA.

OBJ ETIVO:

Verificarquelosexpedientesseencuentrenactualizados.

DESARROLLO:

Conobjetodeverificarquelosexpedientesseencuentrenactualizadossesolicitaron27expedientesparasu
revisin.

RESULTADOS:

NOMBRE:
1. AlfaroMuozJess.
2. BorisJimnezPedro.
3. FloresRazoMaraTeresa.
4. HernndezRosasM.DelRefugio.
5. MartnezPeaGonzalo.
6. NezSantosMiguelErnesto.
7. RuizOlivosArturo.
8. TaerHernndezLauraSilvia.
9. ArvizLpezYolanda.
10. EscobarHernndezNorma.
11. FajardoLunaAdriana.
12. GuzmnAcuaLorena.

250
13. MartnezMartnezJuanManuel.
14. GutirrezGarcaMa.Delosngeles.
15. RodrguezZamoraCsarMauricio.
16. SurezNavaVernicaElizabeth.
17. VargasLenMaradeJess.
18. AlmeidaSurezJavier.
19. EstradaTorradoLaura.
20. GarcaVzquezAlejandra.
21. ManjaresLauraMnica.
22. MartnezValdsAnaMara.
23. RamrezRosasHugo.
24. RamrezSernaRamn.
25. RosasLinaresIsrael.
26. SalgadoGutirrezBenjamn.
27. SantosOralesJosDaniel.

ATRIBUTOS.

1.ConstanciadeCurso.

CONCLUSIONES:

Seobservque8expedientesnoseencuentranactualizados.

DE:EXPEDIENTESDELOSEMPLEADOS.

___________Cumpleconatributos.

___________Nocumpleconatributo.

251
INFORME.

Mxico,D.F.a25deseptiembr edel2005.

SOCIEDADCOOPERATIVATRABAJ ADORESDEPASCUAL,S.C.L.
ATN:LIC.JORGEENSASTIGAN
GERENTEDERECURSOSHUMANOS.

En cumplimiento al Programa de Auditoria, se procedi a la revisin al departamento de RECURSOS


HUMANOS. El objetivo fue comprobar que el personal, realice las funciones encomendadas con apego a
polticasyprocedimientos,coadyuvandoalcumplimientodelosobjetivosdelaempresa.

ALCANCE.

Elpresente informe fue hecho conapego alasnormas deauditoriageneralmenteaceptadas en Mxico, se


examinolainformacindeldepartamentodeRecursos Humanos,conbaseenpruebasselectivas,utilizando
losprocedimientosdeauditoriaaplicablesencadacircunstancia,dentrodelosalcancesnecesariosparapoder
emitirelpresenteinforme.Elperododerevisinfuedel1demayoal28deagostode2005.

RESULTADO.

PROCESODERECLUTAMIENTOYSELECCIN:

Reviselcumplimientodelaspolticasenlosprocesosdereclutamientoyseleccindelpersonal.

Comprob la informacin que presentan los contratos colectivos y/o individuales de trabajo y estos se
encuentrandeacuerdoapolticasdelaempresa.

PROCESODENOMINA:
Verifiqueladecuadoregistrodelostrabajadores,losmovimientosafiliatoriosdealta,baja,modificaciones
desalarioliquidacionesdecuotasobreropatronalpresentadoanteelInstitutoMexicanodelSeguro Social.

252
Mecerciordequelaempresacuentaconlosregistrosnecesariosparacontrolarelnmerodedastrabajados
ylossalariospercibidosporsustrabajadores,salvoquedebeexistirunamejoradministracinenelcontrol
delosexpedientes.

PROCESODECAPACITACION:
Verifiqulaaplicacindepolticasenlosprogramasdecapacitacinencontrandoquelosfondosdestinados
paraesterubrosoninsuficientes.

El jefe de capacitacin nos inform que el presupuesto para el siguiente semestre aumentar en un 30%,
corrigiendoconestoelimpactoenelao.

PROCESODESEGURIDADEHIGIENE:
Revis el procedimiento de los manuales de Seguridad e Higiene encontrando que no cuentan con los
diagramasde flujos correspondientesderivadodeesto existeunamalaadministracindelosrecursospara
esterubro.

ElencargadodelreadeSeguridadeHigieneelaboraralabrevedadposiblelosdiagramasdeflujoytomar
lasmedidasnecesariasparaevitarqueafecteelpresupuestoylaadministracindelaempresa.

CONCLUSIN:
Por lo anteriormente expuesto y considerando la recurrencia con la que se dan este tipo de errores, es
necesarioquelaGerenciadeRecursosHumanosimplantemedidasquepermitandisminuirtalessituaciones.

Las observaciones anteriores, as como, otras de menor importancia, fueron comentadas con oportunidad y
estn siendo atendidas directamente por los jefes de personal de cada uno de los departamentos
correspondientes.

Atentamente:

C.P.CarlosRomeroRamos.

c.c.p.C.P.ManuelMorenoPrez DireccinGeneral.

253
CDULADEDEFICIENCIASDELDEPARTAMENTODERECLUTAMIENTOYSELECCIN.

GRANG YASOCIADOS,S.C.

TIPODEAUDITORIA: EMPRESAAREVISAR:
OperacionalAdministrativa SociedadCooperativaTrabajadoresde AUDITOR:RCH.
Pascual,S.C.L.
RUBRO:PROCESODERECLUTAMIENTOYSELECCIN.
OBJ ETIVO:Verificarquelosmediosutilizadosenelprocesodereclutamientoyseleccinseanlos
adecuadosyseencuentrendebidamenteaplicados.
ALCANCE: Se llevo acabo la revisin de los manuales de reclutamiento y seleccin, y se verific la
existenciadeperfilesdepuesto.
DESARROLLO: Seaplicuncuestionariogeneraldereclutamientoyseleccinyseverificlaexistencia
demanualesdelreclutamiento yseleccin,ascomo elprocedimientoenlautilizacindelosmismosla
existencia de perfiles predefinidos de puestos y de exmenes aplicados en proceso de reclutamiento y
seleccin.
RESULTADO:
1.SeaplicelcuestionariodecontrolinternoalGerentedeRecursosHumanoselcualnosinform
losmediosyprocedimientosqueseempleanparaelreclutamientoyseleccindepersonal,ynos
proporcion la documentacin que sustenta el perfil de puestos y copias de los contratos
utilizadosascomolosmanualesdereclutamientoyseleccin.

2.Severificqueelprocedimientoyseleccinsseapegaalaspolticasdedichosmanuales.

FUENTE DE INFORMACIN: Aplicacin de Cuestionario de Control Interno, supervisin a los


manuales, perfiles de puesto, y de los exmenes aplicados en el proceso de reclutamiento y seleccin
proporcionadosporelGerentedeRecursosHumanos.

ELABOR: REVIS:

C.P.RocoCamachoHernndez. C.P.NormaMartnezGutirrez.
AUDITOR. GERENTEDEAUDITORIA.

254
CDULADEDEFICIENCIASDELPROCESODEVERIFICACINFSICADECONTRATOS.

GRANGYASOCIADOS,S.C.

TIPODEAUDITORA: EMPRESAAREVISAR:
OperacionalAdministrativa. Sociedad Cooperativa Trabajadores de Pascual, AUDITOR:GGR
S.C.L.

RUBRO:PROCESODEVERIFICACINFSICADECONTRATOS.

OBJ ETIVO: Verificar que los contratos utilizados cumplan con los requisitos legales, investigar si
cuentanconlosdiferentestiposdeexmenesdefinidosparacadareayverificarqueelpersonalseaacorde
conelpuestoqueocupa.

ALCANCE: Sellevoacabolarevisinde68expedientesdelasdiferentesdepartamentos.

DESARROLLO: Seanalizaronloscontratosutilizados,yseverificaronlosexpedientesde68empleados

RESULTADO:
Severificqueelaspectolegaldeloscontratosseencuentracorrecto.
Secomprobquesexistendiferentestiposdeexmenesparaelprocesodereclutamientoyseleccin

Seobserv quelaempleadaM.DelosngelesMonroyCsalesconnmerodeempleado3425no
cuentaconelperfildepuestorequerido.

ELABOR: REVIS:

C.P.GuadalupeGonzlezRamrez. C.P.NormaMartnezGutirrez.
AUDITOR. GERENTEDEAUDITORA.

255
CDULADEDEFICIENCIASDELCONTROLDEMOVIMIENTOSAFILIATORIOS.

GRANGYASOCIADOS,S.C.

TIPODEAUDITORA: EMPRESAAREVISAR:
OperacionalAdministrativa Sociedad Cooperativa Trabajadores de Pascual, AUDITOR:GJO.
S.C.L.
.
RUBRO:CONTROLDECONTRATOSYMOVIMIENTOSAFILIATORIOSENELSISTEMA
DELIMSS.

OBJ ETIVO: Comprobarquelosexpedientescontengantodoslosdatosrequisitadosporlasempresas,y


quelosmovimientosafiliatoriosalIMSSestnpresentadosenformaytiempocorrectos.

ALCANCE:Serevisaronlosexpedientesde68empleadosdediferentesdepartamentos.
DESARROLLO: Se reviso cada una de los expedientes, verificando que estuvieran todos los datos
requeridos por la empresa, as como sus movimientos afiliatorios al IMSS sean correctos y
oportunosyseverificquienautorizalascontrataciones.
RESULTADO:
1.Se observ que la firma del contrato de la empleada M. De los ngeles Monroy Csales con
nmerodeempleado3425nocoincideconlasfirmasdesuAltaalIMSSydesuModificacin
deSalarioconlafirmadesucontratoeidentificacinoficial.
2.Se detect que dicho expediente no est autorizado por la persona indicada, la Subdirectora
Administrativa:RaquelManchaEspinosa.
3.Se observ verific que las fechas de altas y bajas si coinciden con las fechas checadas en las
tarjetas, y los movimientos de altas, bajas y modificaciones de salario s fueron presentados
oportunamente.
FUENTE DE INFORMACIN: Revisin de expedientes de los trabajadores de los diferentes
departamentos,proporcionadosporelGerentedeRecursosHumanos.
ELABOR: REVIS:

C.P.GabinodeJessOrtiz. C.P.NormaMartnezGutirrez.
AUDITOR. GERENTEDEAUDITORA.

256
CDULADEDEFICIENCIASDEARCHIVOSYDOCUMENTOSPOREMPLEADOS.

GRANG YASOCIADOS,S.C.

TIPODEAUDITORA: EMPRESAAREVISAR:
OperacionalAdministrativa Sociedad Cooperativa Trabajadores de Pascual, AUDITOR:NML
S.C.L.
RUBRO:ARCHIVODEDOCUMENTOSDEEMPLEADO.

OBJ ETIVO: Verificar que exista un control adecuado de los expedientes de los trabajadores y que
dichos expedientes cuenten con su documentacin completa e investigar quien administra estos
archivos.

ALCANCE:Serevisaronlosexpedientesde68trabajadoresdelosdiferentesdepartamentos.

DESARROLLO:Serevisocadaunodelosexpedientes,verificandoqueestuvierantodaladocumentacin
completayseinvestigquieneselencargadodeadministrardichosexpedientes.

RESULTADO:
Seobservqueelresponsabledearchivarlosexpedientes(MarthaMaraGarcaAguilar)notienelos
expedientesdebidamenteclasificados..

SeobservqueelexpedientedeM.DelosngelesMonroyCsalesconnmerodeempleado3425no
cuentanconladocumentacincompleta.

FUENTE DE INFORMACIN: Revisin de expedientes de los trabajadores, proporcionados por el


GerentedeRecursosHumanos.
ELABOR: REVIS:

C.P.NadiaMeloLpez. C.P.NormaMartnezGutirrez.
AUDITOR. GERENTEDEAUDITORA.

257
CDULA DE DEFICIENCIAS DEL DEPARTAMENTO DE CAPACITACIN Y DESARROLLO
DEPERSONAL.

GRANGYASOCIADOS,S.C.

TIPODEAUDITORA: EMPRESAAREVISAR:
OperacionalAdministrativa SociedadCooperativaTrabajadoresdePascual,S.C.L. AUDITOR:
ARP

RUBRO:CAPACITACINDELPERSONAL(PROGRAMASEMESTRALDE
CAPACITACIN).

OBJ ETIVO: Verificar si se elaboran Programas de Capacitacin y s existe algn fondo destinado al
mismo.

ALCANCE: Se analizo el Manual de Procedimiento para la Capacitacin y Desarrollo del Personal al


100%,asimismoseaplicuncuestionariodeControlInternoalSupervisordeCapacitacin.

DESARROLLO:
SesolicitpormediodeunaAtentaNotaalSupervisordeCapacitacinyDesarrollodePersonal,elManual
deProcedimientoparalaCapacitacinyDesarrollodePersonalparasuanlisis.

RESULTADO:

DelanlisisalManualseobservlosiguiente:
1. S, se elaboran Programas de Capacitacin y este se realiza semestralmente, del cual para nuestra
revisinseseleccionelmesdejuliocorrespondientealsegundosemestredelao2005,ysedetecto
quefue autorizado elmesdejulioynoelmesdejunio.

258
2. ElProgramaSemestraldeCapacitacinnoseelabordeacuerdoalanormatividadaplicable,yaqueno
seintegrlaespecificacindelpersonalalquevandirigidosloscursospornivelyladescripcin
generaldeloscursos.
3. Noseelaboraronloscuestionariosparaladeteccindenecesidadesdecapacitacindelpersonal,quese
estableceenelapartadodeNormasparalaElaboracindelProgramaSemestral.
4. PorotraparteseobservqueexisteunfondodestinadoparalaCapacitacindelPersonalqueasciende
a$150,000.00pesosanuales,elcualnoessuficiente.

FUENTEDEINFORMACIN:
v ManualdeProcedimientoparalaCapacitacinyDesarrollodelpersonal.
v ProgramaSemestraldeCapacitacin.
v CuestionariodeControlInterno.
v AuxiliaresdeMayor.

ELABOR: REVIS:

C.P.AlejandraReyesPlata. C.P.NormaMartnezGutirrez.
AUDITOR. ENCARGADODEAUDITORA.

259
CDULADEDEFICIENCIASDEASISTENCIAALOSCURSOSDECAPACITACIN.

GRANGYASOCIADOS,S.C.

TIPODEAUDITORA: EMPRESAAREVISAR:
Operacional SociedadCooperativaTrabajadoresde AUDITOR:GJO
Administrativa Pascual,S.C.L.

RUBRO:CONTROLDEASISTENCIADELPERSONALENLOSCURSOSDECAPACITACIN

OBJ ETIVO: Verificarcomosecontrolaalpersonalinscritoaloscursosycomoserealizaelprocesode


autorizacinparalainscripcinalosmismos.

ALCANCE:Serevisaronal100%laslistasdeasistenciadeloscursoscorrespondientesalmesdejuliode
2005,seanalizoelManualdeProcedimientosdeCapacitacinyDesarrolloyseaplicunCuestionariode
ControlInternoalSupervisordeCapacitacin.AsimismoserevisaronlasCedulasdeInscripcin,para
verificarqueestuvieranrequisitadasdeacuerdoaloestablecidoensuManual.

DESARROLLO: Conobjetodeverificarcomosecontrolaalpersonalqueasistealoscursosserevisaron
laslistasdeasistencias,proporcionadasporelreadeCapacitacinyDesarrollodelosmesesdelos
siguientescursosdelmesdejuliode2005.

CURSO FECHA HORARIO


Windows,WordyExcel2002 Del08al19dejulio 9:00a13:00hrs.
Mercadotecnia Del15al19dejulio 9:00a13:00hrs.
RelacionesHumanas Del08al12dejulio 9.00a13:00hrs.
Secotejaronlaslistasdeasistenciaquecontrolaelasistente deCapacitacinyDesarrollocontralastarjetas
deasistencia,paraverificarlaasistenciadelpersonalqueestainscritoenloscursosdecapacitacin.

260
FUENTESDEINFORMACIN:

ManualdeProcedimientosdelDepartamentodeCapacitacinyDesarrollo delPersonal.
Listadeasistencia.
CduladeInscripcinacurso.
CuestionariodeControlInterno.
Expedientedeempleados.

ELABOR: REVISO:

C.P.GabinodeJessOrtiz. C.P.NormaMartnezGutirrez.
AUDITOR. GERENTEDEAUDITORIA.

261
CEDULASDESEGUIMIENTO.

FechadeSolventacin: Depar tamento: Reclutamiento y


SeleccindePer sonal.

OBSERVACIN: SUGERENCIA:

1. En la revisin de expedientes personales por cada Se deber corroborar que la firma del
trabajador se observa que Ma. De los ngeles Monroy empleado coincida en todos sus
Csales con nmero de empleado 3425 no corresponde su documentos para evitar posibles
firma de todos sus documentos con el alta al IMSS y las contingenciaslaborales.
modificacionesdesalario.

FechadeSolventacin: Depar tamento:CapacitacinyDesarrollo


dePersonal.

OBSERVACIN: SUGERENCIA:

2.Enlalistadeasistenciadeldepartamentodecapacitacin El encargado del rea de Capacitacin y


noseencuentraregistradoelsiguientepersonal: Desarrollo deber aclararla situacina la
brevedad y en lo sucesivo cerciorarse del
personalqueasistealoscursos.
Nombr e Nmer o
Puesto

TaveraHernndezLaura1Secretaria
GarcaVzquezAlejandraIsela1Operador
T.
VargasLenMaradeJess1Supervisor

FechadeSolventacin: Depar tamento:Capacitaciny


Desar r ollodePer sonal.

262
OBSERVACIN: SUGERENCIA:

3. Se observ que existe un fondo destinado para la El encargado del rea de Capacitacin y
CapacitacindelPersonalqueasciendea$150,000.00pesos Desarrollo deber considerar costos reales
anuales,elcualnoessuficiente. paralaimparticindecursos,yanalizarla
posibilidad de que los cursos sean
nicamentedeactualizacin.

FechadeSolventacin: Depar tamento:Segur idadeHigiene.

OBSERVACIN: SUGERENCIA:

4. El manual de procedimientos del rea de Seguridad e El encargado del rea de Seguridad e


Higiene no cuenta con los diagramas de flujo Higiene deber elaborar ala brevedad los
correspondientes. diagramasdeflujocorrespondientes.

FechadeSolventacin: Depar tamento:Segur idadeHigiene.

OBSERVACIN: SUGERENCIA:

5.Comoresultadodelcotejodelosgastosefectuadospara Sedeberaclararlasituacinalabrevedad
elreadeseguridadehigienenoexisteconcordanciaconel posible y enlosucesivounmayorcontrol
equipoexistenteenlasreasderiesgo. en el ingreso de los artculos adquiridos
porlacompaa.

FechadeSolventacin: Depar tamento:Segur idadeHigiene.

OBSERVACIN: SUGERENCIA:

6.Alverificarquelosextintoresestnenbuenestadoyen El encargado del rea de seguridad e


lugares visibles, se observ que dichos equipos se higiene deber tener un mayor control y
encuentranenmalestadoyquelafechadecaducidadyaha vigilancia sobre la recarga de los
preescrito. extintores para evitar posibles
contingencias.

263
FechadeSolventacin: Depar tamento:Nmina

OBSERVACIN: SUGERENCIA:

7. Se observ que 27 empleados, al checar su tarjeta al Sedebertenermayorcontroldelpersonal


inicio de labores del da 24 de junio de 2005, no portaban queingresaalaempresa.
visualmentesugafete.

FechadeSolventacin: Depar tamento:Nmina

OBSERVACIN: SUGERENCIA:

8.Elempleado5876EstradaTorradoLaura,notienefirma
por la Gerencia de mercadotecnia por la autorizacin en la Eljefedepersonaldeberrecabarlafirma
horadesalidael15demayode2005yademssaliminutos deautorizacindelasalidaporpartedela
antesdelahoraestipuladaenelpermisodesalida. gerenciademercadotecnia.

FechadeSolventacin: Depar tamento:Nmina.

OBSERVACIN: SUGERENCIA:

9.Seencontraron3permisosdesalidadelda11yunodel Eljefedepersonaldeberrecabarlafirma
15demayode2005sinfirmaoVo. Bo.delDepartamento de autorizacin de salida por parte de la
dePersonalodelaGerenciadeRecursosHumanos,siendo gerencia.
lossiguientesempleados:

HernndezRosasMa.delRosario.
SalgadoGutirrezBenjamn.
RoblesMacasLaura.
VenegasPrezAndrs.
FechadeSolventacin: Depar tamento:Nmina.

OBSERVACIN: SUGERENCIA:

10.Sedetectquealgunosempleadosnotienenregistrados Eljefedepersonaldeberaclarartal
retardosdelperiodocomprendidodeMayoaJuliode2005, situacinyactualizarelreportede
enelreportedeincidenciasproporcionadoporlacompaa. incidenciasporelempleado.

264
FechadeSolventacin: Depar tamento:Nmina.

OBSERVACIN: SUGERENCIA:

11. Se detect que la Seorita Manjares Lara Mnica con El jefe de personal deber aclarar dicha
nmerodeempleado4556,nosepresentalaborarelda12 situacin y aplicar la sancin
de junio de 2005, sin que se considere en el reporte de correspondiente.
incidencias por empleado y tampoco se cuenta con
memorandodepermiso.

FechadeSolventacin: Depar tamento:Nmina

OBSERVACIN: SUGERENCIA:

12. No se encontr la incapacidad que ampare la El jefe de personal deber recabar la


inasistenciadeAlejandroFernndezTorres,connmerode incapacidadyencaso denohacerlodeber
empleado7584,porelperiodocomprendidodel17al20de descontarlosdascorrespondientes.
juliode2005,loscualesfueronefectivamentepagados.
FechadeSolventacin: Depar tamento:Nmina

OBSERVACIN: SUGERENCIA:

13.SedetectquealosempleadosMartnezMartnezJuan El jefe de personal deber actualizar el


Manuel con nmero 9898 y Ramrez Serna Ramn con reporte de incidencias por empleado y
nmero 3521 les fue pagado una prima dominical descontar las primas dominicales que
correspondiente al da 21 y 28 de julio de 2005, fueronpagadasenexceso.
respectivamente,loscualesnofueronlaborados.

FechadeSolventacin: Depar tamento:Nmina.

OBSERVACIN: SUGERENCIA:

14. Se detect que Surez Nava Vernica con nmero de El jefe de personal deber actualizar el
empleado 9642, le fue pagada solo una prima dominical, reporte de incidencias por empleado y
debiendoserdos,correspondientesalaprimeraquincenade pagarlaprimadominicalcorrespondiente.
mayode2005.

265
FechadeSolventacin: Depar tamento:Nmina.

OBSERVACIN: SUGERENCIA:

15. Se detect que los empleados Camera Hernndez El jefe de personal deber aclara dicha
Francisco con nmero de empleado 8131 y Pedroza situacin y descontar a los empleados los
Alvarado Julio con nmero de empleado 2654, solicitaron daspagadosenexceso.
permisodeundasingocedesueldo,correspondientesal11
de Junio y al 16 de Julio de 2005, respectivamente, los
cualesnofuerondescontadosdelanmina.

FechadeSolventacin: Depar tamento:Nmina.

OBSERVACIN: SUGERENCIA:

16. Se detect que el empleado Martnez Martnez Juan El jefe de personal deber aclarar dicha
ManuelfuecontratadoporlaCompaaelda18deJuniode situacinydescontaralempleadolosdas
2005,sinembargolefuepagadalaquincenacompleta. pagadosenexceso.

266
CONCLUSIONES.

De acuerdo al trabajo realizado, se observ que el control interno establecido en la Sociedad Cooperativa
Trabajadores de Pascual, S.C.L., contempla varios ciclos y cada uno de ellos deben de ser rigurosamente
vigiladosysupervisadosporlomenosunavezalao,porloquesellevaacabounaauditoriainterna,conel
propsitodeemitirunaopinin,ascomoelinformesobrecomoseestnllevandolosmanualespolticasy
procedimientosparaeficientardichosciclos.

De acuerdo al caso prctico efectuado en el rea de Recursos Humanos especficamente a las reas de
reclutamientoyseleccindepersonal,capacitacinydesarrollo,severificqueesunprocedimientoquese
debeseguirconformealametodologaqueestablecelasociedad.

Porloanteriorcabemencionarqueelcontrolinternoesuninstrumentoquesirvedebaseparapoderemitir
informes ycifrasconfiablesrespaldadosenpapelesdetrabajo,queserealizarondurantelaauditoriadando
como resultado la integridadfsica de los bienes, valores y activos, as como dificultar la colusin de
empleados,fraudes,robosetc.

TodavezqueladireccindeRecursosHumanosdelaSociedadCooperativadePascual,eslaresponsablede
vigilar el estricto cumplimiento de las disposiciones en materia de planeacin y desarrollo de los recursos
humanos,deberreforzarlosmecanismosquecoadyuvenaladecuadoaprovechamientodedichosrecursos,
informando al rgano interno de control de las medidas establecidas. Como resultado de la presente
investigacin,selogrconfirmarqueparalacooperativacomoparacualquierempresaelrecursohumanoes
sindudaunfactoresencialparaellogroyelcumplimientodelosobjetivosorganizacionales.

ParaellogrodeestosobjetivoseldepartamentodeRecursosHumanosincluyefuncionesoperacionalesyde
manejo de personal, tales funciones incluyen procesos como dotacin de personal, capacitar, remunerar y
asesoraraotrosdepartamentos.

Conloanteriorpodemosconcluirqueeldotaralaempresadepersonalcompetentees fundamentalparael
xitodeestaporlotantoeltrabajodesempeadoporeldepartamentodeRecursos Humanosrevistedeuna
granimportancia.

267
BIBLIOGRAFA.

1
Ley General de Sociedades Cooperativas, Mxico 2005, Editorial Talleres Grficos de la Cmara de
Diputados.

2
CERDARichar d,Baldomero ElRgimenCooperativo ,editorialUrgel,51BisBarcelona.

3
CERDA Y RICHART, Baldomero Administracin y Contabilidad de las entidades Cooperativas ,
EditorialUrgel,51BisBarcelona.

4
SANTILLAN, Gonzlez Juan Ramn Introduccin al Control Interno a travs de los ciclos de
Transacciones ,EditorialEcafsa.

5
PERDOMO,MorenoAbraham, FundamentosdeControlInterno, EditorialThomson,NovenaEdicin.

6
RUSENAS, Rubn Oscar Manual de Control Interno Editorial Ediciones Macchi, Buenos Aires
ArgentinaFebrero1999.

7
SCHUSTER,JosAlberto ControlInterno ,EditorialMacchi.

8
RODRGUEZ,ValenciaJoaqunAdministracinModernadePersonal,EditorialThomson,Sexta
Edicin.

268
SOCIEDAD COOPERATIVA DE TRABAJADORES DE PASCUAL S.C.L.
ORGANIGRAMA

ASAMBLEA

GENERAL

CONSEJO
DE
ADMINISTRACION

CONSEJO FONDOS COMISION COMISION DE COMISION


DE JURIDICO Y COMPRAS DE PREVISION CONCILIACION DE
VIGILANCIA VALORES SOCIAL Y ARBITRAJE EDUCACION

AUDITORIA SERVICIO

INTERNA MEDICO

CONSEJO COMISION
DE CONTROL
CONSULTIVO TECNICO

COORDINACION CONTABILIDAD COORDINACION COORDINACION COORDINACION COORDINACION COORDINACION COORDINACION


DE ADMON Y DE JUGOS DE DE DE VENTAS DE VENTAS DE
FINANZAS SUCURSALES OPERATIVA LOGISTICA MANUFACTURA LOCALES FORANEAS EXPORTACIONES

MANTENIMIENTO ALMACEN ENVASADO GERENCIA GERENCIA


CONTABILIDAD COSTOS CONCENTRADOS DE PLANTA DE VENTAS
AUTOMOTRIZ AUTOMOTRIZ CARTON SUR FORANEAS

CONTABILIDAD AREA CONTROL ALMACEN ENVASADO GERENCIA GERENCIA


PRESUPUESTOS DE DE PLANTA DE
GENERAL TECNICA CALIDAD MAQUINARIA BOTELLA NORTE MERCADOTECNIA

IMPUESTOS PLANTA 4 GERENCIA TRATAMIENTO ALMACEN GERENCIA ADMINISTRATIVO


Y PLANTA DE PLASTICOS DE DE
NORMATIVIDAD ADMINISTRATIVA NORTE AGUAS GENERAL AUTOSERVICIOS VENTAS

RECURSOS GERENCIA INVESTIGACION ALMACEN INGENIERIA ADMINISTRATIVO


FISCAL PLANTA Y DE MATERIAS Y DE
HUMANOS SUR DESARROLLO PRIMAS PROYECTOS VENTAS

AREA MANTENIMIENTO ALMACEN DE ENV. MANTENIMIENTO


INFORMATICA NORMATIVIDAD DE Y PRODUCTO Y
SERVICIOS SANITARIO TERMINADO MAQUINARIA

BODEGAS MANTENIMIENTO
LIQUIDACIONES ARCHIVO
PERIFERICAS TETRA

CREDITO PLANTA 4
Y COMEDOR
COBRANZA OPERACIONES

TRAFICO EMPAQUETADO
Y
INTERIOR EMBALAJE

MANTENIMIENTO
DE
EDIFICIOS

SEGURIDAD

PLANTA 3