Está en la página 1de 222

Acstica

y
Audiometra
por
Jos Miguel Boix y Palacin

Dr. en Ciencias Fsicas (UCM)


ptico Diplomado Universitario
(2. Promocin de la Esc. Univ. de ptica de Madrid)
Audiprotesista Titulado Oficial
(2. Promocin de la Esc. Tecn-Prof. del Clot [Barcelona])
Profesor Titular de Universidad del Departamento de ptica (UCM)
Organizador, Coordinador y Profesor
de los 3 Cursos de Ttulo Propio Diploma Certificado
en Acstica y Audiometra (UCM)
Acstica y audiometra

Jos Miguel Boix y Palacin

ISBN: 9788499480428

e-book v.1.0

ISBN edicin en Papel: 978-84-8454-990-1

Edita: Editorial Club Universitario. Telf.: 96 567 61 33


C/. Cottolengo, 25 San Vicente (Alicante)
www.ecu.fm

Maqueta y diseo: Gamma. Telf.: 965 67 19 87


C/. Cottolengo, 25 San Vicente (Alicante)
www.gamma.fm
gamma@gamma.fm

Reservados todos los derechos. Ni la totalidad ni parte de este libro puede


reproducirse o transmitirse por ningn procedimiento electrnico o mecnico, incluyendo
fotocopia, grabacin magntica o cualquier almacenamiento de informacin o siste ma
de reproduccin, sin permiso previo y por escrito de los titulares del Copyright.
Prlogo

Escribir unas lneas como prlogo del libro Acstica y Audiometra, del que
es autor el Dr. Jos Miguel Boix y Palacin, es, al tiempo, un placer y un honor.
Por un lado, por las caractersticas de este interesante libro, que comento con
ms detalle a continuacin, y, por otro, por la amplia formacin y actividad
profesional del autor.
Este magnfico libro resulta de gran utilidad para todos los estudiantes y
profesionales relacionados con la audicin desde todos los puntos de vista.
Sobre todo porque est presentado de una forma sencilla y clara, haciendo fcil
la adquisicin de conceptos con frecuencia complejos y difciles de aprehender.
Adems, se acompaa de un buen nmero de ilustraciones que facilitan la
comprensin de los conceptos difciles.
Los dos primeros captulos se dedican a presentar los conceptos bsicos
de la fsica de las ondas y, en concreto, las ondas elsticas y el sonido. Aqu
encuentra el lector un conjunto de conceptos imprescindibles para todo aquel
interesado en la fsica del sonido. En el apartado 2.3 se introduce, de forma
sencilla y asequible, el concepto de onda estacionaria, de gran inters en la
fisiologa auditiva.
Ya en el captulo 3 el autor entra de lleno en las definiciones y caracters-
ticas del sonido. En este captulo se utilizan de forma alternativa, como resulta
imprescindible, los conceptos fsicos del sonido como los psicoacsticos. As,
se comentan con acierto la amplitud o volumen del sonido y la intensidad,
magnitud fsica ntimamente relacionada a la anterior, la frecuencia, el tono
(pitch), el timbre y el tiempo o duracin del sonido. Culmina el captulo con
unos comentarios sobre el teorema de Fourier. Esta primera parte del captulo
3 encuentra su posterior desarrollo en los captulos 5 y 6. En ambos se tratan
temas tan acuciantes como las diferencias entre frecuencia y tono. En el 5 se

v
vi Prlogo

hace especial mencin de las curvas isofnicas o niveles de igual sonoridad. Un


pregunta interesante como son iguales los sones que los fones? Se responde
ampliamente en este captulo. Si hay un problema que suele llevar tiempo
explicar a los alumnos es el significado de la impedancia acstica y su relacin
con la estructura de odo medio, del que el autor comenta ampliamente su fun-
cin acopladora de impedancias acsticas.
Pero, aun habiendo avanzado hasta el captulo 6, debemos volver un ins-
tante a recordar el ltimo apartado del captulo 3, que habamos dejado atrs.
En este ltimo apartado del captulo 3 se presenta de forma clara y concisa
la diferencia entre ruidos y sonidos que es tan necesaria en Audiologa. Lo
referente al ruido, su importancia y variedades se ampla en el captulo 7, que
trata en profundidad todo lo relativo a la fsica de los ruidos, sus magnitudes,
los mtodos y equipos de medida (sonmetros). Culmina este captulo 7 con
algunas recomendaciones para proteccin frente al ruido y datos legislativos
muy tiles para estudiantes y profesionales.
El captulo 4 resulta fundamental para el estudiante, pero tambin para el
profesional, ya que frecuentemente se confunden las magnitudes y unidades
en las que se deben expresar los sonidos. A veces, sobre todo los jvenes estu-
diantes, desconocen cual es el origen de las magnitudes que se utilizan en
Acstica y Audiologa y ese desconocimiento les impide, por un lado, com-
prender con claridad muchos conceptos y, por otro, el desarrollo profesional
adecuado. Este captulo 4 se presenta con conceptos claros y asequibles, lo cual
resulta muy oportuno en una materia especialmente compleja y, desde luego,
difcil de retener para el que no es experto. La figura 25 es muy de resear
porque, adems de establecer la relacin en micropascales y decibelios que es
siempre de desear, sita al lector en diversos escenarios de la vida normal, adju-
dicndoles la intensidad sonora ms tpica para cada uno. La figura 27 tam-
bin es de un extraordinario inters para todo profesional relacionado con la
audicin porque, al definir el campo auditivo humano, presenta la sensibilidad
del receptor auditivo para caracteres apareados como son la intensidad y la fre-
cuencia. Este captulo 4 encuentra su complemento prctico adecuado en el
captulo 8. En efecto, en este el autor profundiza en los mtodos de medida y de
exploracin auditiva que, como fsico experto en acstica, trasmite a todos los
lectores las caractersticas de los diferentes equipos y mtodos que se utilizan en
la exploracin del sistema auditivo. El audimetro recibe un tratamiento muy
Prlogo vii

completo y en la Figura 53 se esquematizan las caractersticas de los circuitos


electrnicos de este equipo, imprescindible en la exploracin auditiva. Se com-
pleta el captulo con un amplio y completo apartado dedicado a los potenciales
evocados de tronco cerebral, sus mtodos, aplicaciones y resultados obtenidos.
La segunda parte del libro est dedicada a la Audiometra y sus aplicaciones
principales. Un primer captulo (el noveno del libro) se orienta hacia las genera-
lidades de la Audiometra, mientras que los dos captulos siguientes se orientan
a presentar conceptos y aplicaciones de la Audiometra Liminar y Supraliminar.
Un aspecto interesante que presenta el captulo 9 es el de comentar las caracte-
rsticas y diseo de cmaras sonoamortiguadas (como las denomina el autor)
necesarias para la exploracin audiomtrica o para la obtencin de potenciales
evocados auditivos. Un apartado relevante est destinado a explicar el enmas-
caramiento (Masking, en la terminologa inglesa) donde el autor presenta desde
el propio concepto de esta tcnica hasta su realizacin correcta y aplicaciones.
Por su parte el captulo 11 se dedica casi en exclusividad a estudiar el recluta-
miento, o Recruitment.
En los captulos 12 y 13 se presentan determinados aspectos de algunas
patologas auditivas desde el punto de vista del fsico y del profesional, de la
exploracin funcional del odo sin entrar por ello en el mbito de la clnica.
Estos dos captulos junto con el 14, destinado a conocer mejor cmo realizar
una exploracin funcional en nios, que tambin son muy tiles para comple-
mentar cualquier tratado de Otorrinolaringologa, porque presentan de forma
clara y sencilla aspectos prcticos de la fsica de estas lesiones y de la explora-
cin de los pacientes.
En el ltimo captulo, el autor presenta un resumen sucinto de los audfonos.
Desde la fsica a la electrnica este captulo hace un repaso necesario para el
estudioso y para el profesional sobre las caractersticas, tipos y aplicaciones de
estos aparatos tan eficaces en diversos tipos de hipoacusias. Un apartado se
dedica a las diferencias entre audfonos analgicos y digitales, hoy en da tan
necesaria para el profesional que ha de orientar una teraputica o evaluar las
mejores posibilidades para un paciente hipoacsico.
En resumen, puedo decir que se trata de un libro completo de lectura gil y
fcil comprensin de los problemas ms frecuentes de la acstica y la audiome-
tra. Se trata de un libro multidisciplinar que abarca desde los conceptos ms
bsicos de la fsica acstica a las aplicaciones ms cotidianas.
viii Prlogo

Para los estudiantes y profesionales de temas relacionados con la Audicin,


la obra que aqu se presenta tiene mucho que ofrecer. Estoy convencido que se
convertir pronto en un libro muy valorado y por ello, solo me resta concluir
estas lneas felicitando al autor por haber acometido y cumplido con xito este
complejo y difcil proyecto.

Madrid, 11 de febrero de 2011

Prof. Pablo Gil-Loyzaga


Catedrtico de Neurobiologa de la Audicin
Departamento de Oftalmologa y Otorrinolaringologa
Facultad de Medicina
Universidad Complutense de Madrid
Dedicado a mi esposa Seve por su infinita paciencia,
a mi hermano Manuel y a mis sobrinos Carlos y Alberto

ix
Introduccin

Este libro est dedicado a algo tan fundamental como es la Acustica que
estudia el sonido como fenmeno fsico y sus consecuencias, por ser su percep-
cin en todas las personas, salvo aquellos que tienen la enorme desgracia de nacer
anacsicos, que, a su vez, es causa y fundamento de la comunicacin hablada,
que nos eleva a la categora de seres humanos, as como a la Audiometra, rama
de la Audiologa, dedicada especficamente a la deteccin de las numerosas defi-
ciencias auditivas y su compensacin, mediante la adaptacin de audfonos, de
los ms sencillos analgicos a los ms complicados o digitales, aunque el estudio
de estos sea tema de la Tecnologa Protsica Auditiva, elemento que estudia-
remos ligeramente al final.

Pero, para llegar a dominar todas las tcnicas Audiopotesistas no podemos


olvidar los fundamentos fsicos que constituyen las ondas sonoras, porque es as
y no de otra manera, por qu y cmo estn constituidas estas particulares ondas.
De igual forma, podramos hacernos infinidad de preguntas que vamos a tratar
de explicar en los siguientes apartados de la forma ms completa y provechosa,
que pueda contribuir decisivamente en un perfeccionamiento de su formacin
como Audipotesista, profesor de estas temticas o alumno de las escuelas de esta
especialidad que ya han aparecido por el territorio espaol.

A todos ellos les deseo que este libro les sirva en grado sumo para completar,
ampliar y perfeccionar sus conocimientos de esta materia, en principio, tan
complicada, pero que con unos elementales conocimientos de Fsica General y
un estudio de los elementos contenidos aqu, puedan, sin problemas, comprender
y asimilar las causas fsicas y psquicas por las cuales se produce ese fenmeno
tan maravilloso que denominamos Audicin.

vii
ndice de captulos
Acstica
1. Movimientos peridicos. El Movimiento Vibratorio Armnico (MVA)
o Movimiento Armnico Simple (MAS). Generalidades: elongacin,
amplitud, ngulo de fase, desfase, periodo, frecuencia y pulsacin.
Espacio, velocidad y aceleracin en el MVA.
2. Introduccin a las Ondas Elsticas: El sonido. Las ondas elsticas: movi-
mientos ondulatorios. Ondas longitudinales y transversales: ondas
sonoras. Ondas Estacionarias. Ecuacin general del movimiento ondu-
latorio. Velocidad de las ondas longitudinales: velocidad del sonido. Su
relacin con la impedancia.
3. El sonido. Cualidades fsicas y psicofsicas: volumen y altura, inten-
sidad, frecuencia y tono, timbre, tiempo o duracin. Teorema de
Fourier: sonidos puros y sonidos complejos. Diferencias entre sonidos
y ruidos.
4. Magnitudes fsicas y psicofsicas: la ley de Weber - Fechner. Su ecuacin.
El Belio y el Decibelio (unidades). Unidades de presin fsica y su apli-
cacin en Acstica. Presin e intensidad sonoras. Potencia sonora.
Umbrales de percepcin de intensidad: umbral de audibilidad (mnimo)
y umbral de dolor (mximo). Valores intermedios como ejemplo de
sonidos normales. Otras unidades audiomtricas: decibelios SPL y
decibelios HL o HTL y su aplicacin a las nuevas grficas.
5. Diferencias y analogas entre frecuencia y tono; campo de audibilidad:
Representaciones grficas de intensidad en funcin de la frecuencia;
Campo de audibilidad: rea de la diccin. Niveles sonoros: curvas
isofnicas, o de igual sonoridad. Su unidad: Fon o Fonio, su valor ms
importante para la frecueucia de 1 KHz.
6. Estudio de las impedancias fsicas del odo: la impedancia fsica o
absoluta. El odo como acoplador de impedancias y su aplicacin a

01
02 ndice

las nuevas grficas. La impedancia relativa como medida del reflejo


timpnico.
7. Concepto de ruido. Fuentes de ruido. El ruido producido por equipos
industriales. Mtodos y equipos de medida. Soluciones o recursos
generales para la atenuacin y el control del ruido. Legislacin.
8. Mtodos de medida y cuantificacin auditiva. Acumetra. Pruebas de
Weber y Rinne. El audimetro. Su evolucin. Cmo est constituido,
grficas modernas de audiogramas. El mueco de Fowler. El impe-
dancimetro. Partes constitutivas y funcionamiento. Tipos de pruebas
o medidas que es posible efectuar. Pequea evolucin. Diagnstico de
hipoacusias cerebrales: potenciales evocados y sus mtodos.

Audiometra
9. Concepto de Audiometra. Su importancia y objetivos. Tipos de audio-
metras
10. Audiometra liminar: umbrales auditivos. Cmaras sonoamortiguadas.
El examen audiomtrico por va area. Examen audiomtrico por va sea.
Enmascaramiento (Masking): tipos de sonidos enmascarantes. Algunas
consideraciones fundamentales y tcnicas de audiometras liminares con
enmascaramiento. Masking en las pruebas verbales.
11. Audiometra Supraliminar. Qu es y cmo se produce el Recruiment.
Mtodos para su deteccin y medida: pruebas de Fowler, Lcher y de SISI.
Audiometra tonal.
12. Concepto de Trauma acstico. Sus tipos: de primer, segundo y tercer
grado. Su reflejo en la audiometra tonal. Fatiga auditiva: prueba de Peiser.
Audiometra vocal. Listas de palabras: Dr. Tato, etc. Sus grficas. Campo
libre. Tipos de audiometras ms generales: liminares y vocales.
13. Trastornos normales o ms frecuentes en la audiometra clnica.
Hipoacusias de transmisin. Hipoacusia de percepcin (sensorial o
neurosensorial). Hipoacusias mixtas. Audiometras en problemas del
odo medio. Afectaciones del odo interno, de las vas auditivas, y los
centrales.
14. Tcnicas para investigar las hipoacusias en nios: mtodos del neonato,
de Suzuki y Peep-Show. Garaje de Perell y otros. Mtodo de Screening.
ndice 03

Introduccin a la Audiprtesis
15. Qu es un audfono? Sus partes: el micrfono, el altavoz, el amplificador
y la batera. Sus clases. Anamnesis. Mtodos de adaptacin. Audfonos
analgicos y digitales. Mtodo informtico. Medidas acsticas a nivel
timpnico: medidas in situ e in vivo. Estado actual y futuro.
ACSTICA

Captulo 1

1.1) Movimientos peridicos: El Movimiento Vibratorio


Armnico (MVA) o Movimiento Armnico Simple (MAS).
Se denomina movimiento peridico a todo movimiento que, en intervalos de
WLHPSRLJXDOHVVHUHSLWHDVtPLVPRHQDPSOLWXGHV'HQLpQGRVHHQSULQFLSLR
como periodo T, a cada uno de estos intervalos iguales de tiempo (Fig.1). Los movi-
mientos regulares que no cumplen dicha condicin se denominan "aperidicos".
De entre todos los posibles movimientos peridicos, uno de los ms inte-
resantes es el denominado Movimiento Vibratorio Armnico, que vamos
a estudiar a continuacin (Fig. 2): supongamos un punto P, que se mueve
sobre un circunferencia de centro O y radio OP con movimiento uniforme:
Z cte. Entonces, si en cada instante proyectamos el punto P mvil sobre la
circunferencia, sobre el dimetro principal MN; el movimiento descrito por
su proyeccin (punto Q), sobre el citado dimetro, es lo que llamaremos, por
GHQLFLyQmovimiento vibratorio armnico.

1.2) Generalidades: elongacin, amplitud, ngulo de fase,


desfase, periodo, frecuencia y pulsacin.
Si observamos nuevamente la Fig. 2, antes de calcular la expresin mate-
mtica de la ley que cumple el MVA, hemos de considerar una serie de con-
FHSWRVRGHQLFLRQHVSUHYLDV
Para ello, supongamos que la posicin inicial del punto P se encuentra en M,
HVGHFLUSDUDW 3RUODGHQLFLyQIXQGDPHQWDOGHZel ngulo recorrido por
HOUDGLR23TXHIRUPDFRQRWURUDGLRMR20TXHWRPDPRVFRPRUHIHUHQFLDDO
cabo de un tiempo t, ser  W(1), y se denomina ngulo de fase.

1
Captulo 1

Fig. 1. (MHPSORGHPRYLPLHQWRSHULyGLFRQRDUPyQLFR

Entonces, la proyeccin de OP sobre MN, vale:

OQ OP cos q A cos Z t , (2)

Luego, si para representar la posicin del punto Q sobre MN tomamos como


origen de coordenadas el punto O, centro de la circunferencia, la abscisa x, res-
pecto a dicho origen, lo denominamos Elongacin del punto Q, y segn (2), ser:

x  OQ  A cos Zt , (3)

3RUWDQWRSRGHPRVGHQLUODHORQJDFLyQGHXQSXQWRJHQpULFR4FRPRla
distancia a la que se encuetra el citado punto Q, o mvil principal, en cada
LQVWDQWHGHRWURSXQWR2MR\RULJHQTXHVHKDOODHQHOFHQWURGHVXWUD-
yectoria, viene dado por la expresin anterior (3). Aqu hemos tomado como
valor mximo que puede tomar la elongacin: $  23  20* y es lo que
designamos con el nombre de Amplitud = Radio de la circunferencia auxiliar.
Volviendo a la Fig. 2, si cuando empezamos a contar el tiempo t0 = 0, este
radio KDEtD UHFRUULGR \D XQ FLHUWR iQJXOR  D HVWH iQJXOR LQLFLDO TXH QR
GHSHQGHGHOWLHPSRVLQRTXHHVMRVHOHGHQRPLQDdesfase o ngulo de fase
inicial, con lo cual la expresin completa de la elongacin, ser:

x A cos (Zt  G ), (4)

1RWD$TXtODVOHWUDVHQQHJULWDQRVLJQLFDTXHVHWUDWHGHYHFWRUHV

2
Captulo 1

Fig. 2. Esquema para explicar el origen del MVA.

pues, ahora el punto P, arranca de P0 en vez de desde M. Las elongaciones de


O hacia la derecha son positivas, y hacia la izquierda negativas, cualquiera
TXHVHDHOVHQWLGRGHDYDQFHGHOSXQWR43RUQHOUHFRUULGRWRWDOGHHVWH
punto, sobre el dimetro, ser M oO o N o O o M .
Se trata de un movimiento peridico, de iguales caractersticas en cuanto
al tiempo que el circular que le dio origen, ya que en cada vibracin completa
del movimiento armnico, le corresponde una revolucin completa del punto
P. Por tanto, se obtiene:

2
  2 f  . (5)
T

donde f es la frecuencia (nmero de vibraciones por unidad de tiempo), y se mide


en ciclos/seg, y T es el periodo (tiempo empleado en una vibracin completa)
del MVA considerado. A la velocidad angular Z del movimiento circular que
lo origin, se le denomina Pulsacin del movimiento armnico.

3
Captulo 1

 HSUHVHQWDFLyQJUiFDGHO(VSDFLR ), Velocidad ( . ) y Aceleracion (-------)


Fig. 3 5
de un MVA (las amplitudes mximas de las tres grficas estn representados al azar).

Fig. 4 Representacin del Espacio del MVA con un desfase inicial de G radianes.

4
Captulo 1

1.3) Espacio, velocidad y aceleracin en el MVA.


Siempre que estudiamos un movimiento, tenemos que tener en cuenta tres
factores el espacio recorrido, la velocidad y la aceleracin.
Del primer factor, la elongacin, ya tenemos su ecuacin (3), podemos
UHSUHVHQWDUODJUiFDPHQWHFRPRYHPRVHQOD)LJVXSRQLHQGRTXHQRH[LVWH
GHVIDVHLQLFLDO
Ahora ya estamos en condiciones de calcular la velocidad, en mdulo del
punto Q, sin ms que derivar la expresin (3):

dx
u Z Asen Z t u0 sen Z t , (6)
dt

TXHWDPELpQYLHQHUHSUHVHQWDGDHQOD)LJ6LQRVMDPRVHQODH[SUHVLyQ
anterior (6), vemos que, durante el tiempo en que la fase Zt est comprendida
entre 0 y S ODYHORFLGDGHVQHJDWLYDPRYLpQGRVHHOSXQWRGH0D1PLHQWUDV
que si S d Zt d 2S ODYHORFLGDGHVSRVLWLYDPRYLpQGRVHHOSXQWRGH1D0
Vamos a calcular ahora el valor de la aceleracin en mdulo, que, como
sabemos, se obtiene a partir de la expresin de la velocidad (6), sin ms que
derivar con respecto al tiempo:

du 2 2 4S 2
a Z Asen Zt Z x  2 x, (7 )
dt T

que nos dice: la aceleracin a que est sometido el punto Q, al describir el


movimiento armnico simple, es proporcional a la elongacin y de signo con-
trario a esta; es decir, siempre dirigida hacia el punto O.
O, recprocamente, esta propiedad es caracterstica del MVA, por lo que
WRGRPRYLPLHQWRHQHOTXHVHYHULTXH

con K>0,

5
Captulo 1

es un movimiento armnico simple, o MVA, y tiene como ecuacin una expre-


4S 2
sin anloga a la anterior (8), con K Z2 (9). En la Fig. 3 aparece una
T2
UHSUHVHQWDFLyQJUiFD de la elongacin x, la velocidad u y la aceleracin a,
para poder compararlas, siendo sus coordenadas en el origen: x0 = A, u0 = ZA,
y a0 = - AZ6LDKRUDTXLVLpUDPRVUHSUHVHQWDUSRUHMHPSORODHORQJDFLyQFRQ
una fase inicial Gobtendremos la Fig. 4, que es anloga a la vista en la Fig. 3,
pero toda desplazada un ngulo G inicial.

6
Captulo 2

2.1) Introduccin a las ondas elsticas. El sonido.


La mayor parte de nuestros conocimientos relativos a los fenmenos que
WLHQHQOXJDUHQHOPXQGRItVLFRVRQFDSWDGRVSRUQRVRWURVDWUDYpVGHODYLVWD
(|65 %) y por el odo (| 33 %), quedando lo restante para los otros sentidos.
Sin embargo, la informacin que llega a ellos, procedente de puntos distantes,
tarda un cierto tiempo en ser recibida; no vemos ni omos lo que sucede en el
preciso instante en que ocurre el evento, sino que percibimos algo que ocurri
en algn tiempo anterior.
Comencemos por el caso ms sencillo, el sonido, para el cual, las pertur-
baciones mecnicas, originadas en el foco sonoro, dan lugar a una serie de
alteraciones, asimismo mecnicas del medio material que nos separa del foco.
Dichas perturbaciones avanzan, por razones fsicas bien conocidas, como son
ODVIXHU]DVHOiVWLFDVGHFRKHVLyQHQWUHPROpFXODVFRQVWLWX\HQGRORTXHFRQR-
cemos como ondas sonorasTXHSXHGHQGHQLUVHFRPRmovimientos regu-
lares y sistemticos de las molculas del medio denso transmisor, que se
VXSHUSRQHQDORVPRYLPLHQWRVFDyWLFRVSURSLRVGHGLFKDVPROpFXODV\TXH
SURSDJiQGRVHDXQDGHWHUPLQDGDYHORFLGDGOOHJDQDORtGRdonde por otros
efectos mecanoacsticos y electrobioqumicos afectan a los nervios auditivos
del VIII par craneal, mediante los cuales llegan al cerebro, el cual nos da la
sensacin (o interpretacin) que denominamos sonido.
(QHOFDVRGHODYLVLyQQRHVWDQVHQFLOORORVIHQyPHQRVPHFiQLFRVHOpF-
WULFRVRWpUPLFRVSURGXFHQSHUWXUEDFLRQHVGHODVPROpFXODViWRPRVRHVWUXF-
turas electrnicas y, asociada a dicha perturbacin tiene lugar un transporte de
HQHUJtDen el espacio material o en el vaco, y cuando lo recibimos observamos
las caractersticas de un movimiento ondulatorio, es decir, se comporta como
una onda; por eso hablamos de ondas luminosas RQGDVHOHFWURPDJQpWLFDV 

7
Captulo 2

De todo lo anterior, podemos deducir que, para que exista un movimeinto


ondulatorio, es necesaria la existencia:
1.) De un foco emisor punto donde nace o se origina la pertubacin y/o
FDPELRHQODVFRQGLFLRQHVGHHTXLOLEULRGHXQGHWHUPLQDGRQ~PHURGHPROp-
culas, cambiando o variando su posicin inicial por medio de un estmulo que
SXHGHVHUPHFiQLFRWpUPLFRHOpFWULFRHWFHMHPSOROXJDUFRQXQHVWDQTXH
lleno de agua donde cae una piedra (Fig.5).

Fig. 5. (MHPSORWtSLFRGHPRYLPLHQWRRQGXODWRULRXRQGDSLHGUDODQ]DGDDXQODJR PRYL-


miento transversal). O representa el origen.

8
Captulo 2

Fig. 6. (MHPSOR GH PRYLPLHQWR WUDQVYHUVDO PRYLPLHQWR RQGXODWRULR FUHDGR DO PRYHU HO
SULPHUSpQGXORPDVLYRXQLGRDRWURVLGpQWLFRVSRUXQDVHULHGHPXHOOHVRUHVRUWHV

2.) La existencia de un medio denso, generalmente de tipo elstico, es


GHFLUWDOTXHVHVXSRQHIRUPDGRSRUXQFRQMXQWRGHSDUWtFXODVTXHHQWRGDV
direcciones se hallan en equilibrio y, a su vez, unidas por fuerzas de atraccin
y repulsin capaces de transmitir la perturbacin.
3.) Que la recepcin de la perturbacin se realice con un cierto retraso en
ORVGLIHUHQWHVSXQWRVXQSRFRDOHMDGRVGHOIRFRHPLVRUHVGHFLUTXHODWUDQV-
misin se realice con una velocidad QLWDPD\RUTXHFHURSHURQRLQQLWD OD
velocidad de la luz es muy grande, pero nunca f).
4.) Que lo que se transmita sea un WUDQVSRUWH GH HQHUJtD pero no de
materia, pues cada partcula transmite a sus vecinas parte de su energa, per-
maneciendo ella en su lugar (oscila sobre su posicin de equilibrio, pero sigue
conservando su posicin en el espacio) (Fig.5).
Por todo lo cual, el sonido VHSXHGHGHQLUEDMRGRVDVSHFWRVItVLFDPHQWH
FRPR XQD YLEUDFLyQ RQGXODWRULD TXH HV WUDQVPLWLGD SRU XQ JDV XLGR R
slido densos, procedente de un foco sonoro, productor de la perturbacin.
$VXYH]VREUHORVRUJDQLVPRVTXHSXHGHQSHUFLELUORVHSXHGHGHQLUFRPR
ODVHQVDFLyQRUJiQLFRSVtTXLFDTXHFDXVDGDSRUHVWDYLEUDFLyQ anterior, les
proporciona su cerebro.

  2QGDVHOiVWLFDVPRYLPLHQWRRQGXODWRULR
Supongamos que en un instante determinado y en un punto determinado se
produce un impacto, dando lugar a un desplazamiento de la posicin de equilibrio
de las partculas que ocupaban tal lugar (generalmente un movimiento vibra-
torio armnico), pero debido a las fuerzas de cohesin que existen entre ellas,
las partculas prximas son arrastradasFRPHQ]DQGRWDPELpQDGHVSOD]DUVH
siguiendo un movimiento del mismo tipo que el original, estas a sus vecinas y

9
Captulo 2

DVtVXFHVLYDPHQWHDXQPD\RUQ~PHURGHPROpFXODVHQFtUFXORVROtQHDUHFWD
cada vez mayores, hasta que se extingue por un fenmeno de amortiguacin.
(VWRHVGHELGRQRVRORDODVSpUGLGDVGHHQHUJtDSRUUR]DPLHQWRYLVFRVRHQWUH
las partculas (Fig. 5), sino que la energa que inicialmente posean un nmero
muy limitado de partculas (prximas al foco emisor) luego se extiende a un
Q~PHURPXFKRPD\RU(OHMHPSORPiVFDUDFWHUtVWLFRSLHGUDODQ]DGDHQXQODJR

Fig.7. Diagrama que muestra la propagacin del sonido como movimiento longitudinal, en el
primer semiperiodoFRQVXVGHSUHVLRQHVRGLODWDFLRQHV S \FRPSUHVLRQHV S 

Fig.8. 'LDJUDPDVHPHMDQWHDODQWHULRUal segundo semiperiodo, que muestra claramente,


comparado con el anterior, que donde haba una compresin ahora hay una dilata-
cin o enrarecimiento y viceversa.

10
Captulo 2

  2
 QGDVWUDVYHUVDOHV\ORQJLWXGLQDOHVRQGDVVRQRUDV2QGDV
estacionarias.
(QHOHMHPSORDQWHULRU )LJ HVFRQYHQLHQWHREVHUYDUTXHORVGHVSOD]D-
mientos de las partculas en un punto son perpendiculares a la direccin de
SURSDJDFLyQGDGRSRUHOUDGLRGHODFLUFXQIHUHQFLDTXHSDVDSRUpOSXHVFRPR
VDEHPRVRVFLODQKDFLDDUULED\KDFLDDEDMRSHURVLHPSUHSHUSHQGLFXODUHVDOD
VXSHUFLHGHOODJR2WURHMHPSORHVHOGHXQDVHULHGHSpQGXORVPDVLYRVTXH
FXHOJDQPHGLDQWHFXHUGDVQDVGHXQD]RQDVyOLGDHLQDPRYLEOHSHURHVWiQ
unidos entre s por una serie de muelles, y a cualquier desplazamiento que
demos al primero, todos los dems inmediatamente comienzan a oscilar pero
en direcciones perpendiculares al camino de la onda resultante (Fig. 6).
As, por tanto, decimos que una onda se denomina transversal cuando los
GHVSOD]DPLHQWRVVXIULGRVSRUODVSDUWtFXODVVRQGHGLUHFFLyQSHUSHQGLFXODUD
la direccin en que se propaga la perturbacin&RPRORVGRVHMHPSORVDQWH-
ULRUHVODVRQGDVHOHFWURPDJQpWLFDVODVYLEUDFLRQHVFRPXQLFDGDVDXQDFXHUGD
VXMHWDSRUXQH[WUHPRHWF+D\RWURWLSRGHRQGDVGHQRPLQDGDVlongitudinales,
HQODVFXDOHVHOPRYLPLHQWRGHODVSDUWtFXODVWLHQHODPLVPDGLUHFFLyQTXHOD
direccin del desplazamiento. 3RUHMHPSORODWUDVPLVLyQGHOVRQLGR
5HVXOWD XQ SRFR GLItFLO UHSUHVHQWDU JUiFDPHQWH XQD RQGD ORQJLWXGLQDO
pues para hacerlo (Fig.7 y 8), hay que suponer que los desplazamientos se
toman como positivos cuando ocurren en el sentido de la propagacin y nega-
tivos en caso contrario. Una vez construida la onda sinusoidal, donde las orde-
QDGDVUHSUHVHQWDQGHVSOD]DPLHQWRVHQHOVHQWLGRGHOHMHGHODV;VHREVHUYD
)LJ TXHSDUDXQLQVWDQWHGHWHUPLQDGRHQHOSXQWR%SRUHMHPSORWRGDV
ODVSDUWtFXODVYHFLQDVFRQFXUUHQDpO\HQFRQVHFXHQFLDKDEUiXQDconden-
sacin o compresin, TXHVHUHSUHVHQWDSRU'p, mientras que, en el mismo
instante, en el punto A, sucede todo lo contrario y se produce una depre-
sin o enrarecimiento. Al cabo de medio periodo (Fig. 8) las situaciones se
invierten, y donde haba compresin pasa a dilatacin y viceversa, como se
SXHGHREVHUYDUHQHVWDVHJXQGDJUiFD
6L DKRUD KDFHPRV FRLQFLGLU XQD JUiFD FRQ OD RWUD R VLPSOHPHQWH ODV
sobreponemos, los mximos de una coincidirn con los mnimos de la otra,
dando lugar a un tipo de onda especial denominada estacionaria, pues parece
que no avanza o cambia de posicin (Fig.9), y representa un tono puro (o nota
musical), con periodo y longitud de onda constantes.

11
Captulo 2

Fig. 9. 'LDJUDPDTXHUHSUHVHQWDJUiFDPHQWHDXQDRQGDHVWDFLRQDULD

Fig. 10. Diagrama similar al de la Fig. 5, pero con sus parmetros ms importantes.

2.4) Ecuacin general del movimiento ondulatorio.


Por medio de los conceptos vistos tanto en el caso de ondas longitudinales
como de ondas trasversales, el desplazamiento, o ms general, la perturba-
cin Y sufrida por cualquier partcula del medio (Fig. 10), depender de dos
factores: del tiempo y de su distancia al foco emisor o centro de origen de la
perturbacin. Dicha perturbacin puede ser: la elongacin del movimiento
YLEUDWRULR GH ODV SDUWtFXODV GHO PHGLR ODV YDULDFLRQHV GH SUHVLyQ GHO XLGR
GHODVRQGDVORQJLWXGLQDOHVRORVYDORUHVGHORVFDPSRVHOpFWULFR\PDJQpWLFR
GHODVRQGDVHOHFWURPDJQpWLFDVRFXDOTXLHURWUDPDJQLWXGUHODFLRQDGDFRQOD
deformacin local del medio en que se propaga la onda.

12
Captulo 2

3DUDFRQVHJXLUHOREMHWRGHOHStJUDIHHQTXHQRVHQFRQWUDPRVWRPHPRVHQ
la Fig.10, un punto cualquiera O como foco de la perturbacin, en el cual, por
el motivo que sea, aparece un movimiento vibratorio armnico, la elongacin
de este punto vendr dada por la ecuacin:

Yo ,t  Acos t, (10)

siendo A la amplitud mxima y Z la pulsacin. Por tanto, puedo escribir la


expresin anterior (10):
2
Yo ,t  Acos t , (11)
T
Ahora bien, lo que se trata no es de encontrar la ecuacin de la perturbacin
en el origen, sino en un punto P cualquiera, a una distancia x del origen. Como
VDEHPRVTXHODRQGDDYDQ]DFRQXQDYHORFLGDGUDGLDO FWHFX\RYDORUGHSHQ-
der del medio que se trate. Entonces, como este movimiento vibratorio arm-
nico se va repitiendo en todos los puntos, aunque con un cierto retraso, tanto
mayor cuanto ms grande sea x, ODDPSOLWXGTXHWHQGUiHQGLFKRSXQWRP : Yx, t
TXH VHUi OD PtVPD TXH WHQtD HO RULJHQ W  VHJXQGRV DQWHV VLHQGR W el
tiempo que tarda la onda en recorrer el espacio x de O a P. Entonces:

Fig. 11. Diagrama de una onda o movimiento ondulatorio, donde se muestra el parmetro
/RQJLWXGGH2QGD

13
Captulo 2

Fig. 12. 'LDJUDPDTXHPXHVWUDFyPRVHFRPSRUWDOD2QGDHQXQSXQWRMR\VXUHSUHVHQ-


tacin en funcin del tiempo o periodo T.

Vamos a estudiar ahora dos conceptos importantes: Longitud de onda y


Periodo del movimiento ondulatorio.
Sabemos que si en un instante determinado (MRHOWLHPSR), sacamos una
fotografa de la onda (Fig.11), entonces, a ODGLVWDQFLDPtQLPDHQWUHGRVSXQWRV
RSDUWtFXODVPiVSUy[LPDVTXHVHHQFXHQWUDQHQHOPLVPRHVWDGRGHYLEUDFLyQ
(o idntica fase),HVORTXHVHGHQHFRPRlongitud de onda: O Sin embargo,
VLDKRUDHQYH]GHMDUHOWLHPSRMDPRVHOHVSDFLR, es decir, nos situamos en
HOSXQWRMR3\REVHUYDPRVODSDUWtFXODFRUUHVSRQGLHQWHDHVHSXQWRYHUtDPRV
que dicha partcula se mueve as: (Fig.12 superior), es decir realiza un movi-
PLHQWRYLEUDWRULRDUPyQLFRFX\DUHSUHVHQWDFLyQVHREVHUYDHQODPLVPDJXUD
Pues bien, DOWLHPSRPtQLPRTXHWDUGDXQDSDUWtFXODHQUHDOL]DUXQDYLEUDFLyQ
completa es lo que se denomina Periodo del movimiento ondulatorio T.
Ahora bien, en este tipo de movimientos ambas variables estn relacio-
QDGDV tQWLPDPHQWH D WUDYpV GH OD YHORFLGDG GH RQGD que, como ya expli-
camos, depende de la naturaleza del medio, de su densidad y elasticidad; de
forma que, PLHQWUDVXQDSDUWtFXODUHDOL]DXQDYLEUDFLyQFRPSOHWD (tarda un
tiempo T. ), ODRQGDKDDYDQ]DGRXQDORQJLWXGGHRQGDOO sea:
O
O T , (13) o bien : O f, (14)
T
en donde es la frecuencia del movimiento, que sabemos es igual a la inversa

14
Captulo 2

del periodo, RVHDHVWDPELpQLJXDOal nmero de longitudes de onda que el


movimiento ondulatorio recorre en un segundo. 3RURWURODGRVHGHQHFRPR
Nmero de ondas o Nmero de propagacin

2S 2S Z
T , (15)
O TX X
Por tanto, la ltima expresin (12), se puede escribir:

Esta es ODH[SUHVLyQQDO o ms general de una onda o movimiento ondu-


latorioTXHDYDQ]DHQODGLUHFFLyQSRVLWLYD<TXHFRPR\DGLMLPRVHVdoble-
mente peridica en el tiempo, por el periodo T y en el espacio por la longitud
de onda O .

2.5) Velocidad de las ondas longitudinales: velocidad del sonido.


Su relacin con la impedancia.
La velocidad de las ondas longitudinales depender de las cualidades vibra-
torias del medio por donde se transmite. Laplace demostr que la velocidad de
propagacin de una onda en un slido vena dada por la expresin:
(
vc (17)
U

donde E es el Mdulo de Young\ODPDVDHVSHFtFD o densidad.


6LVHWUDWDGHXtGRV OtTXLGRVRJDVHV SRUHOKHFKRGHH[LVWLUHQVXLQWH-
rior dilataciones y compresiones, le llev a deducir:


v f  , (18)


Donde H es el Mdulo de Compresibilidad (esta magnitud y la anterior se


estudian en la parte de la Fsica denominada Elasticidad) y vale:

15
Captulo 2

dP
H , (19)
dV
V

donde dP es la variacin de presin a la que est sometido el elemento de


volumen dV, por unidad de volumen.
3DUDHOFDVRGHORVJDVHVFRPRHODLUHGHVSXpVGHYDULDVWHQWDWLYDVWHyULFR
H[SHULPHQWDOHVVHOOHJyQDOPHQWHDODFRQFOXVLyQGHTXHHVWDVGLODWDFLRQHV
y compresiones son muy rpidas, podra tratarse de un fenmeno adiabtico,
HVGHFLUHQHOTXHVHYHULFDdQ = 0 (aqu Q representa la cantidad de calor
emitida o absorbida en la transformacin). Por tanto, su ecuacin ser:

P.V cte (20) ,
siendo HOFRFLHQWHHQWUHHOFDORUHVSHFtFRDSUHVLyQFWH\HOFDORU
HVSHFtFRDYROXPHQFWHTXHSDUDORVJDVHVELDWyPLFRV FRPRHVHOR[tJHQR
y el nitrgeno) vale J 1.4
Entonces, si diferenciamos en (20); PV J 1dV  V J dP 0 ; de donde obte-
dP
nemos: P.J  H y substituyendo en (18):
dV
V

v' f = (21)

En la cual, sustituyendo los valores normales P0 = 106 dinas /cm2 |1 Atm.
Y U0 = 0.001293 gr /cm3, y para el valor dado, resulta el valor verdadero de
la velocidad del sonido en el aire, a 20: PVJ a.
Aunque aqu aparece la presin P, se puede demostrar que la velocidad de
un movimiento ondulatorio longitudinal en un gas es proporcional a : T **,
HLQGHSHQGLHQWHGHODSUHVLyQ(QHOFDVRGHORVOtTXLGRVWDPELpQSXHGHDSOL-
carse la frmula (18); siendo la densidad de estos mayor que la de los gases,

** Nota.- Aqu T representa la temperatura absoluta.

16
Captulo 2

parece que la v tendra que ser mucho menor, pero no ocurre esto debido a
TXHHO0yGXORGH&RPSUHVLELOLGDG, HVWDPELpQPD\RU
De hecho, la velocidad en los lquidos es mayor que en los gases. As, la
velocidad del sonido en el agua es cuatro veces mayor que en el aire. As, en
el aire a 0 Xo 331m / sg : A 20 ya ha aparecido arriba. En el agua, a 20:,
H O 1450m / sg . y en una varilla de acero: Xc 5100m / sg . Si consideramos
2
un campo de ondas planas (aquellas cuya intensidad es cte. en cualquier punto
del espacio), su Intensidad acstica (que, posteriormente, estudiaremos con
mas atencin) viene dada por:
Pe 2
Ip , (22)
ZA
Pmax
donde Pe , , es la denominada 3UHVLyQHFD](Nw / m2) y
2
Z A U.X, (23)
donde X es la velocidad de la onda en el medio, la expresin anterior (23) nos
proporciona el valor de la Impedancia acstica del medio, en este caso parti-
cular. As, para el caso del aire, a 20, su impedancia vale:
gr cm din.sg
Z a 1.2 u 103 3 .3.4 u 104
cm sg
41
cm3
> Rayls @.
Sin ms que recordar 1 Dina = 1 gr. cm/ sg2. Por otro lado, para el agua:

gr cm
Z H2 o 1 .15 u 104 150.000 Rayls. 6LHQGR5D\O DF~VWLFR
cm3 sg
Como puede observarse, hay una gran diferencia de una a otra, por tanto,
QXHVWURRtGRSDUDSRGHUWUDQVPLWLUHOVRQLGRKDEUiGHHMHUFHUDGHFXDGDPHQWH
como muy buen acoplador de impedancias, puesto que tiene aire fuera y
lquido dentro (odo interno).

17
Captulo 3

3.1) El sonido. Cualidades fsicas y psicofsicas: volumen y altura,


intensidad, frecuencia y tono, timbre, tiempo o duracin.
Para poder comprender estas cuatro cualidades o aspectos que podemos
FRQVLGHUDUHQHOVRQLGRKHPRVGHDSOLFDUOHXQDGREOHGHQLFLyQUHVXPHQGH
todo lo considerado anteriormente.
El sonido es ItVLFDPHQWH una vibracin o movimiento ondulatorio armnico
ORQJLWXGLQDOTXHVHWUDQVPLWHSRUXQJDVXLGRRPHGLRGHQVR VyOLGR SURFH-
dente de un foco inicial, productor y origen de esta perturbacin snica.
A su vez, pstquicamente, sobre los organismos biolgicos que pueden per-
cibirlo, VHSXHGHGHQLUFRPRODVHQVDFLyQRUJDQLFRSVtTXLFDFDXVDGDSRUOD
YLEUDFLyQItVLFDVRQRUD DQWHULRUPHQWHGHQLGD TXHOHVSURSRUFLRQDVXFHUHEUR
o sistema neurodetector3RUWDQWRGHQLUHPRVFRPRFXDOLGDGHVGHOVRQLGR
DDTXHOODVFDUDFWHUtVWLFDVPHMRUHVWXGLDGDV\FRQRFLGDVDWUDYpVGHODVFXDOHV
SRGHPRVFODVLFDURGHQLUXQVRQLGRGHVGHXQDVSHFWRSVtTXLFR
O sea, estas se pueden considerar desde un punto de vista ItVLFRpuro, inde-
SHQGLHQWHPHQWHGHOVXMHWRTXHYDDSHUFLELUHOVRQLGRRELHQGHVGHRWURSXQWR
de vista pstquico, estudiando las sensaciones que el sonido produce en una
PXHVWUD JUDQGH GH VXMHWRV R SHUVRQDV QRUPDOHV VREUH WRGR GHVGH VX IDFHWD
auditiva, y sacando luego valores medios o estndar.
$VtSXHVGHQLUHPRVHQSULPHUOXJDUla Amplitud o Volumen del sonido
como la mayor elongacin que puede alcanzar el movimiento ondulatorio
que representa la presin (o sobrepresin) que acompaa a toda onda sonora
)LJ $ODLPSUHVLyQVXEMHWLYDRVHQVDFLyQTXHSURGXFHHOYROXPHQVHGHQR-
mina Altura del sonido, y segn ella dividimos los sonidos en fuertes y dbiles
(Fig.14).

19
Captulo 3

Fig. 13. 5HSUHVHQWDFLyQJUiFDGHODDPSOLWXGRYROXPHQGHXQVRQLGR

Fig. 14. dem como comparacin de dos sonidos de igual frecuencia pero de distinto
volumen: sonido fuerte (P1 \VRQLGRGpELO 32).

20
Captulo 3

Otra magnitud fsica, que a veces se confunde con la anterior, pues est
relacionada con ella, es la denominada Intensidad en un punto, I, que, para
RQGDVHQPRYLPLHQWRVHGHQHFRPRODPDJQLWXGSURSRUFLRQDODOFXDGUDGR
de la amplitud o presin sonora mxima (Fig. 20):
1 T
I kP 2 max
T o
p.u.dt (24)

Segn esta ltima expresin, es el valor promediado en un periodo T, del


producto de la presin instantnea, p; el valor de la velocidad lineal de vibra-
cin de las partculas, u, para sonidos sinusoidales y en la direccin de vibra-
cin. Su unidad es Watt / m2 (esto lo aclararemos posteriormente).
Por otra parte, en el plano psquico, la intensidad o el volumen del sonido
produce una sensacin denominada Sona o Sonoridad (Loudness). Se mide
en Sones (esto lo trataremos ms ampliamente cuando hablemos de la Ley de
Weber - Fechner).

Fig. 15. &RPSDUDFLyQJUiFDGHGRVVRQLGRVGHGLVWLQWDIUHFXHQFLD8QVRQLGRJUDYH


(f 1 +] \RWURPiVDJXGR I 2 +] 

21
Captulo 3

Fig. 16. 5HSUHVHQWDFLyQJUiFDGHOD7RQDOLGDGR7RQRHQ0HOHQIXQFLyQGHODIUH-


FXHQFLDItVLFD HQ+] f.

Entendemos por Frecuencia ( f ) aquella PDJQLWXGItVLFDTXHQRVPLGHHO


nmero de vibraciones que el movimiento ondulatorio recorre en un periodo
\QXPpULFDPHQWHHVLJXDODODLQYHUVDGHOSHULRGR T 2WDPELpQel nmero
de periodos por segundo que posee una onda sonora.
3DUDFRPSUHQGHUPHMRUHVWRSRGHPRVSODQWHDUXQDVHQFLOODUHJODGHWUHV
En T s. ------------------------- 1 vibracin
En 1 s. -------------------------------- x

Entonces: x f, (25)
En Europa al ciclo/s. (consideramos que YLEUDFLyQ  FLFOR) se le deno-
mina HertzR+HUFLR DEUHYLDGR+] HQKRQRUGHOJUDQItVLFRDOHPDQ+HQULFK
+HUW]
La sensacin psquica que produce la frecuencia se denomina con tres nom-
bres: Tono, Tona o Tonalidad (3LWFK). Esta magnitud se mide en Mel (Fig. 16).
6L YROYHPRV DO FRQFHSWR ItVLFR SDUD VX PHMRU FRPSUHQVLyQ LPDJLQHPRV
un diapasn que pueda dar un sonido de 150 ciclos/sg. y otro con 800 ciclos
/sg, que aparecen representados en la Fig. 15. Al escuchar ambos sonidos el
primero nos sonar como un tono grave mientras que el segundo nos sonar
ms agudo. De esta forma, se puede hacer una divisin aproximada, diciendo
que para frecuencias comprendidas entre 20 y 1.000 ciclos/s nos proporcionan
tonos graves, para frecuencias comprendidas entre 1.000 y 3.000 ciclos/s

22
Captulo 3

Fig. 17. 5HSUHVHQWDFLyQJUiFDGHOVRQLGRFRPSOHMRPiVVHQFLOORHOIRUPDGRFRPRVXPDGH


DPSOLWXGHVSXQWRDSXQWRGHOVRQLGRIXQGDPHQWDOMXQWRFRQVXSULPHUDUPyQLFR

Fig. 18. Fotografa de un Analizador de Sonidos, en tiempo real.

23
Captulo 3

tonos medios (los que ms abundan en la zona conversacional) y entre 3.000 y


20.000 ciclos/s sern tonos agudos (el mximo que se percibe est entre 6.000
\+] 
La ley de dependencia entre la Tonalidad y la Frecuencia no es lineal. La
sensacin de una Octava (nombre que se le asigna al primer armnico y su
frecuencia es doble de la del sonido fundamental), no coincide en general
con la duplicacin de la frecuencia tomada como base. Para verlo ms claro
recurrimos a la Fig.16, en la cual se representa la sensacin frecuencial (Tono)
HQ0HOHQIXQFLyQGHOD)UHFXHQFLDItVLFD HQ+] (QHOODSXHGHREVHUYDUVH
SRUHMHPSORTXHSDUDXQVRQLGRGH+]OHFRUUHVSRQGHXQDVHQVDFLyQGH
PHO/DGLVFUHSDQFLDVHDFHQW~DHQODVDOWDV\EDMDVIUHFXHQFLDV3DUHFH
ser que la OH\TXHGHWHUPLQDODWRQtDHVDSUR[LPDGDPHQWHODPLVPDOH\GH
distribucin de los puntos de mxima excitacin de la membrana Basilar
para cada frecuencia, y que en casos anmalos puede ser diferente para cada
odo en la misma persona (diploacusia).
Otra cualidad importante en el TimbreHVODFXDOLGDGVXEMHWLYDTXHSHU-
mite distinguir dos sonidos de igual intensidad y frecuencia emitidos por dos
focos sonoros diferentes. Gracias al Timbre (fsico y psquico) podemos dis-
tinguir perfectamente un Do de piano de un Do de violn.
Esto es debido a que, generalmente, la misma nota musical emitida por
dos instrumentos con igual intensidad y frecuencia, podamos distinguirlos
perfectamente, por el hecho de que estn dotados de diferentes armnicos u
RQGDV VHFXQGDULDV 0iV WDUGH YHUHPRV TXH XQD RQGD FRPSOHMD FRPSXHVWD
de este tipo de ondas, puede descomponerse en sus componentes puros
mediante el Anlisis de Fourier (vese Fig. 17). Pueden visualizarse mediante
un Analizador de Sonido en tiempo real. Tal estudio se conoce como Anlisis
GHO(VSHFWURVRQRUR\WLHQHPXFKRLQWHUpVHQFDVRVGHHVWXGLRVDXGLRPpWULFRV
o entrenamiento auditivo (Fig. 18).
3RUQOD~OWLPDFXDOLGDGDHVWXGLDUHVel Tiempo o Duracin (o Periodo T
ItVLFDPHQWH VHGHQHFRPRHOWLHPSRHQVHJXQGRVTXHWDUGDXQDSDUWtFXODGHO
medio en dar una oscilacin completa, o tambin el tiempo que emplea una
onda sonora en avanzar un espacio igual a una longitud de onda O (Fig. 19).
As, podemos decir que nuestro odo es muy verstil y sensible, pues puede per-
cibir (en la media general) duraciones de sonidos de 1/100 s hasta 1/8.000 s.
Por otro lado, el umbral de persistencia de un sonido o tiempo mnimo que

24
Captulo 3

necesita para discriminar dos sonidos consecutivos es de 50 ms = 0,05 s, mien-


WUDVTXHHOXPEUDOGHODUHWLQDGHORMRHVGHVORTXHKDFHTXHHOFLQHOR
veamos como movimientos continuos, cuando, en realidad, son una sucesin
de fotos estticas que cambian en un tiempo menor que este y por inercia visual
engaamos al cerebro, dndole una sensacin de continuidad donde realmente
hay una serie de movimientos tipo "Charlot" pero muy rpidos.

3.2) Teorema de Fourier. Sonidos puros y sonidos complejos.


El enunciado de este Teorema: Todo movimiento peridico, no armnico
RFRPSOHMR SXHGHGHVFRPSRQHUVHHQXQDVXPDGHPRYLPLHQWRVDUPyQLFRV
puros, cuyas frecuencias son multiplos de la correspondiente al fundamental
(o sonido puro), segn una serie de nmeros naturales )LJ (QHVWDJXUD
solo aparecen el sonido fundamental y el 1.er armnico para mayor simpli-
cidad, pero se podran representar cualquier sonido por muchos armnicos
que contenga.
Matemticamente, se expresan:
Y a0 cos Z 0t  a1 cos Z1t  a2 cos Z 2t  .......an cos Z n t , (26)
GRQGH1 f1  f0  02 f2  f0  0

 3 f3  f0  0  n  Q 0.

v 

Fig. 19. Representacin del periodo de un sonido puro.

25
Captulo 3

Fig. 20. 'LDJUDPDTXHSUHVHQWDODH[SDQVLyQGHXQDRQGDHVIpULFDGHVRQLGRDSDUWLUGH


un foco F y la representacin de la intensidad (que no es un vector).

Estos movimientos acompaantes se denominan armnicos de 1., 2....


HQpVLPD FODVH FX\DV IUHFXHQFLDV VRQ P~OWLSORV GH OD IXQGDPHQWDO HQ ORV
VRQLGRVPXVLFDOHVFRPRDFDEDPRVGHYHU\VRQORVTXHGHQHQHO7LPEUH
del sonido.

3.3) Diferencias entre sonidos y ruidos.


'HQLUHPRV FRPR sonido a aquel movimiento ondulatorio, de carcter
peridico, que por complicado que sea, puede descomponerse segn el
Teorema de Fourier y que posee una cierta cadencia y sonoridad que lo hacen
ms o menos agradable al odo humano. Mientras que por ruido consideramos
movimientos ondulatorios aperidicos, anrquicos y rpidamente cambiantes,
sin cadencia o sonoridad que suelen ser estridentes y en general desagrada-
EOHVDORtGRWDOHVFRPRFKLUULGRVVLOELGRVPX\LQWHQVRVFUXMLGRVTXHDYHFHV
nos producen una resonancia en los dientes al escribir en una pizarra, lo que
se conoce vulgarmente como "dentera".

26
Captulo 4

4.1) Magnitudes fsicas y psicofsicas: Ley de Weber - Fechner:


su ecuacin. El Belio y el Decibelio (unidades).
Como ya estudiamos anteriormente, las caractersticas fsicas del sonido
tienen sus respectivas impresiones psquicas que nos dan la sensacin cere-
bral de sonido. Es fcil comprobar que no existe una proporcionalidad lineal
entre la intensidad fsica, medida en Watt / cm2 de un sonido que llega al odo
y la sensacin sonora que produce y que hasta ahora hemos designado por
Altura (o Intensidad Fisiolgica), pero a partir de aqu la vamos a designar
PiV FLHQWtFDPHQWH FRPR Sonoridad (en Fones). (Cuando estudiemos los
Isfonos o curvas Isofnicas veremos que nicamente solo la Intensidad
)tVLFD [en decibelios] coincide con la Sonoridad [en Fones] a la frecuencia
GH+] $VtSRUHMHPSORGRVIRFRVVRQRURVLGpQWLFRVDFWXDQGRVLPXO-
tneamente no producen una sensacin doble que uno solo. Esto es debido a
que la Sensacin sonora o Sonoridad obedece a la /H\SVLFRItVLFDGH:HEHU
)HFKQHU cuyo enunciado es: La sensacin producida por la intensidad sonora
o Sonoridad es una funcin lineal del logaritmo de la excitacin, o, en otras
palabras, La sonoridad crece en progresin aritmtica, cuando la excitacin
ORKDFHHQSURJUHVLyQJHRPpWULFD. Es decir, S K log I  K c, donde K y K
son dos constantes que dependen de la escala adoptada convencionalmente
(por un convenio o convencin), para asignar un valor dado a cada sensacin.
As, si atribumos un valor nulo S = O a la sensacin que corresponde a un
valor Umbral de Intensidad, es decir, Io que se trata de un valor tal, que un
LQQLWpVLPR SRU GHEDMR GH pO QR VH R\H QDGD (V GHFLU O K log I o  K c;
K c  K log I o, luego sustituyendo arriba resulta:
I
S K log I  K log I o K (log I  log I o ) K log , (27)
Io

27
Captulo 4

/DLQWHQVLGDGGHOVRQLGRHQHOXPEUDOGHDXGLFLyQSDUDXQDQRWDGH+]VHWRPD
como 10-12 Watts/m2. La relacin de intensidad de sonido expresa cuntas veces es mayor
la intensidad de un sonido dado, en comparacin con el valor umbral.

Fig. 21. Tabla conteniendo sonidos normales, exceptuando sus extremos, as como sus
YDORUHVHQLQWHQVLGDG TXHFUHFHQHQSURJUHVLyQJHRPpWULFDGHUD]yQ\VXV
YDORUHVGH6HQG $ TXHFUHFHQHQSURJUHVLyQDULWPpWLFDGHLGpQWLFDUD]yQ 

28
Captulo 4

Io efectivamente existe y corresponde a un valor standart de 10-16 Watt/


cm2, designndose con el nombre de Intensidad Umbral o8PEUDOPtQLPRGH
Audicin D+]  (QOD)LJVHLOXVWUDQDPERVFRQMXQWRVGHYDORUHV
I
\ORVFRUUHVSRQGLHQWHVGH6HQG $ 
Io
Si en la frmula anterior (27) hacemos K=1, obtenemos una escala de sensa-
ciones sonoras cuya unidad es SL %HOLR WDPELpQOODPDGR%HOOHQKRQRU al
I
famoso Fsico), lo que se deduce de la citada expresin anterior, = 10 y, por
Io
tanto: IL = 10 I0 ya que como sabemos log 10 = 1, y por consiguiente, ser la sen-
sacin sonora cuya intensidad fsica es igual a 10 veces el valor umbral. A esta
unidad de medida de Sonoridades se le denomina Bell o Belio. Pero esta unidad,
en la prctica resulta ser demasiado grande, ya que el umbral diferencial de audi-
cin (incremento mnimo de excitacin para diferenciar dos sonidos consecutivos),
1Belio
HVLJXDODVXGpFLPDSDUWHG = = 1 decibelio. Tanto el belio como el
10
decibelio no tienen dimensin fsica [S = 1], igual que el Radin. Entonces:
I
S ( Belio) log , (27)'
Io
si queremos expresar esta ecuacin en Decibelios (dF):
S ( d E) I I
log sea: SS (d E) 10 log
, o sea (28)
10 Io Io
(VGHFLUKXELpUDPRVREWHQLGRHOPLVPRUHVXOWDGRVLHQODH[SUHVLyQSULPL-
WLYD  KXELpUDPRVVXVWLWXLGR. GLUHFWDPHQWH\DTXH%HOO G.
3DUD WUDWDU GH FRPSUHQGHU HVWR XQ SRFR PHMRU YDPRV D DSOLFDUOR D XQ
HMHPSORUHDOYDPRVDSDVDUHOXPEUDOGHGRORU D+] HTXLYDOHQWHDXQD
Watt a su valor en decibelios (d :
I D 2.5 u 10 3 ,
c m2
2.510 3
Ss ( Belios ) log 16
log 2.51013 log 251012
10

log 25  12 1.4  12 13.4 Belios 134dE

29
Captulo 4

  8QLGDGHVGH3UHVLyQItVLFD\VXDSOLFDFLyQDOD$F~VWLFD
'HWRGRVHVFRQRFLGRTXHODSUHVLyQVHGHQHSRUODIXHU]DHMHUFLGDVREUH
ODXQLGDGGHVXSHUFLH3 )6
En el sistema CGS: 1 Baria = 1 dina/cm2. Como se trataba de una unidad de
pequea cuanta se cre 1 Bar = 106 barias. Por tanto, 1 milibar = 103 barias.
En el sistema MKS o Giorgi: 1 Pascal = 1Nw/m2. Por lo que resulta:
3DVFDO EDULDV2WDPELpQPEDU 3DVFDOHV +SDV
(QHOVLVWHPDWpFQLFR RWHUUHVWUH .SP 2 = 9,8 Pascales = 98 barias.
7DPELpQ QRUPDOPHQWH VH HPSOHDQ RWUDV XQLGDGHV TXH QR SHUWHQHFHQ D
ningn sistema. As, tenemos:
1Kp/cm2 = 9,8 105 barias = 9,8 1043DVFDOHVPP+J 7RUU EDULDV
1Atm = 760 Torr = 1013,25 milibares. En la prctica, se toma aproximada-
mente: 1 Atm| 1 Bar|1 Kp/cm2.
&RQHOPDQHMRGHHVWDVXQLGDGHV\DHVPX\Icil pasar a la presin sonora
umbral: P0 = 2.10-4 barias = 20 PPascales.

  3UHVLyQH,QWHQVLGDGVRQRUDV3RWHQFLDVRQRUD
3RGHPRVGHQLUODLQWHQVLGDGItVLFDGHXQDRQGDVRQRUD , FRPRODHQHUJtD
TXHDWUDYLHVDSRUVHJXQGRODXQLGDGGHVXSHUFLHFRORFDGDSHUSHQGLFXODUPHQWH
a la direccin de propagacin (Fig. 20). Se mide en (erg/s)/cm2 y en Watt/m2.

:
, , (29)
4R2

GRQGH,HVOD,QWHQVLGDG:SRWHQFLDVRQRUD\5HOUDGLRGHODVXSHUFLHHVIp-
rica, cuyo centro O es el foco emisor.
Como vemos, las Intensidades son inversamente proporcionales a los cua-
drados de los radios (Fig. 22).
<VLFRQVLGHUDPRVHOiQJXORVyOLGRFRUUHVSRQGLHQWHDXQDHVIHUD HVWHUHR-
:
radianes. Entonces ser: I , (Aqu R = 1m) [Fig. 20 con R = 1m.] (30)
4S

30
Captulo 4

Fig. 22. Diagrama que muestra que las Intensidades son inversamente proporcionales a
los cuadrados de los radios.

Fig. 23. Curva Umbral de Audibilidad (Isfono de 0 Fones), como lmite de las posibi-
OLGDGHVGHDXGLFLyQDODVGLVWLQWDVIUHFXHQFLDVGHORtGRKXPDQRQRUPDOMRYHQ
y sin transtornos o patologas. Junto con la Tabla 2, que nos da los valores de
6RQRULGDGHQG63/GHODFXUYDDQWHULRUSDUDODVGLVWLQWDVIUHFXHQFLDV

31
Captulo 4

donde I es la intensidad y W la potencia sonora. En este ltimo caso, la inten-


VLGDGYHQGUiPHGLGDHQ HUJV HVWHUHRUDGLiQRHQ:DWWHVWHUHRUDGLiQ.
9HDPRV DKRUD TXp HQWHQGHPRV SRU Potencia sonora: es la energa emi-
tida, por segundo, por un foco sonoro en todas las direcciones del espacio
(Fig. 20):

I2 :2
de donde se deduce: , (32)
I1 :1
Por tanto, las intensidades son directamente proporcionales a las potecias
TXHODVKDQRULJLQDGR. Finalmente, se ha demostrado que la ,QWHQVLGDGItVLFD
I, es directamente proporcional al cuadrado de la Presin mxima:
1 P 2 max
I , (33)
2 ZA
siendo ZA la llamada Impedancia Acstica del medio. Lo cual nos lleva a:
I 2 P22
, (34)
I1 P12
Entonces, teniendo en cuenta las relaciones (32) y (34), nos lleva a otras dos
formas de expresin de la Ley de Weber - Fechner:
:
S 2  S1 10 log 2 , (35)
:1
as como mediante la segunda (34):
P2
S 2  S1 10 log  20 log (36)
P1
Si nos referimos en (35) a la Potencia umbral: So = 0: implica:
:
S 10 log 16 , (37)
10 :DWW
pero si lo hacemos a la presin umbral:
P P
S 20 log 20 log 4
(38)
20PPasc. 210 barias

32
Captulo 4

4.4) Umbrales de percepcin de intensidad: umbral de


audibilidad (mnimo) y umbral de dolor (mximo). Valores
intermedios como ejemplo de sonidos normales.
6HGHQHHO8PEUDOGHDXGLELOLGDGFRPRDTXHOODLQWHQVLGDGItVLFDPtQLPD
SRU GHEDMR GH OD FXDO H LQFOXVR HQ HOOD HO RtGR QRUPDO HV WRWDOPHQWH LQVHQ-
sible, pues no es capaz de notar la menor sensacin. Esta, sabemos, corres-
SRQGH SDUD XQD IUHFXHQFLD GH  +] D I0 = 10-16 W/cm2 = 10-12 W/m2 
P0 = 2 u10-4 barias = 20 PPasc, siendo S0 = 0 dE (Fig 23 y Tabla 2). Vara en
funcin de la frecuencia, como Isfono de 0 Fones (se explicar ms adelante).
+HPRVGHKDFHUQRWDUTXHHQHVWDVFRQGLFLRQHVHVWHHVWtPXORPtQLPRGD
lugar a un desplazamiento de la membrana timpnica de 10- 9 cm, distancia
PHQRUTXHODGpFLPDSDUWHGHOGLiPHWURGHXQDPROpFXODGHKLGUyJHQR
3RURWURODGRVHGHQHHOUmbral de dolor (mximo) como el mayor valor
GH LQWHQVLGDG VRQRUD TXH SXHGH UHVLVWLU XQ RtGR QRUPDO FRQ DOJ~Q VXIUL-
PLHQWR D+]SRUHQFLPDGHOFXDOVREUHYHQGUtDQOHVLRQHVSDWROyJLFDV.
Equivale a ID = 2,5x10-3 W/cm2 = 25 W/m2 PD = 103 barias = 1mbar que
corresponde a una SD = 134 dE (Fig. 24). Vara en funcin de la frecuencia.
A continuacin, presentamos otro diagrama (Tabla 1) que nos ilustra los
YDORUHV LQWHUPHGLRV TXH QRUPDOPHQWH VXHQDQ HQ QXHVWUR HQWRUQR (Q pO VRQ
importantes los espacios de VC YR]FXFKLFKHDGDRPX\EDMDVN = voz normal
y VF YR]IXHUWHTXHHVXQR\HOPiVLQPHGLDWRPpWRGRTXHVXHOHHPSOHDU
el Audioprotesista para calibrar aproximadamente, en un principio, el grado de
KLSRDFXVLDGHOVXMHWRTXHVROLFLWDVXVVHUYLFLRV(TXLYDOHDODVLJXLHQWH)LJ

  2
 WUDVXQLGDGHVDXGLRPpWULFDV'HFLEHOLRV63/\'HFLEHOLRV
HL o HTL y VXDSOLFDFLyQDODVQXHYDVJUiFDV
+HPRV GH UHFRUGDU OLJHUDPHQWH OD GHQLFLyQ GDGD DQWHULRUPHQWH SDUD
SRGHUDVLPLODUPHMRUHVWDVQXHYDVGHQLFLRQHV
1) Decibelios I.L.HQLQJOpVIntensity Level o de Nivel de Intensidad, que
FRUUHVSRQGHQDODSULPLWLYDGHQLFLyQGHOD/H\GH:HEHU)HFKQHU  
I Watt
S1  S0 10 log , donde I 0 10 16 ; (39)
I0 cm2

33
Captulo 4

Fig. 24. Curva de sensacin dolorosa (o de mximo Inconford) en la parte muy superior
del campo de audibilidad (Isfono de 134 Fones).

TABLA 1

Tabla. 1. 9DORUHVGH6 G H[WUHPRV\QRUPDOHVTXHSHUFLELPRVHQQXHVWUDYLGDGLiULD

34
Captulo 4

Fig. 25. (MHPSORVGHVRQLGRVHVWiQGDUFDOLEUDGRVHQOD7DEODTXHSRGHPRVSHUFLELUHQ


una vida normal (abstenerse discotecas).

2.) 'HFLEHOLRV 63/ HQ LQJOpV Sound Pressure Level) o de Nivel de


Presin de Sonido, que provenan de la expresin ya vista (36):

P1
S1  G63/  ORJ (36) donde P0 3DV u 10-4 barias
P0

que eran los decibelios fsicos que se tomaban para obtener las curvas
Isofnicas, siendo la ms importante la curva del Umbral de audibilidad o de
0 Fones (esto se explicar mas adelante), (Fig. 23).
3.) Decibelios H.T.L. o H.L.HQLQJOpV+HDULQJ7KUHVKROG/HYHOR+HDULQJ
Level R GH 1LYHO 8PEUDO GH $XGLFLyQ YLHQHQ GHQLGRV PHGLDQWH OD UHVWD
de cada valor en dE S.P.L. menos sus valores correspondientes del umbral

35
Captulo 4

Fig. 26. (MHPSORGHGLDJUDPDGHDXGLRPHWUtDJLUDGR\OLQHDOL]DGRDOUHSUHVHQWDU


ODVSpUGLGDVDXGLWLYDVHQGHFLEHOLRV+/R+7/2'2,

Fig. 27. Representacin de la zona total de audibilidad, que contiene en su interior el rea
del habla o diccin limitada por las dos curvas bsicas Umbral y de sensacin
dolorosa como frecuencias tericas lmite.

36
Captulo 4

de audibilidad (que dependen de la frecuencia y constituyen lo que origina


la curva Isofnica de 0 Fones, pues no se oyen igual unos sonidos que otros)
(Fig. 23) y Tabla 2:

Aqu va: G +/  G 63/ G XPEUDO  

SHURDTXtKHPRVGHGHQLUDODIUHFXHQFLDDODTXHVHGDSHMGESPL, a
ODIUHFXHQFLDGH+]G +/  GG GHVXXPEUDO  G
+/ $VtRSHUDQGRFRQWRGDVODVIUHFXHQFLDVODFXUYDDQWHULRUVHWUDQVIRUPD
en una recta (diagramas lineales, aunque girados 180) (Fig. 26). De esta forma
estn medidos todos los audiogramas modernos, pues los audimetros efectan
HVWDVUHVWDVDXWRPiWLFDPHQWHGDQGRORVUHVXOWDGRVHQGHFLEHOLRV+/

TABLA 2
)UHFXHQFLD +] Intensidad
8PEUDO G63/
125 45,5
250 24,5
500 11
1.000 6,5#0
2.000 8,5
4.000 9
8.000 9,5
Tabla 2.- Valores que varan en funcin de la frecuencia, como isfono de O fones.

37
Captulo 5

5.1) Diferencias y analogas entre frecuencia y tono.


Se ha descubierto, mediante numerosos experimentos, que solo existe una
relacin lineal entre el tono (medido en mel) y la frecuencia fsica entre los
YDORUHVGH\+] YROYHUD)LJ )XHUDGHHVWHPDUJHQODUHODFLyQ
GHMDGHFXPSOLUVH$QiORJDPHQWHRFXUUHFRQODGHWHUPLQDFLyQGH,VyIRQRV
SXHVQRSXHGHFDOLEUDUVHORTXHXQVXMHWRHQWLHQGHSRUXQVRQLGRGRVYHFHV
PiVDOWRRGRVYHFHVPiVEDMR3HURFXDQGRWDOHVH[SHULHQFLDVVHUHDOL]DQ
con un gran nmero de personas, existe un acuerdo sorprendentemente bueno
entre los resultados.

  5
 HSUHVHQWDFLRQHVJUiFDVGHOD,QWHQVLGDGHQIXQFLyQGHOD
frecuencia: campo de audibilidad.
6HKDGHPRVWUDGRWDPELpQTXHHORtGRQRSUHVHQWDODPLVPDVHQVLELOLGDG
SDUD ODV GLVWLQWDV IUHFXHQFLDV $Vt SRU HMHPSOR VL FRQVLGHUDPRV HO XPEUDO
de audibilidad que sabemos vale I0 = 10-16 W/cm2 que corresponde a 0 dE,
HVWRVRORRFXUUHDODIUHFXHQFLDGH+]$RWUDVIUHFXHQFLDVPD\RUHVR
menores, podemos aumentar la intensidad sin que el odo se entere o capte el
VRQLGR$VtHVWXGLDQGRHOVXFLHQWHQ~PHURGHSHUVRQDVVHKDSRGLGRFRQIH-
cionar la lnea curva Isfona de 0 Fon o Curva o Isfono del Umbral de audi-
bilidad, que se ha conseguido representando las Sensaciones o Sonoridades
mnimas en funcin de la frecuencia (Fig. 23).
Anlogamente, se ha conseguido en la zona superior la Curva (o isofno) de
Sensacin Dolorosa, que corresponde a 130 Fones. Por tanto, al rea incluida
entre estas dos curvas umbrales y las dos ordenadas correspondientes a 20 y
+]HVOD]RQDTXHFRUUHVSRQGHDOOODPDGRCampo de audibilidad, que
puede apreciarse en la Fig. 27.

39
Captulo 5

Fig. 28. 5HSUHVHQWDFLyQJUiFDGHWUHVFXUYDVH[SHULPHQWDOHVGHWHUPLQDGDVGHGLVWLQWD


manera, por varios autores, y en la que la intermedia es la nica que para 1000
+]QRVSURSRUFLRQDOHOYHUGDGHURFHURDXGLRPpWULFR

Fig. 29. 'RVJUiFDVH[SHULPHWDOHVTXHQRVPXHVWUDQOD3UHVELDFXVLDRGHVSOD]DPLHQWR


del umbral medio de audibilidad, para distintas frecuencias en hombres y
PXMHUHVHQIXQFLyQGHODHGDGHQDxRV

40
Captulo 5

Fig. 30. &XUYDV,VRIyQLFDVHQG63/HQIXQFLyQGHODIUHFXHQFLDREWHQLGDVSRU


Robinson y Dadson.

/DFXUYDGHOXPEUDOGHPtQLPDDXGLELOLGDGQRHVMD )LJ VLQRTXH


GHSHQGHIXQGDPHQWDOPHQWHGHOPpWRGRVHJXLGRSDUDVXREWHQFLyQODFXUYD
1 se ha medido monoauralmente y la seal es presentada a un auricular, as
como la presin sonora se mide a la entrada del canal auditivo. La curva
2 es binaural con la presin presentada por una fuente nica a cierta dis-
WDQFLDIUHQWHDOVXMHWR\PHGLGDHQHOFDPSRDQWHVGHVXHQWUDGDHQpO(VWD
es la verdadera curva isfona de 0 Fon. Mientras que la curva 3 se trata
de otra curva binaural, pero con la seal emitida por un cierto nmero de
pequeos altavoces, distribuidos al azar en un plano horizontal y alrededor
GHODFDEH]DGHOVXMHWR\ODSUHVLyQVRQRUDPHGLGDHQHOFDPSRDQWHVGHOD
HQWUDGDGHOVXMHWRHQpO
7DPELpQ SRGHPRV DVHJXUDU TXH HVWD FXUYD HV SDUD JHQWH MRYHQ SXHV YD
YDULDQGRFRQODHGDGGHOVXMHWR$FRQWLQXDFLyQSUHVHQWDPRVODVFXUYDVTXH
representan la prdida progresiva de la sensibilidad del umbral medio de
audibilidad con el aumento de edad, WDQWRSDUDKRPEUHVFRPRSDUDPXMHUHV
para las distintas frecuencias audibles, que aparece en la Fig. 29. A este efecto
natural se le denomina Presbiacusia, DQiORJRDODSpUGLGDGHDFRPRGDFLyQ

41
Captulo 5

GHOFULVWDOLQRHQODYLVLyQ 3UHVELFLD $TXtVHUtDXQDSpUGLGDGHDFRPRGDFLyQ


GHODVFpOXODVGHOYHVWtEXORGHODFyFOHDDOSDVRGHODVGLVWLQWDVIUHFXHQFLDV
(sobre todo las agudas), es decir, supondra un endurecimiento del odo que
DSHQDVHVSHUFHSWLEOHSRUHOVXMHWRVDOYRTXHVHVRPHWDDXQDDXGLRPHWUtD

5.3) rea de la Diccin. Niveles de igual Sonoridad: Curvas


isofnicas.
La zona de la recepcin del habla o de la diccin es ms reducida an que la
general de audicin y est limitada por su parte inferior por unos 30 dE, por su
parte superior rara vez supera los 80 dE y en horizontal, las frecuencias ms
EDMDVGH+]\ODVPiVDOWDVGHDSUR[LPDGDPHQWH+]9HDPRVTXp
entendemos por curvas Isfonas: contornos de igual nivel de percepcin de
la Sonoridad (sensacin que, nos produce la intensidad de un sonido). Esto es
debido a que, como ya sabemos, notas de diferentes frecuencias deben tener
diferentes presiones acsticas SDUDVHULJXDOPHQWHDXGLEOHVFRQHOPtVPRQLYHO
GHVRQRULGDGVXEMHWLYR3RUHMHPSORVHWRPDDXQDSHUVRQDGHSUXHED\VHOH
KDFHRtUXQDQRWDGH+]FRQXQDLQWHQVLGDGGHdE\GHVSXpVHVFXFKD
RWUDQRWDGHGLIHUHQWHIUHFXHQFLD +] DFRQWLQXDFLyQVHOHSURSRQHTXH
DMXVWHHOYROXPHQGHHVWDVHJXQGDQRWDGHIRUPDTXHOHVXHQHFRQLJXDOLQWHQ-
VLGDG LJXDOQLYHOGHVRQRULGDG TXHODSULPHUDQRWDGH+]YHUHPRVTXH
la ha elevado 60 dEpara conseguirlo. Este experimento se repite con muchos
VXMHWRVVLPLODUHV\DODVIUHFXHQFLDVPiVFRUULHQWHVGHOHVSHFWURDXGLWLYR'H
esta forma, se obtuvieron una coleccin de curvas Isofnicas por Robinson y
Dadson que aparecen en la Fig. 30, que son ms exactas que las clsicas obte-
nidas anteriormente por Fletcher y Munson. Estas curvas se obtuvieron con
VXMHWRVVLWXDGRVHQHOLQWHULRUGHXQDFiPDUDDQHFRLFDHQDXGLFLyQELQDXUDO\
FRQODIXHQWHVRQRUDVLWXDGDIUHQWHDOVXMHWRDGLVWDQFLDPD\RUGHXQPHWUR$Vt
como la presin sonora se mide antes que el oyente entre en el campo sonoro y
en el punto en que se situar el centro de su cabeza.

5.4) Su unidad: Fon o Fonio. Su valor ms importante para la


frecuencia de 1kHz.
$HVWRV,VyIRQRVVHOHVKDQDVLJQDGRYDORUHVQXPpULFRV/DXQLGDGXWLOL-
zada se denomina Fon o Fonio'HQLGRGHODVLJXLHQWHIRUPDEl nivel de

42
Captulo 5

sonoridad de una nota (frecuencia pura) en Fones es numricamente igual


al nivel de intensidad de otro sonido, a 1000 Hz, en dE SPL, que tenga la
misma Sonoridad que el primero. O bien, el valor de una determinada curva
en Fones es exactamente igual al valor de su ordenada (Intensidad en dE),
correspondiente a una abscisa (o frecuencia) de 1000 Hz. $VtSHMXQVRQLGR
FRQODPLVPD6RQRULGDGTXHXQDVHxDOGH+]FX\RQLYHOGH,QWHQVLGDGHV
de 60 dE SPL, tiene un nivel de Sonoridad de 60 Fones.
'HVSXpVGHWRGRORDQWHULRUSRGHPRVSUHJXQWDUQRV6RQLJXDOHVORV6RQHV
TXHORV)RQHV"&XiOHVVXGLIHUHQFLD"
La escala de Sonoridades siempre est referida a la comparacin de sonidos.
Est basada fundamentalmente en las observaciones siguientes:
a) La audicin de un msmo sonido en un campo de ondas planas pro-
gresivas con los dos odos, supuestos igualmente sensibles, da lugar a una
sensacin dos veces ms acusada que la audicin de dicho sonido utilizando
un solo odo. Esto permite establecer una escala verdadera de sonoridades
procediendo como sigue: VHDMXVWDXQDIXHQWHVRQRUDSDUDREWHQHUXQDSUHVLyQ
P1, con lo cual se obtiene una sonoridad S1 con los dos odos destapados.
A continuacin, se tapa un odo, con lo cual la sonoridad disminuye a la
mitad. Seguidamente, se aumenta la presin sonora hasta el valor P2 , que per-
mita apreciar al odo libre la misma sonoridad S1 que se perciba con los dos
odos libres.
$FRQWLQXDFLyQVHGHMDQORVGRVRtGRVGHVWDSDGRV\ODVRQRULGDGVHUi61.
Repitiendo el proceso anterior podr establecerse una escala de sonoridades:
S, 2S, 4S... La unidad adoptada es el Son, TXHVHGHQHFRPRla sonoridad de
una seal de 1.000 Hz a 40 dEde Nivel de sonoridad )RQHV .
b) Si los dos sonidos, a los que suponemos de frecuencias muy diferentes
SDUD TXH FRUUHVSRQGDQ D GRV EDQGDV FUtWLFDV VXFLHQWHPHQWH VHSDUDGDV VH
regulan de tal modo que produzcan una msma sonoridad S, si la percepcin es
por separado, cuando los escuchamos simultneamente originan una sensacin
2S. Esto permite sumar las sonoridades de bandas de sonido muy separadas.
/D JUiFD VLJXLHQWH )LJ   UHODFLRQD GH IRUPD EDVWDQWH DSUR[LPDGD
las Sonoridades y los niveles de Sonoridad, es la denominada Funcin de
Transferencia. La presente relacin puede expresarse matemticamente por:
P  40
S = 0,063. Ilog 2, (41) o bien: S 2 10
, (42)

43
Captulo 5

siendo S la sonoridad (Sones), I ODLQWHQVLGDGDF~VWLFDHQG 63/ \P el Nivel


de Sonoridad (Fones). Para P = 40 Fones, le corresponde 1 Son. Las anteriores
expresiones (41) y (42) solo son vlidas entre 20 y 120 Fones. Esta ley poten-
cial es ms conforme a los resultados estadsticos que la antigua ley de Weber
- Fechner, que enunciaba que la Sonoridad es proporcional al logaritmo del
estmulo.

log2
S = 0,063 I
3 
S=2
S = Sonoridad (sones)
P = Nivel de sonoridad (fones)
, ,QWHUVLGDGDF~VWLFD G63/
Fig. 31. 5HSUHVHQWDFLyQJUiFDGHODIXQFLyQGH7UDQVIHUHQFLD OLQHDO TXHSURSRUFLRQDOD
relacin entre la Sonoridad en Sones y los Niveles de Sonoridad en Fones.

44
Captulo 6

6.1) Estudio de las Impedancias fsicas del odo: la impedancia


fsica o absoluta y la Impedancia relativa o medida del
UHHMRWLPSiQLFR
/RSULPHURTXHKHPRVGHGHQLUHVTXpHQWHQGHPRVSRUImpedancia (Zi).
(VWH QXHYR FRQFHSWR ItVLFR IXH GHQLGR SRU +HDYLVLGH SDUD &LUFXLWRV
(OpFWULFRV(VXQFRQFHSWRPX\JHQHUDOTXHVHSXHGHHPSOHDULJXDOHQFXDO-
TXLHUVLVWHPDSH0HFiQLFR0HFDQRDF~VWLFR(OpFWULFR0DJQpWLFRHWF<
TXHVHGHQHFRPRla relacin entre la excitacin comunicada a un sistema
$FFLyQ y la respuesta que este proporciona como consecuencia 5HDFFLyQ .
$Vt
Excitacin
Z=
Z , (43)
i Respuesta
>3DUDSRGHUHQWHQGHUWRGRORTXHDFRQWLQXDFLyQH[SRQHPRVHVFDVLDEVROXWD-
PHQWHQHFHVDULRFRQVXOWDU \HVWXGLDU ORV$SpQGLFHV\HQORVTXHVHHVWXGLD
HVWHFRQFHSWRDSOLFDGRDXQ&LUFXLWR(OpFWULFR $S \DXQ&LUFXLWR0HFiQLFR
FRQ0DVD\&WHGH5LJLGH] $S TXHVHHQFXHQWUDQDOQDOGHOWH[WR@
3DVHPRV D OD ~OWLPD SDUWH \ PiV IXQGDPHQWDO SDUD QRVRWURV TXH HV OD
Equivalencia Mecano-Acstica: (QHOODYDPRVDWHQHUXQDQXHYD,PSHGDQFLD
ZA o ,PSHGDQFLD $F~VWLFD 6XSRQJDPRV XQ Circuito biomecnico FRPR HO
FDVRGHORtGRPHGLR  )LJ TXHHVDFWLYDGRSRUXQDRQGDTXHHMHUFHXQD
SUHVLyQ3iVREUHXQDVXSHUFLHFRPRHQHOFDVRGHODVRQGDVVRQRUDVDF~VWLFDV
VREUHODmembrana timpnica, cuya Impedancia Acstica ZA es el cociente de
la excitacin y la respuesta que, en este caso, es la Velocidad de desplaza-
miento de volumen:

45
Captulo 6

Q = Y S, (44)
HVWHFRQFHSWRItVLFRSXHGHYHQLUGHQLGRSRUXQFLOtQGURGHEDVH6\DOWXUDY
FRUUHVSRQGLHQWHDODYHORFLGDGGHYLEUDFLyQGHODGLFKDVXSHUFLH 3RUWDQWR
s Q P P
ZA = i = i , (45)
Y Q vS
$KRUDELHQFRPRVDEHPRVTXHODSUHVLyQQDFHSRUODDFFLyQGHXQDIXHU]D
)iGLYLGLGDSRUHOYDORUGHODVXSHUFLHS,UHVXOWDWHQLHQGRHQFXHQWDODSUL-
PHUDSDUWHGHODH[SUHVLyQ  GHO$S
Fi Zm
ZA 2
; (46)
vS S2
(VGHFLU/DLPSHGDQFLDDF~VWLFDTXHSUHVHQWDODVXSHUFLH6 a la onda
incidente, es igual a la impedancia mecnica del sistema dividida por el cua-
GUDGRGHGLFKDVXSHUFLHVREUHODTXHDFW~DODSUHVLyQDF~VWLFD3RUWDQWR

GRQGH5AHVODresistencia acstica GLVLSDHQHUJtD \;A HVODreactancia acs-


tica total QRGLVLSDHQHUJtD <WHQLHQGRHQFXHQWD  \ODDQWHULRUH[SUHVLyQ
 VHUi
3RUWDQWRUHVXOWD (48)
GHQRPLQDGDresistencia acstica. <SRURWUDSDUWH
Xm XM  XS
XA ( X A )M  ( X A )K  50)
S S
GRQGH ;A)0HVORTXHVHGHQRPLQDReactancia acstica de Masa, \ ;A)K es
ODReactancia acstica de Rigidez. (QEUHYHH[SOLFDUHPRVHOSRUTXpGHHVWD
VXE. \VHJ~QODDQWHULRU  WHQLHQGRHQFXHQWDODVH[SUHVLRQHV  \  
GHO$SYDOHQ
X ZM
X A M S m S  ZM A ()

HQGRQGHKHPRVGHQLGRODMasa acstica o InertanciaTXHYDOH


M
MA  )
S

46
Captulo 6

3RURWURODGR

HQGRQGHDSDUHFHXQDQXHYDGHQLFLyQ
C A Cm S   54)
GHODCompliancia acstica.3RUWDQWRFRPRUHVXPHQGHWRGRORDQWHULRUDSD-
UHFHXQDQXHYDH[SUHVLyQGHODReactancia Acstica total:
 
X A ZM A  S f .M A   55)
ZC A S f .C A
HVGHFLUTXHOD,PSHGDQFLD$F~VWLFDYDOH

GRQGHZA YLHQHPHGLGDHQ2KPLRVDF~VWLFRV A).


,JXDOTXHHQORVGRVFDVRVSUHFHGHQWHV $SV\ SRGHPRVFRQVLGHUDU
XQDWULSOHHTXLYDOHQFLDHQWUHODVWUHVH[SUHVLRQHVGH,PSHGDQFLDFRQVXOWDQGR
OD  \OD  GHORV$SV\MXQWRFRQOD   Z e { Z m { Z A  57)
GHGRQGHDSDUHFH
([FLWDFLyQ

5HVSXHVWD
} }
(Q UHVXPHQ \ FLxpQGRQRV DO WHPD TXH QRV RFXSD SRGHPRV GHQLU OD
Impedancia acstica del odo como la resistencia total que encuentra el
sonido al pasar desde el exteriorKDVWDHO&RQGXFWR$XGLWLYR,QWHUQR &$, 
HPSLH]DHQODYHQWDQDRYDO 
3RURWURODGRORTXHKHPRVGHQLGRFRPRMasa acsticaMARInertancia
DODPDJQLWXGTXHHTXLYDOHDVXPDGHODVPDVDVGHORVXLGRVHQPRYLPLHQWR
\TXHWDPELpQLQFOX\HODFRUUHVSRQGLHQWHDODPDVDGHORVOLJDPHQWRVHLQVHU-
FLRQHV PXVFXODUHV GH OD FDGHQD WtPSDQRRVLFXODU \ OD PDVD GH pOOD PLVPD
GLYLGLGDSRUODVXSHUFLH~WLOGHOWtPSDQRDOFXDGUDGR RtGRQRUPDOUHGXFLGR
DOPtQLPRSRUVXHTXLOLEULRHQWRUQRDVXHMHGHURWDFLyQ  )LJ 
$KRUDKDUHPRVFRPRUHVXPHQXQanlisis de las magnitudes acsticas
ms importantes

47
Captulo 6

 /DCompliancia acstica = CA RWDPELpQ Elasticidad acstica).3RU  


 S 
C A Cm S  )
Sm K A
GRQGH.AHVODRigidez acstica(VWDHVODH[SOLFDFLyQGHSRUTXpSXVLPRVHVWH
VXEtQGLFHDOD5HDFWDQFLDDF~VWLFDGH5LJLGH]DQWHULRUPHQWH3RUWDQWR
Sm
KA  )
S
\ODPHQFLRQDGD5HDFWDQFLDSXHGHHVFULELUVHFRPR
 KA KA
( X A )K ()
ZC A Z S f
TXHFRPRYHPRVHVGLUHFWDPHQWHSURSRUFLRQDODOD5LJLGH]DF~VWLFD(VWD
HVGHELGDDODPD\RURPHQRUGXUH]DGHORVHOHPHQWRVHOiVWLFRVWDOHVFRPR
PHPEUDQDVGHOWtPSDQRYHQWDQDVRYDO\UHGRQGDOLJDPHQWRV\P~VFXORVGH
ODFDGHQDWtPSDQRRVLFXODUVXVDUWLFXODFLRQHVHWF )LJ 'HODVDQWHULRUHV
H[SUHVLRQHVVHSXHGHGHGXFLU

GRQGHR A = Resistencia acstica GLVLSDHQHUJtD HVODcomponente debida a


los rozamientos o fricciones en las uniones de la cadena o en los desplaza-
mientos de un medio viscoso, etc6LREVHUYDPRVOD)LJSRGHPRVFRQVL-
GHUDUDHVWDVPDJQLWXGHVFRPRODVFRPSRQHQWHVGHXQQ~PHURFRPSOHMR

TXHUHSUHVHQWDla tangente del ngulo de desfase3HURFRPRHVVDELGRSDUD


XQFLHUWRYDORUGHODIUHFXHQFLDfRHOVLVWHPDSXHGHHQWUDUHQUHVRQDQFLDOR
FXDOSXHGHRFXUULUSDUD
KA
K  0; X A  0 Q f R . M A  ; ()
Q f R
)LJ HVGHFLUFXDQGRODFLWDGDIUHFXHQFLDYDOJD
 KA
fR  )
S M A

48
Captulo 6

Fig. 32.  'RV YLVWDV GHO RtGR PHGLR FRQ OD FDGHQD WtPSDQRRVLFXODU FRQ VX HMH GH JLUR
MXQWRFRQRWURHVTXHPDPiVItVLFRGRQGHDSDUHFHQSDUiPHWURVGHODWUDQVPLVLyQGHOVRQLGR
DWUDYpVGHHVWD

X A
M  X A
K
Fig. 33. 5HSUHVHQWDFLyQGHORVIDFWRUHVFRPSOHMRVTXHLQWHUYLHQHQHQHOFiOFXORGHOYDORU
GH OD LPSHGDQFLD DF~VWLFD \ VX VLWXDFLyQ YHFWRULDO $SOLFDFLyQ DO FDVR SDUWLFXODU GH OD
5HVRQDQFLD

(QHVWHFDVRORVHIHFWRVGHODV5HDFWDQFLDVDF~VWLFDVGH0DVD\GH5LJLGH]
VH DQXODQ SRU VHU YHFWRUHV LJXDOHV \ RSXHVWRV (VWR LPSOLFD XQD Pi[LPD
DPSOLWXGHQODPRYLOLGDG RtGRVDQR\MRYHQVLQQLQJXQDSDWRORJtDFRQOD
7URPSDGH(XVWDTXLRDELHUWD 
2WUR GH ORV FRQFHSWRV IXQGDPHQWDOHV HV HO GH Admitancia Acstica o
Movilidad acstica TXH VH GHQH FRPR la magnitud que corresponder a
la mayor o menor facilidad de movimiento del sistema acstico del odo YA \
UHVXOWDVHUODLQYHUVDGHOD,PSHGDQFLDDF~VWLFD

49
Captulo 6


| YA |  )
| ZA |
/DAdmitancia acstica FRQVWDLJXDOPHQWHGHGRVFRPSRQHQWHV

GRQGH *A HV OD Conductancia acstica \ BA HV OD Susceptancia acstica.

$XQTXHWHQJDPRVHQFXHQWD  HVWR12, 03/,&$ que


HVGHFLUVHWUDWDQGHYDORUHV',67,1726
3DUDFDOFXODUVXVYHUGDGHURVYDORUHVKHPRVGHFRQVLGHUDUORVFRPRQ~PHURV
FRPSOHMRVFRPRHQUHDOLGDGVRQ\VXFiOFXORHV

TXHVRQORVYHUGDGHURVYDORUHVGHOD&RQGXFWDQFLDDF~VWLFD\GHOD6XVFHSWDQFLD
DF~VWLFD.
9HDPRVDKRUDHOFDVRGHXQSistema controlado por rigidez:6HWUDWDGHOD
UHODFLyQHQWUHOD&RPSOLDQFLDDF~VWLFD&A \OD5HDFWDQFLDDF~VWLFD;ASDUD
EDMDVIUHFXHQFLDV
(Q HVWH FDVR VL OD IUHFXHQFLD I  +] OD ; A)0 HV GHVSUHFLDEOH
IUHQWHD ;A)KORFXDOLPSOLFDTXH
 

\VL5AHVGHVSUHFLDEOHIUHQWHD ;A  &RUUHFWRHQODPD\RUtDGHORVFDVRV 
(74)

TXHFRQVLGHUDPRVFRPR Impedancia relativa o (IHFWRItVLFRGHOUHHMRHVWDSHGLDO.

50
Captulo 6

XA 
3RUWDQWRHQHVWHFDVR BA  
# S f .C A (5)
R  XA XA
A

RA
y GA # 0 7)
R  X A

A

(VGHFLUODSusceptancia, en este caso, y solo en este caso, es proporcional


a la Compliancia, siendo el factor de proporcionalidad  I.<SRUVHU

LPSOLFDTXH | YA |# BA # Sf .C A (8)


/XHJR solo a bajas frecuencias, VH YHULFD Admitancia o Movilidad |
Susceptancia |Compliancia. A 220 Hz la unidad de Compliancia de 1 cm3 es
igual a 1 milisiemens.

6.2) El odo como acoplador de Impedancias.


$OLQFLGLUXQDRQGDDF~VWLFDHQODVHSDUDFLyQGHGRVPHGLRVGHGLVWLQWD
LPSHGDQFLDFDUDFWHUtVWLFD=\= )LJ SDUWHGHODHQHUJtDRSUHVLyQLQFL-
GHQWHVHWUDQVPLWH SW \RWUDSDUWHVHUHHMD Sr GHSHQGLHQGRGHODUHODFLyQ
Z
t  79)
Z
TXHGHQRPLQDPRVrelacin de Impedancias, de ambos medios.
/DRQGDWUDQVSRUWDXQDHQHUJtD( = (P) /ZDQiORJDD /ZeHQHOFLUFXLWR
HOpFWULFRHTXLYDOHQWH$SOLFDQGRHOTeorema de Thevenin HOVLVWHPDH[FLWDGRU
HQHVWHFDVRODRQGDVRQRUDVHSXHGHVXVWLWXLUSRUXQJHQHUDGRUHOpFWULFRGH
SRWHQFLDOFWH 90  HVGHFLUHTXLYDOHQWHDODSUHVLyQSTXHSURGXFLUtDVREUH
XQDLPSHGDQFLDLQQLWD FRPRHQHOFDVRGHLQFLGHQFLDVREUHXQDVXSHUFLH
WRWDOPHQWHUtJLGD \FRQXQDLPSHGDQFLDen serieLJXDODODLQWHUQD=i del sis-
WHPD HQHOFDVRGHODRQGDODLPSHGDQFLDFDUDFWHUtVWLFDGHOPHGLR= FRPR
VHSUHVHQWDHQHOHVTXHPDGHOD)LJHQGRQGH=HVODLPSHGDQFLDFDUDF-
WHUtVWLFDGHOVHJXQGRPHGLRTXHDFW~DGH,PSHGDQFLDGHFDUJDHQHOFLUFXLWR
HTXLYDOHQWH )LJ 
(QWRQFHVODHQHUJtDWUDQVPLWLGDDODFDUJDHV( = Z QSHUR

51
Captulo 6

 Pi
Q  80)
Z  Z 
 4Z 
UHVXOWD E  Pi  )
( Z Z  ) 
Pi 
&RPR OD HQHUJtD FRQ TXH LQFLGH OD RQGD HV H E =i   VH REWLHQH HO
E Z
Z Z
FRHFLHQWHde TransmisinW    

E
 Z
 Z 

GRQGH VL GLYLGLPRV QXPHUDGRU \ GHQRPLQDGRU SRU = )  VH REWLHQH FRH-
FLHQWH HQIXQFLyQGHt RUHODFLyQGH,PSHGDQFLDV   FX\RYDORUPi[LPRHV
GHWUDQVPLVLyQ YiOLGRWDPELpQSDUDVXH[SUHVLyQUHFtSURFD(W)
W

TXHDSDUWLUGHDKRUDGHQRPLQDPRV&RHFLHQWHGH7UDQVPLVLyQHQHUJpWLFR
acstico, FX\RYDORUPi[LPRVHREWLHQHSDUDt = 1HVGHFLUSDUD= = ZROR
TXHHTXLYDOHDXQDFRSODPLHQWRSHUIHFWRGHLPSHGDQFLDV
$VtHQHOFDVRGHWUDQVPLVLyQDLUHDJXDHQHOTXHH[LVWHXQJUDQGHVDFRSOR

ODUHODFLyQGHLPSHGDQFLDVYDOHWD+ O =  0  \SRUWDQWRHO
 q4
&RHFLHQWHGHWUDQVPLVLyQYDOGUiW HVGHFLUGHORUGHQGHO
&RPRHMHPSORLOXVWUDWLYRSRGHPRVSHQVDUHQXQDFDGHQDHOHFWURDF~VWLFD
RGHDOWDGHOLGDGFRPRODVTXHWHQHPRVWRGRVHQQXHVWUDVFDVDVORVPLFUy-
IRQRV DPSOLFDGRUHV DWHQXDGRUHV OWURV DOWDYRFHV HWF GHEHQ WHQHU VXV
LPSHGDQFLDVDFRSODGDV ODGHVDOLGDGHXQRFRQODGHHQWUDGDGHOVLJXLHQWH 
GHWDOIRUPDTXHFDGDFRPSRQHQWHGHOVLVWHPDHQWUHJXHODPi[LPDHQHUJtDDO
LQPHGLDWRFRQXQDPtQLPDSpUGLGDHQFDGDSDVR
8QDYH]YLVWR\HQWHQGLGRWRGRHVWRSRGHPRVSDVDUDOREMHWRSULPLWLYRGH
QXHVWUDFXHVWLyQ

6.3) La funcin acopladora del odo medio y su aplicacin a las


QXHYDVJUiFDV
(QODSULPLWLYD\DFWXDOYLGDDFXiWLFDODLPSHGDQFLDGHOPHGLRHVVLPLODU
DODGHyUJDQRVUHFHSWRUHVGHRQGDVHOiVWLFDV W~ FRQORTXHVHRSHUDXQD

52
Captulo 6

WUDQVPLVLyQHFD]GHHQHUJtDVRQRUDHQWUHHOPHGLRH[WHULRU DJXD \ORVWHJX-


PHQWRVGHORVSHFHVXRUJDQLVPRVGHYLGDVXEPDULQD
6LQHPEDUJRFXDQGRHVWRVVHUHVVDOLHURQGHOPHGLRDFXRVRDWLHUUDUPH
HVGHFLUDODLUHOHVIXHQHFHVDULRGHVDUUROODUDORODUJRGHVLJORVGHHYROXFLyQ

Fig. 34. (VTXHPDTXHUHSUHVHQWDODWUDQVPLVLyQ\UHH[LyQGHOVRQLGRDOHQFRQWUDUODVXSHU-


FLHGHVHSDUDFLyQGHGRVPHGLRVGHGLVWLQWDLPSHGDQFLDFDUDFWHUtVWLFD=\=.

Fig. 35. &LUFXLWRHOpFWULFRTXHPHGLDQWHHO7HRUHPDGH7KHYHQLQHTXLYDOHRUHSUHVHQWDDO


FDVRDQWHULRUPHGLDQWHXQJHQHUDGRUGHYROWDMHSXQDLPSHGDQFLDGHHQWUDGD= (primer
PHGLR \XQDLPSHGDQFLDLQWHUQD GHFDUJD = RGHOVHJXQGRPHGLR FRQXQDUHVSXHVWDGH
LQWHQVLGDG4 YHORFLGDGGHGHVSOD]DPLHQWRGHYROXPHQ 

53
Captulo 6

XQGLVSRVLWLYRRUJiQLFRHVGHFLUel odo medioTXHOHVVLUYLHUDSDUDDFRSODU


ODEDMDLPSHGDQFLDFDUDFWHUtVWLFDGHODLUHDODGHOyUJDQRWUDQVGXFWRU UJDQR
GH&RUWL LQPHUVRHQHOOtTXLGROLQIiWLFRTXHOOHQDOD&yFOHD
/D FDGHQD RVLFXODU FRQVWLWX\H XQ VLVWHPD PHFiQLFR FRQ HOHPHQWRV ORFD-
OL]DGRVGHPDVD 0 HODVWLFLGDGR&RPSOLDQFLD &m \IULFFLyQ 5 TXHDO
YLEUDUSRUODDFFLyQGHXQDSUHVLyQDF~VWLFDVREUHODPHPEUDQDWLPSiQLFD
WUDQVPLWHHVWDVYLEUDFLRQHVDORtGRLQWHUQR &yFOHD DWUDYpVGHODPHPEUDQD
GHOD9HQWDQDRYDO(VWHVLVWHPDFRUUHVSRQGHGHVGHHOSXQWRGHYLVWDHQHUJp-
WLFRPHGLDQWHXQDVLPLOLWXGHOHFWUyQLFDDXQFXDGULSRORTXHUHFLEHHQHUJtD
DF~VWLFDHQIRUPDGHRQGDVRQRUDHQHOSULPDULR =T {ZO  PHPEUDQDWLP-
SiQLFD \ODWUDQVPLWHDOVHFXQGDULR =F  R9HQWDQDRYDO  YHiVH)LJ 
$TXtHQHVWHGLDJUDPD=FHVODLPSHGDQFLDGHFDUJDRLPSHGDQFLDTXH
SUHVHQWD OD YHQWDQD RYDO RLGR LQWHUQR  \ =T HV OD LPSHGDQFLD WLPSiQLFD R
LPSHGDQFLDGHHQWUDGD LPSHGDQFLDTXHVHPLGHHQHOSULPDULRGHOFXDGUL-
SROR TXHDVXYH]KDGHDFRSODUVHDOD=OGHODLUH )LJ SDUDREWHQHU
ODPD\RUHQHUJtDGHODRQGDVRQRUDVLHQGRODSUHVLyQ3iGHODRQGDLQFLGHQWH
VREUHODPHPEUDQDWLPSiQLFD
/DFDGHQDRVLFXODU FRQWLWXLGDSRUORVKXHVHFLOORVPDUWLOOR\XQTXH\HVWULER 
GHORtGRPHGLRFRQVWLWX\HXQDSDODQFDGHerJpQHURFRQODPLVLyQGHWUDQV-
PLWLUODVYLEUDFLRQHVGHODPHPEUDQDWLPSiQLFD FP DODPHPEUDQDGH
ODYHQWDQDRYDO PP VLWXDGDHQODSDUHGyVHDGHOKXHVRWHPSRUDOGRQGH
FRPLHQ]DOD&yFOHDDWUDYpVGHODFXDOSHQHWUDODHQHUJtDPHFiQLFDTXHSUR-
GXFHODH[FLWDFLyQGLQiPLFDGHOUJDQRGH&RUWL YHiVH)LJ\
(QHVHQFLDVHWUDWDGHDFRSODUODEDMDLPSHGDQFLDGHODLUH=0DODDOWDLPSH-
GDQFLD=FTXHVXSRQHXQyUJDQRPHPEUDQRVRDORMDGRHQXQOtTXLGR\H[FLWDGR
DWUDYpVGHXQDGLPLQXWDYHQWDQD )LJ 
(OPDUWLOOR\HO\XQTXHXQLGRVSRUVXVFDEH]DVHVWiQVLWXDGRVHQODFDMDWLP-
SiQLFD\VXMHWRVSRUHOOLJDPHQWRDQWHURSRVWHULRUTXHFRQVWLWX\HHOHMHGHJLUR
GHODFDGHQDRVLFXODUGDQGROXJDUDXQDSDODQFD GH
JG
er
JpQHUR TXHWUDQVHUH
ODIXHU]D F OLJHUDPHQWHDPSOLFDGDTXHHOWtPSDQRHMHUFHVREUHHOPDQJRGHO
JG
PDUWLOORDOD F IXHU]DTXHHOHVWULERHMHUFHVREUHODYHQWDQDRYDO FXDQGRQR
KD\RWRHVFOHURVLV GHELGRDODrelacin de los brazos de palancaTXHHVTXHPi-
WLFDPHQWHYHPRVHQOD)LJ

54
Captulo 6

Fig. 36. 5HSUHVHQWDFLyQHOpFWULFDGHORtGRPHGLRPHGLDQWHXQFXDGULSRORFX\DLPSHGDQFLD


GH HQWUDGD FRUUHVSRQGH D OD ,PSHGDQFLD 7LPSiQLFD \ VX LPSHGDQFLD GH FDUJD D OD GH OD
9HQWDQD2YDO

Fig. 37. $PSOLDFLyQGHOGLDJUDPDDQWHULRUHQTXHVHPXHVWUDFyPRODLPSHGDQFLDGHHQWUDGD


KDGHDFRSODUVHFRQODLPSHGDQFLDGHODLUH=0VLHQGR3LODSUHVLyQHMHUFLGDVREUHODPHP-
EUDQDWLPSiQLFDTXHDFW~DFRPRYROWDMHGHOJHQHUDGRUHOpFWULFR

Fig. 38. (VTXHPDPHFiQLFRGHORtGRPHGLRFX\RVKXHVHFLOORV\XQTXH\HVWULERDGHFXDGD-


PHQWHXQLGRVDFW~DQFRPRXQDSDODQFDGHWHUFHUJpQHURTXHDPSOLFDEDVWDQWHODSUHVLyQ
DFWXDQWHVREUHOD9HQWDQDRYDO

55
Captulo 6

(VWDJDQDQFLDGHIXHU]DVXSRQHXQDPD\RUJDQDQFLDGHSUHVLyQVLVHWLHQH
HQFXHQWDHOFRQRFLGRPrincipio de la Prensa HidrulicaODUHODFLyQHQWUHOD

VXSHUFLHDFWLYD6GHOWtPSDQR ST  SDUVWHQVD DODGHODYHQWDQDRYDO

STXHUHVXOWDGHORUGHQGH
S  
= =  
S  
3RUWDQWRXQDSUHVLyQ3HQHO7tPSDQRSURGXFHXQDIXHU]D) = P6<
XQDIXHU]D) ) 3STXHGDOXJDUDXQDSUHVLyQ3VREUHODYHQWDQD
RYDO\SRU  UHVXOWD
) 3S
P= = SRU   P Pp |  P  
S S
(VGHFLUTXHHORtGRPHGLRSRUYtDDpUHDSURSRUFLRQDXQDJDQDQFLDGH
SUHVLyQGHYHFHVORTXHFRUUHVSRQGHDXQDDPSOLFDFLyQHQ6HQVDFLyQGH
Intensidad
S c P
Amp  loJ   ORJ  # (d E  SPL) 87)
Sc P
/D DQDORJtD HOHFWURDF~VWLFD SHUPLWH YLVXDOL]DU \ HVWXGLDU HO FRPSRUWD-
PLHQWR HQHUJpWLFR GH HVWH VLVWHPD FRPR XQ transformador de impedancias
)LJ (ORtGRPHGLRDFW~DFRPRXQWUDQVIRUPDGRUGHDFRSODPLHQWRFRQ
XQDUHODFLyQWHyULFDGHWUDQVIRUPDFLyQ GHDFXHUGRFRQODLJXDOGDGGHHQHU-
JtDVHQHOSULPDULR\VHFXQGDULR VLQSpUGLGDV 

3RW$F~VW    ;

ORTXHVXSRQHreducir unas quinientas veces la impedancia que presenta la


Ventana ovalvista desde el tmpano FRQVLJXLHQGRFRQHOOR

XQDJUDQPHMRUDHQHODFRSODPLHQWRGH=TDODLPSHGDQFLDGHODLUH=o\SRU
WDQWRXQDySWLPDWUDQVPLVLyQGHHQHUJtDDF~VWLFD

56
Captulo 6

Fig. 39. $QDORJtDHOHFWURDF~VWLFDTXHUHSUHVHQWDDO2tGRPHGLRFRPRXQWUDQVIRUPDGRU


GH,PSHGDQFLDVTXHDMXVWDODLPSHGDQFLDGHHQWUDGD=TFRQODGHVDOLGD=V.

Fig. 40. 5HSUHVHQWDFLyQGHOHVTXHPDGHEORTXHVGHORtGRPHGLRHQTXHHVWiQUHSUHVHQWDGDVWRGDVODV


GLVWLQWDVLPSHGDQFLDVGHVXVGLVWLQWRVFRPSRQHQWHVFX\DUHVROXFLyQHVEDVWDQWHFRPSOLFDGD

Fig. 41. 5HSUHVHQWDFLyQJUiFDGHORVYDORUHVPHGLRV HVWiQGDU GHODFRPSRQHQWHUHVLV-


WLYD5\;GHOD,PSHGDQFLDWLPSiQLFD 6KDZ 

57
Captulo 6

 (OUHHMRWLPSiQLFR,PSHGDQFLDUHODWLYDFRPRPHGLGDGHO
msmo.
$HVWDUHODFLyQGHWUDQVIRUPDFLyQGHORtGRPHGLRODKHPRVOODPDGRterica
SRUTXHHQUHDOLGDGHVWiFRQVHJXLGDDWUDYpVGHXQVLVWHPD FDGHQDRVLFXODU 
TXHWLHQHXQDLPSHGDQFLDSURSLDEDVWDQWHFRPSOHMDFRQFRPSRQHQWHVIXQGD-
PHQWDOPHQWHFDSDFLWLYRV HODVWLFLGDG HLQGXFWLYRV PDVDVPHFiQLFDV \SRU
WDQWRHVIXQFLyQGHODIUHFXHQFLD
/D)LJHVXQDUHSUHVHQWDFLyQGHOesquema de bloques del odo medio
HQHOTXHDSDUHFHQODVLPSHGDQFLDVGHVXVGLVWLQWRVFRPSRQHQWHV$Vt
ZFRUUHVSRQGHDODimpedancia de las cavidades.
ZHVODLPSHGDQFLDGHODparte membranosa timpnica TXH12H[FLWDDO
PDUWLOOR
ZGHOFRQMXQWRPDUWLOOR\XQTXH
Z4GHODXQLyQ\XQTXHHVWULER
Z5UHSUHVHQWDODLPSHGDQFLDTXHSUHVHQWDHORtGRLQWHUQRLQFOXLGDODPDVD
LQHUWDQFLD TXHDxDGHHOHVWULER\ODFRPSOLDQFLDGHOD9HQWDQDRYDO
 HV OD UHODFLyQ GH LPSHGDQFLDV GHO WUDQVIRUPDGRU GH DFRSODPLHQWR VLQ
GLPHQVLRQHV 
(QHVWDJXUDORVEORTXHVFRUUHVSRQGHQDHOHPHQWRVPHFiQLFRVFRQOD
PLVPDYHORFLGDGGHYLEUDFLyQHVGHFLUUHFRUULGRVSRUODPLVPDFRUULHQWHHQ
HOFLUFXLWRHOpFWULFRHTXLYDOHQWHTXHVHREVHUYDHQGLFKDJXUD
/DVFRPSRQHQWHVGHOFLUFXLWRUHVSRQGHQDODVFDUDFWHUtVWLFDVPHFiQLFDVGH
ORVGLVWLQWRVHOHPHQWRVLQWHJUDGRVHQHORtGRPHGLR6XFiOFXORGLUHFWRHVXQD
WDUHDPX\FRPSOHMDHQDOJXQRVGHHOORVSRUORTXHKD\TXHUHFXUULUDPHGLGDV
LQGLUHFWDV3RUHMHPSORVHSXHGHFDOFXODUGLUHFWDPHQWHOD,QHUWDQFLDDF~VWLFD
0AGHOHVWULERDSDUWLUGHVXPDVD PJ 

(QFDPELRHVGLItFLOHYDOXDURWURVFRPSRQHQWHVFRPRODFRPSOLDQFLDGHELGDD
ODHODVWLFLGDGGHODVXQLRQHVyVHDV6HUHFXUUHHQWRQFHVDPHGLGDVJOREDOHVGHOD
LPSHGDQFLDWLPSiQLFDFRQODSRVLELOLGDGGHGLIHUHQFLDUDOJXQRVFRPSRQHQWHV
3RUHMHPSORODRWRHVFOHURVLVHVHTXLYDOHQWHDXQD,PSHGDQFLDLQQLWDDOD
HQWUDGDGHOWUDQVIRUPDGRUGHDFRSODPLHQWR\SRUORWDQWRHTXLYDOHDGHVFR-
QHFWDUHOSULPDULRGHGLFKRWUDQVIRUPDGRUORTXHHOLPLQDUtDGHOFLUFXLWROD

58
Captulo 6

LPSHGDQFLDGHFDUJD=5(QOD)LJ GHELGDD6KDZ HVXQDUHSUH-


VHQWDFLyQJUiFDPHGLDGHYDORUHVPHGLGRVSRUGLVWLQWRVDXWRUHVGHODFRP-
SRQHQWH UHVLVWLYD 5 \ UHDFWLYD ; GH OD ,PSHGDQFLD WLPSiQLFD (Q HOOD VH
DSUHFLDFyPRODFRPSRQHQWHUHVLVWLYDHVSUDFWLFDPHQWHFRQVWDQWH\GHORUGHQ
GHA FJV PLHQWUDVTXHODFRPSRQHQWHUHDFWLYDHVPX\QHJDWLYD JUDQ
FRPSRQHQWHGHUHDFWDQFLDDF~VWLFDGHULJLGH] DIUHFXHQFLDVEDMDVFRQXQD
FXUYD TXH VH DSUR[LPD D XQD KLSpUEROD HTXLOiWHUD UHIHULGD D VXV DVtQWRWDV
FRPRHMHV;I FWHFRPRFRUUHVSRQGHDODPD\RULQXHQFLDDHVWDVIUH-
FXHQFLDVGHODFRPSRQHQWHGHELGDDODFRPSOLDQFLD
;  GRQGHODVXE7VLJQLFDWLPSiQLFD 

(VWRLPSOLFDTXHHQ2WRORJtDVHPLGHODLPSHGDQFLDWLPSiQLFDDEDMDIUH-
FXHQFLD +] DODTXHFRUUHVSRQGHXQYDORUPHGLRGHUHDFWDQFLDGHA
FJV TXHVXSRQHFRPSOLDQFLDDF~VWLFDFDOFXODEOHDSDUWLUGHODUHODFLyQ

;  GHGRQGH&T u VA).
&T
(VWDXQLGDGHVHTXLYDOHQWHDFPGLQ
6LGLYLGLPRVHVWDUHDFWDQFLD;SRUODLPSHGDQFLDQRUPDOPHGLDGHORtGR
REWHQHPRVXQDimpedancia relativaTXHSXHGHFRQVLGHUDUVHFRPRXQDFLHUWD
PHGLGDGHOUHHMRHVWDSHGLDO VLHPSUHVREUH+] TXHHVXQDWDUHDGHORV
,PSHGDQFLyPHWURVR$GPLWDQFLyPHWURV
3DUD FRPSOHWDU HVWH DSDUWDGR \D VROR QRV TXHGD SRU GHPRVWUDU TXH la
compliancia timpnica no se mide en segundos sobre A , sino enFP HQ
PDJQLWXG o volumen equivalente de una cavidad hueca y llena de aire que
presente la msma compliancia.
$OKDEODUGHHTXLYDOHQFLDVGHGXMLPRVTXH&A &m.S  \SRURWUDSDUWH
VLGHVLJQDPRVSRUGHVSOD]DPLHQWRYLEUDFLRQDOGHODPDVD>YpDVH$S  @VH
REWLHQH
6 9
&m = = OXHJR & = =
T
) S6 p p
/RTXHFRLQFLGHFRQHOSURSLRFRQFHSWRGH&RPSOLDQFLDGHXQYROXPHQ
HVWRHVODYDULDFLyQGHYROXPHQSRUXQLGDGGHSUHVLyQLQWHUQD
6LHQGRHODLUHMXQWRFRQODVRQGDVVRQRUDVHOXLGRFRQWHQLGRHQODFDYLGDG
ODUHODFLyQVHGHGXFHGLIHUHQFLiQGRHQODHFXDFLyQWHUPRGLQiPLFDGHHVWDGR

59
Captulo 6

GHODVtransformaciones adiabticas
39 FWH 
  6LKDFHPRVG3 S\3 30 + p | P0GLIHUHQFLDQGRHQOD  
dV V
S9309G9   \
p 30
&RPR30 GLPFPTXHHVHOYDORUQRUPDOGHODSUHVLyQDWPRVIpULFD
3RUWDQWR
dV VeFP5
&T = = \GHDTXtHOYROXPHQHTXLYDOHQWHVHUi
p [GLQ
Ve [&TGLQFP3HURFRPRODFRPSODQFLDWLPSiQLFDPHGLD D
+] HVGHORUGHQGH[FP5GLQOHFRUUHVSRQGHUtDXQDFDYLGDG
FRQXQYROXPHQHTXLYDOHQWHGHDLUH
GLQ FP5
Ve [ FP
FP GLQ
que es el 9ROXPHQHTXLYDOHQWHHVWLPDGRFRPRYDORUPHGLRGHODFRPSOLDQFLD
WLPSiQLFDKXPDQD RtGRVDQR 
/DPHGLGDGHHVWDFRPSRQHQWHWLPSiQLFD\VXYDULDFLyQFRQODGLIHUHQFLD
GHSUHVLyQHVWiWLFDHQODVGRVFDUDVGHODPHPEUDQDWLPSiQLFDFRQVWLWX\HQODV
WpFQLFDVGH,PSHGDQFLRPHWUtD R$GPLWDQFLRPHWUtD \7LPSDQRPHWUtDGHDOWR
YDORUGLDJQyVWLFRHQ2WRORJtD\$XGLRPHWUtD

60
Captulo 7

  'HQLFLyQGHUXLGR
Dijimos anteriormente que un sonido o un tono puro era el que estaba com-
puesto por una sola frecuencia y cuya representacin se da en la Fig. 42 (A).
Los sonidos que se encuentran en la mayor parte de las situaciones prc-
ticas son combinaciones ordenadas o desordenadas de tonos puros. Estos
sonidos compuestos o complejos son llamados respectivamente sonidos ape-
ridicos o ruido.
Los agradables, sonidos peridicos y armnicos, caractersticos de los
emitidos por los instrumentos musicales, presentan una onda que repite su
forma en el tiempo, tal y como se indica en la Fig. 42 (B).
Su representacin matemtica resulta de la aplicacin del anlisis de
Fourier, o descomposicin espectral de un sonido complejo como combina-
cin de tonos puros de frecuencias mltiples.
3RUQGHQLPRVFRPRruido a aquel sonido complejo que tiene nume-
URVDVXFWXDFLRQHVDOHDWRULDVGLVWULEXLGDVDORODUJRGHXQDPSOLRPDUJHQGH
frecuencias (Fig. 42 [C]).
6XEMHWLYDPHQWHORVUXLGRVSXHGHQWDPELpQGHQLUVHFRPRWRGRVRQLGRQR
deseado (desagradable al odo y a la persona) por ser de carcter desarmnico
o estridente.
Los ruidos ms empleados en audioprtesis o ruidos de enmascaramiento
Mascking, se dividen en:
Ruido blanco: en el cual, el nivel espectral es constante en todas las fre-
cuencias, y la energa espectral del ruido depende del ancho de banda (carac-
terizada por el valor de su frecuencia central), en que sea analizado.
Ruido rosa: la energa espectral es independiente del ancho de banda del
DQiOLVLV\RWURVYDULRVTXHHVSHFLFDUHPRVPiVDGHODQWH

61
Captulo 7

)LJ A: Representacin de una onda sinusoidal pura, o sonido puro, con su anlisis
espectral.
B: Representacin de una sonda peridica compuesta (con armnicos), con su
representacin espectral respectiva.
C: Representacin de un sonido inarmnico y aperidico (ruido), con su anlisis
espectral en bandas.

62
Captulo 7

Aqu se pueden aplicar todos los conceptos que hemos estudiado para el
sonido: potencia y presin sonoras, intensidad en dE, etc.

  )XHQWHVVRQRUDV
Pueden ser de lo ms variadas y son todos aquellos elementos que dan
lugar a la llamada contaminacin acstica y que, en mayor o menor grado,
existen en todos los lugares del mundo y de nuestra vida ordinaria, salvo en
el campo libre y solitario.
Para su estudio se han separado rodamientos, engranajes, combustin,
ruido de maquinaria elctrica, vibraciones en mquinas, ruido generado por
equipos industriales, ventiladores, etc.

)LJ 5HSUHVHQWDFLyQJUiFDGHODVWUHV5HGHVR&XUYDVGH3RQGHUDFLyQ$%\&

63
Captulo 7

Antes de tratar de analizar cada uno de estos elementos sonoros hemos


de explicar que para intentar simular en los equipos de medida (que estudia-
remos posteriormente) las caractersticas de la audicin, se introdujeron las
denominadas Redes o Curvas de PonderacinTXHHQGHQLWLYDQRVRQPiV
TXHXQRVOWURVHOHFWUyQLFRVTXHPRGLFDQODVHxDOVRQRUDSDUDFDGDEDQGDGH
frecuencia, adaptndola a las curvas de audicin (Fig. 43).
Las tres redes ms utilizadas son:
- La red A que corresponde al inverso del contorno o lnea isofnica de
40 Fones, que es la que corrige las frecuencias altas y bajas.
/DUHG%TXHUHFXHUGDDOLQYHUVRGHOFRQWRUQRGH)RQHV\UHFWLFD
las frecuencias muy bajas.
- La red C que corresponde a una respuesta prcticamente lineal.
Las medidas de los niveles de presin sonora (SPL) obtenidas por lectura
de los Sonmetros, XVDQGRHVWRVOWURVUHFLEHQHOQRPEUHGHNiveles Sonoros
(NS), expresados en dE(A), dE(B) y dE(C), dependiendo de la red usada.
En la actualidad, es la red A la que ms ampliamente se utiliza, por corre-
lacionarse mejor con la respuesta subjetiva del individuo y de la comunidad
frente al ruido.
El estudio del nivel sonoro con el tiempo, permite FODVLFDUORVUXLGRVen:
1.) Constantes o continuos; 2.) Estables; 3.) Fluctuantes o aleatorios; y 4.)
De impulsos o impactos. Los primeros, como su nombre indica, se caracte-
rizan por la estabilidad del NS a lo largo de un periodo grande de tiempo;
ejemplo: ruido de motores elctricos, bombas de agua. Los segundos, cuando
el nivel de presin acstica poderado A (LpA) tiene una variacin mxima,
entre mximos y mnimos, de 5 dE. Los terceros, tanto el nivel de presin
acstica como su espectro varan de forma aleatoria, ms o menos mode-
UDGDPHQWHVLJXLHQGRDOJXQDXFWXDFLyQGHODSURSLDIXHQWHGHODGLVWDQFLD
IXHQWHUHFHSWRU R GHO PHGLR HQ TXH VH SURSDJD HMHPSOR HO WUiFR URGDGR
Finalmente, los cuartos o ruidos de impactos se caracterizan por el rapidsimo
incremento y disminucin de la presin sonora con el tiempo; ejemplo: los dis-
SDURVGHDUPDVGHIXHJRRJROSHVGHPDUWLOORSLOyQ(VWRVVRQORVPiVGDxLQRV
para el aparato auditivo, pues es imposible la adaptacin, y pueden producir
las ms variadas y agudas lesiones: desde la rotura traumtica de la mem-
EUDQDWLPSiQLFDKDVWDGDxRSHUPDQHQWHHQORVQHUYLRVDF~VWLFRVHLQFOXVRGHO
cerebro.

64
Captulo 7

Tambin el ruido ambiental ha aumentado mucho. Durante los ltimos 20


DxRVODFDQWLGDGWRWDOGHHQHUJtDDF~VWLFDSURGXFLGDVHKDGREODGRHQORVSDtVHV
miembros de la Comunidad Europea. As, entre 1960 y 2005, la circulacin de
DXWRPyYLOHVVHKDFXDGUXSOLFDGR\HOWUiFRDpUHRVHKDPXOWLSOLFDGRSRU
Antes de continuar, vamos a exponer unas nociones fundamentales para
todo el que estudie ms ampliamente el tema del ruido. Vamos a ver qu se
entiende por Nivel Continuo Equivalente (Leq TXHDSDUHFHFXDQGRODVXF-
tuaciones del nivel de ruido varan aleatoriamente en un periodo de tiempo
T, y est considerado como el Nivel de un ruido Cte. que tuviera la misma
energa sonora que aquel, durante el mismo periodo de tiempo T.

donde t = t1 t0 = tiempo de trabajo expuesto al ruido, Tmax es el periodo de tiempo


considerado como mximo en esta situacin, L(t) es Nivel de ruido instantneo.
Si L(t) es el nivel de presin sonora instantneo del ruido en bandas de
frecuencia, en dE(A), Leq representa el Nivel Continuo equivalente, expresado
tambin en dE $ SDUDFDGDXQDGHGLFKDVEDQGDV6LODSDVDUDDVHU 6 /
i
W /LRSURPHGLRGHO1LYHODFXiWLFRHTXLYDOHQWHHQG $ 
3RURWURODGRGHQLUHPRVNivel diario equivalente (LAeqd) como el nivel de
ruido medido mediante la red de ponderacin A (curva A del Sonmetro) cons-
tante, que en las 8 horas diarias VHUHHUHDXQWUDEDMDGRU tiene la misma energa
WRWDOTXHHOUXLGRXFWXDQWHPHGLGR Este nivel est directamente relacionado
con la integracin matemtica del cuadrado de la presin sonora (dE(A)):

donde t = t2 - t1 es el tiempo de trabajo expuesto al ruido, PA(t) es la Presin


Acstica instantnea, y Tmax el mismo de antes.
Por otro lado, denominamos Nivel de Pico (Lmax) (vase Fig. 46) como el
valor del nivel, en dE, dado por la ecuacin:

65
Captulo 7

donde Pmax es el valor mximo de la presin acstica instntanea a la que est


expuesto el trabajador (en Pascales) y PO es la presin de referencia umbral (2
u 10-5 Pas {3DV 

)LJ Presentacin de la mayora de los elementos industriales productores de ruido, en


tres columnas: A = su variacin de la fuerza de excitacin con el tiempo. B = su
espectro sonoro. C = su variacin del nivel de dichas fuerzas con la velocidad.

  5XLGRSURGXFLGRSRUHTXLSRVLQGXVWULDOHV
Vamos aqu a tratar de dar un somero repaso a las distintas caractersticas
de los ruidos generados por la variada maquinaria industrial.
Para ello, y sin profundizar, qu sera ms propio de un curso especializado en
Ruido, podemos contemplar la Fig. 44, en donde se presenta, para la mayora de
elementos industriales productores de ruidos, la variacin con el tiempo de sus

66
Captulo 7

fuerzas de excitacin (A) (causantes del ruido), los espectros de dichas fuerzas (B)
y la variacin del nivel de dichas fuerzas con la velocidad (C).

  0pWRGRV\HTXLSRVGHPHGLGDVRQyPHWURV
La medida prctica y ms simple de la intensidad de un sonido o ruido se
realiza mediante un instrumento complejo denominado sonmetro.
Si observamos la Fig. 45, en la que aparece el esquema de un sonmetro
genrico, vemos que est compuesto, en primer lugar, por un micrfono (1), un
DPSOLFDGRUFRQFDUDFWHUtVWLFDVHVSHFLDOHV\QDOPHQWHSRUXQLQVWUXPHQWR
de medida (6), sobre el cual puede leerse la intensidad de la presin sonora
que recibe el aparato en dE (A, B o C) (segn la escala que se le indique).
6XIXQFLRQDPLHQWREDVHHVODWUDQVIRUPDFLyQGHODVHxDOVRQRUDHQHOpF-
WULFDTXHVHSURGXFHHQHOPLFUyIRQR  \HVPDJQLFDGDSRUun primer paso
DPSOLFDGRU  $FRQWLQXDFLyQXQOWURHVSHFLDO  GHMDSDVDUODVIUHFXHQ-
cias de forma similar a como lo hace el odo humano, atenuando las la sensi-
bilidad del aparato hacia uno de los extremos (Fig. 45).
3RVWHULRUPHQWHXQDQXHYDDPSOLFDFLyQ SDVR   OOHYDODVHxDOHOpFWULFD
DXQQLYHOVXFLHQWHSDUDGHVSOD]DUODDJXMDGHOLQGLFDGRU   ORVPiVPRGHUQRV
nos proporcionan el valor de medida en nmeros en un display digital), pero
antes pasa por un circuito (5) que ajusta la lectura (analgica o digital) para
TXHHVWDFRUUHVSRQGDDORTXHOODPDPRVYDORUHFD]GHODVHxDOVRQRUDFX\D
expresin matemtica la vemos seguidamente. Para ello, en la siguiente Fig. 46,
YDPRVDGLVWLQJXLUJUiFDPHQWH\PDWHPiWLFDPHQWHTXpHQWHQGHPRVSRUNivel
HFD] as otros tambin importantes como son: los Valores de Pico, de Pico a
Pico y Nivel medio. 3HURHQODSUiFWLFDVRORYDPRVDPDQHMDUHOYDORUHFD]GH
ODVHxDOVRQRUDH[SUHVDGRHQGE(A) y otros en el sonmetro.

)LJ Diagrama de bloques que componen un Sonmetro.

67
Captulo 7

)LJ Representacin de la variacin en dB de un sonido en funcin de la frecuencia,


detalles del nivel de pico, de pico a pico, nivel medio y QLYHOHFD] de un sonido
puro, y los mismos parmetros para un ruido no peridico.

68
Captulo 7

)LJ Esquema de una Barrera acstica, con la sombra acstica que produce.

  6ROXFLRQHVRUHFXUVRVJHQHUDOHVSDUDHOFRQWUROGHOUXLGR
6LFRQVLGHUDPRVTXHWDQWRHOWUiFRHQODVFLXGDGHVVREUHWRGRHOTXHKDQ
de soportar las viviendas que se encuentran ubicadas en las proximidades de
una va rpida o carretera de mucha circulacin, as como los ruidos indus-
triales derivados de aparatos o maquinaria pesada, una de las mejores formas
de atenuarlos es mediante la instalacin de Barreras Acsticas.
6H HQWLHQGH SRU EDUUHUDV DF~VWLFDV DTXHOODV VXSHUFLHV VyOLGDV FRQ VX-
FLHQWHSHVRVXSHUFLDO SDUHGHVGXUDV\GHQVDV FRQDOPHQRV.SPTXH
suelen interponerse en la marcha de las ondas sonoras, impidiendo parcial-
mente su propagacin y creando una zona de sombra acstica ( Fig. 47).
Esta atenuacin de los niveles sonoros est originada por la difraccin
que sufren estas ondas al alcanzar los bordes de la barrera. Por otra parte,
HGLFDFLRQHVPRQWtFXORV\HQJHQHUDOEDUUHUDVVyOLGDVDUWLFLDOHVVRQREV-
WiFXORVUHODWLYDPHQWHHFDFHVSDUDFRQVHJXLUDWHQXDFLRQHVORFDOHVHQiUHDV
HVSHFtFDV

69
Captulo 7

)LJ *UiFDTXHSHUPLWHXQFiOFXORUiSLGRGHla atenuacin del sonido producida por


una fuente puntual, debida a la presencia de una barrera rgida en funcin del
nmero de Fresnel N.

70
Captulo 7

)LJ Figura que presenta los sistemas ms comunes de control de ruido industrial,
actuando sobre la fuente o sobre su transmisin o sobre el receptor.

La atenuacin que ofrece una barrera acstica no es funcin nica de sus


dimensiones, sino que tambin depende de las distancias relativas del obser-
vador y de la fuente a lla. Una extrapolacin de las teoras de Fresnel sobre
la difraccin de ondas nos permite obtener una expresin matemtica para el
clculo de la atenuacin L que presentan las barreras acsticas para fuentes
puntuales:
2SN
L 20 log  5,  HQGSPL) (92)
Th 2SN
siendo NHO1~PHURGH)UHVQHOTXHYLHQHGHQLGRSRU
2
N
O
>( A  B )  d @ , (93)

donde es la longitud de onda del sonido incidente, en m.


d es la distancia de la fuente sonora al receptor, en m.
A +B es la distancia mnima que recorre la onda sonora desde la fuente al
receptor en m (pasando por encima de la barrera).

71
Captulo 7

)LJ Especie de historieta en que se puede observar las posibles soluciones consecutivas
que pueden adoptarse para la progresiva eliminacin del ruido de una mquina en
un puesto de trabajo prximo a ella.

72
Captulo 7

8QDJUiFD )LJ TXHSHUPLWHHOFiOFXORUiSLGRGHHVWDDWHQXDFLyQVH


SUHVHQWDHQGLFKDJXUD(OOtPLWHLQIHULRUDSUR[GVHSURGXFHSDUDIUH-
cuencias muy bajas o para la posicin del observador muy prximo a la lnea
de visin directa de la fuente sonora. El lmite superior est determinado
por las condiciones ambientales y ha sido establecido experimentalmente en
DSUR[G
/DV EDUUHUDV DUWLFLDOHV VRQ HIHFWLYDV \ UHODWLYDPHQWH HFRQyPLFDV HQ HO
FDVRGHOWUiFRURGDGRVLHPSUHTXHVXVGLPHQVLRQHVORQJLWXGLQDOHVVHDQDGH-
FXDGDV\FXDQGRVHWUDWHGHSURWHJHUHGLFDFLRQHVGHEDMDDOWXUD XQDRGRV
plantas como mximo). Igualmente se utilizan con xito para proteger deter-
PLQDGDV]RQDVGHODUDGLDFLyQVRQRUDJHQHUDGDVSRUIXHQWHVMDVRPyYLOHV
limitadas (servicios mecnicos en terrazas o aparcamientos, etc.). Ahora bien,
para conseguir una adecuada disminucin de ruido industrial habr que actuar
sobre tres aspectos (vase Fig. 49):
- Control de ruido en la fuente.
- Disminucin de los efectos de transmisin.
- Aislando lo ms posible al receptor.
7RGR HVWR TXHGD PiV FODUR HQ OD )LJ  HQ TXH VH REVHUYDQ JUiFD-
mente las posibles soluciones consecutivas que pueden adoptarse para que
el operario de esa mquina pueda seguir trabajando bien, sin adquirir una
hipoacusia de percepcin que, prcticamente, lo inutilizara al trmino de su
vida laboral.

  1RPHQFODWXUD\OHJLVODFLyQ
(QFXDQWRDODQRPHQFODWXUD\DKHPRVH[SOLFDGRORVXFLHQWHSDUDXQWH[WR
general, no insistiendo ms sobre ello. Quien desee un mayor conocimiento, tendr
que acudir a cursos o textos dedicados exclusivamente al Ruido.
En cuanto a apartados de la legislacin, no es muy actual, tenemos:
 5HDO 'HFUHWR  GH  GH 2FWXEUH %2(  GH  1RY  VREUH
proteccin de los trabajadores frente a los riesgos derivados de la exposicin
al ruido durante el trabajo (en este hay nomenclatura).
 &RUUHFFLyQ GH HUURUHV HQ HO 5HDO 'HFUHWR  GH  GH 2FWXEUH
(BOE 295 de 9 Dic.) sobre la proteccin de los trabajadores.
- Ordenanza General de Proteccin del Medio Ambiente Urbano (Decla-
racin de zonas protegidas).

73
Captulo 7

- Ordenanza de Instalacin y Uso de Sirenas y Alarmas (EA de M.)


'LUHFWLYDGHOD&RPLVLyQGHGHDEULOGHSRUODTXHVHDGDSWDDO
SURJUHVR WpFQLFR OD 'LUHFWLYD &(( GHO &RQVHMR UHODWLYD D OD DSUR[L-
macin de las Legislaciones de los Estados miembros, sobre el nivel sonoro
DGPLVLEOH\HOGLVSRVLWLYRGHHVFDSHGHORVYHKtFXORVGHPRWRU &(( 
'LDULR2FLDOGHODV&RPXQLGDGHV(XURSHDVQ~PHUR/GHGHPD\RGH
<RWURVPXFKRVGHVSXpVUHODWLYRVDOPLVPRWHPD

74
Captulo 8

  0pWRGRVGHPHGLGD\FXDQWLFDFLyQDXGLWLYD
/DSULPHUDSDUWHGHHVWDFXHVWLyQSRGHPRVGHQLUODFRPROD$XGLRPHWUtD
LQVWUXPHQWDOFOiVLFDTXHHVWiFRQVWLWXLGDSRUXQDVHULHGHSUXHEDVVHQFLOODV
TXHIXHURQODVSULPHUDVTXHVHXWLOL]DURQSDUDREWHQHULQIRUPDFLyQVREUHOD
SRVLEOHhipoacusia* de un determinado sujeto.
(O PpWRGR PiV SULPLWLYR DXQTXH SRU VX VHQFLOOH] QR PHQRV ~WLO \ TXH
D~QHOPRGHUQR$XGLRSURWHVLVWDHPSOHDFDVLVLQTXHUHUORFXDQGRFRPLHQ]DD
WUDWDUFRQHOVXMHWRTXHDFXGHHQEXVFDGHVXD\XGDHV
- El mtodo de la Voz hablada o el examen de la Audicin por la Voz:
6XSRQLHQGRTXHODGLVWDQFLDGHVHSDUDFLyQHQWUHHOH[DPLQDGRU\HOVXMHWRHV
GHXQRVFPDSUR[LPDGDPHQWHSXHGHQRFXUULUORVVLJXLHQWHVFDVRV
D  &XDQGR D HVWD GLVWDQFLD 12 VH R\H OD YR] dbilmente cuchicheada
SRGHPRVVXSRQHUTXHH[LVWHXQDSpUGLGDPHGLDGHXQRV30 dE.
E &XDQGRtGHPQRVHSHUFLEHODYR]fuertemente cuchicheadaSRGHPRV
VXSRQHUTXHH[LVWHXQDSpUGLGDPHGLDGHXQRV45 dE.
F &XDQGRtGHPQRVHR\HODYR]normal o moderadaSRGHPRVVXSRQHU
TXHSRVHHXQDSpUGLGDPHGLDGHXQRV60 dE.
G  &XDQGR SDUD RtU KD\ TXH KDEODUOH HQ YR] alta SRGHPRV VXSRQHU XQD
SpUGLGDGHXQRV75 dE.
H &XDQGRKD\TXHKDEODUOHDJULWRVHVGH90 dERPiV
I 3RU~OWLPRFXDQGRDSHVDUGHORVJULWRVQRVHHQWHUDHVVRUGRSUR-
IXQGR FRQRVLQUHVWRVDXGLWLYRV RSRVHHXQDFRIRVLV SpUGLGDWRWDOGHO
yUJDQRDXGLWLYR 

1RPEUHPRGHUQRTXHVHGDDOD DQWLJXD VRUGHUD

75
Captulo 8

8.2) Tcnicas de Acumetra. Diapasones.


'HVLJQDPRVSRU$FXPHWUtDXQDVHULHGHWpFQLFDVPiVFRPSOHMDVTXHHOPpWRGR
DQWHULRUTXHYLHQHQVLHQGRPDQHMDGDVSRUORVRWyORJRVGHVGHKDFHPXFKRWLHPSR
EDVDGDVHQODSHUFHSFLyQGHOVRQLGRGHYLEUDFLyQGHORVGHQRPLQDGRV'LDSDVRQHV
TXHHVWXGLDUHPRVDFRQWLQXDFLyQTXHVRQFRQRFLGRVFRPRIXHQWHHVWDEOHGHVRQLGR
GHVGHKDFHEDVWDQWHVDxRV\TXHDSHVDUGHORVDYDQFHVGHODVPHGLGDVHOHFWUy-
QLFDVQRGHMDQGHVHUXVDGRVSRUODPD\RUtDGHORVRWRUULQRODULQJyORJRV
8QDYH]YLVWDHVWDLQWURGXFFLyQSRGHPRVSDVDUDGHQLUTXpHQWHQGHPRV
SRU'LDSDVRQHV YHiVH)LJ 

Fig. 51. 'LEXMRGHXQGLDSDVyQFRQVXPDQJR\GRVUDPDV

Fig. 52 5
 HSUHVHQWDFLyQGHODVPHGLGDVWRPDGDVHQXQ:HEHUFRQODSDUWLFXODULGDGGHTXH
ODIUHFXHQFLDGH+]QRHVWiODWHUDOL]DGD

76
Captulo 8

/RV'LDSDVRQHVVRQXQRVLQVWUXPHQWRVFOiVLFRVIXQGDPHQWDOHVHQODSUL-
PLWLYD$FXPHWUtD\HVWiQFRQVWLWXLGRVSRUXQDHVSHFLHGHKRUTXLOODJUXHVD\
FRQVLVWHQWHGHDFHURWHPSODGRRGHDOHDFFLRQHVGHPDJQHVLRTXHFRQVWDGH
XQPDQJR\GRVUDPDVLJXDOHVTXHDOVHUJROSHDGDV\SRQHUVHHQYLEUDFLyQ
QRVVXPLQLVWUDQWRQRVSXURV RGHXQDIUHFXHQFLD~QLFD (OFOiVLFR6HWGH
+DUWPDQFRQVWDGHXQMXHJRGHGLDSDVRQHV )LJ FX\RVVRQLGRVYDQ
HQ RFWDYDV VXFHVLYDV GHVGH  +] D  +] VLHQGR HO SULPHUR HO PiV
JUDYH \HO~OWLPR HOPiVDJXGR ORVPiVXWLOL]DGRVHQODVH[SORUDFLRQHV
7RGDYtDHQWUHORVRWyORJRVHVPX\GHEDWLGRHOWHPDGHODLPSRUWDQFLDGH
HVWRVLQVWUXPHQWRVSXHVSDUDDOJXQRVKDQTXHGDGRDQWLFXDGRVDOH[LVWLUOD
PRGHUQD$XGLRPHWUtDHOHFWUyQLFDRGLJLWDOPLHQWUDVTXHODPD\RUtDSLHQVD
TXHWRGDYtDSXHGHQVHUXWLOL]DGRVSDUDREWHQHUXQDRULHQWDFLyQVREUHHOWLSR
GH KLSRDFXVLD \ HO QLYHO PtQLPR GH DXGLFLyQ GHMDQGR OD FRQIHFFLyQ GH XQ
DXGLRJUDPDSDUDORVFDVRVHQTXHVHQHFHVLWHQGDWRVPiVSUHFLVRV
&RQYLHQHJROSHDUHOGLDSDVyQVREUHXQDPLVPDVXVWDQFLDDXQTXHFRQXQ
JROSHVHFRSHURVXDYHFRQREMHWRGHTXHQRVHDxDGDQDUPyQLFRVKHPRVGH
KDFHUORVREUHIHOSDSDUDORVTXHSURGXFHQVRQLGRVJUDYHV 3+] \XQDJRPD
GXUDSDUDORVTXHGDQVRQLGRVDJXGRV !3+] 

8.3) Pruebas de Weber y Rinne.


(VWDVGRVSUXHEDVVRQODVPDVEiVLFDV\IXQGDPHQWDOHVGHWRGRHOFRQWH-
QLGRGHOD$FXPHWUtD

Fig. 52 )RWRJUDItDGHXQHVWXFKHFRQWHQLHQGRXQ6HWGH+DUWPDQ

77
Captulo 8

9HDPRVHQTXpFRQVLVWHODSULPHUD 3UXHEDGH:HEHU HVWDVHUHDOL]DDOFRORFDU


XQGLDSDVyQGHODWHUQDJUDYH R RYDULRVVXFHVLYRVGHGLVWLQWDVIUH-
FXHQFLDV VLHPSUHGHODWHUQD ya en vibracinHQHOGHQRPLQDGR9HUWH[ RFHQWUR
GHODOtQHDPHGLDGHOKXHVRIURQWDO \DFRQWLQXDFLyQVHSUHJXQWDDOVXMHWRVLVLHQWH
LJXDOODYLEUDFLyQSRUORVGRVRtGRV\VLQRHVDVtSRUFXiOR\HPHMRU3XHGHQ
VXFHGHUWUHVFDVRV
D 6LR\HLJXDOSRUDPERVODGRVSXHGHVHUSRUTXHVHDQRUPR\HQWH QRSRVHH
KLSRDFXVLD HQ QLQJ~Q RtGR  QRUPDO HQ DXGLFLyQ  R ELHQ SRUTXH SRVHD XQD
KLSRDFXVLDVLPLODUSRUDPERVODGRV
E Que oiga ms fuerte por el odo mejor RPHQRVKLSRDF~VLFRORTXHLPSOLFD
una Hipoacusia unilateral de Percepcin.
c) Que se perciba mejor con el odo mas hipoacsico RGHSHRUDXGLFLyQORFXDO
LPSOLFDXQD+LSRDFXVLDGH7UDQVPLVLyQ
(VWRHQOHQJXDMHSURSLRVHGLFHTXHODWHUDOL]DKDFLDWDORtGRSRUORTXHHQ
XQDUHSUHVHQWDFLyQJHQpULFDGHHVWDSUXHEDVHREVHUYDHQOD)LJFRQHOVLJXLHQWH
GLDJQyVWLFRSRVLEOHHQ\+]DIHFWDGR2,SRUKLSRDFXVLDGHSHUFHSFLyQ
HQ+]LPSOLFDDIHFWDGRSRUKLSRDFXVLDGHWUDQVPLVLyQHQHVHRtGR2
VHDHQUHVXPHQKLSRDFXVLDPL[WDHQRtGRL]TXLHUGR
9HDPRVDKRUDODH[SOLFDFLyQGHODDQWHULRUGLYLVLyQ(VWXGLDUHPRVSULPHURHO
FDVRE GHXQDKLSRDFXVLDGHSHUFHSFLyQHORtGRFRQPHQRVUHVHUYDFRFOHDUHVHO
PHQRVVHQVLEOHGHORVGRVDOHVWtPXORVRQRURHQFDPELRQRVHVDEHFRQFHUWH]D
SRUTXpHQODVOHVLRQHVFRQGXFWLYDVVHUHIXHU]DHOVRQLGRHQHOODGRGHSHRUDXGL-
FLyQ7DPELpQPRGHUQDPHQWHVHWLHQGHDFRQVLGHUDUHVWHDXPHQWRGHDXGLFLyQSRU
IHQyPHQRVGHHQPDVFDUDPLHQWRTXHWLHQHQOXJDUHQHORtGRVDQRRFRQPHQRV
OHVLRQHVGHWUDQVPLVLyQFRQHOVRQLGRTXHHQWUDSRUHOFRQGXFWRDXGLWLYRSHQHWUD
WDPELpQWRGRHOUXLGRDPELHQWDOHQVRUGHFLHQGRODDXGLFLyQHQORVFDVRVQRUPDOHVR
FRQKLSRDFXVLDVGHSHUFHSFLyQORFXDOLPSOLFDTXHse oye mejor por el bueno.
(QODVFRQGXFWLYDVFDVRF HVWHHQPDVFDUDPLHQWRQRVHSURGXFHSRUQRUHFLELU
ODLQWHUIHUHQFLDGHOPHGLRDPELHQWHUXLGRVRGHELGRDODEDUUHUDRSXHVWDDOSDVRGHO
VRQLGRSRUYtDDpUHD\FRPRODyVHDVHHQFXHQWUDQRUPDOPHQWHHQEXHQDVFRQGL-
FLRQHVHORtGRFDSWDSRUHVWDYtDWRGRHOVRQLGRVLQGLFXOWDGGHQLQJXQDFODVH R
PHMRUHQHOWDSDGRKLSRDF~VLFRTXHHQHOQRUPDODELHUWR 
Veamos ahora la Prueba de RinneWLHQHHOSURSyVLWRGHHVWDEOHFHUODGLIHUHQFLD
HQWUHODDXGLFLyQHQXQPtVPRRtGRSRUYtDDpUHD\SRUYtDyVHD3DUDOOHYDUODD
FDERVHFRORFDHOGLDSDVyQHQHOPDVWRLGHV\OXHJRDOODGRGHORtGR HQHODLUH 

78
Captulo 8

XWLOL]DQGRWDPELpQHOGLDSDVyQGH+]SRUVXSXHVWRHQYLEUDFLyQ3XHGHQGDUVH
WDPELpQWUHVFDVRV
D 6LVHR\Hms por va sea que por va areaLQGLFDTXHVHWUDWDGHXQD
Hipoacusia de Transmisin \VHGHQRPLQD5,11(1(*$7,92 
E 6LVHR\Hms por va area que por va sea, puede ser una audicin normal
o una Hipoacusia de Percepcin\VHGHQRPLQD5,11(326,7,92  
F 7DPELpQH[LVWHXQIDOVR5LQQHQHJDWLYRFXDQGRHVXQLODWHUDOGHSHUFHS-
FLyQSXHVHQWRQFHVVHSXHGHRtUSRUHOFRQWUDODWHUDO3DUDWHUPLQDUYHDPRVHQHO
FXDGURVLJXLHQWH 7DEOD ODVGLIHUHQWHVUHVSXHVWDVTXHSRGHPRVREWHQHUFRQHVWD
SUXHED\VXGLDJQyVWLFRSUHFLVR

&RPRFRORIyQSUHVHQWDPRVOD7DEODHQODTXHVHFRQWLHQHQWRGRVORVSURFH-
GLPLHQWRVGHHVWDVGRVSUXHEDVDGHPiVGHODVSUXHEDVGH%LQJ\*HOOH

79
Captulo 8

80
Captulo 8

  (ODXGLyPHWUR6XHYROXFLyQ&yPRHVWiFRQVWLWXLGR
Funcionamiento.
3RU GHQLFLyQ HV XQ DSDUDWR TXH VLUYH SDUD PHGLU OD DXGLFLyQ GHO ODWtQ
audireRtU\GHOJULHJRmetronPHGLGD 2WURVDSDUDWRVWDPELpQFXPSOHQFRQ
HVWDSUHPLVDSHURVHGD~QLFDPHQWHHOQRPEUHGHAudimetro, HQODDFWXD-
OLGDGa un aparato electrnico que genera sonidos puros, de diferente fre-
cuencia, sin decaer en intensidad.
3RURWURODGRWDPELpQVHSXHGHDPSOLDUHVWDGHQLFLyQHQUHODFLyQDVX
XWLOLGDG HO DXGLyPHWUR HV XQ DSDUDWR HOHFWUyQLFR que sirve para medir la
capacidad de audicin de un sujeto, tanto su umbral mnimo como su umbral
superior de molestia (Inconford), adems de poder explorar sus posibilidades
audiomtricas caracterizando su rea auditiva.
6XIXQGDPHQWRVHUiSRUWDQWRXQJHQHUDGRUGHRVFLODFLRQHVHQWUHWHQLGDV
GH DXGLRIUHFXHQFLD FDOLEUDGDV WDQWR HQ OR TXH UHVSHFWD D VX IUHFXHQFLD HQ
FLFORVVFRPRHQVXLQWHQVLGDGHQdE
/DLGHDGHFRQVWUXLUXQLQVWUXPHQWRSDUDHVWRVQHVTXHWXYLHUDODYHQWDMD
VREUHORVGLDSDVRQHVGHsostener permanentementeHOYROXPHQGHOVRQLGRTXH
XWLOL]DPRVHQODH[SORUDFLyQpoder conocer la cuanta del mismo y variarla
a voluntad as como su frecuenciaQRHVQXHYD(QXQSULQFLSLRVHXVDURQORV
VLVWHPDVSXUDPHQWHPHFiQLFRVHQ+DUWPDQQLGHyXQDSDUDWRGHHVWDV
FDUDFWHUtVWLFDVTXHGHQRPLQyAcmetro \SRVWHULRUPHQWHRWURVKDVWDOOHJDU
DHQ$OHPDQLDGRQGHVHFUHyHOSULPHUDSDUDWRGRWDGRGHYiOYXODVWHU-
PRLyQLFDVDOTXHVHGDHOQRPEUHGH2WRDXGLFLyQGHOFXDOGHULYDQORVTXH
DFWXDOPHQWH SRVHHPRV 3URGXFtD RVFLODFLRQHV GH DXGLRIUHFXHQFLD OODPDGDV
DVtSRUTXHHOQ~PHURGHHVWDVRVFLODFLRQHVVHVWiGHQWURGHODJDPDGHYLEUD-
FLRQHVVRQRUDVTXHHVFDSD]GHVHUSHUFLELGDSRUHORtGRKXPDQR
(VWDVRVFLODFLRQHVVRQDPSOLFDGDVSRURWUDVSDUWHVGHODSDUDWRPHGLDQWHODV
FXDOHVQRVXIUHQQLQJ~QFDPELRFXDOLWDWLYRVLQRVLPSOHPHQWHFXDQWLWDWLYR$O
PLVPRWLHPSR\VREUHHVWDDFFLyQELHQDVXHQWUDGDRELHQDVXVDOLGDVHFRORFD
XQVLVWHPDGHFDOLEUDGRUHJXODGRUGHODLQWHQVLGDGGHODVRVFLODFLRQHVHQdE
(VWDVRQGDVVRQGHQDWXUDOH]DHOpFWULFD\SRUWDQWRQRDXGLEOHV3DUDFRQ-
YHUWLUODV HQ RVFLODFLRQHV DXGLEOHV HV QHFHVDULR TXH D VX VDOLGD KD\D XQ HOH-
mento transductorDXULFXODURDOWDYR]HOHFWURPHFiQLFRHQHOTXHHVWDVRQGDV
PXHYHQSRUPHGLRGHXQVHQFLOORHOHFWURLPiQHQORVFDVRVPiVJHQHUDOHV
XQDPHPEUDQDTXHWUDQVGXFHDvariaciones de presinGHOPHGLRDPELHQWH

81
Captulo 8

Fig.53. (VTXHPDGHEORTXHVGHXQ$XGLyPHWURPRGHUQR

82
Captulo 8

ODVSULPLWLYDVRVFLODFLRQHVHOpFWULFDVLQDXGLEOHVPRYLHQGRDVtODVPROpFXODV
GHDLUHSDUDODH[SORUDFLyQSRUYtDDpUHDRWLPSiQLFDRWUDQVPLWLHQGRHVWDV
YLEUDFLRQHVSRUYtDyVHDGLUHFWDPHQWHDSR\DQGRXQYLEUDGRUVREUHHOPDV-
WRLGHVXRWURSXQWRDQDWyPLFRGHGRQGHSDVDDWUDYpVGHORVWHJXPHQWRVKDVWD
HOLQWHULRUGHODFyFOHDPiVSUy[LPDRDDPEDVFRQGLVWLQWDLQWHQVLGDG
([DPLQHPRVDKRUDHOHVTXHPDGHEORTXHVGHXQDXGLyPHWURPRGHUQR )LJ 
(VWRVDSDUDWRVOOHYDQRWURVFLUFXLWRVGHVWLQDGRVDVXPLQLVWUDUODVWHQVLRQHV
QHFHVDULDV SDUD DOLPHQWDU ORV FLUFXLWRV GHO RVFLODGRU GH DXGLRIUHFXHQFLD
GHO DPSOLFDGRU GHVFULWR $ HVWD OD GHVLJQDPRV FRQ HO QRPEUH GH fuente de
alimentacin.
(QHOJHQHUDGRUGHDXGLRIUHFXHQFLDVHFRQWURODHOQ~PHURGHRVFLODFLRQHVV
SDUD OR TXH VH KD GH GLVSRQHU GH XQ PDQGR PHGLDQWH HO FXDO VH VHOHFFLRQD
DTXHOODIUHFXHQFLDFRQODTXHVHTXLHUHKDFHUHVDSDUWHGHODH[SORUDFLyQ(VWR
VHOOHYDDFDERPHGLDQWHXQFRQPXWDGRUHOFXDOHOLJHXQDVHULHGHSXQWRVD
H[SORUDUDORODUJRGHODJDPDDXGLEOH
(QXQSULQFLSLRVHXWLOL]DURQODVIUHFXHQFLDVGHORVGLDSDVRQHV\TXHHVWRVD
VXYH]ODVKDEtDQWRPDGRGHODHVFDODPXVLFDO0LHQWUDVTXHDKRUDVHFRQVWUX\HQ
ORVDXGLyPHWURVPRGHUQRVFRQIUHFXHQFLDVTXHPDQWLHQHQXQDUHODFLyQGHFLPDO
JHQHUDOPHQWH  HQWUHORVQ~PHURV\VRQQRUPDOPHQWHORVVLJXLHQWHV
\+]
2WURVRVFLODGRUHVJHQHUDQWRGDODJDPDGHIUHFXHQFLDVDXGLEOHVGHXQDIRUPD
FRQWLQXDVLQWUDQVLFLyQHLQFOXVRSXHGHFRQFHELUVHXQVLVWHPDPL[WR
(O DPSOLFDGRU GHO DXGLyPHWUR SXHGH GHVWLQDUVH WDPELpQ D DPSOLFDU ODV
VHxDOHVSURFHGHQWHVGHXQPLFUyIRQRFDVVHWWH&'HWFDPSOLDQGRDVtVXXVR
SDUDH[SORUDFLRQHVDXGLRYHUEDOHV\SRUWDQWRODVSRVLELOLGDGHVGHOLQVWUXPHQWR
%DVWDSDUDHOORGLVSRQHUGHXQFRQPXWDGRUTXHVXSULPDODDFFLyQRVFLODGRUD\
FRQHFWHHODPSOLFDGRUDOPLFUyIRQRXDSDUDWRTXHVHWUDWH7DPELpQSRVHHXQ
DWHQXDGRUFDOLEUDGRHQdETXHFRQWURODHOYROXPHQGHODYR]GHORSHUDGRU
$HVWHUHVSHFWRKHPRVGHWHQHUHQFXHQWDTXHFRPRHOYROXPHQGHODYR]
DOKDEODUGHODQWHGHXQPLFUyIRQRHVXQDYDULDEOHGHSHQGLHQWHGHODSHUVRQDOD
GLVWDQFLDODUHVRQDQFLDHOWRQRGHYR]HWFODFDOLEUDFLyQGHVXLQWHQVLGDGQR
VHPDQWLHQHFRQODPLVPDSUHFLVLyQTXHFRQORVWRQRVSXURVJHQHUDGRVSRUOD
DFFLyQRVFLODGRUD
(ODXGLyPHWURPRGHUQRGLVSRQHDGHPiVGHRWUDVHULHGHFLUFXLWRVLPSXHVWRV
SRU OD WpFQLFD GH H[SORUDFLyQ VXSUDOLPLQDU FRQ GLVWLQWRV QHV GLDJQyVWLFRV

83
Captulo 8

2WURV FLUFXLWRV FRPSOHPHQWDULRV HQ HO DXGLyPHWUR VRQ enmascarador seal


luminosa de respuesta TXH HV XQ FLUFXLWR PX\ VLPSOH TXH SHUPLWH DO VXMHWR
H[DPLQDGRLQGLFDUTXHHOSDFLHQWHR\HSXOVDQGRXQLQWHUUXSWRU\HQFHQGLHQGR
FRQHOPLVPRXQDOXFHFLWDHQHOSDQHOGHODSDUDWRSelector de auricularesTXH
SHUPLWHPDQGDUDHVWRVHOWRQRGHODXGLyPHWURDXQODGRRDORWURRDORVGRVDO
PLVPRWLHPSR PRQRDXUDORELQDXUDO HVWpUHR RKDFHUFRPELQDFLRQHVFRQHO
WRQR\HOUXLGRHQPDVFDUDGRU&DVLWRGRVORVPRGHUQRVDXGLyPHWURVVRQHVWpUHR
FRQGRVRVFLODGRUHV\DPSOLFDGRUHVLQGHSHQGLHQWHV
3RUQYDPRVDHVWXGLDUlos elementos de control y correccin TXHGDQDO
DXGLyORJRODFHUWH]DGHXQDEXHQDPDUFKD\ODSRVLELOLGDGGHVXFRUUHFFLyQHQ
FDVRFRQWUDULR$VtFRQWLHQHXQLQVWUXPHQWRGHPHGLGDGHOWLSRGHXQPLOLDP-
SHUtPHWUR YXyPHWUR TXHQRVVHxDODODVDOWHUDFLRQHVFXDQWLWDWLYDVHQODFDOL-
EUDFLyQVREUHWRGRHQODVSUXHEDVGHLQWHOLJLELOLGDG VLODDJXMDHQWUDHQOD]RQD
URMDHODSDUDWRGLVWRUVLRQD\ODDXGLFLyQYDDHPSHRUDUPXFKR 
+D\ TXH KDFHU FRQVWDU TXH VH WLHQGH D OD QRUPDOL]DFLyQ LQWHUQDFLRQDO HQ
ODVPHGLGDVGHDXGLRORJtD8QSDVRFRQVLGHUDEOHVHGLRHQ3DUtVSRUHO&RPLWp
,QWHUQDFLRQDOQRPEUDGRHOGHDEULOGHEDMRODGLUHFFLyQGHO'U/FKHU
6HGLHURQHQQRUPDVSDUDORVDXGLyPHWURVWRQDOHVSHURVHGHMyVLQUHVROYHU
HOSUREOHPDGHODVDXGLRPHWUtDVYHUEDOHVTXHGHSHQGHQGHFDGDOHQJXD(QOD
DFWXDOLGDG(VSDxDFXHQWD\DFRQODVQRUPDV81(SDUDDXGLyPHWURV 3URSXHVWD
81(MXOLR TXHFRQFXHUGDFRQ&(,& 2& 
/DSRWHQFLDTXHHORSHUDGRUGHEHHQWUHJDUFRPRPtQLPRVHJ~QODVIUHFXHQ-
FLDVVHUiSDUDOD9$ YtD$pUHD VHJ~QODVLJXLHQWH7DEOD

7$%/$
)UHFXHQFLD += ,QWHQVLGDG ZX)
 
 
 
 
 
 
 

84
Captulo 8

(OUXLGRGHIRQGRGHORVDXULFXODUHVVHUiGHdPHQRUTXHHOGHOWRQRTXH
HVWpVXPLQLVWUDQGRHODSDUDWR
9HDPRVDKRUDORVWLSRVGHDXGLyPHWURVTXHKDQLGRDSDUHFLHQGRDORODUJRGH
ODKLVWRULDHQSULPHUOXJDUmecnicos $F~PHWURV electrnicos GHYiOYXODV 
PX\YROXPLQRVRVelectrnicos transistorizadosHOHFWUyQLFRVDQDOyJLFRV FRQ
FLUFXLWRVVXSHUUHGXFLGRV ORVPiVQRUPDOHVDFWXDOPHQWH\digitales ORVVXSHU-
PRGHUQRVHVWRVGRVWLSRV~OWLPRVSXHGHQSRQHUVHHQVHULHFRQXQRUGHQDGRU
SUHYLDPHQWHSURJUDPDGRGDQGRRULJHQDORVAudimetros computarizadosGH
IRUPDTXHHVWRVQRVSXHGHQSURSRUFLRQDUODVJUiFDVDXGLRPpWULFDVSRUPHGLR
GHXQSOyWHUDXWRPiWLFDPHQWHWDQWRSRUYtDRVHDFRPRSRUYtDDpUHDDVtFRPR
SDVDUODVGLUHFWDPHQWHDODFKDGHOSDFLHQWH7DPELpQH[LVWHQORV automticos
\DFRQWRGRLQWHJUDGR TXHUHDOL]DQWRGRHOFLFORGHPHGLGDVPHGLDQWHXQPLFUR-
SURFHVDGRUTXHOOHYDQLQFRUSRUDGRVLUYHQSDUDGHVFXEULUDORVVLPXODGRUHV

  *UiFDVPRGHUQDVGH$XGLRJUDPDV(OPXxHFRGH)RZOHU
3DUD SRGHU UHSUHVHQWDU ORV GRV RtGRV HQ XQD VROD JUiFD SXHV D YHFHV
VLJXLHQGR ODV FRQVWXPEUHV DQWLJXDV VH HPSOHDQ GRV JUiFDV XQD SDUD FDGD
RtGRUHSUHVHQWDQGRORVYDORUHVGHORtGRL]TXLHUGRcon el color azul\ORVYDORUHV
GHORtGRGHUHFKRcon el color rojo UHJODQHPRWpFQLFDDOUHYpVTXHHQODSROt-
WLFD (QHVWDVJUiFDVPRGHUQDV\DOLQHDOL]DGDV FRQVXOWDUQDOGHFXHVWLyQ
 WRGRVORVGHXQPLVPRWLSRYDQXQLGRVSRUXQDOtQHDFRQWLQXD )LJ 
0RGHUQDPHQWHVHHPSOHDODVLJXLHQWH7DEODSDUDORVVtPERORVDXGLRPp-
WULFRVUHFRPHQGDGRVSRU$6+$

7$%/$

85
Captulo 8

3DUDWHQHUXQDUHJODQHPRWpFQLFDSDUDUHFRUGDUWRGRVORVVtPERORVGHOFRQ-
WHQLGRGHODWDEODDQWHULRUHVSDUDORTXHVHFUHyHOGHQRPLQDGR0XxHFRGH
)RZOHUTXHSRGHPRVFRQWHPSODUHQOD)LJ

  (OLPSHGDQFLyPHWUR6XVSDUWHVFRQVWLWXWLYDV\IXQFLRQDPLHQWR
$QWHVGHFRPHQ]DUDGHVLJQDURGHQLUVXIXQFLyQKHPRVGHFRQRFHUFyPR
HVWiIRUPDGRRFRPSXHVWRXQ,PSHGDQFLyPHWUR\FyPRIXQFLRQD
(O2WRDGPLWDQFLyPHWURR,PSHGDQFLyPHWURDFWXDOWLHQHVXRULJHQHQHOSXHQWH
HOHFWURDF~VWLFRGH7HUNLOGVHQ\1LHOVHQ\FRQVWLWX\HXQLQVWUXPHQWRFRPSOHMR
(QODYHUVLyQTXHQRVVHUYLUiFRPREDVHSDUDODGHVFULSFLyQ\TXHSRVWH-
ULRUPHQWHKDVLGRPRGLFDGD\SHUIHFFLRQDGD YpDVH)LJ KD\WUHVWXERV
TXHFRQX\HQHQODVRQGDTXHDVXYH]GHEHDMXVWDUVHHQHO&$( &RQGXFWR
$XGLWLYR([WHUQR PHGLDQWHXQWHUPLQDOSUHYLDPHQWHVHOHFFLRQDGRVHJ~QHO
WDPDxR GH GLFKR FRQGXFWR \ FRUUHFWDPHQWH FRORFDGR HVWR HQ ODV YHUVLRQHV
LQGXVWULDOHVYLHQHGDGRPHGLDQWHWUHVOXFHVSHTXHxDVYHUGHDPDULOOD\URMD 
HQHOPLVPRVRSRUWH

U

S
Fig. 54. 'LEXMR DOJRKXPRUtVWLFRSHURPX\~WLO GHO0XxHFRGH)RZOHU

86
Captulo 8

Fig. 55. (VTXHPDGHFyPRHVWiIRUPDGRLQWHULRUPHQWHXQ,PSHGDQFLyPHWUR

(Q GLFKD JXUD  HQ OD SULPHUD UDPD YHPRV TXH XQ RVFLODGRU VXPL-
QLVWUDDXQDPSOLFDGRUYDULDEOH DGDSWDGRDXQVHUYRFRQWUROUHODFLRQGRFRQ
HOJHQHUDGRUGHFF XQDVHxDODF~VWLFDGHIUHFXHQFLDMD JHQHUDOPHQWH
+] TXHSDVDDXQDXULFXODU\TXHDWUDYpVGHOWXER$ODFRQGXFHDODFDYLGDG
TXHTXHGDHQWUHODVRQGD\HOWtPSDQRDWUDYpVGHO&$(
(QODFDYLGDGSRUHIHFWRGHHVWDVHxDODSDUHFHXQDSUHVLyQVRQRUD&XDQWR
PD\RUHVHOYROXPHQGHODFDYLGDG\VXFRPSOLDQFLDHTXLYDOHQWHPHQRUVHUi
ODSUHVLyQVRQRUD3DUDPDQWHQHUGLFKDSUHVLyQVRQRUDFRQVWDQWHHVQHFHVDULR
DXPHQWDUHOXMRVRQRURGHOWUDQVGXFWRUHPLVRUTXHHVORVHPLGHDOYDORUDU
ODFRPSOLDQFLDRDGPLWDQFLD DEDMDVIUHFXHQFLDV 
8QWUDQVGXFWRUFDSWDGRURPLFUyIRQRGHWHFWD DWUDYpVGHOWXER% ODSUH-
VLyQ GH OD FDYLGDG \ VHUYRFRQWUROD HO XMR VRQRUR D WUDYpV GHO DPSOL-
FDGRU\JHQHUDGRUGHFRUULHQWHFRQWtQXDSDUDPDQWHQHUODSUHVLyQVRQRUD
constante.

87
Captulo 8

6HVXHOHWUDEDMDUHQODFDYLGDGDXQQLYHOGHSUHVLyQFRQVWDQWHGHIRUPDTXH
FXDQGRHOQLYHOGHSUHVLyQVRQRUDHQODFDYLGDGHVHOQLYHOSUHMDGR JHQHUDO-
PHQWHGE63/SDUDXQYROXPHQGHFF ODDJXMDGHOPDUFDGRURPHGLGRU
PDUFD HO  3DUD HOOR HO PHGLGRU YROWtPHWUR  HVWi WDPELpQ FRQHFWDGR D XQD
IXHQWHGHDOLPHQWDFLyQGHFRUULHQWHFRQWLQXDFRQVWDQWHSHURDVXYH]YDULDEOH
SRUHOVHUYRFRQWURO3DUDPDQWHQHUHOQLYHOGHSUHVLyQVRQRUDFRQVWDQWHHQOD
FDYLGDGVHUiQHFHVDULRHQDOJXQRVFDVRVDXPHQWDUODVHxDOGHODPSOLFDGRU
WDQWRPiVFXDQWRPD\RUVHDODHQHUJtDWUDQVPLWLGD(OPDQGRGHODPSOLFDGRU
HVWiWDUDGRGLUHFWDPHQWHHQFF\QRVGDOD&RPSOLDQFLD#$GPLWDQFLD
3RUQHOWXER&HVWiDOLPHQWDGRSRUXQDERPEDQHXPiWLFDTXHSHUPLWH
YDULDUODSUHVLyQGHODLUHGHQWURGHODFDYLGDGTXHDVXYH]VHUHJLVWUDFRQ
XQPDQyPHWUR'HHVWDIRUPDSRGHPRVQLYHODUODSUHVLyQGHODFDYLGDGFRQ
ODSUHVLyQGHODFDMDWLPSiQLFDORTXHOOHYDUiDTXHODPRYLOLGDGVHDPi[LPD
\DVtGHSDVRVDEUHPRVWDPELpQODSUHVLyQGHFDMD
7DPELpQQRVSHUPLWHGHWHUPLQDUODVYDULDFLRQHVGHPRYLOLGDG &RPSOLDQFLDR
$GPLWDQFLD HQIXQFLyQGHORVFDPELRVGHSUHVLyQ 7LPSDQRPHWUtD  )LJ 
/DPD\RUtDGHORV$GPLWDQFtPHWURVPRGHUQRVWLHQHQDGHPiVun audi-
metro acopladoFDSD]GHVXPLQLVWUDUXQDVHxDOFDOLEUDGD$FLHUWDVLQWHQ-
VLGDGHV HVWD VHxDO GHVHQFDGHQD XQD WHQVLyQ GHO P~VFXOR GHO HVWULER TXH
DXPHQWD OD ULJLGH] GHO VLVWHPD \ GLVPLQX\H OD PRYLOLGDG 'HWHFWDQGR HVWD
YDULDFLyQGHPRYLOLGDGQRVDSHUFLELPRVGHODDSDULFLyQGHOUHHMR6HUiipsi-
lateral VLVHSURYRFDHQHOODGRTXHHVWiODVRQGD\contralateral VLVHSURYRFD
HOHVWtPXORHQHORtGRFRQWUDULRDGRQGHHVWiODVRQGD
/DSUHVLyQPDQRPpWULFDYDUtDHQWUHPPGH+2\PPGH+O.
(OYDORUTXHSXHGHSURGXFLUGDxRHQODPHPEUDQDWLPSiQLFDFRQQHRIRUPD-
FLRQHVHVGHORUGHQGHPPGH+O.

  7LSRVGHSUXHEDVRPHGLGDVTXHHVSRVLEOHHIHFWXDU3HTXHxD
HYROXFLyQ

/RVYDORUHVGHODFRPSOLDQFLDQRUPDOVRQGLItFLOHVGHGHWHUPLQDUSXHVKD\
YDORUHVEDMRVHQFDVRVQRUPDOHV\PiVELHQDOWRVHQFDVRVDQRUPDOHV
'HFXDOTXLHUIRUPDHOGLVSRQHUGHH[SORUDFLRQHVDQWHULRUHVHQHOPLVPR
VXMHWR\HOSRGHUFRPSDUDUFRQORVYDORUHVGHORtGRGHORWURODGRSXHGHQD\XGDU
PXFKRHQODVFRUUHFWDVYDORUDFLRQHV3RGUtDPRVFRQVLGHUDUYDORUHVQRUPDOHV
GHFRPSOLDQFLDORVFRPSUHQGLGRVHQWUH\FP3.

88
Captulo 8

Fig. 56. &


 RPSOLDQFLDHVWiWLFD,QWURGXFLHQGRXQDSUHVLyQGH $ HQHOFRQGXFWRDXGL-
WLYRH[WHUQRGHMDPRVUtJLGDODPHPEUDQDWLPSiQLFD/DPHGLGDGHODFRPSOLDQFLD
VHUiODGHOFRQGXFWRDXGLWLYRH[WHUQR(QODRWUDJUiFD % GHMDPRVDODPHPEUDQD
WLPSiQLFDHQVXPi[LPDPRYLOLGDG6HUiODVXPDGHODFRPSOLDQFLDGHOFRQGXFWR
DXGLWLYRH[WHUQR\HOFRPSOHMRWLPSDQRRVLFXODU/DGLIHUHQFLDHQWUHDPEDVVHUiOD
FRPSOLDQFLDHVWiWLFDGHOFRPSOHMRWLPSDQRRVLFXODU

89
Captulo 8

Fig. 57 *
 UiFDV TXH UHSUHVHQWDQ ODV YDULDFLRQHV GH FRPSOLDQFLD PiV FOiVLFDV GH FLQFR
FDVRV GH SHUWXUEDFLyQ yWLFD HQ IXQFLyQ GH OD SUHVLyQ LQWURGXFLGD (;&(372 OD
$ 1250$/ 

5HYLVWHXQDJUDQLPSRUWDQFLDGHVGHHOSXQWRGHYLVWDFOtQLFRODIRUPDGHOD
FXUYDWLPSDQRPpWULFD\H[LVWHQYDULDVFODVLFDFLRQHVGHODVFXDOHVQRVRWURV
HQWUHVDFDPRVODGH%URRNV )LJ (QUHDOLGDGH[LVWHQPXFKRVWLSRVLQWHU-
PHGLRVTXHSDUWLFLSDQHQYDULDVSDWRORJtDV YpDVH)LJVD 
(QFXDQWRDODSUHVLyQGHFDMD\GHDFXHUGRFRQHOFULWHULRGHOD$6+$VH
FRQVLGHUDQRUPDOHQQLxRVFRQXQFULWHULRDPSOLRFXDQGRHOPi[LPRHVWi
HQWUH\PPGH+23DUDDGXOWRV\FRQFULWHULRHVWULFWRHO
Pi[LPRGHEHHVWDUHQWUH\PP 2OLYLHU (QQLxRVVRQIUHFXHQWHV
ODVSUHVLRQHVQHJDWLYDVFDPELDQWHVGHXQDH[SORUDFLyQDRWUD

90
Captulo 8

Fig. 58
Fig. 58 - 60. (
 QHOODVSXHGHQREVHUYDUVHORVGLVWLQWRVWLSRVGHWLPSDQRPHWUtDVVHJ~QGLV-
WLQWRVWLSRVGHSDWRORJtDVREWHQLGDVFRQXQLPSHGDQFLyPHWUR

91
Captulo 8

Fig. 59

92
Captulo 8

Fig. 60

93
Captulo 8

  3RWHQFLDOHV(YRFDGRVDF~VWLFRV\VXVPpWRGRV
7DPELpQVHGHQRPLQDDODSUXHEDHQODTXHHVWRVVHREWLHQHQ
EOHFWUREQFHIDOR$XGLRPHWUtD (($ REvoked TestTXHHVWDPELpQHTXLYD-
OHQWHD(5$Evoked Response Audiometry.
%HUJHUIXHHOFUHDGRUGHODHOHFWURHQFHIDORJUDItD\DTXHJUDFLDVDpOVHGHV-
FXEULyODGLIHUHQFLDHQODVFRPSOLFDGDVRQGDVGHO((* EOHFWUREQFpIDOR*rama)
GHODVRQGDVRULJLQDGDVSRUORVHVWtPXORVVRQRURV0iVWDUGH*HLVOHU'DYLV
0DUFRV\*LEEVHVWXGLDQ\DODVDOWHUDFLRQHVHQHOWUD]DGRSRUODLQWURGXFFLyQ
GHORVVRQLGRV/RVDYDQFHVDFWXDOHVKDQOOHYDGRDHVWDSUXHEDKDVWDXQOtPLWH
TXH ODV KDFH PX\ ~WLOHV SDUD ODV LQYHVWLJDFLRQHV HQFDPLQDGDV D GHWHFWDU OD
SUHVHQFLDRDXVHQFLDGHDXGLFLyQDQLYHOFHUHEUDO )LJ 
(VXQDSUXHEDREMHWLYDTXHQRUHTXLHUHODFRODERUDFLyQGHOVXMHWRSRUOR
TXHHVWiPX\LQGLFDGDHQQLxRVSHTXHxRVRVXEQRUPDOHVHVGHFLUGHFXDO-
TXLHUSHUVRQDTXHSRUFLHUWDVUD]RQHVQRSXHGDUHVSRQGHUDORVWHVWFRQYHQ-
FLRQDOHV /D (5$ FRPR VH GHQRPLQD JHQHUDOPHQWH HVWi EDVDGD HQ OR TXH
ORV DPHULFDQRV OODPDQ UHVSXHVWDV HYRFDGDV DXQTXH PiV ELHQ VH WUDWH GH
UHVSXHVWDVSURYRFDGDVSRUHOHVWtPXORVRQRUR
(QHO((* (OHFWURHQFpIDORJUDPD VHSXHGHQLGHQWLFDUSHTXHxDVYDULD-
FLRQHVDQWHODUHFHSFLyQGHOVRQLGRDWUDYpVGHORtGR(VWDVDOWHUDFLRQHVVRQ
PX\SHTXHxDV\GLItFLOHVGHLQGLYLGXDOL]DUHQPHGLRGHOIRQGRGHWRGDVODV
UHVSXHVWDVFRUWLFDOHVGHELGDVDOFRQMXQWRGHHVWtPXORVTXHDOVHUKXPDQROH
DIHFWDQFRQWtQXDPHQWH\SDUDVHSDUDUODVHVQHFHVDULRHOHPSOHRGHXQRUGH-
QDGRURFRPSXWDGRUDHVSHFLDOPHQWHSURJUDPDGD
&RQYLHQHHIHFWXDUODSUXHEDEDMRHIHFWRVVHGDQWHVQRLQKLELGRUHVGHODDFWL-
YLGDGFRUWLFDO\DOQLxRSHTXHxRHVPHMRUGRUPLUOR+D\TXHWHQHUHQFXHQWD
DOOHHUORVUHVXOWDGRVTXHHQORVPHQRUHVGHDxRVODVFXUYDVGHO(5$GDQ
UHVSXHVWDV DQRUPDOHV SRU QR WHQHU D~Q FRPSOHWDPHQWH PLHOLQL]DGD ODV YtDV
DF~VWLFDVQHUYLRVDV\VHSXHGHQFRQIXQGLUFRQDOWHUDFLRQHVHQFHIiOLFDVORTXH
HQUHDOLGDGFRUUHVSRQGHDQLxRVQRUPDOHV\HVWDVDOWHUDFLRQHVVRQHQWHUD-
PHQWHQRUPDOHVSRUODFDXVDH[SOLFDGD
3DUDHIHFWXDUODSUXHEDVHFRORFDQORVHOHFWURGRVDOSDFLHQWHFRPRSDUDHIHF-
WXDUXQHOHFWURHQFHIDORJUDPDQRUPDOXQRHQHOYHUWH[\ORVRWURVHQODUHJLyQ
WHPSRUDO/DLPSHGDQFLDGHFRQWDFWRKDGHVHU.:6HDGDSWDQORVDXULFX-
ODUHVDOSDFLHQWHRPHMRUHQFDPSROLEUHVHOHHQYtDQWRQRVSHULyGLFRVFRQLQWHU-
YDORVGHWUHVVHJXQGRV YDORUPHGLR HQWUHXQR\HOVLJXLHQWHFRQXQWRWDOTXH

94
Captulo 8

Fig. 61 (
 VTXHPDTXHPXHVWUDGHTXpHOHPHQWRVHVWiFRPSXHVWRXQDSDUDWRSDUDHIHFWXDU
(($\FyPRYDFRQHFWDGRDOSDFLHQWH

Fig. 62. 3HUOFRUUHVSRQGLHQWHDODRQGD9GHXQ(($

95
Captulo 8

Fig. 63. 6
 HULHGHUHJLVWURVGH3($7& 3RWHQFLDOHV(YRFDGRV$XGLWLYRVGH7URQFR&HUHEUDO 
DGLVWLQWDVLQWHQVLGDGHVGHXQYDUyQGHDxRVVLQQLQJ~QWLSRGHSDWRORJtDDXGL-
WLYD\FRQXQQLYHOGHDXGLFLyQQRUPDO

SXHGH YDULDU HQWUH ORV  D ORV  )LJ  \   (O DSDUDWR VH HQFDUJD \D GH
KDFHUORWRGRDXWRPiWLFDPHQWH\HORUGHQDGRUYDLQYHVWLJDQGRVRODPHQWHODVUHV-
SXHVWDVTXHVLJDQDFDGDHVWtPXORVRQRURDFXPXOiQGRODVHQODVHULHGHLPSXOVRV
\PRVWUDQGRDOQDOGHODVHULHXQDVFXUYDVFOiVLFDVVLHQGRODPiVLPSRUWDQWH
ODFRUUHVSRQGLHQWHDODRQGD9 )LJ UHVXPHQGHHVWDVUHVSXHVWDVHYRFDGDV
GHQRPLQDGRV3RWHQFLDOHV(YRFDGRV$XGLWLYRVGH7URQFR&HUHEUDO 3($&7 TXH
HVWiQUHSUHVHQWDGRVHQOD)LJ
/DV FXUYDV HVWXGLDGDV FRUUHVSRQGHQ D SRWHQFLDOHV FRUWLFDOHV GHO VLVWHPD
VHQVRULDOLQHVSHFtFROODPDGRSRUORVQHXUyORJRVFRPSOHMR.HQQXHVWUR
FDVR OD FRUUHVSRQGLHQWH D OD DXGLFLyQ VH WUDWD GH XQ FRQMXQWR GH RQGDV ODV

96
Captulo 8

GRVSULPHUDVGHJUDQDPSOLWXGVHJXLGDVGHXQFRQMXQWRRVHULHGHSHTXHxRV
WUD]RV6LVHWRPDQYDULRVWRQRVDGLIHUHQWHVLQWHQVLGDGHV\VHUHJLVWUDQODV
FXUYDV SRGHPRV KDFHU XQ HVWXGLR DXGLRPpWULFR SDUHFLGR DO REWHQLGR SRU
PHGLRVFRQYHQFLRQDOHV )LJ 
(VWDWpFQLFDQRGHWHUPLQDXPEUDOHVDXGLWLYRVVLQRTXHLQGLFDODOOHJDGDGHO
HVWtPXORVRQRURDODFRUWH]DFHUHEUDOGHVSXpVGHKDEHUDWUDYHVDGRHOyUJDQR
GH&RUWL(QFXDQWRDODFDSDFLGDGGHHQWHQGHUGHOVXMHWRGHSHQGHUiGHRWURV
IDFWRUHVGHVDUUROORPHQWDOSVLFROyJLFRHVWDGRVGHODVYtDVHWF(VGHVXSRQHU
QRREVWDQWHTXHHQODPD\RUtDGHORVFDVRVXQFDPLQRH[SHGLWRKDFLDORVFHQ-
WURVVXSHULRUHVLQGLFDFLHUWRQLYHODXGLWLYR\FRPSUHQVLYRYHUtGLFR3XHGHQ
VHUYLUWDPELpQSDUDGHVHQPDVFDUDUVLPXODGRUHVPX\FRQWXPDFHV

Fig. 64. '


 LVWLQWRV QLYHOHV GH GHWHFFLyQ ((* FRQ SRWHQFLDOHV $%5 FRQ VXFHVLYDV LQWHQ-
VLGDGHVVRQRUDVGHVGHDG%+/HQTXHSXHGHREVHUYDUVHODXQLyQGHORV
GLYHUVRVPi[LPRVGHODVRQGDV9TXHSURSRUFLRQDXQDFXUYDVLPLODUDODREWHQLGD
HQXQD$XGLRPHWUtDFRQYHQFLRQDO

97
AUDIOMETRA

Captulo 9

9.1) Concepto de Audiometra.


Se entiende por Audiometra un conjunto de tcnicas que permiten apre-
ciar la agudeza auditiva y determinar la magnitud de esta en relacin con las
YLEUDFLRQHVDF~VWLFDVTXHOOHJDQDORtGR\SRUWDQWRSRGHUFXDQWLFDUODV
SRVLEOHVGHFLHQFLDVHQVXIXQFLRQDPLHQWRHVGHFLUODVKLSRDFXVLDV (o, en
trminos antiguos, sorderas).
Su origen est fundamentado en la primitiva Otologa (de oots = odo
y logos = tratado), que era la ciencia que estudiaba el odo y su repercusin
en humanos o animales dotados de l. Luego se ampli como la parte de la
Medicina que estudiaba el rgano del odo, la audicin y todos los problemas
que de ellos pueden derivarse.
De aqu naci la Audiologa (carrera superior en algunos pases): se con-
sidera la parte de la Otologa que se encarga de todos los problemas de la
audicin, tanto en el odo normal como en el hipoacsico.
El campo de la audiologa ha llegado a ser tan vasto que existen especia-
listas dedicados solamente a esta rama de la Otologa. Se extiende cada da
ms y aparecen nuevos mtodos de medicin, diagnstico, topodiagnstico
audiomtrico y tratamientos audiolgicos, por lo que ha sido necesario crear
centros especializados con el concurso de variados especialistas: otlogos,
psiclogos, geriatras, hasta ingenieros electroacsticos y fsicos.
La Audiometra es una parte muy joven de la Otologa, pues, podemos decir
que, realmente, hasta despus de la Segunda Guerra Mundial, no ha comen-
zado su rpido desarrollo. Hasta entonces se haba hecho muy poco respecto
al diagnstico y tratamiento audiolgicos, haciendo mediciones empricas y
dudosas en su mayor parte, por emplear aparatos costosos, de difcil manejo
\ SRFD DELOLGDG )XH D SDUWLU GHO UiSLGR GHVDUUROOR GH OD HOHFWUyQLFD \ VX

99
Captulo 9

miniaturizacin cuando realmente se ha ampliado su campo, consiguiendo un


desarrollo, tanto en el diagnstico, medida y tratamiento de las hipoacusias
como su mejora y rehabilitacin.

9.2) Su importancia y objeto.


El primitivo objeto de la Acumetra (tal como se designaba esta rea en
un principio) (acus = sonido y metros = medida) tal como se realizaba en
pocas no muy lejanas, era investigar el estado de audicin mnima del sujeto
en cuestin. Desde el descubrimiento de la vlvula electrnica, comienza la
fabricacin de los primeros audimetros (a la par de las radios caseras), gene-
ralmente bastante voluminosos (del tamao de una maleta mediana de varios
kilos de peso), pero esto puso ya al alcance de todos los otlogos (que, como
siempre, pudieran pagar su elevado coste), se pudo comenzar a explorar el
campo tonal auditivo (respuesta del odo a diversas frecuencias), tanto en
el umbral como en su techo ,QFRQIRUG, igual que hacia ambos extremos
WRQDOHV GHWHUPLQDQGRHO&DPSRGH$XGLELOLGDG  YHDVH)LJ \DGHPiVVH
han incorporado muchas pruebas, de acuerdo con las necesidades actuales,
que ofrecen la solucin de casi todos los problemas auditivos, bien por va
mdica, quirrgica o protsica.
Veamos ya, la importancia y para qu sirve la moderna audiometra:
1) Para determinar el umbral mnimo de audicin. Es el primer objetivo
esencial en la medicin de la audicin: encontrar la mnima cantidad de sonido
(intensidad) que el sujeto examinado puede or.
 Para establecer un topodiagnstico: mediante la audiometra se puede
explorar el campo auditivo, efectuando varias pruebas, que pueden mostrar
el sitio o lugar donde se encuentra la lesin, a lo largo del camino que
sigue la energa sonora, en diversas formas, desde el odo externo hasta
impresionar la corteza cerebral.
3) 3DUDHQFRQWUDUORVRtGRVOiELOHVDODIDWLJDDF~VWLFD esta ciencia nos
permite descubrir a los individuos que tengan un odo (o los dos) predispuesto
para el trauma acstico (que ms adelante explicaremos), mediante las
correspondientes pruebas de fatiga acstica.
4) 3DUD PHGLU ORV $F~IHQRV una variante de esta especialidad es poder
determinar, con mayor o menor exactitud, el ruido tico que siente el paciente
que los sufre, por comparacin de los tonos del audimetro.

100
Captulo 9

5) 3DUDGHVFXEULUDORVVLPXODGRUHV\GLVLPXODGRUHV existen pruebas que per-


PLWHQGHVHQPDVFDUDUWDQWRDOLQGLYLGXRTXHVLPXODXQDKLSRDFXVLDSDUDEHQH-
ciarse de alguna forma, como al que disimula una hipoacusia que le imposibilita
incorporarse a determinadas clases de trabajo, ejemplo: pilotos de aviacin civil o
militar.
6) 3DUD GHWHUPLQDU HQ 0HGLFLQD /HJDO HO JUDGR GH LQYDOLGH] DXGLWLYD esta
rama de la Medicina, que cada vez adquiere mayor importancia, necesita de la
Audiometra con el objeto de que le auxilie en la calibracin de los daos ocurridos
en caso de accidente o causa criminal.
 3DUDH[SORUDUUHVWRVDXGLWLYRV en casos de hipoacusias profundas, es nece-
sario procurar estudiar bien la audicin con el propsito de encontrar restos audi-
tivos que hagan posible una reeducacin adecuada al caso. En este momento,
muchos posibles sordomudos de antao son personas que se desenvuelven en la
vida sin ningn contratiempo, gracias al adiestramiento auditivo de sus restos,
con o sin labiolectura.
8) Para explorar la posibilidad de una intervencin quirrgica: sin la ayuda
inestimable de la Audiometra no se hubiese podido desarrollar la microciruga
de las hipoacusias de transmisin, pues nos indica la posibilidad de xito, adems
nos ayuda en el momento operatorio para saber si la intervencin va por buen
camino.
9) 3DUD GHVFXEULU KLSRDFXVLDV VXEOLPLQDOHV: conviene siempre descubrir la
hipoacusia en sus comienzos, para lo cual se investigan conjuntos de personas
mediante la audiometra en grupo. Con audimetros especiales de varios auricu-
lares, o en ambiente abierto (campo libre), se pasan palabras y preguntas y al que no
responde debidamente se le efecta una Audiometra individual clsica. Esto sera
conveniente hacerlo en escuelas, fbricas y cuarteles, grandes almacenes, etc.
10) Para dirigir la prescripcin de la prtesis auditiva: con el audiograma
comn y las pruebas complementarias se obtiene la posibilidad de utilizacin de
un audfono. Esto nos permite, como tcnicos audiprotesistas, la eleccin acertada
del mismo, y al mdico el consejo al sujeto sobre la conveniencia o no de la prtesis
auditiva (esto debera ser previo al caso anterior).
As, vemos que el objeto de la Audiometra es actualmente mltiple, de ah la
extraordinaria importancia que ha adquirido en sus ltimos aos y que, cada da,
se acenta ms a medida que aumenta el nmero de especialistas otlogos, inge-
nieros de sonido y tcnicos audilogos o audioprotesistas.

101
Captulo 9

1RVHUiUDURTXHGHQWURGHDOJXQRVDxRVVHDREOLJDWRULRYHULFDUODDXGL-
cin a todas las personas, cada cierta cantidad de aos, para intentar mejorar
el estado auditivo medio de toda la poblacin.
Muchos nios que no avanzan en sus estudios se debe a hipoacusias
infantiles no diagnosticadas, si a esto aadimos la cantidad de gente que,
en el futuro, por causas de excesivo uso y abuso de los auriculares perso-
nales (walkman, ipod, apod etc.) y la excesiva intensidad percibida en pubs y
discotecas, no podr desenvolverse normalmente en su vida por padecer de
KLSRDFXVLDVSUHFRFHVRGHFLHQWHDXGLFLyQKDUiQGHOD$XGLRPHWUtDXQJUDQ
futuro (similar al de las pticas hace ya algunos aos), con grandes posibili-
dades a su desarrollo y aplicacin.

9.3) Tipos de Audiometra.


([LVWHQPX\YDULDGRVWLSRVGH$XGLRPHWUtDVTXHSRGHPRVFODVLFDUVHJ~Q
los distintos puntos de vista:
1) Segn las caractersticas de manejo del instrumental que se utiliza:
Audiometra manual.
automtica.
computarizada.
 Segn las caractersticas del material que se emplea:
Audiometra tonal.
vocal.
fontica (logoaudiometra).
3) 6HJ~QODUHODFLyQHQWUHODIXHQWHVRQRUD\HOVXMHWRH[DPLQDGR
Audiometra clsica (Acumetra) [es solo cualitativa].
por va area (con auriculares).
por va sea (con vibrador).
en campo libre (con EDWHV).
4) 6HJ~QODVFDUDFWHUtVWLFDVGHODVIUHFXHQFLDV
Audiometra de frecuencia contnua.
 HQRFWDYDVRP~OWLSORVGH
5) 6HJ~QHOQ~PHURGHSHUVRQDVTXHLQWHUYLHQHQ
Audiometra individual.
colectiva.

102
Captulo 9

6) 6HJ~QHOREMHWRTXHVHSHUVLJXH
Audiometra de diagnstico.
pronstico.
despistaje.
capacidad laboral.
incapacidad laboral.

 Segn la edad del examinado:


Audiometra del neonato (recin nacido).
infantil.
del adulto.
geritrica (de ancianos).

8) Segn el tipo de respuesta:


Audiometra objetiva.
subjetiva.
  UHHMD
involuntaria.
automtica.

9) Segn el mecanismo investigado:


Audiometra tonal area.
sea.
por medicin de Admitancia (Impedanciometra).

10) 6HJ~QHOQLYHOWRSROyJLFRGHODYtDDXGLWLYD
Audiometra liminar.
supraliminar.
vocal.
sensibilizada.
por admitancia.
direccional.
cerebral (electroencefaloaudiometra) { EEA)
de Potenciales Evocados = (PEATC).

103
Captulo 9

7RGDVHOODVHVWiQHQUHODFLyQGLUHFWDFRQODQDOLGDGGHODPHGLFLyQGHOD
audicin y la gran divisin es la Audiometra Subjetiva (o de respuesta cons-
ciente) y la Objetiva (no participa la voluntad del sujeto).

Las mltiples pruebas audiomtricas necesarias para realizar la correc-


cin protsica racional de las hipoacusias en su conjunto constituyen la
Audiometra denominada Protsica y puede ser esquemticamente repartida
en dos grandes grupos:
A) Grupo de pruebas de orientacin protsica.
B) control protsico.
Pudiendo dividir el apartado A) en cuatro clases:
 7RQDOHVOLPLQDUHV>JHQHUDOPHQWHPRQRDXUDOHV 2' 2,@
   VXSUDOLPLQDUHV
3) Vocales (dem que liminares).
4) en campo libre.
Destinadas a poner en evidencia las caractersticas IXQFLRQDOHV de cada
uno de los odos del hipoacsico. Los exmenes audiomtricos del tipo A)
deben ser obligatoriamente practicados antes de todo ensayo de utilizacin
o adaptacin audioprotsica. Tienen por objeto el orientar al audiprotesista
sobre el tipo de hipoacusia que padece el sujeto y su cuanta, para proceder
en consecuencia, a la seleccin y adaptacin individual de la prtesis auditiva
que el individuo afectado necesita.

104
Captulo 10

10.1) Audiometra liminar: umbrales auditivos.


Se entiende clsicamente por Audiometra liminar aquella prueba que
tiende a medir la cantidad de audicin mnima que pueda percibir un odo,
LGHQWLFDQGRliminar con umbral auditivo. Ahora bien, en la mayora de los
casos en que se efecta una prueba de este tipo, normalmente es con propsito
protsico, y casi todos los mtodos de adaptacin implican tambin conocer el
umbral mximo (para poder ajustar a l, las prestaciones del posible aparato),
nivel ya conocido como de Inconford o de molestia. Entonces, designaremos
como Audiometra liminar aquella que tiene por objeto averiguar los dos
lmites: superior e inferior, en general, de un hipoacsico.
Ya hemos estudiado el Audimetro como instrumento base (superior, sin
duda, a los anteriormente mencionados en Acumetra), para tomar una
EXHQD DXGLRPHWUtD 3HUR HVWR VROR QR HV VXFLHQWH SDUD REWHQHU ORV GDWRV
DXGLWLYRVGHXQVXMHWR\DQRWDUORVVHJ~QORVVtPERORVGHODVJUiFDVFOiVLFDV
como ya hemos visto anteriormente.
Un audiograma puede presentar errores debidos a varias causas:
D 'HFLHQWHSUHSDUDFLyQGHODXGLRSURWHVLVWD QRUPDOPHQWHQRWLWXODGR
b) Mala calibracin del Audimetro.
F ,QVXFLHQWHVRQRDPRUWLJXDFLyQ
d) Distraccin y errores en la anotacin.
e) Ensordecimiento inapropiado.
Vamos a comentarlos ligeramente:
D ,JXDOTXHRFXUUHFRQRWURVDSDUDWRVFLHQWtFRVHOXVRGHODXGLyPHWUR
requiere un estudio tcnico primero y una prctica despus, sin la cual es
imposible poder efctuar bien una audiometra y, por tanto, confeccionar ade-
FXDGDPHQWHXQDJUiFDFRQODDXGLFLyQGHXQVXMHWR

105
Captulo 10

b) Hablbamos en el punto anterior del Audimetro y su calibracin, aqu


aadiremos que es necesario, cada cierto tiempo, la correccin del aparato, o
en todo caso, saber sus defectos o posibles descalibraciones para conocer los
errores que se puedan ocasionar en las medidas.
c) Los ruidos del ambiente inciden sobre la audicin, es preciso medirla en
un medio silencioso apropiado, o por lo menos sonoamortiguado. Este incon-
veniente se salva disponiendo de una sala o habitacin silenciosa, o en su
FDVRGHXQDFDELQDVRQRDPRUWLJXDGDDUWLFLDOPHQWH
d) Las distracciones del tcnico Audioprotesista son ms frecuentes de lo
que nos pudiera parecer. No es difcil el cambiar de odo, confundiendo los
resultados del O. derecho por el O. izquierdo, o viceversa. Otras veces existen
omisiones, quedando sin anotar, por ejemplo, la va sea de un lado; tambin
pueden cambiarse las vas sin querer. Todo esto se averigua fcilmente efec-
tuando las pruebas clsicas con los diapasones, que podemos hacer en pocos
minutos despus en nuestro gabinete.

Fig. 65. Dibujo que ilustra cmo est construida una cmara sonoamortiguada.

106
Captulo 10

Fig. 66. En el centro podemos observar el vibrador de frente y de perfl, que se sujeta a la
DSyVLVPDVWRLGHGHOSDFLHQWHPHGLDQWHXQDGLDGHPD

e) Como veremos ms adelante, el defecto o exceso de ensordecimiento en


el lado contrario para intentar eliminar la audicin del odo no investigado es
causa frecuente de errores en la interpretacin de los audiogramas.

10.2) Cmaras sonoamortiguadas


Con objeto de salvar el inconveniente producido por el ensordecimiento
del odo por el ruido de cualquier medio, se construyen en los gabinetes de
Audiometra unas cmaras especiales que tienen por misin aislar al sujeto
del ruido externo circundante en la medida de lo posible.
Si tenemos en cuenta que el ruido normal que existe en una habitacin, al
parecer silenciosa, es de cerca de 50 dE, se puede comprender que el sujeto exami-
nado proporcione unas respuestas que no son las que corresponden a su verdadero
umbral.
Es necesario, para tomar una buena audiometra, el aislamiento del
paciente de la atmsfera de ruidos que le envuelve. nicamente se puede con-
seguir esto con la sonoamortiguacin. Esta podemos decir que est conse-
guida con sonoaislamiento de 30 a 40 dEpara la gran mayora. En cambio,

107
Captulo 10

ser necesaria la amortiguacin casi total en las observaciones que se hagan


en sujetos normales, con poca prdida o en investigacin. Aquello se consigue
con cmaras audiomtricas porttiles (van dotadas generalmente de ruedas),
que hay en casi todas las clnicas.
Se suele conseguir un ambiente sonoamortiguado adecuado de la siguiente
forma (Fig. 65): se construyen dos cmaras, una dentro de otra; la interior es
de madera a la que van adosados paneles de porexpan o sustancia similar,
con objeto de que absorba el ruido interior. Las paredes de la cmara exte-
rior pueden ser tambin de madera o ladrillo revestido. El hueco que queda
entre las dos se rellena con lana de vidrio o virutas de corcho. Como es impo-
sible la falta de contacto entre las dos cmaras, como sera lo ideal, el suelo
de la menor se apoya en muelles elsticos, como los que llevan los camiones
alrededor de los amortiguadores, ms bien duros, con objeto de que no se tras-
mitan las vibraciones circundantes que incidiran sobre la va sea. Tambin
es importante la existencia de una ventana con doble acristalamiento por
donde se vean las caras el paciente y el operador, pero sin que aquel vea cmo
opera este. Esto reduce el sentimiento de claustrofobia y el aislamiento que
pueden soportar, sobre todo las personas mayores. La cmara audiomtrica (la
pequea) debe ser sonoaislada (para que no penetren los ruidos del exterior), al
mismo tiempo que sonoamortiguada o anecoica SDUDHYLWDUODUHH[LyQGHORV
sonidos, o sea, la reverberacin que pueda existir en el interior. Para resumir, la
cmara audiomtrica debe reunir las siguientes condiciones, segn Fournier:
 /RVPDWHULDOHVHPSOHDGRVKDQGHVHUGHEDMRFRHFLHQWHGHWUDQVPLVLyQ
VRQRUDSDUDTXHHOVRQLGRH[WHULRUVHDEVRUED RQRVHUHHMH 
 4XHH[LVWDDLVODPLHQWRGHODVSDUHGHV\GHOVXHORSDUDHYLWDUODUHH[LyQ
sonora (reverberacin).
  5HYHVWLPLHQWR LQWHULRU FRQ PDWHULDOHV GH FRHFLHQWH GH UHH[LyQ EDMR
(terciopelo acrlico) as como de alta absorcin.
Tambin hay que tener en cuenta que los auriculares corrientes dejan un
hueco de aire de unos 6 cm3 que amortigua el sonido unos 20 dE para la va
area, en cambio, sensibiliza la va sea. Los auriculares ms propios son
los que van dotados, a su vez, de una especie de carcasas envolventes (como
las que se usan para disminuir la audicin de los sonidos muy fuertes, como
amortiguadores para evitar el trauma acstico) semejantes a los que llevan los
operarios de pista en los aeropuertos, que aislan mucho del ruido externo y

108
Captulo 10

disminuyen la audicin cruzada area, teniendo los colores ya mencionados


para diferenciar los odos.
En ciertos ambientes no ruidosos pueden servir como medio aislante sonoro
para obtener audiometras estndares.

10.3) El examen audiomtrico liminar de la va area.


Es a veces muy difcil para un buen tcnico audiometrista la investigacin
de los umbrales mximo y mnimo de audicin, pues aunque no exista ninguno
de los inconvenientes citados anteriormente como posible causa de error, el
HVWDGRHPRFLRQDOGHOSDFLHQWHODIDOWDGHDWHQFLyQ\ODGHFLHQWHLQWHOLJHQFLD\R
cultura pueden proporcionar resultados anormales muy distantes del verdadero
umbral auditivo del paciente. Es conveniente seguir siempre una metodologa
en la realizacin tcnica de la prueba; nosotros proponemos seguir el siguiente
ritual en su realizacin, de acuerdo con las corrientes actuales:
1.) Se acompaa al sujeto hacia el interior de la cmara audiomtrica,
indicndole que se siente en la silla o silln destinado al efecto, despus se
le quita el audfono si ya lleva alguno, as como los pendientes si es mujer (u
hombre moderno) pues estorban al colocarle los auriculares (con la misma
indicacin de colores que el mueco de Fowler: el rojo a la derecha y el azul a
la izquierda), procurando que no compriman demasiado el pabelln auricular,
ni que, tampoco, queden demasiado sueltos, porque puede escaparse parte
de la intensidad emitida por el auricular al exterior, dndonos un error en el
umbral; tambin hemos de sealarle la perilla o botn que sirve para contestar
DUPDWLYDPHQWHDSUHWDQGRRVROWDQGR
2.) Una vez el sujeto dentro de la cmara y tranquilizado, con la puerta
cerrada,* debemos conectar el interruptor que desconecta el oscilador (vase
Fig. 53) y nos permite hablarle a travs de los auriculares en una intensidad
adecuada a su hipoacusia, como este lleva un regulador de intensidad, ajusta-
remos sta para que el hipoacsico nos oiga bien (tener cuidado de que la aguja
del vuometro no se pase nunca a la zona roja, pues en ella existe distorsin y se
entendera peor). Despus comenzaremos a explicarle la prueba que vamos

* Nota.- Antes de cerrar, hemos de hacer observar al paciente que la puerta posee una
doble manivela, de forma que se puede abrir o cerrar desde dentro o desde fuera, con objeto
de evitarle el posible sentimiento de claustrofobia.

109
Captulo 10

a efectuarle, indicndole que siempre que oiga el tono o sonido (damos uno
grave, fuerte, por ejemplo), por poco que sea, toque el botn o perilla para
que nosotros sepamos que oye, o bien si carece de habilidad manual mantenga
levantada la mano mientras oye y la mantenga bajada solo cuando no oiga.
Tambin es importante al principio tranquilizarle e incluso esperar unos
minutos si se encuentra agitado. As como que se espera de l la mxima
FRRSHUDFLyQSXHVODSUXHEDHVSDUDVXSURSLRELHQ\PHMRUtD\QDOPHQWHVH
le pregunta por qu odo cree que oye mejor.
3.) Una vez hecho todo esto, comenzamos con la prueba propiamente dicha,
conectando solo el odo que cree or mejor. Empezaremos por una frecuencia
intermedia, por ejemplo 1.000 Hz, con una intensidad no muy alta, por ejemplo
60 dE y seguiremos subiendo de 10 en 10 dE si no la oye, o bajaremos de 5
en 5 dE si la oye, hasta que deje de percibirla. Entonces, subimos 5 dE y si ya
lo oye anotaremos (segn hemos aprendido) en esa frecuencia el valor de la
intensidad de que se trate.
Despus, se puede hacer en el orden que se quiera, pero nosotros aconse-
jamos hacerlas alternadamente hacia los graves y los agudos, o sea:
2.000, 750, 3.000, 500, 4.000, 250, 6.000, 125 y, despus, 8.000 si se quiere,
pero no es absolutamente necesario.
Una vez que hayamos terminado con este odo, pasamos al otro, avisando al
paciente de lo que vamos a hacer.
Repetimos todo la operacin con el odo peor, y una vez terminado, nos
ponemos al habla con el sujeto para explicarle que vamos a pasar a otra prueba,
transmitindole sonidos bastante fuertes, de menor a mayor intensidad, sin
que por ello tengan que apretar botn alguno o levantar la mano; que nosotros,
SRUHOUHHMRGHVXFDUDRH[SUHVLyQGHVSXpVGHUHFLELUHOVRQLGR\DVDEHPRV
cundo comienzan a molestarle, parndonos en esa intensidad, haciendo todo el
barrido de frecuencias igual que antes, y apuntando en cada una, con un trin-
gulo invertido (rojo-o-azul) los valores obtenidos (umbral de Inconford).
Hemos de explicar por qu comenzamos por el odo mejor: esto es debido
a que, como sabemos, por la va area existe audicin cruzada a partir de los
50 dE, es decir, enviando ms de 50 dE a un odo se comienza a percibir por el
contralateral.
3RUWDQWRVLYHPRVTXHHQWUHDPEDVJUiFDVKD\XQDGLIHUHQFLDGHGE o
PiVKHPRVGHHQVRUGHFHUHOPHMRU\YROYHUDWRPDUODJUiFDGHOSHRURWUD

110
Captulo 10

vez, pues la primera nos ha podido resultar mal (falsa audiometra o audiom-
tria fantasma).

10.4) El examen audiomtrico por va sea.


Esta va o camino del sonido es de extraordinaria importancia para poder apre-
ciar en qu estado se encuentra el odo interno: si existiera o no una hipoacusia
de percepcin, pues el hecho de ir el sonido del exterior al odo interno direc-
tamente, obviando los obstculos del odo medio, nos proporciona una indica-
cin ms exacta de cmo se halla el odo fundamental, lo que implica que nunca
podremos obtener valores de audicin ms bajos por va sea que por va area
SXHVLQFOXVRHQDXGLFLyQQRUPDOODDPSOLFDFLyQTXHSURSRUFLRQDODYtDDpUHD
hace que se oiga prcticamente igual).
Para realizar esta prueba hemos de aplicar el vibrador o cpsula vibratoria,
que viene en uno de los extremos de la diadema (Fig. 66), en uno de ambos
mastoides (porcin del hueso parietal que est inmediatamente detrs de ambos
pabellones auditivos u orejas), comprobando a la vez, que se ha colocado de una
forma estable, pues hemos de comprobar que no ha quedado debajo parte de
pelos, sudor, etc.; y, posteriormente, aseguraremos su colocacin dando encima
del vibrador unos golpecitos con el extremo del dedo ndice para comprobar si
est situado de una forma estable.
A continuacin, dejamos solo al sujeto, encerrado** en la cmara, y proce-
demos a efectuar la prueba de idntica forma a cmo lo indicamos por va area;
siempre teniendo en cuenta que si el estado de un odo es mucho peor que el otro
(40 dEo ms de diferencia) hemos de ensordecer el mejor con su auricular corres-
pondiente, repitiendo la prueba otra vez. Las anotaciones de los diversos valores
ORVKDUHPRVGHDFXHUGRDODVQRWDFLRQHVGHODVSXQWDVGHHFKD\FRORUFRUUHVSRQ-
GLHQWHVTXHVHUHHUHQDODVQRUPDV\DHVWXGLDGDVGHOPXxHFRGH)RZOHU

10.5) Enmascaramiento.
Se denomina enmascaramiento o ensordecimiento, en ingls Masking,
a la accin que consiste en la aplicacin del ruido especial en un odo
(generalmente el de mejor estado) para cubrir o disimular el sonido, procente

** Nota.- Recordar lo dicho en la nota anterior.

111
Captulo 10

del otro odo, que se est examinando por va sea o por va area, para que el
sujeto no ofrezca una impresin errnea de su audicin. En caso de no hacerlo
as, se tiene la posibilidad de obtener curvas audiomtricas fantasma o par-
cialmente errneas.
Para que un ruido sea efectivo en el enmascaramiento, debe presentar ciertas
condiciones:
1) Un mnimo de intensidad para llegar a ensordecer el odo contrario, o sea, que
GHEHSRVHHUODVXFLHQWHSRWHQFLDFRPRSDUDEORTXHDUODVHQVDFLyQDXGLWLYDGHOWRQR
que se est aplicando, en el odo contralateral.
2) Un mximo utilizable, pues puede producir, por audicin cruzada, no solo el
enmascaramiento del odo contrario sino tambin del que estamos explorando, si es
demasiado intenso.
3) Que tonalmente (o sea, en frecuencia) sea distinto totalmente de la frecuencia
que se est aplicando, como veremos ms adelante, como ser un tono ms bajo, pan-
tonal o de banda estrecha.
Esta tcnica es muy importante y debe ser dominada por todo aquel que se con-
sidere un buen audiometrista, pues sin ella pueden obtenerse, a veces o en deter-
PLQDGRVFDVRVIDOVDVJUiFDVDXGLRPpWULFDVTXHFRQOOHYDUtDQXQDIDWDOFRUUHFFLyQ
audiomtrica.
Para poder comprender a aprender bien la tcnica de enmascaramiento hemos de
saber dar una respuesta correcta a las siguientes preguntas:
1. Cundo se debe enmascarar por va area?
2. Cundo se debe enmascarar por va sea ?
3. Qu tipo de enmascaramiento es el mVHFD]HQFDGDFDVR?
4. 3RVHHUXQFULWHULRGH(FDFLD. Cul es la intensidad mnima efectiva de ruido
de enmascaramiento?
5. Mantener un criterio de No repercusin. Cul es la mxima de ruido enmas-
carante que puede emplearse sin afectar al odo explorado?
Vamos, a continuacin, a contestarlas adecuadamente:
1. La respuesta a esta pregunta pasa por la determinacin de la atenuacin inte-
raural por va area, que es la diferencia entre el nivel de intensidad de la seal en un
odo y el nivel de intensidad con que esta seal llega a la sea del otro lado. Esto fue
medido por Goldstein, quien expone los siguientes valores de atenuacin interaural:
Frecuencia (Hz) 125 250 500 1.000 2.000 4.000 8.000
Atenuacion (dF) 35 40 40 40 45 50 50

112
Captulo 10

Es importante que las gomas o protectores de los auriculares del audimetro


conserven su elasticidad para evitar una mayor propagacin al crneo del sujeto,
facilitada por la rigidez de las almohadillas.
Por ejemplo: la vibracin producida por un auricular normal TDH - 39, equi-
SDGRFRQDOPRKDGLOODV0;$5KDFHYLEUDUHODLUHGHOFRQGXFWRORVFDUWt-
lagos y las masas semirgidas, transmitiendo el sonido a la cclea contralateral a
travs del crneo. Como promedio, la atenuacin interaural utilizando este tipo
de auriculares supra-aurales (sistema convencional) es de, aproximadamente,
40 dE.
Utilizando estos auriculares supra-aurales la diferencia entre las vas area y
sea no puede ser de promedio superior a 40 dE, puesto que si no se transmite
por la va normal lo har por la indirecta.
Tambin se puede aumentar la atenuacin interaural utilizando para enmas-
carar un auricular pequeo insert earphone a 60 dE, ya que el rea que se expone
a la vibracin disminuye. Con auriculares del tipo ER-3A intraconducto, que
se acoplan mediante envolvente de espuma, pueden conseguirse atenuaciones
hasta de unos 70 dE. Como norma general a seguir:
Se debe enmascarar por va area cuando la diferencia entre la va explo-
rada y la sea sea igual o superior a 40 dE.
2. Al colocar el vibrador en un lado, la seal llega a la otra cclea practica-
mente sin prdidas. Clnicamente puede haber diferencias de 5-10 dE debidas a:
variacin subjetiva de resultados, colocacin del vibrador, diferencias introdu-
cidas por la piel y forma del crneo del sujeto y mejor transmisin de las altas
frecuencias si el punto de aplicacin del vibrador est ms cercano a la cclea
correspondiente. La atenuacin interaural por va sea es casi nula. Por tanto,
cuando se explora por va sea debe enmascararse siempre. Si no se enmas-
cara, estamos midiendo el umbral seo del odo mejor.
Se excepta el caso en que la va area y la sea coinciden o solo hay una
diferencia de 10 dE. Dado que la sea real estar siempre entre la indiferente y
la area y, a su vez, no puede ser ms baja que la area, la sea que medimos
es la real.
3. /DHFDFLDGHOHQPDVFDUDPLHQWRVHGHQHFRPRHOJUDGRGHHQVRUGHFL-
miento producido en funcin del nivel de intensidad del ruido que nos afecte.
Por tanto, el ruido enmascarante ms efectivo ser el que produzca el mayor
cambio de umbral con la menor intensidad.

113
Captulo 10

Entendemos por ruido enmascarante o enmascarador a un estmulo auditivo,


generado por un elemento mecnico o electrnico que produce una clase de
ruido caracterstico distinto del tono o de la palabra que est escuchando por el
odo contrario (contralateral) o por el mismo (ipsilateral).
A continuacin, expondremos los tipos ms generales de ruido enmascarante
utilizados en los audimetros actuales:
a) La frecuencia inmediata inferior. Cualquier frecuencia est mejor ensorde-
cida por la inmediata inferior que otra cualquiera ms aguda. Este fenmeno se
aplica como base para ensordecer un tono determinado por su inmediata inferior
de tonalidad ms grave. Si tomamos como tono 2.000 Hz, se ensordece con el
de 1.000 Hz o, en caso de que sea de 1.000 Hz, se tomar el de 500 Hz para este
propsito.
b) Ruido de Sierra. Se trata de un generador de ondas en pico que produce
un ruido similar al de una sierra industrial de madera en funcionamiento. Es de
calidad inferior a los siguientes, no obstante, bien utilizado sirve para las pruebas
estndares.
c) Ruido Blanco o Termal. En ingls White noise :16HGHQHFRPRXQUXLGR
de distribucin uniforme de intensidad que se produce cuando pasan todas las
frecuencias al mismo tiempo. Posee densidad espectral constante y tiene la misma
energa por ciclo. Es el ms indicado para audiometra verbal, pues en la tonal es
muy difcil enmascarar con este tipo de ruido las frecuencias de 250 y 500 Hz.
d) Ruido Rosa. En ingls Pink noise = PN. Es un ruido blanco con una disminu-
cin de 3 dE por octava al elevar la frecuencia.
e) Ruido blanco de banda estrecha. En ingls (Narrow band noise = NBN). Es
una banda de ruido blanco, centrada en la frecuencia que se pretende enmascarar.
Fletcher lleg a determinar que lo que en realidad ensordece son los 50 a 100 Hz
que se hallan por encima y por debajo del tono investigado (la banda crtica). El
colocar todas las frecuencias unidas no produce un poder enmascarante mayor
sino una intensidad mayor de la debida. Si se estrecha la banda enmascarante por
debajo de la banda crtica, la similitud del ruido enmascarante blanco de banda
estrecha con un tono puro puede producir confusiones en el paciente. Este ruido
vara con la frecuencia que se pretende enmascarar. Con este mtodo no se tienen
los inconvenientes sealados con el ruido pantonal. Es el masking ms indicado
para la audiometra tonal, calibrado en nivel de enmascaramiento efectivo, pero
solo lo traen adaptado los audimetros de mayor coste.

114
Captulo 10

6HGHQHFRPRnivel de enmascaramiento efectivo el que enmascara un


tono puro de esa intensidad centrado en la banda. Cuando el nivel de enmas-
caramiento efectivo sea de x dE, se enmascara un tono puro de x dE de inten-
sidad centrado en la banda.
f) Speech Noise (SN). Se trata de un ruido blanco con una disminucin de
12 dE por octava a partir de los 1.000 Hz hacia las altas frecuencias.
Esta disminucin de nivel en las altas frecuencias, en el Ruido rosa y en el
Speech noise se corresponde con la poca importancia de las altas frecuencias
en el espectro de la palabra. En la Fig. 67 pueden observarse los espectros de
ruido blanco y de speech noise emitidos por auriculares del tipo TDK-39.
4. Veamos qu entendemos como &ULWHULRGHHFDFLD.
En audiometra tonal y dado que utilizamos ruido blanco de banda estrecha
FDOLEUDGRHQQLYHOGHHQPDVFDUDPLHQWRHIHFWLYRVHUiVXFLHQWHODDSOLFDFLyQ
por va area de un nivel de enmascaramiento igual al nivel medio de audicin
para enmascarar un posible estmulo lateralizado. De acuerdo con la tcnica
psicoacstica de Goldstein aadiremos por precaucin 15 dE de seguridad.
5. Criterio de No repercusin.
Si aplicamos el enmascaramiento con un auricular supra-aural, la atenua-
cin interaural es de 40 dE de promedio, por tanto, el nivel de enmascara-
miento no deber superar en 40 dE el nivel medio de la va sea del lado
explorado.
Cuanto mayor sea el Rinne conocido del lado enmascarado, mayor deber
ser el nivel de enmascaramiento a emplear, y si es muy elevado es posible que
repercuta, en cuyo caso no es posible encontrar un nivel de enmascaramiento
TXHFXPSODORVFULWHULRVGHHFDFLD\1RUHSHUFXVLyQ8QDVROXFLyQDHVWHSUR-
blema consiste en utilizar auriculares intraconducto o auriculares pequeos
insert- earphone para enmascarar, con lo que aumentaremos la atenuacin
interaural a 70 o 60 dE, respectivamente. En este caso, ya podremos aumentar
el nivel de enmascaramiento para compensar el Rinne del odo a enmascarar,
sin repercutir en el odo explorado.

10.6) Algunas consideraciones fundamentales.


1. De cclea a cclea no puede haber transmisin de sonido por tratarse del
paso de un sonido de un medio de baja densidad (blando) a otro del mismo tipo
a travs de un medio muy rgido (crneo) y tener impedancias muy distintas.

115
Captulo 10

2. La va sea medida es independiente del lugar de colocacin del


vibrador. Hay una pequea tendencia a la homolateralizacin a frecuencias
DOWDV DJXGRV ORTXHMXVWLFDHOKHFKRGHFRORFDUHOYLEUDGRUHQHOODGRTXH
se pretende explorar.
3. Efecto de oclusin. Bing en 1891, determin el incremento de sensibi-
lidad por va sea cuando se oclua el CAE. (Conducto Auditivo Externo),
en una audicin normal o en una hipoacusia de percepcin. Este incremento
est relacionado con una energa adicional que alcanza la cclea, no con un
incremento intrnseco de sensibilidad. Se reduce la prdida por propagacin
a travs del odo medio y externo. En las hipoacusias de transmisin no se
produce este incremento al ocluir el CAE, puesto que ya existe una oclusin
intrnseca. El aumento de sensacin sonora por va sea es de:
A 250 Hz 15 dF
a 500 Hz 15 dF
a 1.000 Hz 10 dF

Al efectuar el enmascaramiento por va area en las exploraciones de la va


sea tendremos que tener en cuenta el efecto de oclusin sumando los valores
antes mencionados a la va area del odo enmascarado para las frecuencias
anteriormente sealadas y, adems, los 15 dE de seguridad.
4. Si el audimetro est correctamente calibrado, el nivel de la va sea no
puede estar por debajo del de la va area.
5. Los auriculares intraconducto presentan las siguientes ventajas:
a) Mayor atenuacin interaural (60 dE).
b) Mayor atenuacin del ruido ambiente.
c) Menor transmisin vibrotctil.
d) Posible solucin a conductos estrechos o colapsados.
Pero tambin tienen sus inconvenientes:
a) Necesitan una calibracin individual y distinta de los auriculares supra-
aurales. Proporcionan peor respuesta por debajo de los 500 Hz y por encima
de los 4.000 Hz.
b) Variabilidad del nivel segn sea mayor o menor la introduccin del
auricular en el CAE.
c) Necesitan mayor higiene y solidez.
6. La sensibilidad por va sea no es 100 por 100 independiente del estado

116
Captulo 10

del odo medio. Los pacientes con otoesclerosis presentan casi siempre una
bajada a 2.000 Hz, descrita por Carhart en 1950, conocida como hendidura
de Carhart (vase la Fig. 68).

Fig.67. *UiFDV TXH UHSUHVHQWDQ HO HVSHFWUR GH 5XLGR EODQFR \ 6SHHFK QRLVH HPLWLGRV
por auriculares TDH - 39 (Konkle DF, Rintelmann WF. Principles of sppech
Audiometry. Baltimore University Park Press. 1983 ).

6HSUHHUHHOHPSOHRGHOYLEUDGRUVREUHODDSyVLVPDVWRLGHVFRQUHV-
pecto a la posicin en el centro de la frente, debido a la ausencia de una
banda que situe el vibrador en la frente con la presin esttica estndar. Se
recomienda una fuerza de 550 gramos-fuerza. Tambin es debido al efecto de
homolateralizacin de las altas frecuencias.
Mtodo de Operacin (mtodo psicoacstico de Golstein,1979).
Exploracin tonal de la va area con enmascaramiento.
9HULFDUYHUEDOPHQWHFRQORVDXULFXODUHVGHODXGLyPHWURFXiOHVHORtGR
mejor y realizar la audiometra tonal area de este lado.
2. Realizar la audiometra tonal area sin enmascarar del odo peor.
3. Realizar la audiometra tonal sea sin enmascarar, colocando el vibrador
en el lado que posee mejor media de audiometra area.

117
Captulo 10

4. Si la diferencia entre la peor area (frecuencia por frecuencia) y la


sea es mayor de 40 dE, hay que repetir la area peor enmascarando la
mejor.

Fig.68. (QODJUiFDSRGHPRVREVHUYDUORVSHUOHVDpUHR\yVHRGHXQDKLSRDFXVLDFRQ
MDFLyQHVWDSHGLDO$ORVPHVHVGHVSXpVGHODRSHUDFLyQQRVRORKDPHMRUDGROD
va area sino tambin la sea, desapareciendo la hendidura de Carhart que exista
en el preoperatorio.

5. Enmascarar por va area el odo mejor a un nivel igual al umbral areo


del odo enmascarado + 15 dE.
6. Restablecer en presencia del enmascaramiento en el odo mejor, el
umbral anterior por va area en el odo peor.
7. Cada vez que el paciente oye un tono (pulsado o modulado) subir el nivel
de enmascaramiento en 5 dE
8. Cada vez que no oiga el tono, aumentarlo en pasos de 5 dE hasta que lo
oiga.
9. Continuar el proceso hasta que sea posible realizar tres incrementos de
5 dE en el enmascaramiento sin alterar el umbral del tono. Habremos llegado
al plateau y ese ser el umbral verdadero.
10. Anotar este umbral en el audiograma y el nivel de enmascaramiento
QDO

118
Captulo 10

Exploracin tonal de la va sea con enmascaramiento.


1. Se han obtenido las dos audiometras areas y la sea colocando el
vibrador en la mastoides de la mejor area.
6LXQDGHODVGRVDpUHDVFRLQFLGHFRQODyVHDRQRGLHUHPiVGHGE,
la sea es correcta. Si la diferencia entre la area y la sea correspondientes
es mayor de 10 dE, hay que repetir la sea enmascarando.
3. El nivel de enmascaramiento por va area en el odo enmascarado ser
igual para cada frecuencia a la suma del umbral areo de este lado + 15 dE+
efecto de oclusin si lo hubiere (no se debe considerar el efecto de oclusin en
las hipoacusias de transmisin).
4. Proceder igual que en el caso de la va area hasta encontrar el plateau.
$QRWDUHOXPEUDOHQHODXGLRJUDPD\HOQLYHOGHHQPDVFDUDPLHQWRQDO

10.7) Enmascaramiento en las pruebas verbales.


Debe enmascararse cuando la diferencia entre el umbral de recepcin verbal
HQHORtGRDH[SORUDU\ODPHGLDWRQDO D+] GHQRPLQDGD
Media Haic, por va sea del odo contralateral es mayor de 45 dE.
Debe enmascararse con un nivel igual o superior al umbral de recepcin
verbal del odo explorado menos 30 dE. En algunos casos ser necesario incre-
mentar el nivel de enmascaramiento para evitar una lateralizacin.
Enmascaramiento Central.
:HJHO\/DQH  ORGHQLHURQFRPRHOFDPELRRHPSHRUDPLHQWRHQHO
umbral debido a la aplicacin de un ruido enmascarante en el odo contralateral
a intensidades inferiores al nivel de atenuacin interaural. Son debidas a inte-
racciones a travs del sistema nervioso central. La estimulacin de los ncleos
olivares superiores debilita los impulsos aferentes de la cclea opuesta.
Hoy sabemos tambin que la presencia de un ruido enmascarante en un
odo inhibe la emisin otoacstica en el odo contralateral.
Estos valores no se tienen en consideracin en la clnica normal ya que no
existen ponderaciones uniformes de los mismos.
Sensorineural Acuity Level (SAL) o Nivel de Agudeza Neurosensorial.
Tcnica desarrollada por Jerger y Tillman en 1960. Se trata de comparar en
un sujeto normal y en uno patolgico las respectivas variaciones del umbral
por va area producidas por la presencia de un ruido enmascarante por va
sea. Es una variante de la Prueba de Rainville (1959).

119
Captulo 10

Es necesario que el audimetro tenga la posibilidad de enmascarar por va


sea con un ruido blanco de banda estrecha. Se determinar en varios sujetos
normales la variacin del umbral por va area producido por la presencia de
ruido enmascarante por va sea. Esta variacin puede ser del orden de 45 dE.
Se tienen estos valores tabulados para cada frecuencia.
En una hipoacusia de transmisin y tambin en un ruido normal, hay una
variacin importante del umbral en presencia del ruido. En una hipoacusia
de percepcin, el efecto ser tanto menor cuanto mayor sea la prdida
perceptiva.
Para realizar la prueba se halla el umbral por area sin y con enmascara-
miento. Se determinan las diferencias. Estas se restan de los valores tabulados
para sujetos normales y el valor hallado es la componente perceptiva.
Sin embargo, la prueba SAL no tiene en cuenta el efecto de oclusin pre-
sente en sujetos normales y ausente en hipoacusias de transmisin (Jerger y
Jerger, 1965). Su empleo no se ha estandarizado en la clnica diaria.

10.8) Audiometra tonal.


Todo lo que acabamos de exponer constituye las audiometras tonales, pues
estas se basan en la emisin y percepcin de tonos puros (de una frecuencia
MD\GHWHUPLQDGD TXHVRQORVTXHQRUPDOPHQWHHPLWHXQEXHQDXGLyPHWUR
y se emplean en la determinacin de los umbrales involuntarios (mnimo y de
inconford que nos indican una parte fundamental del diagnstico de posibles
hipoacusias y como base para poder efectuar una adecuada adaptacin de sus
medios protsicos (audfonos) en pro de los pacientes o sujetos hipoacsicos.

120
Captulo 11

11.1) Audiometra Supraliminar.


Hasta ahora con la audiometra tonal liminar hemos averiguado los lmites
de audicin inferior = umbral y superior = inconford que un sujeto posee.
Pero, como dijo Lscher: Una sordera no puede considerarse funcionalmente
esclarecida si no se conoce el comportamiento de toda la extensin del campo
auditivo. Por tanto, para poder efectuar un completo examen funcional audio-
lgico, hemos de estudiar el comportamiento del odo a niveles superiores al
umbral y, con ello, podremos apreciar las posibles distorsiones en los tres
parmetros siguientes: Intensidad, Tiempo y Frecuencia. Vamos pues, a estu-
diar cada una de ellas, enlazando con la importante cuestin siguiente.

11.2) Qu es y cmo se produce el recruitment.


El recruitment llamado tambin en espaol reclutamiento, es el mas impor-
tante de los transtornos en la percepcin de la intensidad y consiste en una
relacin anmala entre la Altura (percepcin psquica de la intensidad) y la
Intensidad fsica o volumen del estmulo; en estos pacientes se produce un
estrechamiento del campo auditivo que les lleva de no or apenas a or muy
fuerte, sin un aumento importante en la intensidad, casi sin separacin tem-
poral entre ambas sensaciones. As pues, el reclutamiento (mejor hubiera sido
haberlo denominado reforzamiento) es un fenmeno paradjico basado en
la capacidad que poseen algunos odos hipoacsicos de no percibir el sonido
a intensidades normales, mientras que, por encima de un determinado nivel,
presentan la capacidad para or igual que un odo sano o an mejor.
6X FDXVD H[DFWD VLROyJLFDPHQWH QR VH FRQRFH D~Q $SUR[LPDGDPHQWH
Fowler crey que se trataba de un mecanismo de defensa o compensacin por

121
Captulo 11

el que se consegua, en unas determinadas circunstancias, un cierto reagrupa-


PLHQWRGHEUDVQHUYLRVDVGHQWURGHODFyFOHDQROHVLRQDGDVGHORtGRKLSRDF~-
VLFRFRQREMHWRGHTXHOOHYDVHQHOVXFLHQWHQ~PHURGHLPSXOVRVDOFHUHEUR
FRQODQDOLGDGGHFRQVHJXLUTXHHVWHSHUFLELHVHHQFLHUWDVFRQGLFLRQHV igual
RPHMRUTXHXQRQRUPDOUHULHQGRVHHVWDVDun cierto nivel de intensidad que
dispara el fenmeno. El descubrimiento de esta disfuncin de la percepcin
de la intensidad y su localizacin en el rgano de Corti (Cclea) hizo que se
estableciera la diferenciacin entre corticopatas (lesiones cocleares) y lesiones
retrococleares para las hipoacusias de percepcin que hasta entonces existan,
avanzando as, con las correspondientes pruebas, un paso muy importante para
establecer un topodiagnstico de las vas auditivas.

11.2) Mtodos y pruebas para su deteccin y medida.


Existen varias pruebas para poner en evidencia el reclutamiento, siendo las
ms utilizadas las de Fowler, Lscher y SISI. Veamos resumidamente cada
una de ellas:
1) Mtodo de Fowler:
Consiste en la determinacin de igual altura de la sensacin binaural, com-
parando en la misma frecuencia, una intensidad fsica sonora en ambos odos.
Requiere la presencia de una diferencia de audicin mnima de 30 dE entre
ambos odos.
2) Mtodo de Lscher:
Est fundado en la discriminacin de dbiles variaciones de intensidad,
aplicando un sonido modulado; se practica aumentando el umbral de audicin
a 40 dE sobre el nivel medio del paciente y sobre el que se hace or el sonido
modulado variable entre 0,25 y 5 dE. La normalidad est entre 0,85 y 1,5 dE.
3) Mtodo de SISI (Short Increment Sensibility Index):
Su nombre obedece a la designacin del valor del ndice de sensibilidad a
pequeos incrementos de intensidad. Para ello, se utilizan pequeos estmulos
relativamente mantenidos y sin ninguna ritmicidad. La prueba se realiza a 20
dEsobre el umbral medio de intensidad area y se compara con estmulos de
1 dE. Respuestas superiores al 80 % se considera que existe reclutamiento.
Esta prueba es la que hoy en da se practica con mayor proporcin por ser ms
fcil de resolver por el enfermo cuando no es posible utilizar la de Fowler. Los
modernos audimetros incorporan este mtodo automticamente.

122
Captulo 11

Para completar el panorama de la Audiometra supraliminar es necesario


que comentemos, aunque sea brevemente, los otros dos tipos de distorsiones
que enunciamos en un principio.
Las distorsiones en el Tiempo abarcan dos tipos fundamentales: los fen-
menos de Adaptacin y Fatiga.
4) La AdaptacinHVODFDSDFLGDGGHDFRPRGDFLyQDORVHVWtPXORVDF~V-
ticos y la prueba consiste en medir la sensibilidad auditiva durante un tiempo
determinado con un tono continuo en el umbral; a esta prueba se la denomina
Ton Decay.
5) La Fatiga o disminucin de la capacidad auditiva del rendimiento coclear
despus de un estmulo prolongado. Su prueba clsica es la de Peyser y es de
JUDQLQWHUpVSDUDSUHYHQLUORVWUDXPDVDF~VWLFRVHQODVLQGXVWULDVRWUDEDMRVGH
elevado ruido ambiental.
 3RUQODVGLVWRUVLRQHVHQIUHFXHQFLDVHGHQRPLQDQDiploacusias, por
las cuales una misma frecuencia es percibida de distinta forma por cada odo.
Son de muy difcil valoracin audiomtrica.

123
Captulo 12

12.1) Concepto de Trauma acstico. Sus tipos: de Primer,


6HJXQGR\7HUFHU*UDGR6XUHHMRHQOD$XGLRPHWUtD7RQDO
Antes del desarrollo actual de la Audiometra se la denominaba Enfermedad
de los caldereros y, ms modernamente, sera de los chapistas. Se notaba
en estas profesiones que, al correr del tiempo, la audicin de los interesados
GLVPLQXtDSRFRDSRFRSULPHURSDUDODYR]FXFKLFKHDGDKDVWDOOHJDUDOQDO
a una hipoacusia (o sordera) casi total.
6HGHQHFRPR7UDXPD$F~VWLFRDWRGDOHVLyQSURGXFLGDHQHORtGRLQWHUQR
(cclea) por impactos sonoros fuertes y persistentes como los que se producen
en industrias varias: estampidos, ruidos estrambticos, explosiones, golpeteo
de martillos o taladros de percusin, etc. Interesa mucho la composicin tonal,
pues los agudos son peores que los graves, y de estos el tono de 8.000 Hz es
el que ms lesiones produce.
El sujeto expuesto a grandes y contnuos ruidos, sin proteccin, los
primeros das tiene cefalas. Despus existe una ligera hipoacusia y una sen-
sacin de malestar en el odo, como de replecin, luego despus de un corto
periodo, el enfermo se acostumbra a esta nueva situacin y es ms tarde cuando
DSDUHFHQORVDF~IHQRVFRPHQ]DQGRDQRWDUHOSDFLHQWH\ODJHQWHGHVXHQWRUQR
que su audicin est disminuida. Despus de un periodo mayor, que depende
de la intensidad a que est expuesto y de la mayor o menor resistencia coclear
al dao o lesin, y por tanto, la hipoacusia va progresando cada vez ms.
Larsen ha estudiado audiomtricamente muy bien lo que les ocurre evo-
lutivamente a estos enfermos. Consider tres grados en la evolucin de este
7UDXPDTXH\DVRQFOiVLFRV
1.er Grado$OFRPLHQ]RFXDQGRQRVHWLHQHD~QQLQJ~QWUDQVWRUQRDXGLWLYR
y se oye bien la palabra hablada pero el audiograma muestra una cada entre 20

125
Captulo 12

y 30 dEen la frecuencia de 4.000 Hz, de una octava de extensin ms o menos,


pero que se rehace o eleva otra vez en el extremo tonal agudo. (Fig. 69).
2. Grado: El audigrama muestra en estos estados un mayor descenso del
XPEUDOODKLSRDFXVLDHV\DPDQLHVWDVLHQGRODSpUGLGDGHXQRVGE
y abarca mayor extensin, unas dos octavas, cayendo ms en las frecuencias
agudas (Fig. 70).
3.er Grado/DFDtGDGHODFXUYDHVPiVDFHQWXDGDKD\DF~IHQRV\UHFOXWD-
miento intensos, el umbral decrece hasta los 60 dE o ms, abarcando una gran
extensin de la zona tonal aguda, y ya no existe, en esa zona, recuperacin
alguna (Fig. 71). Desgraciadamente, muchos afectados slamente ya en este
grado se dan cuenta o toman conciencia de su problema, cuando ya no hay
solucin posible.
No se sabe a ciencia cierta por qu se lesiona selectivamente la frecuencia
de 4.000 Hz, a pesar de estar estimulado el odo por un ruido pantonal o uti-
lizar experimentalmente otra frecuencia.
En todos los casos se da un aumento de fatiga auditiva cada vez mayor,
hasta la irreversibilidad total por las lesiones de la Cclea. Solamente en el
1.er grado, y en condiciones especiales, es posible volver a la normalidad.
Como ya algo sabemos, la nocividad del ruido depende de los siguientes
factores:
1) Nivel de intensidad del ruido.
 7LHPSRGHH[SRVLFLyQDOUXLGR
3) Frecuencia del ruido.
4) Intevalo de tiempo entre las exposiciones al ruido.
 /DPD\RURPHQRUUHVLVWHQFLDFRPRVXMHWRSDVLYRUHFHSWRUGHOUXLGR
Existen individuos cuyo odo (Cclea) es muy resistente al ruido y otros
son muy lbiles. Para evitar la accin nociva del ruido sobre estos individuos
TXHPDQLHVWDQXQDSUHGLVSRVLFLyQDODOHVLyQOD/H\SHUFHSW~DODVVLJXLHQWHV
actuaciones:
a) La periodicidad de las exploraciones auditivas ser, por lo menos,
anual.
b) La conveniencia de una Audiometra al preempleo, para poder controlar,
a posteriori, los efectos del ruido.
c) Es preceptivo un reconocimiento de adaptacin al trabajo, dos meses
despus de ingresar en este ambiente ruidoso.

126
Captulo 12

12.2) Fatiga auditiva. Test de Peiser.


La mejor manera de determinar esta sensibilidad induvidual a los efectos
GHO UXLGR HV XWLOL]DU HO GHQRPLQDGR 7HVW GH 3HLVHU PX\ HPSOHDGR KDVWD OD
actualidad para prevenir o atenuar la denominada hipoacusia profesional que
SXHGHGHVHPERFDUHQHO7UDXPDDF~VWLFRDQWHULRUPHQWHH[SOLFDGR
Para poder efectuar la prueba correspondiente al citado test, con tonos
puros, hemos de efectuar las siguientes operaciones:
1) Determinar el umbral normal, medido para la frecuencia de 1.000 Hz,
por va area.
2) Estimular, en la citada frecuencia, con un tono continuo (fatiga) con una
intensidad de 100 dE, durante 180 s (3 minutos).
 'DUXQGHVFDQVRGHV
4) Efectuar una nueva determinacin del umbral a la frecuencia de 1.000 Hz.
 1XHYRGHVFDQVRPiVSURORQJDGR KRUD 

Fig. 69. 'LDJUDPDGHOD$XGLRPHWUtDFRUUHVSRQGLHQWHDXQ7UDXPDDF~VWLFRGH1.er Grado.

127
Captulo 12

6) Determinar el umbral normal, medido para la frecuencia de 1.000 Hz, por


va sea.
7) Repetir la intruccin 2) exactamente.
8) Repetir 3).
9) Volver a determinar el umbral normal, medido para la frecuencia de
1.000 Hz, por va sea.
La interpretacin es la siguiente:
NormalSXHGHKDEHUXQGHVSOD]DPLHQWRGHOXPEUDOHQWUH\GE.
SospechosoH[LVWHXQGHVSOD]DPLHQWRGHOXPEUDOHQWUH\GE.
Fatigabilidad netamente anormal o indicio de labilidad coclear: el despla-
zamiento del umbral es > 10 dE.
Esta prueba, insistimos, deber hacerse previa al empleo de una persona en
un ambiente ruidoso superior a los 70 - 80 dE que pueda, bien por intensidad,
ELHQSRUGXUDFLyQSURYRFDUOHXQWUDXPDDF~VWLFRGHOJUDGRTXHVHD

  $XGLRPHWUtDYRFDOR/RJRDXGLRPHWUtD/LVWDGHSDODEUDVGHO
Dr. Tato.
6HUHHUHDODGLVFULPLQDFLyQDXGLWLYDGHODSDODEUDRGHOOHQJXDMHRUDO\
los datos que suministra nos informan sobre los niveles corticales de capta-
cin y comprensin.
Adems del Audimetro con dispositivo para la realizacin de la
Audiometra vocal (AV) (que es similar al de hablar con el paciente al prin-
cipio de las pruebas anteriores), es conveniente disponer de una cmara
VRQRDPRUWLJXDGD SDUD HO KLSRDF~VLFR \ GH XQ DPELHQWH WUDQTXLOR \ VLOHQ-
cioso para el examinador; tambin precisa de un material elegido de listas
de palabras seleccionadas y de frases, de forma que todo ello haya sido
calibrado previamente.
Por tanto, la audiometra vocal relaciona dos parmetros: uno (variable
independiente) que es la Intensidad en dE+7/\RWUR ODIXQFLyQ HOGHOD
GLFXOWDGGHODFDSWDFLyQGHOPHQVDMHYRFDOGDGRHQSRUFHQWDMH
En un principio parece difcil cifrar la intelegibilidad, ya que el estmulo
constituido por la palabra es eminentemente variable (conjunto transitorio de
GLIHUHQWHVIUHFXHQFLDVHLQWHQVLGDGHV SXHVDGHPiVLQX\HPXFKRHOJUDGRGH
conocimiento de la lengua, la mayor o menor inteligencia del sujeto, el poder
de suplencia mental, etc.

128
Captulo 12

Fig. 70. 'LDJUDPDGHOD$XGLRPHWUtDFRUUHVSRQGLHQWHDXQ7UDXPDDF~VWLFRGH*UDGR

Fig. 71. 'LDJUDPDGHOD$XGLRPHWUtDFRUUHVSRQGLHQWHDXQ7UDXPDDF~VWLFRGH3.er Grado.

129
Captulo 12

Fig.72. '
 LIHUHQWHVFXUYDV RLQFOLQDFLRQHV VHJ~QHOPDWHULDOYHUEDOTXHSXHGHVHUHPSOHDGR
en una logoaudiometra: 1 Frases, 2 Bislabas espndeas (las ms empleadas), 3
Monoslabos, 4 Logotomas monoslabos.

A medida que aumenta la intensidad de emisin de los vocablos, irn apa-


reciendo diferentes umbrales que sern estudiados (y anotados), as como
se apoyan en un examen de rutina sobre la inteligibilidad de los vocablos
del test.
Estos test de inteligibilidad pueden ser efectuados con (Fig. 72):
Lista de palabras monosilbicas.
/LVWDGHSDODEUDVELVLOiELFDV 'U7DWR  )LJ\ 
Lista de frases convenidas.
/RVYRFDEORVGHEHQWHQHUHOPLVPRQ~PHURGHVtODEDVQRSUHWHQGHULQGXFLU
QLQJ~QHTXtYRFRPROHVWR HVGHFLUQRGHEHH[LVWLUQLQJ~QYRFDEORGHGREOH
VHQWLGR ORVHOHPHQWRVGHEHQVHUGHSURQXQFLDFLyQMD\DODYH]SDUWHGHO
vocabulario usual del sujeto (Fig. 72 y 73).
En la audiometra vocal clsica se utilizan palabras fonticamente equili-
EUDGDVTXHFRQVWLWX\HQODXQLGDGGHPHGLGD\VHFXHQWDHOQ~PHURGHSDOD-
bras correctamente repetidas por el sujeto a intensidades variables, lo cual
permite determinar estadsticamente la curva de inteligibilidad.

130
Captulo 12

Fig. 73. '


 LVFR FRPSDFWR &'  TXH FRQWLHQH  OLVWDV GH SDODEUDV GHO 'U 7DWR HQ FDVWH
llano) empleables tanto en la deteccin de umbrales como test de discriminacin
en adultos o nios.

131
Captulo 12

Fig. 74. 7
 LSRHVWiQGDUGH$XGLRJUDPDYRFDOHPSOHDGRHQHVWHWLSRGHSUXHEDVFRQWH-
niendo la curva normotipo o de logoaudicin normal en espaol.

La prueba se realiza con auriculares del tipo ya mencionado, en odos sepa-


rados o bien en campo libre para control protsico; se emplea tambin un
micrfono (con o sin lectura labial), acomodndose a la velocidad que precise
el sujeto, o bien con voz registrada en un material o soporte sonoro equili-
brado, es decir, en una cinta casette o, modernamente, en un CD (Fig. 73).
En el umbral tonal (se trata de un umbral de detectabilidad), y por lo
WDQWRQRSXHGHUHFRQRFHUVHQLQJ~QPHQVDMH\el umbral de inteligibilidad
VHGHQHFRPR el nivel de intensidad, al cual, solo el 50 % de palabras son
repetidas correctamente y viene a ser unos 20 dE superior al umbral tonal
ISO a 1000 Hz, lo cual permite establecer equivalencias con las curvas tonales
(Fig. 74).
El primer inters de la audiometra vocal es precisar el nivel real del
umbral. Hay una zona ms o menos neta en razn de la dispersin de
rendimientos, en ese instante privilegiado en que el mensaje es reconocido.
Esta imprecisin es mayor cuanto mas desequilibrio de frecuencias existe y si
se suman factores de distorsin.

132
Captulo 12

Fig. 75. Diagrama vocal que nos muestra las distintas inclinaciones de la curva normo-
tipo para bislabas espndeas () y monoslabos (------) (en ingls [I] y espaol
[E])

El segundo inters del audiograma vocal es objetivar el efecto de degra-


dacin tonal sobre la inteligibilidad, as pues el desequilibrio frecuencial, la
presencia de distorsiones supraliminares o la amputacin de una parte del
HVSHFWURIUHFXHQFLDOVHUHHMDUiQHQODIRUPDGHODFXUYDYRFDO
Al estudiar en la AV las posibilidades del individuo sobre el lenguaje
hablado e investigar sobre los parmetros de intensidad y discriminacin (es
GHFLUVREUHORVDVSHFWRVQHXURVHQVRULDOHV\QHXURVLROyJLFRVGHODDXGLFLyQ 
VRQHVWRVGDWRVGHORVSDUiPHWURVHVSHFtFRVGHODVLRORJtDGHODSDODEUDORV
que nos proporcionan informacin que complementa los datos obtenidos por
la audiometra tonal.
6L DQWHV KHPRV GHQLGR FRPR umbral de inteligibilidad como en el que
se obtiene el 50 % de palabras repetidas correctamente, es a esa intensidad
lo que ahora denominaremos umbral vocal liminar, a aquel en el cual se
LGHQWLFDHOQ~PHURGHHVWtPXORVFRQHOQ~PHURGHORVHUURUHV
Y llamaremos umbral vocal supraliminar el que estudia el porcentaje
mximo de discriminacin, es decir, el mximo porcentaje de palabras com-
prendidas y que repite el sujeto con exactitud, cualquiera que sea la inten-
VLGDGQHFHVDULDSDUDTXHORORJUH

133
Captulo 12

Fig. 76. *
 UiFDTXHQRVPXHVWUDXQFRQWUROWHOHIRQRPpWULFRGHODUHVWDXUDFLyQHVWHUHRSUR-
tsica de la audicin binaural de un sujeto de 22 aos, que presentaba una importante
GHFLHQFLDDXGLWLYDHQDPERVRtGRV *'HFURL[\-'HKDXVV\ (QHOODSRGHPRV
apreciar: D: curva vocal monoauricular del OD. G: dem del OI. D1: curva medida
en campo libre, habindosele colocado en el OD un audfono ear level, regulado
a un nivel confortable para la voz media. [d]: ganancia auditiva monoaural obtenida
en estas condiciones (paso de D a D1) G1: curva vocal medida en campo libre,
habindosele colocado tan solo al OI un audifono idntico, regulado en igualdad de
sonoridad con el OD, en las condiciones anteriormente mencionadas. g: ganancia
monoaural necesaria para que la curva G retroceda a la curva G1 (condicin real-
izada cuando el equilibrado audioprotsico de la audicin binaural es correcto).
D1 + G1: curva vocal medida en campo libre, habindose colocado la prtesis bin-
DXUDOVLQPRGLFDFLyQGHORVUHJODMHVSUHFHGHQWHVEJDQDQFLDDOUHGHGRUGHG%
resultante del aumento de intensidad subjetiva, consecutiva a la restauracin de la
audicin binaural simtrica.

Con los resultados del examen y con los parmetros de intensidad y de


GLVFULPLQDFLyQVHWUD]DXQJUiFRHQHOFXDOVHGLEXMDODFXUYDQRUPRWLSR
(vase Fig. 74), teniendo en cuenta que en dicha curva vocal son muy impor-
tantes las siguientes caractersticas:
Umbral de detectabilidad: El sonido se percibe, pero no se reconoce.
Umbral de audibilidad: Se reconoce el sonido, pero no se comprende
el lenguaje.
Umbral de inteligibilidad: Se oye y se comprenden los vocablos en el
GHOWRWDOGHFDVRV

134
Captulo 12

Fig. 77. (
{
 MHPSORGHSDUWHGHXQDOLVWDGHSDODEUDVELVtODEDVGHO'U7DWRMXQWRDOSURFHGL-
PLHQWRSUiFWLFRQHFHVDULRSDUDSRGHUFDOFXODUODVGLVWLQWDVYDORUDFLRQHVGHGH
LQWHOLJLELOLGDGSRUHOQ~PHURGHDFLHUWRV

135
Captulo 12

Ya se ha mencionado que el material fontico debe ser amplio en cantidad


y en calidad y, en general, estar compuesto de palabras bislabas igualmente
DFHQWXDGDV HVSyQGHDV  )LJ   OR FXDO LPSOLFD HQRUPHV GLFXOWDGHV SDUD
su adquisicin: cada sonido vocal debe ir precedido o seguido de un sonido
consonante y puede intercalarse un sonido consonante y uno vocal o seguir
DHVWH~OWLPR
En toda prueba vocal hay que tener en cuenta la atencin del examinando,
su actitud psicolgica y la posible fatiga.
+D\ TXH H[SOLFDUOH DO SULQFLSLR DO KLSRDF~VLFR HQ TXp FRQVLVWH OD
prueba, realizarla monoauricularmente (primero un odo y luego el otro),
con o sin lectura labial, con o sin ensordecimiento, y tambin binaural-
mente as como en campo libre (sobre todo para el control audioprotsico,
posterior a la adaptacin) (Fig. 76) con la voz natural o con soporte y
DQRWDU GHELGDPHQWH HQ HO JUiFR ORV GLVWLQWRV YDORUHV REWHQLGRV HQ ODV
GLVWLQWDVPRGDOLGDGHVGHODSUXHEDVHJ~QHOPpWRGRGHODSDUWHLQIHULRU
de la Fig. 77.
Una vez acabada la prueba, las curvas de inteligibilidad deben interpre-
tarse en relacin a la curva normal, que en la lista de palabras bisilbicas
FRPRODVGHO'U7DWRTXHVHH[SRQHQHQHOHMHPSORGHOD)LJ HQODTXH
tambin se expone la forma prctica de la prueba para su representacin gr-
FD\TXHFRPRSRGHPRVREVHUYDU )LJ WLHQHIRUPDGH6LWiOLFDTXH
VHVLW~DHQWUH\GE\FUX]DHOHMHGHOHQORVGE. En las monosi-
lbicas la suplencia tiene menos actuacin, dndose principalmente los casos
(Fig. 78):
La curva puede estar menos enderezada que la normal.
La curva puede ser paralela a la normal.
La curva puede estar ms inclinada que la normal, por disminucin de
la inteligibilidad (hipoacusia de percepcin), alcanzando distintas formas que
se resumen en: muy oblicua, meseta y campana que comprenden todas las
formas posibles. Las caractersticas bsicas de la curva de inteligibilidad,
pueden resumirse en cinco caracteres (Fig. 79):
1) Umbral de Inteligibilidad (o sensibilidad del odo para la discrimi-
nacin de vocablos) es la medida en dE sobre la ordenada del 50 % de la
distancia que separa la curva patolgica de la normotipo (A), HQODJXUD
citada.

136
Captulo 12

2) Pendiente de la curva: Se objetiva en su interseccin con el eje del


  GH YRFDEORV FRPSUHQGLGRV 3XHGH HVWDU FLIUDGD SRU HO iQJXOR IRU-
mado por la tangente a la curva en este punto de interseccin y el eje del
50 % (B), dem.
3) Mximo de InteligibilidadTXHVHGHQHSRUODRUGHQDGDTXHDIHFWDHQ
el punto culminante (C),tGHP
4) Porcentaje de discriminacinTXHVHGHQHFRPRHOGHYRFDEORVFRP-
prendidos a un nivel de intensidad situado a 35 dE por encima del umbral de
inteligibilidad (D), tGHP
 Umbral de distorsin ser el nivel de intensidad vocal que corresponde
al comienzo del decrecimiento de la curva cuando exista (E), GHP
Si la curva es en campana este umbral corresponde a la intensidad del
mximo de inteligibilidad, ya que, despus decrece.
([LVWHQXQDVHULHGHSUXHEDVGHDXGLRPHWUtDYRFDOTXHVHYDOHQGHDOJ~Q
DUWLFLRSDUDPRGLFDURGLVWRUVLRQDUHOPHQVDMHYRFDO\REWHQHUDVtGLFXO-
tades insuperables en caso de alteraciones anatmicas, funcionales o psquicas
de las vas centrales y centros relacionados con la comprensin del lenguaje.
Se utilizan alteraciones de las cualidades de la voz emitida (frecuencia, inten-
sidad y timbre), de las cualidades rtmicas del habla (movimientos, ordena-
cin sonora, acento), de las cualidades superiores del lenguaje (extensin,
VLJQLFDFLyQFODULGDGDOWHUQDQFLDGHODHPLVLyQDXGLFLyQELQDXUDOHWF $Vt
tenemos:
7HVWGH%RFFDRGHYRFDOOWUDGD
7HVWGHYRFDOLQWHUUXPSLGD
7HVWGHYHORFLGDGDFHOHUDGDRUHWDUGDGD
7HVWGHVXPDFLyQ
7HVWGH/DIyQ
7HVWIRQpWLFRGH%RUHOO0DVVRQ\
7HVWGHDXGLRPHWUtDHVSHFLDOGHGLVFULPLQDFLyQYRFDO
 7HVW GH DXGLRPHWUtD GLUHFFLRQDO GH SRVLELOLGDG GH GLIHUHQFLDFLyQ GH
tiempo e intensidad.
Existe, adems, una audiometra vocal con recepcin del examinando por
va sea, denominado Weber vocal, usando preferentemente para deter-
minar el mejor estado neurosensorial para la posible recuperacin del habla, y
HVPX\VLJQLFDWLYDSDUDVXPLQLVWUDURULHQWDFLRQHVTXLU~UJLFDVSRUHMHPSOR

137
Captulo 12

Fig. 78. Distintas inclinaciones de la curva normotipo en los siguientes casos:


1. Curva normal.
2. Hipoacusia con prdida mayor en graves.
3. Hipoacusia de transmisin o de percepcin plana sin recruiment
4. Hipoacusia neurosensorial con prdida selectiva de agudos.
5. Hipoacusia neurosensorial. Aqu sera posible un gran desequilibrio de de frecuencias o
presencia de reclutamiento si la curva tonal fuese horizontal.
6. Hipoacusia neurosensorial. Curva tpica de reclutamiento.

en la Otoesclerosis. No se debe cometer el error de comparar la curva sea de


inteligibilidad normal con la de conduccin area, pues sus normotipos son
diferentes.

  &
 DPSROLEUH7LSRVGHDXGLRPHWUtDVPVJHQHUDOHVOLPLQDUHV
\YRFDOHV
Como ya dijimos cuando hablamos de las cmaras sonoamortiguadas
y de los audimetros, las pruebas ms reales para comprobar la audicin
han de hacerse por va area pero sin cascos o auriculares: en campo
libre. Lo ideal sera disponer de un gran espacio y en l unos altavoces o
megfonos, situados alrededor de la cabeza del paciente y as comprobar
el estado auditivo del sujeto con los audfonos, si se les ha efectuado una
adaptacin protsica, o a odo descubierto. Pero como esto no es posible
de ordinario, se recurre D ODV FiPDUDV GRQGH VH LQVWDODQ GRV EDHV R

138
Captulo 12

Fig. 79. Curva que representa las caractersticas bsicas de la curva de Inteligibilidad:
 $8PEUDOGH,QWHOLJLELOLGDG G% 
 %3HQGLHQWHGHODFXUYD  
 &0i[LPRGH,QWHOLJLELOLGDG  R HQHUURUHV 
 '3RUFHQWDMHGHGLVFULPLQDFLyQ  
 (8PEUDOGHGLVWRUVLyQ  

altavoces como los que todos tenemos en casa para las cadenas musicales
o CD, que van conectados a una salida especial del Audimetro, mediante
ORVFXDOHVVLUYHQSDUDODFRPXQLFDFLyQFRQHOKLSRDF~VLFRFXDQGRQRWLHQH
puestos los auriculares, o bien para efectuarle las audiometras liminares
o vocales de una forma ms natural y ms propia o cercana a como van a
or en el medio en que se desenvuelva, de forma bilateral o estereofnica,
con lo cual se consigue una mejora de unos 10 dE por esta causa, pudiendo
llevar los audfonos, si son dos, a un nivel de ganancia o volumen ms
bajo.
En cuanto a todos los tipos de audiometra posibles, que son muchos,
los tipos fundamentales son las liminares o tonales y las vocales, ya que de
ambas obtenemos las informaciones precisas para llevar a cabo una buena
adaptacin.
Con las primeras averiguamos los umbrales de mnima audicin y de
inconford o molestia, su tipo de hipoacusia y la ganancia que el audfono ha de
suministrar, en cada frecuencia, para una audicin confortable. Y mediante la

139
Captulo 12

audiometra vocal, si tiene o no recruitment y por qu odo tiene mejor inteli-


gibilidad, que es en principio, en el que debemos efectuar la adaptacin, salvo
que su prdida sea muy grande.

140
Captulo 13

13.1) Trastornos normales o ms frecuentes en la Audiometra


Clnica.
Entendemos por transtornos normales aquellos que, en la prctica
diaria del audioprotesista, se presentan como habituales o ms frecuentes, no
porque el estado de sus odos estn perfectamente o carezcan del ms mnimo
defecto o problema. Estos son: hipoacusias de Transmisin e hipoacusias de
Percepcin, que pueden ser cocleares (como el Trauma acstico, ya estudiado)
y retrococleares, como el Neurinoma del Acstico, e hipoacusias mixtas que,
a la vez, son de transmisin y percepcin, junto con la presbiacusia ya expli-
cada. Por tanto, vamos a comenzar nuestro estudio por este tipo de hipoacusias
(antiguamente sorderas) ms frecuentes en las que haremos especial hincapi
en el tipo y caractersticas de sus audiometras, obtenidas en Gabinetes o
Clnicas de Adaptacin audioprotsica.

13.2) Hipoacusias de Transmisin.


Se denominan hipoacusias de Transmisin (o de conduccin) a aquellas
GLVPLQXFLRQHVGHDXGLFLyQTXHWLHQHQVXRULJHQHQXQDGHFLHQWHFRQGXFFLyQ
del sonido a travs del odo medio (lo que denominamos va area), por causas
fundamentalmente mecnicas (debido a diversas patologas que acontecen en
el odo externo y/o medio). Si observamos detenidamente una audiometra en
XQFDVRGHHVWHWLSR )LJ YHUHPRVTXHHQHOJUiFRFRUUHVSRQGLHQWHDOD
transmisin por va sea (<) se mantiene ms o menos normal, ya que la cclea
del sujeto como su sistema de transmisin neuronal se mantienen intactos,
mientras que la medida por va area (O) est baja (O.D). En las hipoacusias
de este tipo, el grado de afectacin de la Impedancia del odo externo y/o

141
Captulo 13

Fig. 80. Conjunto de resultados de las ms importantes pruebas de audicin, en el caso de


una hipoacusia de Transmisin para el lado derecho de grado moderado.

142
Captulo 13

PHGLRTXHFRPRVDEHPRVGHSHQGHGHODPDVDHODVWLFLGDG\IULFFLyQLQXLUi
sobre la frecuencia sonora percibida por va area de la siguiente forma:
a) La prdida o disminucin de elasticidad (o mayor rigidez) pro-
ducidas, por ejemplo, por perforacin timpnica, otoesclerosis o anquilosis
de la cadena tmpano-osicular, perjudica la transmisin de sonidos de bajas
frecuencias.
E /RVDXPHQWRVGHPDVDSURGXFLGRVSRUHMHPSORSRUWXPRUHVLQD-
maciones, presencia de lquidos o serosidad en la caja, colesteatoma, cuerpo
extrao o tapn de cerumen, etc., provocan prdidas de transmisin de fre-
cuencias altas.
c) Los aumentos de friccin producidos, por ejemplo, por mala articula-
cin de la cadena u otros, originan prdidas de transmisin de los sonidos de
frecuencias medias.
Frecuentemente, se suelen asociar estos tres factores en mayor o menor
grado, por lo que la curva umbral determinada por va area en el audiograma
tonal aparece ms o menos horizontal (prdida pantonal), similar a una curva
normal pero desplazada hacia abajo. Si observamos los diagramas de las otras
pruebas complementarias, veremos que la de la audiometra vocal conserva
su trazado normal, pero la intensidad necesaria para alcanzar la mxima dis-
criminacin (100 %) y el umbral de Inteligibilidad (50 %) ha de ser de mayor
cuanta.

13.3) Hipoacusia de Percepcin (sensorial o neurosensorial).


Este tipo de hipoacusias son las debidas a una disminuida percepcin del
mensaje sonoro, bien porque existen lesiones o trastornos en el rgano bsico
de la audicin (Cclea), denominadas sensoriales o de origen coclear (o peri-
fricas), o bien lo que falla es la transmisin electro-bioqumica de los nervios
auditivos (Octavo par craneal), en cuyo caso se denominan neurosensoriales
o de origen retrococlear (o centrales), aunque esta ltima sera ms propia
cuando la lesin se encuentra en la zona auditiva del crtex.
Si observamos detenidamente una audiometra tonal correspondiente a
este tipo de trastorno (Fig. 81), podemos observar que, tanto la audicin por
va area como por la va sea, estn igualmente afectadas, por lo que sus dos
representaciones (< y O) as como en el otro odo (> y X), son descendentes y
paralelas, con una diferencia menor o igual de 10 dB. Y respecto a las otras

143
Captulo 13

Fig. 81. Conjunto de resultados de las ms importantes pruebas de un estudio audiolgico


en el caso de una hipoacusia de Percepcin de origen coclear para ambos odos de
valor medio, con aumento moderado en OD.

144
Captulo 13

exploraciones complementarias o pruebas supraliminares de resultados posi-


tivos que contribuyen positivamente al establecimiento de diagnstico topo-
JUiFRGHODOHVLyQ\DTXHVLHVGHRULJHQFRFOHDUVXHOHLUDFRPSDxDGDGH
recruiment o reclutamiento.
0LHQWUDVTXHSDUDFRQUPDUHOGLDJQyVWLFRGHKLSRDFXVLDQHXURVHQVRULDOR
de origen retrococlear es necesario acudir al estudio de unos PEATC u otras
pruebas (Rx, TC, RM ). Otra caracterstica muy propia de este tipo de afec-
taciones es que en la audiometra vocal suelen aparecer curvas con meseta
(vase Fig. 79), que no alcanzan el 100 % de discriminacin, por mucho que se
eleve la intensidad de la voz. En los casos en que exista reclutamiento (R+), es
frecuente encontrar un descenso de la mxima discriminacin a medida que
aumenta la intensidad, despus de culminar el cenit de la meseta.

13.4) Hipoacusias mixtas.


Como su nombre indica, son hipoacusias que participan, a la vezGHGL-
cultades de transmisin y de percepcin en el mismo odo. Ello es debido a
que su patologa causal afecta, simultneamente, tanto a las estructuras del
odo externo y/o medio como a las de la cclea y/o va nerviosa auditiva (Fig.
82). En la Audiometra tonal se observa que la cada de los umbrales de va
area y de va sea son superiores a 20 dB, y existe entre ellos una diferencia
superior a 10 dB. En las pruebas complementarias o supraliminares tales como
la audiometra vocal podr aparecer una curva semejante a la de transmisin
o a la de percepcin, segn cual de las dos sea predominante.

13.5) Audiometras en problemas del odo medio.


Las patologas o trastornos de enfermedad que acontecen en la parte media
del odo, de muy diversa etiologa y algunas con riesgo de graves complica-
FLRQHVSHUMXGLFDQHOSURFHVRGHWUDQVPLVLyQ\DPSOLFDFLyQGHOVRQLGRHQVX
camino hacia el odo interno. Segn su grado, el nmero y clase de sus estruc-
turas anatmicas afectadas, as ser la cuanta o grado de la hipoacusia de
conduccin o transmisin provocada. Dentro de esta clase vamos a estudiar
las ms generales o frecuentes:

145
Captulo 13

Fig. 82. Conjunto de resultados de las ms importantes pruebas de un estudio audiolgico en


el caso de una hipoacusia mixta en el lado izquierdo en grado avanzado o fuerte.

146
Captulo 13

a) Hipoacusias producidas por lesiones agudas o crnicas en el odo


medio, sin desgarros o roturas de la membrana timpnica.
Estos trastornos congestivos son producidos normalmente por: infecciones
agudas o crnicas de la caja timpnica como otitis, otosalpinginitis, reagu-
dizaciones otticas, barotraumas, etc. Anatomopatolgicamente, se traducen
HQ XQD LQDPDFLyQ GH OD PXFRVD GH UHYHVWLPLHQWR TXH FXEUH ODV SDUHGHV
de la caja y la cadena tmpano-osicular, que puede manifestarse desde un
simple aumento de espesor de la membrana timpnica, produciendo una leve
miringitis, hasta el edema de toda la mucosa, incluida la que recubre ambas
YHQWDQDV$XGLRPpWULFDPHQWHHVWDLQDPDFLyQVHWUDGXFHSRUXQDFDtGDGH
DG%HQHOSHUOGHODYtDDpUHDGHPD\RUFXDQWtDSDUDORVWRQRVJUDYHV
puesto que aumenta la friccin y la rigidez (Fig. 80), aunque esto no es del
todo exacto ya que tambin aumenta la masa, por lo que tambin puede darse
una ligera cada en agudos, pero nunca suele pasar de 50 dB. Estas hipoacu-
sias casi siempre involucionan hacia la normalidad, una vez que disminuye el
fenmeno congestivo que las origin. Si destruyen algn elemento bsico de
la caja pasan a otra clase de hipoacusia que ms adelante estudiaremos.
b) Lesiones con lquido (o mucus) en la caja (sin) perforaciones de la
membrana.
Algunos trastornos o lesiones agudas o crnicas pueden producir alguna
cantidad de lquidos en el interior de la caja tmpano-osicular: que, en
general, resultan ser exudados o transudados, pero a veces, pueden ser (al
salir) purulentos (otorreas) o hemticos (otorragias). Esto puede ocurrir
despus de algn episodio como los descritos en el anterior apartado, cuyo
exudado a veces no encuentra el camino para su evacuacin o como tam-
bin ocurre en el caso de un hemotmpano o de una otosalpinginitis con la
Trompa de Eustaquio cerrada, o bien un barotrauma (trastorno producido por
XQEUXVFRDXPHQWRGHSUHVLyQ (QFXDQWRDVXUHHMRDXGLRPpWULFRSRUHVWDU
el mecanismo ntimo de la transmisin obstaculizado por un aumento en la
masa implica que la cada en agudos existe en todos los casos. Pero como el
lquido llena casi siempre toda la caja, o incluso puede estar sometido a pre-
sin, habr tambin una alteracin en la rigidez. Todo lo cual, nos lleva a un
SHUOHQODYtDDpUHDFRQXQDFDtGDPHGLDGHDG%FRUUHVSRQGLHQWHD
una hipoacusia de transmisin (Fig. 83). Si no se realiza un tratamiento ade-
cuado, de larga duracin, termina por desarrollar una Otitis adhesiva crnica

147
Captulo 13

Fig. 83. Audiometra tonal de ambos odos, con una hipoacusia de transmisin moderada,
pantonal en el OD, correspondiente a una otitis adhesiva crnica. En el OI, ligera
afectacin en las frecuencias graves postottica.

(fusin cicatrizal), con una timpanoesclerosis y anquilosis (o mayor rigidez)


de la cadena tmpano-osicular.
6LHOFDVRORSHUPLWHVHUtDFRQYHQLHQWHKDFHUXQDLQVXDFLyQGHDLUHFRQ
objeto de restaurar momentneamente las presiones, y hacer inmediatamente
otra audiometra, y as nos daremos cuenta ms exactamente del grado de
lesin, lo que servira para establecer el posible diagnstico audiolgico.
Tambin, en algunos casos, puede aparecer una curva de hipoacusia mixta
(Fig. 82) debido a la presin ejercida por el lquido sobre las ventanas, lo cual
cambia la hidrodinmica normal de los lquidos endolabernticos del odo
interno (Cclea), o tambin que ocurran fenmenos vasomotores de origen
UHHMRTXHFDXVHQWUDVWRUQRVDODYtDyVHD
c) Otoesclerosis.
En la Otoesclerosis primaria, no se conocen an las causas. Se produce un
FUHFLPLHQWRH[FHVLYR\FDOFLFDFLyQDQyPDODGHOKXHVRODEHUtQWLFR XQLODWHUDO
o bilateral) que comienza alrededor de la ventana oval y afecta a la platina
del estribo y regiones prximas. La frecuencia de aparicin es mucho mayor
en las mujeres (8/1), con cierta predisposicin familiar (factores genticos)

148
Captulo 13

Fig. 84. Audiometra tonal en ambos odos que presenta una hipoacusia de transmisin
bilateral consecuente a una otoesclerosis incipiente con predominio de prdida en
graves por efecto del aumento de rigidez en el movimiento de la cadena osicular.

Fig. 85. Audiometra tonal de ambos odos, que presenta una hipoacusia pantonal de tipo
mixto, causada por otoesclerosis de grado avanzado, bilateral y casi simtrica.

149
Captulo 13

con agravacin durante el embarazo (factores hormonales). La inmovili-


zacin del estribo va provocando una rigidez progresiva en la transmisin
del sonido hacia el odo interno. Como pruebas ms aconsejables podemos
LQGLFDUODGH*HOOp%LQJH,PSHGDQFLRPHWUtDFRQUHHMRHVWDSHGLDOSHUGLGR
en su Audiometra tonal aparece una prdida inicial en graves (Fig. 84) y ms
tarde pantonal. Cuando se lesiona el rgano sensorial, por alteracin de los
lquidos labernticos (perilinfa y endolinfa), se transforma en una hipoacusia
mixta (Fig. 85). Existen enfermedades seas generales con manifestaciones
otolgicas, como son la osteognesis imperfecta, la enfermedad de Paget y la
RVWHtWLVEURVDORFDOL]DGD\DTXHHQWRGDVHOODVSXHGHGHVDUUROODUVHXQIRFR
RWRHVFOHUyWLFRFRQFOtQLFDVHPHMDQWHDODGHVFULWDDGHPiVGHXQDVLQWRPDWR-
ORJtDJHQHUDOHVSHFtFDSRUDIHFWDFLyQGHRWURVKXHVRVGHOHVTXHOHWR\RWURV
rganos.
d) Colesteatoma.
Se considera como factor predisponente del colesteatoma primario la
entrada en la cavidad tmpano-osicular del revestimiento epidrmico de la
SRUFLyQiFLGDGHODPHPEUDQDWLPSiQLFDDQLYHOGHVXLQVHUFLyQGHOVXUFR
timpnico. El colesteatoma secundario (no se trata de otra clase sino del
segundo estado de afectacin) surge tras la retraccin de la porcin tensa
(Timpanoesclerosis), de forma que en el epitelio ectpico es muy impor-
WDQWHHOHVWtPXORLQDPDWRULR$FRQWLQXDFLyQVHIRUPDXQWHMLGRDQyPDOR
granulomatoso que va creciendo a la vez que erosiona al hueso adyacente
(ostetis) y destruye las estructuras en el epitmpano. Tiene una sintoma-
WRORJtDFRQRWDOJLDFHIDOHDV\HEUHDVtFRPRFRQHVFDVDVHFUHFLyQmuy
ftida (tpica), perforacin y tmpano deformado.
Respecto de lo que ms nos interesa, el grado de hipoacusia de transmi-
sin que produce suele ser variado y progresivo segn la evolucin de las
estructuras afectadas. En la fase inicial hay prdida de agudos, siendo pan-
tonal posteriormente. Puede llegar a ser mixta cuando se complica con una
ODEHULQWLWLV )LJ 'HMDGDDVXOLEUHHYROXFLyQVLQWUDWDPLHQWRGHULYD
en una enfermedad grave, muy destructiva e invalidante para la audicin y
con riesgo de graves complicaciones incluso a nivel cerebral.

150
Captulo 13

Fig. 86. Audiometra bilateral que indica una hipoacusia de transmisin en ambos odos,
asimtrica debida a Colesteatoma en estado inicial en OI y ms evolucionado en el
OD. La afectacin laberntica del OD aade una prdida neurosensorial coclear,
pasando a ser una hipoacusia mixta en este odo.

13.6) Afectaciones del odo interno y de las vas auditivas.


Cuando por causas muy diversas se produce una agresin sobre el odo
interno que est acompaada de hipoacusia, suelen acompaarse otras alte-
UDFLRQHV FX\R FRQMXQWR GH VtQWRPDV FRQJXUDQ HO GHQRPLQDGR 6tQGURPH
coclear: hipoacusia de percepcin progresiva, distorsiones en el tono o tona-
lidad (Diploacusia) y de la altura del sonido (reclutamiento), acfenos persis-
tentes y vrtigos frecuentes (pero no constantes). Si inciden varias causas de
afectacin coclear, aunque no sean simultneas en el tiempo, cada una de ellas
lesiona irreversible y progresivamente al rgano sensorial auditivo.
a) Hipoacusias de percepcin debidas a infeccin.
Toda infeccin del odo interno, cualquiera que sea el germen productor,
ocurre con una hipoacusia con cada en la va sea. Esta hipoacusia es irre-
versible posteriormente, quedando un descenso permanente, sobre todo en
los tonos agudos. La curva audiomtrica vara extraordinariamente segn el
asiento y la extensin de los daos, desde una ligera cada en algunas frecuen-
cias hasta la anacusia total (Fig. 87).

151
Captulo 13

Fig. 87. Audiometra de ambos odos que muestra una hipoacusia mixta avanzada produ-
cida por una laberintitis en OI a causa de una infeccin viral o bacteriana.

No existe nada caracterstico. Lo mismo ocurre en las laberintitis trau-


mticas, sean por accidente o producidas por alguna intervencin en el odo.
Como es normal, el laberinto posterior toma parte en el cuadro patolgico,
por lo que las pruebas vestibulares nos ayudarn a profundizar en el conoci-
miento de las posibles causas.
b) Presbiacusia.
La Presbiacusia es en la audicin, lo que la Presbicia es para la visin.
Se trata de una prdida progresiva de la audicin, debido al envejecimiento
VLROyJLFRGHORtGRLQWHQR PX\IUHFXHQWHHQDQFLDQRV $FW~DVHJ~QIDFWRUHV
an no conocidos que podran ser bien genticos o vasculares que, en algunos
FDVRVSXHGHQPDQLIHVWDUVHPiVSURQWRGHORKDELWXDO DxRV /DSUHGR-
minante degeneracin de las clulas sensoriales que origina una hipoacusia
perceptiva de origen coclear, y de las neuronas del ganglio espiral (origen
UHWURFRFOHDU SDUHFHGHEHUVHDXQGHFLHQWHDSRUWHGHR[tJHQR\QXWULHQWHV
Suele ser bilateral y prcticamente simtrica, afectando, en primer lugar, a
las frecuencias agudas y, progresivamente, a medias y graves (Fig. 88). En la

152
Captulo 13

DXGLRPHWUtDYRFDOHVWtSLFDODGLFXOWDGGHGLVFULPLQDUODVSDODEUDVVREUHWRGR
las que contienen slabas con letras de formantes agudos, lo que les incapacita
para participar en las conversaciones de varias personas (hipoacusia social).
Estn ms profundamente afectados los hombres que las mujeres, como ya
vimos en 5.2 y, en concreto, en la Fig. 29.
c) Hipoacusias producidas por totxicos.
La cclea es extraordinariamente lbil para toda clase de txicos, tanto
sean endgenos como exgenos (dao irreversible en las clulas sensoriales
auditivas y, a veces, vestibulares). A causa de los primeros, como residuo
de enfermedades metablicas, se encuentran las hipoacusias producidas
por diabetes o hiperuremia. Tambin pueden venir producidas por toxinas
producidas por bacterias en el curso de enfermedad infecciosa, sobre todo si se
hallan en el odo medio. Entre las producidas por ototxicos exgenos tenemos
los antibiticos aminoglucsidos: estreptomicina, gentamicina, tobramicina,
amikacina, neomicina, espectinomicina, kanamicina. Otra clase de
antibiticos: eritromicina, vancomicina, viomicina, cloranfenicol, cloroquina.
Algunos diurticos: cido etacrnico, furosemida. Algunos analgsicos:

Fig. 88. Estudio audiomtrico que indica una hipoacusia de percepcin, debida a una
Preesbiacusia avanzada, con su tpica cada progresiva en frecuencias altas, medias
y bajas, bilateral y casi simtrica.

153
Captulo 13

Fig. 89. Audiometra en ambos odos que muestra una hipoacusia de percepcin, producida
por lesin coclear de ototxicos (en concreto Kanamicina), con prdida pantonal de
moderada intensidad, bilateral y prcticamente simtrica.

salicilatos o sus derivados como el cido acetil saliclico (aspirina). Otras


drogas: quinina (contenida en la conocida tnica Schweppes y que antigua-
mente se tomaba para combatir la malaria), cisplatina, etc. As como toda clase
de txicos industriales: mercurio, plomo, arsnico, azufre, benzol y otros com-
puestos orgnicos. La toxicidad depende del tipo de sustancia, dosis, tiempo
de administracin o impregnacin, capacidad de eliminacin renal, modo de
aplicacin y sensibilidad individual a sus efectos. La hipoacusia producida en
todos los casos es de percepcin, bilateral y prcticamente simtrica, con cada
en agudos al principio y frecuentes acfenos que despus se transforma en
pantonal (Fig. 89). Puede haber vrtigos y alteraciones del equilibrio si llega a
afectar al laberinto primario.
d) Hipoacusia producida por el hydrops laberntico.
En la enfermedad o sndrome de Mnire, por causa desconocida, se incre-
menta momentneamente la presin endolinftica, lo que provoca pequeas
roturas en el laberinto membranoso. La mezcla de endolinfa y perilinfa altera
el potencial endococlear de las clulas sensoriales que quedan inactivadas.
Su evolucin va tpicamente acompaada de episodios de vrtigo, hipoacusia

154
Captulo 13

y acfenos (se aaden nuseas, vmitos y otros sntomas vegetativos) provo-


cados por una alteracin de la presin, volumen y composicin de los lquidos
endolinfticos (hydrops endolinftico). Pasada la crisis aguda, desaparecen los
sntomas pero, segn el nmero de episodios sufridos, el dao coclear va en
aumento y se va haciendo irreversible. Al inicio provoca una ligera hipoacusia
de percepcin, coclear unilateral que afecta a las frecuencias graves (Fig. 90).
En fase ms avanzada llega a ser pantonal, de grado profundo (Fig. 91) y con
acfenos persistentes.
e) Hipoacusia causada por los traumas craneanos.
Estas lesiones auditivas pueden acontecer de dos formas, segn se produzca
un trauma en la cabeza sin fractura del hueso temporal o con fractura del mismo.
En el primer caso, se produce una hipoacusia de percepcin que ocurre en el
odo homolateral y, alguna vez, en el contralateral.
En su estudio audiomtrico se encuentra una curva parecida a la del Trauma
acstico, o sea, una cada situada en la frecuencia de 4.000 Hz, principalmente,
de diferente grado de intensidad, llegando hasta una hipoacusia muy profunda
con restos auditivos o con anacusia (Fig. 92). En estos ltimos casos, el labe-
ULQWRSRVWHULRURFyFOHDHVWiVLHPSUHOHVLRQDGR/RVSHUOHVDXGLRPpWULFRVHQHO
trauma craneal varan mucho, pero las dos vas descienden siempre unidas ms
o menos paralelamente. As como presencia de reclutamiento en todos los casos
pero distintas logoaudiometras segn las lesiones. En los casos graves siempre
hay transtornos cocleares.
En el segundo caso, es decir, cuando hay rotura del temporal, puede originar
una hipoacusia de transmisin, una de percepcin pura o una mixta con ambos
componentes. Si la lnea de fractura est en direccin sagital puede, aunque es
raro, afectar la caja timpnica, dislocando sus huesecillos, en tal caso la curva
audiomtrica ser la tpica de una hipoacusia de transmisin, la cadena puede
llegar a luxarse con lo que la va area desciende, mientras que la sea se man-
tiene normal.
Si la fractura llega tambin al odo interno, se produce una hipoacusia de tipo
mixto, una de percepcin pura y hasta la cofosis total segn el lugar y la pro-
fundidad de la rotura. Si la fractura es transversal, puede abrir el espacio labe-
rntico, hiriendo el delicado rgano coclear y el vestibular, producindose una
hemorragia endolinftica que termina en una laberintitis traumtica, cofosis
total y dems signos labernticos.

155
Captulo 13

Fig. 90. Audiometra de ambos odos que muestra una hipoacusia de percepcn unila-
teral que afecta a los graves, por lesin de las clulas sensoriales ms apicales de
la cclea, causada por la enfermedad de Menire en sus fases iniciales.

Fig. 91. Audiometra que muestra la enfermedad de Menire en fase avanzada, causando
prdida sensorial pantonal intensa en OD y ligera cada en graves en el OI (bilat-
eral asimtrica).

156
Captulo 13

f) Hipoacusia por neurinoma (o neuritis) del nervio acstico.


/D QHXULWLV GHO 9,,, SDU FUDQHDO R QHUYLRV DXGLWLYRV  R LQDPDFLyQ GHO
nervio por infeccin del virus herpes zoster, va acompaado de hipoacusia
perceptiva retrococlear profunda, intenso dolor neurlgico, vrtigo, nistagmo,
HEUH\SDUiOLVLVIDFLDO6HDFRPSDxDGHSHTXHxDVDPSROODVHQHORtGRH[WHUQR
(importante). Superada la infeccin, la audicin se recupera ligeramente, pero
queda una prdida irreversible. Suele ser unilateral.
El neurinoma del acstico (tumor benigno de la envoltura mielnica del
QHUYLR FUHFHGHQWURGHOFRQGXFWRDXGLWLYRLQWHUQRFRPSULPLHQGRVXVEUDV
que, por esta causa, degeneran. Tambin afecta a los nervios vestibular (vr-
tigos), al nervio facial (parlisis) y trigmino (dolor y parlisis facial) y, a
veces, al troncoencfalo y cerebelo (clnica neurolgica). La hipoacusia que
origina suele ser unilateral, cayendo sobre todo en las frecuencias medias
FXUYD HQ FXHUGD RMD  FRPR PXHVWUD OD )LJ  DYDQ]D FRQ HYROXFLyQ
lenta, progresiva e irreversible que termina afectando a todas las frecuencias

Fig. 92. Audiometra tpica de un trauma craneano, sin rotura del hueso temporal, con
hipoacusia perceptiva, con cada en 4.000 Hz en el OD y una hipoacusia mixta
profunda en OI con restos auditivos.

157
Captulo 13

Fig. 93. Audiometra que muestra una hipoacusia neurosensorial retrococlear en el


2' FXUYDHQFXHUGDRMD RULJLQDGDSRUXQneurinoma del nervio acstico que
FRPLHQ]DDOHVLRQDUEUDVQHUYLRVDVFRUUHVSRQGLHQWHVDIUHFXHQFLDVPHGLDV

(pantonal). Puede intentarse curar con ciruga, pero los daos en el nervio son
irrecuperaables.
g) Alteraciones centrales de la audicin.
La agnosis acstica (hipoacusia psquica, afasia sensorial o audiomudez
sensorial) se debe a una lesin en la va nerviosa auditiva (hipoacusia neuro-
sensorial retrococlear) bien por traumatismos craneoenceflicos, encefalitis,
o lesiones pre, peri o posnatales del sistema nervioso central. En estos casos
H[LVWHXQOHQWRGHVDUUROORGHOOHQJXDMHGHELGRDODGHFLHQFLDDXGLWLYD&RQ
frecuencia se reconoce tarde, por lo que el pronstico no es favorable (es nece-
sario emplear EEA o PEATC). Es muy conveniente diferenciarla de la disfasia
o desarrollo retardado del lenguaje, con audicin normal.

158
Captulo 14

14.1) Tcnicas para investigar las hipoacusias en nios: mtodos


del neonato, de Suzuki y Peep - Show. Garaje de Perell y otros.
Aproximadamente, un uno por mil de los nios recin nacidos tiene una
hipoacusia de percepcin importante. Dentro de ellos un 2 % ingresados en
una UCI tiene una prdida auditiva considerable.
Vamos a exponer, a continuacin, los mtodos ms importantes de explo-
racin del nio, posiblemente hipoacsico. Comencemos con los recin
nacidos: es muy de desear que la deteccin del nio con defectos de audicin
se efecte lo antes posible y en cualquier caso antes de los seis meses. En
Estados Unidos la media es de dos aos, con notable retraso sobre los seis
meses mencionados.
La estimulacin se realiza con intrumentos que generan estmulos sonoros
complejos, de frecuencia modulada, intensidad y tiempo calibrados, provo-
cados a una distancia de unos 20 cm de cada odo (campanillas) (Fig. 94).
Las respuestas positivas consisten:
5HHMRFyFOHRPXVFXODU
5HHMRFyFOHRSDUSHEUDO
- Muecas de su cara.
- Cambios del estado inicial.
5HHMRGH0RURHWF
Marion Downs de U. de Colorado y Veit y Bizaguet en Francia han publi-
cado extensamente sobre este tipo de exploracin. De esta forma, se puede
hacer una primera evaluacin, indicando a los padres la necesidad de poste-
riores controles en los cambios de los nios que no respondan correctamente
a los estmulos mencionados.

159
Captulo 14

Fig. 94. '


 LDJUDPDTXHPXHVWUDORVVXFHVLYRVUHHMRVIDFLDOHVVXJ~QODHGDGGHXQLQIDQWH
desde su nacimiento hasta los dos aos, que hacen visible su maduracin nerviosa
auditiva.

160
Captulo 14

En un intento de sistematizar la prueba y valorar pequeos cambios de acti-


vidad del nio, que puedan interpretarse como respuestas al estmulo acstico,
se ha utilizado en la Universidad de Stanford (USA) y en otros 14 hospitales
un audimetro de deteccin hipoacsica para neonatos: denominado el Crib-
O-Gram. En l se estimula mediante un sonido complejo de 3.000 Hz durante
XQVHJXQGR\DXQDLQWHQVLGDGGHGUHSLWLHQGRODPLVPDRSHUDFLyQ
treinta veces (Fig. 95). Un detector de movimientos muy sensible est colo-
cado debajo del soporte de la incubadora y registra las respuestas, que son
analizadas por un microprocesador durante 10 s antes de la estimulacin y
las compara con el movimiento durante el segundo de estmulo y los 2,5 s
siguientes. Si esto no diera resultados convincentes, es conveniente someterle
a una EEA para infantes (Fig. 96).
Ms adelante, los padres del nio que no comienza a hablar al ao, acuden
en busca de una correcta valoracin de la audicin del nio, previa a la tera-
SpXWLFDTXHGHEDDSOLFDUVH(VWDH[SORUDFLyQUHYLVWHHVSHFLDOGLFXOWDGSRUTXH
en el nio no podemos contar con la misma colaboracin que con el adulto.
Antes de pasar a describir los distintos mtodos a utilizar, consideramos opor-
tuno exponer unos consejos generales que son importantes:
1) En toda exploracin infantil es preciso familiarizarse con el nio para
TXHFRMDFRQDQ]D\FRODERUH+D\TXHGHGLFDUEDVWDQWHWLHPSRHQHVDODERU
Nada mejor que disponer de una habitacin adecuada y debidamente deco-
rada, con varios juguetes que animen al nio (nada de batas blancas!).
2) Aconsejamos la presencia de los padres o de la madre, para que el nio
no se encuentre aislado o extrao. Esta presencia deber ser pasiva y no deben
intervenir en el desarrollo de la prueba (los padres son muy dados a hablar o
MXVWLFDUODPHMRURSHRUDFWXDFLyQGHVXKLMR 
3) Hay que comenzar siempre la exploracin con una frecuencia grave y de
bastante intensidad. Preferiblemente en el lado donde se supone mejor audi-
cin. A este tipo de pruebas se denominan genricamente: Audiometra del
juego.
Esta segunda prueba se denomina:
a) 5HHMRGH2ULHQWDFLyQ&RQGLFLRQDGR 52& :
Este mtodo fue descrito por Suzuki y Ogiba en 1959 y es el indicado para
QLxRVGHDDxRVGHHGDG/DUHVSXHVWDGHOQLxRDXQVRQLGRHVHOUHHMRGH
orientacin hacia el foco sonoro que, como sabemos, aparece a los 4 meses.

161
Captulo 14

La participacin del nio en l es escasa, ya que solo precisamos que gire su


cabeza hacia el foco sonoro. Si se condiciona, se gira al or el sonido para as
poder ver el mueco iluminado y en movimiento que aparece a continuacin
en el mismo lado (Fig. 97). Se realiza en campo libre y es conveniente la
proximidad del nio a los altavoces (situados por encima de los muecos) para
evitar prdidas por la distancia y tambin el efecto del local que podra alterar
la calibracin. La respuesta es global de los dos odos y no es posible diferen-
ciar uno del otro, a menos que se empleen auriculares (salida a los auriculares
en lugar de los altavoces).
A estas edades el desarrollo auditivo no se ha realizado plenamente y
hay que aplicar correcciones que tengan en cuenta las prdidas debidas a la
edad:
---- Entre 2 1/2 y 3 aos --------------------------------- 10 dE
---- 2 y 2 1/2 ---------------------------------------- 15
---- 1 y 2 ------------------------------------------- 20
---- Antes del ao ----------------------------------------- 30 .

Fig. 95. Esquema que muestra la instalacin de un sistema Crib-O-Gram con el altavoz a
la derecha y el detector y procesador delante.

162
Captulo 14

Fig. 96. Neonato sometido a un moderno equipo de potenciales evocados auditivos de


estado estable, para determinar la prdida auditiva, segn las frecuencias de un
SRVLEOHQLxRGHFLHQWHDXGLWLYRDQWHVGHORVVHLVPHVHV

b) Mtodo de Peep-Show.
Fue descrito por Dix y Hallpique en 1947, es el sistema ms usado con el
diorama tipo tren o con proyecciones. En la versin espaola y para obligar
mejor al nio a participar, el espectculo queda dentro de una caja (Fig. 98).
Si el nio participa, se ilumina el paisaje, que se hace entonces visible (ya que
en un principio la caja es opaca y negra) salvo un cristal delantero, y el tren se
pone en movimiento.
Hay posibilidad de estimulacin visual y acstica al mismo tiempo o acs-
tica solamente. Se le colocan los auriculares (siempre en plan de juego) y se
adiestra al nio para que, cuando reciba el estmulo, apriete una de las dos
palancas, situadas a los lados de la caja. A continuacin, el tren se mueve en
el paisaje iluminado. Si el nio aprieta sin que el explorador haya emitido el
estmulo, el juguete no se pone en movimiento.
Si el nio se condiciona al sonido, pulsa tan pronto lo oye y tenemos
una respuesta positiva que nos permitir realizar el audiograma variando la

163
Captulo 14

LQWHQVLGDG\ODIUHFXHQFLD$VtREWHQGUHPRVXQSHUODXGLRPpWULFRSDUDFDGD
odo.
Si se condiciona a la luz pero no al sonido, no oye, pero su comportamiento
intelectivo es bueno, ya que es capaz de asociar la percepcin del estmulo
visual con la realizacin motriz.
Si no se condiciona ni a la luz ni al sonido, tiene transtornos de tipo cen-
tral. Existen otros mtodos parecidos, como el Garaje de Perell (Fig. 99)
y otros, con variados juguetes y tambin observando el comportamiento
y las reacciones del nio en una cabina con campo libre, en la que se han
situado muecos con altavoces dentro. Un buen explorador puede realizar
audiogramas con juegos simples, pero los mtodos descritos permiten siste-
matizar la prueba y obtener buenos resultados por personal no especializado
o especialmente preparado y con nios hipoacsicos, as como tambin en
SOXULGHFLHQWHV

Fig. 97. Dibujo que muestra un instrumento (o juguete) de Suzuki, para efectuar una ade-
cuada audiometra infantil.

164
Captulo 14

Fig. 98. Dibujo que muestra un instrumento (o juguete) de Peep-Show, para efectuar una
perfecta audiometra infantil.

Fig. 99. Dibujo que muestra un Garaje de Perell (o juguete), para efectuar una posible
audiometra infantil.

165
Captulo 14

14.2) Mtodo de Screening


Se denomina as a la serie de procedimientos necesarios para efectuar reco-
nocimientos auditivos masivos, tanto de recin nacidos, nios en edad escolar o
adultos que trabajan en centros con gran cantidad de personas, como fbricas,
almacenes o cuarteles del ejrcito. Normalmente, se realizan en grupo salvo
en el caso de los neonatos que habr de efectuarse individualmente.
3DUDHOORVHQHFHVLWDXQPDJQHWyIRQRROHFWRU&'FRQDPSOLFDGRUXQLGR
a su vez, con 20 o 30 cascos auriculares. El material vocal consiste en unas
cifras del 0 al 9, agrupadas por tros, y cada grupo de tres cifras es separado
por un intervalo de 4 s. Por ltimo, cada uno de estos grupos se transmite a
una intensidad decreciente, de 5 en 5 dE, desde 30 dE por encima del nivel
de referencia hasta 3 por debajo. Este nivel de referencia es de 0 dE, arbitra-
riamente elegido y que corresponde al nivel medio o estndar en el cual una
serie de sujetos normoyentes oye las listas de cifras. Cada sujeto examinado
debe escribir en una hoja impresa y en unas casillas determinadas las cifras
que oye. Pero a pesar del material encumbrante y costoso, as como los resul-
WDGRVREWHQLGRVHQFLHUWRVSDtVHVHOFRHFLHQWHGHHUURUGHHVWRVPpWRGRVGH
screening (o colectivos) parece elevado en relacin con el que puede alcan-
zarse con pruebas ms simples e individuales (como las ya descritas, aunque
ltimamente en Espaa se ha dado una Ley que obliga a efectuar este tipo de
pruebas a todos los neonatos) y, por esta causa, hasta ahora estos mtodos no
han sido obligatorios o vulgarizados.

166
INTRODUCCIN A LA AUDIOPRTESIS
Captulo 15

15.1) Qu es un audfono?
$VtGHQLPRVODVH[RSUyWHVLVDXGLWLYDVLQGLYLGXDOHVGHFDUDFWHUHOHFWUy-
QLFR DQDOyJLFRVRGLJLWDOHV GHVWLQDGRVDODDPSOLFDFLyQGHORVVRQLGRVSDUD
GH HVWD IRUPD FRPSHQVDU HQ WRGR R HQ SDUWH ODV GHFLHQFLDV DXGLWLYDV R
KLSRDFXVLDV GHODVSHUVRQDVTXHODVSDGHFHQ
$ SHVDU GH ORV HQRUPHV DYDQFHV FRQVHJXLGRV HQ HVWH FDPSR KD\ TXH
WHQHUHQFXHQWDTXHXQKLSRDF~VLFRFRQXQDXGtIRQRSRUSHUIHFWRTXHHVWp
DGDSWDGR QR HV XQD SHUVRQD FRQ DXGLFLyQ QRUPDO HV GHFLU TXH VX UHQGL-
PLHQWR DXGLWLYR QXQFD HVWDUi DO   FRPR FXDQGR HUD MRYHQ \ VDQR
FRPSOHWDPHQWH $Vt HV FRQYHQLHQWH SUHYHQLU DO VXMHWR TXH YLHQH HQ EXVFD
GH QXHVWUD D\XGD TXH QR HVSHUH PiV GH OR TXH VX SUyWHVLV SXHGD SUR-
SRUFLRQDUOH ([LVWHQ GRV PRWLYRV IXQGDPHQWDOHV SDUD TXH HVWR RFXUUD
 /DDPSOLFDFLyQTXHSURSRUFLRQDXQDXGtIRQRQRHVGHFDUiFWHUJHQHUDO
VLQRTXHHVVHOHFWLYDFRQODIUHFXHQFLD\VHHPSOHDSDUDTXHVHDGDSWHGHOD
PHMRU IRUPD SRVLEOH D OD SpUGLGD GHO LQGLYLGXR   &DVL WRGRV ORV WLSRV GH
KLSRDFXVLD VREUH WRGR ODV SHUFHSWLYDV  YDQ DFRPSDxDGRV GH RWURV WLSRV GH
WUDVWRUQRV PiV R PHQRV PROHVWRV SpUGLGD GH VHQVLELOLGDG TXH YDUtD FRQ OD
IUHFXHQFLD UHFOXWDPLHQWR HQ DOJXQDV KLSRDFXVLDV GH SHUFHSFLyQ 7LQLWXV R
DF~IHQRVHWF &RPRYHUHPRVPiVDGHODQWHHQORVDXGtIRQRVHOSDVRGH
VRQLGR D YLEUDFLyQ HOpFWULFD GH HVWD D VX DPSOLFDFLyQ FDVL QXQFD OLQHDO 
\ OXHJR VX SRVWHULRU WUDQVIRUPDFLyQ D VRQLGR DPSOLFDGR QR VLHPSUH HVWiQ
OLEUHVGHLQWHUIHUHQFLDVGLVWRUVLyQ\UXLGRVGHIRQGR

167
Captulo 15

  6
 XVSDUWHVHOPLFUyIRQRHODOWDYR]HODPSOLFDGRU\OD
batera.
&RPRVDEHPRVHOSULQFLSLRIXQGDPHQWDOGHWRGRVLVWHPDDPSOLFDGRUHV
DXPHQWDUVXFLHQWHPHQWHODGpELORQRUPDOSUHVLyQVRQRUDHQWUDQWHDOPLFUy-
IRQR SDUD TXH D VX VDOLGD PHGLDQWH HO DOWDYR] R DXULFXODU  VHD SHUFLELGD
FRPRXQDSUHVLyQVRQRUDIXHUWHFDSD]GHVHUGLVFULPLQDGDDGHFXDGDPHQWH
SRUHOKLSRDF~VLFR )LJ\ 
(OSULPHUFRPSRQHQWHEiVLFRHVHOmicrfonoWUDQVGXFWRUGHHQWUDGDTXH
WLHQH SRU PLVLyQ UHFLELU OD SUHVLyQ VRQRUD GH HQWUDGD SXHGH VHU HO OHQJXDMH
KDEODGR  \ WUDQVIRUPDUOR HQ XQD WHQVLyQ H LQWHQVLGDG HOpFWULFDV DOWHUQDV
-XQWR D pO VH KDOOD HQ DOJXQRV PRGHORV OD ERELQD LQGXFWRUD TXH SHUPLWH
LQWURGXFLUHQHODXGtIRQRODYR]SHURHQIRUPDGHRQGDVHOHFWURPDJQpWLFDV

Fig. 100  D  (VTXHPD VHQFLOOR GH ODV SDUWHV IXQGDPHQWDOHV GH XQ DXGtIRQR E  (VTXHPD
HOHFWUyQLFRGHEORTXHVRHWDSDVGHXQDXGtIRQRFRQVWUXLGRFRQ&LUF,QWHJUDGRV

168
Captulo 15

Fig. 101 6HQFLOORHVTXHPDGHXQDXGtIRQRUHWURDXULFXODULQGLFDQGRXQDPSOLFDGRUGHWUHV


HWDSDV

SURGXFLGDVSRUDOJ~QWLSRGHDOWDYR]GHWHOpIRQRDQWLJXRRFDEOHHVSHFLDOHQ
DOJXQRVOXJDUHVGHHVSHFWiFXORVSRUHMHPSOR7DPELpQHVWiHOLQWHUUXSWRUTXH
SHUPLWHHOSDVRSRUXQRXRWURRSRUDPERVDODYH]7RGRHVWRFRQVWLWX\HHO
LPSXWGHODXGtIRQR
/D VHJXQGD SDUWH R PiV IXQGDPHQWDO OD FRQWLWX\H HO DPSOLFDGRU TXH
KD YDULDGR PXFKR GHVGH FLUFXLWRV FRQ WUDQVLVWRUHV GLRGRV UHVLVWHQFLDV \
FRQGHQVDGRUHVSDUDVXDFRSODPLHQWRFRQODHWDSDDQWHULRU\GHVDOLGDKDVWD

Fig. 102 7UDQVSDUHQFLDTXHQRVPXHVWUDHOLQWHULRUGHXQDXGtIRQRUHWURDXULFXODU D DQWLJXR


\ E PRGHUQR\FyPRVHKDOODQGLVWULEXLGDVVXVGLVWLQWDVSLH]DV

169
Captulo 15

Fig. 103 &DMDDELHUWDGHODSDUWHSRVWHULRUGHXQUHWURDXULFXODUHQODTXHVHPXHVWUDQORV


FRQWUROHVRtrimmersTXHUHJXODQ 3 ODVDOLGDPi[LPD * ODJDQDQFLD + HOWRQR
RFDtGDGHJUDYHV\HOFRQWUROGH$*& $ DVtFRPRVXVUHVSHFWLYDVDFFLRQHVVREUH
ODFXUYDGHUHVSXHVWD

170
Captulo 15

Fig. 104 )LJXUD TXH PXHVWUD ORV GLVWLQWRV WLSRV GH DXGtIRQRV SDVDGRV \ DFWXDOHV D  'H
EROVLOOR E 5HWURDXULFXODU F ,QWUHDDXULFXODURGHFRQFKD G ,QWUDFRQGXFWR\
H &,&

ORV PRGHUQRV FLUFXLWRV LPSUHVRV R LQWHJUDGRV FRQ XQ VLQQ~PHUR GH FKLSV
HQORVDPSOLFDGRUHVGLJLWDOHVFX\DPLVLyQHVFRPR\DGLMLPRVSRWHQFLDU
RDPSOLFDUODLQWHQVLGDGHQWUDQWHSDUDTXHDODVDOLGDHVWDLQWHQVLGDGVHDGH
PD\RUDPSOLWXG-XQWRFRQpOHVWiQORVVLVWHPDVGHFRQWURO\UHJODMHTXHFRP-
SUHQGHQORVSRWHQFLyPHWURVSDUDUHJXODUHOYROXPHQGHVDOLGDHOUHJXODGRU
GHWRQDOLGDGSDUDVXELUREDMDUORVJUDYHVDVtFRPRRWURVSRVLEOHVSDUDUHJXODU
RWURVVLVWHPDVGHFRQWUROGHYROXPHQ$*& 2, 3&HWF
/DWHUFHUDSDUWHRGHVDOLGDFRQVWLWXLGDSRUHO altavoz TXHHQ ORV DXGt-
IRQRVVHWUDQVIRUPDHQauricularFX\DPLVLyQGHWUDQVGXFWRUHVWUDQVIRUPDU
ODLQWHQVLGDGDPSOLFDGDGHQXHYRHQVRQLGRVTXH\DVHUiQSHUIHFWDPHQWH

171
Captulo 15

DXGLEOHV TXHQRVLHPSUHGLVFULPLQDEOHV SRUHOKLSRDF~VLFR-XQWRDpOVXHOH


KDEHUXQDVDOLGDSDUDHOYLEUDGRUOWURVGHVDOLGDHWF
2WUD SDUWH IXQGDPHQWDO HV OD pila R batera TXH VLUYH FRPR IXHQWH GH
HQHUJtDSDUDHOIXQFLRQDPLHQWRGHWRGRHOFRQMXQWR3XHGHQVHUSULPDULDVR
VHFXQGDULDV

15.3) Clases de audfonos.


'HVGH HO SXQWR GH YLVWD PRUIROyJLFR YDPRV D GHVFULELU FRQVLGHUDQGR
DOJXQRV IRUPDWRV GLIHUHQWHV HVSHFLDOPHQWH HQ OR UHODWLYR D VX WDPDxR HVWD
HYROXFLyQHVWitQWLPDPHQWHOLJDGDDOGHVDUUROOR\PLQLDWXUL]DFLyQGHODVEDWH-
UtDVRSLODVTXHFRPRVDEHPRVVRQVXIXHQWHGHHQHUJtDJUDFLDVDODVFXDOHV
ORVDXGtIRQRVGHVGHHOPiVVLPSOHDOPiVVRVWLFDGRVRQFDSDFHVGHUHDOL]DU
VXIXQFLyQ YpDVH)LJ 
D /RVPiVDQWLJXRV\SRWHQWHVVRQORV&RQYHQFLRQDOHVRGHFRUGyQOOD-
PDGRVWDPELpQDSDUDWRVGHEROVLOORTXHFRQVWDQVHJ~QHOWLSRGHDGDSWDFLyQ
XQRRGRVFRUGRQHV\VHDOLPHQWDEDQXQDRGRVEDWHUtDVGHOWLSR5R(
FRQFRQWUROHVGHJDQDQFLDGHWRQR\$*&R&RQWURO$XWRPiWLFRGH*DQDQFLD
'HVXJUDQFXHUSRSDUDOOHYDUHQXQEROVLOORLQWHULRURH[WHULRUVDOtDXQFRUGyQ
SURYLVWRGHGRVFODYLMDVXQDFRUUHVSRQGLHQWHDODVDOLGDGHODPSOLFDGRU\
RWUDSDUDVHUFRQHFWDGDDODXULFXODURYLEUDGRU
&XDQGRHODXGtIRQRFRQYHQFLRQDOHUDELQDXUDO\GLVSRQtDGHEDODQFHVRQRUR
WHQtDTXHLUSURYLVWRGHGRVVDOLGDVLQGHSHQGLHQWHVXQDSDUDFDGDDXULFXODUR
DOPHQRVGHXQDFODYLMDWULSRODU\XQFRUGyQHQ<6XVYHQWDMDVVRQHVHQFLDO-
PHQWHODVTXHVHGHULYDQGHODFLUFXQVWDQFLDGHWHQHUELHQVHSDUDGRHOPLFUy-
IRQRGHODXULFXODU\ODGHGLVSRQHUGHHVSDFLRSDUDXQDLPSRUWDQWHIXHQWHGH
DOLPHQWDFLyQ ODVSLODV\DFLWDGDV DGHFXDGDDXQDPSOLFDGRUSRWHQWH JHQH-
UDOPHQWHFRQYHQFLRQDORSULPLWLYR FRQXQDJUDQUREXVWH]PHFiQLFD
6LKDEODPRVVLHPSUHHQSDVDGRHVSRUTXHVHKDOODQWRWDOPHQWHREVROHWRV
E /RVRetroauriculares YROYHUD)LJ FRPRVXQRPEUHLQGLFDVRQORV
TXHVHOOHYDQGHWUiVGHODRUHMDVHDOLPHQWDQFRQEDWHUtDVGH=LQFDLUHXy[LGR
GHPHUFXULRGHOPRGHOR(3PXFKRPiV SHTXHxDVTXHHQHOWLSRDQWH-
ULRUSRUORTXHVHUiQLQFDSDFHVGHVXPLQLVWUDUODPLVPDSRWHQFLDGHVDOLGD
(QFXDQWRDODSRVLFLyQGHOPLFUyIRQR\GHODXULFXODUHQXQSULQFLSLRHVWX-
YLHURQWRWDOPHQWHVHSDUDGRVSDUDHYLWDUHOHIHFWRGHUHWURDOLPHQWDFLyQHQWUH
DPERV PiV FRQRFLGR FRPR HIHFWR /DUVHQ LQWHUQR TXH VH PDQLHVWD FRPR

172
Captulo 15

XQ SLWLGR PX\ LQWHQVR \ FRQWLQXR PX\ PROHVWR SDUD HO SRUWDGRU GHO DXGt-
IRQR3HURPRGHUQDPHQWHVHKDFRQVLGHUDGRFRORFDUORVHQODSDUWHVXSHULRU
IURQWDOFRQYHQLHQWHPHQWH\DF~VWLFDPHQWHVHSDUDGRV )LJ HLQFOXVRVH
DGRSWDQGLYHUVDVVROXFLRQHVSDUDXQHIHFWRGLUHFFLRQDOPiVSUy[LPRDOVLR-
OyJLFR(QSRFRVDxRVVHKDPHMRUDGRHQWRGRVORVDVSHFWRVVHKDUHGXFLGR
HOWDPDxR\DXPHQWDGRODFDOLGDGGHODUHVSXHVWDWDQWRHQSRWHQFLDFRPRHQ
EDQGDSDVDQWHGHOLGDG\VLVWHPDVGHFRQWURO YROYHUD)LJ (QWUHODV
YHQWDMDVPRUIROyJLFDVSURYLHQHQGHVXPHQRUWDPDxRPHMRUUHVXOWDGRHVWp-
WLFR QRWRWDOD~Q PHQRUHVPROHVWLDVPHFiQLFDVVXSUHVLyQGHUXLGRVGHURFH
FRPRVXFHGtDFRQHODQWHULRUEXHQDGLUHFFLRQDELOLGDGDF~VWLFD\SRVLELOLGDG
GHPHMRUSHUFHSFLyQHVWHUHRIyQLFDFRQXQDDGDSWDFLyQELQDXUDO
F  (O VLJXLHQWH PRGHOR IXHURQ ORV GHQRPLQDGRV ,QWUDDXULFXODUHV TXH
DOJXQDV YHFHV HUDQ GH &RQFKD FRPSOHWD SRU OOHQDU FRPSOHWDPHQWH HVWD
SDUWHGHORtGRRSDUFLDOPHQWHRWUDVYHFHV FRPRHOTXHVHREVHUYDHQOD
)LJ 
/OHYDSLODVD~QPiVSHTXHxDVGHOPRGHOR5R5ORTXHOHVOLPLWD
VXSRWHQFLDSHURGHWRGDVPDQHUDVKDH[LVWLGRDOJ~QPRGHORUHODWLYDPHQWH
SRWHQWH6RQPiVGLVFUHWRVTXHORVUHWURHVGHFLUTXHSRVHHQPD\RUHVWpWLFD
SRUORTXHIXHURQGHPD\RUDJUDGRGHORVKLSRDF~VLFRV1HFHVLWDQXQPROGHR
DGDSWDGRUHVSHFLDOTXHVHWRPDFRQXQPRGHORGHODXGtIRQRYDFtR

Fig. 105. )LJXUDTXHPXHVWUDODSDUWHVXSHULRU\IURQWDOHQXQPRGHUQRUHWURDXULFXODUFRQ


ODGLVSRVLFLyQGHOPLFUyIRQR P GHELGDPHQWHDLVODGRDF~VWLFDPHQWHGHODXULFXODU
D SDUDHYLWDUVXDFRSORRUHDOLPHQWDFLyQLQWHUQD

173
Captulo 15

Fig. 106 )
 LJXUD TXH PXHVWUD ORV GLVWLQWRV WLSRV GH DGDSWDFLyQ SRVLEOHV 0RQyWLFD  
'LyWLFD  'LFyWLFD  \HVWHUHRIyQLFD  

G 6RQORVGHQRPLQDGRV,QWUDFDQDOHVHQTXHODPD\RUtDGHOFXHUSRGHO
DXGtIRQRVHKDOODGHQWURGHODSULPHUDSDUWHGHOFRQGXFWRDXGLWLYRH[WHUQR
TXHGDQGR VROR YLVLEOH XQD HVSHFLH GH ERWyQ HQ GRQGH H[LVWH XQD PLQL-
WUDPSLOODSDUDLQWURGXFLUODSLODTXHDTXtHVPHQRUD~QTXHODDQWHULRUGHO
PRGHOR+3R9$3MXQWRFRQHOSRWHQFLyPHWURSDUDUHJXODUHO
YROXPHQGHVDOLGD$YHFHVOOHYDQFRQWURO3&*7RGRHVWRKDVLGRSRVLEOH
SRU OD PRGHUQD PLQLDWXUL]DFLyQ HOHFWUyQLFD GH IRUPD TXH ORV PRGHUQRV
DPSOLFDGRUHVVHKDOODQHQXQFKLSFXDGUDGRGHRPPGHODGR6RQORV
SUHIHULGRVHQODDFWXDOLGDGVREUHWRGRVLVRQGLJLWDOHV
H  (O FROPR GH OD PLQLDWXUL]DFLyQ \ GH OD HVWpWLFD SRU VHU WRWDOPHQWH
invisibles VRQ ORV GHQRPLQDGRV CIC &RPSOHWDPHQWH ,QWURGXFLGRV HQ HO
&RQGXFWR TXHVHFRORFDQHQODSDUWH~OWLPDGHOFRQGXFWRFRQXQKLORGH
QD\ORQSDUDSRGHUVDFDUORVGHVSXpV(QXQSULQFLSLRVXSUHVWDFLyQVHYHtD
UHVWULQJLGD SRU VX SHTXHxR DSRUWH GH SUHVLyQ VRQRUD SHUR WDPELpQ HVWH
DVSHFWRVHKDVXSHUDGRGHQLWLYDPHQWHSDUDORFXDOFXHQWDQFRQODYHQWDMD
GHVXVLWXDFLyQ PiVDYDQ]DGRVTXHODVHJXQGDFXUYDGHO&$( JUDFLDVD
ODFXDOVHUHGXFHFRQVLGHUDEOHPHQWHHOHVSDFLRHQWUHODPHPEUDQDGHVDOLGD
1RWD3&VLJQLFD3LFN&OLFNR&RUWHGH3LFRV

174
Captulo 15

GHODXULFXODU\HOWtPSDQR PHQRUYROXPHQ PHQRUFRPSOLDQFLD PDQL-


IHVWiQGRVH PiV HFD] OD SUHVLyQ VRQRUD GH XQ pPEROR WDQ UHGXFLGR /D
FRQIHFFLyQGHVXVPROGHVHVPX\GHOLFDGDVREUHWRGRODWRPDGHLPSUH-
VLyQ1RSURGXFHQSRWHQFLDHOHYDGDSRUORTXHVRORYDOHQSDUDKLSRDFXVLDV
PHGLDV QXQFD JUDYHV R SURIXQGDV /OHYDQ ODV SLODV GH WDPDxR PtQLPR
5

15.4) Anamnesis.
3RGHPRVGHVLJQDUFRQHVWHQRPEUHDODLQPHGLDWDSUXHEDTXHHODXGLRSUR-
WHVLVWDVRPHWHDOSDFLHQWHQDGDPiVWRPDUVXSULPHUFRQWDFWR6HGHQRPLQD
DQDPQHVLVRLQWHUURJDWRULRHQHOEXHQVHQWLGRGHODSDODEUDGHOFXDOVHSXHGHQ
REWHQHULPSRUWDQWtVLPRVGDWRVTXHRULHQWHQDOH[SHUWRTXpFODVHGHKLSRDFXVLD
SXHGHSDGHFHUHOVXMHWRQRUPDOPHQWHDFRPSDxDGRGHXQIDPLOLDU
'HVGHHOSULPHUPRPHQWRYDPRVDWHQHUTXHXWLOL]DUXQGHWHUPLQDGR
YROXPHQGHYR]SDUDHVWDEOHFHUODFRQYHUVDFLyQ/DH[SHULHQFLDGHODXGLR-
SURWHVLVWDOHSXHGHOOHYDUDHIHFWXDUVXVSUHJXQWDVHPSOHDQGRKiELOPHQWH
GLVWLQWRVQLYHOHVFRQYHUVDFLRQDOHV HQYROXPHQ SDUDDVtWDQWHDUHOySWLPR
SDUDODLQWHOLJLELOLGDGGHOSDFLHQWHLQFOXVRDTXHOSDUDHOFXDOSUHVHQWDGL-
FXOWDGHVSDUDHQWHQGHUQRV7RGRHOORVLQTXHVHSHUFDWHGHTXHOHHVWDPRV
\DUHDOL]DQGRXQH[DPHQSUiFWLFRGHDXGLRPHWUtD
6L FRQ YR] FXFKLFKHDGD VLJXH UHVSRQGLHQGR VX SpUGLGD HV LQIHULRU D
GVLORKDFHFRQGLFXOWDGHVWDUiDOUHGHGRUGHORVG6LQRV
HQWLHQGHVRORFRQYR]QRUPDOHVWDUHPRVDQWHXQDKLSRDFXVLDVXSHULRUD
GVLQHFHVLWDPRVHPSOHDUXQDYR]IXHUWHVXGpFLWDOFDQ]DPiVGHG
&XDQGRODYR]HVJULWDGD\VHR\HVLJQLFDTXHODSpUGLGDHVXQRVG6L
DSHVDUGHWRGRVQXHVWURVJULWRVQRR\HVHWUDWDGHUHVWRVDXGLWLYRVRXQD
FRIRVLVWRWDO
8QDYH]TXHKHPRVDGDSWDGRHOQLYHODGHFXDGR HQFDVRGHKLSRDFXVLDV
PD\RUHVGHODVPHGLDVHVFRQYHQLHQWHUHDOL]DUDOLQWHUHVDGRHOLQWHUURJD-
WRULRPHQFLRQDGRFRQODD\XGDGHODXGLyPHWURFOtQLFRTXHVHDMXVWDFRQOD
DPSOLFDFLyQDGHFXDGDSDUDTXHHOSDFLHQWHSXHGDRLUQRVFyPRGDPHQWH 
6HOHGHEHSUHJXQWDUVXQRPEUH\DSHOOLGRVHQGRQGHKDQDFLGR\GHVGH
FXDQGRSDGHFHODKLSRDFXVLDVLKDVLGREUXVFDPHQWHROHKDLGRDXPHQ-
WDQGROHQWDPHQWHRVLODSDGHFHGHVGHODLQIDQFLD$VtFRPRODVVLJXLHQWHV
SUHJXQWDVKDQGHIRUPDUSDUWHGHQXHVWURFXHVWLRQDULREiVLFR

175
Captulo 15

&RQTXpRtGRR\HPHMRU" ODLQIRUPDFLyQTXHQRVIDFLOLWHKDGHFRLQ-
FLGLU FRQ HO DXGLRJUDPD SHUR HV VRUSUHQGHQWH OD FDQWLGDG GH JHQWH TXH
QR FRQWHVWD FRUUHFWDPHQWH D HVWD SUHJXQWD  (V PX\ LPSRUWDQWH KDEHUVH
IRUPDGRXQDLPSUHVLyQGHVXHVWDGRPHQWDOJHQHUDO\GHVXQLYHOFXOWXUDO
SDUDKDFHUOHDGHFXDGDPHQWHODVSUHJXQWDV
8VDRKDXVDGRDOJ~QDXGtIRQRRDSDUDWR"6DWLVIDFWRULDPHQWHRQR"(Q
HO~OWLPRFDVRTXpSUREOHPDVWHQtD" $VtSRGUHPRVKDFHUXQDYDORUDFLyQ
GHODVGHFLHQFLDVGHODDGDSWDFLyQRYHQWDDQWHULRU 
/HPROHVWDQORVUXLGRVH[FHVLYDPHQWHIXHUWHV" 3UHJXQWDRULHQWDGDD
YDORUDUODEDQGDGLQiPLFDGHVXDXGLFLyQ 
2\H ELHQ HQ WHUWXOLDV \ FRORTXLRV" 3UHJXQWD RULHQWDGD D YDORUDU OD
LPSRUWDQFLDGHODDXGLFLyQHVWHUHRIyQLFD\VRFLDO 
7LHQHUXLGRVSURSLRVHQHOLQWHULRUGHORtGR  DF~IHQRV "+DWHQLGR
YpUWLJRVRPDUHRV" 3UHJXQWDRULHQWDGDDFRQRFHUXQDHWLRORJtDODEHUtQWLFD
TXHSXHGDDFRQVHMDUHOHPSOHRGHFRPSUHVLyQ 
(V XVWHG GLHVWUR R ]XUGR" (VWD SUHJXQWD QRV RULHQWD VREUH OD PD\RU
IDFLOLGDGGHPDQHMR\XWLOL]DFLyQGHODXGtIRQR(QQLxRVSXHGHHVWDUUHOD-
FLRQDGDFRQODGLIHUHQWHIXQFLyQGHORVGRVKHPLVIHULRVFHUHEUDOHV 
8VDJDIDV"ELIRFDOHV" (VWRQRVRULHQWDFRQYLVWDVDODDSOLFDFDFLyQGH
XQDJDIDDXGLWLYD 
/HUHVXHQDODYR]\QRHQWLHQGHELHQFRQVXDXGtIRQR" $TXtVHWUDWDUi
GHXQH[FHVRGHJUDYHV XR\HELHQHOWLPEUHGHODSXHUWD"
4XpWLSRGHDXGtIRQROHJXVWDUtDHPSOHDU" 6LSRUVXKLSRDFXVLDKD\SRVL-
ELOLGDGGHHOHFFLyQQRVRULHQWDVREUHODYDORUDFLyQGHOIDFWRUHVWpWLFR 
6RQPX\LPSRUWDQWHWDPELpQHVWRVIDFWRUHV
(OJUDGRGHFRODERUDFLyQHLQWHUpVSRUSDUWHGHOVXMHWRDDGDSWDU
(OJUDGRGHFRODERUDFLyQ\D\XGDSUHYLVLEOHSRUSDUWHGHODIDPLOLD
(OJUDGRGHKDELOLGDGPDQXDOGHOLQWHUHVDGR
6LJXLHQGRFRQODDQDPQHVLVQRVLQWHUHVDWDPELpQFRQRFHUVXHQWRUQR
VRQRURKDELWXDO\HQTXpFRQGLFLRQHVVRFLDOHVHQFXHQWUDPiVQHFHVDULDOD
SRVLEOHXWLOL]DFLyQGHODXGtIRQR'HHVWHPRGRDWLVEDQGR\DHOQLYHOGHVX
SpUGLGDDXGLWLYD\ODQDWXUDOH]DGHODPLVPDFRPHQ]DUHPRVDMX]JDUODV
SRVLELOLGDGHVGHD\XGDUHDO

176
Captulo 15

15.5) Mtodos de adaptacin.


(VWDHVODIDVHPiVIXQGDPHQWDO\GHOLFDGDSDUDXQEXHQDXGLRSURWHVLVWD
3XHVELHQFRQORVGDWRVSURSRUFLRQDGRVSRUWRGRVORVSURFHGLPLHQWRVGH
H[SORUDFLyQ DXGLWLYD DQWHULRUPHQWH GHVFULWRV HVWDUHPRV \D HQ FRQGLFLRQHV
GH HVWDEOHFHU VL OD KLSRDFXVLD HV XQL R ELODWHUDO VL HV GH WUDQVPLVLyQ R GH
SHUFHSFLyQ\HOQLYHOPHGLRGHVXSpUGLGD7DPELpQVDEUHPRVVLHOSDFLHQWH
HV FDSD] GH DOFDQ]DU XQRV QLYHOHV DFHSWDEOHV GH GLVFULPLQDFLyQ D XQ QLYHO
GHDPSOLFDFLyQGHWHUPLQDGRQLYHODSDUWLUGHOFXDOHOSDFLHQWHSXHGHPRV-
WUDU LQFRPRGLGDG R ,QFRQIRUG  DVt FRPR OD H[LVWHQFLD R QR GH IHQyPHQRV
GH GLVWRUVLyQ VRQRUD GH RULJHQ FRFOHDU UHFOXWDPLHQWR  (Q HVWH PRPHQWR \D
KHPRVGHGHFLGLUVLHOSDFLHQWHHVFDQGLGDWRDXQDSUyWHVLVDXGLWLYD RDXGt-
IRQR  \ TXp WLSR \ PRGHOR OH SXHGH DSRUWDU XQ PD\RU EHQHFLR $XQTXH HO
PpGLFR RWRUULQRODULQJyORJR SRGUtD \ GHEHUtD VHU FDSD] GH KDFHU HVWD GHWHU-
PLQDFLyQ XQ DXGLRSURWHVLVWD H[SHULPHQWDGR \ FRQ XQ JUDGR VDWLVIDFWRULR
GH IRUPDFLyQ SXHGH OR PLVPR EDViQGRVH HQ ODV FRQFOXVLRQHV GHO H[DPHQ
DXGLROyJLFR SUHFHGHQWH /D SUHJXQWD DKRUD HV &XiQGR HVWi LQGLFDGD OD
DGDSWDFLyQGHXQDXGtIRQR"(QSULQFLSLRSDUDFXDOTXLHUKLSRDFXVLDQRUHFX-
SHUDEOH PHGLDQWH WUDWDPLHQWRV PpGLFRV R TXLU~UJLFRV TXH RFDVLRQH DOJ~Q
WUDVWRUQR GH FRPXQLFDFLyQ ODERUDO IDPLOLDU R VRFLDO DO VXMHWR HV VXVFHS-
WLEOH GH PHMRUDUVH PHGLDQWH OD DGDSWDFLyQ GH XQD SUyWHVLV DXGLWLYD KHPRV
GH WHQHU PX\ HQ FXHQWD TXH GHEHPRV SRQHUQRV HQ PDQRV GH SURIHVLRQDOHV
FXDOLFDGRV\GRWDGRVGHPHGLRVWpFQLFRVTXHOD/H\H[LJHFX\DDFWXDFLyQ
VHUHDOLFHHQXQ*DELQHWHR&OtQLFDDXGLROyJLFD\QRHQPDQRVGHGHVDSUHQ-
VLYRV TXH VH KDFHQ SDVDU SRU DXGLRSURWHVLVWDV TXH OR ~QLFR TXH KDFHQ HV
FROJDUORVDXGtIRQRVVHDQDGHFXDGRVRQRHQFXDOTXLHUOXJDU\FREUDU
HOHYDGDVFDQWLGDGHVHPEDXFiQGRQRVFRQXQDYHUERUUHDVHXGRFLHQWtFDTXH
VRORKDFHGHVSUHVWLJLDUHVWDGLJQtVLPDSURIHVLyQ 
/RVWLSRVGHDGDSWDFLyQVHJ~QHOVLVWHPDGHSUyWHVLVHPSOHDGRSXHGHQVHU
)LJ 
D $GDSWDFLyQPRQyWLFDHVODSURSRUFLRQDGDDXQVRORRtGRFXDQGRHQHO
RWURHVLPSRVLEOHODDGDSWDFLyQSRUFDXVDVYDULDV
E $GDSWDFLyQ GLyWLFDHVDTXHOODTXHPHGLDQWHXQFDEOH9HQSDUDOHORORV
GRVRtGRVUHFLEHQODPLVPDVHxDOGHXQ~QLFRDPSOLFDGRU
F  $GDSWDFLyQ GLFyWLFD HV DTXHOOD HQ HQ TXH ORV GRV RtGRV UHFLEHQ GRV
VHxDOHVGLVWLQWDVPHGLDQWHXQFDEOH<HQVHULHSRUGLVWLQWDDPSOLFDFLyQTXH

177
Captulo 15

VHFRQVLJXHYDULDQGRODLPSHGDQFLDGHORVDXULFXODUHV EDODQFH DSHVDUGH


SURYHQLUGHXQ~QLFRDPSOLFDGRU
G $GDSWDFLyQ estereofnicaHVDTXHOODHQTXHFDGDRtGRSHUFLEHXQDVHxDO
YHUGDGHUDPHQWH GLVWLQWD SRU OD H[LVWHQFLD GH GRV DXGtIRQRV LQGHSHQGLHQWHV
(V OD FRQGLFLyQ GH OD DXGLFLyQ QDWXUDOTXH SHUPLWH GHWHUPLQDU ODGLUHFFLyQ
GHOIRFRVRQRURHQHOHVSDFLRSRUSHTXHxtVLPDVGLIHUHQFLDVGHLQWHQVLGDG\GH
WLHPSRGHXQRtGRUHVSHFWRGHORWUR
&LWDUHPRVFRPRYHQWDMDVIXQGDPHQWDOHVGHODDGDSWDFLyQHVWHUHRIyQLFD
 3RVLELOLGDGGHGHWHUPLQDUODSRVLFLyQRGLUHFFLyQGHOIRFRVRQRUR
 $XPHQWRGHVHQVDFLyQVRQRUDVHSUHFLVDPHQRUYROXPHQSDUDRtULJXDO
TXH FRQ ODV RWUDV DGDSWDFLRQHV GLVPLQX\HQGR HO ULHVJR GH UHDOLPHQWDFLyQ
DF~VWLFD
  0HMRU GLVFULPLQDFLyQ HQ DPELHQWHV UXLGRVRV R HQ ORV TXH KD\ YDULRV
IRFRVVRQRURVVLPXOWiQHRVDOSRGHUVLWXDUORVHQSXQWRVGLVWLQWRVGHOHVSDFLR
  0HMRUtD R GLVPLQXFLyQ GHO XPEUDO GLIHUHQFLDO GH LQWHQVLGDG \ GH IUH-
FXHQFLD3DUDIUHFXHQFLDV+]SUHGRPLQDQGLIHUHQFLDVGHWLHPSR3DUD!
+]SUHGRPLQDQGLIHUHQFLDVGHLQWHQVLGDG
  $XPHQWR GH OD VHQVLELOLGDG GH  D  G UHVSHFWR D OD DGDSWDFLyQ
PRQyWLFD
 'LVPLQXFLyQGHODIDWLJDDXGLWLYD0D\RUFRQFHQWUDFLyQ
$SHVDUGHODVJUDQGHVYHQWDMDVTXHVXSRQHODDGDSWDFLyQHVWpUHRHVWDQR
VLHPSUHHVSRVLEOH'HKHFKRQRVHUiDFRQVHMDEOHFXDQGRVHGpDOJXQDGHODV
VLJXLHQWHVVLWXDFLRQHV
D ([LVWHQ WUDVWRUQRV FHQWUDOHV HQ OD LQWHJUDFLyQ GHO PHQVDMH KDEODGR
PDODIXVLyQELDXUDO 
E &RIRVLVRSpVLPDLQWHOLJLELOLGDGSRUUHVWRVDXGLWLYRVHQXQRGHORV
RtGRV
F 'LIHUHQFLDGHXPEUDOHVWRQDOHVHQIUHFXHQFLDVFRQYHUVDFLRQDOHVHQWUH
DPERVRtGRVGHRPiVG
G 'LIHUHQFLDGHLQWHOLJLELOLGDGHQWUHDPERVRtGRVGHXQRVXSH
ULRUHV
H ([LVWHQFLDGHGLSORDFXVLD
7DPELpQ KHPRV GH WHQHU HQ FXHQWD ODV YHQWDMDV GH XQD DGDSWDFLyQ HVWH-
UHRIyQLFDFRQGRVUHWURDXULFXODUHVHQQLxRVVRUGRVSURIXQGRVIUHQWHDODWUD-
GLFLRQDOGLyWLFDFRQDXGtIRQRGHEROVLOOR

178
Captulo 15

(QSULPHUOXJDUFRQWDPRVFRQODVVHLVYLVWDVDQWHULRUPHQWH\DGHPiV
 (VWLPXODFLyQGHODLQWHJUDFLyQHQXQDVRODLPDJHQDXGLWLYDGHODVVHxDOHV
SHUFLELGDVSRUFDGDXQRGHORVGRVRtGRVTXHHTXLYDOHDODHVWLPXODFLyQFHUH-
EUDOGHODIXQFLyQHVWHUHRIyQLFD
 $XVHQFLDGHUXLGRGHURFHFRQODURSD\OWUDMHSURGXFLGRSRUODPLVPD
 (OLPLQDFLyQGHOHIHFWRSDQWDOODGHOSURSLRFXHUSR
 0HMRUDFHSWDFLyQSRUHOQLxR\VXVSDGUHV
3XHGHGDUVHXQLQFRQYHQLHQWHODIRUPDGHVXMHWDUHOUHWURDODRUHMDVLHV
SHTXHxR HVSDUDGUDSRJRPLOODVRDURVGHPHWDOHVSHFLDOHVFRQDEUD]DGHUDV 
6LQRHVSRVLEOHUHDOL]DUODDGDSWDFLyQHVWpUHRRELDXUDOGHEHPRVSUHFLVDU
HORtGRPiVDGHFXDGRSDUDDGDSWDUODSUyWHVLVPRQyWLFD$XQTXHKD\PXFKRV
FULWHULRV HQ JHQHUDO SRGHPRV DFRQVHMDU TXH VL OD SpUGLGD HV PRGHUDGD QR
SDVDQGR GH  G GH SpUGLGD HQ IUHFXHQFLDV FRQYHUVDFLRQDOHV HQ DPERV
RtGRV DGDSWDUHPRV HO RtGR SHRU 6L VH VREUHSDVD HVWH QLYHO HOHJLUHPRV QRU-
PDOPHQWHHORtGRPHMRURFRQPHQRVSpUGLGD\DTXHVHUiHVWHHOTXHPD\RU
SURYHFKRREWHQJDGHODDPSOLFDFLyQ
3RURWURODGRVLXQRtGRSUHVHQWDFXDOTXLHUWLSRGHSDWRORJtDDQLYHOGHRtGR
H[WHUQRRPHGLRFRQSRVLEOHVVXSXUDFLRQHVXRWRUUHDV RWLWLDH[WHUQDVHFFHPD-
WRVDVRPHGLDVDJXGDVRFUyQLFDVSHUIRUDFLRQHVWLPSiQLFDVXRWLWLVVHURVDV
HWF HOHJLUHPRVSUHIHUHQWHPHQWHHORtGRTXHQRODVSUHVHQWH\DTXHHQORVFDVRV
GHSURFHVRVVXSXUDWLYRVRVHURVRVFRQVDOLGDDO&$(ODRFOXVLyQGHHVWHFRQXQ
PROGHRDGDSWDGRUDXULFXODUHVWiWRWDOPHQWHFRQWUDLQGLFDGRFDVLVLHPSUH6LD
SHVDUGHHVWDVFLUFXQVWDQFLDVKHPRVGHSURFHGHUDODDGDSWDFLyQWHQGUHPRV
TXHUHFXUULUDDGDSWDFLRQHVSRUYtDyVHDFRQWpFQLFDVHVSHFLDOHVFRPR&526
%,&526HWFTXHSRUODEUHYHGDGGHOSUHVHQWHFDStWXORQRSRGHPRVGHVFULELU
6HUiFRQYHQLHQWHDKRUDH[SRQHUODVLQGLFDFLRQHV GHDGDSWDFLyQSRU9tDVHD
 6HGHEHHIHFWXDUHVWDHQWRGRVORVFDVRVHQTXHHOQLYHOGHSpUGLGDGHSHUO
DXGLRPpWULFRseoVHDLQIHULRUDORVG
 (QORVFDVRVGH$WUHVLD DXVHQFLDGHSDEHOOyQRGHFRQGXFWR RHVWUHFKH]
Pi[LPDGHO&$(
 2WLWLVRVXSXUDFLRQHVGHORtGRPHGLRRH[WHUQR \DWUDWDGDV 
 2tGRVLQWHUYHQLGRVTXLU~UJLFDPHQWHHQORVFXDOHVODQXHYDSLHOGHOFRQ-
GXFWRSRUVXGHELOLGDGQRDGPLWHFRQIRUWDEOHPHQWHXQDGDSWDGRUDMXVWDGR
 &XDQGRHOSDFLHQWHYLHQHXVDQGRGXUDQWHPXFKRVDxRVXQDXGtIRQRSRU
YtDDpUHD\VHKDYLFLDGRDHVWHWLSRGHDXGLFLyQ

179
Captulo 15

3RU ~OWLPR YDPRV D FLWDU DOJXQDV FRQWUDLQGLFDFLRQHV SDUD OD DGDSWD-


cin GH DXGtIRQRVLQWUDFRQGXFWRRLQWUDFDQDOHVTXHWDQGHPRGDHVWiQHQOD
DFWXDOLGDG
D 0DODKDELOLGDGPDQXDORSHUVRQDSRFRFXLGDGRVD
E &RQGXFWRH[FHVLYDPHQWHSHTXHxRRPX\DFRGDGR HVFDVDUHWHQFLyQ\
DOWRULHVJRGHUHDOLPHQWDFLyQ 
F 3HUODXGLRPpWULFRSRUGHEDMRGHORVG
G 6HHVWURSHDQPiVTXHORVRWURVWLSRVGHPD\RUWDPDxR VREUHWRGRHQOD
REVWUXFFLyQSRUFHUDGHOFRQGXFWRGHOSHTXHxRRULFLRGHVDOLGDGHOVRQLGR 
1RREVWDQWHHOFULWHULRGHOFDVRDQWHULRUF QRSXHGHVHUFRQVLGHUDGRFRPR
DOJR UtJLGR H LQDPRYLEOH SXHVWR TXH OD WHFQRORJtD GH ODV SUyWHVLV LQWUDFD-
QDOHVHVWiDYDQ]DQGRDSDVRVDJLJDQWDGRV\ORTXHKR\QRVSDUHFHLPSRVLEOH
PDxDQDSXHGHVHUWRWDOPHQWHYiOLGR(VSHUDPRVFRQWRGRORDQWHULRUKDEHU
KHFKRXQDH[SRVLFLyQEDVWDQWHYiOLGDSDUDRULHQWDUQRVHQHOGLItFLO\FRPSOHMR
PXQGRGHODVDGDSWDFLRQHV

 $XGtIRQRVDQDOyJLFRV\GLJLWDOHV
$FWXDOPHQWH H[LVWHQ HQ OD IDEULFDFLyQ \ GHVDUUROOR GH ODV SUyWHVLV DXGL-
WLYDVWUHVWLSRVRPRGHORVGHWHFQRORJtDHOHFWURDF~VWLFD
(OprimeroHVODTXHGHQRPLQDPRV7HFQRORJtD$QDOyJLFDTXHHVODWHF-
QRORJtD WUDGLFLRQDO GHVGH OD DSDULFLyQ GHO WUDQVLVWRU FRPR HOHPHQWR DPSOL-
FDGRU SRU H[FHOHQFLD FRQ HO DEDQGRQR GH ODV YiOYXODV R OiPSDUDV SRU
FRQVLGHUDUVHREVROHWDV\GHWDPDxRVLQDSURSLDGRV DXQTXHKD\TXHUHFRUGDU
TXHHQVXVWLHPSRVKXER$XGLRPHWURVGHOWDPDxRGHXQDPDOHWD\GHYDULRV
NLORVGHSHVR %iVLFDPHQWHXQDSDUDWRDXGLWLYRFRQVWUXLGRFRQHVWDWHFQR-
ORJtD HV DTXHO TXH IDEULFDGR HQ VHULH R GH IRUPD SHUVRQDOL]DGD QRV KD GH
SURSRUFLRQDU XQD VHULH GH FDUDFWHUtVWLFDV HOHFWURDF~VWLFDV SUHHVWDEOHFLGDV
SRUVXGLVHxDGRU\TXHVRORSRGUiQVHUYDULDGDVPHGLDQWHXQRVFRQWUROHVGH
DMXVWH R WULPPHUV $Vt VX SDUWH SULQFLSDO HO FLUFXLWR DPSOLFDGRU VROR
DXPHQWDUi GH DPSOLWXG ODV YDULDFLRQHV GH WHQVLyQ HOpFWULFD SURGXFLGDV HQ
HOPLFUyIRQRSRUODVYDULDFLRQHVGHSUHVLyQDF~VWLFD\TXHSRVWHULRUPHQWH
VHUiQYXHOWDVXQDYH]DPSOLFDGDVDYDULDFLRQHVGHSUHVLyQVRQRUDSRUHO
DOWDYR]RDXULFXODU(VWRVFDPELRVVHKDFHQGLUHFWDPHQWHFRQODVDOYHGDGGH
ORVUHVSHFWLYRVDFRSODPLHQWRVGHLPSHGDQFLDHQWUHHOPLFUyIRQR\ODHQWUDGD
GHODPSOLFDGRUHODXULFXODU\ODVDOLGDGHODPSOLFDGRUVLQQLQJ~QHOHPHQWR

180
Captulo 15

LQWHUPHGLR YpDVH)LJ (VWHWLSRGHDXGtIRQRVHVWDUiLQGLFDGRSDUDSHU-


VRQDVTXHGHVDUUROOHQXQDYLGDVLPSOHRQRUPDOVLQHVSHFLDOQHFHVLGDGGHRtU
ELHQHQFRQYHUVDFLRQHVGHYDULDVSHUVRQDVRDPELHQWHVUXLGRVRV9DQGHVGH
HOREVROHWRGHEROVLOORKDVWDDOJXQRVLQWUDFDQDOHVRGHFRQFKD6XVSULQFL-
SDOHVOLPLWDFLRQHVVRQTXHVXVUHJXODFLRQHVQRVRQIiFLOPHQWHPHPRUL]DEOHV
RUHSURGXFLEOHV$SDUHFLHURQVREUH
$ ORV VHJXQGRV VH OHV GHQRPLQD GH 7HFQRORJtD VHPLGLJLWDO R GLJLWDO-
PHQWHSURJUDPDEOHV )LJ (VWRVFRUUHVSRQGHQDODWUDQVLFLyQHQWUHOD
(UD$QDOyJLFD\OD(UD'LJLWDORFRPSXWDUL]DGD6HWUDWDGHDTXHOORVDSD-
UDWRVFX\DDPSOLFDFLyQDQDOyJLFD HVGHFLUQRFRPSXHVWDGHFKLSVSHURVt
GHFLUFXLWRVLQWHJUDGRV HVSRVLEOHDMXVWDUODPHGLDQWHXQSURJUDPDGRUELHQ
GHOWLSR3&LQIRUPiWLFRRELHQPHGLDQWHXQSURJUDPDGRULQGHSHQGLHQWH
TXH QRV RIUHFH HO IDEULFDQWH FRPR FRPSOHPHQWR GH OD GHOLFDGD ODERU GH
DGDSWDFLyQ8QDGHODVFDUDFWHUtVWLFDVPiVHVSHFtFDVGHHVWHWLSRGHDSD-
UDWRVHVTXHHODPSOLFDGRUVXHOHLUDFRPSDxDGRGHGRVDFXDWURPHPR-
ULDVODVFXDOHVFRQODD\XGDGHOSURJUDPDEDVHSHUPLWLUiQJXDUGDUYDULDV
FXUYDVGHUHVSXHVWDTXHPHMRUVHDGDSWHQDGLVWLQWRVDPELHQWHVDF~VWLFRV
VLHPSUH GH DFXHUGR FRQ ODV GLVPLQXLGDV FDUDFWHUtVWLFDV GHO VXMHWR DO TXH
YDGHVWLQDGR,JXDOPHQWHSRGUHPRVDMXVWDU\PHPRUL]DUORVJUDGRVDGH-
FXDGRVGHORVFRQWUROHVTXHSRVHDHODPSOLFDGRUGHODXGtIRQRDVtFRPR
OLPLWDFLRQHVDF~VWLFDV $*&3&:'5&HWF 'HHVWDIRUPDHVSRVLEOH
UHJXODUODFXUYDGHODXGtIRQRVHJ~QORVDPELHQWHVHQTXHVHKDOOHVXPHU-
JLGR (VWR QDWXUDOPHQWH KD GH VHU HIHFWXDGR SRU HO SURSLR XVXDULR ELHQ
PHGLDQWHXQERWyQRPHGLDQWHXQSHTXHxRPDQGRDGLVWDQFLDTXHSXHGH
OOHYDUVHHQXQEROVLOOR
/RVGHWHUFHUDJHQHUDFLyQRGH7HFQRORJtD'LJLWDO FRPSOHWDPHQWH DSD-
UHFLHURQHQ6RQWRWDOPHQWHDXWRPiWLFRV7DQWRHQVXSURJUDPDFLyQ
TXHHMHUFHDVXYH]GHPHGLGRULQYLYR OXHJRYHUHPRVORTXHHVWRVLJQL-
FD  VH KDFH GLUHFWDPHQWH FRQ HO DXGtIRQR FRORFDGR HQ HO &$( VL HV XQ
LQWUDRH[WHULRUVLHVXQUHWURDXULFXODU )LJ 6XFDUDFWHUtVWLFDSULQFLSDO
HVODH[LVWHQFLDGHGRVFRQYHUWLGRUHVXQRDQDOyJLFRGLJLWDOHQODHQWUDGD
GHODPSOLFDGRUGLJLWDO\RWURGLJLWDODQDOyJLFRDODVDOLGDGHODPSOLFDGRU
SDUDTXHVXXVRVHDHTXLYDOHQWHDOFDVRDQDOyJLFRSXUR6XFKLSDPSOLFDGRU
GHWDPDxRPtQLPROOHYDLQFRUSRUDGRXQ'63 'LJLWDO6LJQDO3URFHVRU TXH
OHSHUPLWHJUDFLDVDXQDIyUPXODGHFiOFXORPX\FRPSOLFDGDFRQRFLGDFRPR

181
Captulo 15

Fig. 107 (
 VTXHPDTXHPXHVWUDODGLVSRVLFLyQGHODFRQH[LRQHVGHXQDXGtIRQRGLJLWDOPHQWH
SURJUDPPDEOHRGHWHFQRORJtDVHPLGLJLWDO

Fig. 108 (
 VTXHPDGHXQDXGtIRQRWRWDOPHQWHGLJLWDOGRQGHGHVWDFDQORVGRVFRQYHUVRUHV
GHHQWUDGD\GHVDOLGD

182
Captulo 15

Fig. 109 (VTXHPDGHXQDFRSODPLHQWR XRtGRDUWLFLDO GHFF

DOJRULWPRDXQDYHORFLGDGSDUHFLGDDORVPRGHUQRVSURFHVDGRUHVGH3&GDU
HQ FDGD PRPHQWR OD UHVSXHVWD PiV DGHFXDGD HQ UHODFLyQ FRQ HO DPELHQWH
DF~VWLFRTXHOHURGHD$VtSRUHMHPSORHQXQDPELHQWHUXLGRVREDMDUiOD
DPSOLFDFLyQGHJUDYHVWDQWRFXDQWRVHDQHFHVDULRSDUDXQDPiVSHUIHFWD
DXGLFLyQGHOXVXDULR3RUWDQWRXQDXGtIRQRGLJLWDOFDUHFHUiGHFRQWUROGH
YROXPHQ OD IDPRVD UXHGHFLWD  \D TXH JUDFLDV D VX VLVWHPD FDVL LQWH-
OLJHQWH VHUi pO PLVPR HO TXH SURSRUFLRQH HO YROXPHQ PiV FRQIRUWDEOH GH
DXGLFLyQ

183
Captulo 15

Fig. 110. 'LDJUDPDHVTXHPiWLFRHQGRVYLVWDVGHOSXHQWHDF~VWLFRGH=ZLVORFNL

7LHQHQDEVROXWDFRPSDWLELOLGDGFRQORVWHOpIRQRVPRYLOHV*60FRPR
VRQ OD PD\RUtD \ WHFQRORJtDV PiV DYDQ]DGDV \D TXH TXHGD VROXFLRQDGR
HOSUREOHPDGHUXLGRGHIRQGR\GLVWRUVLyQGHORVDQDOyJLFRV2WURJUDQ
SUREOHPDUHVXHOWRHVHOGHODUHDOLPHQWDFLyQDF~VWLFDRHIHFWR/DUVHQ\D
TXH HVWD FODVH GH DXGtIRQRV PHMRUD VX UHVSXHVWD Pi[LPD VLQ SUREOHPD
GH SLWLGRV WDQ PROHVWRV \D TXH PHGLDQWH XQ WHVW GH FRQWURO DXWRPiWLFR
GHWHFWDUiDSDUWLUGHTXpQLYHOFRPLHQ]DODUHDOLPHQWDFLyQPHPRUL]DQGR
D FRQWLQXDFLyQ OD VDOLGD Pi[LPD GH SUHVLyQ VRQRUD DQWHULRU D OD WHPLGD
UHDOLPHQWDFLyQ

184
Captulo 15

15.7) Medidas acsticas a nivel timpnico: medidas in situ e


in vivo.
7UDGLFLRQDOPHQWHODVFDUDFWHUtVWLFDVGHXQDXGtIRQRVHKDQH[SUHVDGRHQ
IXQFLyQ GH ORV GDWRV REWHQLGRV FRQ XQ DSDUDWR HOHFWURDF~VWLFR GHQRPLQDGR
RtGRDUWLFLDOPHGLDQWHXQDFRSODPLHQWRGHFF RFP  5RPDQRZ 
)LJ 
6RQFRQGLFLRQHVGHSUXHEDSHUIHFWDPHQWHUHSURGXFLEOHV\TXHSHUPLWHQYHUL-
FDU\FRPSUREDUODFDOLGDG\FDUDFWHUtVWLFDVHOHFWURDF~VWLFDVGHXQDXGtIRQR
/RVGDWRVVHH[SUHVDQGHDFXHUGRFRQODQRUPD,(&\ODJDQDQFLDVH
GHQHFRPRODUHODFLyQHQWUHHOQLYHOGHSUHVLyQVRQRUDSURGXFLGDSRUHODXGt-
IRQR\PHGLGDHQFDPSROLEUHFRQXQPLFUyIRQRVLWXDGRHQHOPLVPRSXQWR
(Q=ZLVORFNLGHVDUUROOyXQSXHQWHDF~VWLFRTXHVHDSUR[LPDPiVDODUHD-
OLGDGTXHHODFRSODPLHQWRGHFF )LJ ,QVWDODGRHQHOPDQLTXt.(0$5
.QRZOHV (OHFWURQLFV 0DQLNLQ IRU $FRXVWLF 5HVHDUFK  TXH IXH GLVHxDGR HQ
 SRU %XUNKDUG \ 6DFKV \ FRQVWUXLGR SRU ODUPD .QRZOHV (OHFWURQLFV
HQ )LJ GHQWURGHFX\DFDEH]DVHKDOODXQSXHQWHHOHFWURDF~VWLFR
GH =ZLVORFNL FRQ HO TXH VH HIHFW~DQ ODV PHGLGDV WRGR HOOR LQWURGXFLGR HQ
XQDFiPDUDDQHFRLFD&RQHVWHVLVWHPDSRGUHPRVHIHFWXDUPHGLGDVLQVLWX
TXHVHDSUR[LPDQPiVDODUHDOLGDG\DTXHDTXtVHWLHQHQHQFXHQWDODUHVR-
QDQFLDGHOFRQGXFWRORVHIHFWRVGHGLIUDFFLyQGHODFDEH]DHWF$XQTXHQR
SXHGHYDORUDUODVGLIHUHQFLDVDQDWyPLFDVGHXQDSHUVRQDDRWUDSHURHQUHD-
OLGDGVHWUDWDGHREWHQHUYDORUHVHVWiQGDU/DVFDUDFWHUtVWLFDVGHWUDQVIHUHQFLD
GHO.(0$5VHFRUUHVSRQGHSHUIHFWDPHQWHFRQODFDUDFWHUtVWLFDGHWUDQVIH-
UHQFLDHQFDPSROLEUHHQHOWtPSDQRGHXQDSHUVRQDQRUPDORTXHFDUH]FDGH
DQWHFHGHQWHV RWRSDWROyJLFRV 7RGR OR DQWHULRU VH GHVFULEH HQ OD QRUPD ,(&
SDUDODPHGLGDVDF~VWLFDVGHORVDXGtIRQRVLQVLWX
3RVWHULRUHVLQYHVWLJDFLRQHVHIHFWXDGDVSRU/DXULGVHQ\*XQWKHUVHQHQ
GHVDUUROODURQXQQXHYRPpWRGR RULJHQGHODVPHGLGDVLQYLYR TXHHPSOHDED
XQPLFUyIRQRTXHPHGLDQWHXQQRWXEREODQGRGHVLOLFRQD )LJ VHFROR-
FDEDHQHO&$(3DUDODPHGLGDVLQYLYRHVWHFRQGXFWRVHLQWURGXFtDHQHODGDS-
WDGRU D WUDYpV GH RWUR FDQDO R YHQWLQJ SHUPLWtD HIHFWXDU PHGLGDV IiFLOHV \
DEOHV )LJ (VWHWLSRGHPHGLGDVVHKDQKHFKRLPSUHVFLQGLEOHVSDUDORV
HVWXGLRV VLJXLHQWHV UHVXOWDGRV REWHQLGRV FRQ PLFUyIRQRV GLUHFFLRQDOHV ODV
GLIHUHQFLDVHQWUHSDUiPHWURVDF~VWLFRVGHORVDXGtIRQRVUHWURDXULFXODUHV\ORV
LQWUDDXULFXODUHVRLQWUDFRQGXFWRODYDORUDFLyQGHOFRPSRUWDPLHQWRDF~VWLFR

185
Captulo 15

Fig. 111 7
 UHVSRVLFLRQHVGHO.(0$5 .QRZOHV(OHFWURQLFV0DQLNLQIRU$FXVWLF5HVHDUFK 
\XQDFXDUWDPRVWUDQGRHOLQWHULRUGHVXFDEH]DGRQGHVHKDOODLQVWDODGRHOSXHQWH
GH=ZLVORFNL

186
Captulo 15

Fig. 112 0
 LFUyIRQRFRQVRQGDGHVLOLFRQDLQVWDODGRHQHOLQWHULRUGHO&$(SDUDPHGLGDV
LQYLYRGHOVRQLGRLQFLGHQWHVLQDXGtIRQR

Fig. 113 0
 LFUyIRQRFRQVRQGDGHVLOLFRQDLQVWDODGRHQHOLQWHULRUGHO&$(SDUDPHGLGDV
LQYLYRGHOVRQLGRLQFLGHQWHFRQDXGtIRQR

187
Captulo 15

Fig. 114 D  &XUYD TXH SURSRUFLRQD HO DQiOLVLV HVSHFWUDO GH OD HQHUJtD GH OD SDODEUD HQ
IXQFLyQGHODIUHFXHQFLD E &XUYDTXHUHSUHVHQWDHOQLYHOGHSUHVLyQVRQRUDUHJLV
WUDGDPHGLDQWHHOSXHQWHDF~VWLFRGH=ZLVORFNLVLWXDGRHQHO.(0$5VtQDXGt-
IRQR7DPELpQVHGHQRPLQDIXQFLyQGHWUDQVIHUHQFLD F &XUYDUHVXOWDQWHRVXPD
GHODVGRVDQWHULRUHVTXHUHSUHVHQWDHODQiOLVLVHVSHFWUDOGHODHQHUJtDGHODSDODEUD
HQHOLQWHULRUGHORtGRFHUFD RPP GHOWtPSDQR

188
Captulo 15

GHORVGLVWLQWRVWLSRVGHPROGHVRDGDSWDGRUHV/DSDUWH D GHOD)LJSUH-
VHQWDODGLVWULEXFLyQGHODHQHUJtDGHODSDODEUDHQIXQFLyQGHODIUHFXHQFLD(Q
HOODSRGHPRVREVHUYDUFyPRGLVPLQX\HHOQLYHOGHHQHUJtDDODVIUHFXHQFLDV
GH\+]XQYDORUGHXQRVG%FRQUHVSHFWRDODVIUHFXHQFLDV
PiVEDMDV*UDFLDVDODVSURSLHGDGHVDF~VWLFDVGHOSDEHOOyQDXGLWLYR RYXO-
JDUPHQWHRUHMD \GHO&$(VHSURGXFHQXQDVUHVRQDQFLDVD\D
+]GRQGHVHKDOODQORVIRUPDQWHVWHUFHUR\FXDUWRGHODVYRFDOHVUHIRU]DQGR
ODPHMRUFDSWDFLyQDOOtGRQGHSUHFLVDPHQWHODHQHUJtDGHODVSDODEUDVGHFUHFH
(VWRVHIHFWRVTXHGDQSDWHQWHVDOUHJLVWUDUHQFDPSROLEUHODFXUYDGHQLYHO
GHSUHVLyQVRQRUDFRQHOSXHQWHDF~VWLFRGH=ZLVORFNLVLWXDGRHQHOLQWHULRU
GHO.(0$5 YpDVH)LJ $HVWDWtSLFDFXUYDVHOHGHQRPLQD)XQFLyQGH
Transferencia>SDUWH E GHOD)LJ@6LDKRUDHIHFWXDPRVODVXPDGHDPEDV
IXQFLRQHVIUHFXHQFLDDIUHFXHQFLDREWHQGUHPRVFRPRUHVXOWDGRODFXUYD F 
GHODPLVPDJXUDTXHUHSUHVHQWDODGLVWULEXFLyQGHODHQHUJtDGHODSDODEUD
UHVXOWDQWHHQHOLQWHULRUGHORtGRHVWiQGDU&RPRDDQ]DPLHQWRGHORVFRQFHSWRV
DQWHULRUHVRSDUDVXPHMRUDFODUDFLyQGDUHPRVDFRQWLQXDFLyQDOJXQDVGH-
QLFLRQHVIXQGDPHQWDOHVUHODFLRQDGDVFRQODVPHGLGDVLQVLWX\ODVPHGLGDV
LQYLYR
  5HVSXHVWD LQ VLWX 6H WUDWD GHO QLYHO GH SUHVLyQ VRQRUD GHWHUPLQDGD
FHUFDGHOWtPSDQRFRQODVRQGDDQWHVPHQFLRQDGDFRQHODXGtIRQRFRORFDGR
)LJ UHIHULGRDODSUHVLyQVRQRUDHQHOPLVPRSXQWR\HQFDPSROLEUHVLQ
ODSUHVHQFLDGHOVXMHWR
 )XQFLyQGHWUDQVIHUHQFLD 6HWUDWDGHOQLYHOGHSUHVLyQVRQRUDGHWHUPL-
QDGDFHUFDGHOWtPSDQRVLQ DXGtIRQR )LJ \UHIHULGRDODSUHVLyQVRQRUD
HQHOPLVPRSXQWR\HQFDPSROLEUHVLQODSUHVHQFLDGHOVXMHWR3UHVHQWDXQD
UHVRQDQFLDGHXQRVG%DODIUHFXHQFLDGH+]DSUR[LPDGDPHQWH
 3pUGLGDGH,QVHUFLyQ (VODLQWURGXFLGDSRUODSUHVHQFLDGHODGDSWDGRU
TXHPRGLFDODUHVRQDQFLDQDWXUDOGHO&$(\GHOSDEHOOyQDXGLWLYRSRUTXHGDU
SDUWHGHHVWHHQODFRQFKD
 *DQDQFLD(WLPyWLFDRGH,QVHUFLyQ (VODGLIHUHQFLDGHQLYHOGHSUHVLyQ
VRQRUDDQLYHOGHOWtPSDQRPHGLGDSULPHURFRQHODXGtIRQRFRORFDGR FRQVX
DGDSWDGRU \GHVSXpVVLQDXGtIRQR7DPELpQHVLJXDODODGLIHUHQFLDHQWUHOD
UHVSXHVWDLQVLWX\ODIXQFLyQGH7UDQVIHUHQFLD
6HKDFRPSUREDGRTXHXQDFXUYDGHJDQDQFLDHWLPyWLFDDPSOLD\VXDYH
SURSRUFLRQDPD\RULQWHOLJLELOLGDG3DUDORJUDUOD )LJ VHSXHGHQHPSOHDUOWURV

189
Captulo 15

Fig. 115 6
 LREVHUYDPRVODVGRVFXUYDVUHVXOWDQWHVGHODSDUWHLQIHULRUGHODJXUDYHUHPRV
FODUDPHQWHODGLIHUHQFLDHQWUHOD*DQDQFLDHWLPyWLFDGHXQUHWURDXULFXODUQRUPDO\
GRWDGRGHXQOWURDF~VWLFR

190
Captulo 15

DF~VWLFRVGLVSXHVWRVHQHODXGtIRQRRHQHOFRGRGHFRQH[LyQFRQHODGDSWDGRU
(VWRVGLVSRVLWLYRVHOLPLQDQODUHVRQDQFLDKDELWXDOD+]\SURSRUFLRQDQ
XQD UHVRQDQFLD D OD PLVPD IUHFXHQFLD TXH OD IXQFLyQ GH WUDQVIHUHQFLD 'H
HVWDIRUPDVXPDQGRODVFXUYDV D \ E REWHQHPRVHQHOVHJXQGRFDVRXQD
FXUYDSUiFWLFDPHQWHFDVLSODQDPX\VLPLODUDODQDWXUDOGHORtGR>)LJ F @
OR TXH PHMRUDUi HQRUPHPHQWH OD LQWHOLJLELOLGDG GHO VXMHWR FRQ HO DXGtIRQR
FRORFDGR
'HQRPLQDPRV *DQDQFLD (WLPyWLFD ,Q 9LWUR R ,Q 6LWX  D OD REWHQLGD
PHGLDQWH HO .(0$5 \ VX FRUUHVSRQGLHQWH SXHQWH DF~VWLFR DVt FRPR
*DQDQFLD(WLPyWLFD,Q9LYRHVODTXHREWHQHPRVFRQODVRQGDFRORFDGDHQ
HOVXMHWRH[SORUDGRMXQWRFRQVXDXGtIRQR(VWD~OWLPDWHQGUi\DSUHVHQWHODV
FDUDFWHUtVWLFDVDQDWyPLFDVSDUWLFXODUHVGHOSDFLHQWHLQYHVWLJDGR8QHMHPSOR
GHHVWDV~OWLPDVGHQLFLRQHVORWHQHPRVHQOD)LJHQODTXHDSDUHFHQ
UHSUHVHQWDGDV   OD UHVSXHVWD LQ VLWX LQ VLWX JDLQ    OD *DQDQFLD HWLPy-
WLFD LQVHUWLRQJDLQ   ODIXQFLyQGH7UDQVIHUHQFLD H[WHUQDOHDUUHVRQDQFH 
MXQWRFRQ  ODSpUGLGDGHLQVHUFLyQ LQVHUWLRQORVV 
.LOOLRQ \ 0RQVHU LQWURGXMHURQ HO WpUPLQR &RUJ FRUUHFWLRQ JXUH  SDUD
LQGLFDU ODV GLIHUHQFLDV HQWUH OD FXUYD GHO DFRSODGRU GH  FF ,(&   \ OD
JDQDQFLD HWLPyWLFD HQ HO .(0$5 )LJ  &RPR SXHGH REVHUYDUVH HVWRV
YDORUHVYDUtDQVHJ~QVHWUDWHGHXQDXGtIRQRUHWURDXULFXODUXQDJDIDDXGLWLYD
XQDXGtIRQRLQWUDDXULFXODUXQLQWUDFRQGXFWR\XQDQWLJXRDXGtIRQRGHEROVLOOR
3RURWURODGRKDVWDKDFHSRFRWLHPSRODVSUHVWDFLRQHVGHORVDXGtIRQRV
HVWDEDQEDVWDQWHOLPLWDGDV\QRSHUPLWtDQPXFKRMXHJRDODKRUDGHDMXVWDUOD
FXUYDGHUHVSXHVWDDODQHFHVDULDSRUHOSDFLHQWHSRUWDQWRWDPSRFRHUDUHQ-
WDEOHLQYHVWLJDUFRQDSDUDWRVSDUDUHDOL]DUPHGLGDV,QYLYRVLODWHFQRORJtD
H[LVWHQWHQRSHUPLWtDPRGLFDUODUHVSXHVWDGHODXGtIRQRHQIXQFLyQGHODV
QHFHVLGDGHVUHDOHVGHODDGDSWDFLyQ

  (VWDGRDFWXDO\IXWXUR
&RQWLQXDQGRFRQHOWHPDDQWHULRUHOWLHPSR\ODHYROXFLyQWHFQROyJLFDD
KD SRVLELOLWDGR HO GHVDUUROOR GH DSDUDWRV TXH SHUPLWHQ UHDOL]DU ODV PHGLGDV
HOHFWURDF~VWLFDVGHORVDXGtIRQRVHQHOLQWHULRUGHOFDQDODXGLWLYR RVXSHULQ
YLYR \DTXHDOHIHFWXDUODVPHGLGDVVHWLHQHQHQFXHQWDORVGHWDOOHVDQDWy-
PLFRVGHOLQWHUHVDGRFRPRSXHGHQVHUODIRUPD\YROXPHQGHOFDQDODXGLWLYR
DVtFRPRODLQXHQFLDGHOPROGHDGDSWDGRU

191
Captulo 15

Fig. 116 &


 RQMXQWR GH JUiFDV TXH LQGLFDQ OD UHVSXHVWD tQ VLWX OD JDQDQFLD HWLPyWLFD OD
IXQFLyQGHWUDQVIHUHQFLD\ODSpUGLGDGHLQVHUFLyQ

Fig. 117 &


 XUYDVGHFRPSDUDFLyQHQWUHODFXUYDGHUHVSXHVWDQRUPDO ,(& \ODFXUYD
GHUHVSXHVWDHWLPyWLFD .(0$5 R ,(&  D HQXQDXGtIRQRUHWURDXULFXODU
\ E HQXQDJDIDDXGLWLYD

192
Captulo 15

(Q FXDQWR D OD ~WLPD WHFQRORJtD TXH HV OD 'LJLWDO QRV SHUPLWH DOJXQDV
YHQWDMDVTXHQRHUDQSRVLEOHVDQWHULRUPHQWHVHDMXVWDQDXWRPiWLFDPHQWHDOD
FXUYDDXGLRPpWULFDGHOSDFLHQWHFRQXQPtQLPXPGHRSHUDFLRQHVSRUSDUWH
GHODGDSWDGRU6HDXWRUUHJXODQFRQREMHWRGHHYLWDUHOPROHVWRHIHFWR/DUVHQR
SLWLGRFRQVWDQWHGHUHDOLPHQWDFLyQPLFUyIRQRDXULFXODU7DPELpQVRQFDSDFHV
GHDXWRUUHJXODUVHHQODEDQGDGHJUDYHVSDUDKDFHUPiVLQWHOLJLEOHHOVRQLGR
TXHLQWHUHVDHQXQDPELHQWHUXLGRVRRGHPXFKDVFRQYHUVDFLRQHVHQOXJDUHV
R ]RQDV UHYHUEHUDQWHV R QR SUHSDUDGDV SDUD HVWRV DFRQWHFLPLHQWRV 7RGR
HOORKDFHTXHODDXGLFLyQVHDPX\EXHQDPXFKRPHMRUTXHFRQODVDQWLJXDV
WHFQRORJtDV DQDOyJLFDV FRQ ODV TXH HUD PX\ SUHFDULD OD HYLWDFLyQ GH HVWRV
SUREOHPDV
(QFXDQWRDOIXWXURDSHVDUGHODGLFXOWDGTXHVXSRQHHOHMHUFLFLRGHOD
SURIHFtDRDGLYLQDFLyQFRQORVWUHPHQGRVDYDQFHVTXHKDQRFXUULGRHQORV
~OWLPRVDxRVGHVGHHODXGLyPHWUR\DXGtIRQRGHPDOHWDGHYDULRVNLORVGH
SHVRVREUHWRGRSRUHOWDPDxR\SHVRGHODVEDWHUtDVKDVWDXQPLQ~VFXOR&,&
GLJLWDOTXHIXQFLRQDHQHOLQWHULRUGHOFRQGXFWRDXGLWLYRWRWDOPHQWHLQYLVLEOH
TXHIXQFLRQDFRQXQDPLQLSLODGHPPGHGLiPHWUR\TXH\DFDVLHVFDSD]
GHVHUYLUSDUDWRGDFODVHGHKLSRDFXVLDV QRODVSURIXQGDV KDFHTXHVHSUH-
VHQWHXQDHYROXFLyQPX\HVFDVDVDOYRTXHHQHOIXWXURVHGHVFXEUDQPpWRGRV
UHYROXFLRQDULRVGHDPSOLFDFLyQ WHFQRORJtDVPROHFXODUHVRSRUQDQRWHFQROR-
JtDV FRQORFXDOSRGUtDKDFHUVHSRVLEOHHODXGtIRQRSHUVRQDORSHUVRQDOL]DGR
HVGHFLUGLVHxDU\FRQVWUXLUXQDPSOLFDGRUSDUDFDGDSHUVRQDWHQLHQGRHQ
FXHQWDWRGRVORVSDUiPHWURVELROyJLFRV\DXGLRPpWULFRVTXHHQVXGHFLHQFLD
SXGLHUDSUHVHQWDUDSDUWHGHORVGDWRVDQWURSRPpWULFRVGHVXyUJDQRDXGLWLYR
GHVGHHOSDEHOOyQGHODRUHMDKDVWDHORtGRPHGLR DVtFRPRWRGRVORVGHWD-
OOHV GH XQ WRSRGLDJQyVWLFR DYDQ]DGR TXH D\XGDUD D ORFDOL]DU H[DFWDPHQWH
HORULJHQ\OXJDUGHOSUREOHPDTXHKDRULJLQDGRVXGHFLHQFLDDXGLWLYD&RQ
HVWHFRPSOHWRSURFHGLPLHQWRSRGUtDFRPSHQVDUVHFDVLWRGRVHVWRVSUREOHPDV
FRQODODERU\DPSOLDGHGLFDFLyQGHORVDXGLRSURWHVLVWDVIXWXURVPXFKRPHMRU
IRUPDGRV \ HVSHFLDOL]DGRV TXH HV XQR GH ORV REMHWLYRV SULQFLSDOHV TXH KD
SHUVHJXLGRODUHDOL]DFLyQGHODSUHVHQWHSXEOLFDFLyQ

193
APNDICE 1

Para poder asimilar mejor los conceptos y frmulas del apartado 6.1 del cap-
tulo 6 es necesario entender primero los conceptos de Impedancia y otros, apli-
cados a un Sistema ELCTRICO, que es el ms sencillo, explicado en Fsica
General de primer curso, o incluso en el antiguo preuniversitario. Para ello
vamos a considerar un sistema formado por un Circuito Elctrico de corriente
alterna (vase Fig. 1A ), el cual est formado por una Resistencia R normal,
como la de la plancha elctrica de nuestra casa, una Autoinduccin L, como las
TXHH[LVWHQHQORVWUDQVIRUPDGRUHVGHORVWXERVXRUHVFHQWHV\QDOPHQWHXQ
Condensador C o Capacitancia que posee la propiedad de poder ser atravesado
por la corriente alterna, pero no por la coriente continua, todo esto en cuanto a
elementos resistores o capaces de presentar una impedancia (o resistencia). En
cuanto a elemento excitador contamos con un generador de corriente alterna
que produce una diferencia de potencial dada por la expresin: V = V0eLW, (en
realidad se trata de un MVA) que, por causa de la Impedancia que presentan
todos los elementos descritos anteriormente Ze, da lugar, como respuesta, a una
intensidad alterna I, de forma que esta impedancia elctrica (medida en ohmios)
ser (Fig. 2A):

V
Ze = = R2 + X 2 , (1)
I

en donde R es la Resistencia (se mide en ohmios) y X = XL XC (2) es la


reactancia total (tambin se mide en ohmios) que como vemos es la diferencia
entre la reactancia inductiva XL y la rectancia capacitiva XC, que tienen por
valores separados:
XL L fL, (3)

195
Apndice 1

donde es Z la velocidad angular de la vibracin elctrica alterna y


1 1
XC , (4)
ZC 2S f C
O sea que resulta (segn la Fig. 2A):

Fig. 1A. Fig 1. Diagrama de un Circuito Elctrico, con generador de corriente alterna (V)
(excitacin), con una Resistencia (R), una Autoinduccin (L) y una Capacidad o Condensador
(C), todos colocados en serie y el valor de su Impedancia. Siendo I la intensidad elctrica que
recorre el circuito (o respuesta).

196
Apndice 1

Fig. 2A. Esquema que representa la disposicion vectorial de los factores complejos* que
intervienen en el clculo de la impedancia del Circuito Elctrico anterior

Si queremos conocer (Fig. 1A), los valores de la diferencia de potencial


entre:
1) los extremos de la Resistencia, ser: VR = RI, (Ley de Ohm) (6)

2) los extremos de la Autoinduccin vale: \QDOPHQWH

1
C
3) los extremos de la Capacidad, ser: VC  I . dt
d (8)

* En realidad, ambos componentes: X y R e se tratan de los dos componentes de un nmero


complejo: Ze = R e + iX .

197
APENDICE 2

En este nuevo apndice vamos a estudiar el caso de un Sistema Mecnico


TXH YLHQH HQ OD )LJ $ IRUPDGR SRU XQ VXHOR PX\ UtJLGR R UPH
G VREUH
el que se desliza un cuerpo de masa M, que se arrastra JG con una v o velo-
cidad (respuesta), ya que de ella tira una Fuerza F (elemento excitador),
con un Parmetro
JG de Rozamiento (o friccin) 5, crendose una Fuerza de
Rozamiento F y sujeta a un muelle que posee JG una Rigidez Mecnica S m ,
que tambin origina otra Fuerza hacia atrs, F s o Fuerza de Rigidez. Aqu ya
podemos plantear las siguientes Equivalencias con el caso estudiado anterior-
mente (Apndice 1):
R (Resistencia elctrica) { RP(Parmetro de friccin) (9)
L $XWRLQGXFFLQ { M (Masa del cuerpo), (10)
1
C  Capacidad   ((Compliancia mecnica o Elasticidad) = Cm,(11)
Sm
resulta, en este caso, aprovechando las equivalencias anteriores, el valor de la
Impedancia Mecnica total ser (vase Fig. 4A)

donde Xm es la Reactancia Mecnica total, siendo XM la Reactancia de Masa


y vale: X M Z M 2S f .M , (13)
as como XS es la Reactancia de Rigidez y vale:
Sm Sm 1
XS , (14)
Z 2 S f ZC m
por tanto, la Impedancia Mecnica total ser:

198
Apndice 2

<DVXYH]WDPELpQVHYHULFDSDUDORVYDORUHVHTXLYDOHQWHVDORVSRWHQ-
ciales en los extremos de los tres elementos elctricos Fig. 1A sealados en Fig
3A, como fuerzas:

FR)

Z m RP2  ( X M  X S ) 2

Fig. 3A. Diagrama que representa la disposicion de los elementos que componen un Sistema
0HFiQLFR\TXHLQX\HQHQVXLPSHGDQFLDFRQODH[SUHVLyQGHVXYDORU

1RWD/DVXEPVLJQLFDmecnica y la sub-M: de masa.

199
Apndice 2

Fig. 4A. Esquema que representa la disposicion vectorial de los factores complejos que
intervienen en el clculo de la Impedancia Mecnica del circuito mecnico anterior

1) El valor del mdulo de la Fuerza de Rozamiento: FR RP .v, (16)


2) El valor del mdulo de la Fuerza Impulsora:

3) El valor del mdulo de la Fuerza de Rigidez:


v.dt. (18)

en donde es el desplazamiento vibracional de la masa; es decir:


d9
v o bien que : 9 vv.dt. (19)
dt
Entonces, comparando estas expresiones con las encontradas en (6), (7) y
(8), resultan las equivalencias siguientes:
Excitacin: V { F (20) y por otra parte R { RP ; L { M
Respuesta: I { Vv; C { Cm
(21) }
Con todo este bagaje fsico-matemtico ya estamos en condiciones de
enfrentarnos con la ltima parte relativa al odo como un Sistema Mecano-
acstico con unas ecuaciones similares a las de ambos Apndices.
G G
Igual que antes, ambosG componentes
G G X m y R P representan los dos formantes
de un nmero complejo: Zm R P  i X m

200
REFERENCIAS

1. Fsica General. F. Sears y M. Zemansky. Aguilar (1976). Madrid.


2. Vibraciones y Ondas. A. P. French. Revert (1980). Barcelona.
3. Audicin. I. R.Sinclair. Alhambra (1981). Madrid.
4. An Introduction to Acustic. R. Randall. Addison-Press (1985). Cambridge. U. K.
5. Fundamentals of Acustics. L. E. Kinsler, A. R. Frey. Chapman and Hall (1951)
New York.
6. Noise Pollution. A. Lara, R. W. B. Sthepens. John Willey and Sons (1986), SCOPE. 24.
Ed. Londres..
7. Audiprtesis: enfoque mdico, fonoaudiolgico y electroacstico. Dr. Yankel Pasik et
l. El Ateneo, 1990. Madrid.
8. Acustics. B. I. Smith. Logman G. L. (1982). Londres.
9. Curso Prctico de Audiometra. W. Niemeyer. Salvat (1982), 2. Ed. Barcelona.
10. Audimetra Clnica. Michel and Claudine Portmann. Toray-Masson (1992),
4. Ed. Barcelona.
11. Acstica. L. L. Beranek. Hispanoamericana (1980). Buenos Aires.
12. Handbook of Clinical Audiology. Jackc Katz Ph. D., Willians and Wilkins. (1994), 4.
Ed. Baltimore. EE UU.
13. Audiologa Prctica. Gonzalo de Sebastin. Mdica Panamericana (1979),
3. Ed. Buenos Aires.
14. Vibraciones Mecnicas. R. Roca Vila y L. Jun Len. Limusa (1981). Mjico.
16. Accoustique et Electroacoustique. Tomos I y II. J:J. Matras. Eyrolles (1983). Pars.
17. Audiology: Principles and Practice. H.A. Newby. Appleton-Century-Crofts Inc.
(1958). N. Y.
18. Hearing and Deafness. D. Hallowell. M. D. and S.R. Silverman. Ph. D. Holt,
Rinehart and Winston, Inc. (1962). N. Y.
19. Lexicn de Comunicologa. J. Perell. M. D. Augusta (1977). Barcelona.
20. Physical and Applied Acoustics. E. Meyer and E.G. Newmann. Academic Press (1987).
N. Y.
21. Clinical Masking: A Decision-Making Process. B. A. Goldstein and C. W. Newman
(en Ref. 12).
22. Bone Conduction Threshold Testing. D. D. Diks. (en Ref. 12).
23. Masking. J. W. Sanders en Ref. 12, pero 2. Ed. (1979).

201
Referencias

24. Manual of Practical Audiology. S. Arlinger. Vols. 1 y 2. Whurr Publisher Ltd. (1993).
Londres.
25. Comments on Earphones in Audiometry. M. C. Killion and E. Villchur. [Zwislocki
et l. J. Acoustical Soc. Am. 83, pgs 1688-1689 (1988)] y [J. Acoustical Soc. Am.
85(4), Pgs. 1775-1778. Abril (1989)]. USA.
26. Machinery Noise and Diagnostics. R. Lyon. Butterwoths (1987). Boston.
27. Theoretical Acustics. P. M. Morse and K. U. Ingard. Pricenton University Press (1968).
New Jersey.
28. Audioprtesis: Teora y Prctica. A. Angulo, J. L. Blanco y F. Matos. Masson (1997).
Barcelona.
29. La Adaptacin de Prtesis Auditivas (Fundamentos, Mtodos y resultados). K. W.
Berger and E. N. Hagberg (en castellano por LAEM S.A.) 1. Ed. (1986) Alicante.
30. Speech Audiometry. M. Martin. Taylor and Francis (1987). London.
31. Fundamentals of Acustic Signa Processing. M. Tohyama and T. Koike. Academic
Press (1998). London.
32. Medida y Control del Ruido. J. M. Ochoa y F. Bolaos. Productica. Marcombo (1990).
Barcelona.
33. Principles of Vibration and Sound. T. Rossing and N. Flecher. Springer-Verlag (1995).
N. Y.
34. Cuaderno de Logoaudiometra. M. R. de Crdenas y V. Marrero. Cuadernos de la
Uned. UNED (1994). Madrid.
35. Gua Laem para or mejor. W. J. Staab, Ph. D. (en castellano traduccin del libro:
Hearing Aids A User s Guide). LAEM (1995). Alicante.
36. Introduction to Audiology. N. F. Martin. 5. Ed. Prentice-Hall (1994). New Jersey.
37. Estudio de los Circuitos Elctricos. J. Lagasse. Tomo I (1963) Paraninfo. Madrid.
38. Estudio de la Funcin Auditiva Perifrica, mediante Potenciales Evocados Auditivos
de Tronco Cerebral. D. R. Stapells. Actas del Symposium Internacional sobre
Problemas de Audicin y Comunicacin en el Nio (1995). Granada.
39. Brain stem auditory evoked responses. Studies of waveform variations in 50 normal
human subjets. K. H. Chiappa, K. J. Gladstone and R. R. Young. Arch. Neurol. 36(2),
(1979). Pgs.: 427-38.
40. The adaptation of coclear an brainstem auditory evoked potentials in humans. A R D.
Thorton, M. J. Coleman. Electroenceph. Clin. Neurophisiol. 39(4), (1979), pgs.
399-406.
41. Principles of electric response audiometry. H. Davis. Ann. Otol. Rhinol. Laringol. 85,
(1976), pgs.: 179-186.
42. Distribution of brainstem responses to acustic stimuli over the human scalp. A. F. Van
Olphen, M. Rodenburg and C. Verwey. Audiol. 17, (1978), pgs.: 511-18.
43. Use of auditory braintem responses by prematures and newborn infants. P. A.
Desplands and R. Galambos. Neuropediatrie. 11(2), (1980), pgs.: 99-107.

202
Referencias

44. Intersubject variability of the auditory-evoked brain stem potentials. R. J. McClelland


and R. S. Mccrea. Audiology. 18. (1979). Pgs.: 462-71.
45. Relationchip between head size and latency of the auditory brainstem response. J. J.
Dempsey, E. Censorano and M. Mazor. Audiology. 25. (1986) pgs.: 258-62.
46. Reconstruction of the audiogram using brainstem responses and high pass noise
masking. M. Don, J. J. Eggemont and D. E. Brackmann. Ann. Otol. Rhinol. Laryngol.
56, (1979). Pgs.: 88-98.
47. Clinical usefulness of auditory braintem responses in patients with sensorineural and
mixed hearing loss. J. Kozlowski. Pol. Tyg. Lek. 50, (1995), pgs.: 36-39.
48. Human auditory nerve action potentials in brainstem evoked responses: Latency-
intensity functions in detection of cochlear and retrocochlear abnormality. A. C.
Coats. Arch. Otolaryngol. 104, (1978), pgs.: 709-17.
49. In consistency of auditory middle latency and state responses in infants. D. R. Stapells, R.
Galambos, J. A. Costello and S. Makeg. Clin. Neurophysiol. 71, (1988), pgs.: 289-95.
50. The automated prediction of hearing threshold in sleeping suvjets using auditory
study-state evoked potentials. G. Rance, F. W. Rickards, L. T. Cohen, S. De Vidi and
G.M. Clark. Ear. Her. 16, (1995), pgs.: 499-507.
51. Neonatal screening for deafness. M. Feinmesser. Arch. Otolaryngol. 102, (1976) pgs.:
297-99.
52. Sensorineural Hearing Loss in Young Children. A systematic approach to evaluation.
D. G. Pappas and M. R. Mundy. Southern Medical J. 74(8), (1981). pgs.: 265-67.
53. La Impedanciometra. D. Brooks. Anales ORL Iberoamericanos I(5), (1974), pgs.:
519-33.
54. Guidlines for Acoustic immitance screening of middle ear function. American Speech-
Language-Hearing Association (ASHA) Comitee on Audiometric Evaluation. ASHA,
21, (1979), pgs.: 283-88.
55. Auditory Disorders in School Children: Screening for hearing loss and middle ear
disorders. J. Roeser and J. L. Northern. Cp. 7. Thieme-Stratton Inc. (1981). N. Y.
56. Recommended Methods for Measurement of Electro-acoustical of hearing aids. IEC
Publication 118 (1959). Amedment N. 1 to this publication (1973). USA.
57. An Acoustic Coupler for Earphone Calibration. J. J. Zwislocki. Report LSC-7.
Laboratory of Sensory Comunication (1970). Syracuse University. U S A.
58. Earphone Pressure Response in Ears and Couplers. R. M. Sachs and M. D. Burkhard.
Paper presented at the 83rd. Meeting of the Acoustical Society of America, 21st. April
(1972). (IRPI report No. 20021-2).
59. IEC Report on Methods of Measurement of Performance Characteristics of Hearing
Aids under Simulated In Situ Working Conditions. J. Draft. IEC-publication 118-8.
(1981). USA.
60. Apuntes de Audiometra y Tecnologa Protsica. E. Salesa. 1.er Curso de Formacin de
Audioprotesistas (2. Promocin). ETP del Clot. (1984). Barcelona.

203
Referencias

61. Anthropometric Manikin for Acoustic Research. M. D. Burklard and R. M. Sachs.


Acoustical Society of America J. No. 1 (1975). USA.
62. The External Ear: New Knowledge. E A G. Shaw. Proceeding from the VII Danavox
Symposium.(1975). Dinamarca.
63. In Situ Measurement of Hearing Aids. H. Bergenstoff. Danavox Publication (1977).
Dinamarca.
64. Think Etymotic. Danavox Publication (1980). Dinamarca.
65. $QHZ&RPSXWHUL]HG0HWKRGIRU+HDULQJ$LGWWLQJ%DVHGRQ0HDVXUHPHQW at The
Eardrum. O. Lauridsen and H. Birk Nielsen. Scandinavian Audiology. No. 2. (1981).
Suecia.
66. Methods for Measuring the Performance of Hearing Aids. F.F.Romanoff. JASA. 13,
(1942), pgs.: 294-304. USA.
67. Discussion of some problems involved in deriving objective performance criteria for
a wearable hearing aid for clinical measurements with laboratory apparatus. E. W.
Ayers. Proceeding of the 1st. ICA Congress (1945). Pgs.: 141-43.
68. On Acustical Characteristics of the Earmould. H. Ewertsen, J. B. Ipsen and S. S.
Nielsen (1956). Copenhagen.
69. Basic principles of otometry. J. A. Victoreen. Thomas Edit. III  6SULQJHOG,QJODWHUUD
70. Hearing Enjancement. J. A. Victoreen. Thomas Edit., III  6SULQJHOG,QJODWHUUD
71. Use of pure tone measurements in hearing aid evaluation. W. R. Kee. Audecibel.
Winter 9, pg. 15 (1972).
72. ([SHULHQFHV ZLWK FRPSXWHUDLGHG KHDULQJ DLG WWLQJ Corell, Ludvingsen and B.
Nielsen. Scand. Audio. 12(3), (1983). Dinamarca.
73. $SXQWHVGHORV&XUVRV\'LSORPD&HUWLFDGRHQ$F~VWLFD\$XGLRPHWUtD
J. M. Boix, E. Salesa et l., Dpto. de ptica UCM.

204