Está en la página 1de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos

CODELCO Chile Divisin Salvador

DECLARACINDEIMPACTOAMBIENTAL

FLOTACINDEESCORIASCONVERTIDORTENIENTE
FUNDICINPOTRERILLOS

CODELCOCHILEDIVISINSALVADOR

CODELCOChile DivisinSalvador

CODELCOChile

Pgina 1 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

CONTENIDO

1. INTRODUCCIN...................................................................................................................6
2. ANTECEDENTESGENERALES................................................................................................7

3.

2.1

IdentificacindelProyectoydelProponente.....................................................................7

2.2

AntecedentesdelTitular.....................................................................................................7

2.3

AntecedentesdelRepresentanteLegal..............................................................................7

2.4

IndicacindeltipodeProyectooActividad........................................................................7

2.5

Objetivo...............................................................................................................................8

2.6

JustificacindelaLocalizacin............................................................................................8

2.7

VasdeAcceso.....................................................................................................................9

2.8

MontodelaInversin.......................................................................................................10

2.9

Vidatildelproyecto........................................................................................................11

2.10

FechaEstimadadeInicio...............................................................................................11

2.11

ManodeObra...............................................................................................................11

2.12

Superficie.......................................................................................................................11

2.13

Cronograma...................................................................................................................12

DESCRIPCINDELASPARTES,ACCIONESYOBRASFSICASDELPROYECTO........................13
3.1

DescripcinGeneraldelaSituacinActual.......................................................................13

3.2

DescripcinGeneraldelProyecto.....................................................................................14

3.3

DescripcindelaEtapadeConstruccindelProyecto.....................................................16

3.4

DescripcindelaEtapadeOperacin..............................................................................18

3.4.1

TrasladodeEscoriadesdeConvertidorTeniente.....................................................18

3.4.2

EnfriamientodeEscoriaenOllayEnvodeEscoriaaPlantadeFlotacin................18

3.4.3

PlantadeFlotacindeEscorias.................................................................................19

3.4.4

DepsitodeRelavesFiltrados...................................................................................22

3.5

DescripcindelaEtapadeCierredelProyecto................................................................35

3.6

InstalacindeFaenas........................................................................................................36

3.7

MovimientosdeTierra......................................................................................................37

3.8

Caminos.............................................................................................................................38

3.9

MaterialesdeEmprstito..................................................................................................38

3.10

Comedores....................................................................................................................39

3.11

OficinasySaladeControl..............................................................................................39

3.12

ServiciosHiginicosySistemadeAlcantarillado...........................................................39

3.13

CasasdeCambio...........................................................................................................40

CODELCOChile

Pgina 2 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

5.
6.

3.14

Bodegas.........................................................................................................................40

3.15

Estanques......................................................................................................................41

3.16

ServiciosySuministros..................................................................................................42

3.16.1

SuministrodeEnergaElctrica.................................................................................42

3.16.2

SuministrodeAguaPotableeIndustrial...............................................................42

3.16.3

SuministrodePetrleo..............................................................................................43

3.16.4

SuministrodeAire.....................................................................................................44

3.17

Controldeacceso..........................................................................................................44

3.18

ManejoyDisposicindeResiduosSlidos....................................................................44

3.19

ManejoyDisposicindeEfluentesLquidos.................................................................45

3.20

MantencindeInfraestructurasyEquipos...................................................................45

3.21

AspectosAmbientalesdelProyecto..............................................................................46

3.21.1

Ruido.....................................................................................................................46

3.21.2

PatrimonioCultural...............................................................................................46

3.21.3

FlorayFauna............................................................................................................47

3.21.4

Paisaje....................................................................................................................49

3.21.5

Turismo..................................................................................................................49

3.21.6

Antropologa..........................................................................................................49

3.21.7

HidrologaeHidrogeologa........................................................................................50

3.21.8

Suelo..........................................................................................................................50

ANLISISDEPERTINENCIADEINGRESOALSEIA................................................................51
PRINCIPALESEMISIONES,RESIDUOSYDESCARGASDELPROYECTOALAMBIENTE.............64
6.1

7.

EmisionesalaAtmsfera..................................................................................................64

6.1.1

EmisionesdeMaterialParticulado............................................................................64

6.1.2

EmisindeAzufre......................................................................................................65

6.1.3

EmisindeArsnico..................................................................................................66

6.2

EfluentesLquidos.............................................................................................................66

6.3

ResiduosSlidos................................................................................................................67

NORMATIVAAMBIENTALAPLICABLEALPROYECTO..........................................................68
7.1

LegislacinAmbientaldeCarcterGeneral......................................................................68

7.1.1

ConstitucinPolticadelaRepblica........................................................................68

7.1.2
Ley19.300,deBasesGeneralesdelMedioAmbiente,modificadaporlaLeyN
20.417/2010,queCreaelMinisterio,elServiciodeEvaluacinAmbientalyla
SuperintendenciadelMedioAmbiente...................................................................................68

CODELCOChile

Pgina 3 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

7.1.3
DSN95/2001,MinisterioSecretaraGeneraldelaPresidencia,Reglamentodel
SistemadeEvaluacindeImpactoAmbiental.........................................................................70
7.2

LegislacinAmbientalAplicabledeCarcterEspecfico...................................................71

7.2.1

Infraestructura..........................................................................................................71

7.2.2

Aire............................................................................................................................72

7.2.3

Agua...........................................................................................................................78

7.2.4

Suelo..........................................................................................................................80

7.2.5

Residuos....................................................................................................................81

7.2.6

SustanciasPeligrosas.................................................................................................82

7.2.7

Transporte.................................................................................................................87

7.2.8

Electricidad................................................................................................................88

7.2.9

DisposicindeRelaves..............................................................................................89

7.2.10

RecursosNaturales....................................................................................................89

7.2.11

HigieneIndustrial......................................................................................................91

7.2.12

SeguridadMinera......................................................................................................91

8 PERMISOSAMBIENTALESSECTORIALESAPLICABLESALPROYECTO...................................97
9 RELACINDELPROYECTOCONLASPOLTICAS,PLANESYPROGRAMASDEDESARROLLO
REGIONALYCOMUNAL...........................................................................................................106
8.1RelacindelProyectoconlasPolticas,PlanesyProgramasdeDesarrolloRegionaly
Comunal......................................................................................................................................106
10
COMPROMISOSVOLUNTARIOS....................................................................................110
11
FIRMADELADECLARACINDEIMPACTOAMBIENTAL.................................................111

LISTADODEANEXOS

Anexo1
Planos
Anexo2

HojasdeDatosdeSeguridaddeProductos

Anexo3

AntecedentesparaSolicitarelPermisoAmbientalSectorialN84

Anexo4

ResultadosdeTestsAmbientales(ABA/NAG/SPLP)

Anexo5

ResolucindeAprobacindelPlandeCierredeDivisinSalvador

Anexo6

ProcedimientosencasosdeEmergencia

Anexo7

ProcedimientoManejodeResiduosSlidos

Anexo8

VisacindelPlandeManejodeResiduosPeligrosos

Anexo9

MedicionesdeRuidoBasalyAnlisisdeImpacto

CODELCOChile

Pgina 4 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Anexo10

InformedeProspeccinArqueolgicayPaleontolgica

Anexo11

InformesdeFlorayFauna

Anexo12

EvaluacinPaisajstica

Anexo13

EvaluacindelImpactoTurstico

Anexo14

InformeAntropolgico

Anexo15

ReconocimientoHidrogeolgico

Anexo16

AntecedentesparaSolicitarelPermisoAmbientalSectorialN96

Anexo17

EstimacindeEmisiones

Anexo18

AntecedentesparaSolicitarelPermisoAmbientalSectorialN94

Anexo19

AntecedentesparaSolicitarelPermisoAmbientalSectorialN90

Anexo20

AntecedentesparaSolicitarelPermisoAmbientalSectorialN101

Anexo21

AntecedentesparaSolicitarelPermisoAmbientalSectorialN106

Anexo22

AntecedentesparaSolicitarelPermisoAmbientalSectorialN81

CODELCOChile

Pgina 5 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

1.

INTRODUCCIN

LaFundicindeCobrePotrerillos,deCODELCOChileDivisinSalvador,deseaprocesarlasescorias
provenientes directamente desde el reactor Convertidor Teniente (CT5) en una planta de
flotacin, con la finalidad de maximizar sus indicadores de recuperacin y rendimiento
metalrgicos. Se entiende por procesamiento de las escorias de fundicin, al proceso de
concentracinpormediodelcualesposiblerecuperarelcobrecontenidoendichaescoria,elque
se encuentra presente por efectos de arrastres de metal blanco y de oclusiones metlicas
producidasalinteriordelreactorConvertidorTenientedurantelafusindelosconcentrados.

ElprocesodeFlotacinaimplementar,suponedejarfueradeoperacinlosactualestresHornos
de Limpieza de Escorias (HLE), la implementacin de un proceso de enfriamiento de escoria en
ollas, molienda, flotacin, espesamiento y filtrado, para obtener por un lado concentrado de
cobre,elqueserecircularalaFundicin,yporotro,relavescon12%dehumedadpromedio,los
queserndispuestosenundepsitoderelavesfiltrados.

Paraladisposicinderelavesfiltrados,sehaconsideradoundepsitoubicadoenladenominada
Quebrada Afluente, con una vida til aproximada de 5 aos, cuyo diseo y parmetros de
operacinesentregadoenlapresenteDeclaracin.

LaplantadeflotacinprocesarescoriasgeneradasporelConvertidorTeniente,estimndoseque
laleypromediodeCuenstasserde8a11%,conunacapacidaddediseodetratamientodiario
de1700toneladasdeescoria,delascuales,lacapacidadnominaldeprocesamientocorrespondea
1468 toneladas. Producto del procesamiento, se generarn al da 295 toneladas diarias de
concentradodecobrey1173toneladasdiariasderelavesfiltrados(valoresnominales).

Este nuevo proceso a implementar, modifica la operacin actual de la Fundicin Potrerillos,


definidaenelproyectoCambioTecnolgicoFundicinPotrerillosaprobadomedianteRCAN47
del24dejuliode2000.Porestaraznprincipal,ademsdelatipificacinpropiadelproyectoen
elmarcodelSEIA,CODELCOChileDivisinSalvadoringresaalSistemadeEvaluacindeImpacto
Ambiental a travs de esta Declaracin, el Proyecto denominado Flotacin de Escorias
ConvertidorTenienteFundicinPotrerillos.

CODELCOChile

Pgina 6 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

2.

ANTECEDENTESGENERALES

2.1

IdentificacindelProyectoydelProponente

Nombre del Proyecto: FLOTACIN DE ESCORIAS CONVERTIDOR TENIENTE FUNDICIN


POTRERILLOS.

2.2

AntecedentesdelTitular

Nombre
RUT
Domicilio
Fono
Fax

2.3

AntecedentesdelRepresentanteLegal

RepresentanteLegal
RUT
Domicilio
Fono
Fax

2.4

:CODELCOChile,DivisinSalvador
:61.704.000K
:Avda.BernardoOHiggins#103,ElSalvador
:52472510
:52472514

:RodrigoRamnVargasVargas
:12.515.204k
:Av.BernardoOHiggins#105,ElSalvador.
:52472499
:52472859

IndicacindeltipodeProyectooActividad

SegnloestablecidoenelArtculo8delaLey19.300sobreBasesGeneralesdelMedioAmbiente,
modificada por la Ley 20.417 Crea el Ministerio, el Servicio de Evaluacin Ambiental y la
Superintendencia del Medio Ambiente, Los proyectos o actividades sealados en el artculo 10
slopodrnejecutarseomodificarsepreviaevaluacindesuimpactoambiental,deacuerdoalo
establecido en la presente ley. Al respecto, el proyecto Cambio Tecnolgico Fundicin
Potrerillos,ingresadoalSEIAmedianteunaDIAaprobadaatravsdelaRCAN047del24dejulio
de2000,establece,entreotrascosas,laoperacindelosHornosdeLimpiezadeEscoria(HLE),la
disposicin de stas, el procesamiento de concentrado y las emisiones de la Fundicin. Estas
componentes son modificadas por el Proyecto Flotacin de Escorias Convertidor Teniente
FundicinPotrerillos,porcuantocambialalneadeprocesosqueseleentregaalaescoriauna
vezextrada delConvertidorTeniente, yporlotanto,debeingresaralSistemadeEvaluacinde
ImpactoAmbiental(SEIA).

Por otro lado, segn lo establecido en el Artculo 10 de la Ley 19.300, modificada por la Ley
20.417,yenelArtculo3delDecretoSupremoN95/01ReglamentodelSistemadeEvaluacinde
ImpactoAmbiental(SEIA),losproyectosoactividadessusceptiblesdecausarimpactoambiental,
en cualesquiera de sus fases, que debern someterse al Sistema de Evaluacin de Impacto
Ambiental,sonlossiguientes:

CODELCOChile

Pgina 7 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

TipificacinPrincipal:

Letra i) Proyectos de desarrollo minero, incluidos los de carbn, petrleo y gas,


comprendiendo las prospecciones, explotaciones, plantas procesadoras y disposicin de
residuosyestriles.

Enconsideracinaloindicadoanteriormente,elproyectoconsistenteenlaFlotacindeEscorias
Convertidor Teniente Fundicin Potrerillos, debe ingresar al Sistema de Evaluacin de Impacto
Ambiental,mediantelapresenteDeclaracindeImpactoAmbiental.

2.5

Objetivo

La presente Declaracin tiene por objetivo obtener la aprobacin ambiental del Proyecto
Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos que modifica al proyecto
Cambio Tecnolgico Fundicin Potrerillos aprobado mediante RCA N 047 del ao 2000,
consistiendo ste, en un proyecto de mejoramiento que permite incrementar los ndices de
recuperacinyrendimientometalrgicosdecobredelaFundicin,ascomoladisminucindelos
ndicesdeemisindelazonadePotrerillos,enconformidadconlanormativaambientalaplicable
alaactividad.

2.6

JustificacindelaLocalizacin

LalocalizacindelProyectoesenelcomplejoindustrialPotrerillos,elcualseubicaalnororiente
delaregindeAtacama, enelreacordilleranaentrelos500y4.000msnm,enlaProvinciade
Chaaral.

Especficamente en el sector de Potrerillos, el Proyecto se emplazar al Oeste bajo el actual


depsito de escorias, y su ubicacin se justifica en base a su cercana a la Fundicin, terreno
disponibleycondicionesfavorablesparalaimplementacindeldepsitoderelavesfiltrados.

LascoordenadasUTM(DatumWGS84Huso19S)delproyectoson:
Tabla1.CoordenadasdeUbicacindelProyecto(DatumWGS84Huso19S)
PartesdeProyecto

Coordenadas
Norte

Este

reaEnfriadodeEscoriasenOllas

7.076.740

452.680

PlantadeTratamiento

7.076.850

452.540

DepsitodeRelaves

7.076.800

452.400

CODELCOChile

Pgina 8 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Imagen1.Ubicacinregional,provincialycomunaldelProyectoFlotacindeEscoriasConvertidorTeniente
FundicinPotrerillos.

2.7 VasdeAcceso

Lazonaseencuentrafueradelradiourbano,distantea45KmdeElSalvadorya63KmdeDiego
deAlmagro.LarutaprincipaldeaccesoseencuentraapartirdelaRuta5Norte,siguiendolaRuta
C13,empalmandoluegoalaRutaC163yretomandoluegolaRutaC31.

CODELCOChile

Pgina 9 de 111

DIA Fllotacin de Escorias Convertid


dor Teniente Fun
ndicin Potrerilllos
CO
ODELCO Chile Divisin Salvad
dor

Imagen2.VasdeaaccesoalazonadelProyecto
o.
Tabla2..RutasdeAcceeso.
R
Ruta(desdeha
asta)
CopiapaCha
aral
ChaaralaDieggodeAlmagro
o
D
DiegodeAlmag
groaSalvador
D
DiegodeAlmag
groaPotrerillo
os

Disttanciaaprox.
(km)
167
63
53
91

SaalvadoraPotrrerillos

45

Camino Alterrnativo Copiaap


D
DiegodeAlmag
gro

100

Condicionessdelcamino
CaminoPavimentado(Rutta5)
CaminoPavimentado
CaminoPavimentado
Caminopavimentado(46km);
uperficial
caminocontratamientosu
m)
desal(45km
Caminocontratamientosuperficial
desal
CaminoPavimentado

2.8

MontodelaaInversin

Lainveersinestimad
daparalaimplementacin
ndelProyectoesde60MillonesUS$.

CODELCO
OChile

P
gina 10 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

2.9

Vidatildelproyecto

SegnloestablecidoenelPlandeNegociosenDesarrollodeDivisinSalvador,elProyectotiene
unavidatiloperacionalestimadaen5aos.

2.10 FechaEstimadadeInicio
El Proyecto se iniciar una vez que se cuente con la Resolucin de Calificacin Ambiental
favorable,ydeacuerdoalacartaGanttadjuntaenelpunto2.12.

2.11 ManodeObra
ParaelProyectoFlotacindeEscoriasConvertidorTenienteFundicinPotrerillossehaestimado
quelamanodeobraparalasdistintasetapasser:

Tabla3.ManodeObraestimadarequeridaporelProyecto.

EtapadelProyecto
ConstruccinyMontaje
Operacin(incluyemantencin)
Cierre

Manodeobrarequeridapromedio
280 personas
45 personas
170personas

Manodeobramxima
300personas
45personas
200personas

ParalaetapadeOperacindelProyecto,sehaconsideradoquestaseaefectuadaporelpersonal
actualdelprocesodelimpiezadeescoriaenhornos(HLE),quequedarfueradeoperacinconel
presente Proyecto. Asimismo, para las etapas de construccin y cierre se privilegiar la
contratacindemanodeobralocal.

2.12 Superficie
Lasuperficietotaldelproyectopresentadoaevaluacines:

Tabla4.SuperficiedelProyecto.

Zona

Superficie(ha)

reaEnfriadodeEscoriasenOllas

2,23

PlantadeTratamiento

3,90

DepsitodeRelaves

6,64

Total

12,77

CODELCOChile

Pgina 11 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

2.13 Cronograma
AcontinuacinsemuestralacartaGanttgeneraldelproyecto.

Etapa
Construccin
Operacin
Cierre

Ao
1 2 3 4 5 6


Imagen3.CartaGanttdelProyecto.

CODELCOChile

Pgina 12 de 111

DIA Fllotacin de Escorias Convertid


dor Teniente Fun
ndicin Potrerilllos
CO
ODELCO Chile Divisin Salvad
dor

3.

DESCRIPCI
NDELASPA
ARTES,ACCIO
ONESYOBRASSFSICASDELLPROYECTO

3.1

Descripcin
nGeneraldelaSituacinA
Actual

mente, la Fundicin de Cobre de Potrerillos,


P
p
procesa
660..000 tonelad
das anuales de
Actualm
concen
ntradossecossdecobre,prrovenientesd
delaDivisinSalvador(30
0%35%apro
oximadamentte)
yotrossproveedoressnacionales,siendounafu
undicindeccarctermaqu
uiladora.

Enelp
procesodeFu
usindeconcentradoseneelConvertido
orTeniente,d
denominadoC
CT5,segenerran
escoriaas con altos niveles de cobre conteenidos, entree 9% y 11%. Estas esco
orias son lueego
ingresaadas a los Ho
ornos de Lim
mpieza de Esccorias (HLE, 3
3 unidades), en los cuales, mediante un
processo Batch basaado en reducccinsedimentacin, con mezcla petr
leo de Enap
p6 / Aire com
mo
agentee reductor inyyectado a los hornos mediante toberras directameente en el baao fundido, se
lograrecuperarparrtedelcobre contenidoen
nformadeM
MetalBlanco, elqueluego esincorporado
mente al pro
oceso. Los gaases generados en los HLLE, particularmente duran
nte la etapa de
nuevam
reducccin, son cole
ectados a travs de las caampanas de gases,
g
de maanera de ser evacuados a la
atmsfferaatravsdelaschimen
neasdecadaHLE.Enestaetapaseobservalapresenciadehum
mos
negross en la desccarga de la chimeneas deebido a la baaja eficiencia del reductorr y combustiin
incomp
pletadelpetrrleoincorporado.

Laesco
oriageneradaaenlosHLEp
poseeunaleyydeCupromeediode1,3%,locualperm
mitesudescarte
a botaadero. El me
etal blanco recuperado,
r
se une al geenerado en el Convertid
dor Teniente,, y
contin
ansuprocessamientoenlaFundicinh
hastalageneeracindeno
odosdecobre.

oFundicinsemuestraaccontinuacin::
Undiaggramageneraaldelproceso

Imaggen4.Diagram
mageneraldelProcesoActuaaldelaFundicinPotrerillos.

CODELCO
OChile

P
gina 13 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

LosparmetrosprincipalesdelaoperacinactualdelaFundicinson:

Tabla5.ParmetrosprincipalesdelProcesoActualdelaFundicinPotrerillos.

ParmetrodeOperacinCTHLE
FusindeConcentradossecos
GeneracindeEscoriadeCT
LeydeCuenEscoriadeCT
GeneracindeEscoriaaBotadero*
LeypromediodeCuenEscoriasdebotadero
RecuperacinMetalrgicaPromedio Fundicin
ConsumodePetrleoenHLE
Consumo de Combustibles Lquidos derivados del
PetrleoenlosHLE(toberas+quemadorsumergido)
EmisionesalaAtmsferadelaFundicinPotrerillos
EmisindeAzufre*
EmisindeArsnico*
EmisindeMaterialParticulado**

Unidad
T/ao
T/da
%
T/ao
%
%
Unidad
l/min

Valor
660.000
1.500
8 11
350.000
1,3
95,2
Valor
14 16

Unidad
T/ao
T/ao
T/ao

Valor
37.383
241,4
853,3

*EstimacionesrealizadasenbaseamodelacinMETSIM(modelacinmetalrgica).
**Valorbaseao2010

3.2

DescripcinGeneraldelProyecto

Producto del contenido de Cu en las escorias obtenidas en el Convertidor Teniente (CT5), el


Proyecto considera el reemplazo del proceso actual de recuperacin de Cobre en los Hornos de
LimpiezadeEscorias(HLE,3unidades),porunprocesodeflotacindeescoriasconobtencinde
concentradodecobre.

UnesquemadelsistemaqueconstituyeelpresenteProyectosometidoaevaluacin,consisteen:

CODELCOChile

Pgina 14 de 111

DIA Fllotacin de Escorias Convertid


dor Teniente Fun
ndicin Potrerilllos
CO
ODELCO Chile Divisin Salvad
dor

Imagen5.Diagramaageneraldelp
procesodelaFFundicinPotreerillosconelProyectoFlotacindeEscoriass
ConveertidorTeniente.

Los paarmetros principales dee la operacin esperada de la Fundicin, unaa vez se haaya
implem
mentadoelprroyectoFlotacindeEscorriasConvertid
dorTenienteFundicinPotrerillos,son::

CODELCO
OChile

P
gina 15 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Tabla6.ParmetrosprincipalesdelProcesoFuturodelaFundicin,considerandolaimplementacindel
Proyecto.

ParmetrodeOperacinCTHLE
FusindeConcentradossecos
GeneracindeEscoriadeCT(nominal)
LeydeCuenEscoriadeCTpromedio
Generacinderelavesdeescoria
LeypromediodeCuenrelavesdeEscoria
RecuperacinMetalrgicaPromedioFundicin
ConsumodePetrleoenelProyecto
Consumo de Combustibles Lquidos derivados del
*
Petrleo
EmisionesalaAtmsferadelProyecto
EmisindeAzufre**
EmisindeArsnico**
EmisindeMaterialParticuladoFundicin***
Emisin de Material Particulado Instalaciones
Proyecto(enoperacin)****

Unidad
T/ao
T/da
%
T/ao
%
%
Unidad
m3

Valor
660.000
1.468
811
400.000
0,4
97,4
Valor
3,5

Unidad
T/ao
T/ao
T/ao
T/ao

Valor
35.122
156,4
180
190

*Sloparausodegeneradorderespaldoencasodefallaensuministroelctrico.
**EstimacionesrealizadasenbaseamodelacinMETSIM(modelacinmetalrgica).
***EmisinestimadaconsiderandolosHLEfueradeoperacin(baseao2010).
**** Promedio anual de la estimacin de emisiones durante la vida til del Proyecto en su etapa de operacin (transporte de
escoria,transportedeconcentradodeescoria,superficieexpuestaderelave,procesodeimplementacindecobertura).

3.3

DescripcindelaEtapadeConstruccindelProyecto

LaConstruccindelProyectoFlotacindeEscoriasConvertidorTenienteFundicinPotrerillos,se
realizarendosetapas:i)conlaFundicinOperando,yii)conlaFundicinDetenida.

ParaeltrasladodelosequiposdesdelosproveedoreshaciaPotrerillos,eltrnsitoserealizarpor
vaspblicas,porlocualsecumplircontodalanormativaaplicableindicadaenelpunto6.2.7del
presentedocumento.

I.
TrabajosconlaFundicinOperando

Trabajos en la superficie superior del escorial: Comprenden la excavacin y preparacin de


superficiesylaconstruccinde2losasparalelasdehormignarmado,quesoportarnlasollasde
escoria para su enfriamiento forzado, y la instalacin de una red de caeras que conducir las
aguas actualmente utilizadas para el proceso de enfriamiento del escorial, y que se emplearn
paraenfriarlasollas.Igualmente,sereubicarlabsculaexistentedepesajedeollas,ubicndolaa
laentradadelaslosas.

Estasactividadesnopresentaninterferenciasconlaoperacinactualdemovimientoydescargade
loscamionesdeescoriaenelsectornororientedelescorial,sinembargoseconfinarelreade
trabajo, con las precauciones asociadas al trnsito de vehculos en estas vas de circulacin
aledaas,yserealizartodaactividadentotalcoordinacinconelpersonaldeoperaciones.Cabe

CODELCOChile

Pgina 16 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

indicarquetodoelmovimientonecesarioparalaconstruccinserrealizadoencaminosinternos
deDivisin,porlocualseaplicarnnormasinternasparaelcontrolderiesgos.

Trabajos al borde del talud del escorial: Corresponden a trabajos de excavacin para la
construccindeunatolvadehormign,laquerecibirlaescoriarequebrajadaqueingresarala
Planta de Flotacin, seguida por la instalacin en su base de un apron feeder y una correa
transportadora que conducir a la Planta. Aqu rigen las mismas precauciones ya descritas,
asociadasaltrnsitodevehculosenlasvasdecirculacinaledaasinternasdelaDivisin,que
requierencoordinacinconpersonaldeoperaciones.

ConstruccindelaPlantadeFlotacindeEscoria: LaPlantairdispuestasobreunaplataforma
estructural paralela al borde inferior del Escorial, lo que requerir realizar un corte de 9 m de
profundidadenelterreno,seguidoporunterraplnestructural.

Para la construccin del edificio de molienda y flotacin, se aplicarn precauciones por la


proximidadconvasdecirculacindevehculos.

A medida que se completen las excavaciones, movimientos de tierra y preparacin de los


respectivosterrenos,seproseguirconlasobrascivilesdehormigonesparalatolvaderecepcin,
y de las fundaciones y estructuras de la correa de alimentacin al rea de molienda.
Paralelamente,serealizarnlasobrascivilesdefundacionesdeledificiodemoliendayflotacin,
salas elctricacontrol, y otras dependencias, as como de los molinos, celdas de flotacin y
equiposrestantesenesteedificio.Tambinseejecutarnlostrabajosdehormigonesenlasreas
deespesadoresyfiltros,todolocualsepuedeefectuarsininterferenciasconlasactualesfaenas
productivas, siempre teniendo en consideracin las prevenciones de seguridad y coordinacin
necesarias, dado que existen actividades productivas con circulacin de vehculos y maquinarias
enlazona,aunquedepocafrecuencia.

Una vez que las obras de hormign de fundaciones de edificios y equipos ya se vayan
completando, se realizarn los montajes de equipos y estructuras e instalaciones varias de
sistemasauxiliares,caeras,equipos,componentesylneaselctricasydecontrol.

En el caso del rea de acercamiento al Convertidor Teniente, los trabajos de desarme de


instalacionesexistentes,despejeyrellenos,sepodrnrealizarsininterferenciasconlaoperacin.
La circulacin de camiones con material de relleno y actividades en general asociadas a estos
trabajos, se coordinar con el movimiento de camiones de escoria que all se realiza, con las
correspondientesmedidasdeprevencinantecualquiersituacinderiesgo.

Enelreaderecepcin,almacenamientoypreparacindecarga,seefectuarnlasexcavaciones
necesariasparalaconstruccindelbuznderecepcindecamionesquedescargarnconcentrado
deescoria,serealizarnloshormigonadosdelfosodelbuznalimentador,galeradelacorreade
alimentacin a tolva y fundaciones de esta misma. Se requiere tambin para estas faenas el
confinamientodelreadetrabajo,conlasprecaucionesasociadasalmovimientodemaquinarias
quenormalmenteserealizaenelrea,querequierencoordinacinconpersonaldeoperaciones.

II.
TrabajosconDetencindelaFundicin

CODELCOChile

Pgina 17 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Los trabajos tienen que ver con la consecucin de los desarmes de instalaciones existentes,
despeje y rellenos en la Nave Fundicin, que se efectuarn con detencin de los Hornos de
LimpiezadeEscoriaN1yN2,porloqueelConvertidorTeniente(CT5)continuaroperandocon
descargasporollasloalHornodeLimpiezaN3.

LostrabajosalinteriordelaNave,yenparticularelretirodelHornodeLimpiezadeEscoriaN1
requerirn interrupciones menores de la operacin normal, que significarn restricciones a la
operacin en el sector del Convertidor Teniente, por lo que stas se realizarn en base a una
cuidadosaprogramacinypermanentecoordinacinconelpersonaldeoperaciones.

3.4 DescripcindelaEtapadeOperacin

3.4.1 TrasladodeEscoriadesdeConvertidorTeniente

LaescoriageneradaenelConvertidorTeniente,serdepositadaenollasde635pie3decapacidad.
El vaciado de la escoria ser realizado por pasaje (canal) en la sangra actual del Convertidor
Teniente.Paraestaactividad,semantendrnenoperacinlossistemasdecaptacindegasesque
actualmenteposeeelConvertidorTenienteenelcanaldesangradeescoria.

Paralacorrectaoperacindevaciadodelaescoriaytrasladomediantecamindeescorias,ser
necesarioelretirodelactualHornodeLimpiezadeEscoriaN1,quequedarfueradeoperacin
conlaimplementacindelProyecto.

Lasolasdeescoriasellenarnhasta3/4desucapacidad.Estasollasserntrasladadasmediante
camionesdeescoriahastaelsectordeenfriamiento,elcualseubicarsobreelactualdepsitode
escorias,especficamenteensupartecentral,distantea500maproximadamentedesdelasalida
delanaveFundicin.

3.4.2 EnfriamientodeEscoriaenOllayEnvodeEscoriaaPlantadeFlotacin

Las ollas con escoria sern dispuestas en filas, sobre dos losas de concreto, con una canaleta
centralderecepcinyrecuperacindeposiblesderramesdeaguadeenfriamiento.

El agua a utilizar para el enfriamiento de las ollas ser la que actualmente se utiliza para el
enfriamiento de escorias en botadero, depsito aprobado mediante resolucin N 366 del ao
2003, la cual proviene de las aguas residuales de los procesos de enfriamiento de la Planta de
Oxgenoydelasplantasdeagua,lasqueseacumulanenunestanqueexistentede4500m3de
capacidad,ubicadoalpiedelescorial,enelsectorOeste.Elperiododeenfriamientoserde32
horas, y ser provista mediante un eje central de aspersin ubicado entre las dos filas de ollas,
como se visualiza en el Plano M40064000131PLA003, adjunto en el Anexo 1. El consumo
mximo de agua para el enfriamiento ser de 41,2 L/s, logrndose un enfriamiento controlado.
Estaaguaayudaralfraccionamientodelaescoriaenfriadaenlaolla.

Elflujodeaguaquerebalsadelaollaserrecolectadoyrecirculadoalmismoestanquedeorigen,
desdedondeserrecirculadaalproceso.

CODELCOChile

Pgina 18 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Productodelenfriamientodelaescoria,ydadaslasaltastemperaturasalacualseencuentra,slo
se espera la generacin de vapor de agua. Todo otro elemento presente en el agua de
enfriamientoquedaocluidodentrodelamatrizvtreaqueformalaescoriaalenfriarse.

Unavezquesehayacompletadoelciclodeenfriamiento,lasollasserntomadasporelcaminde
escoriaselcuallasinclinarparaverterelaguaremanente,laspesarenlabsculadecamiones,y
las trasladar hasta el sector de acopio de escoria fra, donde ser volteada y sometida a
fraccionamientomedianteelusodeunmartilloneumticopicador,pasandoademssobreellaun
equiporodanteprovistodeorugasmetlicas.

Laescoriafragmentadaseracopiadasobreelescorial,medianteelusodeuncargadorfrontal,en
unsectorprximoalatolvade300[ton]ubicadaenelbordedelasuperficiesuperiordelEscorial,
quedisponeensubocasuperiordeunaparillametlicade10deapertura.Desdeesteacopiose
alimentarestatolvamedianteuncargadorfrontalouncamintolva.Estatolvaalimentaensu
parte inferior un apronfeeder de placas metlicas, que traspasa la escoria a una correa
transportadora,queirsobreunpuentedesdeelEscorialhastalaPlantadeFlotacindeEscorias.

3.4.3 PlantadeFlotacindeEscorias
Paraladescripcindesarrolladaacontinuacin,seconsideraquelacapacidaddeprocesamiento
de diseo de la planta ser de 1.700 toneladas por da, y de 1.468 toneladas por da nominal
(capacidad real), considerando las posibles variaciones en la tasa de fusin de concentrados, as
comodelcontenidodeFedestos.
Las secciones que componen la Planta de Flotacin de Escorias se encuentran indicadas en el
PlanoM400640000131PLA004delAnexo1.

3.4.3.1 ChancadoMolienda
Para la molienda gruesa de la escoria se proyecta un molino SAG semiautgeno, de 16 pies de
dimetro y 8 pies de largo, de una potencia de 1.100 kw, provisto de corazas de acero. ste se
cargar con bolas de molienda de acero de 4a 5, con un 12%de llenado de bolas y 74% de la
velocidadcrtica,quedandoelmaterialconunagranulometrade100%10mm.

Una vez que la escoria ha pasado por el Molino SAG, el material molido pasar a la seccin de
moliendafinaenunmolinodeBolas,quedandoconunagranulometrade80%325#.

EnelcajndetraspasoalmolinodeBolas,seadicionarnreactivoscolectoresHOSTAFLOTE703,a
una tasa de50 g/T, HOSTAFLOT E 930, a una tasa de consumo de 50 g/T, y reactivo espumante
FLOTANOLH70,aunatasadeconsumode15g/T,sinperjuiciodequelatasadeconsumopueda
modificarse,obien,losreactivospuedanserreemplazadosporotrosdesimilarescaractersticas.
LashojasdedatosdeseguridaddelosproductosdelamezclaseencuentranenelAnexo2.

CODELCOChile

Pgina 19 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Tabla7.ConsumodereactivosenlaetapadeMolienda.
Reactivo
ColectorHOSTAFLOTE703
ColectorHOSTAFLOTE930
EspumanteFLOTANOLH70

TasadeConsumo
(g/T)
50
50
15

ConsumoMensual
(Kg)
2.550
2.550
765

ElMolinodeBolasesde15piededimetro,por23piedelargo,conunapotenciade2.500Kw,
provistodecorazasdeaceroodegoma.stesecargaconbolasdemoliendadeacerode2,con
un32%dellenadodebolasy74%delavelocidadcrtica.

El producto del molino de Bolas se descargar a un cajn receptor, desde donde una bomba
centrfugaimpulsarlapulpaaunabaterade8Hidrociclonesde10,con6unidadesoperandoy
2enreserva.

ElproductogruesodelaclasificacinesrecirculadoalmolinodeBolas,yelproductofinopasaal
procesodeflotacin.

3.4.3.2 Flotacin

Paralaflotacindeescoriaseconsiderauncircuitodecuatroetapas:

Unaetapadeflotacinprimaria:seutilizarunaceldadeflotacinde20m3.

LaetapaRougher:Seproyectantresceldasde20m3.

EtapaderepasoScavenger:Paraestaetapaseproyectancuatroceldasde20m3.

LaetapaCleaner:Estaetapaempleatresceldasde5m3.

CODELCOChile

Pgina 20 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Produc to f ino
des de Molienda

Flotacin
Scavenger

Flotac in
Rougher

Flotacin
Primaria

Flotacin Limpieza

Espesador
Relaves
Es pes ador
Conc entrado
Agua Recuperada
Espesamiento y Filtrado
de Concentrado

Agua Recuperada
Espesamiento y Filtrado
de Relave

Filtro Concentrado
Concentrado

Filtro Relave
Agua Recuperada
a Proceso

Queque Relave
a disposicin

Imagen6.CircuitodeFlotacinen4etapas.

3.4.3.3 EspesamientodeConcentradosdeEscoria

El concentrado final, con aproximadamente 30% de slidos, se bombear a un Espesador de


Concentrados,de14mdedimetro,dondeseagregafloculanteSNFaunatasadeconsumo15
g/T (proveniente de un estanque de preparacin comn para el espesamiento de relaves), sin
perjuiciodequelatasadeconsumopudiesevariar,obien,estereactivopudieseserreemplazado
en etapas futuras, por otro de similares caractersticas. La Hoja de Datos de Seguridad del
productoseencuentraenelAnexo2.

El overflow de agua clara se enviar aun estanque de aguas de procesos adyacente, de 6 m de


dimetro, con capacidad de 100 m3, desde donde se recircularn al proceso en el circuito
conminucinflotacin.Elunderflowdeconcentradosespesados,conaproximadamente60%de
slidos,serbombeadoalprocesodefiltrado.

3.4.3.4 EspesamientodeRelavesdeEscoria

Los relaves finales, con aproximadamente 50% de slidos, se bombearn a un Espesador de


Relaves, de 10 m de dimetro, donde se agrega floculante SNF a una tasa de consumo 15 g/T
(provenientedeunestanquedepreparacincomnparaelespesamientodeconcentrados),sin
perjuiciodequelatasadeconsumopudiesevariar,obien,estereactivopudieseserreemplazado
en etapas futuras, por otro de similares caractersticas. La Hoja de Datos de Seguridad del
productoseencuentraenelAnexo2.

El overflow de agua clara se enviar al estanque de aguas de procesos adyacente, el cual


corresponde al mismo indicado en el punto anterior. El underflow de relaves espesados, con
aproximadamente60%deslidos,irafiltracin.

CODELCOChile

Pgina 21 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

3.4.3.5 FiltradodeConcentrado

El underflow de concentrados espesados se bombear a un filtro de presin de placas


horizontales.Elaguafiltradaserretornadaalespesadordeconcentrado,ylosconcentradosde
escoria filtrados, con 8 a 10% de humedad, se transportarn mediante una correa a una tolva
elevada. sta cargar camiones tolva de 25 [ton], con el fin de retornar los concentrados de
escoria a la Fundicin, dejndolos en una tolva de almacenamiento nueva, ubicada en las
cercanas de los silos de concentrados actualmente existentes, hacia donde sern alimentados
medianteunacorrea.
3.4.3.6 FiltradodeRelaves

Elunderflowderelavesespesadossebombearaunestanquepulmnde4mdedimetro,con
una capacidad aproximada de 50 m3, de donde se alimentarn tres filtros de vaco de bandas
horizontales,cadaunode54m2desuperficiefiltrable.Elaguafiltradaserretornadaalestanque
espesador de relaves, y los relaves filtrados, con un promedio de 12% de humedad, sern
transportadospormediodeuncarrotripperydeunacorrealateralde12m,tipostacker,hastala
QuebradaAfluenteparasudepositacin.
3.4.3.7 FusindeConcentradosdeEscoriaenlaNaveFundicin
Elconcentradodeescoriasprovenientesdelprocesodeflotacin,sertrasladadodesdelaplanta
defiltrosproyectada,encamionesencarpadoshacialaplantaderecepcinymezclaactual.

Esteconcentradoconhumedadde8%,seralmacenadoenunsilodedicadoparaestacorriente.

En la mezcla de concentrados para la fusin en el Convertidor Teniente, se adicionar en una


proporcin de hasta un 15% respecto de la mezcla regular. La mezcla de concentrados ser
conducidahacialaPlantadeSecado,luegodelocualserenviadoasilosdeconcentradossecos
delConvertidorTeniente.

Finalmente,lamezcladeconcentradosseinyectaparaserfundidoatravsdetoberasalreactor
ConvertidorTeniente,pasandoposteriormenteportodaslasetapasdelaFundicin.

3.4.4 DepsitodeRelavesFiltrados
LosrelavesgeneradosenlaPlantadeFlotacinrequerirndelemplazamientodeundepsitoque
permitasualmacenamientoenformasegurayestable,tantoparalaetapadeoperacincomola
decierredelmismo.

Como se mencion anteriormente, el depsito de relaves indicado en el presente documento,


tieneunacapacidadquepermitesufuncionamientopor5aos.

BasadoenelactualdiseodelaPlantadeTratamiento,sehaestimadounaproduccinnominal
derelavesde1.173t/da(400.000t/ao).

CODELCOChile

Pgina 22 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

3.4.4.1 DepsitodeRelavesenQuebradaAfluente
Este sitio corresponde a una quebrada natural ubicada a unos 200 m al Oeste de la Planta de
TratamientodeEscoria.Poseeunapendientedefondodel12,5%,conunlargomediode500my
un ancho de 145 m, y pendientes transversales de terreno ligeramente pronunciadas, del orden
del25%.

Estesitiopermiteladepositacinde950.000m3derelaves(1.900.000tderelavessecos),locual
se logra perfilando (excavando) la superficie del terreno para maximizar su capacidad, lo que
adems permite obtener material para la construccin de los distintos rellenos y coberturas. Se
considerarealizarescarpeoperfilamientosdelfondoylasladerasdelaquebrada,equivalentea
excavar75.000m3.
ElritmodedepositacinsehaestimadoconsiderandoquelaPlantadeFlotacinoperar24horas
al da y 340das por ao, lo que equivale a producir del orden de 398.820 toneladas de relaves
secosporao(1.173toneladassecasporda),porloquesuvidatildeoperacinesde5aos.

Para la depositacin y el manejo de estos relaves, al poseer una mnima humedad, sern
manejadosydepositadosensuperficieatravsdeequiposmecanizados.

LaubicacingeneraldeldepsitoseencuentraenelplanoA1E40024000GR001,yladisposicin
en planta de los relaves se encuentra en el plano A1E40024000GR002, ambos adjuntos en el
Anexo1.
3.4.4.2 EtapasdeConstruccinDepsitodeRelavesFiltradosQuebradaAfluente
Lasetapasdeconstruccindeldepsitoderelavesfiltradossedividenendos,siendo:(i)etapade
construccin de obras y/o estructuras iniciales, y (ii) etapa de construccin y/o operacin de la
colocacindelosrelavesfiltrados.
I.

EtapadeConstruccindeObrasy/oEstructurasIniciales
Estasobrascorrespondenalasrequeridasporeldepsitoderelavesfiltrados,lascualesse
requieren para garantizar el almacenamiento tanto en cantidad (toneladas) y seguridad
(estabilidad)delapiladerelaves.Lasobrasconsideradascorrespondena:

o Escarpe y/o perfilamiento (excavacin) de la base de la cubeta del depsito, por


unvolumentotalde75.000m3.
o Disposicintemporaldelmaterialexcavadoenlapartesuperiordelaquebrada
o Sistemadedrenajebasal,emplazadoporelfondodelaquebrada
o Sentinaderecoleccindefiltraciones
o Murodecontencin
o Canalesperimetrales

CODELCOChile

Pgina 23 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

II.

EtapadeConstrucciny/oOperacin
La etapa corresponde a la construccin propiamente tal de la pila del depsito de
relavesfiltrados,laconsideralassiguientesfaenas:

o Descargaderelavesdesdeelsistemamecanizado(correas)
o Esparcidoderelaves,atravsdeequipomecanizado(bulldozer)
o Etapadeoreoderelaves
o Compactacindelosrelavesporcapas,atravsdeequipomecanizado(bulldozer
yrodillo)
o Colocacindecoberturagranular

3.4.4.3 DescripcindelaObras

Escarpey/operfilamiento

Consideraelescarpedelaszonasdesuelosnoaptosparalacolocacindelrelavefiltrado.
Ademsseexcavaroperfilarelfondodelaquebradaenunanchode30myunlargode
480m,conelobjetodedefinircanchasparaladepositacinycompactacindelrelave.El
material obtenido de este perfilamiento, de un volumen total de 75.000 m3, ser
depositadoenunbotaderotransitorioenlapartealtadelaquebrada.ElplanoA1E40024
000GR102 adjunto en el Anexo 1, muestra el detalle del tratamiento de fundacin y
perfiladodelaQuebrada.

Depositacintemporaldelmaterialexcavado

Elmaterialexcavadodelperfilamientodelaquebradaseracopiadoenunbotaderode2
nivelesde10mdealtocadauno,conunabermaintermediade5m,enlapartealtadela
quebrada. Este material se utilizar para la construccin de las distintas obras que
requieran material de relleno, as como para la cobertura de los distintos niveles del
depsito de relaves. El plano A1E40024000GR107 adjunto en el Anexo 1, seala la
ubicacindeldepsitotemporaldelmaterialexcavado.

Sistemadedrenajebasal
Unavezperfiladoelfondodelaquebradaseconsideralaconstruccindeundrenbasalde
dimensionesde5x1.6m,elcualestcompuestounazonadematerialdrenantede1mde
espesor, el cual corresponde a gravas de tamao medio de 4, y dos materiales de
transicinde0,3mcadaunodeespesor.Laprimeracapadeestematerialdetransicin
corresponde a una arena media a gruesa con tamao mximo de 3/8, mientras que la
segundacapacorrespondeaunagravaarenosadetamaomximode1.

Estedrenrecorretodoelfondodelaquebradaypasabajoelmurodecontencin.Aguas
abajodeestemuroseubicaelmurodetrminodedren,elcualesunmurodehormign
armadoquecumplelafuncindeencauzarlasposiblesfiltracionesqueconduzcaeldrena
unaparedconbarbacanaslascualesdrenanaunazanjacolectoraquepormediodeuna
tubera de HDPE de dimetro 200mm PECC100PN6 conduce las aguas a la sentina de

CODELCOChile

Pgina 24 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

recoleccindefiltraciones.ElplanoA1E40024000GR103adjuntoenelAnexo1,seala
eldiseodelsistemadedrenaje.

Sentinaderecoleccindefiltraciones

Seubicaaguasabajodelmurodecontencin,yseconectaalmurodetrminodedrenpor
mediodeunatuberadeHDPEdedimetro200mmPECC100PN6.Estasentinatieneuna
dimensin superior de 10 m x 10 m, con una profundidad de 1,5 m y taludes 2:1 (h:v).
Adems,cuentaconunrecubrimientode geotextil ygeomembrana,elcual estfijadoa
unazanjadeanclajeperimetralalasentinade0,70mx0,70m.ElplanoA1E40024000
GR105adjuntoenelAnexo1,sealaeldiseodelasentinaderecoleccindefiltraciones.

Murodecontencin

Seemplazainmediatamenteaguasabajodeldepsitoderelavesfiltrados,ycorrespondea
un muro de emprstito de 5 m de altura, coronamiento de 5 m y taludes 2:1 (h:v),
construido con material de obtenido de la excavacin y/o perfilamiento del depsito,
bsicamentecompuestoporgravasarenosasdetamaomximo1ydeunmaterialde
transicinenlacaraaguasarribadelmurode3.0mdeespesor,conelobjetodedaruna
superficieaptaparalacolocacindelaimpermeabilizacindeltalud,quecorrespondea
ungeotextilde300gr/m2yunageomembranade1,5mmdeespesor.ElplanoA1E40024
000GR104adjuntoenelAnexo1,sealaeldiseodelmurodecontencinocierre.

Canalperimetral
El depsito comprende la construccin de un canal perimetral en la ladera Este, de una
extensin de 580 m, el cual captar y conducir las aguas lluvias para finalmente
descargarlas aguas abajo del depsito. En los primero 490 m este canal se construir
mediantelosetasprefabricadasyunradierdefondo,mientrasqueelsegundotramodel
canalconsideralacolocacindeunatuberacorrugadatipomediacaa,deundimetro
de500mm.Altrminodeestesegundotramo,seconstruirundisipadorquecomprende
unmachndeanclajedeltubocorrugadoyuntramorevestidodemamposterade0,30
mdeespesor.

Elcanalperimetralsehadiseadoparaconducirunalluviadeperiododeretornode100
aos,equivalentea30l/s.ElplanoA1E40024000GR106adjuntoenelAnexo1,seala
eldiseodelcanaldecontorno.

3.4.4.4 MtodoConstructivo
Para la depositacin y colocacin segura y estable de los relaves, se ha considerado un mtodo
constructivoquesebasaentresetapas,siendostas:

1. Etapadedescargaderelaves:Correspondeadescargadelosrelavesfiltradosatravsde
un sistema de correas transportadoras. Dado que el sistema de descarga (correas) es
mvil,ladescargadelosrelavesserealizarendiferentespuntosdeldepsito,estopara
facilitarlafaenay/oetapadeesparcidodematerial.

CODELCOChile

Pgina 25 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

2. Etapa de desplazamientoy esparcido de relaves: Corresponde al desplazamiento de los


relavesdesdeelpuntodedescargahastalazonaemplazamientodefinitivodestos,para
luegoseresparcidosenunreadeterminada.Paraestafaenaserequerirndosequipos
conunacapacidadmnimade225m3/hora.
3. Etapa de compactacin de relaves: Para lograr la densidad de 2 t/m3 se ha definido un
espesordecapade20cm,unmnimode3pasadasyunequipoconrodillolisovibratorio
depesoestticomnimo10t.
4. Coberturaparalaspilasderelaves:Unavezquecadaunadelaspilasderelavesvayan
siendoterminadas(7entotal),seconsideralacolocacindeunacoberturade30cmde
espesor, compuesta bsicamente por el material obtenido de la excavacin y/o
perfilamiento del depsito. Este material corresponde a gravas arenosas con un tamao
mximode1,yconcontenidodefinosquenosupereel15%.
LosplanosA1E40024000GR108,A1E40024000GR109yA1E40024000GR110,adjuntosen
elAnexo1delaDIA,presentanelcrecimientodeldepsitodurantesuvidatil.
3.4.4.5 DimensionesdelDepsito

La altura mxima de la pila de relaves, esto para su ltima etapa es de 70 m, dado que estar
formadapor7nivelesdedepositacinderelavesde10mdealturacadauno.

3.4.4.6 ParmetrosGeotcnicos
Losparmetrosgeotcnicoslosprincipalesmateriales(suelosyrellenos)presentesenelproyecto
deldepsitoderelavesfiltradosson:

I. Suelodefundacin
LainformacingeotcnicadelsitioQuebradaAfluenteindicaqueelsubsueloestcompuestopor
mezclasdegravaslimosasyarenaslimosas,concompacidadmediaaaltaapartirdelos0,8mde
profundidad. Las partculas presentan cantos angulosos y tamao mximo de 10, con un
contenidodefinoslimososaproximadode20%yuncontenidodehumedaddel7%.

Laspropiedadesdeestosmaterialesson:

CODELCOChile

Pgina 26 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Tabla8.Propiedadesgeotcnicasdelsuelodefundacin

PropiedadesGeotcnicasdelSuelodeFundacin
Densidadnaturalseca
Contenidodehumedadnaturaldelsuelo
Densidadnaturalhmeda

1,65

7%
1

Cohesin

1,76
0

35

ngulodefriccininterna

II. MaterialdeRelave
Corresponde a un material fino y seco para el cual se estiman los siguientes parmetros
geotcnicos:

Tabla9.Propiedadesgeotcnicasdelmaterialderelavesfiltrados

PropiedadesGeotcnicasdelMaterialdeRelave
Densidadnaturalseca
Cohesin

1,5

30

ngulodefriccininterna

III. MaterialdelBotaderoTemporaldelaExcavacin
Las arenas limosas y gravas limosas sern removidas del sitio y trasladadas hasta la zona de
acopio,dondeserndepositadasporvolteoycompactadasporpasadasdecamin.Seestimaque
enetascondicioneselmaterialquedarcondensidadesmediasabajasysereducirsucontenido
dehumedad.

Conservadoramenteseasumieronlassiguientespropiedadesdelmaterialdelbotadero:
Tabla10.Propiedadesgeotcnicasdelmaterialdelbotadero

PropiedadesGeotcnicasdelMaterialdelBotadero
Densidadnaturalseca
1,50
Contenidodehumedadnaturaldelsuelo
Densidadnaturalhmeda
Cohesin
ngulodefriccininterna

CODELCOChile

3%
1

1,69
0

34

Pgina 27 de 111

DIA Fllotacin de Escorias Convertid


dor Teniente Fun
ndicin Potrerilllos
CO
ODELCO Chile Divisin Salvad
dor

3.4.4.7
7 SismodeDiseo
Elsitiodeemplazam
mientodelassinstalacionesseencuentrraubicadoen
nlaZonaSsm
mica2,segnse
estableeceenlasnormasNCh236
69Of.2003yN
NCh433Of96,correspondieentesalanormativavigen
nte
dediseeossmicod
deestructuraseinstalacio
onesindustriaales,ydeedifficios,respecttivamente.Essta
zonap
presentauna sismicidadmedia,medidaaentrminosscualitativos,,ysedefineu
unaaceleraciin
efectivvamximadelsuelo(A0)de0.30g.

En estaa etapa del proyecto,


p
pod
dr consideraarse que estaa aceleracin
n correspondee al valor dee la
aceleraacin mxima del sismo de diseo para la etap
pa de operacin de los tranques, y el
coeficiente pseudoesttico equivalente podr determinaarse como 2//3 de dicha aceleracin, es
0.2g.
decir,0

3.4.4.8
8 EstabilidadPiladeRellaves
ElanlisisdeestabilidaddelaPiladeRelavessfuerealizadoutilizandou
unaseccintransversaldeela
siguien
ntegeometraa:

Imagen7.G
Geometrautilizadaparaelanlisisdeestabilidad

El estudiosere
ealizmedian
nteelprogram
maSlidedeR
Rocsciencedo
ondeseanalizztantolafaalla
circular global como
c
la de bloque
b
global mediante el mtodo Speencer. Las caargas y criterios
consideradosfu
ueronlassigu
uientes:
I.

Cargaesttica(vertical)obtenidaapaartirdelpeso
oespecficodeelmaterial.

II.

Cargassmica:Sesimulaaronlascargaasssmicasmedianteunanlisispseudoesttico.Esste
anlisis con
nsiste en la aplicacin de fuerzas ho
orizontales a la masa dee deslizamien
nto
potencial laas cuales rep
presentan las fuerzas inerrciales durantte un evento
o ssmico. Esttas
fuerzas, pro
oporcionales a la masa en
e deslizamieento, se defin
nen a partir de coeficienttes
ssmicos(KH).

III.

Lanapafreticaseencuentraausentee.

IV.

Criteriosde
eAceptacin:

CODELCO
OChile

P
gina 28 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Tabla11.Criteriodeaceptacin
CONDICIN

FACTORDE
SEGURIDAD(FS)

COEFICIENTESSMICO
(*)HORIZONTAL(KH)

ESTTICO

1,3

0,0

SISMOENOPERACIN

1,1

0,2

Resultadosobtenidos:
DeacuerdoalmtodoSpencer,tantoparaelcasopseudoestticoconunKH=0.2como
para el caso esttico, se obtuvieron los siguientes valores para el Factor de Seguridad
(FoS):

Tabla12.FactoresdeSeguridadobtenidosmedianteelmtodoSpencer

CONDICIN
PseudoestticoKH=0.2
EstticoKH=0

FACTORDESEGURIDAD
FALLACIRCULARGLOBAL
FALLAGLOBALENBLOQUE
1,04
1,05
1,8

1,7

De lo indicado anteriormente se concluye que la pila de relaves es estable, considerando los


parmetrosgeotcnicosdefinidosyuntaluddeconstruccindelapilade2,5H:1V.

3.4.4.9DepsitoTemporaldelMaterialExcavado
Elbotaderoestarconformadopor75.000m3desueloprovenientedelescarpey/operfilamiento
delsitio1.Seubicarenlamismaquebradadelsitio1,lacualposeeunapendientedefondode
12.5%.Elbotaderoseproyectaconunaalturamximade20m,con2bancosde10mdealturay
unabermaintermediade5m.Eltaludconsideradoparacadabancoesde2H:1V.

ElanlisisdeestabilidaddelBotaderodeMaterialexcavadofuerealizadoutilizandounaseccin
transversaldelasiguientegeometra:

Imagen8.Geometraanalizada.

CODELCOChile

Pgina 29 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

El estudio se realiz mediante el programa Slide de Rocscience donde se analiz tanto la global
comolalocalenbasea2modosdefalla:circularyenbloque.Lascargasycriteriosconsiderados
fueronlossiguientes:

I.
Cargas Estticas: Corresponde a la sobrecarga vertical producto del peso propio de los
materiales.
II.
CargasSsmicas:Sesimularonlascargasssmicasmedianteunanlisispseudoesttico.
III.
Elanlisisdeestabilidadaserealizconsiderandounvalordelcoeficientedeaceleracin
pseudoestticahorizontalequivalentea2/3delaAceleracinmxima(0.3g).
IV.
NapaFreticaausente.
V.
CriteriosdeAceptacin:

Tabla13.Criteriosdeaceptacin

CONDICIN

FACTORDE
SEGURIDAD(FS)

COEFICIENTESSMICO
(*)HORIZONTAL(KH)

ESTTICO

1,3

0,0

SISMOENOPERACIN

1,1

0,2

Resultadosobtenidos
CasoPseudoEsttico:DeacuerdoalmtodoSpencer,paraelcasopseudoestticoconun
KH=0.2seobtuvieronlossiguientesvaloresparaelfactordeSeguridad(FoS):
Tabla14.FactoresdeSeguridadobtenidosmedianteelmtodoSpencer
paraelcasoPseudoesttico
CASO
PSEUDOESTTICO
GLOBAL
LOCALBANCO
SUPERIOR
LOCALBANCOINFERIOR

FACTORDESEGURIDAD
FALLACIRCULAR
1,05
1,16

FALLAENBLOQUE
1,06

1,07

1,06

CasoEsttico:DeacuerdoalmtodoSpencer,paraelcasoestticoconunKH=0se
obtuvieronlossiguientesvaloresparaelfactordeSeguridad(FoS):

CODELCOChile

Pgina 30 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Tabla15.FactoresdeSeguridadobtenidosmedianteelmtodo
SpencerparaelcasoEsttico

CASO
ESTTICO

FACTORDESEGURIDAD

GLOBAL
LOCALBANCO
SUPERIOR
LOCALBANCOINFERIOR

FALLACIRCULAR
1,68
1,84

FALLAENBLOQUE
1,66

1,64

1,60

Deacuerdoaloindicadoanteriormente,seconcluyequeelbotaderoesestable,considerandolos
parmetrosgeotcnicosyuntaluddeconstruccindelosbancosdelbotaderode2H:1V.

3.4.4.10CaracterizacindelosRelavesyPotencialDrenajecidodeRoca
Mediantelaejecucindeunapruebapilotodeescoriaenfriadaenollaconusodeaguaindustrial,
se obtuvo a travs de ensayos de laboratorio una muestra de relave generado a partir de este
material.Elrelavegeneradoapartirdeltestdeflotacina80%325#,fueanalizadomediantelos
test ABA (Balance cidoBase) y NAG (Generacin de cido Neta) a fin de analizar su capacidad
comopotencialgeneradordedrenajescidos.

LosresultadosdelaevaluacindeltestABAsemuestranenlossiguientescuadros:

Identificacin
dela
Muestra
Normal
(original)
Normal
(repeticin1)
Normal
(repeticin2)
Normal
(repeticin3)

Tabla16.ResultadosdelTestABA(originalyrepeticiones).

S
SO4=
SSO4=
Sulfuro
KgCaCO3 equiv/tonmaterial
%
%
%
calculado
%
PN
PA
PNN
PN/PA
0,14
0,02
0,007
0,133
4,006
4,166
0,161
0,961
0,15

0,02

0,007

0,143

0,604

4,479

3,874

0,135

0,15

0,02

0,007

0,143

4,353

4,479

0,126

0,972

0,15

0,02

0,007

0,143

3,116

4,479

1,363

0,696

Fuente:Informederesultadosdepruebasmetalrgicas,CIMMT&S(Anexo4).

De acuerdo a estos resultados y el criterio de interpretacin del test ABA indicado en el cuadro
siguiente:

CODELCOChile

Pgina 31 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Tabla17.CriteriosdeinterpretacindetestABA.

PotencialRepresentado
CriteriodeInterpretacin
BajooNuloPotencialdeGeneracindecido
PNN>20yPN/PA>3
PotencialMarginaldeGeneracindecido
PNN<20y1<PN/PA<3
AltoPotencialdeGeneracindecido
PNN<0yPN/PA<1

SeinterpretaquelamuestraderelavedeescoriapresentaunAltoPotencialdeGeneracincida
alestarsujetaaunadisolucintotal(condicinextrema).
En base a este resultado, se realiz el test NAG, que permite cuantificar el potencial neto de
generacindecido,siendoeltestABAslocualitativo.ElresultadodelTestNAGindicquela
generacincidaesmuybajaocasinula,puestoqueelrelavecontendrasuficienteconcentracin
deelementosneutralizadoresparacontrarrestarlo.Paraquesepuedacuantificarunaapreciable
generacindeefluentescidosexpresadoscomokgdecidoportoneladadematerial(relave),el
pH resultante de este efluente debiera ser inferior a 4,5 pero todas las mediciones arrojaron
resultadosentre6y7.

Muestra

Masa
(g)

RelaveT5
RelaveT5
RelaveT5
RelaveT5
RelaveT5

2,51
2,55
2,56
1,15
1,06

Tabla18.ResultadosTestNAG(quintuplicado)

Vol.H2O2
pH
Molaridad
Vol.Sol.
15%V/V
resultante
NaOH
NaOH
(ml)
(ml)
250
7,02

250
7,04

250
6,15

250
6,94

250
6,94

NAG;kg
H2SO4/ton

Fuente:Informederesultadosdepruebasmetalrgicas,CIMMT&S(Anexo4).

Adems de lo anterior, se debe tener presente las caractersticas climticas de la zona de


emplazamiento del Proyecto, la cual, de acuerdo a la clasificacin de Kppen, est catalogada
como clima desrtico fro (BWk), con 44 mm de precipitacin anual promedio1. Lo anterior,
sumado a las obras de contencin y desvo de agua lluvias, disminuye las probabilidades de
generacindedrenajescidosylamovilidaddecontaminantesdesdeelrelavedeescorias,porser
escasalaprobableinteraccindelmaterialconagua.

Cabesealarquelaescoriasometidaalaspruebasdelaboratoriofueenfriadaenunaollaconuso
deaguaindustrial.

LoscertificadosdelosanlisisABAyNAGseencuentranenelAnexo4.

Estudio de Clima para la Divisin Salvador, Pontificia Universidad Catlica de Chile Fundacin Chile,
2008.

CODELCOChile

Pgina 32 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

3.4.4.11Movilidaddecontaminantes

Paraelenfriamientodelaescoriaenollas,seemplearaguaresidualdeprocesosdeenfriamiento
delasoperacionesdelaPlantadeOxgenoyPlantasdeAgua,queactualmentesonutilizadaspara
elenfriamientodeescoriaenbotadero(circuitocerrado).Asimismo,paraelprocesodeflotacin,
se utilizar agua industrial proveniente del estanque La Ola que abastece los procesos de
Potrerillos. Una caracterizacin del agua de enfriamiento y del agua industrial se muestra a
continuacin:

Tabla19.Caracterizacindelaguaautilizarparaelenfriamientodeescorias.

CODELCOChile

Elementos

Smbolo

Unidad

Aguaresidualde
enfriamiento

Aguaindustrial

Plata

Ag

mg/L

<0,000050

0,0013

Aluminio

Al

mg/L

0,0524

0,435

Arsnico

As

mg/L

1,42

1,04

Boro

mg/L

15,9

7,78

Bario

Ba

mg/L

0,624

33,5

Berilio

Be

mg/L

<0,0025

<0,0025

Bismuto

Bi

mg/L

<0,0025

<0,0025

Calcio

Ca

mg/L

329

151

Cadmio

Cd

mg/L

0,00048

0,00056

Cobalto

Co

mg/L

<0,00050

<0,00050

Cromo

Cr

mg/L

<0,0025

0,0029

Cobre

Cu

mg/L

0,33

2,25

Hierro

Fe

mg/L

0,69

7,16

Potasio

mg/L

100

39,9

Litio

Li

mg/L

5,33

2,63

Magnesio

Mg

mg/L

85,4

35,5

Manganeso

Mn

mg/L

0,0274

0,181

Molibdeno

Mo

mg/L

0,0287

0,0143

Sodio

Na

mg/L

>800

535

Nquel

Ni

mg/L

0,0028

<0,0025

Fsforo

mg/L

2,37

1,56

Plomo

Pb

mg/L

0,00342

0,0148

Antimonio

Sb

mg/L

0,0075

0,0071

Selenio

Se

mg/L

0,0163

0,0113

Silicio

Si

mg/L

65,5

35,6

Estao

Sn

mg/L

<0,00050

<0,00050

Estroncio

Sr

mg/L

4,55

2,92

Titanio

Ti

mg/L

<0,010

<0,010

Pgina 33 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Talio

Tl

mg/L

<0,00050

<0,00050

Uranio

mg/L

0,00147

0,000965

Vanadio

mg/L

0,0566

0,039

Zinc

Zn

mg/L

0,12

0,124

Mercurio

Hg

mg/L

< 0,00005

<0,00005

Cloruro

Cl

mg/L

2319

1010

Sulfato

SO4

mg/L

720

176

mg/L
CaCO3
mg/L
CaCO3

169

96

17

Alcalinidad
Bicarbonato
AlcalinidadCarbonato

Tanto el agua industrial del estanque La Ola como el agua residual de procesos, sobrepasan los
lmitesestablecidosenelDSN90referidoalatablaN1,paraloselementosAs,B,Se,ClyNa.
Esta norma est siendo utilizada como referencia para comparacin de lmites permitidos, dado
queparaelcasodelaguaindustrial,estaaguacorrespondeaaguadeingresoalproceso,yparael
casodelasaguasresidualessernreutilizadasenelprocesodeenfriamientodeescoriaenollas,
dondeunaparteseevaporaryotraparteserrecirculada,constituyendouncircuitocerrado,no
generndoseladescargadeRiles.

Paradeterminarelefectodelautilizacindeestaaguasobreelrelavefinalresultantedelproceso
de Flotacin, se efectu una prueba a nivel de laboratorio, generando relave a partir de las
escorias a tratar. La obtencin de estas escorias fue a travs de una prueba a escala de
enfriamientocontroladoenollas,conutilizacindeestaaguadeenfriamientoyaguaindustrial.

A la muestra de relaves generada, se le realizaron los test ABA y NAG, cuyos resultados se
presentanenelpuntoanterior,yademsselerealizelensayoSPLP(LixiviacinporPrecipitacin
Sinttica),paradeterminarlamovilidaddeloscontaminantespresentes,suniveldetoxicidadysu
relacin con los valores regulados por el DS N 148, Reglamento Sanitario Sobre Manejo de
ResiduosPeligrosos.

LosresultadosdeltestSPLPsepresentanenlasiguientetabla:
Tabla20.ResultadosdelTestSPLP

Identificacin de
laMuestra
Normal
Valor regulado
porlaEPA[mg/l]

As
[mg/l]
<0,5
5,0

Pb
[mg/l]
<0,2
5,0

Se
[mg/l]
<0,5
1,00

Ba
[mg/l]
<0,5
100

Cd
[mg/l]
<0,005
1,0

Cr
[mg/l]
0,05
5,0

Hg
[mg/l]
<0,001
0,2

Ag
[mg/l]
<0,02
5,0

Fuente:Informederesultadosdepruebasmetalrgicas,CIMMT&S(Anexo4).

CODELCOChile

Pgina 34 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

LaaplicacindelTestSPLPentregcomoresultadounlixiviado con contenidodeloselementos


inorgnicosregulados,menoresalosnivelesmximosfijadosenelDSN148/03,delMinisteriode
Salud(valoresgeneralmentemenoresaun10%dellmitedelanorma).

Enconsecuencia,lamuestraNopresentacaractersticadepeligrosidadsegnelprocedimientode
LixiviacinporPrecipitacinSinttica,presentandounaescasamovilidaddecontaminantes,yno
constituyendounresiduopeligroso.

ElinformedelaboratorioconlosresultadosdeaplicacindeltestSPLPseencuentraenelAnexo
4.

3.5

DescripcindelaEtapadeCierredelProyecto

ParaelcierredelProyecto,sehanconsideradolassiguientesobras,quevandelamanoconlas
obras de cierre que DSAL ha estudiado para sus actuales operaciones (Resolucin N 1514 del
SERNAGEOMINdel1dejuniode2011,adjuntaenelAnexo5).

Desmantelamientodeinstalaciones,edificios,equiposymaquinaria

Se considera el desmantelamiento y retiro de instalaciones, edificios, equipos, estanques y


maquinaria de forma de dejar el rea libre. Adems se demoler todas las estructuras
superficiales.

Losequiposymaquinariasexistentesalcesedelasoperacionessernclasificadosparasuposible
enajenacin,trasladoaotrasfaenasodisposicinfinalenlugaresautorizados.

Desenergizadodeinstalaciones

Previo al desmantelamiento se desenergizar todas las instalaciones retirando tendidos


elctricos,lneasdealimentacinypostacin,pueselreanotendrunusopblicoposterioryno
habrnestructurasremanentes.

CierredeaccesosySealizaciones
En consideracin que el rea quedar libre de estructuras e instalaciones y las estructuras
remanentes (fundaciones) quedarn cubiertas, slo se considera el bloqueo de caminos de
accesos al rea con pretil con zanja y la instalacin de seales en el permetro y entrada de
caminoscerrados,advirtiendodelosriesgosdeentraralrea.

Estabilizacindetaludes

Engeneralnosernecesariorealizargrandesmovimientosdetierrasparaellevantamientodelas
instalaciones,porloqueseprevquenoserequerirestabilizarlos.

Retirodematerialesyrepuestos

CODELCOChile

Pgina 35 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Todos los materiales y repuestos existentes, sern retirados y clasificados para su posible
enajenacin,trasladoaotrasfaenasodisposicinfinalenlugaresautorizados.

Proteccindeestructurasremanentes

Serealizarunaevaluacinderiesgos,mediantelacualsedeterminarntodaslasestructurasque
presenteriesgosalaspersonas,lasqueserndemolidasocubiertas.

DepsitodeRelavesFiltradoQuebradaAfluente

Paraelcierredeldepsitoderelaves,sehaconsideradoelcierrepaulatinoaplicableacadaunode
lossietenivelesdelapiladerelaves,atravsdelaimplementacindeunacoberturadematerial
granular, proveniente del escarpe de la Quebrada Afluente en la etapa de construccin del
depsito.

Estacoberturagranularserdispuestaencapasde30cmdealtoenlasuperficiedecadaunade
laspilasalfinalizarsuvidatil.Enlossectoresdetaluddecadapila,lacoberturaalcanzarlos3m
deancho,afindequeseaestable.

Semantendrnloscanalesperimetralesydecontornodeldepsitoparalaetapadecierre,afin
dedesviarelcursodeaguaslluviasprovenientesdelahoyahidrogrfica.

RespectodelosCaminos
Alcesedeoperaciones,seevaluarnloscaminosquesedejarntransitablesyaseaparacontrol
de la etapa de cierre o para estudios posteriores, y los caminos que deben ser cerrados. Los
caminos que no se requiera utilizar en forma posterior, sern cerrados mediante una barrera
compuestaporunazanjaconpretil.
Conelobjetivodedesincentivarelaccesoalazona,secolocarnletrerosdeadvertencia(accesos
restringidos, peligro de derrumbes, etc.), los que se ubicarn al comienzo de los caminos que
quedarnhabilitados(portones).
Nosecontemplanmedidasespecialesdeperfilamientodeloscaminosqueserncerrados.

Todas las medidas de cierre contempladas para el presente Proyecto, sern incorporadas en el
plan de cierre de Divisin Salvador, por lo cual se aplicarn los procedimientos y estndares
contenidosenl.

3.6 InstalacindeFaenas

ParadarinicioalasobrasdelProyectoserequiereinstalacindefaenaenelreaindustrial.

Enestaetapa,seutilizarnlosservicioshiginicoseinstalacionesdeaguapotableexistentesenel
rea, ubicados a menos de 75 m de la faena de construccin. En caso contrario, se instalarn
baos qumicos que sean necesarios, cuyos residuos sern retirados por una empresa
debidamenteautorizada,locualserexigidocontractualmente.

CODELCOChile

Pgina 36 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

El personal de las empresas contratistas que participen en la construccin, se alimentar en el


comedordefaenadePotrerillos.Elalojamientodelpersonalserpreferentementeenlalocalidad
deDiegodeAlmagro.

3.7
MovimientosdeTierra
Enelreadeenfriamientodeollas,seproyectantresplataformas.Endosdeellasseconstruirn
losas de hormign que soportarn las ollas de enfriamiento. La plataforma 3, necesaria para
maniobradecamiones,seubicarenelcostadoponientedelaplataforma1.Enestareasobrela
cual se proyectan las plataformas, el movimiento de tierra corresponde slo a corte, cuya
profundidadserde1.5m.

Laplataformaprincipalsobrelacualseconstruirnlasinstalacionesdelaplantadeflotacinde
escoria, se emplazar en el sector norponiente de la Fundicin Potrerillos, y requerir de la
ejecucindecorteyrelleno.

Como se indic en el punto 3.4.4.1, para el depsito de relaves filtrados, se realizar una
excavacin o perfilamiento equivalente a 75.000 m3 de material proveniente de la Quebrada
Afluente.Lasiguientetablamuestralascubicacionesdelmovimientodetierrasarealizar:
Tabla21.ResumendeCubicacionesdemovimientosdetierra.
rea

tem

Enfriamiento
deOllas

1.

PreparacindelreadeTrabajo

1.1

DespejeyLimpiezadelaFaja

2.

MovimientodeTierra

2.1
2.2
Plantade
1
Tratamiento
1.1
2
2.1
2.2
2.3
2.4
2.5
3
3.1
Depsitode
1.
Relaves
1.1
Filtrados
1.2
1.3
1.4
1.5
1.6

CODELCOChile

Descripcin

ExcavacinCorteT.C.N.
PreparacindelaSubrasante
PreparacindelreadeTrabajo
DespejeyLimpiezadelaFaja
MovimientodeTierra
Escarpe
ExcavacindeCorteT.C.N.
ExcavacinenRoca
Terrapln
PreparacindelaSubrasante
ElementosdeControlySeguridad
BarrerasSimplesdeHormign
MovimientodeTierra
Excavacinreacubeta
Excavacinzanjadrenbasal
Excavacinpiscina
Excavacinzanjadeanclaje
Excavacinsistemadrenajemurode
trmino
Excavacinzanjacanaldecontorno

Unidad

Cantidad

ha

0.34

m3
m3

m3
m3
m3
m3
m3

13,135
6,447

1.93

4,615
30,525
1,500
55,280
13,395

115

75.000
3.820
9.910
2.205
40

m3

400

ha
m3
m3
m3
m3
m2
m

Pgina 37 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Los materiales granulares provenientes de las excavaciones, podrn utilizarse como rellenos de
terrapln,previamenteseleccionadosyseparadosdetodomaterialinadecuado.

3.8

Caminos

Seproyectan3caminosinterioresparadarconexinalasdistintasinstalacionesdelaplanta,con
unavelocidaddediseode30Km/hr.

El trazado de los caminos interiores se encuentra en el Plano M400640000121PLA007, del


Anexo1.
La tabla siguiente entrega las cubicaciones del movimiento de tierras para la habilitacin de los
caminosinteriores.

Tabla22.ResumendeCubicacionesparaCaminos
rea
Caminos
Interiores

ITEM

DESCRIPCIN
UNIDAD
PREPARACINDELREADETRABAJO

1.1

DespejeyLimpiezadelaFaja

MOVIMIENTODETIERRA

2.1
2.2
2.3
2.4
3
3.1
4
4.1
4.2

Escarpe
m3
ExcavacindeCorteT.C.N.
m3
Terrapln
m3
PreparacindelaSubrasante
m2
CAPASGRANULARES
BaseGranular
m3
ELEMENTOSDECONTROLYSEGURIDAD
SealizacinVerticalLateral
N
BarrerasSimplesdeHormign
m

Ha

CANTIDAD
0.46

1,893
308
5,182
3,295
826
7
552

ElProyectoenevaluacinnoconsideralamodificaciny/oimplementacindecaminosfueradel
reaindustrial.

3.9

MaterialesdeEmprstito

Elmaterialdeemprstitorequeridoparalaconstruccindehormigonesserobtenidodelugares
quecuentenconlarequeridaautorizacin,requirindose5400m3dehormign.

Como se indic en el punto 3.7, los materiales granulares provenientes de las excavaciones,
podrn utilizarse como rellenos de terrapln, previamente seleccionados y separados de todo
materialinadecuado.

CODELCOChile

Pgina 38 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Los volmenes necesarios de material de emprstito por reas y finales se muestran en la


siguientetabla:
Tabla23.MaterialdeEmprstitoRequeridoporelProyecto
rea
Enfriamiento
deOllas
Plantade
Flotacin
Caminos
Internos
Depsitode
Relaves
TOTAL

Descripcin

Unidad

Cantidad

m3
m3
m3
m3
m3
m3

0
13.135
55.280
30.525
5.182
308
64.011
91.375
124.473
135.343
10.870

Terrapln
ExcavacinCorteT.C.N.
Terrapln
ExcavacinCorteT.C.N.
Terrapln
ExcavacinCorteT.C.N.
Rellenosycoberturas
ExcavacinCorteT.C.N.
Terrapln
ExcavacinCorteT.C.N.
Materialdeemprstitoproyecto

m3
m3
m3

3.10 Comedores

No se considera la instalacin de un comedor en el marco del Proyecto, dado que Divisin


Salvador cuenta con un comedor de faena en Potrerillos para otorgar alimentacin a los
trabajadoresquelaborarnenestafaenaindustrial.

3.11 OficinasySaladeControl
ElProyectoconsideralaimplementacindeunasaladecontrolparalaoperacindelaplantade
flotacin,laquecontarconunaoficinaparaelpersonal.SuubicacinseencuentraenelPlano
M400640000131PLA013delAnexo1.

3.12 ServiciosHiginicosySistemadeAlcantarillado
Para las etapas de construccin y cierre del proyecto, cada empresa contratista que participe
deberdisponerdebaosqumicossuficientesencantidad,deacuerdoalnmerodetrabajadores
que posea, as como deber surtir de agua potable para el uso del lavamanos. Se exigir
contractualmentequelosresiduosdelosbaosseanretiradosporempresascalificadas.

Para la etapa de operacin del Proyecto, y en consideracin al nmero de trabajadores que


laborarnenste,ascomoenlodispuestoenelD.S.N594,seinstalarn3baoscompuestos
por1WCyunlavamanos,enelprimerpisodelaplantadeflotacin,dondeseencuentralasala
de control general. Por otro lado, en atencin que los servicios higinicos, no pueden estar
instaladosamsde75metrosdedistanciadelreadetrabajo,sehadispuestolainstalacinde
dosbaosqumicosadicionales:UnoenelsectordeubicacindelTripperderelave,yotroenel
sectordeenfriamientodeollas.

CODELCOChile

Pgina 39 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Paraelcasodelosbaosinstaladosenlaplantadeflotacin,conelobjetodeoptimizarelusode
los recursos de agua disponibles en la Planta, para los Inodoros (WC) se emplear agua del tipo
industrial o de proceso, y para los lavamanos agua potable. La alimentacin de ambos tipos de
agua, se har mediante conexiones a los actuales sistemas de distribucin existentes en
Potrerillos.Respectoaladisposicindelasaguasservidas,siguiendoloadoptadoengeneralenla
Planta para pequeas instalaciones, se contempla un sistema basado en fosa sptica y pozo
absorbente.LasaguasquerecibelaFosaSpticasituadaenladenominadaPlataformaSanitaria,
luegodecumplireltiempoderetencinrecomendadoporlasnormassanitarias(24horas),pasar
alPozodeAbsorcin,dondeseinfiltrarenelterreno.EnelplanoM40064000121PLA010del
Anexo1,seentregaeldiseodelareddeaguasservidas.

EnelcasodelosbaosqumicosinstaladosenelsectordelTripperyelenfriamientodeescoria,
stos sern retirados por una empresa calificada, cuidando la disposicin de los residuos en un
lugar autorizado. Todo ello serrealizado a travs de un servicio externo, razn por la cual esta
exigenciaquedarestipuladacontractualmente.

ElProyectonorequierelaimplementacindeunareddealcantarillado.

3.13 CasasdeCambio
Como casas de cambio de los trabajadores que operarn la planta de flotacin y el depsito de
relaves filtrados, se utilizarn las mismas casas de cambio que actualmente se encuentran en
funcionamientoenlaFundicinRefinera.

3.14

Bodegas

ParaelpresenteProyecto,seconsideralahabilitacindedosbodegas:
I.
BodegaGeneral

Paraalmacenamientodematerialesyherramientasparaefectuarlamantencindelaplanta.

Considera el almacenamiento de pequeas cantidades de pinturas, aceites, grasas y lubricantes,


ascomodematerialesypiezasderepuesto.

Construccin de 60 m2 (10 m x 6 m). Ubicada al costado poniente del sector de Flotacin.


Construidaconmurosdealbailera,radierdeconcreto,conventilacin,quecuentaademscon
proteccincontraincendios.

Su localizacin se muestra en Plano M400640000131PLA001,Disposicin General


InstalacionesTratamientodeEscoria,adjuntoenelAnexo1.

II.
BodegadeReactivosdeFlotacin

CODELCOChile

Pgina 40 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Paraalmacenamientosemanaldelosreactivosautilizarenlaflotacin.

Construccin de 30.3 m2 (5.8 m x 5.2 m). Construida con muros de albailera, radier de
concreto, con ventilacin, sistema de contencin de derrames, y que cuenta adems con
proteccincontraincendios.Contarconduchadeemergenciaylavaojos.

Estabodegacuentaconunacapacidadtotaldealmacenamientomximade7isocontenedoresde
1 m3 de capacidad para la mezcla de los reactivos a utilizar en la molienda (HOSTAFLOT E 703,
HOSTAFLOTE930,FLOTANOLH70),ascomodospalletsconsacosdefloculanteSNF(40sacos).

SulocalizacinsemuestraenelPlanoM400640000131PLA004,DisposicinGeneralMolinos
deFlotacin,EspesadoresyFiltros,adjuntoenelAnexo1.Eldetalledelabodegadereactivosse
encuentraenelPlanoM400640000131SK007,adjuntoenelAnexo1.

En caso de derrames u otros incidentes que pudiesen ocurrir, relacionado con el uso de estas
sustancias,seprocederdeacuerdoaloindicadoenelprocedimientoPDIV061PlanGeneralde
Emergencias, y el procedimiento PDIV015 Manejo y Control de Derrames de Sustancias
PeligrosasuOtrasSustancias,ambosadjuntosenelAnexo6.

3.15 Estanques
ParaeldesarrollodelProyectodeFactibilidaddeLimpiezadeEscoriaCTFundicinPotrerillos,se
necesitarlahabilitacinde3estanques:
I.

Estanque de Agua de Procesos: Recibir los rebalses de agua clara de los espesadores,
filtrados de los filtros de concentrados y de relaves y agua industrial de reposicin
proveniente del estanque La Ola. Adems, alimentar agua de procesos a sectores de
MoliendayFlotacin.Tieneunacapacidadde150m3,condimensiones:6mdedimetro
por6mdealtura.Estconstruidodeplanchasdeacerode10mm.Contarademscon
unpretildecontencin.

II.

Estanque de Petrleo Diesel: Estanque de reserva de Petrleo Diesel, necesario para el


funcionamiento de los generadores de emergencia. Tiene una capacidad de 3,5 m3, con
dimensiones: 1,5 m de dimetro por 2,5 m de largo, horizontal. Ser construido de
planchas de acero de 6 mm. Contar adems con un pretil de contencin de capacidad
iguala1,1veceselvolumentotaldelestanquesegnloestablecidoenlanormativa.

En caso de derrames u otros incidentes que pudiesen ocurrir, relacionado con el


almacenamiento y uso del petrleo, se proceder de acuerdo a lo indicado en el
procedimiento PDIV061 Plan General de Emergencias, adjunto en el Anexo 6. El plano
M400640000131SK008adjuntoenelAnexo1,seentregaelesquemadelestanquede
almacenamiento.
III.

Estanque de Agua ContraIncendio: Estanque de reserva de agua ante potenciales


incendios.Tieneunacapacidadde140m3,condimensiones:6mdedimetropor6mde
alto. Ser construido de planchas de acero de 10 mm, y contar adems con 3 tipos de

CODELCOChile

Pgina 41 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

bombas de impulsin: 1 bomba con motor elctrico, 1 bomba con motor diesel y una
bombajockey,estaltimadebajocaudalypotenciasuficienteparapresurizarlaslneas
compensandoposiblesfugas.
La ubicacin de los estanques se encuentra indicada en el plano M400640000131PLA001
adjuntoenelAnexo1.

3.16 ServiciosySuministros

3.16.1 SuministrodeEnergaElctrica

El Proyecto considera la instalacin de una sala elctrica en la que se alojar el equipamiento


elctrico mayor: centros de control de motores, centro de distribucin de carga, switchgear,
generador, gabinetes PLC, Gabinete comunicacin, UPS, Tablero de Instrumentacin, tablero de
Fuerza, Tablero de Alumbrado. En este caso particular de este proyecto, los transformadores se
encontrarnfueradelasalaelctrica,auncostadodeella.

La energa elctrica ser alimentada desde la subestacin elctrica Potrerillos, y los niveles de
tensinautilizarsernlossiguientes:

12kV:desdealimentadoresexistentesenPotrerilloshastasubestacindebajada
delanuevaPlanta;3fases,50Hz.
4,16kV:alimentacindemolinodebolasySAG,3fases,50Hz.
380V:tensindealimentacindefuerza,3fases,50Hz.
220V:tensindealimentacindealumbrado,1fasemsneutro,50Hz.

ElconsumoelctricoesperadodelProyecto,indicandoelconsumodelosequiposprincipales,se
muestraenelcuadrosiguiente:

Tabla24.Cuadroresumendepotencias.

MolinoBolasySAG
OtrasCargas
TotalProyecto

Demanda
Media
KVA
4,000
2,693
6,693

Demanda
Mxima
KVA
4,211
2,990
7,200

PotenciaNominal
Transformadores
KVA
8,000
3,000
11,000

3.16.2 SuministrodeAguaPotableeIndustrial
El agua potable durante la etapa de construccin y cierre, provendr del sistema actual de
abastecimientodelaDivisin,ascomodesurtidoresdeaguaenbidones,quesernrequeridos

CODELCOChile

Pgina 42 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

contractualmente a las empresas que participen en estas etapas, dado que los usos son
principalmenteparaconsumodelostrabajadoresynecesidadesdehigienepersonal.

En el caso de la etapa de operacin, el agua potable requerida ser provista a partir del actual
sistemadeaguapotableexistenteenPotrerillos.

El agua industrial que se requerir principalmente en trabajos de obras civiles, el make upde la
planta de flotacin, y el sistema de WC, ser proporcionada a travs de la actual red de agua
industrialquealimentaaPotrerillos.
Elaguaparaelenfriamientodelaescoriaenollas,talcomoseindicanteriormente,provendr
desde un estanque de acumulacin de aguas de descarte de los procesos de enfriamiento de la
PlantadeOxgenoyPlantasdeAgua,porlocualnorequieredeaportesdeaguafresca.

Tabla25.ConsumosdeAguaPotableeIndustrialdelProyecto.

FUENTE
CONCEPTO

Estanquede
Aguade
acumulacinde
enfriamiento
aguasdedescarte
enfriamientoPOX
Requerimiento*
PlantasdeAgua
AguaparaProceso
AguaIndustrial
deMolienda
AguaparaCircuito
AguaIndustrial
deFlotacin
AguaIndustrial
Recuperada
AguaIndustrial
Makeup
PrdidaOperacional
AguaIndustrial
(1%)
Requerimiento
AguaIndustrial
Proceso
AguaIndustrial
RequerimientoWC
AguaPotable
RequerimientoL

CONSUMOMXIMO
m3/da
L/s

RECUPERACINMXIMA
m3/da
L/s

3.557,0

41,2

2.860,0

33,1

697,0

8,1

2.503,0

29,0

0,0

288,3

0,0

3,3

24,2
280,2
0,7
0,8

2.169,0

25,1

0,3

3,2
0,008
0,009

*Correspondealaguadereposicinporconceptodeprdidasporevaporacin.

3.16.3 SuministrodePetrleo
Se requerir del abastecimiento de petrleo Diesel para el funcionamiento de un equipo
generadorderespaldoelctrico,encasodefallaenelsuministrodelaPlantadeflotacin.

Se ha definido un Grupo Generador de emergencia, diesel, de 170 kVA, 380 V, para lo cual se
construir un estanque de 3,5 m3 de capacidad para almacenar el petrleo requerido. Las
condicionesdeesteestanquesesealanenelpunto3.15.

CODELCOChile

Pgina 43 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

DivisinSalvadorcuentaconcontratosdeabastecimientodepetrleoconunaempresadelrubro,
que cuenta con las autorizaciones debidas en la materia. Asimismo, la Divisin cuenta con
procedimientos para actuar en casos de emergencias que se puedan presentar, el cual se
encuentraadjuntoenelAnexo6.

3.16.4 SuministrodeAire
ElProyectoconsideralainstalacindeunasaladecompresoresparaproveerdeairealprocesode
flotacin.Esteedificioseencuentraadyacentealedificiodeflotacin,haciaelsectorSur.Lasala
decompresoresconsidera7unidadescompresorasosopladorasdeaireparalaPlanta.

3.17

Controldeacceso

ElcomplejoindustrialPotrerilloscuentaconaccesoscontroladosquecorrespondenalospuntos
deingresoalreadelproyecto.

3.18

ManejoyDisposicindeResiduosSlidos

Acontinuacinsesealalaestimacinderesiduosslidosagenerarseencadaunadelasetapas
delProyecto:

Tabla26.Estimacindegeneracinderesiduosslidos.

Etapa

ResiduosPeligrosos

Construccin

Huaipesusados,tubos
fluorescentesy
ampolletasquebradas,
petrleoyaceitesusados,
arenasytierras
contaminadasconaceites.
Pinturas.
Huaipesusados,tubos
fluorescentesy
ampolletasquebradas,
tierrascontaminadascon
petrleoyaceites,aceite
usado.
Tierrascontaminadascon
espumantes.
Tierrascontaminadascon
hidrocarburos,restosde
estructurascontaminadas
conreactivosdeflotacin.

Operacin

Cierre

Cantidad
(T)
5

ResiduosnoPeligrosos
Asimilablesadomsticos.
Materialdedespunte,
restosdematerialesde
construccin.

Cantidad
(T)
44

15

Asimilablesadomsticos.

30

10

Asimilablesadomsticos.
Restosdematerialesde
construccin.

29

CODELCOChile

Pgina 44 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Elmanejodelosresiduospeligrososynopeligrosos,serealizardeacuerdoaloestablecidoenel
procedimientodeManejodeResiduosSlidos,adjuntoenelAnexo7.Paraelcasodelosresiduos
peligrosos,sudestinofinalserelCentrodeManejodeResiduosSlidosdelaDivisin,aprobado
ambientalmentemedianteRCAN078de2009.Losresiduospeligrososemanejarndeacuerdoal
PlandeManejodeResiduosPeligrosos,cuyavisacinseencuentraenelAnexo8.

Para el caso de los residuos asimilables a domsticos, stos se manejarn de acuerdo a lo


establecidoenelprocedimientoindicado,perosudestinofinalserelRellenoSanitarioaprobado
ambientalmentemedianteRCAN30del31demayode2004.

3.19

ManejoyDisposicindeEfluentesLquidos

El proyecto Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos no considera la


generacindeefluenteslquidosindustrialesenningunadesusetapas.

Paraelenfriamientodeescorias,sehabilitarunsistemadecoleccindeaguasdeenfriamiento
querebalsendelasollas,siendoestaaguarecuperadasyrecirculadasalproceso.

Para las etapas de espesamiento y filtrado, tanto para el concentrado de escorias como para el
relave, esta agua sern recuperadas y enviadas al estanque de agua de proceso de la Planta de
Flotacin,recirculndose.

Paraelcasodeldepsitoderelaves,sehabilitarunasentinaalpiedeldepsito,afindecolectar
enellacualquierfiltracindeaguasprovenientedeldepsito,causadasporeventospuntualesde
precipitacindirectasobrelapiladerelaves.Estaaguaseevaporarenlasentinaderecoleccin,
obienserecuperaryenviaralproceso.

Enelcasodelasaguasresidualesprovenientesdelusodeservicioshiginicos,seconsideraque
losbaosdelsectordelaplantadeflotacin,estarnconectadosaunaplataformasanitaria,que
cuentaconfosaspticaypozodeabsorcin.Paraelcasodelosbaosqumicosainstalarenlas
distintasetapasdelProyecto,stosseimplementarnyretirarnporunaempresaespecialista.

3.20 MantencindeInfraestructurasyEquipos
Durantelasoperacionesserequerirunamantencinperidicadelosequiposymaquinariasdel
proyecto,detalmaneradegarantizarsufuncionamientoenptimascondiciones.

LamantencindelosequiposymaquinariasutilizadosenlasdistintasoperacionesdelProyectose
realizarenuntallerdemantencinyaexistenteenPotrerillos,mientrasquelamantencindelos
equiposqueoperarnenlaplantadeflotacinserealizarinsitu.

Cuando sea necesario, se realizarn obras de conservacin de los caminos. Adems, stos sern
humectadosperidicamenteparaminimizarlasemisionesdematerialparticulado.

CODELCOChile

Pgina 45 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

3.21 AspectosAmbientalesdelProyecto
3.21.1 Ruido
Lasemisionesderuidoestnasociadasalfuncionamientodelosequiposprincipales:

Tabla27.PotenciaSonoradeEquiposPrincipales.

Equipo
PotenciaSonora Promedio
MolinoSAG
92db
MolinodeBolas
85db
CeldasdeFlotacin
85db
Saladesopladoresparaflotacin
90db
Filtrosconcentradoescoria
90db
Filtrosrelaveescoria
84dB

Serealizellevantamientodelosnivelesbasalesderuidoactualesenlazonadeemplazamientoy
en la casa habitada ms cercana, arrojando niveles de ruido de 75 dB. Sin embargo, durante el
periododemedicin(5minutos)seregistrelpasodedoscamionesyunacamioneta,dadoquela
casahabitacinseencuentracercanaalaRutaC167.Elinformeconlosresultadosdelamedicin
deruidobasalseencuentraadjuntoenelAnexo9.

Considerandolosnivelesderuidobasal,ascomolapresinsonoradelosequipos,sedetermin
el incremento de los niveles de presin sonora resultantes, expresados en dB(A) actualmente
medidos en Quebrada Mina Cal Sector Escorial, Quebrada Mina Cal con Quebrada Afluente y
QuebradaElJardn(casahabitacindeunafamiliadelaComunidadColla),cuandoseinicienlas
actividadesdelaPlantadeFlotacindeEscorias.

Las conclusiones del clculo en el incremento de la presin sonora indican que, debido a las
distancias que separan a la fuente de ruido de los lugares en que se midi ruido de fondo, la
atenuacin es suficiente para reducir el nivel de presin sonora a valores tales que el ruido
combinadonosobrepasalosvaloresactualesdefondomedidos(verAnexo9).

3.21.2 PatrimonioCultural
Se efectu una prospeccin arqueolgicapaleontolgica en el sector de emplazamiento del
Proyecto,queparaelsectordelaQuebradaAfluente,enlazonamediasuperiorqueserutilizada
por el depsito de relaves y la construccin de la planta de flotacin, detect un sitio
paleontolgico constituido por algunos ndulos sedimentarios con fsiles de invertebrados
marinos de edad jursica observables en superficie, a todas luces arrastrados desde su
estratigrafaoriginalenunafloramientounos50maloeste.Dadoestecarcterselesinterpreta
comomarginalesaldepsitoestratificadonuclear.

CODELCOChile

Pgina 46 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Dado que los materiales encontrados constituyen material de arrastre, se considera que el
Proyectonosignificarunimpactosobreestacomponente.

Imgenes9y10.Restospaleontolgicos(PentacrinusprobableyBivalvia),encontradosenndulosde
materialdearrastre.Fuente:InformedeProspeccinArqueolgica.

Enlazonadeemplazamientodelproyecto,nosedetectaronrestosdepatrimonioarqueolgicoe
histrico.
ElinformedelaprospeccinarqueolgicapaleontolgicaseencuentraadjuntoenelAnexo10.

3.21.3 FlorayFauna
Se efectuaron dos campaas de monitoreo de flora y fauna en el sector de emplazamiento del
Proyecto,queparaelsectordelaQuebradaAfluente,enlazonamediasuperiorqueserutilizada
poreldepsitoderelavesylaconstruccindelaplantadeflotacin,arroj:

Flora y vegetacin: Se caracteriza por la presencia de individuos aislados, con densidades bajas,
dispersos tanto en las laderas como en el fondo de la quebrada y cuya distribucin espacial no
muestra ningn patrn determinado. Ninguna de las especies presentes presenta problemas de
conservacin.Lasespeciespresentesson:
Ephedrabreana(Pingopingo)
Oxaliseremobia
Atripleximbricata(Ojalar)
Lyciumminutifolium(Churque)
Adesmiaerinaceae(aahuablanca)
Cistanthesalsoloides
Phrodusmicrophyllus(Montedeburro)
Salpiglossisspiniscens(Palitoamargo)
Fauna terrestre: El sector presenta una baja riqueza de especies (una especie de reptil y dos
especiesdeaves)yendensidadesmuybajas.Desdeelpuntodevistapoblacional,nosonreasde

CODELCOChile

Pgina 47 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

concentracindefauna,debidofundamentalmenteaunautilizacinhistricadelasquebradasy
porladegradacinecolgicaquesehaproducidodebidoalosdiversoscambiosdelospatrones
naturales y evolutivos del medio natural y de la comunidad de vertebrados, la cual no puede
establecerinteraccionesentreellosysumedio.Lasespeciesencontradasson:

Liolaemusplatei(lagartijadePlate)
Cathartesaura(Jotedecabezacolorada)
Asthenesmodesta(Canasterochico)
Abrothrixandinus(Ratnandino)
Phyolltisxanthopygus(Lauchnorejudoamarillo

LaespecieLiolaemusplateieslanicaespecieencontradaenelreadeestudioqueseclasifica
dentro de una categora de conservacin, la cual es considerada como una especie Rara en el
nortedeChile(SAG,2009).EstatipificacinindicaquelaspoblacionesdeL.plateiocupanunrea
geogrficapequeaoestnrestringidasaunhbitatmuyespecficoqueescasoenlanaturaleza.
Por otro lado, L. platei es definida como Rara en el rea de estudio porque presenta en forma
naturalmuybajasdensidadespoblacionales,aunqueocupeunreageogrficamayor(CONAMA,
2008). La especie L. platei no se encuentra en los listados de los otros cuerpos legales (D.S.
151/2007, D.S. 50/2008, D.S. 51/2008, D.S. 23/2009) del Ministerio Secretara General de la
Presidencia).SeinducequelaQuebradaElJardnestaraaportandoalariquezadeespeciesdela
QuebradaAfluente,yrepresentaraunhbitatFuenteyuncentrodereproduccin,apartirdela
cuallosejemplarespuedendesplazarseycolonizarlasquebradasaledaas.

Por lo anteriormente descrito, en consideracin a la existencia de una muy baja densidad


poblacional de la lagartija de plate en el sector de emplazamiento, dado que en la primera
campaafueronavistados2individuosyenlasegundacampaa3,nosehaconsideradoqueel
Proyectosignifiqueunimpactonegativosobreestaespecie.
Flora y Fauna acutica: no se detectaron ensambles de flora y fauna acutica en el sector de
emplazamiento,dadoqueelsectornocuentaconaguasuperficial.

Ensntesis,paratodosloscomponentesbiticosestudiadosenambascampaasdeidentificacin
de flora y fauna, se concluye que la ocupacin de la quebrada Afluente no representa ninguna
prdida significativa en trminos de su biota ya que por un lado, las especies ah presentes se
encuentranampliamentedistribuidasenelpasyporotro,lasabundanciasdelaspoblacionesson
muybajasenrelacinasectorescercanos,comoeslaQuebradaElJardn.

LosinformesdeambascampaasdemonitoreoseencuentranenelAnexo11.

CODELCOChile

Pgina 48 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

3.21.4 Paisaje
SerealizunaevaluacinpaisajsticadelsectordeemplazamientodelProyecto,indicandosteno
influyesignificativamenteenlazona,dadoquesuimpactoesmnimocomparadoconelimpacto
yaexistenteproducidoporlaactividadindustrialquesehadesarrolladoporaproximadamente90
aosenlazona,debidoaquelamagnituddelproyectoestambinmenor.

ElinformedeevaluacinpaisajsticaseencuentraenelAnexo12.

3.21.5 Turismo
SerealizunaevaluacindelpotencialimpactotursticodelProyectoenlazona,indicandocomo
resultado que ste se encuentra lejano a los atractivos tursticos de la Comuna de Diego de
Almagro,yporlotantonoseranafectadosdirectamenteporestaactividad.

La importancia turstica que presenta Potrerillos, est relacionado con la actividad minera
desarrollada en el pasado, del que se han conservado sus principales edificios, constituyndose
como museo de sitio. El emplazamiento de las obras del Proyecto no se relaciona con este
atractivo,yaqueselocalizanenelsectorubicadoalNortedelazonadeusoindustrialactualdela
localidad,comopuedeserobservadoenlafigura2anterior.
A su vez, por tratarse de un rea industrial, con un estado de conservacin catalogado como
regularparaSERNATUR,elProyectonoejerceraunaafectacindirectasobreelcampamento,ya
quesuusoactualesrestringidoyposeeunaadministracinprivada.
ElinformedeevaluacindeimpactotursticoseencuentraenelAnexo13.

3.21.6 Antropologa
SerealizunaevaluacinalavariableantropolgicaasociadaalaComunidadCollaquehabitaen
sectores cercanos al Proyecto (Quebrada El Jardn y Agua Dulce) que pudiese ser afectada por
ste, el cual indic como resultado que la implementacin del proyecto Flotacin de Escorias
ConvertidorTenienteFundicinPotrerillos,considerandosuemplazamientoreadeinfluencia
directa, ms un buffer de 1000 metros incluido como margen de seguridad, no afectara la
actividadeconmicanicomercialnidesubsistenciadelsector,puesdeacuerdoalosealadoenla
correspondienteDIA,stenoaumentarlasemisionesdelrespectodelactualproceso,niconlleva
intervenciones sobre el territorio rural de la comunidad Colla o de alguno de sus recursos
ambientales.

Tampoco se afecta el patrn de asentamiento y redes sociales activas asociadas a ste, pues el
proyectonoimplicalaintervencindentrodelterritorioCollanieltrasladodelaspersonasdela
comunidadaotrosector.Tampocoseprevlaafectacinsobreaspectosidentitariososimblicos
delgrupo,debidoalamencionadafaltadeinteraccineinfluenciaentrelosespaciosdestinadosal
Proyectoyaquellosqueactualmentehabitayutilizalacomunidad.

CODELCOChile

Pgina 49 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

ElinformeAntropolgicoseencuentraenelAnexo14.

3.21.7 HidrologaeHidrogeologa
Respecto a la variable hidrolgica, el sector de emplazamiento del Proyecto constituye una
quebrada seca, que presentara escurrimientos superficiales en casos de precipitaciones
abundantes en el rea. En consideracin al clima de la zona, indicado en el punto 3.14.8, stas
alcanzaran44mmcomopromedioanual.LahoyahidrogrficaaportantealaQuebradaAfluente
esde0,3Km2

Serealizunreconocimientohidrogeolgicodelsectordeemplazamientoqueindicaquelahoya
hidrogrficanitieneaguasarribaunrespaldodehoyahidrogrficaqueleproporcioneunarecarga
subterrnea procedente del sector Sureste, ya que existe el excampamento e instalaciones
mineras.ElinformedeReconocimientoHidrogeolgicoseencuentraenelAnexo15.

3.21.8 Suelo

SerealizunestudiodeedafologaenelsectordeemplazamientodelProyecto,elcualsealaen
susresultadoslosiguiente:

Lossuelosreconocidospresentanunescasodesarrollopedogentico,loquesecorrelaciona
directamentealosambientesdesrticosprecordilleranosandinos.

Las unidades de suelo reconocidas tienen un escaso valor para el desarrollo de actividades
agrcolas,clasificndoseenCapacidaddeUsoVIIyVIII.

Losfenmenoserosivosdescritosestnrelacionadosalascondicionesambientalesenquese
desarrollan estos suelos. Siendo esencialmente agentes hdricos los que actan sobre el
paisajedesuelos,manifestndoseenlaformadesurcosdegradomoderadoasevero.

Se prev que la ejecucin del proyecto no producir una prdida irreparable de los suelos
relacionadosnidelavegetacinpresenteenelreareconocida.

Enconsideracinalasconclusionesdelestudio,entrminosdelacalidadagrolgicadelossuelos
presentes,seestimaqueelimpactodelProyectosobreelrecursosueloserndeescasoalcance.
ParalaejecucindelProyecto,elTitularentregaenelAnexo16,losantecedentesparalasolicitud
delPermisoAmbientalSectorialN96,CambiodeUsodeSuelo.

CODELCOChile

Pgina 50 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

5.

ANLISISDEPERTINENCIADEINGRESOALSEIA

Segn el artculo 4 del Reglamento del Sistema de Evaluacin de Impacto Ambiental, SEIA, El
titulardeunproyectooactividaddeloscomprendidosenelartculo3deesteReglamento,oaquel
que se acoja voluntariamente al SEIA, deber presentar una Declaracin de Impacto Ambiental,
salvo que dicho proyecto o actividad genere o presente alguno de los efectos, caractersticas o
circunstanciascontempladosenelartculo11delaLey19.300yenlosartculossiguientesdeeste
Ttulo,encuyocasodeberpresentarunEstudiodeImpactoAmbiental.

El Artculo 11 Ley 19.300, sobre Bases Generales del Medio Ambiente, establece que Los
proyectos o actividades enumerados en el artculo precedente requerirn la elaboracin de un
Estudio de Impacto Ambiental, si generan o presentan a lo menos uno de los siguientes efectos,
caractersticasocircunstancias:,enunciandoestosefectos,caractersticasocircunstanciasensus
literalesa)alf).

CadaunodeestosliteralesestdesarrolladoenelReglamentodelSEIA,enlosartculos5al11,
normasqueestablecenloscriteriosyreglasparadeterminarlapresenciadealgunodelosefectos,
caractersticasocircunstanciasquede acuerdoalartculo11delaLeyN19.300,determinanla
necesidaddeunEstudiodeImpactoAmbiental.

Acontinuacin,seanalizaelProyectodeacuerdoalartculo11delaLey19.300,modificadaporla
LeyN20.417,yalosartculos5al11delReglamento(aexcepcindelartculo7)quesonlos
quepermitendefinirsielProyectodebepresentarunaDeclaracindeImpactoAmbiental(DIA)o
unEstudiodeImpactoAmbiental(EIA).EldetalledelanlisisdepertinenciadeingresoalSEIA,se
presentaenloscuadrossiguientes:
Artculo
Art.11
Letraa)
Ley19.300

Art.5
Reglamento
SEIA
Letraa)

CODELCOChile

Contenido
Riesgo para la salud de la
poblacin, debido a la cantidad y
calidad de efluentes, emisiones o
residuos;

Evaluacin
El Proyecto Flotacin de Escorias Convertidor
Teniente Fundicin Potrerillos, no genera riesgo
para la salud de la Poblacin, debido a que no se
encuentracercanoasitiospoblados.
AsimismoelProyectonogeneraefluenteslquidos,
cuentaconcontroldeemisionesalaire,ymanejar
sus residuos de acuerdo a lo establecido en la
legislacin.
Aobjetodeevaluarsisegeneraopresentaelriesgoaqueserefiereelincisoanterior,se
considerar
Lo establecido en las normas
primarias de calidad ambiental y
de emisin vigentes. A falta de
tales normas, se utilizarn como
referencia las vigentes en los
Estados que se sealan en el
artculo
7
del
presente
Reglamento.

El Proyecto no generar efluentes lquidos. El agua


residual de los procesos ser recirculada. Las
potenciales filtraciones desde el depsito de
relaves, sern colectadas en una sentina para su
evaporaciny/orecirculacinalproceso.
Las emisiones atmosfricas del Proyecto se
consideran que disminuirn respecto a la situacin
actual, adems, el Proyecto no se encuentra
cercano a sectores poblados. Asimismo, los niveles
deemisinpermanecerndentrodeloestablecido

Pgina 51 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Artculo

Letrab)

Letrac)

Letrad)

CODELCOChile

Contenido

Evaluacin
en el Plan de Descontaminacin y la Norma de
EmisindeArsnicosvigentes.(Anexo17)

La composicin, peligrosidad,
cantidad y concentracin de los
efluentes lquidos y de las
emisionesalaatmsfera.

El Proyecto no generar efluentes lquidos. El agua


residual de los procesos ser recirculada. Las
potenciales filtraciones desde el depsito de
relaves, sern colectadas en una sentina para su
evaporaciny/orecirculacinalproceso.
Enbasealanlisisdelasemisionesatmosfricasdel
Proyecto, se considera que stas disminuirn
respecto a la situacin actual, adems, el Proyecto
no se encuentra cercano a sectores poblados.
Asimismo, los niveles de emisin permanecern
dentro de lo establecido en el Plan de
Descontaminacin y la Norma de Emisin de
Arsnicosvigentes.(Anexo17)
La frecuencia, duracin y lugar de El Proyecto no generar efluentes lquidos. El agua
lasdescargasdeefluenteslquidos residual de los procesos ser recirculada. Las
ydeemisionesalaatmsfera.
potenciales filtraciones desde el depsito de
relaves, sern colectadas en una sentina para su
evaporaciny/orecirculacinalproceso.
Enbasealanlisisdelasemisionesatmosfricasdel
Proyecto, se considera que stas disminuirn
respecto a la situacin actual, adems, el Proyecto
no se encuentra cercano a sectores poblados.
Asimismo, los niveles de emisin permanecern
dentro de lo establecido en el Plan de
Descontaminacin y la Norma de Emisin de
Arsnicosvigentes.(Anexo17)
La composicin, peligrosidad y Residuosdomsticoseindustriales:
cantidadderesiduosslidos.
Durante las etapas de construccin, operacin y
cierresegenerarnresiduosdomsticosyresiduos
industriales. La segregacin, transporte y
disposicin de estos residuos se realizar de
acuerdo a los Procedimientos Ambientales de
Divisin Salvador (Anexo 7). Los residuos
industriales clasificados como Peligrosos se
manejarn segn el Plan de Manejo de Residuos
PeligrososdelaDivisin(Anexo8),quecuentacon
surespectivaresolucinvigente.
ResiduosMinerosMasivos:
El relave de escoria constituye un residuo minero
masivo, por lo cual queda excluido del mbito de
aplicacin del DS N 148. Adicionalmente, de
acuerdoalanlisisSPLPrealizado(verAnexo4)se
concluyequenoesunresiduopeligroso.

Pgina 52 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Artculo
Letrae)

Letraf)

Letrag)

Letrah)

Contenido
Evaluacin
Lafrecuencia,duracinylugardel Residuosdomsticoseindustriales:
manejoderesiduosslidos.
Durante las etapas de construccin, operacin y
cierresegenerarnresiduosdomsticosyresiduos
industriales. La segregacin, transporte y
disposicin de estos residuos se realizar de
acuerdo a los Procedimientos Ambientales de
Divisin Salvador (Anexo 7). Los residuos
industriales clasificados como Peligrosos se
manejarn segn el Plan de Manejo de Residuos
PeligrososdelaDivisin(Anexo8),quecuentacon
surespectivaresolucinvigente.
ResiduosMinerosMasivos:
El relave de escoria constituye un residuo minero
masivo, por lo cual queda excluido del mbito de
aplicacin del DS N 148. Adicionalmente, de
acuerdoalanlisisSPLPrealizado(verAnexo4)se
concluyequenoesunresiduopeligroso.
La diferencia entre los niveles Deacuerdoalamedicindenivelderuidobasalya
estimados de inmisin de ruido la potencia sonora de los equipos principales, el
conproyectooactividadyelnivel Proyectonogenerarnivelesderuidoqueimpacten
deruidodefondorepresentativoy la zona poblada ms cercana (Quebrada El Jardn),
caracterstico del entorno donde dadosulejanaconelProyecto(Anexo9).
exista
poblacin
humana
permanente.
Lasformasdeenerga,radiacino El Proyecto no generar formas de energa,
vibraciones generadas por el radiacin o vibraciones que afecten a sectores
proyectooactividad;y
poblados, los que adems, se encuentran alejados
delsitiodeemplazamiento.
Losefectosdelacombinaciny/o El proyecto no generar efectos negativos
interaccin conocida de los sinrgicos o acumulativos que pudieran poner en
contaminantes
emitidos
o riesgo la salud de las poblaciones cercanas al
generados por el proyecto o proyecto, puesto que no habr emisiones de
actividad.
contaminantes.

Conclusin Artculo 11, letra a) Ley N 19.300 y Artculo 5 del Reglamento SEIA: En base al
anlisis realizado para la norma legal indicada y para cada una de las letras del Art. 5, se
concluye que el proyecto Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos, no
genera riesgo para la salud de la poblacin, debido a la cantidad y calidad de los efluentes,
emisionesoresiduosquegeneraoproduce.

CODELCOChile

Pgina 53 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Norma
Art.11
Letrab)
Ley19.300

Art.6
Reglamento
SEIA
Letraa)

Letrab)

CODELCOChile

Contenido
Efectos adversos significativos
sobre la cantidad y calidad de los
recursos naturales renovables,
incluidoselsuelo,aguayaire;

Evaluacin
En el rea de emplazamiento del proyecto, los
suelos estn limitados en su uso ya que no tienen
valor agrcola, ganadero ni forestal. Por lo mismo,
los efectos debido al cubrimiento y compactacin
producto del emplazamiento y operacin del
proyectonosernsignificativos(Anexo16).
En la zona en que operar el proyecto no existen
cursos superficiales de agua ni acuferos que
pudieranverseafectados(Anexo15).
Si bien el proyecto generar emisiones a la
atmsfera,elrecursonaturalairenoverafectado
su calidad de manera significativa en relacin a su
situacin actual, permaneciendo los niveles de
emisiones dentro de lo establecido en el Plan de
Descontaminacin y la Norma de Emisin de
Arsnico.(Anexo17)
Porltimo,deacuerdoalosestudiosrealizados,la
variable flora y fauna no sufrir impactos
significativosporelProyecto(Anexo11).
Aobjetodeevaluarsisegeneraopresentaelriesgoaqueserefiereelincisoanterior,se
considerar
Lo establecido en las normas
secundariasdecalidadambientaly
de emisin vigentes. A falta de
tales normas, se utilizarn como
referencia las vigentes en los
Estados que se sealan en el
artculo
7
del
presente
Reglamento.

En el rea de emplazamiento del proyecto, los


suelos estn limitados en su uso ya que no tienen
valor agrcola, ganadero ni forestal. Por lo mismo,
los efectos debido al cubrimiento y compactacin
producto del emplazamiento y operacin del
proyectonosernsignificativos.(Anexo16)
En la zona en que operar el proyecto no existen
cursos superficiales de agua ni acuferos que
pudieranverseafectados.(Anexo15)
Si bien el proyecto generar emisiones a la
atmsfera,elrecursonaturalairenoverafectado
su calidad de manera significativa en relacin a su
situacin actual, permaneciendo los niveles de
emisiones dentro de lo establecido en el Plan de
Descontaminacin y la Norma de Emisin de
Arsnico.(Anexo17)
Porltimo,deacuerdoalosestudiosrealizados,la
variable flora y fauna no sufrir impactos
significativosporelProyecto(Anexo11).
La composicin, peligrosidad, El Proyecto no generar efluentes lquidos. El agua
cantidad y concentracin de los residual de los procesos ser recirculada. Las
efluentes lquidos y de las potenciales filtraciones desde el depsito de
emisionesalaatmsfera.
relaves, sern colectadas en una sentina para su
evaporaciny/orecirculacinalproceso.
Las emisiones atmosfricas del Proyecto se
consideran que disminuirn respecto a la situacin
actual, adems, el Proyecto no se encuentra
cercano a sectores poblados. Asimismo, los niveles

Pgina 54 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Norma

Contenido

Letrac)

La frecuencia, duracin y lugar de


lasdescargasdeefluenteslquidos
ydeemisionesalaatmsfera.

Letrad)

La composicin, peligrosidad y
cantidadderesiduosslidos.

Letrae)

Lafrecuencia,duracinylugardel
manejoderesiduosslidos.

CODELCOChile

Evaluacin
deemisinpermanecerndentrodeloestablecido
en el Plan de Descontaminacin y la Norma de
EmisindeArsnicosvigentes(Anexo17).
El Proyecto no generar efluentes lquidos. El agua
residual de los procesos ser recirculada. Las
potenciales filtraciones desde el depsito de
relaves, sern colectadas en una sentina para su
evaporaciny/orecirculacinalproceso.
Las emisiones atmosfricas del Proyecto se
consideran que disminuirn respecto a la situacin
actual, adems, el Proyecto no se encuentra
cercano a sectores poblados. Asimismo, los niveles
deemisinpermanecerndentrodeloestablecido
en el Plan de Descontaminacin y la Norma de
EmisindeArsnicosvigentes.(Anexo17)
Residuosdomsticoseindustriales:
Durante las etapas de construccin, operacin y
cierresegenerarnresiduosdomsticosyresiduos
industriales. La segregacin, transporte y
disposicin de estos residuos se realizar de
acuerdo a los Procedimientos Ambientales de
Divisin Salvador (Anexo 7). Los residuos
industriales clasificados como Peligrosos se
manejarn segn el Plan de Manejo de Residuos
PeligrososdelaDivisin(Anexo8),quecuentacon
surespectivaresolucinvigente.
ResiduosMinerosMasivos:
El relave de escoria constituye un residuo minero
masivo, por lo cual queda excluido del mbito de
aplicacin del DS N 148. Adicionalmente, de
acuerdoalanlisisSPLPrealizado(verAnexo4)se
concluyequenoesunresiduopeligroso.
Residuosdomsticoseindustriales:
Durante las etapas de construccin, operacin y
cierresegenerarnresiduosdomsticosyresiduos
industriales. La segregacin, transporte y
disposicin de estos residuos se realizar de
acuerdo a los Procedimientos Ambientales de
Divisin Salvador (Anexo 7). Los residuos
industriales clasificados como Peligrosos se
manejarn segn el Plan de Manejo de Residuos
PeligrososdelaDivisin(Anexo8),quecuentacon
surespectivaresolucinvigente.
ResiduosMinerosMasivos:
El relave de escoria constituye un residuo minero
masivo, por lo cual queda excluido del mbito de
aplicacin del DS N 148. Adicionalmente, de
acuerdoalanlisisSPLPrealizado(verAnexo4)se
concluyequenoesunresiduopeligroso.

Pgina 55 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Norma
Letraf)

Letrag)

Letrah)

Letrai)

Letraj)

Letrak)

Letral)

CODELCOChile

Contenido
La diferencia entre los niveles
estimados de inmisin de ruido
conproyectooactividadyelnivel
deruidodefondorepresentativoy
caracterstico del entorno donde
se concentre fauna nativa
asociada a hbitat de relevancia
para su nidificacin, reproduccin
oalimentacin.

Evaluacin
El clculo del incremento de la presin sonora
esperadaconlaoperacindelProyecto,indicanque
debido a las distancias que separan a la fuente de
ruidodeloslugaresenquesemidiruidodefondo,
la atenuacin es suficiente para reducir el nivel de
presin sonora a valores tales que el ruido
combinado no sobrepasa los valores actuales de
fondo medidos. Por lo anterior, el Proyecto no
generarimpactoporruido.(Anexo9).
Para el caso de los trabajadores que operarn la
plantadeflotacin,seconsideralaimplementacin
demedidasdecontrolfrentealagente,talcomoel
usodeequiposdeproteccinpersonaladecuado.
Lasformasdeenerga,radiacino El Proyecto no generar formas de energa,
vibraciones generadas por el radiacinovibracionesqueafectensectoresdelos
proyectooactividad.
recursosnaturalesrenovables.

Losefectosdelacombinaciny/o
interaccin conocida de los
contaminantes emitidos y/o
generados por el proyecto o
actividad.
La relacin entre las emisiones de
los contaminantes generados por
elproyectooactividadylacalidad
ambiental de los recursos
naturalesrenovables.
La capacidad de dilucin,
dispersin,
autodepuracin,
asimilacin y regeneracin de los
recursos naturales renovables
presentes enel rea de influencia
delproyectooactividad.
La cantidad y superficie de
vegetacin nativa intervenida y/o
explotada, as como su forma de
intervenciny/oexplotacin.

La cantidad de fauna silvestre


intervenida y/o explotada, as
como su forma de intervencin
y/oexplotacin.

El proyecto no generar efectos negativos


sinrgicos o acumulativos que pudieran afectar los
recursosnaturalesrenovables.

ElProyectonogeneraremisindecontaminantes
que afecten la calidad ambiental actual ni los
recursos naturales renovables, por el contrario, el
Proyecto significar una reduccin en cuanto a los
nivelesactualesdeemisindematerialparticulado
yarsnico.(Anexo7).
De acuerdo con las caractersticas ambientales de
los sectores donde se emplazar el proyecto, no
existen recursos naturales renovables cuya
capacidad de dilucin, dispersin, autodepuracin,
asimilacinoregeneracinpudieraverseafectada.

LazonadeemplazamientodelProyecto,poseeuna
escasa cobertura vegetacional, y las especies
presentes no se encuentran en categora de
conservacin(Anexo4).
Cabe sealar que la zona de emplazamiento del
proyecto,muestraevidentessignosdeintervencin
antrpica, dado que se encuentran en l restos de
basurasdispersos.
Enelsectordeemplazamientosedetectunabaja
densidad poblacional de especies de fauna
presente. Se detect la especie Liolaemus Platei
catalogada como rara por el DS N 5/1998,
ReglamentodelaLeydeCaza.Sinembargo,stase
encontr en un nmero reducido de individuos (2
en la primera campaa y 3 en la segunda). Se

Pgina 56 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Norma

Contenido

Letram)

El estado de conservacin en que


se encuentren especies de flora o
de fauna a extraer, explotar,
alteraromanejar,deacuerdoalo
indicadoenloslistadosnacionales
de especies en peligro de
extincin, vulnerables, raras o
insuficientementeconocidas.

Letran)

El volumen, caudal y/o superficie,


segn corresponda, de recursos
hdricos a intervenir y/o explotar
en:
n.1)Vegasy/obofedalesubicados
enlasRegionesIyII,quepudieren
ser afectadas por el ascenso o
descenso de los niveles de aguas
subterrneas.
n.2) reas o zonas de humedales
que pudieren ser afectadas por el
ascenso o descenso de los niveles
de aguas subterrneas o
superficiales.
n.3)
Cuerpos
de
aguas
subterrneasquecontienenaguas
milenariasy/ofsiles.
n.4) Una cuenca o subcuenca
hidrogrficatransvasadaaotra.

Evaluacin
consideraquelaQuebradaElJardneselreservorio
de la fauna en el sector, y es desde ah que las
especies migran a quebradas aledaas. Por este
motivo,porserunreareducidadeintervenciny
las densidades poblacionales bajas, pero presentes
en sectores que no sern intervenidos por el
Proyecto, se considera que la magnitud de la
intervencinesmenor.(Anexo4)
Enelsectordeemplazamientosedetectunabaja
densidad poblacional de especies de fauna
presente. Se detect la especie Liolaemus Platei
catalogada como rara por el DS N 5/1998,
ReglamentodelaLeydeCaza.Sinembargo,stase
encontr en un nmero reducido de individuos (2
en la primera campaa y 3 en la segunda). Se
consideraquelaQuebradaElJardneselreservorio
de la fauna en el sector, y es desde ah que las
especies migran a quebradas aledaas. Por este
motivo,porserunreareducidadeintervenciny
las densidades poblacionales bajas, pero presentes
en sectores que no sern intervenidos por el
Proyecto, se considera que la magnitud de la
intervencinesmenor.(Anexo4)
ElProyectonoconsideralaintervencinderecursos
hdricos. El abastecimiento de agua industrial
provendrdelestanqueLaOla,queabastecetodos
los procesos de la Fundicin, y el cual se alimenta
delascaptacionesquelaDivisinposeeenelsector
cordillerano. El Proyecto no requiere de aumentar
losderechosdeaguaexistentes.

n.5) Lagos o lagunas en que se


generenfluctuacionesdeniveles.

CODELCOChile

Pgina 57 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Norma
Letra)

Letrao)

Letrap)

Letraq)

Contenido
Las alteraciones que pueda
generar sobre otros elementos
naturales y/o artificiales del
medioambientelaintroduccinal
territorio nacional de alguna
especie de flora o de fauna; as
como la introduccin al territorio
nacional, o uso, de organismos
modificados genticamente o
medianteotrastcnicassimilares.
La superficie de suelo susceptible
de perderse o degradarse por
erosin,
compactacin
o
contaminacin.

Evaluacin
El Proyecto no considera la introduccin de
especies de flora y fauna ni de organismos
genticamentemodificados.

De acuerdo al estudio edafolgico realizado (ver


Anexo16),seestimaqueelimpactodelProyecto
sobre el recurso suelo ser de escaso alcance,
dado que stos poseen un escaso desarrollo
pedogentico, clasificndose en capacidad de uso
VIIyVIII.(Anexo16)
La diversidad biolgica presente De acuerdo a los estudios de flora y fauna
en el rea de influencia del realizados (Anexo 4) y de suelo (Anexo 16), se
proyecto o actividad, y su estimaqueelProyectonogenerarimpactosenla
capacidadderegeneracin.
diversidadbiolgicadelreadeinfluencia.

La superficie o volumen de un ElProyectonoconsideraintervencinalgunasobre


glaciar
susceptible
de glaciares.
modificarse.2

Conclusin Artculo 11 letra b) Ley N 19.300 y Artculo 6 del Reglamento SEIA: En base al
anlisis realizado para la norma legal indicada y para cada una de las letras del Art. 6, se
concluye que el proyecto Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos no
genera o presenta efectos adversos significativos sobre la cantidad y calidad de los recursos
naturalesrenovables,incluidoselsuelo,agua,aireyglaciares.

Introducido en el texto por el D.S. 122 del Ministerio Secretara General de la Presidencia, publicado en el
Diario Oficial el 29 de Noviembre de 2008.

CODELCOChile

Pgina 58 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Norma
11
Letrac)
Ley19.300

Art.8
Reglamento
SEIA

Letraa)

Letrab)

Letrac)

Letrad)

CODELCOChile

Contenido

Evaluacin

Reasentamiento de comunidades
humanas,oalteracinsignificativa
de los sistemas de vida y
costumbresdegruposhumanos;

El Proyecto no considera el reasentamiento de


comunidades humanas, y de acuerdo al informe
antropolgicorealizado(Anexo14),seestimaqueel
Proyecto no generar alteraciones significativas
sobre el sistema de vida de la comunidad Colla
aledaa.
A objeto de evaluar si el proyecto o actividad genera reasentamiento de comunidades
humanas, se considerar el desplazamiento y reubicacin de grupos humanos que
habitanenelreadeinfluenciadelproyectooactividad,incluidassusobrasy/oacciones
asociadas()
Asimismo,aobjetodeevaluarsielproyectooactividadgeneraalteracinsignificativade
los sistemas de vida y costumbres de grupos humanos, se considerar el cambio
producidoenlassiguientesdimensionesquecaracterizandichosistemadevida:
Dimensin geogrfica, consistente El proyecto Flotacin de Escorias Convertidor
en la distribucin de los grupos TenienteFundicinPotrerillos,nogenerarcambios
humanos en el territorio y la en la dimensin geogrfica de los grupos humanos
estructura espacial de sus existentes en la zona, dado que se desarrolla
relaciones,
considerando
la totalmente en un rea circunscrita al sector de
densidadydistribucinespacialde Potrerillos, y stos se encuentran alejados del
la poblacin; el tamao de los sectordeemplazamiento.
predios y tenencia de la tierra; y
los flujos de comunicacin y
transporte;
Dimensin
demogrfica, El Proyecto no generar cambios en la dimensin
consistente en la estructura de la demogrficadelosgruposhumanosexistentesenla
poblacin local por edades, sexo, zona,dadoquesedesarrollatotalmenteenunrea
rama de actividad, categora circunscrita al sector de Potrerillos, y stos se
ocupacional y status migratorio, encuentranalejadosdelsectordeemplazamiento.
considerandolaestructuraurbano Asimismo, si bien se espera en las etapas de
rural;laestructurasegnramade construccin y cierre de un nmero mayor de
actividad econmica y categora trabajadores,esteimpactoestemporalydemenor
ocupacional;
la
poblacin envergadura.
econmicamente
activa;
la
estructura de edad y sexo; la
escolaridad y nivel de instruccin;
ylasmigraciones;
Dimensin
antropolgica, De acuerdo a la evaluacin antropolgica realizada
considerando las caractersticas (Anexo 14), el Proyecto no generar cambios en la
tnicas;ylasmanifestacionesdela dimensin antropolgica de los grupos humanos
cultura, tales como ceremonias existentes en la zona, dado que se desarrolla
religiosas,
peregrinaciones, totalmente en un rea circunscrita al sector de
procesiones,
celebraciones, Potrerillos.
festivales, torneos, ferias y
mercados;
Dimensin
socioeconmica, ElProyectonogenerarcambiossignificativosenla
considerando el empleo y dimensinsocioeconmicadelosgruposhumanos
desempleo; y la presencia de existentes en la zona, dado que para la etapa de
actividades
productivas operacinseestimauntotalde52trabajadores,los
dependientes de la extraccin de que provendrn del rea de operacin de los
recursos naturales por parte del HornosdeLimpiezadeEscoriaquequedarnfuera

Pgina 59 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Norma

Contenido

Evaluacin

grupo humano, en
individualoasociativa;o

Letrae)

forma deoperacinconelProyecto.
Sin embargo, en las etapas de construccin y
operacin,elnmerodetrabajadoresrequeridoses
mayor, estimndose que un 70% provendr de
manodeobralocal.
Dimensin de bienestar social ElProyecto nogenerarcambiosenladimensinde
bsico,relativoalaccesodelgrupo bienestar social bsico de los grupos humanos
humanoabienes,equipamientoy existentes en la zona, dado que se desarrolla
servicios, tales como vivienda, totalmente en un rea circunscrita al sector de
transporte,
energa,
salud, Potrerillos, y stos se encuentran alejados del
sectordeemplazamiento.
educacinysanitarios.

Conclusin Artculo 11 letra c) Ley N 19.300 y Artculo 8 del Reglamento SEIA: En base al
anlisis realizado para la norma legal indicada y para cada una de las letras del Art. 8, se
concluye que el proyecto Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos, de
acuerdoasunaturalezaylugardeemplazamiento,nogenerareasentamientodecomunidades
humanasoalteracinsignificativadelossistemasdevidaycostumbresdegruposhumanos.

Norma
Art.11
Letrad)
Ley19.300

Art.9
Reglamento
SEIA
Letraa)

Letrab)

CODELCOChile

Contenido
Localizacin en o prxima a
poblaciones, recursos y reas
protegidas, sitios prioritarios para
la conservacin, humedales
protegidos
y
glaciares,
susceptibles de ser afectados, as
como el valor ambiental del
territorio en que se pretende
emplazar.

Evaluacin
El proyecto Flotacin de Escorias Convertidor
Teniente Fundicin Potrerillos, no interviene ni se
emplaza en reas protegidas, sitios prioritarios,
humedales protegidos ni glaciares, dado que
correspondeaunaZonaconintervencinantrpica
histrica.
Asimismo, el Proyecto se encuentra emplazado en
un sector lejano a los sectores de ocupacin y uso
quelaComunidadColladeDiegodeAlmagroposee
en el sector de Agua Dulcey QuebradaEl Jardn,y
deacuerdoalaevaluacinantropolgicarealizada,
no se generarn impactos negativos sobre la
Comunidad.(Anexo14)
Aobjetodeevaluarsielproyectooactividadselocalizaprximoapoblacin,recursoso
reasprotegidassusceptiblesdeserafectadas,seconsiderar
La magnitud o duracin de la
intervencin o emplazamiento del
proyecto o actividad en o
alrededor de reas donde habite
poblacin protegida por leyes
especiales;

El Proyecto se encuentra emplazado en un sector


lejano a los sectores de ocupacin y uso que la
Comunidad Colla deDiegode Almagro posee en el
sector de Agua Dulce y Quebrada El Jardn, y de
acuerdoalaevaluacinantropolgicarealizada,no
se generarn impactos negativos sobre la
Comunidad.(Anexo14)
La magnitud o duracin de la El Proyecto no considera intervencin sobre reas
intervencin o emplazamiento del con recursos protegidos, y su emplazamiento es
proyecto o actividad en o totalmenteenunazonaIndustrialdelargadata.
alrededor de reas donde existen

Pgina 60 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Norma

Letrac)

Contenido
recursos protegidos en forma
oficial;o
La magnitud o duracin de la
intervencin o emplazamiento del
proyecto o actividad en o
alrededor de reas protegidas o
colocadasbajoproteccinoficial.

Evaluacin

El Proyecto, no considera la intervencin de reas


protegidas o bajo proteccin oficial, y su
emplazamiento es totalmente en una zona
circunscritaalsectordePotrerillos.

Conclusin Artculo 11 letra d) Ley N 19.300 y Artculo 9 del Reglamento SEIA: En base al
anlisis realizado para la norma legal indicada y para cada una de las letras del Art. 9, se
concluyequeelreadeemplazamientodelproyectoFlotacindeEscoriasConvertidorTeniente
Fundicin Potrerillos no se localiza prxima a poblaciones, recursos y reas protegidas, sitios
prioritarios para la conservacin, humedales protegidos ni glaciares, susceptibles de ser
afectadas.
Norma
Art.11
Letrae)
Ley19.300

Contenido
Alteracin
significativa,
en
trminosdemagnitudoduracin,
delvalorpaisajsticootursticode
unazona,y

Art.10
Reglamento
SEIA

A objeto de evaluar si el proyecto o actividad, en cualquiera de sus etapas, genera o


presenta alteracin significativa, en trminos de magnitud o duracin, del valor
paisajsticodeunazona,considerar:

Letraa)

La duracin o la magnitud en que El Proyecto no obstruir la visibilidad a zonas con


se obstruye la visibilidad a zonas valorpaisajstico.
convalorpaisajstico;

Letrab)

Laduracinomagnitudenquese El Proyecto no alterar recursos o elementos del


alteren recursos o elementos del medio ambiente de zonas con valor paisajstico o
medio ambiente de zonas con turstico.
valorpaisajsticooturstico;

Letrac)

La duracin o la magnitud en que


se obstruye el acceso a los
recursos o elementos del medio
ambiente de zonas con valor
paisajsticooturstico;o.
La intervencin o emplazamiento
del proyecto o actividad en un
rea declarada zona o centro de
interstursticonacional,segnlo
dispuesto en el Decreto Ley N
1.224de1975.

Letrad)

Evaluacin
Deacuerdoalaevaluacinpaisajsticayevaluacin
delimpactotursticodelProyecto(Anexos12y13),
seestimaquestenogenerarimpactosnegativos
sobreestascomponentesambientales.

El Proyecto no obstruir el acceso a recursos o


elementos del medio ambiente de zonas con valor
paisajsticooturstico.

El Proyecto no se interviene ni se encuentra


directamenteemplazadoenunreadeclaradazona
ocentrodeinterstursticonacional.

ConclusinArtculo11letrae)LeyN19.300yArtculo10ReglamentoSEIA:Enbasealanlisis
realizado a la norma legal indicada y a cada una de las letras del Art. 10 del Reglamento, se

CODELCOChile

Pgina 61 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

concluye que el proyecto Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos, no


presentaalteracindelvalorpaisajsticootursticodelreadeinfluencia.

Norma
Art.11
Letraf)
Ley19.300

Art.11
Reglamento
SEIA
Letraa)

Letrab)

Letrac)

Letrad)

Contenido
Alteracin de monumentos, sitios
con
valor
antropolgico,
arqueolgico, histrico y, en
general, los pertenecientes al
patrimoniocultural.

Evaluacin
Se realiz una prospeccin arqueolgica
paleontolgica que para el sector de la Quebrada
Afluente,detecttresndulosconrestosfosilizados
deinvertebradosmarinos,todosmenoresa1mde
dimetro, se indica adems que stos constituyen
material de arrastre provenientes de un manto
sedimentario proveniente de una estratigrafa de
otrolugar(verAnexoN10).
Aobjetodeevaluarsielproyectooactividad,respectoasureadeinfluencia,generao
presenta alteracin de monumentos, sitios con valor antropolgico, arqueolgico,
histricoy,engeneral,lospertenecientesalpatrimoniocultural,seconsiderar:
La
proximidad
a
algn El Proyecto no se encuentra prximo a ningn
Monumento Nacional de aquellos Monumento Nacional declarado como tal por el
definidosporlaLey17.288;
ConsejodeMonumentosNacionales.
La magnitud en que se remueva,
destruya,
excave,
traslade,
deterioreosemodifiqueenforma
permanente algn Monumento
Nacionaldeaquellosdefinidospor
laLey17.288;
La magnitud en que se modifique
o deteriore en forma permanente
construcciones, lugares o sitios
que por sus caractersticas
constructivas, por su antigedad,
por su valor cientfico, por su
contexto histrico o por su
singularidad,
pertenecen
al
patrimoniocultural;o
Laproximidadalugaresositiosen
que se lleven a cabo
manifestaciones propias de la
culturaofolkloredealgnpueblo,
comunidadogrupohumano.

El Proyecto no se remueve, destruye, excava,


traslada o deteriora ningn Monumento Nacional
declaradocomotalporelConsejodeMonumentos
Nacionales.

El Proyecto no modifica o deteriora en forma


permanente construcciones, lugares o sitios que
pertenezcanalpatrimoniocultural.

El Proyecto no se encuentra prximo a lugares o


sitiosenlascualessellevenacabomanifestaciones
propias de la cultura o folklore de algn pueblo,
comunidadogrupohumano.
Se realiz una evaluacin antropolgica en la
Comunidad Colla de Diego de Almagro, indicando
que el Proyecto no significar impactos negativos
sobreestaComunidad(Anexo14).

ConclusinArtculo11letraf)LeyN19.300yArtculo11ReglamentoSEIA:Enbasealanlisis
realizado a la norma legal indicada y a cada una de las letras del Art. 11 del Reglamento, se
concluye que el rea de influencia del proyecto Flotacin de Escorias Convertidor Teniente
Fundicin Potrerillos, no altera monumentos, sitios con valor antropolgico, arqueolgico,
histricoy,engeneral,lospertenecientesalpatrimoniocultural.

CODELCOChile

Pgina 62 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

ConclusinGeneral:

Ensntesis,elproyectoFlotacindeEscoriasConvertidorTenienteFundicinPotrerillossometido
aevaluacin,nogenerariesgoparalasaluddelapoblacin,debidoalacantidadycalidaddelos
efluentes,emisionesoresiduosquegeneraoproduce;noprovocaefectosadversossignificativos
sobrelacantidadocalidaddelosrecursosnaturales;nogenerareasentamientodecomunidades
humanas ni alteracin significativa de sistemas de vida; no se localiza prxima a poblaciones,
recursos y reas protegidas, sitios prioritarios para la conservacin, humedales protegidos o
glaciares,susceptiblesdeserafectados;noprovocaalteracindelvalorpaisajsticodelterritorio,
ni alteracin de monumentos, sitios con valor antropolgico, arqueolgico, histricos y, en
general,lospertenecientesalpatrimoniocultural.

En consecuencia, puesto que el proyecto Flotacin de Escorias Convertidor Teniente Fundicin


Potrerillos,noproduceningunodelosefectos,caractersticasocircunstanciasmencionadosenel
artculo 11 de la Ley19.300, sobre Bases Generales del Medio Ambiente (y sus modificaciones),
desarrollados en los artculos 5, 6, 8, 9, 10 y 11 del Ttulo II del Reglamento del SEIA, para su
evaluacinambientalprocedepresentarunaDeclaracindeImpactoAmbiental(DIA),todoellode
conformidadaloindicadoenelartculo4delmencionadoReglamento.

CODELCOChile

Pgina 63 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

6.

PRINCIPALESEMISIONES,RESIDUOSYDESCARGASDELPROYECTOALAMBIENTE

6.1

EmisionesalaAtmsfera

6.1.1 EmisionesdeMaterialParticulado
BasadosenlosresultadosdelasemisionesisocinticasqueserealizanenlaFundicin,loscuales
sonreportadosenformamensualalSistemadeEvaluacindeImpactoAmbientalyalaAutoridad
Sanitaria,deacuerdoaloestablecidoenelPlandeDescontaminacindelaFundicinPotrerillos,
se tuvo que la emisin total de la Fundicin para el ao 2010 fue de 853,3 toneladas (lmite de
emisinestablecidoenelDSN179/99PlandeDescontaminacincorrespondea5.500T/ao).De
esteniveldeemisin,setuvoqueelaportedeemisinprovenientedelactualprocesodeHornos
deLimpiezadeEscorias(HLE1,2y3)fuedeacuerdoaloqueseindicaenlasiguientetabla:

Tabla28.EmisindematerialparticuladoprovenientedelosHornosde
LimpiezadeEscoria1,2y3(baseao2010).
2010
EmisinHLEs
Enero
62,4
Febrero
48,1
Marzo
49,7
Abril
54,4
Mayo
55,2
Junio
58,6
Julio
56,1
Agosto
54,1
Septiembre
55,6
Octubre
51,6
Noviembre
52,8
Diciembre
74,8
TOTAL
673,5

DeloanteriorsetienequelaemisindematerialparticuladoprovenientedelaFundicinensu
operacin actual proviene en un 79% del proceso de recuperacin de cobre en los Hornos de
LimpiezadeEscoria(HLE1,2y3),quetalcomosemencionenelpunto3.1esunprocesoque
presenta poca eficiencia con emisin de humos negros producto de la mala combustin del
petrleoutilizadocomoagentereductor.

Por otro lado, se realiz una estimacin de las principales emisiones de material particulado del
Proyecto en su etapa de construccin, operacin, y cierre de acuerdo a la metodologa EPA. Las
emisiones provenientes de la combustin en los motores de equipos mviles no fueron
consideradasdebidoaquesonmarginalesrespectodelasgeneradasporeltrnsitodemaquinaria
yerosinelica.Elresultadodelaestimacindeemisionesindica:

CODELCOChile

Pgina 64 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Tabla29.EstimacindeemisionesdematerialparticuladoagenerarseenelProyecto.
Etapa

Actividad

Construccin ConstruccinPlanta
ConstruccinCaminosyreaenfriamiento
HabilitacinDepsitoRelaves
Operacin
Emisinportransportedeescoria
Emisinportransportedeconcentradosdeescoria
Erosinelicadeldepsito*
Emisinporimplementacindecobertura
(transporte+disposicindematerial)*
Cierre**
Deconstruccin

Emisin
[T]
0,181
0,598
4,26

EmisinAnual
[T]

19,04
5,78
161
4,21

0,78

*Promediodelaestimacindeemisionesdurantelavidatil(5aos).
**Enelcasodelaetapadecierre,conservadoramenteseadoptunaemisinsimilaralageneradadurante
laconstruccindelsectorPlanta,caminosyreadeenfriamiento,dadoqueenestaetapanosegenerarn
movimientosdetierra.

Enelcasodelaestimacindeemisionesparaeldepsitoderelaves,considerandolaexposicin
de la superficie de relave a la erosin elica, as como a la implementacin de la cobertura de
material granular, se ha considerado el peor escenario, a fin de realizar una estimacin
conservadora. La estimacin supone que el material depositado quedar expuesto en su mayor
superficieporlatotalidaddelao,situacinqueenlaprcticaserdiferente,dadoquecadavez
que se finalice la disposicin de una pila de relaves (7 en total), sta ser cubierta con material
granular.

Enelcasodeltrnsitoencaminos,sehaconsideradocomomedidademitigacin,lahumectacin
deloscaminosnopavimentados.

EldetalledelaestimacindelasemisionesconsideradasseadjuntaenelAnexo17delaDIA.

6.1.2 EmisindeAzufre
ParalaestimacindelaemisindeazufredesdelaFundicin,productodelcambiodetecnologa
autilizarparalarecuperacindecobredesdelasescorias,serealizunamodelacinmetalrgica
delaFundicinatravsdelsoftwareMETSIM.

EstesoftwareconsiderlamodelacindelcasobasedelaFundicinylasituacinconlaPlantade
Flotacin.

EnelAnexo17seadjuntaelinformedelamodelacinMETSIMrealizada,conlosdatosdeentrada
ysalida,ascomolascondicionesambientalesconsideradas.

El resultado de la modelacin indic que la emisin de Azufre con la operacin de la Planta de


Flotacin alcanzar 35.122 T/ao, considerando una captacin de 84,5%. Esto significa una

CODELCOChile

Pgina 65 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

reduccin de 2.261 toneladas respecto del caso base, que no considera la implementacin del
Proyecto.Elresumenseindicaenlasiguientetabla:

Tabla30.EmisinestimadadeAzufreparacasobaseyProyecto(METSIM).

Escenario
Base
(FundicinoperandoconHornosdeLimpiezadeEscoria)
Flotacin
(FundicinoperandoconPlantadeFlotacindeEscorias)
Reduccindeemisiones

T/ao
37.383

%captacin
83,5

35.122

84,5

2.261

6.1.3 EmisindeArsnico
DeformasimilaralaestimacindeAzufrerealizadaconelmodelometalrgicoMETSIM,seestim
la emisin total de arsnico proveniente de la Fundicin para el caso base y situacin con la
implementacindelProyecto.

ElresultadodeestamodelacinseadjuntaenelAnexo17.

ElresultadodelamodelacinindicquelaemisindeArsnicoconlaoperacindelaPlantade
Flotacin alcanzar 156,4 T/ao, considerando una captacin de 90,6%. Esto significa una
reduccin de 85 toneladas respecto del caso base, que no considera la implementacin del
Proyecto.Elresumenseindicaenlasiguientetabla:

Tabla31.EmisinestimadadeArsnicoparacasobaseyProyecto(METSIM).

Escenario
Base
(FundicinoperandoconHornosdeLimpiezadeEscoria)
Flotacin
(FundicinoperandoconPlantadeFlotacindeEscorias)
Reduccindeemisiones

6.2

T/ao
241,4

%captacin
85,5

156,4

90,6

85

EfluentesLquidos

El proyecto Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos no considera la


generacin de efluentes lquidos industriales en ninguna de sus etapas, tal como se indic en el
punto3.19.

En el caso de las aguas residuales domsticas, los baos del sector de la planta de flotacin, se
encontrarn conectados al actual sistema de alcantarillado de Potrerillos, y para el caso de los
baosqumicosainstalarenlasdistintasetapasdelProyecto,stosseimplementarnyretirarn
porunaempresaespecialista.

CODELCOChile

Pgina 66 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

6.3

ResiduosSlidos

Tantoenlaetapadeconstruccin,operacinycierresegenerarnresiduosslidosasimilablesa
domsticos,loscualessemanejarndeacuerdoalprocedimientoPDIV017ManejodeResiduos
Slidos (Anexo 7). Estos residuos sern dispuestos en el Relleno Sanitario de Divisin Salvador,
aprobadomedianteRCANN30del31demayode2004.

Elmanejodelosresiduospeligrososynopeligrosos,serealizardeacuerdoaloestablecidoenel
procedimientodeManejodeResiduosSlidos,adjuntoenelAnexo7.Paraelcasodelosresiduos
peligrosos,sudestinofinalserelCentrodeManejodeResiduosSlidosdelaDivisin,aprobado
ambientalmentemedianteRCAN078de2009,deacuerdoaloestablecidoenelPlandeManejo
deResiduosPeligrososdeDivisinSalvador,cuyavisacinseencuentraadjuntaenelAnexo8.

CODELCOChile

Pgina 67 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

7.

NORMATIVAAMBIENTALAPLICABLEALPROYECTO

En esta Seccin se analiza la forma en que se considera dar cumplimiento a las exigencias de
carcter ambiental aplicables, de acuerdo a la normativa ambiental general y sectorial vigente
relacionadaconelProyecto.

La legislacin vigente en Chile, que es aplicable al proyecto, comprende disposiciones de tipo


general y especfica sobre aspectos ambientales (calidad del aire y emisiones atmosfricas,
manejo,ytransportedesustanciaspeligrosas,condicionessanitariasyambientalesenlugaresde
trabajo,entreotras).

Este anlisis est orientado a identificar los aspectos normativos generales y especficos, de
carcterambiental,asociadosalaejecucindelProyecto.

7.1

LegislacinAmbientaldeCarcterGeneral

7.1.1 ConstitucinPolticadelaRepblica
LaConstitucinPolticadelaRepblicadeChilede1980,consagracomogarantaconstitucionalel
"derecho a vivir en un medio ambiente libre de contaminacin" en el N 8 de su Artculo 19,
disposicinquesealalosiguiente:

Artculo19:LaConstitucinaseguraatodaslaspersonas:

N8)Elderechoavivirenunmedioambientelibredecontaminacin.EsdeberdelEstadovelar
paraqueestederechonoseaafectadoytutelarlapreservacindelanaturaleza.

LaLeypodrestablecerrestriccionesespecficasalejerciciodedeterminadosderechosolibertades
paraprotegerelMedioAmbiente.".

7.1.2 Ley 19.300, de Bases Generales del Medio Ambiente, modificada por la Ley N
20.417/2010, que Crea el Ministerio, el Servicio de Evaluacin Ambiental y la
SuperintendenciadelMedioAmbiente.

Organismocompetente:ServiciodeEvaluacinAmbiental(SEA)

Materia:LaLey19.300constituyeelmarcolegalbsicodereferenciageneraldetodalanormativa
ambiental sectorial de nuestro pas. Ella procura regular y desarrollar las instituciones e
instrumentosnecesariosparalaproteccindelmedioambiente,deacuerdoalodispuestoporel
artculo19,N8delaConstitucinPoltica.

En tal sentido, esta ley determina y delimita, por una parte, el derecho a vivir en un medio
ambientelibredecontaminacin,estableciendolosmrgenestolerablesylegtimosdealteracin
al medio ambiente que no constituyen infraccin a este derecho y, por otra, regula varios
instrumentosdegestinambiental,entreotros,elSistemadeEvaluacindeImpactoAmbiental.

CODELCOChile

Pgina 68 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

La Ley 19.300 fue recientemente modificada por la Ley N 20.417, que regula el rediseo de la
institucionalidadambientaldelpas,teniendocomofinalidadlacreacindelMinisteriodelMedio
Ambiente,elServiciodeEvaluacinAmbientalylaSuperintendenciadelMedioAmbiente.

La misma Ley 20.417 establece modificaciones al Sistema de Evaluacin Ambiental, dictacin de


planes y normas, clasificacin de especies, entre otras, varias de las cules entraron en vigencia
desde la fecha de publicacin del cuerpo legal, modificaciones que en lo aplicable al proyecto
sometidoaevaluacin,hansidoconsideradasenelpresentedocumento.

El Sistema de Evaluacin de Impacto Ambiental previsto en la Ley 19.300, modificada por la Ley
20.417,estableceparaaquellosProyectosquesonsusceptiblesdeocasionarefectossignificativos
sobreelmedioambiente,laobligacindesometerseaunaevaluacinambientaldelosimpactos
que involucren la que, una vez aprobada, los habilitar para obtener todos los permisos y
autorizaciones necesarias que se requieran para llevar a cabo el Proyecto o actividad de que se
trate.

En lo que a este Sistema de Evaluacin de Impacto Ambiental se refiere, se relacionan


especficamenteconelProyectolassiguientesdisposicionescontenidasenlaLey19.300deBases
GeneralesdelMedioAmbiente:

Artculo8:Losproyectosoactividadessealadosenelartculo10slopodrnejecutarseo
modificarse previa evaluacin de su impacto ambiental, de acuerdo a lo establecido en la
presenteley.()

Artculo 10: Los Proyectos o actividades susceptibles de causar impacto ambiental, en


cualesquiera de sus fases, que debern someterse al Sistema de Evaluacin de Impacto
Ambiental,sonlossiguientes:

Letra i) Proyectos de desarrollo minero, incluidos los de carbn, petrleo y gas,


comprendiendo las prospecciones, explotaciones, plantas procesadoras y disposicin de
residuosyestriles.

Relacinconelproyecto:Deacuerdoalosrequerimientosindicadosenlosartculosprecedentes,
el Proyecto Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos debe ingresar
obligatoriamente al SEIA, dado que modifica al Proyecto Cambio Tecnolgico Fundicin
Potrerillos, y adems por s solo, se encuentra tipificado dentro del listado de Proyectos
indicadosenlaLey.

Forma de cumplimiento: Con el ingreso de la presente DIA para la evaluacin de impacto


ambientaldelproyectooactividad,sedacumplimientoaestadisposicin.

Artculo11:EstablecequelosproyectosoactividadesquedebensometersealSEIAconforme
alartculo10,slorequerirndeunEstudiodeImpactoAmbientalcuandoconcurrenalguno
delosefectos,caractersticasycircunstancias,sealadosenlosliteralesdeesteartculo11.

CODELCOChile

Pgina 69 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Relacinconelproyecto:Deacuerdoaloprevistoenestadisposicin,elproyectoquesesomete
alSistemanorequieredeunEstudiodeImpactoAmbiental,todavezquenopresentaningunode
losefectos,caractersticasycircunstanciasdescritosenella.

Formadecumplimiento:SeacreditaenelCaptulo4AnlisisdePertinenciadeIngresoalSEIA
del presente documento, la no concurrencia de los efectos, caractersticas y circunstancias que
hacenprocedenteunEIA.

Artculo 18: Establece que los proyectos y actividades que deban ingresar al SEIA y no
requieran de un Estudio de Impacto Ambiental, debern presentar una Declaracin de
ImpactoAmbiental.

Relacinconelproyecto:Conformealoanterior,elproyectoquesesometealSistemaseevala
medianteunaDeclaracindeImpactoAmbiental.

Formadecumplimiento:LapresentacindeestaDeclaracin.

7.1.3 DSN95/2001,MinisterioSecretaraGeneraldelaPresidencia,ReglamentodelSistema
deEvaluacindeImpactoAmbiental.

Organismocompetente:ServiciodeEvaluacinAmbiental(SEA)

Materia: El DS N 95/2001 modifica la primera versin del Reglamento (DS N 30/1997)


precisandomayoresdetallesaproyectosyactividadesquedebeningresaralSEIA,yestableciendo
loscriteriosparadistinguirelingresoalsistemadeevaluacin.

Asimismo, determina los contenidos mnimos con los que deben cumplir dichos instrumentos,
desarrollandotambinelprocedimientoparasutramitacinyevaluacin.Porotraparte,define
los permisos ambientales sectoriales que se debern otorgar necesariamente una vez que el
respectivoestudioodeclaracinseacalificadofavorablemente.

El cumplimiento de estas normativas se realiza mediante el sometimiento de la presente


DeclaracindeImpactoAmbientalysuscontenidos.

EsteReglamentoesaplicableensugeneralidadalaevaluacindelpresenteproyecto.Sinperjuicio
de ello, corresponde individualizar las siguientes disposiciones como las especficamente
pertinentesalapresenteDIA:

Artculo 3: Determina los proyectos o actividades que conforme al artculo 10 de la Ley


19.300 debern ingresar al Sistema de Evaluacin de Impacto Ambiental. Especficamente,
resultaaplicableelliterali),quedescribecomoactividadoproyectoasometersealSEIA:

Letra i) Proyectos de desarrollo minero, incluidos los de carbn, petrleo y gas,


comprendiendo las prospecciones, explotaciones, plantas procesadoras y disposicin de
residuosyestriles.

CODELCOChile

Pgina 70 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Seentenderporproyectosdedesarrollomineroaquellasaccionesuobrascuyofinesla
extraccinobeneficiodeunoomsyacimientosmineros,ycuyacapacidaddeextraccin
demineralessuperioracincomiltoneladas(5.000t)mensuales.

Relacin con el proyecto: Segn lo dispuesto en la disposicin transcrita, el presente proyecto


debe ingresar obligatoriamente al SEIA, dado que consiste en la recuperacin de cobre desde
escoriasmedianteflotacin,concapacidaddetratamientonominalde1468toneladasdiarias.

Forma de cumplimiento: Con el ingreso de la presente DIA para la evaluacin de impacto


ambientaldelproyectooactividad,sedacumplimientoaestadisposicin.

TtuloII(artculos4al11):Establecequelosproyectosoactividadesquedebensometerseal
SEIA conforme al artculo 3, slo requerirn de un Estudio de Impacto Ambiental cuando
concurrenalgunodelosefectos,caractersticasycircunstancias,sealadosenlosartculosde
esteTtulo.

Relacinconelproyecto:DeacuerdoaloprevistoenesteTtulo,elproyectoquesesometeal
SistemanorequieredeunEstudiodeImpactoAmbiental,todavezquenopresentaningunode
losefectos,caractersticasycircunstanciasdescritosenl.

Formadecumplimiento:SeacreditaenelCaptulo4AnlisisdePertinenciadeIngresoalSEIA
del presente documento, la no concurrencia de los efectos, caractersticas y circunstancias que
hacenprocedenteunEIA.

TtuloIIIPrrafo2(artculo14al16):RegulaloscontenidosdelasDeclaracionesdeImpacto
Ambiental,losquehansidoincluidosenelpresentedocumento,demaneraqueloscaptulos
deestaDIAcorrespondenalasexigenciasdeestePrrafo.

Relacin con el proyecto: De acuerdo a lo previsto en este Ttulo, la DIA del proyecto requiere
cumplirconloscontenidosestablecidosenestePrrafo.

Forma de cumplimiento: Cada Captulo de la presente DIA desarrolla los contenidos mnimos
exigidosporestePrrafo.

7.2 LegislacinAmbientalAplicabledeCarcterEspecfico.
7.2.1 Infraestructura
7.2.1.1 DFL 458/1976, del Ministerio de Vivienda y Urbanismo. Ley General de Urbanismo y
Construcciones.
Organismo competente: Ministerio de Vivienda y Urbanismo / Municipalidad de Diego de
Almagro.

Materia: Regula la planificacin urbana, urbanizacin y construccin para todo el territorio


nacional.

CODELCOChile

Pgina 71 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Artculos 116 y 116 bis: La construccin, reconstruccin, reparacin, alteracin,


ampliacinydemolicindeedificiosyobrasdeurbanizacindecualquiernaturaleza,sean
urbanasorurales,requerirnpermisodelaDireccindeObrasMunicipales,apeticindel
propietario,conlasexcepcionesquesealelaOrdenanzaGeneral.

RelacinconelProyecto:ElProyectoenevaluacin,requieredelaconstruccindeinstalaciones
nuevasymodificacindeinstalacionesenelreaFundicin.
Formadecumplimiento:Previoalaejecucindelasobras,sesolicitarelpermisorespectivoala
DireccindeObrasMunicipalesdelaI.MunicipalidaddeDiegodeAlmagro.
7.2.1.2 DS47/1992,delMinisteriodeViviendayUrbanismo.OrdenanzaGeneraldeUrbanismo
yConstrucciones.
Organismocompetente:DireccindeObrasMunicipales.

Materia: reglamenta la Ley General de Urbanismo y Construcciones, y regula el procedimiento


administrativo, el proceso de planificacin urbana, el proceso de urbanizacin, el proceso de
construccin,ylosestndarestcnicosdediseoydeconstruccinexigiblesenlosdosltimos.

Artculo 4.3.21: Establece los requisitos de distanciamiento de los edificios industriales


destinadosalfuncionamientodeestablecimientosconsideradoscomopeligrosos.
Aplica en las distancias desde los lugares de almacenamiento, acopio o disposicin de los
residuospeligrosos.

RelacinconelProyecto:ElProyectoconsideralaconstruccindeedificiosindustriales(Plantade
flotacindeescorias).

Forma de cumplimiento: Las disposiciones establecidas en el DS N 74, se encuentran


incorporadaseneldiseodelProyecto.

7.2.2 Aire
7.2.2.1 DS N 18/1997, Del Ministerio Secretara General de la Presidencia. Declara Zona
SaturadaporAnhdridoSulfurosoyMaterialParticuladoRespirablealaZonaCircundanteala
FundicindePotrerillos.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria
Materia:DeclarazonasaturadaporSO2yMaterialParticuladoalazonacircundantealaFundicin
dePotrerillos.

RelacinconelProyecto:elProyectoseencuentraemplazadoenlazonadeclaradasaturadapor
elDSN18,sinembargoendichazona,yanoseencuentrapoblacinexistente.

CODELCOChile

Pgina 72 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Formadecumplimiento:noaplica.

7.2.2.2 DSN179/1998,DelMinisterioSecretaraGeneral delaPresidencia.EstablecePlan de


DescontaminacinparalaZonaCircundantealaFundicindePotrerillosdelaDivisinSalvador
deCODELCOChile.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria

Materia: Establece el Plan de Descontaminacin para la Zona Circundante a la Fundicin de


Potrerillos.

Sexto:LaFundicindePotrerillosdelaDivisinSalvadordeCODELCOChiledeberlimitar
lasemisionesatmosfricasdeanhdridosulfurosoylasemisionesatmosfricasdematerial
particuladorespirable,expresadascomomaterialparticuladototal,demodoquestasno
superenlosvaloresconsignadosenelsiguientecronograma:

CRONOGRAMADEREDUCCIONDEEMISIONESDEANHIDRIDOSULFUROSOYMATERIAL
PARTICULADOTOTAL:

Ao

EmisinAnualMx.
EmisinAnualMx.
AnhdridoSulfuroso
MaterialParticuladoTotal
Ton/ao(1)

Ton/ao(1)
Desde1999
352.000

6.300
Desde2000
100.000

5.500
Desde2003
*

Relacin con el Proyecto: El Proyecto deja fuera de operacin el proceso de recuperacin de


cobremedianteelusodelos3hornosdelimpiezadeescoriaexistentes,modificandolaoperacin
globaldelaFundicinPotrerillos.

Formadecumplimiento:Paraelcasodelaemisindematerialparticuladorespirable,seespera
una disminucin de aproximadamente 670 toneladas anuales al dejar fuera de operacin los
hornosdelimpiezadeescoriaHLE1,2y3.Porotrolado,productodelaoperacindelProyecto,
considerandolostransportesdeescoriayconcentrado,mslaoperacindeldepsitoderelaves,
seestimaunaemisinanualequivalentea187toneladaspromedio.Porestemotivo,elProyecto
enevaluacinmejoraanmselniveldecumplimientodelplandedescontaminacinreferidoa
materialparticulado(verpunto5.1.1.delapresenteDeclaracin).

En el caso del Anhdrido Sulfuroso, de acuerdo a lo indicado en el punto 5.1.2, se realiz una
modelacinmetalrgicaMETSIM,queindicqueproductodelcambioenelprocesodelalimpieza
deescorias,seproducirunareduccinde2.261toneladasdeemisinanualdeazufrerespecto
delasituacinactual.

CODELCOChile

Pgina 73 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

7.2.2.3 DSN165/1999,DelMinisterioSecretaraGeneraldelaPresidencia.EstableceNormade
EmisinparalaRegulacindelContaminanteArsnicoEmitidoalAire.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:Regulaloslmitesmximosdeemisindearsnicoparadistintostiposyubicacionesde
fuentesemisoras.

Artculo7:Aquellasfuentesexistentes,ubicadasenlaProvinciadeChaaral,IIIReginde
Atacama,cuyacapacidadactualdeproduccinseaigualosuperiora500.000ton/aode
concentrado de cobre, podrn emitir como mximo las siguientes cantidades, en los
plazosqueseestablecenacontinuacin:
a)Elao2000,1.450ton/ao.
b)Desdeelao2001inclusive,800ton/ao.
c)Desdeelao2003inclusive,150ton/ao.
Si no existieren asentamientos humanos, dentro de un radio de 2,5 kilmetros medidos
desdelafuenteemisora,noseaplicarloprescritoenlaletrac)precedente.

Relacin con el Proyecto: El Proyecto deja fuera de operacin el proceso de recuperacin de


cobremedianteelusodelos3hornosdelimpiezadeescoriaexistentes,modificandolaoperacin
globaldelaFundicinPotrerillos.
Formadecumplimiento:Comoseindicenelpunto5.1.3,serealizunamodelacinmetalrgica
METSIM,laqueindicaqueproductodelaimplementacindelProyecto,seesperaunareduccin
de85toneladasanualesdeArsnicoenlaemisinglobaldelaFundicin(Anexo17).

TtuloIIIMetodologasdemedicinycontroldelanorma:establecelametodologade
clculoycontroldelasemisionesenlafuente.

Relacin con el Proyecto: El Proyecto deja fuera de operacin el proceso de recuperacin de


cobremedianteelusodelos3hornosdelimpiezadeescoriaexistentes,modificandolaoperacin
globaldelaFundicinPotrerillos,loqueimplicarmodificacionesenlametodologadeclculodel
balancedeemisionesdeAs.

Forma de cumplimiento: El Titular presentar una actualizacin a la metodologa de clculo del


balancedeemisionesdeAsalaAutoridadSanitariaparasuevaluacin.
7.2.2.4 DFL725/1967,MinisteriodeSalud.CdigoSanitario.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:Regulaaspectosgeneralesrelacionadosconelfomento,proteccinyrecuperacindela
saluddelaspersonas.

Artculo89:Establecenormasreferidaalaconservacinypurezadelaireyevitarenlla
presencia de materias u olores que constituyan una amenaza para la salud, seguridad o
bienestar del hombre o que tengan influencia desfavorable sobre el uso y goce de los

CODELCOChile

Pgina 74 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

bienes.Lareglamentacindeterminar,adems,loscasosycondicionesenquepodrser
prohibidaocontroladalaemisinalaatmsferadedichassubstancias.

RelacinconelProyecto:Elproyectocontemplaemisionesmenoresporcombustindemotores
dieseldeloscamionesquesernempleadoseneltransporte.

FormadeCumplimiento:ElProyectodarcumplimientoaestanormativaadoptandolasmedidas
que sean necesarias para el control de la contaminacin atmosfrica. Entre las medidas se
considera la exigencia contractual al transportista de lo establecido en las normas de emisin
vehicular,enespecialmediantelaexigenciadelosCertificadosdeRevisinTcnicavigentesdelos
vehculosautilizarparaeltransporte.

7.2.2.5 DS N 59/1998 del Ministerio Secretara General de la Presidencia. Norma de Calidad


PrimariaparaMaterialParticuladoRespirableMP10,ModificadoporDSN45/2001.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia: Regula las concentraciones mximas de MP10 en el aire, tanto diarias como anuales,
paraestacionesdeclaradascomoEstacionesMonitorasconRepresentatividadPoblacional.

Relacinconelproyecto:Seproducirnemisionesatmosfricasdematerialparticuladoproducto
delasotrasdeconstruccinycierredelProyecto,ascomoemisionesprovenientesdelaerosin
quesufralacubetaderelavesfiltradosyeltrnsitopormovimientodeescoriasyconcentradoen
laetapadeoperacin.

FormadeCumplimiento:ElProyectoseencuentraalejadodezonaspobladas,porlocualnoaplica
estanormativa.Noobstante,seimplementarnmedidasdemitigacinparalaemisindematerial
particuladoreferentesalahumectacindecaminosycoberturadelapiladerelavesconmaterial
granular.

7.2.2.6DSN113/2003delMinisterioSecretaraGeneraldelaPresidencia.NormaPrimariade
CalidaddeAireparaDixidodeAzufre(SO2).

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:RegulalasconcentracionesmximasdeSO2enelaire,tantodiariascomoanuales,para
estacionesdeclaradascomoEstacionesMonitorasconRepresentatividadPoblacional.

Relacin con el proyecto: Los concentrados provenientes de la flotacin de escorias se


procesarnenlaFundicindeCobredePotrerillos,procesoenelcualsegeneraremisindeSO2,
dadoque,sibienlosconcentradosdeescoriacarecendeaportedeazufre,stosseprocesarn
mezcladosconconcentradosdecobredeotraprocedencia.

FormadeCumplimiento:ElProyectoseencuentraalejadodezonaspobladas,porlocualnoaplica
estanormativa.Noobstante,habindoserealizadoelbalancedemasayemisionesdelaFundicin
mediantelamodelacinMETSIM,sehaestimadoquelaemisindeAzufreglobaldelaFundicin
tendrunareduccinde2.261toneladasanuales.

CODELCOChile

Pgina 75 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

7.2.2.7DSN12/2011delMinisteriodelMedioAmbiente.EstableceNormaPrimariadeCalidad
AmbientalparaMaterialParticuladoFinoRespirableMP2,5.

Organismocompetente:SuperintendenciadelMedioAmbiente.

Materia: Regula las concentraciones mximas de MP2,5 en el aire, tanto diarias como anuales,
paraestacionesdeclaradascomoEstacionesMonitorasconRepresentatividadPoblacional.

RelacinconelProyecto:Seproducirnemisionesatmosfricasdematerialparticuladoproducto
delasotrasdeconstruccinycierredelProyecto,ascomoemisionesprovenientesdelaerosin
quesufralacubetaderelavesfiltradosyeltrnsitopormovimientodeescoriasyconcentradoen
laetapadeoperacin.

FormadeCumplimiento:ElProyectoseencuentraalejadodezonaspobladas,porlocualnoaplica
estanormativa.Noobstante,seimplementarnmedidasdemitigacinparalaemisindematerial
particuladoreferentesalahumectacindecaminosycoberturadelapiladerelavesconmaterial
granular.

7.2.2.8 DS N 144/1961, Ministerio de Salud. Establece Normas para Evitar Emanaciones o


ContaminantesAtmosfricosdeCualquieraNaturaleza.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:EstableceNormasparaEvitarEmanacionesoContaminantesAtmosfricosdeCualquiera
Naturaleza.

Artculo1:Losgases,vapores,humos,polvo,emanacionesocontaminantesdecualquiera
naturaleza, producidos en cualquier establecimiento fabril o lugar de trabajo, debern
captarseoeliminarseenformatalquenocausenpeligros,daosomolestiasalvecindario.

RelacinconelProyecto:Productodelasetapasdeconstruccin,operacinycierredelProyecto,
se generarn emisiones de material particulado y emisiones del tipo vehicular. Sin embargo el
Proyectonoseencuentracercanoasectorespoblados.

FormadeCumplimiento:SibienelProyectonocontarconsectorespobladoscercanos,durante
las distintas etapas del Proyecto se humectar frecuentemente los caminos con el objeto de
minimizar las emisiones de material particulado. Asimismo, para el caso de actividades de
transporteatravsdecontratistas,seconsideralaexigenciacontractualdeloestablecidoenlas
normas de emisin vehicular, en especial mediante la exigencia de los Certificados de Revisin
Tcnica vigentes de los vehculos a utilizar para el transporte. Para el caso de movimientos de
mquinas y vehculos propios, se considera la aplicacin irrestricta de la normativa interna
divisionalquehaceexigibleloscertificadosderevisintcnicaaldadelosvehculos.

Artculo7:Prohbeselacirculacindetodovehculomotorizadoquedespidahumovisible
porsutubodeescape.

CODELCOChile

Pgina 76 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Relacin con el Proyecto: El Proyecto considera el movimiento permanente de maquinaria para


laslaboresdetransportedemateriales,productos,subproductosyresiduos.

Forma de cumplimiento: Los vehculos y maquinaria contarn con las revisiones tcnicas y
mantencinadecuadaparaoperarenbuenascondiciones,sinemitirgasesenformasignificativani
advertiremisindehumovisibleatravsdeltubodeescape.

7.2.2.9 DS N 55/1994, Ministerio de Transporte y Telecomunicaciones. Establece Normas de


EmisinAplicablesaVehculosMotorizadosPesadosqueIndica.

(IncluyemodificacionesD.S.N16/98(MSGP);D.S.N20/2001(MSGP);D.S.N117/2002MSGP);
D.S.N58/2003(MSGP);D.S.75/2004;D.S.95/2005Normasrelacionadas:Res.Ex.2113/2004).
OrganismoCompetente:SecretaradeTransportes/CarabinerosdeChile

Materia: Regula los lmites de emisin de vehculos motorizados pesados que circulen por la
ReginMetropolitana,enelterritoriocontinentaldelaVReginyenlasregionesIV,VI,VII,VIII,IX
yX.

Relacin con el Proyecto: Se utilizarn vehculos pesados para el transporte de equipos y


materialesautilizarenlaconstruccindelProyecto.

Formadecumplimiento:Paraeltransportedeequiposymaterialesparalaetapadeconstruccin
delProyecto,seemplearflotademaquinariayvehculosnosuperioracincoaos,detalforma
quecertifiqueelcumplimientodeestanorma.Estacondicinserexigidaporcontrato,yadems
se podr exigir los certificados de emisiones de la maquinaria y vehculo, junto con la revisin
tcnicaalda.

7.2.2.10DSN4/1994,MinisteriodeTransportesyTelecomunicaciones.NormasdeEmisinde
ContaminantesAplicablesalosVehculosMotorizados.

Organismocompetente:SecretaradeTransporte.

Materia:Establecelasconcentracionesmximasdemonxidodecarbonohidrocarburosyhumos
visibles,enlaemisindetubosdeescapedevehculosmotorizados.

Relacin con el Proyecto: Durante las distintas etapas del Proyecto, se utilizarn vehculos
motorizadosparaelmovimientodemateriales.

Forma de cumplimiento: Todos los vehculos utilizados cumplirn con lo establecido en este
Decreto,locualserexigidoenformacontractual.

CODELCOChile

Pgina 77 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

7.2.2.11DSN686/1998,MinisteriodeEconomaFomentoyReconstruccin.NormadeEmisin
paralaRegulacindelaContaminacinLumnica.

Organismocompetente:SuperintendenciadeElectricidadyCombustibles.

Materia:EstableceloslmitesmximosdeemisinlumnicahacialoscielosnocturnosdelaII,IIIy
IVregiones.

Relacin con el Proyecto: El Proyecto considera la instalacin de luminaria exterior para el


alumbradodesusdiferentesreas.

Formadecumplimiento:Losindicadoresdelanormaseencuentranincorporadoseneldiseodel
Proyecto.

7.2.3 Agua
7.2.3.1 DS N 90/2000 Ministerio Secretara General de la Presidencia. Establece Norma de
EmisinparalaRegulacindeContaminantesAsociadosalasDescargasdeResiduosLquidosa
AguasMarinasyContinentalesSuperficiales.
OrganismoCompetente:SuperintendenciadeServiciosSanitarios.

Materia: Establece la concentracin mxima de contaminantes permitida para residuos lquidos


descargadosporlasfuentesemisoras,aloscuerposdeaguamarinosycontinentalessuperficiales
delaRepblicadeChile.

RelacinconelProyecto:ElProyectonoconsideraladescargaderesiduosindustrialeslquidosa
cursosdeaguascontinentalessuperficialesnimarinas.

Forma de cumplimiento: El Proyecto considera el uso de aguas residuales de los procesos de


enfriamientodelaPlantadeOxgenoyPlantasdeAguaparaelenfriamientodelaescoria.Tantoel
agua que rebalse de la etapa de enfriamiento, as como el agua recuperada de los procesos de
espesamiento y filtrado del concentrado y de la escoria, sern recuperados y recirculados al
proceso, constituyendo un circuito cerrado sin descargas al medio ambiente. Adems, en el
depsitoderelavesfiltradosseimplementarunasentinaparacaptaryrecuperartodaslasaguas
que filtren producto de las precipitaciones directas sobre el rea del depsito, las que sern
evaporadasy/orecirculadasalproceso.

7.2.3.2 DS N 594/1999 Ministerio de Salud. Reglamento Sobre Condiciones Sanitarias y


AmbientalesBsicasenlosLugaresdeTrabajo.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:Establecelascondicionessanitariasyambientalesbsicasquedebercumplirtodolugar
de trabajo, sin perjuicio de la reglamentacin especfica que se haya dictado o se dicte para
aquellasfaenasquerequierencondicionesespeciales.

CODELCOChile

Pgina 78 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

PrrafoIIDelaProvisindeAguaPotable,Artculos12al15:Establecequetodolugar
detrabajodebecontarconabastecimientodeaguapotable,ascomoregulalaaprobacin
dedichosistema.

RelacinconelProyecto:ElProyectodeberproveerdeaguapotableasustrabajadoresentodas
lasetapasdelmismo.

Formadecumplimiento:Elaguapotableprovendrdelsistemaactualdeabastecimientodeagua
potable que posee Potrerillos. En las etapas de construccin y cierre, cada empresa contratista
deber proveer a sus trabajadores de agua potable en suficiente cantidad, lo cual quedar
estipuladocontractualmente.

PrrafoIIIDelaDisposicindeResiduosIndustrialesLquidosySlidos,Artculos16y
17:Establecelaprohibicindevaciaralaredpblicadedesagessustanciaspeligrosas,
ascomolaprohibicindeincorporaralasnapasdeaguasubterrneayotros,losrelaves
industriales o mineros o las aguas contaminadas con productos txicos de cualquier
naturaleza.

RelacinconelProyecto:ElProyectonoconsideraladescargadesustanciaspeligrosasalsistema
dealcantarillado,niladisposicindelosrelavesminerosenlaszonasqueindica.

Forma de cumplimiento: El Proyecto considera es establecimiento de un circuito cerrado de


recirculacin de aguas en el proceso, por lo que no generar descarga de riles. Asimismo, las
bodegasysectoresenlosqueseutilicesustanciaspeligrosascontarnconunradierdehormign,
ysistemaderecuperacindederrames,evitandoquestosseviertanenlareddealcantarillado.
Asimismo,ladisposicinderelavesfiltradosserealizarenelsectordelaQuebradaAfluente,la
cual, de acuerdo al reconocimiento hidrogeolgico realizado as como los resultados de las
calicatasdealtaprofundidadefectuadas,noposeenapasubterrnea.

PrrafoIVDelosServiciosHiginicosyEvacuacindeAguasServidas,Artculo26:Las
aguasservidasdecarcterdomsticodebernserconducidasalalcantarilladopblico,o
en su defecto, su disposicin final se efectuar por medio de sistemas o plantas
particularesenconformidadalosreglamentosespecficosvigentes.

RelacinconelProyecto:elProyectorequerirlaprovisindebaosalostrabajadoresdurante
todassusetapas.

Formadecumplimiento:ElProyectoconsideraelestablecimientode3baosfijosenlazonadela
PlantadeFlotacin,loscualesestarnconectadosconelsistemadealcantarilladoparticularcon
quecuentaPotrerillos.Adems,paralasetapasdeconstruccinycierre,ascomoparalosbaos
ubicados en los sectores del depsito, stos sern retirados por una empresa debidamente
autorizada.

CODELCOChile

Pgina 79 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

7.2.3.4 Norma Chilena Oficial 409 Of. 2004 y Of. 2005. Ministerio de Salud. Requisitos de
CalidadyMuestreodelAguaPotable.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:Fijalacalidaddelaguapotable,ascomolosmtodosdemuestreoyanlisis.

RelacinconelProyecto:ElProyectoabastecerdeaguapotableasustrabajadores.

Forma de cumplimiento: Divisin Salvador proveer el agua potable desde el sistema actual
existenteenPotrerillos.LosanlisisdeaguapotablesoninformadosmensualmentealaAutoridad
Sanitaria.

7.2.4 Suelo

7.2.4.1 DFL 458/1976, del Ministerio de Vivienda y Urbanismo. Ley General de Urbanismo y
Construcciones.

Organismo competente: Ministerio de Vivienda y Urbanismo / Municipalidad de Diego de


Almagro.

Materia: Regula la planificacin urbana, urbanizacin y construccin para todo el territorio


nacional.

Artculo 61: (). La desafectacin de bienes nacionales de uso pblico se tramitar, por
consiguiente, como una modificacin del Plan Regulador. El decreto de desafectacin
dispondr, adems, la inscripcin de dominio del predio a nombre del Servicio
MetropolitanooRegionaldelaViviendayUrbanizacinquecorresponda.

RelacinconelProyecto:ElProyectoseencuentraubicadosobrelaPropiedaddenominadaAgua
de la Cortadera, de Divisin Salvador. Para el sector de emplazamiento de las instalaciones del
ProyectoFlotacindeEscoriasConvertidorTeniente,serequerirdelPermisoCambiodeUsode
Suelo.

Forma de cumplimiento: En el Anexo 16, se entregan los antecedentes para la solicitud del
PermisoCambiodeUsodeSueloenelmarcodelSEIA,yposterioralaautorizacindelProyecto,
serealizarlatramitacindelPermisoenformasectorial.

7.2.4.2 Decreto Ley N 3557/1980, Ministerio de Agricultura. Establece Disposiciones Sobre


ProteccinAgrcola.

OrganismoCompetente:ServicioAgrcolayGanadero.

Materia:Establecenormasgeneralessobreproteccinagrcola.

Artculo 11: Los establecimientos industriales, fabriles, mineros y cualquier otra entidad
que manipule productos susceptibles de contaminar la agricultura, debern adoptar

CODELCOChile

Pgina 80 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

oportunamente las medidas tcnicas y prcticas que sean procedentes a fin de evitar o
impedirlacontaminacin.().

RelacinconelProyecto:ElProyectoconsideralautilizacindesustanciaspeligrosas,decarcter
txicoenlasetapasdeflotacindeescoria.

Forma de cumplimiento: El manejo de las sustancias peligrosas se realizar por entero en el


interior del predio en el cual se emplazar el Proyecto, en el cual no se desarrollan actividades
agrcolas. Adems, el manejo de las sustancias se realizar de acuerdo a la normativa vigente
descritamsadelante.

7.2.5 Residuos

7.2.5.1DSN148,ReglamentodeResiduosPeligrososdelMinisteriodeSalud.
Organismocompetente:AutoridadSanitaria.

Materia: Este Reglamento establece las condiciones sanitarias y de seguridad mnimas a que
deber someterse la generacin, tenencia, almacenamiento, transporte, tratamiento, reuso,
reciclaje,disposicinfinalyotrasformasdeeliminacindelosresiduospeligrosos.

RelacinconelProyecto:Segenerarnresiduosenlasetapasdeconstruccin,operacinycierre.

Forma de Cumplimiento: El manejo de los residuos peligrosos, se realizar de acuerdo a lo


establecido en el procedimiento de Manejo de Residuos Slidos, adjunto en el Anexo 7, y su
destino final ser el Centro de Manejo de Residuos Slidos de la Divisin, aprobado
ambientalmente mediante RCA N 102A de 2001 y RCA N 078 de 2009, de acuerdo a lo
establecidoenelPlandeManejodeResiduosPeligrosos,cuyavisacinseencuentraenelAnexo
8.

7.2.5.2 DS N 594/1999, del Ministerio de Salud. Reglamento sobre Condiciones Sanitarias y


AmbientalesBsicasenlosLugaresdeTrabajo.
Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:EsteReglamentoestablecelasexigenciasaplicablesaloslugaresdetrabajo,tendientesa
mantener las condiciones sanitarias y ambientales bsicas para resguardar la salud de los
trabajadores.

Prrafo III (artculos 16 al 20): Regula la disposicin de residuos industriales lquidos y


slidos, prohibiendo el vaciamiento de sustancias peligrosas en desages de aguas
servidasyexigiendoautorizacinsanitariaparaladisposicinderesiduosindustriales.

Relacin con el proyecto: El proyecto sometido a evaluacin no contempla la generacin de


residuosindustrialeslquidos,peroscontemplalageneracinderesiduosslidosensusdistintas
etapas.

CODELCOChile

Pgina 81 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

FormadeCumplimiento:Elmanejodelosresiduosslidosagenerarseserealizardeacuerdoa
loestipuladoenelpunto5.3delapresenteDeclaracin,teniendocomodestinofinalelCentrode
ManejodeResiduosSlidos,autorizadomedianteRCAN102Ade2001yRCAN078de2009.

7.2.5.3 DFL725/1967,MinisteriodeSalud.CdigoSanitario.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:Regulaaspectosgeneralesrelacionadosconelfomento,proteccinyrecuperacindela
saluddelaspersonas.

Artculo80:CorrespondealServicioNacionaldeSaludautorizarlainstalacinyvigilarel
funcionamiento de todo lugar destinado a la acumulacin, seleccin, industrializacin,
comercioodisposicinfinaldebasurasydesperdiciosdecualquierclase.

Relacin con el proyecto: El proyecto sometido a evaluacin no contempla la generacin de


residuosindustrialeslquidos,peroscontemplalageneracinderesiduosslidosensusdistintas
etapas.

FormadeCumplimiento:Elmanejodelosresiduosslidosagenerarseserealizardeacuerdoa
loestipuladoenelpunto5.3delapresenteDeclaracin,teniendocomodestinofinalelCentrode
ManejodeResiduosSlidos,autorizadomedianteRCAN102Ade2001yRCAN078de2009.

7.2.6 SustanciasPeligrosas

7.2.6.1 DS N 594/1999 Ministerio de Salud. Reglamento Sobre Condiciones Sanitarias y


AmbientalesBsicasenlosLugaresdeTrabajo.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:Establecelascondicionessanitariasyambientalesbsicasquedebercumplirtodolugar
de trabajo, sin perjuicio de la reglamentacin especfica que se haya dictado o se dicte para
aquellasfaenasquerequierencondicionesespeciales.

Ttulo II, Prrafo I, Artculo 5: Regula las condiciones que deben presentar los pavimentos y
revestimientos de los pisos, as como las caractersticas de especficas de los pisos de los
lugaresdondesealmacenen,fabriquenomanipulenproductostxicosocorrosivos(slidosy
lavables,dematerialresistentealasustanciaalmacenada,impermeablesynoporosos).

TtuloIII,PrrafoI,Artculo32:Regulalaexistenciadeventilacin,artificialonatural,enlos
recintosdetrabajo.

Ttulo III, Prrafo II, Artculo 37: Regula las vas de evacuacin, zonas de seguridad y
sealizacionestendientesasuprimirelfactordepeligroexistenteenellugardetrabajo,yque
puedaafectarlaseguridadosaluddeltrabajador.

CODELCOChile

Pgina 82 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Ttulo III, Prrafo II, Artculo 39: Indica que las instalaciones elctricas y de gas deben ser
construidas,instaladas,protegidasymantenidasdeacuerdoalasnormasestablecidasporla
autoridadcompetente.
Ttulo III, Prrafo II, Artculo 42: Regula las condiciones que deben cumplir los recintos
destinadosparaelalmacenamientodematerialesysustanciaspeligrosas,indicandoquedebe
hacerse en recintos especficos, adecuados a las caractersticas de cada sustancia, estar
identificadasdeacuerdoalasnormaschilenasoficialesenlamateria.Asimismo,sealaquese
debemantenerdisponibleenellugardetrabajoenformapermanenteunplandetalladode
accinparaenfrentaremergencias,ylaHojadeDatosdeSeguridaddelasustanciapeligrosa
almacenada.
Ttulo III, Prrafo III, Artculos 44 al 52: Regula la implementacin de medidas para la
prevencindeincendiosenloslugaresdetrabajo,ascomolascaractersticasdestas.

RelacinconelProyecto:ElProyectorequieredelusoyalmacenamientodereactivosautilizaren
el proceso de flotacin de escorias, sustancias peligrosas catalogadas como txicas. Adems
requerir del uso de sustancias para efectuar las mantenciones a los equipos y maquinarias
contemplados(lubricantesyaceites).
Formadecumplimiento:LaDivisinimplementardosbodegasdealmacenamientoparainsumos
requeridos por el Proyecto, las cuales se encuentran descritas en el punto 3.14. En ambas, el
manejodelassustanciasserealizarconformealoestablecidoenesteReglamento.

7.2.6.2 Norma Chilena 2245 de 2003, Sustancias Qumicas Hojas de Datos de Seguridad
Requisitos.
Organismocompetente:MinisteriodeSalud.

Materia:Seestablecenlosrequisitosnecesariosparainformarsobrelascaractersticasesenciales
ylosgradosderiesgoquepresentanlassustanciasqumicasparalaspersonas,lasinstalacioneso
materiales, transporte y medioambiente. Las indicaciones que especifica la NCh, son una pauta
para la confeccin de la Hoja de Datos de Seguridad que deber estar disponible en los lugares
dondesemanipulensustanciaspeligrosas.TodaslasdisposicionesdeestaNormasonaplicablesal
proyecto.

Relacinconelproyecto:ElProyectoconsideraelusoyalmacenamientodereactivosrequeridos
paraelprocesodeflotacindeescorias,loscualesestncatalogadoscomosustanciastxicas,por
loquedebesometersealasexigenciasdeHojasdeDatosdeSeguridadqueregulaestaNorma.

Forma de Cumplimiento: La Divisin mantendr la HDS de los productos a utilizar para las
personas que lo requieran y participen en la manipulacin del barro andico. Las HDS de las
sustanciasautilizarseencuentranenelAnexo2.

CODELCOChile

Pgina 83 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

7.2.6.3NormaChilena382de2004,SustanciasQumicasClasificacinGeneral.
Organismocompetente:MinisteriodeTransporteyTelecomunicaciones.

Materia:EstableceunaclasificacingeneraldesustanciaspeligrosasporClaseyDivisin.Todaslas
disposicionesdeestaNormasonaplicablesalproyecto.

Relacin con el proyecto: El Proyecto considera el uso y almacenamiento de reactivos a utilizar


paralaflotacindeescorias,clasificadascomosustanciastxicas.

Forma de Cumplimiento: Los reactivos a utilizar se encuentran catalogados como sustancias


peligrosas pertenecientes a la Clase 6 de acuerdo a esta norma, lo que puede verificarse en las
HojasdeDatosdeSeguridadcontenidasenelAnexo2deestaDIA.
7.2.6.4 Norma Chilena 2120 de 2004, Sustancias Peligrosas Parte 6: Clase 6 Sustancias
TxicasySustanciasInfecciosas.
Organismocompetente:MinisteriodeTransporteyTelecomunicaciones.

Materia: Establece Clase o Divisin, riesgo secundario, grupo de embalaje/envase, disposiciones


generales y Nmero de gua GRE, para las sustancias catalogadas en la Clase 6. Todas las
disposicionesdeestaNormasonaplicablesalproyecto.

Relacin con el proyecto: El Proyecto considera el uso y almacenamiento de reactivos para la


flotacindeescorias,clasificadoscomosustanciaspeligrosaspertenecientesalaClase6.1.

Forma de Cumplimiento: El embalaje de los reactivos ser exigible contractualmente a los


proveedoresdestos.
7.2.6.5 Norma Chilena 2120 de 2004, Sustancias Peligrosas Parte 3: Clase 3 Lquidos
Inflamables.

Organismocompetente:MinisteriodeTransporteyTelecomunicaciones.

Materia: Establece Clase o Divisin, riesgo secundario, grupo de embalaje/envase, disposiciones


generales y Nmero de gua GRE, para las sustancias catalogadas en la Clase 3. Todas las
disposicionesdeestaNormasonaplicablesalproyecto.

Relacin con el proyecto: El Proyecto considera el uso y almacenamiento de petrleo, aceite y


lubricantes.

Forma de Cumplimiento: El embalaje de los productos ser exigible contractualmente a los


proveedoresdestos.
7.2.6.6NormaChilena2.137Of.92,SustanciasPeligrosas,Embalajes/Envases,Terminologa,
ClasificacinyDesignacin.

CODELCOChile

Pgina 84 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Organismocompetente:MinisteriodeTransporteyTelecomunicaciones.

Materia: Establece referencia sobre los embalajes/envases, terminologa, clasificacin y


designacin.TodaslasdisposicionesdeestaNormasonaplicablesalproyecto.

Relacinconelproyecto:ElProyectoconsideraelusoyalmacenamientodereactivosdeflotacin
de escorias, clasificados como sustancias peligrosas, por lo que debe dar cumplimiento a las
exigenciasespecficasdeenvasesyembalajeprevistasen estanorma.
FormadeCumplimiento:Paralaidentificacinyrotulacinparaelalmacenamientoyembalajede
las sustancias a utilizar, se exigir contractualmente el cumplimiento de esta disposicin al
proveedordestas.

7.2.6.7NormaChilena2.190Of.2003,TransportedeSustanciasPeligrosasDistintivospara
IdentificacindeRiesgos.

Organismocompetente:MinisteriodeTransporteyTelecomunicaciones.

Materia:Establecelosrequisitosdelosdistintivosdeseguridadconquesedebenidentificarlos
riesgosquepresentanlassustanciaspeligrosas;incluyendorequisitossobrelascaractersticasde
las marcas, etiquetas y rtulos, uso de ellos, excepciones en el uso, y lugares en que se deben
colocar.TodaslasdisposicionesdeestaNormasonaplicablesalproyecto.

Relacin con el Proyecto: el Proyecto requiere del uso de reactivos, petrleo, aceites y
lubricantes.

Forma de cumplimiento: Se exigir contractualmente al proveedor el cumplimiento de las


disposicionescontenidasenestaNormaparaeltransportedelosinsumoshacialaDivisin.

7.2.6.8 DSN78/2010,delMinisteriodeSalud.ApruebaReglamentodeAlmacenamientode
SustanciasPeligrosas.
Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia: Establece las condiciones de seguridad de las instalaciones de almacenamiento de


sustanciaspeligrosas.

Artculo 3: Indica las exclusiones del mbito de aplicacin del reglamento, entre las que se
seala:LasfaenasdelaindustriaextractivaminerareguladasporeldecretoN132de2002
delMinisteriodeMineraqueapruebaelReglamentodeSeguridadMinera.Noobstante,las
sustancias peligrosas almacenadas en las instalaciones o servicios de apoyo de las faenas
mineras, ubicadas en el radio urbano, se sometern a las disposiciones del presente
Reglamento,enloquefuerecompatibleconelReglamentodeSeguridadMinera.
Relacin con el proyecto: El Proyecto sometido a evaluacin contempla la habilitacin de dos
bodegasdealmacenamientodeinsumosparalaoperacindelmismo.

CODELCOChile

Pgina 85 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Forma de Cumplimiento: El Proyecto sometido a evaluacin es parte de una faena minera


extractivareguladaporelDSN132ReglamentodeSeguridad Minera,ylasinstalacionesdelas
bodegasconsideradas,seencuentranenelsectorindustrialdePotrerillos,fueradelradiourbano
delasciudadesmscercanas(distantea45KmdeElSalvadorya63KmdeDiegodeAlmagro),
raznporlacualquedaexcluidodelmbitodeaplicacindeestanormativa.

7.2.6.9 DSN160/2009,delMinisteriodeEconoma,FomentoyReconstruccin.Reglamento
de Seguridad para las Instalaciones y Operaciones de Produccin y Refinacin, Transporte,
Almacenamiento,DistribucinyAbastecimientodeCombustiblesLquidos.

Organismocompetente:SuperintendenciadeElectricidadyCombustibles

Materia: establece los requisitos mnimos de seguridad que deben cumplir las instalaciones de
combustibleslquidosderivadosdelpetrleoybiocombustibles,enadelanteeindistintamenteCL,
ylasoperacionesasociadasalaproduccin,refinacin,transporte,almacenamiento,distribucin
y abastecimiento de CL que se realicen en tales instalaciones, as como las obligaciones de las
personas naturales y jurdicas que intervienen en dichas operaciones, a objeto de desarrollar
dichas actividades en forma segura, controlando el riesgo de manera tal que no constituyan
peligroparalaspersonasy/ocosas.

RelacinconelProyecto:ElProyectorequieredelainstalacindeunestanquedealmacenamiento
depetrleo,de3,5m3decapacidad,paralaoperacindeungeneradordeenergaderespaldo,en
casosdefalloenelsuministroelctrico.

Forma de cumplimiento: El estanque de almacenamiento a implementar, ser adquirido a un


proveedorautorizado,ycontarconcertificacin.Asimismo,seimplementartodaslasmedidas
deseguridadcontenidasenelReglamento,ascomolasmedidasparacontencindederramesy
otrasemergencias,deacuerdoalosprocedimientosquelaDivisinmaneja(Anexo6PlanGeneral
deEmergencia).

7.2.6.10DSN298/2005,MinisteriodeEconomaFomentoyReconstruccin.Reglamentoparala
CetrtificacindeProductosElctricosyCombustibles,yDerogaDecretoqueindica.

OrganismoCompetente:SuperintendenciadeElectricidadyCombustibles.

Materia:CertificacindeProductosElctricosyCombustibles.

Artculo5:Indicalossistemasbajoloscualesdeberealizarselacertificacindeproductos
combustibles.

Relacin con el Proyecto: El Proyecto considera la implementacin de un estanque de


almacenamientodecombustiblepararespaldodelequipogeneradorelctrico.

Forma de cumplimiento: El estanque de almacenamiento a instalar, poseer la certificacin


correspondiente,cuyadocumentacinsermantenidaporlaDivisin.

CODELCOChile

Pgina 86 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

7.2.7 Transporte

7.2.7.1Enloreferentealvehculo

Organismocompetente:DireccindeVialidad.

Materia:
Ley18.290deTrnsito;
D.S.N100/79(Tiposdevehculos);
D.S.156/90(RevisinTcnica);
D.S.55/94(NormasdeEmisinparaVehculosPesados);
D.S.4/94(NormasdeEmisinparaVehculosenUso),
ResolucinN1/1995queEstableceDimensionesMximasaVehculosqueIndica;
ResolucinN1707/95(Tacgrafo);
ResolucinN1533/99(ParachoquesTraserosantiempotramiento);
ResolucinN1463/2000(ParachoquesTraserosantiempotramiento);
ResolucinN1464/2000(luceslaterales);
ResolucinN1465/2000(Cintasretrorreflectivas);
ResolucinN1465/2000(CintasRetroreflectivas);
D.S.N300/94(AntigedadMximadevehculosdecarga)y
ResolucinN333/70(Botiquinesenvehculosdecarga),
ResolucinN303/94(RelacinPesoPotencia),todalanormativaexistentedelMinisterio
deTransportesyTelecomunicaciones(MTT);
D.S. N 158/80 del M.O.P (pesos por ejes mximos, y la relacin peso bruto total en
funcindelasdistanciasdelasruedas)

RelacinconelProyecto:Esaplicableentodoelterritorionacionalalosvehculosquetransitan
porvaspblicas.

Forma de cumplimiento: El Proyecto para la etapa de construccin, realizar transporte de


equipos y materiales por caminos pblicos, por lo cual establecer en forma contractual al
Transportistaelcumplimientodelanormativaasociadaasuactividad.

7.2.7.2Enloreferentealtransporte
Organismocompetente:DireccindeVialidad.

Materia:
Ley18.290deTrnsito(TtuloIlicenciasdeConducir);
D.S75/87(CondicionesparaelTransportedeCarga);
D.S 298/94 todos del MTT (Reglamenta el Transporte de Cargas Peligrosas por Calles y
Caminos),ylaRes.Ex427/2002delaSEREMITT3regin).
DecretoconFuerzadeLeyN206/60delMinisteriodeObrasPblicasyLeyN15.840/1964
sobre Ley General del MOP, hoy refundida en el Decreto 294 de 1984, que regula la
habilitacinyusodecaminos

RelacinconelProyecto:Esaplicablealaactividaddetransportedecargas.

CODELCOChile

Pgina 87 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Forma de cumplimiento: El Proyecto para la etapa de construccin, realizar transporte de


equipos y materiales por caminos pblicos, por lo cual establecer en forma contractual al
Transportistaelcumplimientodelanormativaasociadaasuactividad.

7.2.8 Electricidad
7.2.8.1 EnloquerespectaalSuministro
Organismocompetente:MinisteriodeEconomaFomentoyReconstruccin

D.F.L. N 4/2007, Fija el Texto Refundido, Coordinado y Sistematizado, del Decreto con
FuerzadeLeyN1,deMinera,de1982,LeyGeneraldeServiciosElctricos.
DSN119/1989,ReglamentodeSancionesenMateriadeElectricidadyCombustibles.
Ley N 19.940/2004, Regula Sistemas de Trasporte de Energa Elctrica, Establece un
Nuevo Rgimen de Tarifas para Sistemas Elctricos Medianos e Introduce las
AdecuacionesqueIndicaalaLeyGeneraldeServiciosElctricos.
LeyN20.018/2005,ModificaelMarcoNormativodelSectorElctrico.
Ley N 20.040/2005, Modifica el Decreto con Fuerza de Ley N 1, de 1982, del
Ministerio de Minera, Ley General de Servicios Elctricos.
D.F.L. N 2/2006, Introduce Adecuaciones al Decreto con Fuerza de Ley N 1,
de Minera, de 1982, Ley General de Servicios Elctricos.

Organismocompetente:MinisteriodeMinera

DSN327/1997,ReglamentodelaLeyGeneraldeServiciosElctricos

Materia de los cuerpos normativos: Regulan la generacin, suministro, transporte, y uso de la


energaelctrica.

RelacinconelProyecto:losnivelesdetensinquemanejarelproyectosondemediatensiny
bajatensin.Lalneademediatensinesde12KVy4.16KVylalneadebajatensinesde380V

Formadecumplimiento:elProyectoconsideraensudiseotodalaregulacinelctricaaplicable.

7.2.8.2NormasTcnicas

DS N 91/1984, del Ministerio de Economa, Fomento y Reconstruccin, Deroga el


Artculo 50 del Reglamento de Instalaciones Elctricas y Fija Normas Tcnicas en
Materias que Seala.
Norma Chilena Elctrica 4/2003, Instalaciones de Consumo en Baja Tensin.
Norma Chilena Elctrica 10/84, Establece el procedimiento general para la puesta
en servicio de una instalacin interior de electricidad.
NSEG. 5 E.n. 71. Electricidad, tiene por objeto fijar las disposiciones para la
ejecucin de instalaciones elctricas de corrientes fuertes y para el mejoramiento o
modificaciones de las existentes.

NormaTcnicadeSeguridadyCalidaddeServiciodediciembrede2009

CODELCOChile

Pgina 88 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

NormasTcnicasparaelfuncionamientodelosCDEC
NormasTcnicasdeinstalacionesemitidasporlaSuperintendencia(NSEG)yestablecidasenla
NormaChilena(NCH).

Materia de los cuerpos normativos: Regulan el diseo y condiciones de seguridad de las


instalacioneselctricas.

RelacinconelProyecto:losnivelesdetensinquemanejarelproyectosondemediatensiny
bajatensin.Lalneademediatensinesde12KVy4.16KVylalneadebajatensinesde380V
Formadecumplimiento:elProyectoconsideraensudiseotodalaregulacinelctricaaplicable.

7.2.9 DisposicindeRelaves
7.2.9.1 DSN248/2007,delMinisteriodeMinera.ReglamentoparalaAprobacindeProyectos
deDiseo,Construccin,OperacinyCierredelosDepsitosdeRelaves.

Organismocompetente:ServicioNacionaldeGeologayMinera.

Materia:Fijanormassobreprocedimientosparalaaprobacindelosproyectosdedepsitosde
relavesmineros,ylosrequisitosdediseo,construccin,operacinycierredelosdepsitosde
relavesminerosyladisposicindesusobrasanexasquegaranticenlaseguridaddelaspersonasy
delosbienes.

RelacinconelProyecto:elProyectoconsideralaconstruccin,operacinycierredeundepsito
derelavesfiltradosal12%dehumedadpromedio.
Forma de cumplimiento: El Diseo del Depsito contiene las especificaciones indicadas en el
Reglamento. El Titular da cumplimiento a lo establecido en el Reglamento, mediante la
presentacin de esta Declaracin para su evaluacin, as como la presentacin de la
documentacin del Permiso Ambiental Sectorial N 84. Una vez aprobado el Proyecto, el Titular
entregarlosantecedentesnecesariosparalatramitacindelPermisoSectorialcorrespondiente.
(Anexo3).
7.2.10 RecursosNaturales

7.2.10.1 Resolucin Exenta N 133/2005, Ministerio de Agricultura. Establece Regulaciones


CuarentenariasparaelIngresodeEmbalajesdeMadera.

Organismocompetente:ServicioAgrcolayGanadero.

Materia: Seala que los embalajes de madera utilizados para el transporte de cualquier envo,
procedentesdelextranjerooentrnsitoporelterritorionacional,incluidolamaderadeestibade
carga.

CODELCOChile

Pgina 89 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

RelacinconelProyecto:ElProyectorequieredelaimportacindeequiposparalaoperacinde
laplantadeflotacin.

Forma de cumplimiento: Divisin Salvador dar cumplimiento a la normativa reglamentaria y


requerir su cumplimiento por parte de las empresas importadoras de partes o piezas que se
utilicen, extendiendo su cumplimiento a cualquier contratista. Se exigir la certificacin del
embalajedemadera.

7.2.10.2Ley19.473/1996,MinisteriodeAgricultura.LeydeCaza.

Organismocompetente:ServicioAgrcolayGanadero.

Materia:Regulalacazaocapturademamferosoanfibiosdelafaunasilvestre.

Artculo3:Prohbeseentodoelterritorionacionallacazaocapturadeejemplaresdela
fauna silvestre catalogados como especies en peligro de extincin, vulnerables, raras, y
escasamenteconocidas,ascomoladelasespeciescatalogadascomobeneficiosasparala
actividadsilvoagropecuaria,paralamantencindelequilibriodelosecosistemasnaturales
oquepresentendensidadespoblacionalesreducidas.

Relacin con el Proyecto: En la zona de la Quebrada Afluente, se detect la presencia de la


especieLiolaemusPlatei,LagartijadePlate,especiecatalogadacomoRara,enelDSN5/1998.En
la primera campaa de prospeccin de fauna se detectaron 2 individuos, y 3 en la tercera
campaa.

Formadecumplimiento:SeinstruiralpersonalqueparticipeenelProyecto,previoaliniciode
ste, acerca de la prohibicin establecida en la Ley. Asimismo, se implementarn letreros
informativosenelreadelProyecto.

7.2.10.3DSN5/1998,ModificadoporelDSN53/2003,MinisteriodeAgricultura.Reglamento
delaLeydeCaza.

Organismocompetente:ServicioAgrcolayGanadero.

Materia:Regulalacaza,captura,crianza,conservacinyutilizacinsustentabledeanimalesdela
faunasilvestre,conexcepcindelasespeciesylosrecursoshidrobiolgicos.

Artculo4:Seprohbelacazaocapturaentodoelterritoriodelassiguientesespeciesde
anfibios,reptiles,avesymamferos:()
LagartijadePlateLiolaemusPlatei
E:Especiecatalogadacomobenficaparalamantencindelequilibriode
losecosistemasnaturales.
R:EspeciecatalogadacomoRaraparalazonaNorte.

Relacin con el Proyecto: En la zona de la Quebrada Afluente, se detect la presencia de la


especieLiolaemusPlatei,LagartijadePlate,especiecatalogadacomoRara,enelDSN5/1998.En

CODELCOChile

Pgina 90 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

la primera campaa de prospeccin de fauna se detectaron 2 individuos, y 3 en la tercera


campaa.

Formadecumplimiento:SeinstruiralpersonalqueparticipeenelProyecto,previoaliniciode
ste, acerca de la prohibicin establecida en la Ley. Asimismo, se implementarn letreros
informativosenelreadelProyecto.

7.2.11 HigieneIndustrial
7.2.11.1 DS N 594/1999 Ministerio de Salud. Reglamento Sobre Condiciones Sanitarias y
AmbientalesBsicasenlosLugaresdeTrabajo.IncluyeDecretoN97/2011,ModificaDSN
594/1999.

Organismocompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:Establecelascondicionessanitariasyambientalesbsicasquedebercumplirtodolugar
de trabajo, sin perjuicio de la reglamentacin especfica que se haya dictado o se dicte para
aquellasfaenasquerequierencondicionesespeciales.
Relacin con el Proyecto: El Proyecto constituir un lugar de trabajo para las etapas de
construccin,operacinycierre,porcuantodebecumplirlasdisposicionesdeesteReglamento.

Forma de cumplimiento: Divisin Salvador cuenta con un Sistema de Gestin Integral, en cuyo
mbitogestionatodolorelacionadoconlahigienedesuslugaresdetrabajoylasaludocupacional
de sus trabajadores. Este sistema de gestin se extender para abarcar las reas que se
implementenconelProyectoenevaluacin.

7.2.12 SeguridadMinera
7.2.12.1DSN132/2004,delMinisteriodeMinera.ReglamentodeSeguridadMinera.

Organismocompetente:ServicioNacionaldeGeologayMinera.

Materia: Este Reglamento establece el marco regulatorio general al que deben someterse las
faenasdelaIndustriaExtractivaMineraNacionalpara:
a) Proteger la vida e integridad fsica de las personas que se desempean en dicha
Industriaydeaquellasquebajocircunstanciasespecificasydefinidasestnligadasaella.
b)Protegerlasinstalacioneseinfraestructuraquehacenposiblelasoperacionesmineras,
yporende,lacontinuidaddesusprocesos.
Relacin con el proyecto: El Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos,
formapartedeunafaenamineraextractivareguladaporelD.S.N132,dadoquecorrespondea
una actividad contenida dentro de las definiciones establecidas en el Reglamento. El DS N 132
aplicaensutotalidadparalaDivisinSalvador.
FormadeCumplimiento:ElProyectoformapartedeunafaenamineraextractivareguladaporel
D.S.N132,dadoquecorrespondeaunainstalacindeapoyoeinfraestructuranecesariaparael

CODELCOChile

Pgina 91 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

funcionamiento de las faenas de Divisin Salvador, por cuanto, as como con las faenas
actualmente existentes, el Titular dar cumplimiento de igual forma, a los requisitos de este
ReglamentoentodolorelacionadoconelProyectopresentadoparasuevaluacin.

Enespecialsepuedeindicar:

TTULOIINORMASGENERALES,CaptuloPrimeroDelasObligacionesdelasEmpresas.

RelacinconelProyecto:Establecelasnormasgeneralesquedebecumplirlaempresapara
iniciar, operar y cerrar su actividad, tanto en forma administrativa, de equipamiento, de
capacitacinytcnicos.

Forma de Cumplimiento: Divisin Salvador aplicar todos sus estndares, tanto tcnicos,
administrativos, de seguridad, de gestin, entre otros, a las actividades contempladas en el
Proyectoenevaluacin,manteniendo

Artculo 21. Toda empresa minera que inicie o reinicie obras o actividades, deber
previamenteinformarloporescritoalServicio,()

Forma de Cumplimiento: Divisin Salvador tiene inscritas sus operaciones ante el


Sernageomin.

Artculo23. (),laEmpresaMineradeberpresentarunProyectodePlan deCierrede


acuerdoaloqueenesteReglamento,ensuTtuloX,sedispone,paralaaprobacindel
Servicio.
Losplanesdecierredebernserrevisadoscadacincoaosenformatalqueseadecuena
lafaenamineraatravsdeltiempoyasegurenelcumplimientodelosobjetivosdelTtulo
XdelpresenteReglamento.()

FormadeCumplimiento:Enelpunto3.5delaDIAdelProyectoenevaluacin,sedetalla
la etapa de abandono o cierre del mismo. Las obras de cierre incluidas en esta DIA son
concordantes con el plan de cierre de Divisin Salvador, que fue aprobado mediante
ResolucinN1273delSERNAGEOMINdel3dejuliode2009,yposeeunaactualizacin
reciente,lacualfuepresentadaenenerode2011alSernageominparasurevisin.Enlo
sucesivo, el plan de cierre de Divisin Salvador ser actualizado de acuerdo a lo que
estableceel Reglamento deseguridadminera,enelcualseincorporarntodaslasreas
nuevasgeneradasapartirdeproyectos.

Artculo28.LasEmpresasMinerasdeberncapacitarasustrabajadoressobreelmtodo
yprocedimientoparaejecutarcorrectamentesutrabajo,implementandolosregistrosde
asistenciayasignaturas,quepodrnserrequeridosporelServicio.

Forma de Cumplimiento: Divisin Salvador mantiene permanentemente a sus


trabajadores capacitados para ejecutar las labores de sus puestos de trabajo. Una vez
aprobado el proyecto, y dado que planta de flotacin de escorias estar inserta en el
SistemadeGestinIntegraldelaDivisin,serndifundidosalpersonallosprocedimientos
deoperacindesta,mantenindoselosregistrosdeestacapacitacinenlaDivisin.

CODELCOChile

Pgina 92 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Artculo 29. Las Empresas mineras, para la ejecucin de sus trabajos, debern regirse
primeramente por las normas tcnicas especificadas en este Reglamento, luego por las
aprobadasporloscompetentesOrganismosNacionalesyensubsidio,poraquellasnormas
tcnicasinternacionalmenteaceptadas.

FormadeCumplimiento:DivisinSalvadorrigesusactividadesporlodispuestoenelD.S.
N132;sinperjuiciodeello,enelpunto6delaDIAsesealanotrasnormasaplicablesal
Proyectoenevaluacin.
Artculo30.Todoslosequipos,maquinarias,materiales,instalacioneseinsumos,debern
tenersusespecificacionestcnicasydefuncionamientoenidiomaespaol.

FormadeCumplimiento:Todaslasespecificacionesdesistemasyequipos,seencontrarn
enidiomaespaol.

Artculo 31. La Empresa minera debe adoptar las medidas necesarias para garantizar la
vida e integridad de los trabajadores propios y de terceros, como as mismo de los
equipos,maquinarias,einstalaciones,estnonoindicadasenesteReglamento.()
Tanto el acceso de visitas, como personal ajeno a las operaciones mineras de la faena,
deberestarreguladomedianteunprocedimientoquecauteledebidamentesuseguridad.

Forma de Cumplimiento: Divisin Salvador ha implementado, mantenido y mejorado


continuamentesuSistemadeGestindeSeguridadySaludOcupacional,partedelSistema
deGestinIntegrado,yhaformuladoentornoal,mltiplesmedidasparagarantizarla
vidaeintegridaddelostrabajadores,propiosydeterceros,ascomolosbienesfsicosde
laDivisin.Asimismo,paraelaccesodevisitas,todoelloestreguladoporprocedimientos
internosdeautorizacinycontrol.

Artculo 32. Ser deber de la Empresa Minera, proporcionar en forma gratuita a sus
trabajadores los elementos de proteccin personal adecuados a la funcin que
desempeen,debidamentecertificadosporunorganismocompetente.()

Forma de Cumplimiento: Divisin Salvador hace entrega gratuita de E.P.P. a sus


trabajadores y hace extensivo este requerimiento a sus empresas Contratistas. Todo lo
anteriorseencuentraexplicitadoenelReglamentoInternodeOrdenHigieneySeguridad
yelReglamentoEspecialparalaImplementacindeunSistemadeGestindeSeguridady
SaludOcupacional(RESSO).

Artculo35.Todaempresamineraconcien(100)omstrabajadoresdebercontarensu
organizacin conunDepartamentode PrevencindeRiesgos,el que deberserdirigido
exclusivamenteporunExpertoCategoraAoB,calificadoporelServicio.()

FormadeCumplimiento:DivisinSalvadorcuentaconunDepartamentodePrevencinde
RiesgosdeFaenas,dirigidoporunExpertoSernageomincategoraA.Losdocumentosde
respaldosseentreganenelAnexo18,SolicituddePAS94.

CODELCOChile

Pgina 93 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Artculo 36. Los productores mineros y los compradores de minerales y de productos


beneficiados, debern confeccionar mensualmente las informaciones estadsticas de
produccin,decomprasyaccidentesenlosformulariosestablecidosporelServicio.()

Forma de Cumplimiento: Divisin entrega mensualmente sus reportes al Servicio, razn


porlacual,losndicesdeseguridadasociadosalProyectosernincorporadosenl.

TTULO II NORMAS GENERALES, Captulo Segundo de las Obligaciones de los


Trabajadores,artculos38al41:indicalasobligacionesdelostrabajadoresensulugarde
trabajo.

FormadeCumplimiento:Lasobligacionesdelostrabajadoresseencuentranestablecidas
enelReglamentoInternodeOrden,HigieneySeguridaddelaDivisin.

TTULOIINORMASGENERALES,CaptuloTerceroNormasGenerales,artculos42al54,
56al58,60al62:Indicanormasgeneralesaimplementarenlafaenaminera.

FormadeCumplimiento:Lasnormasgeneralesindicadasenestosartculos,seencuentran
implementadas, y a la vez explicitadas en el Reglamento Interno de Orden, Higiene y
Seguridad,enelRESSO,ReglasporlaVida,procedimientoseinstructivosdetrabajo,yen
general, se encuentran incorporadas en el Sistema de Gestin Integrado que la Divisin
implement,mantieneymejoracontinuamente.

TTULO II NORMAS GENERALES, Captulo Cuarto Condiciones Sanitarias Mnimas en


Faenas Mineras, artculos 63 al 66: Indica las condiciones sanitarias mnimas a
implementarenunafaenaminera.

Forma de Cumplimiento: Divisin Salvador cumple con lo establecido en los artculos


indicados,otorgandoasustrabajadoreslosservicioshiginicosapropiados,aguafresca,y
casas de cambio. Asimismo, Divisin Salvador, da cumplimiento a los trminos
establecidosenelD.S.N594.ElcompromisodelaDivisinconelcumplimientodeeste
DecretoseindicaenelAnexo18,SolicituddePAS94.

TTULO II NORMAS GENERALES, Captulo Quinto Obligaciones Ambientales, artculos


67al70:Establecelasobligacionesambientalesdeunafaenaminera.

FormadeCumplimiento:laDIAdelProyectoFlotacindeEscoriasConvertidorTeniente
FundicinPotrerillos,dacumplimientoaloestablecidoenestosartculos.

TTULO II NORMAS GENERALES, Captulo Sexto Estadsticas, Accidentes y Planes de


Emergencia, artculos 71 al 77: Establece la forma de reportar las estadsticas de
seguridad,losrequisitosparaatenderprimerosauxiliosypersonalentrenado.

Forma de Cumplimiento: Mensualmente Divisin Salvador reporta las estadsticas de


seguridad propias y de terceros. Asimismo, y en especfico para el sector de Potrerillos,
lugarenelcualseencuentraubicadoelProyectoenevaluacin,secuentaconunaUnidad
deServiciodeAtencindeUrgenciayunabrigadadeemergencia.

CODELCOChile

Pgina 94 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

TTULOVIIPROCESAMIENTODESUSTANCIASMINERALES,Captulo Primero Plantasde


TratamientodeMinerales,artculos314al325: DefinealasPlantasdeTratamientode
Minerales,yestablecelosestndaresporloscualesdebenregirse.
Formadecumplimiento:ElProyectoenevaluacin,ascomolosantecedentesindicados
ensusAnexos,dancuentadelcumplimientodeestanormativa.

TTULOVIIPROCESAMIENTODESUSTANCIASMINERALES,Captulo Cuarto Depsitosde


Residuos Mineros, artculos 338: Define que los proyectos de depsitos de relaves se
regirnporelDSN248.

Forma de cumplimiento: El Titular dar cumplimiento de acuerdo a lo indicado en el


punto2.6.9.

TTULO IX INSTALACIONES Y SERVICIOS DE APOYO, Captulo Primero Generalidades,


artculos354al356:Definelasinstalacionesdeapoyoyestablecequestasdebencontar
conlosmejoresestndaresdefuncionamientodeacuerdoalascondicionesambientalesy
permanencia del personal en stas, as como el cumplimiento a la legislacin nacional
aplicable.

FormadeCumplimiento:ElProyectoenevaluacinentregalainformacinreferentealos
estndaresaplicadosparalaconstruccindeinstalacionesdeapoyo,comolosonbodegas,
estanques,yotros,ylasmedidasdeseguridadimplementadas.

TTULOIXINSTALACIONESYSERVICIOSDEAPOYO,CaptuloSegundoTransporte

Artculo357.Laconduccinyeltrnsitodevehculosenunafaenamineraseregirn,en
lo esencial, por las disposiciones contenidas en la Ley de Trnsito; las que sern
complementadas con medidas de carcter especfico propias de las condiciones
operacionalesdecadafaena,lasquenopodrnestarendiscordanciacondichaley,pero
spuedensermsexigentes.
Noobstanteloanterior,elServicio,atendiendolasparticularescondicionesqueimponeel
trnsitodeequiposymaquinariasmineras,podrautorizarmodalidadesdistintas.

Forma de Cumplimiento: Para el transporte de la escoria desde la Fundicin, as como


para el transporte del concentrado obtenido, Divisin Salvador cumplir con las
disposicionesestablecidasenlaLeydeTrnsito,dadoqueeltodoprocesodeobtencinde
licenciainternadeconducirsebasaendichanorma.

Artculo 374. Los vehculos automotores sern inspeccionados diariamente, en


especial los frenos, direccin, luces, bocina y depurador de gases, cuando
corresponda. Al comienzo de cada jornada, antes de ser puestos en servicio, deber
asegurarsequesehanefectuadolasreparacionesnecesarias.
Ningnvehculoautomotorpodrtransitarsitienealgndefectoencualquieradelos
sistemasantesmencionados.

CODELCOChile

Pgina 95 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Forma de Cumplimiento: Respecto a las inspecciones de los equipos y su estado de


operacin,estoseencuentraestipuladocontractualmente.

TTULO IX INSTALACIONES Y SERVICIOS DE APOYO, Captulo Quinto Sistemas


Elctricos: Establece las condiciones requeridas para las instalaciones elctricas, sus
mantenciones, reparaciones y operacin para las distintas partes que componen la
FaenaMineraengeneral.

FormadeCumplimiento:EldiseodelainstalacinelctricadelProyectocumpleconlo
indicadoenlanormativaelctricaaplicable.

Ttulo X NORMAS SOBRE CIERRE DE FAENAS MINERAS, Captulo Primero Normas


Generales, artculos 489 al 492: define Plan de Cierre, las consideraciones para su
formulacin, forma de presentacin y tramitacin del permiso ante el Sernageomin,
ascomolasatribucionesdeesteorganismoparalafiscalizacindeloscompromisos
delPlan.

FormadeCumplimiento:Enelpunto3.5delaDIAdelProyectoenevaluacin,sedetalla
laetapadeabandonodelmismo.

TtuloXNORMASSOBRECIERREDEFAENASMINERAS,CaptuloSegundoAspectos
TcnicosdelosProyectosdePlanesdeCierre,artculos498y499:

Artculo495:ElProyectodePlandeCierredeDepsitosdeRelavesdebercontener
losiguiente:
Desmantelamientodeinstalaciones,
Secadodelagunasdeaguasclaras,
Mantencindecanalesperimetrales,
Sistemadeevacuacindeaguaslluvias,
Cierredeaccesos,
Recubrimientodecubetaytaludes,
Estabilizacindetaludes,
Sealizaciones,
Habilitacindevertederodeemergencia,
Cercadodetorrescolectoras,
Instalacindecortavientos,
Compactacindebermadecoronamiento,
Piscinasdeemergencia(evaporacin),
Construccindemurodeproteccinalpiedeltalud,y
Medidasdereparacin.

FormadeCumplimiento:Enelpunto3.5delaDIAdelProyectoenevaluacin,sedetalla
laetapadeabandonodelmismo.

CODELCOChile

Artculo 498. El Proyecto de Plan de Cierre de Plantas, Edificios e Instalaciones


auxiliaresdeberreferirsealossiguientesaspectos:

Pgina 96 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Desmantelamiento de instalaciones, edificios, equipos y maquinarias, cuando fuese


necesario,
Desenergizarinstalaciones,
Cierredeaccesos,
Estabilizacindetaludes,
Sealizaciones,
Retirodematerialesyrepuestos,
Proteccindeestructurasremanentes.

FormadeCumplimiento:Enelpunto3.5delaDIAdelProyectoenevaluacin,sedetalla
laetapadeabandonodelmismo.

Artculo 499. El Proyecto de Plan de Cierre de Manejo de Residuos y otros deber


incluirlosiguiente:
Retirodeescombros,
Proteccindeestructurasremanentes,
Retiroydisposicinfinalderesiduosquenopermanecernenellugar,
Cierresyletrerosdeadvertencia,y
Disposicinfinalderesiduosquepermanecernenellugar.

FormadeCumplimiento:Enelpunto3.5delaDIAdelProyectoenevaluacin,sedetalla
laetapadeabandonodelmismo.Respectodelmanejoderesiduos,endichopuntodela
DIAsesealaquealdesmantelarlasinstalaciones,seanalizarsiposeecontaminacinpor
contactoconsustanciaspeligrosas.Encasodedeterminarsequecorrespondeaunresiduo
slido peligroso, la Divisin lo manejar de acuerdo a lo establecido en el DS N 148
ReglamentoSanitarioSobreelManejodeResiduosPeligrosos,odeacuerdoalanormativa
que se encuentre vigente a la fecha de cierre de la bodega, lo que ser informado
debidamentealaautoridad.

7.2.13 ProteccinRadiolgica
7.2.13.1 Ley 18.302/1984, Ministerio de Minera. Ley de Seguridad Nuclear (incluye
actualizaciones).

OrganismoCompetente:ComisinChilenadeEnergaNuclear.

Materia: Regula las actividades relacionadas con los usos pacficos de la energa nuclear y con
otrasinstalacionesylassustanciasnuclearesymaterialesradiactivosqueseutilicenenellascomo
desutransporte,conelobjetodeproveeralaproteccindelasalud,laseguridadyelresguardo
delaspersonas,losbienesyelmedioambienteyalajustaindemnizacinocompensacinporlos
daosquedichasactividadesprovocaren;deprevenirlaapropiacinindebidayelusoilcitodela
energa, sustancias e instalaciones, nucleares; y de asegurar el cumplimiento de los acuerdos o
conveniosinternacionales

RelacinconelProyecto:ElProyectoconsideralaimplementacindedensmetrosnuclearespara
lamedicindedensidaddeflujosdeentraday/osalidadeequiposprincipales.

CODELCOChile

Pgina 97 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

FormadeCumplimiento:DivisinSalvadorcumplircontodaslasdisposicionescontenidasenla
Ley,paralocual,previoaliniciodelasactividades,tramitaroportunamentetodoslospermisos
relacionadosconeltransporte,uso,almacenamientoydesechodelosequiposautilizar.

7.2.13.2 DS N 12/1985 Ministerio de Minera. Reglamento para el Transporte Seguro de


MaterialesRadiactivos.

OrganismoCompetente:ComisinChilenadeEnergaNuclear

Materia: Establece las condiciones que debe cumplir el transporte de materiales radiactivos en
todaslasmodalidadesdetransporteporvaterrestre,acuticaoarea,mientrastalesmateriales
radiactivosnoformenparteintegrantedelmediodetransporte.

RelacinconelProyecto:ElProyectoconsideralaimplementacindedensmetrosnuclearespara
lamedicindedensidaddeflujosdeentraday/osalidadeequiposprincipales.

FormadeCumplimiento:ElTitular,previoalaejecucindelaactividaddetransporte,gestionar
todaslasautorizacionesrequeridasparaefectuarlo,ascomoimplementartodaslasmedidasde
seguridadrequeridasporlalegislacin.

7.2.13.3 DS N 133/1984, Ministerio de Salud. Reglamento sobre Autorizaciones para


Instalaciones Radiactivas o Equipos Generadores de Radiaciones Ionizantes, Personal que se
DesempeaenEllas,uOperetalesEquiposyotrasActividadesAfines.

OrganismoCompetente:MinisteriodeSaludAutoridadSanitaria.

Materia:establecelas condicionesyrequisitosquedebencumplirlasinstalacionesradiactivas o
losequiposgeneradoresderadiacionesionizantes,elpersonalquesedesempeeenellasuopere
estosequipos,laimportacin,exportacin,distribucinyventadelassustanciasradiactivasque
se utilicen o mantengan en las instalaciones radiactivas o en los equipos generadores de
radiacionesionizantesyelabandonoodesechodesustanciasradiactivas.

RelacinconelProyecto:ElProyectoconsideralaimplementacindedensmetrosnuclearespara
lamedicindedensidaddeflujosdeentraday/osalidadeequiposprincipales.

Forma de cumplimiento: El Titular, previo al inicio de la implementacin de estos equipos,


solicitarlasautorizacionesrequeridas.

CODELCOChile

Pgina 98 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

PERMISOSAMBIENTALESSECTORIALESAPLICABLESALPROYECTO

A continuacin se revisa la aplicabilidad al Proyecto de los Permisos Ambientales Sectoriales en


relacin con el Reglamento del Sistema de Evaluacin de Impacto Ambiental (DS N 95/01). Se
sealaademslaautoridadqueotorgaelpermisoysurelacinconelproyecto.
IdentificacindelosPermisosSealadosen Autoridadquelo
RelacinconelProyecto
elD.S.N95/01
Otorga
Artculo 68. Permiso para arrojar lastre, DIRECTEMAR
No aplica, dado que el Proyecto de
escombrosobasurasyderramarpetrleoo
Flotacin de Escorias del Convertidor
sus derivados o residuos, aguas de relaves
Teniente, no considera arrojar ningn
de minerales u otras materias nocivas o
tipoderesiduosenlasaguassometidasa
peligrosas de cualquier especie, que
lajurisdiccinnacional.
ocasionen daos o perjuicios en las aguas
sometidas a la jurisdiccin nacional, y en
puertos, ros y lagos, a que se refiere el
artculo 142 del D.L. 2.222/78, Ley de
Navegacin.
Artculo 69. En los permisos para efectuar DIRECTEMAR
No aplica, dado que el Proyecto de
vertimientos en aguas sometidas a
Flotacin de Escorias del Convertidor
jurisdiccin nacional o en alta mar, desde
Teniente, no considera vertimientos en
naves, aeronaves, artefactos navales,
aguassometidasajurisdiccinnacional.
construcciones y obras portuarias, a que se
refierenlosartculos108y109delD.S.1/92
delMinisteriodeDefensaNacional
Artculo 70. En el permiso para emplazar DIRECTEMAR
No aplica, dado que el Proyecto de
instalaciones terrestres de recepcin de
Flotacin de Escorias del Convertidor
mezclas oleosas en puertos y terminales
Teniente, no considera emplazar
instalaciones terrestres de recepcin de
martimos del pas, a que se refiere el
mezclas oleosas en puertos y terminales
artculo 113 del D.S. 1/92 del Ministerio de
martimosdelpas.
DefensaNacional
Artculo 71. En el permiso para descargar DIRECTEMAR
No aplica, dado que el Proyecto de
en aguas sometidas a la jurisdiccin
Flotacin de Escorias del Convertidor
nacional, aguas que contengan mezclas
Teniente, no considera descargar en
oleosas, provenientes de una planta de
aguassometidasalajurisdiccinnacional
tratamiento de instalaciones terrestres de
ningntipodeaguasresiduales.
recepcin de mezclas oleosas, a que se
refiere el artculo 116 del D.S. 1/92 del
MinisteriodeDefensaNacional
Artculo72.Enlospermisosparainstalary DIRECTEMAR
No aplica, dado que el Proyecto de
Flotacin de Escorias del Convertidor
operar un terminal martimo y las caeras
Teniente, no considera instalar y operar
conductorasparaeltransportedesustancias
un terminal martimo, ni caeras
contaminantes o que sean susceptibles de
conductoras para el transporte de
contaminar, a que se refiere el artculo 117
sustancias contaminantes o que sean
del DS 1/92 del Ministerio de Defensa
susceptiblesdecontaminar.
Nacional.
Artculo73.Enelpermisoparaintroduciro DIRECTEMAR
No aplica, dado que el Proyecto de
descargar en aguas sometidas a la
Flotacin de Escorias del Convertidor
jurisdiccin nacional, materias, energa o
Teniente, no considera introducir o
sustancias nocivas o peligrosas de cualquier
descargar en aguas sometidas a la

CODELCOChile

Pgina 99 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

especie, que no ocasionen daos o


perjuiciosenlasaguas,lafloraolafauna,a
queserefiereelartculo140delDS1/92del
MinisteriodeDefensaNacional.

jurisdiccinnacional,materias,energao
sustancias nocivas o peligrosas de
cualquier especie, que no ocasionen
daosoperjuiciosenlasaguas,laflorao
lafauna.
Artculo 74. En los permisos para realizar SERNAPESCA
No aplica, dado que el Proyecto de
actividades de cultivo y produccin de
Flotacin de Escorias del Convertidor
recursos hidrobiolgicos, (DS N 430, de
Teniente, no considera realizar
1992, del Ministerio de Economa, Fomento
actividades de cultivo y produccin de
yReconstruccin).
recursoshidrobiolgicos.
Artculo 75. En los permisos para realizar
CONSEJODE
No aplica, dado que el Proyecto de
trabajos de conservacin, reparacin o MONUMENTOS Flotacin de Escorias del Convertidor
restauracin de Monumentos Histricos; NACIONALES Teniente, no considera realizar ningn
para remover objetos que formen parte o
tipo de trabajo asociado a monumentos
histricos.
pertenezcan a un Monumento Histrico;
para destruir, transformar o reparar un
Monumento
Histrico,
o
hacer
construcciones en sus alrededores; o para
excavaroedificarsielMonumentoHistrico
fuere un lugar o sitio eriazo, a que se
refieren los artculos 11 y 12 de la Ley N
17.288,sobreMonumentosNacionales.
CONSEJODE
Artculo 76. En los permisos para hacer
No aplica, dado que el Proyecto de
excavaciones de carcter o tipo MONUMENTOS Flotacin de Escorias del Convertidor
arqueolgico, antropolgico, paleontolgico NACIONALES Teniente,
no
considera
hacer
o antropoarqueolgico, a que se refieren
excavaciones de carcter o tipo
los artculos 22 y 23 de la Ley N 17.288,
arqueolgico,
antropolgico,
sobre Monumentos Nacionales, y su
paleontolgicooantropoarqueolgico.
Reglamento sobre Excavaciones y/o
Prospecciones
Arqueolgicas,
Antro
polgicas y Paleontolgicas, aprobado por
DS484/90,delMinisteriodeEducacin.
Artculo 77. En el permiso para hacer
CONSEJODE
No aplica, dado que el Proyecto de
construcciones nuevas en una zona MONUMENTOS Flotacin de Escorias del Convertidor
declarada tpica o pintoresca, o para NACIONALES Teniente,
no
considera
hacer
ejecutarobrasdereconstruccinodemera
construcciones nuevas en una zona
conservacin,aqueserefiereelartculo30
declarada tpica o pintoresca, o para
de la Ley N 17.288, sobre Monumentos
ejecutar obras de reconstruccin o de
Nacionales.
meraconservacin.
Artculo 78. En el permiso para iniciar
CONSEJODE
No aplica, dado que el Proyecto de
trabajos de construccin o excavacin, o MONUMENTOS Flotacin de Escorias del Convertidor
para desarrollar actividades como pesca, NACIONALES Teniente,noconsiderainiciartrabajosde
caza, explotacin rural o cualquiera otra
construccin o excavacin, o para
actividad que pudiera alterar el estado
desarrollaractividadescomopesca,caza,
natural de un Santuario de la Naturaleza, a
explotacin rural o cualquiera otra
que se refiere el artculo 31 de la Ley N
actividad que pudiera alterar el estado
17.288,sobreMonumentosNacionales.
naturaldeunSantuariodelaNaturaleza.

CODELCOChile

Pgina 100 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

DIRECCIN
No aplica, dado que el Proyecto de
Artculo 79. En el permiso para efectuar
exploraciones de aguas subterrneas enGENERALDEAGUAS Flotacin de Escorias del Convertidor
Teniente, no considera efectuar
terrenos pblicos o privados de zonas que
exploraciones de aguas subterrneas de
alimenten reas de vegas y de los llamados
ningntipo.
bofedales, en las Regiones de Tarapac y
Antofagasta, a que se refiere el inciso
tercero del artculo 58 del D.F.L. 1.122/81,
delMinisteriodeJusticia,CdigodeAguas.
Artculo 80. En el permiso para realizar
DIRECCIN
No aplica, dado que el Proyecto de
nuevas
explotaciones
o
mayoresGENERALDEAGUAS Flotacin de Escorias del Convertidor
Teniente, no considera efectuar
extracciones de aguas subterrneas que las
explotaciones de aguas subterrneas de
autorizadas, en zonas de prohibicin, a que
ningntipo.
se refiere el artculo 63 del D.F.L. 1.122/81,
delMinisteriodeJusticia,CdigodeAguas.
Artculo 81. En el permiso para el COMISINCHILENA En el Anexo 22 se entregan los
emplazamiento, construccin, puesta en
antecedentesparasolicitarelPAS81.
DEENERGIA
servicio,
operacin,
cierre
y
NUCLEAR
desmantelamiento, en su caso, de las
instalaciones, plantas, centros, laboratorios,
establecimientosyequiposnucleares,aque
se refiere el artculo 4 de la Ley N 18.302,
LeydeSeguridadNuclear.
Artculo 82. En el permiso para centrales COMISINCHILENA No aplica, dado que el Proyecto de
nucleares de potencia, plantas de
Flotacin de Escorias del Convertidor
DEENERGIA
enriquecimiento,
plantas
de
Teniente, no considera la instalacin de
NUCLEAR
reprocesamiento
y
depsitos
de
unacentraloplantadeenerganuclear.
almacenamiento permanente de desechos
calientes de larga vida, a que se refiere el
artculo 4 de la Ley N 18.302, Ley de
SeguridadNuclear.
Artculo 83. En el permiso para el COMISINCHILENA No aplica, dado que el Proyecto de
transporte de materiales radiactivos en
DEENERGIA
Flotacin de Escorias del Convertidor
todaslasmodalidadesdetransporteporva
NUCLEAR
Teniente, no considera transportar
terrestre, acutica o area, mientras tales
materialesradiactivos.
materiales radiactivos no formen parte
integrantedelmediodetransporte,aquese
refiere el artculo 1 del DS 12/85 del
MinisteriodeMinera.
Artculo 84. En elpermiso para emprender SERNAGEOMIN En el Anexo 3 se encuentran los
laconstruccindetranquesderelave,aque
antecedentesparasolicitarelPASN84.
serefiereelDecreto248/2004delMinisterio
de Minera, Reglamento de Construccin y
OperacindeTranquesdeRelaves.
Artculo 85. En el permiso para ejecutar SERNAGEOMIN No aplica, dado que el Proyecto de
labores mineras dentro de una ciudad o
Flotacin de Escorias del Convertidor
poblacin, en cementerios, en playas de
Teniente, no considera ejecutar ningn
puertos habilitados y en sitios destinados a
tipodelaboresmineras.
lacaptacindelasaguasnecesariasparaun
pueblo; a menor distancia de cincuenta
metros(50m),medidoshorizontalmente,de
edificios, caminos pblicos, ferrocarriles,

CODELCOChile

Pgina 101 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

lneaselctricasdealtatensin,andariveles,
conductos, defensas fluviales, cursos de
agua y lagos de uso pblico, y a menor
distancia de doscientos metros (200 m),
medidos horizontalmente, de obras de
embalse,
estaciones
de
radiocomunicaciones,
antenas
e
instalaciones de telecomunicaciones, a que
se refiere el artculo 17 N 1 de la Ley N
18.248,CdigodeMinera.
Artculo 86. En el permiso para ejecutar SERNAGEOMIN
labores mineras en lugares declarados
parques nacionales, reservas nacionales o
monumentos naturales, a que se refiere el
artculo17N2delaLeyN18.248,Cdigo
deMinera.
Artculo 87. En el permiso para ejecutar SERNAGEOMIN
labores mineras en covaderas o en lugares
que hayan sido declarados de inters
histrico o cientfico, a que se refiere el
artculo17,N6,delaLeyN18.248,Cdigo
deMinera.
Artculo 88. En el permiso para establecer SERNAGEOMIN
unapilamientoderesiduosminerosaquese
refiere el inciso 2 del artculo 233 y
botaderos de estriles a que se refiere el
artculo 318, ambos del DS N 72/85 del
Ministerio de Minera, Reglamento de
SeguridadMinera.
Artculo89.Enelpermisoparalaextraccin
MOPTT
de ripio y arena en los cauces de los ros y
esteros,aqueserefiereelartculo11dela
LeyN11.402.
Artculo 90. En el permiso para la
construccin, modificacin y ampliacin de
cualquierobrapblicaoparticulardestinada
AUTORIDAD
a la evacuacin, tratamiento o disposicin
SANITARIA
final de residuos industriales o mineros, a
que se refiere el artculo 71 letra b) del
D.F.L.725/67,CdigoSanitario.
Artculo 91. En el permiso para la
construccin, modificacin y ampliacin de
cualquierobrapblicaoparticulardestinada
a la evacuacin, tratamiento o disposicin
AUTORIDAD
final de desages y aguas servidas de
SANITARIA
cualquier naturaleza, a que se refiere el
artculo 71 letra b) del D.F.L. N 725/67,
CdigoSanitario.

CODELCOChile

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera ejecutar labores
minerasdeningntipo.

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera ejecutar labores
minerasdeningntipo.

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera establecer un
apilamientodelosresiduosindicadosen
elartculo88.

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera extraccin de
ridos.
No aplica, dado que el Proyecto de
Flotacin de Escorias del Convertidor
Teniente,noconsideraeltratamientode
residuosindustrialesymineros.
En el Anexo 19 se encuentran los
antecedentesparasolicitarelPASN91.

Pgina 102 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Artculo 92. En el permiso para ejecutar


labores mineras en sitios donde se han
alumbrado aguas subterrneas en terrenos
particulares o en aquellos lugares cuya
explotacin pueda afectar el caudal o la
calidad natural del agua, a que se refiere el
artculo 74 del D.F.L. N 725/67, Cdigo
Sanitario
Artculo 93. En los permisos para la
construccin, modificacin y ampliacin de
cualquierplantadetratamientodebasurasy
desperdicios de cualquier clase; o para la
instalacin de todo lugar destinado a la
acumulacin, seleccin, industrializacin,
comercio o disposicin final de basuras y
desperdicios de cualquier clase, a que se
refieren los artculos 79 y 80 del D.F.L. N
725/67,CdigoSanitario.
Artculo 94. En la calificacin de los
establecimientos industriales o de bodegaje
aqueserefiereelartculo4.14.2.delDSN
47/92, del Ministerio de Vivienda y
Urbanismo, Ordenanza General de
UrbanismoyConstrucciones.
Artculo 95. En los permisos para realizar
pesca de investigacin que sea necesaria
para el seguimiento de la condicin de
poblaciones de especies hidrobiolgicas en
la aplicacin del primer ao del plan de
seguimiento ambiental, a que se refiere el
TtuloVIIdelaLeyN18.892,LeyGeneralde
PescayAcuiculturaysusmodificaciones.
Artculo96.Enelpermisoparasubdividiry
urbanizar
terrenos
rurales
para
complementar alguna actividad industrial
con viviendas, dotar de equipamiento a
algnsectorrural,ohabilitarunbalnearioo
campamento turstico; o para las
construcciones
industriales,
de
equipamiento, turismo y poblaciones, fuera
deloslmitesurbanos,aqueserefierenlos
incisos 3 y 4 del artculo 55 del D.F.L. N
458/75 del Ministerio de Vivienda y
Urbanismo.
Artculo 97. En el permiso para la
instalacin de un cementerio, o de un
crematorio, a que se refiere el artculo 5
delDSN357/70delMinisteriodeSalud.
Artculo 98. En el permiso para la
recoleccin de huevos y cras con fines
cientficos o de reproduccin, a que se

CODELCOChile

AUTORIDAD
SANITARIA

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera ejecutar labores
minerasenlossitiosindicados.

AUTORIDAD
SANITARIA

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera la construccin,
modificacin y ampliacin de plantas de
tratamientodebasurasydesperdicios;ni
la instalacin de lugares para la
acumulacin,seleccin,industrializacin,
comercioodisposicinfinaldebasurasy
desperdicios.

AUTORIDAD
SANITARIA

En el Anexo 18 se encuentran los


antecedentesparasolicitarelPASN94.

SERNAPESCA

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera realizar pesca de
investigacin.

MINVU

En el Anexo 16 se encuentran los


antecedentesparasolicitarelPASN96.

MINSAL

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera la instalacin de
uncementerio,odeuncrematorio.
No aplica, dado que el Proyecto de
Flotacin de Escorias del Convertidor
Teniente,no considera la recoleccin de

MINAGRI

Pgina 103 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

refiere el artculo 5 de la Ley N 4.601,


sobreCaza.

huevos y cras con fines cientficos o de


reproduccin.

Artculo 99. En el permiso para la caza o


capturadelosejemplaresdeanimalesdelas
especies protegidas, a que se refiere el
artculo9delaLeyN4.601,sobreCaza.
Artculo 100. En el permiso para la
introduccin en el territorio nacional de
ejemplares vivos de especies exticas de la
fauna silvestre, semen, embriones, huevos
para incubar y larvas, a que se refiere el
artculo25delaLeyN4.601,sobreCaza.

MINAGRI

Artculo 101. En el permiso para la


construccindelasobrasaqueserefiereel
artculo294delD.F.L.N1.122de1981,del
MinisteriodeJusticia,CdigodeAguas.
Artculo 102. En el permiso para corta o
explotacin de bosque nativo, en cualquier
tipodeterrenos,oplantacionesubicadasen
terrenos de aptitud preferentemente
forestal, a que se refiere el artculo 21 del
DecretoLeyN701,de1974,sobreFomento
Forestal.
Artculo 103. En el permiso para la corta o
explotacindelaespecievegetaldecarcter
forestal denominada Alerce Fitzroya
cupressoides(Mol.)Johnston,cuandosta
tenga por objeto la habilitacin de terrenos
paralaconstruccindeobraspblicas,aque
se refiere el Decreto Supremo N 490, de
1976,delMinisteriodeAgricultura.
Artculo 104. En el permiso para la corta o
explotacindelaespecievegetaldecarcter
forestal denominada Pehun Araucaria
araucana(Mol.)K.Koch,cuandostatenga
porobjetolahabilitacindeterrenosparala
construccin de obras pblicas, a que se
refiere el Decreto SupremoN43,de1990,
delMinisteriodeAgricultura.
Artculo 105. En el permiso para la corta o
explotacin de Queule Gomortega keule
(Mol.) Baillon, Pitao Pitauia punctata
(Mol.), Belloto del Sur Beilschmiedia
berteroana(Gay)Kostern,RuilNothofagus
alessandrii Espinoza, Belloto del Norte
Beilschmiediamiersii(Gay)Kostern,cuando
statengaporobjetohabilitarterrenospara
la construccin de obras pblicas, a que se
refiere el Decreto SupremoN13,de1995,

MOPTT

CODELCOChile

MINAGRI

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente,noconsideralacazaocaptura
delosejemplaresdeanimales.
No aplica, dado que el Proyecto de
Flotacin de Escorias del Convertidor
Teniente,noconsideralaintroduccinen
elterritorionacionaldeejemplaresvivos
deespeciesexticasdelafaunasilvestre,
semen, embriones, huevos para incubar
ylarvas.
En el Anexo 20 se encuentran los
antecedentes para solicitar el PAS N
101.

MINAGRI

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera la corta o
explotacindebosquenativo.

MINAGRI

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera la corta o
explotacindeAlerce.

MINAGRI

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera la corta o
explotacindePehun.

MINAGRI

No aplica, dado que el Proyecto de


Flotacin de Escorias del Convertidor
Teniente, no considera la corta o
explotacindeQueule,Pitao,Bellotodel
Sur,Rul,BellotodelNorte.

Pgina 104 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

delMinisteriodeAgricultura.
Artculo 106. En el permiso para las obras
de regularizacin y defensa de cauces
naturales,aqueserefiereelsegundoinciso
delartculo171delD.F.L.N1.122de1981,
delMinisteriodeJusticia,CdigodeAguas.

MOPTT

En el Anexo 21 se encuentran los


antecedentes para solicitar el PAS N
106.

ConclusinGeneral:

De acuerdo al anlisis de los Permisos Ambientales Sectoriales establecidos en el DS N 95/01


ReglamentodelSEIAdesdeelArt.68alArt.106,seconcluyequeelProyectoFlotacindeEscorias
ConvertidorTenienteFundicinPotrerillos,requieresolicitarlossiguientesPermisosAmbientales
Sectoriales:

PASN81
PASN84
PASN91
PASN94
PASN96
PASN101
PASN106

CODELCOChile

Pgina 105 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

RELACINDELPROYECTOCONLASPOLTICAS,PLANESYPROGRAMASDEDESARROLLO
REGIONALYCOMUNAL

9.1RelacindelProyectoconlasPolticas,PlanesyProgramasdeDesarrolloRegionalyComunal
Conforme a lo dispuesto en el Artculo 9 ter de la Ley 20.417 de 2010 Crea el Ministerio, el
Servicio de Evaluacin Ambiental y la Superintendencia del Medio Ambiente, los proponentes
debern describir la forma en que los proyectos o actividades sometidos a evaluacin se
relacionanconlaspolticas,planesyprogramasdedesarrolloregional,ascomoconlosplanesde
desarrollocomunal.

Talcomose hasealado, elProyecto consideralaflotacindeescoriasparalarecuperacindel


cobre contenidas en stas, y aumentar as el rendimiento y porcentaje de recuperacin de la
FundicinPotrerillos.

ParaelanlisissehaconsideradolarevisindelaEstrategiaRegionaldeDesarrolloparaAtacama:
Periodo 20072017, donde se analizaron los lineamientos y los objetivos para determinar su
relacin con el Proyecto. Adems, para determinar la relacin del Proyecto con los planes de
desarrollocomunal,seanalizelPLADECOperiodo20112015,actualmentevigenteydisponible
enlaComunadeDiegodeAlmagro,dondeelProyectotendrsuinfluenciadirecta.

Acontinuacinsemuestraelanlisisantesmencionado.

CODELCOChile

Pgina 106 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Regin

Reginde
Atacama

CODELCOChile

Poltica/Plan/
Programa

ObjetivoyPolticaEstratgicarelacionadaconelProyecto

LineamientoEstratgicoN5:DiversificacinyMayorDinamismo
delaEconomaRegional.

Objetivo general: Promover una regin diversificada, tanto en su


canastadeproductos,comoenlospasesdedestino,sustentadaen
una produccin de bienes y servicios que incorpora nuevos
conocimientoseinnovacinpermanente,apartirdeldesarrollode
Estrategia Regional de actividades basadas en el uso eficiente de sus recursos y
Desarrollo de Atacama potencialidades, en el marco de un desarrollo sustentable
ambientalyterritorialmente.
20072017

Objetivo N 1: Incorporar infraestructura habilitante (inclusive


agua y energa) para el desarrollo y competitividad de las
empresas.

Meta 2: Lograr que el PIB regional represente el 3,2% del PIB


nacional.

Pgina 107 de 111

RelacinconelProyecto

El Proyecto Flotacin de Escorias


Convertidor Teniente Fundicin
Potrerillos, aumenta los niveles de
recuperacin metalrgica de la
Fundicin, de 95,2% a 97,4%, lo que
redundaenunamayorproduccinde
cobre. Este aumento en la
produccin, aporta al aumento del
PIBregional.

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Regin

Reginde
Atacama

CODELCOChile

Poltica/Plan/
Programa

ObjetivoyPolticaEstratgicarelacionadaconelProyecto

Lineamiento estratgico N9: Medio ambiente para el desarrollo


sustentable.

Objetivogeneral:
Fortalecer la institucionalidad regional encargada de la
planificacin e implementacin de las Polticas Pblicas de
MedioambienteenAtacama.

Gestionar el uso sustentable del patrimonio natural regional,


Estrategia Regional de promoviendo el desarrollo de una Educacin para la
Desarrollo de Atacama Sustentabilidad y garantizando el acceso ciudadano a la
InformacinAmbiental.
20072017

Objetivo 4: Garantizar el derecho ciudadano a vivir en un medio


ambiente libre de contaminacin previniendo y mitigando los
efectosdelasactividadesantrpicas,enestrecharelacinpblico
privada.

Meta8:Consolidarsistemapreventivodemonitoreosyanlisisde
calidad del aire ampliado y consolidado en las comunas de la
regindeAtacama.

Pgina 108 de 111

RelacinconelProyecto

El Proyecto de Flotacin de Escorias


Convertidor Teniente Fundicin
Potrerillos genera emisiones al aire,
peroquesinembargo,noimplicanla
superacin de normas de emisin
para la Zona Saturada de Potrerillos,
basados en que las actividades se
desarrollarn alejados de centros
poblados y se implementarn
medidasdemitigacin.
Por lo tanto, el Proyecto no se
contrapone con los Lineamientos
estratgicos, objetivos y metas
expresadasenlaERD.

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile Divisin Salvador

Comuna

DiegodeAlmagro

DiegodeAlmagro

CODELCOChile

ActividaddelProyecto
relacionada

Minera

Minera

Poltica/Plan/
Programa

PlanComunalde
DesarrolloSostenible
(20112014).

PlanComunalde
DesarrolloSostenible
(20112014).

ObjetivoyPolticaEstratgica
relacionadaconelProyecto
ImagenObjetivo:DiegodeAlmagro,una
comunaconunabaseproductivadiversa.

Objetivo estratgico 2: Generar


condiciones para que Diego de Almagro
cuente con ms y mejores fuentes de
trabajo.

ImagenObjetivo:DiegodeAlmagro,una
comunaambientalmentesustentable.

Objetivo estratgico 1: Disear Una


Adecuada Poltica Medioambiental Que
PromuevaElDesarrolloSustentableDeLa
Comuna.

Pgina 109 de 111

RelacinconelProyecto
Para las distintas etapas del
Proyecto Flotacin de Escorias
Convertidor Teniente Fundicin
Potrerillos,
se
considera
privilegiar la contratacin de
manodeobralocal.
ElProyectoFlotacindeEscorias
Convertidor Teniente se ajusta y
cumplir con toda la normativa
ambiental
aplicable,
contribuyendo al Desarrollo
Sustentable de la Comuna de
DiegodeAlmagro.

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile - Divisin Salvador

10

COMPROMISOSVOLUNTARIOS
Elproyectonocontemplalarealizacindecompromisosvoluntarios.

CODELCOChile

Pgina 110 de 111

DIA Flotacin de Escorias Convertidor Teniente Fundicin Potrerillos


CODELCO Chile - Divisin Salvador

11 FIRMADELADECLARACINDEIMPACTOAMBIENTAL

PORTANTO,deconformidadconloexpuestoprecedentementedeacuerdoconloestablecidoen
laLeysobreBasesGeneralesdelMedioAmbienteyenelReglamentodelSistemadeEvaluacin
deImpactoAmbiental,

Bajo juramento, declaro que, en base a los antecedentes presentados, cumplo con la normativa
ambientalvigenteasociadaalaejecucindelproyectooactividad.

RuegotenerpresentequemipersonerapararepresentaraCODELCOCHILE,constadelaescritura
pblica con fecha 12 de Abril de 2011, otorgada en Santiago, en la Notara de Osvaldo Pereira
Gonzlez,copiaactualizadadelacualseacompaaaestapresentacin.

RodrigoVargasVargas
RepresentanteLegal
CODELCOChileDivisinSalvador

CODELCOChile

Pgina 111 de 111