Está en la página 1de 299

Curso:Abordajeintegraldelaobesidadenlaniez

ProgramaGeneral

INTRODUCCION
En las ltimas tres dcadas distintos factores han favorecido la transicin demogrfica,
epidemiolgicaynutricionalenlospasesdeLatinoamrica.Unamayorurbanizacinyglobalizacin
ha conllevado a cambio en los patrones alimentarios, incrementando el consumo de grasas
saturadas y azcares refinados, e inactividad fsica debido a mayor disponibilidad y acceso a
transporte locomotor, tecnologas como herramientas de trabajo o recreacin y restriccin de
lugarespararecreacindebidoainexistenciadelosmismosoporrazonesdeseguridad.Todoello,
hafavorecidoalincrementodelsobrepesoyobesidadenadultos,adolescentesynios;resultando
enlaepidemiadelsigloXXI.

LaobesidadenadolescentesynioslescolocaenriesgodepadecerdiabetestipoII,hipertensin,
elevacin en los niveles de colesterol, problemas respiratorios, entre otros. Esto debiese ser de
suma preocupacin debido a que a temprana edad estas personas requerirn de atencin
profesionalparatratarenfermedadescrnicas,quedenoseratendidasadecuadamente,podrn
resultarendiscapacidades,altoscostosparalafamiliayelpas.

Esporello,queelprofesionaldesaluddebertenerlacapacidaddeabordardeformaefectivael
problemadesobrepesoyobesidadenlaniez;involucrandoalniooadolescenteyasufamilia.
Esto lo lograr al conocer el contexto del paciente, los avances en las tcnicas de diagnstico e
intervencin que se recomiendan a nivel clnico para lograr cambios y resultados a lo largo del
tiempo.

DESCRIPCIONDELCURSO
Elcursoestdirigidoaprofesionalesdelasaludconestudiosenmedicina,enfermera,nutricin,
psicologaocarrerasafines.

Estecursotendrunaduracinde14semanas,tiempoduranteelcualsecursarnunmdulode
induccinyprcticasobreelusoynavegacinenelaulavirtualytresmdulostemticosenlos
cualesseabordarnlossiguientestemas:1)Ambienteobesognicoycambiodecomportamiento,
2)Actividadfsicaenniosyadolescentesy3)Diagnsticoytratamientonutricionaldelpaciente


consobrepesoyobesidad.Elmdulointroductoriotendrunaduracindedossemanasylostres
mdulos temticos tendrn una duracin de cuatro semanas con entrega de actividades y
participacin en una o dos sesiones virtuales a lo largo de cada uno. Estas sesiones virtuales de
realizarn los das sbado, en las cuales los participantes y uno de los profesores y expertos se
conectaranenlneaalmismotiempo(sesinsincrnica)paraimpartirunacharlamagistralytener
uncortoforodediscusinalfinalizar.

Paracompletarexitosamenteelcursosehaestimadoqueelparticipantedeberdedicardedosa
treshorasdiarias.

El curso contara con el apoyo de un tutor por cada 25 a 30 participantes, quienes orientaran y
guiarnelaprendizaje.Elprogramaacadmicodelcursocomprendeuntotalde140horas,durante
las cuales se realizar lectura de documentos, observacin de videos, participacin en sesiones
virtualesyrealizacindeactividadesdeaprendizajequecomplementarnyreforzarnelcontenido
asignadoparacadatema.

COMPETENCIAYOBJETIVOSESPECFICOS
Alfinalizarelcursoelparticipanteestarenlacapacidaddedesarrollarestrategiasparaelabordaje
efectivoanivelclnicodelpacientepeditricoobeso.Atravsde:

Conocerdelosdeterminantespsicosocialesasociadosalaobesidadyloselementosbsicos
delamotivacinparaelcambiodelcomportamientobasadosenlaprcticadelatcnicade
laentrevistamotivacional.

Comprender la importancia de la actividad fsica para la prevencin y tratamiento del


pacientepeditricoconsobrepesoyobesidad,recomendacionesyprogramasdeactividad
fsicayreduccindelaactividadsedentariadirigidosalafamilia.

Realizardiferentesdeterminacionestravsdeherramientasdiagnsticasypredictivasde
sobrepeso/obesidad, as como plantear un plan de trabajo individualizado como ruta
terapeticanutricional.


CONTENIDOS
Ambienteobesognicoy
cambiodecomportamiento

Actividadfsicaenniosy
adolescentes

TransicinNutricionalen
AmricaLatina
Determinantesdela
obesidadyposibles
estrategiasdeintervencin
Introduccinalcambiode
conductacentradoenel
paciente
Practicadelatcnicas
teraputicasutilizadaenla
entrevistamotivacionalpara
cambiodeconducta

Epidemiologay
fisiopatologadelaobesidad
ylainfluenciadelaactividad
fsica(Balanceenergtico)
Beneficiosy
recomendacionesdela
actividadfsicaenniosy
adolescentesyevaluacin
delacondicinfsica.
Programasdeactividad
fsicaydereduccindela
actividadsedentaria,trabajo
conlafamilia
Ejemplosdejuegos
dinmicos,recreacinldica
yotrasactividades
recreativas

Diagnsticoytratamiento
nutricionaldelpacientecon
sobrepesoyobesidad
Cribaje/Valoraciondel
estadonutricionaldelnio
consobrepeso/obesidad
Parmetrosdeintervencin
nutricionaldelniocon
sobrepesoyobesidad
Patologasasociadasa
sobrepesoyobesidad
infantil.Prevenciny
tratamiento

METODOLOGAYACTIVIDADES
Lametodologaenseanzaaprendizajeempleadasebasaenlateoradelconstructivismo,apartir
delacualcadaparticipantedesarrollaunprocesonicodeaprendizajeapartirdelosconocimientos
yexperienciaspreviasdecadaunoylasdelosotrosparticipantesconloscualesinteracteatravs
delasdiferentesactividadesprogramadasenelcurso.

Algunas de las actividades diseadas para el logro de los objetivos propuestos se describen a
continuacin:

Sesionesvirtuales:Sehanprogramadoconlosexpertosytutoresparaabordarcadaunode
los mdulos propuestos. Estas sesiones permitirn que el participante adquiera nuevos
conocimientosycompartaexperienciaseinquietudesconlosexpertos,tutoresyelresto
departicipantes.

Forosdediscusin:Dentrodecadaunodelosmdulosestcontempladounforoenlos
cuales se colocar una pregunta generadora de discusin relacionada al tema de


aprendizaje.Pararealizarsusaportes,losparticipantesrevisaranlaslecturasyrealizarn
bsquedasenInternetdeotrasreferencias.Lostutoresrealimentarnycalificarncada
unodelosaportes.

Estudiodecaso:esladescripcindeunasituacinconcretaatravsdelacualsepretende
que los alumnos estudien la situacin, definan los problemas, lleguen a sus propias
conclusionessobrelasaccionesquehabraqueemprender,contrastenideas,lasdefiendan
ylasreelaborenconnuevasaportaciones.

Cuestionarios: representan una actividad destinada a comprobar la lectura, revisin de


presentacionesvirtualesyasistenciaalassesionessincrnicasimpartidasporexpertos.Para
estaactividadlosparticipantesdebernrespondera5preguntasrelacionadasconeltema
delasemana.

Simulaciones: son situaciones ficticias a travs de las cuales los participantes debern
demostrarlacorrectaaplicacindelastcnicassolicitadas

Ensayos: es un escrito en prosa, generalmente breve, que expone una interpretacin


personalsobreuntemaenespecial.Lasideasseentrelazanenformaorganizadaparadar
unalgicainternaalacomposicin.Elensayopuedepartirdelareflexindeotrosydebe
convencerconlosargumentosqueallseexponen.

EVALUACION
Paraelprocesodeevaluacinseutilizaranrubricasdeevaluacinparaasignarlacalificacin
correspondienteconbaseacriteriosdeevaluacinpreviamenteestablecidos.
Eltutorasignadoencadamduloserelencargadodeevaluaryrealimentarcadaunadelas
actividadesdeenseanzaaprendizaje.
Enelcuadro1sepresentalaponderacinqueserasignadaacadaunodelosmdulospropuestos
dentrodeestecurso.

Cuadro1:Ponderacindelosmdulos

Modulo
Ponderacin


Ambienteobesognicoycambiodecomportamiento
30puntos
Balanceenergtico:Ingestaygasto(Actividadfsica)
35puntos
Diagnstico y tratamiento nutricional del paciente con 35puntos
sobrepesoyobesidad
Total
100puntos

Cabemencionarquelostrabajosentregadosdespusdelafechalmite,sernpenalizados.
Paraaprobarelcursoelparticipantedeberalcanzarlacalificacinmnimade70puntospara
obtenereldiplomacorrespondientealfinalizarelcurso.

CRONOGRAMA
Mdulo
Induccinyprcticasobreaulavirtual

Fechas
14deoctubreal20
deoctubre
Ambienteobesognicoycambiodecomportamiento
21deoctubreal17
denoviembre
Balanceenergtico:Ingestaygasto(Actividadfsica)
18denoviembreal
15dediciembre
Diagnstico y tratamiento nutricional del paciente con sobrepeso y 13deeneroal13de
obesidad
febrero

EXPERTOS
Margarita Safdie, PhD. posee un doctorado (PhD) en Kinesiologa y Promocin de la Salud de
QueensUniversity,Canad.HaejercidocomoinvestigadoraenelCentrodeInvestigacionesparala
NutricinylaSaluddelInstitutoNacionaldeSaludPblicaenCuernavaca,Mxico,dondetambin
trabajcomoprofesoradenutricinycoordinadoradelaconcentracindenutricindentrodela
Maestra de Salud Pblica. Tambin tiene experiencia como coordinadora de proyectos de
investigacin igual como en la implementacin de proyectos, metodologas cualitativas y
cuantitativasparaelmonitoreodietarioenmujeresynios,polticaalimentariaynutricindesalud
pblica.


ManuelRamrezZea,MD,PhD.EselCoordinadordelCentrodeInvestigacindelINCAPparala
PrevencindelasEnfermedadesCrnicas(CIIPEC)enMesoamricayRepblicaDominicanaydel
Laboratorio de Fisiologa y Composicin Corporal del Instituto de Nutricin de Centro Amrica y
PanamINCAP.ElDr.RamreztieneundoctoradoenCienciasdelEjercicioydelDeporteobtenido
enlaUniversidadEstataldePensilvania,conmsde10aosdeexperiencia,particularmenteen
investigacin cientfica y formacin de recursos humanos. El Dr. Ramrez tiene diversas
publicaciones en revistas cientficas internacionales sobre los temas de composicin corporal,
medicindeactividadfsicaycondicinfsicas,gastoenergtico,entreotros.
Gabriel Tarducci, MSc, Ph.D. Profesor titular de la Universidad de ISALUD y de la Universidad
Nacional de La Plata en Argentina. El doctor Tarducci concluy recientemente el programa de
doctoradoenlaUniversidaddeACorua,Espaa,FacultaddeEducacinFsicayenlaUniversidad
de Buenos Aires, Facultad de Farmacia y Bioqumica, rea Nutricin Humana. Ha impartido
numerososcursossobreactividadfsicaysaludytienemsde20publicacioneseneltema.Hasido
colaboradordelaReddeActividadFsicadelasAmricas,iniciativadelCenterforDiseaseControl
/WorldHealthOrgnization,eintegrantedelConsejoAsesordelaOrganizacinSaludenFamiliade
Espaa.
ReinaLlad,MD,MS.Mdicoycirujanoconmsterenpediatrayneonatologaconmsdediez
aos de experiencia en la atencin clnica peditrica. Ha coordinado el programa Nios en
movimiento en Palma de Mallorca desde el 2006 a la fecha y el proyecto Ramallet sobre
prevencinytratamientodesobrepesoyobesidadenpersonasconSndromedeDowndeAtencin
Tempranadesdeel2012.LefueotorgadoelttulodeAntropometristaalfinalizaryaprobarelcurso
decertificacin:InternacionalenCineantropometria.IsaknivelIdictadoporInternationalSociety
ofAdvancementofKinanthropometry,USA.

COORDINACION
GabrielaMejicano
LicenciadaenNutricinegresadadelaUniversidadFranciscoMarroqunenlaciudaddeGuatemala,
posee una Maestra en Nutricin y Alimentacin de la Universidad San Carlos de Guatemala y
recientementecompletelPostgradodeDireccinyGestindeProyectosFormativosconeluso
delasTICenlaUnivesitatObertadeCatalunya,Barcelona,Espaa.Harecibidodoscursosdediseo


instruccional para entornos virtuales y un curso de tutora virtual ofrecido por la Organizacin
Panamericana de la Salud (OPS). Actualmente es Coordinadora Acadmica del Centro de
InvestigacindelINCAPparalaPrevencinde EnfermedadesCrnicas(CIIPEC).Cuenta consiete
aosdeexperiencia enel diseo,implementaciny desarrollodecursosvirtualesen elCampus
VirtualdeSaludPblicadelaOPSyenelAulaVirtualdelINCAP.

DinaRoche
Licenciada en Nutricin Clnica egresada de la Universidad Francisco Marroqun en la ciudad de
Guatemala,actualmenteseencuentracursandounamaestraenNeurofisiologadelaConductade
laUniversidadFrancisco Marroqun,Guatemala.Complethace algunosaoselcursode diseo
instruccional para educacin virtual dictado en el INCAP. Tiene experiencia en el desarrollo,
coordinacinyevaluacindecursosimpartidosenelAulaVirtualdelINCAP.Actualmentetrabaja
enelreadecapacitacinydifusindeinformacindelCentrodeInvestigacindelINCAPparala
prevencindeenfermedadescrnicas(CIIPEC).

GuadeDesarrollo
Mdulo:AmbienteObesognicoyCambiodeConducta
I.

II.

III.

Introduccin
Paragarantizarlaefectividaddelostratamientosenlospacientesconobesidad
enlaniezyqueestoslogrenincidirdirectamenteenlacalidaddevidadeellos,
debieranexistirporlomenosdoscondiciones:unaadecuadaprescripcinpor
partedelprofesionaldelasaludyuncorrectocumplimientodelamisma.

Esimportanteparalosprofesionalesdelasaludquetrabajanconlapoblacin
infantilconozcanlosdeterminantes,consecuenciasyposiblestratamientosde
la obesidad infantil; con el fin de poder identificar las obstculos y posibles
aliadosquecontribuyanalaadherenciadelostratamientosprescritos.

Portratarsedeunproblemadesaludpblicaqueincluyemltiplesfactoresy
que adems posee una naturaleza compleja donde los factores comporta
mentalesylossubjetivosdesempeanunrolimportante,seconsideraquela
motivacinparageneraruncambiodeconductaenestapoblacinesvitalpara
garantizarunestilodevidasaludable.

A travs del presente mdulo se pretende dar a conocer al participante


herramientas para motivar, acompaar y mantener al paciente y familia
involucrados dentro de su tratamiento; y as poder identificar las variables
implicadasenelcumplimientodelmismoyelusodeestrategiasqueayudena
lamotivacindelpacienteydelafamilia.

Competencias
Alfinalizarelmduloelparticipantereconocerlosdeterminantesasociadosa
la obesidad y la importancia de la motivacin para generar un cambio de
conductaenlospacientesconobesidaddurantelaetapadelaniez.

Objetivosespecficos
Alfinalizarestemduloustedpodr:

1. Comprender conceptos de la transicin nutricional y cuales son los


determinantesenlaepidemiadelaobesidad

2. Hacerunanlisiscrticodelainformacinymejorarelconocimientoyla
comprensin de las complicaciones de la obesidad y los posibles
tratamientosindividuales,familiaresypolticos.

3. Conocerunaestrategiamotivacionaldecambiodeconductacentradaen
clientesymanejodelosconceptosbsicosparalamotivacindecambio
deconducta.

4. Aplicarymanejarlosconceptosyelementosbsicosdelatcnicadela
entrevista motivacional para el cambio de conducta centrada en las
necesidadesdelcliente.
IV.

Contenidos
a. Tema1:TransicinNutricionalenAmricaLatina

Lecturasbsicas
Barrry M Popkin, Linda S Adair y Shu Wen Ng. Transicin de la nutricin
globalypandemiadelaobesidadenpasesendesarrollo.NutritionReviews
Vol70(1):321.Doi:10.1111/j.17534887.2011.00456x.
Sinopsis:Actualmentelasdietasdependenmsdealimentosprocesados,y
laspersonashanaumentadosuconsumodealimentosfueradecasa,mayor
consumodeaceitescomestiblesybebidasendulzadasconazcar.Tambin
se ha observado una disminucin en la actividad fsica y el aumento del
sedentarismo. Los efectos negativos de estos cambios en la conducta de
alimentacinhaniniciadoaserreconocidosenpoblacionesdebajoymedio
ingreso econmico, pues ha llamado la atencin de la salud pblica el
aparecimiento de enfermedades como la diabetes, hipertensin y la
obesidad.Enestarevisinsedocumentanloscambiosquehanocurridoy
ocurren en relacin a la obesidad global y describe lo que algunos pases
estn haciendo en respuesta a ello. Se hace nfasis en las opciones
potencialesconsideradasporlospasesconbajoymedioingresoeconmico.

Ascomotambinproveeunaevaluacincomprensivadelestadoactualde
lacienciasobreloscambiosrelacionadosconlaalimentacinqueocurrenen
lospasesdelmundoconbajoymedioingresoeconmico.

Joseph A Skelton et al. Etiologies of Obesity in Children: Nature and


Nurture. Pediatr Clin N Am 58 (2011) 1331354 doi:
10.1016/j.pcl.2011.09.006
Sinopsis: La investigacin cientfica ha proporcionado una perspectiva
increbledelascausasyfactoresquecontribuyenalaobesidadinfantil,un
asunto biopsicosocial profundamente complejo. El modelo ecolgico para
comprenderlaobesidadeselquemejorcaptalosfactoresimplicadosquese
sobreponen. En este artculo, los autores proporcionan una breve visin
divididaentrelosfactoresbiolgicos(naturaleza)ylosfactorespsicosociales
ydecomportamiento(crianza).Sinembargocomoconcualquiercondicin
compleja,lalneaentrelosdospuedefrecuentementeborrarse.

Kumanyika Shiriki. Environmental influences of childhood obesity: Ethnic


andculturalinfluencesincontext.PhysiologyandBehavior94(2008)6170.
Doi:10.1016/j.physbeh.2007.11.019.
Sinopsis: La etnicidad se asocia con las diferencias relacionadas con la
alimentacin, preferencias y comportamientos y las influencias culturales
pueden contribuir al riesgo de obesidad en la niez. Sin embargo, las
actitudes culturales y creencias no son la nica fuente potencial de la
variacin tnica en la prevalencia de la obesidad infantil y no deben
estudiarsedeformaaislada.Lasvariablesdemogrficas,socioculturalesy
ambientales deben tambin ser consideradas. Este artculo resalta la
evidenciasobrelasvariacionesenlosgrupostnicosylaformaenlacuallas
variables culturales y otras variables ambientales que varan entre grupos
tnicospuedeninteractuar.Seproporcionaunabrevedescripcinsobrelas
caractersticasrelevantesdelaspoblacionesnativasminoritariasdeE.U.A,
seguidadeinformacinselectasobrelasinfluenciasenobesidadinfantilen
estas poblaciones durante la gestacin, infancia, niez y adolescenciay la
discusinsobrelosfactoresculturalesyambientales.

b. Tema 2: Complicaciones de la obesidad en nios e identificacin de


tratamientosanivelindividual,familiar,escolarypoltico.

Recursosylecturasbsicas
The Weight of a Nation. HBO documentaries. Captulo 3: Nios en crisis.
Disponible
en:
http://theweightofthenation.hbo.com/films/main
films/Crisis(duracin1h07min)
Daniels, Stephen R. The consequences of Childhood Overweight and
Obesity.ProjectMUSE.TheFutureofChildren,Volume16,Number1,spring
2006, pp. 4767. (Article). Published by Princeton University. DOI:
10.1353/foc.2006.0004
Sinopsis: En este artculo Daniels documenta la carga pesada que el
sobrepesoimplicaenlasaluddelosnios.Sediscutenlosriesgosinmediatos
asociadosconlaobesidadenlaniezylosriesgosalargoplazodelosnios
y adolescentes que se convertirn en adultos obesos y sus otras
implicaciones a la salud. Daniels seala que muchos problemas de salud
relacionadosconlaobesidadquesecreanaplicablessloalosadultosyase
estn viendo en los nios y con frecuencia cada vez mayor. Se examina
sistemticamentelossistemasdelcuerpo,ysemuestracmolaobesidaden
laedadadultapuededaarcadaunoycmolaobesidadinfantilexacerbael
dao.Danielsinformaquesehaplanteadoqueelaumentodelaprevalencia
yseveridaddelaobesidadinfantilpuedenrevertirelaumentoconstantede
laeramodernaenlaesperanzadevida,laprimeraenlahistoriamoderna.

Gilbert P. August, Sonia Caprio, Ilene Fennoy, Michael Freemark, Francine R.


Kaufman,RobertH.Lustig,JanetH.Silverstein,PhyllisW.Speiser,DennisM.Styne,
andVictorM.Montori.PreventionandTreatmentofPediatricObesity:An
Endocrine Society Clinical Practice Guideline Based on Expert Opinion. J Clin
EndocrinolMetab93:45764599,2008.doi:10.1210/jc.20072458

Sinopsis:EnestaguasedescribenlasrecomendacionesdelaSociedadde
Endocrinologa Clnica para la prevencin y tratamiento de la obesidad
peditrica.

Mary Story, Karen M. Kaphingst, Ramona RobinsonOBrien, and Karen


Glanz. Creating Healthy Food and Eating Environments: Policy and
EnvironmentalApproaches.Annu.Rev.PublicHealth2008.29:25372.
Sinopsis:Estarevisindescribeunmarcoecolgicoparalaconceptualizacin
de varios ambientes alimentarios y las condiciones que influyen en la
eleccindealimentos,connfasisenlosconocimientosactualessobrelos,
centros de cuidado infantil, escuela, lugar de trabajo, las tiendas al por
menor, y el escenario del restaurante. Tambin se examinan cuestiones
importantesdelasdisparidadesenelaccesoalosalimentosparalosgrupos
debajosingresosydeminorasylascuestionesdenivelmacro.Sedestacan
el estado de medicin y la evaluacin de los entornos de nutricin y la
necesidaddeaccinparamejorarlasalud.

c. Tema 3: Introduccin al cambio de conducta: Entrevista Motivacional


centradaenelpaciente.

Lecturasbsicas
Lizarraga, S. D., and M. Ayarra. "Entrevista motivacional" ANALES del
sistemasanitariodeNavarra.Vol.24.2001.
Sinopsis:laentrevistamotivacionalesuntipodeentrevistacentradaenel
paciente, que busca ayudar explorar y resolver contradicciones sobre
conductasohbitosinsanos.Intentaaumentarlaconcienciadelospacientes
sobre sus riesgos de salud y su capacidad para hacer algo al respecto.
Adems, cuida la salud mental de los sanitarios porque incrementa la
satisfaccincomoprofesionalesyprevienelasensacindeimpotencia.En
este artculo adems se presentan una serie de tcnicas que los
profesionalespuedenaprenderyqueayudarnamejoralaentrevistaclnica
motivacional.Astambincomolascaractersticasdelprofesionalsanitario
queproporcionanelambientedeseguridadyapoyoidealparaelcambio.

Miller, William R., and Stephen Rollnick. Entrevista motivacional:


preparandoparaelcambiodeconductasadictivas.Paidos,2012.Capitulos
5,6y8.

Sinopsis:Estelibropresentaaspectosrelacionadosconeltemadecambio
deconducta,puescomoprofesionalesdelasaluddebemosconocerlarazn
que motiva el cambio de las personas que se enfrentan a problemas
personales. La entrevista motivacional es una aproximacin destinada a
ayudarapacientesaqueadquieranuncompromisoyalcanceneldeseode
cambiar.Enlostrescaptulosseleccionadosserevisarnlosprincipiosyla
faseIdelaentrevista.

d. Tema4:Estudiodecasoyaplicacinlatcnicasteraputicasutilizadaen
laentrevistamotivacionalparacambiodeconducta.
RollnickSandMillerW.MotivationalInterviewing:HelpingPeopleChange.
Thirdeditioned2012,USA:GuilfordPublications.
Sinopsis: En este libro se aclaran los cuatro procesos de la entrevista
motivacional atrayendo, centrndose, evocando y la planificacin y
vvidamentedemuestracmosevenenaccin.

e. Lecturaopcional:
NidhiGupta,KashishGoel,PriyaliShah,andAnoopMisra.Childhood
ObesityinDevelopingCountries:Epidemiology,Determinants,and
Prevention.EndocrineReviews33:4870,2012

V.

ActividadesdeAprendizaje

Tema Actividad
Descripcin
Fecha
1
Revisin de lecturas Realizarlalecturadelossiguientes 21 al 27
bsicas
documentos: (ver referencia en octubre
contenidos)
1. Transicin de la nutricin
global y pandemia de la

obesidad en pases en

desarrollo

de

2. Etiologies of Obesity in
Children: Nature and
Nurture.
3. Environmental influences
of childhood obesity:
Ethnic
and
cultural
influencesincontext
Foro
Realizaraporteaforodediscusin
sobre
las
determinantes
individuales,
culturales
y
ambientales asociados a la
obesidadeidentificacindecausas
ms importantes en nios y
adolescentes.
Revisinderecursosy Realizarlalecturadelossiguientes
lecturasbsicas
documentos: (ver referencia en
contenidos)

1. The Weight of a Nation.


HBO
documentales.
Captulo3:Niosencrisis.
2. The consequences of
Childhood Overweight and
Obesity.
3. Prevention and Treatment
of Pediatric Obesity: An
Endocrine Society Clinical
Practice Guideline Based
onExpertOpinion
Revisin de lecturas Realizarlalecturadelossiguientes
bsicas
documentos: (ver referencia en
contenidos)

1. Laentrevistamotivacional
2. Entrevista motivacional:
preparandoparaelcambio
de conductas adictivas.
Captulos5,6y8.

7
28 al 3
noviembre

de

4 al 10
noviembre

de

11 al 17
noviembre

de

Presentacin

Lecturabsica

Conferenciavirtual

RevisarpresentacinPowerpoint 11 al 17 de
noviembre
MotivationalInterviewing:Helping 18 al 24 de
PeopleChange
noviembre
Entrevista motivacional y tcnicas 14denoviembre
de consejera para promover el
cambiodeconducta.
Resolucin de estudio de caso en 18 al 24 de
parejas
noviembre

Estudiodecaso

VI.

VII.

ConferenciaVirtual

Conferencia virtual: Entrevista motivacional y tcnicas de consejera para


promoverelcambiodeconducta
Fecha:Sbado14denoviembre2015
Hora:7:30a9:00am(HoraCentroamrica)
Sala4(participantes)

Conferencista:
MargaritaSafdie,esNutricionistaegresadadelaUniversidadIberoamericanaen
MxicoconunMsterenNutricinAplicadayPolticasenAlimentacinenla
UniversidaddeTufts,Boston,EUAyrecingraduadadelProgramadeDoctorado
enKinesiologayPromocindelaSaludconnfasiseninvestigacineneltema
dePrevencindeObesidadenlaNiezenlaUniversidaddeQueens,Kingston,
Canad.LaDra.Safdietambinhacolaboradocomotutoravirtualencursosen
lneasobresaludinternacionalycatedrticaaniveluniversitario.Tambinha
publicadodiversosartculossobreeltemadeprevencindelaobesidadenla
niez.

Evaluacin

En el siguiente cuadro se detalla la valoracin asignada a cada actividad del


mdulo:

Actividad
Forodediscusin
Estudiodecaso
Total

Valoracin
10
20
30

Antes y Ahora

Transicin de la nutricin global y pandemia de la obesidad en


pases en desarrollo

Barry M Popkin, Linda S Adair, y Shu Wen Ng


Referencia: Popkin, B. et. Al. Global nutrition transition and the pandemic of obesity in
developing
countries.
Nutrition
Reviews
Vol.
70(1):321.
doi:10.1111/j.17534887.2011.00456.x

Aos atrs el discutir sobre una inminente pandemia global de obesidad era considerado
como una hereja. Pero en los aos 70 , las dietas comenzaron a depender ms de
alimentos procesados, aumento en el consumo de alimentos fuera de casa, aumento en
el consumo de aceites comestibles y de bebidas endulzadas con azcar. Tambin se
comenz a observar una disminucin en la actividad fsica y el aumento del
sedentarismo. Los efectos negativos de dichos cambios se comenzaron a reconocer a
principio de los aos 90, principalmente en las poblaciones de bajo y medio ingreso
econmico, pero ellos no llamaron la atencin hasta que enfermedades como la
diabetes, hipertensin y la obesidad comenzaron a dominar el globo terrestre. Ahora, el
rpido aumento en las tasas de obesidad y sobrepeso es ampliamente documentado
desde las reas rurales en los pases ms pobres de frica subsahariana y en el sur de
Asia hasta las poblaciones en pases con mayor ingreso econmico. Tambin son bien
documentados los cambios rpidos y simultneos respecto a la actividad fsica. La
formacin a larga escala de programas y medidas polticas estn siendo exploradas en
pocos pases; sin embargo, son pocos los pases comprometidos con esfuerzos serios
en la prevencin de los serios desafos nutricionales con que se enfrentan.

Palabras Claves: transicin nutricional, obesidad, programas de prevencin de la


obesidad, polticas

INTRODUCCION

Un par de dcadas atrs era considerada


como una hereja el hablar de una
inminente pandemia global de obesidad.
Sin embargo, la alimentacin y los patrones
de actividad cambiaron claramente y
drsticamente en Los Estados Unidos de
Amrica y para los aos 80 era claro que la
calidad alimentaria en Los Estados Unidos
de Amrica estaba empeorando, la
actividad fsica estaba disminuyendo
drsticamente y la obesidad estaba
aumentando a lo largo de Los Estados
Unidos y Europa.
En ese momento
nicamente Los Estados Unidos era
considerado como un pas con problema de
obesidad ya que ms de la mitad de la
poblacin adulta de determinada edad-,
grupo tnico-, o sub-poblacin de cierto
grupo tnico presentaba sobrepeso u
obesidad. El curso de economa del hogar
estaba desapareciendo como curso de arte
enseado en las escuelas de Los Estados
Unidos de Amrica, el consumo de
alimentos
procesados
y
comidas
preparadas aumentaba y se volva bastante
comn
comer
fuera
de
casa,
particularmente los restaurantes de comida
rpida estaban acaparando gran parte de la
vida
de
muchas
personas
y
la
preocupacin sobre una amplia gama de
condiciones de salud relacionadas con la
obesidad estaba en aumento. Revisando la
publicacin anterior sobre la transicin
nutricional publicada en Nutrition Reviews ,
1,2
varios temas claves fueron encontrados :
la urbanizacin fue una causa principal en
el incremento de obesidad global y
sobrepeso en los pases de bajo y medio
ingreso econmico. Los cambios en la
produccin de aceites comestibles han
creado aceites vegetales baratos que
permiten a las personas de pases con bajo
y medio ingreso econmico aumentar su
consumo energtico a un costo econmico
1
bastante bajo . Sin embargo, en ese
momento de la historia se asuma que la
hambruna global y la malnutricin eran la

preocupacin principal de los pases con


bajo y medio ingreso econmico; por lo
tanto, era bastante difcil dirigir la atencin
hacia lo que estaba realmente ocasionando
el cambio alimenticio y el cambio en la
actividad fsica, los cuales estaban
aumentando la amenaza de obesidad en
estos escenarios.
Durante las ltimas dcadas, un cambio
drstico ha ocurrido en etapas, en relacin
a la forma en que la poblacin general del
planeta come, bebe y se mueve, y estos
cambios han chocado con la biologa
humana por lo que se han creado grandes
cambios en la composicin corporal. Los
principales desajustes entre la biologa
humana y la sociedad moderna que hemos
identificado en nuestra investigacin se
3-12
resaltan en la Tabla 1.

Tabla1. Choques Tecnolgicos con la Biologa


humana
Biologa

Tecnologa

Preferencia por azcares

Endulzantes calricos y
baratos, beneficios de
procesar alimentos

Sed y
hambruna/saciedad

Revolucin de bebidas
calricas

Mecanismos no unidos
Preferencia por
alimentos grasosos

Revolucin de aceites
comestibles, semillas de
aceite de alto
rendimiento; eliminacin
barata de aceites

Deseo de eliminar
esfuerzo

Tecnologa en todas las


fases de
movimiento/esfuerzo

Datos de referencias 3-1

En el 2008, se estim que el sobrepeso y la


obesidad afectaba a casi 1.5 billones de
adultos alrededor del mundo. Un estimado, el
cual un anlisis reciente con datos nuevos
demuestra que es una subestimacin, predijo
que para el ao 2030 aproximadamente 2.16
billones de adultos alrededor del mundo
estarn con sobrepeso y 1.2 billones sern
13
obesos . A continuacin se presentan datos
sobre
tendencias
provenientes
de
investigaciones repetitivas llevadas a cabo
de 1990-2010 en 40 pases usando los
mismos mtodos; estos datos sugieren que 2
o ms billones de personas posiblemente ya
tengan
sobrepeso
o
sean
obesas
actualmente. Las implicaciones en salud de
estas
tendencias,
calidad
de
vida,
productividad y costos de asistencia mdica
son asombrosos. La carga es mucho mayor
para gran parte de Asia, Amrica Latina, El
Oriente Medio y frica
debido a las
diferencias en patrones de grasa y
composicin
corporal
y
el
efecto
cardiometablico del ndice de masa corporal
(IMC) a niveles muy por debajo de los lmites
14,15
.
normales de IMC de 25 para sobrepeso
Por ejemplo, estos resultados se observan
en India en relacin a la prevalencia de
diabetes y de glucosa alterada en ayunas y
en China en la prevalencia de hipertensin y
de diabetes.
Esta resea documenta los cambios que
han ocurrido y estn ocurriendo en relacin a
la obesidad global y describe lo que algunos
pases estn haciendo en respuesta a ello.
Se hace nfasis en las opciones potenciales
consideradas por los pases con bajo y
medio ingreso econmico. Esta resea
tambin provee un examen comprensivo del
estado actual de la ciencia sobre los cambios
relacionados con la alimentacin que ocurren
en los pases del mundo con bajo y medio
ingreso econmico.

OBESIDAD EN PAISES CON BAJO Y


MEDIO INGRESO ECONOMICO
Estudios recientes han usado datos
provenientes de un gran nmero de pases
para estimar las tasas de prevalencia actual
de obesidad y para proyectar aumentos en
esta condicin en todas las regiones del
13,16
. Sin embargo, poca informacin
mundo
detallada existe en cuanto a tendencias
longitudinales para pases con bajo y medio
ingreso econmico, aparte de Brasil, China,
17,18
. Adems, ninguno de los
India y Mxico

estudios recientes se ha enfocado en las


tendencias existentes dentro del pas que se
relacionan con las diferencias entre la vida
urbana y rural o las existentes entre ingreso
y bienestar. La impresin general ha sido
que en los pases con ms alto ingreso
econmico es ms frecuente encontrar tasas
de obesidad ms altas en las reas rurales y
entre los pobres, lo cual es contrario a lo
observado
en
pases
con
ingresos
econmicos ms bajos. Sin embargo,
evidencia nueva sugiere que estos patrones
estn cambiando, y que el aumento en la
tasa de obesidad entre los pobres conlleva
importantes implicaciones para la distribucin
19
de las desigualdades en la salud . Durante
las pasadas tres dcadas, la media
estandarizada del IMC, la medida ms
utilizada para definir sobrepeso y obesidad,
ha aumentado por 0.4-0.5 kilogramos /
2
13
metro / ao .
La mayor laguna en esta literatura se
relaciona con la falta de datos y el examen
superficial de los patrones y tendencias sin
brindar la atencin suficiente a la literatura
existente y a la dinmica de cambio, aqu
tienden a enfocarse a simples perspectivas
transversales. Por
ejemplo, en estudios
16
recientes, Subramanium et al ., utilizando
nicamente una serie de datos e ignorando
la dinmica, seal que los ricos son ms
propensos que los pobres a ser obesos. Esta
es una conclusin bastante distinta a la
20,21
., quien
alcanzada por Jones-Smith et al
utiliz datos similares pero un anlisis
longitudinal. Jones-Smith et al. estudi datos
transversales repetitivos de mujeres entre las
edades de 18 y 49 aos en 37 pases en va
de desarrollo para determinar tendencias
dentro de los propios pases en relacin a
desigualdades entre sobrepeso-obesidad por
nivel socioeconmico [SES por sus siglas en
ingls] entre 1989 y 2007 (n= 405,550).
Meta-regresin se utiliz para examinar las
asociaciones entre producto interno bruto
[GDP por sus siglas en ingls] y el aumento
desproporcional en la prevalencia de
sobrepeso por SES con examen adicional
por modificacin de desigualdad en el nivel
econmico del pas. En 27 de 37 pases, un
SES ms alto (versus uno ms bajo) fue
asociado con mayor aumento en la
prevalencia de sobrepeso; en los restantes
10 pases, un SES ms bajo (versus uno
ms alto) fue asociado con mayor aumento
en la prevalencia de sobrepeso. GDP fue
positivamente relacionado con un aumento
ms rpido en la prevalencia de sobrepeso

entre los grupos de menor nivel econmico.


Entre los pases con un GDP ms alto, una
desigualdad de ingreso ms bajo fue
asociado con un rpido crecimiento en la
prevalencia de sobrepeso entre la poblacin
pobre.
Otra
limitacin
en
la
presente
investigacin es su enfoque en mujeres en
edad reproductiva y en preescolares. Esto
refleja
la
disponibilidad
de
datos
provenientes de diversos pases que han
confiado en estudios demogrficos y de
salud los cuales se han enfocado en mujeres
en edad reproductiva y en nios. Pocos
estudios, particularmente algunos estudios
nacionales de Mxico y Brasil y algunos
estudios longitudinales a gran escala como el
Estudio Chino de Salud y Nutricin, el
Estudio de la Vida Familiar de Indonesia y el
Estudio de la Vida Familiar de Mxico, que
19
cubren todos los grupos de edad y sexo .
Utilizando datos inclusivos, se pueden
observar patrones bastante distintos en
cuando a gnero-especfico en relacin a
patrones de cambio y diferencias en base a
SES. De acuerdo con los datos tan limitados
y los estudios proporcionados, hombres con
ms alto SES tienen tasas ms altas de
sobrepeso y obesidad en comparacin a
22
hombres con SES ms bajo . Estos datos
contrastan con las tendencias encontradas
entre mujeres como lo destacan los dos
artculos de Jones-Smith et al, arriba
20,21
.
mencionados
Mientras sabemos que la prevalencia de
obesidad pareciera estar en aumento en los
pases con bajo y medio ingreso econmico,
no estn claras cules son las diferencias
urbano-rural existentes. Esta resea rene
algunos datos completos que han sido
publicados
recientemente
en
otras
19,20
. Estos datos provienen de
partes
repetidas investigaciones transversales a
nivel nacional de 441,916 mujeres rurales y
364,267 mujeres urbanas (total de 806,183)
mujeres adultas (18-49 aos de edad) de 42
pases de Asia, El Medio Oriente, frica,
(Este, Oeste, Centro y Sureste), y Amrica
Latina. Los cambios absolutos y relativos en
la prevalencia de sobrepeso y obesidad para
mujeres en estos pases y regiones se
muestran en la informacin de soporte de
este artculo disponible en lnea como
TablaS1.
La prevalencia combinada de
sobrepeso y obesidad (sobrepeso=IMC 25,
obesidad = IMC 30 ; denominado
sobrepeso/obesidad de aqu en adelante),
creci para todos los 42 pases en
aproximadamente un promedio de 0.7 puntos

porcentajes por ao. Al utilizar los pesos de


las poblaciones, se estima que el 19% de
mujeres del rea rural y el 37.2% de mujeres
del rea urbana tienen sobrepeso u
obesidad.

Diferencias Urbanas versus Rurales y el


Desplazamiento de la Carga de Obesidad
hacia los pobres
Figura 1 y Figura S1 en la informacin de
soporte en lnea resume la variacin
ponderada anual absoluta y la variacin
ponderada anual relativa de la prevalencia
de sobrepeso/obesidad y obesidad sola,
respectivamente, entre las mujeres del rea
rural versus mujeres del rea urbana por
regin. En promedio, mujeres del rea
urbana tienen una prevalencia base ms alta
y aumentos mayores en prevalencia de
sobrepeso/obesidad comparada con mujeres
del rea rural en los 42 pases estudiados
(0.8 versus 0.5 puntos de porcentaje para
sobrepeso; 0.4 versus 0.2 puntos de
porcentaje para obesidad). Sin embargo,
existen diferencias en cuanto a regiones, en
mujeres del rea rural en Amrica Latina, El
Medio Oriente y frica del Norte presentan
incrementos
mayores
en
prevalencia
comparadas a sus contrapartes urbanas. La
variacin anual relativa en prevalencia
ponderada es mayor para el rea rural
(3.9%) comparada a la de mujeres del rea
urbana (2.5%). En otras palabras, las
mujeres del rea rural estn alcanzando
rpidamente a sus contrapartes del rea
urbana. Figura S1 (disponible en la
informacin de soporte en lnea) muestra las
estadsticas de la prevalencia de obesidad y
los resultados son consistentes. Las altas
tasas anuales relativas de variacin en
obesidad comparadas con las de sobrepeso
sugieren que la prevalencia de obesidad, en
particular, est cambiando rpidamente.

Figura 1. Cambios absolutos y Relativos anuales en puntos


porcentuales en prevalencia ponderada de sobrepeso y
obesidad (SO) (IMC > 25) entre mujeres del rea urbana y rural
de 42 pases por regin (N=42).

En nuestro estudio tambin se observaron


los datos de cada uno de los 42 pases
clasificados segn su GDP per cpita (ver
Fig.S2 en la informacin de soporte en
lnea).
Pareciera existir una pequea
asociacin entre el tipo de residencia y la
prevalencia de sobrepeso u obesidad en
pases con ms alto GDP. Entre los pases
con ms bajo GDP las mujeres del rea
urbana son ms propensas a tener
sobrepeso u obesidad, y los pases alrededor
de la media y al fondo del rango de
distribucin del GDP, presentan una
proporcin mayor de mujeres del rea
urbana
con
sobrepeso
u
obesidad
comparadas con las del rea rural. Anlisis
estadsticos muestran que un aumento per
cpita de GDP est asociado con un
aumento en la variacin anual absoluta en
prevalencia de sobrepeso y obesidad
nicamente en las reas rurales.

FACTORES CLAVES PARA EXPLICAR EL


AUMENTO
EN
OBESIDAD:
PAPEL
POTENCIAL EN FUTUROS PROGRAMAS
Y MEDIDAS POLITICAS

ltimamente la obesidad es el reflejo de un


desbalance de energa, por lo que las
principales reas de intervencin se
relacionan con el consumo y el gasto
energtico, para lo cual el principal
componente modificable es la actividad
fsica. Es claro que los grandes cambios
respecto al acceso a la tecnologa han
reducido
las
actividades
laborales
relacionadas con el gasto energtico en las
ocupaciones que ms trabajo o esfuerzo
requieren, como por ejemplo en la agricultura
y la minera, tambin como en los sectores
laborales que requieren de menor gasto
energtico como son los de prestacin de
23
servicios y manufactura . Los cambios en el
transporte, el ocio y en el trabajo domstico (

25

cocinar, limpiar, cuidar de nios, etc) han


contribuido tambin a la reduccin de la
actividad fsica. Adems, la compleja
interaccin entre los factores biolgicos que
operan durante el desarrollo fetal e infantil y
los desbalances energticos relacionados
con los mismos, agravan varios problemas
26
de salud . Tales cambios han sido bien
documentados en China y tambin se
pueden observar en diversas situaciones en
muchos pases.
Encontrar las formas de aumentar la
actividad fsica en todos los grupos de edad
es importante para la salud pblica, pero las
opciones para aumentar el gasto energtico
a travs de la actividad fsica podran estar
limitadas en pases con bajo o medio ingreso
econmico. Por ejemplo, para compensar un
aumento de alrededor de 110 Kcal
provenientes de comidas o bebidas en una
ingesta diaria promedio, una mujer que pese
54kg deber caminar moderadamente rpido
por 30 minutos, y un hombre de 82kg
alrededor de 25 minutos. Esperar estos
niveles de actividad fsica es pedir
demasiado, por lo tanto la modificacin en la
ingesta es la clave para bajar la prevalencia
de obesidad, particularmente con el continuo
descenso en la actividad fsica y el aumento
del sedentarismo (datos no publicados). La
mecnica alimenticia representa un conjunto
de temas complejos. A nivel global, accesos
nuevos a la tecnologa (e.g., aceites
comestibles baratos, comidas con exceso de
caloras-vacas , supermercados modernos
y la distribucin y mercadotecnia de
alimentos ) y los marcos reglamentarios
(e.g., Organizacin Mundial del Comercio y
el flujo ms libre de bienes, servicios y
tecnologas) estn cambiando las dietas en
los pases con bajo y medio ingreso
econmico. Conjuntamente con esto estn
todos los asuntos crticos relacionados a la
seguridad alimentaria y acceso global a
alimentos
suficientes
para
satisfacer
adecuadamente los niveles de nutrientes.
Muchas poblaciones se basan en los granos
bsicos y suministro de alimentos, mientras
que la transicin general ha desplazado la
estructura de precios y la disponibilidad de
alimentos y ha creado una transicin
nutricional ligada con la obesidad y con la
hambruna. Hemos utilizado datos detallados
conjuntamente con datos provenientes de
gastos energticos y de otros factores, para
examinar los patrones y tendencias del
pasado y as poder predecir, hasta el ao
2020 y 2030, los patrones de actividad fsica
y comportamiento sedentario en Los Estados

Unidos de Amrica, en El Reino Unido,


27
Brasil, China e India .
Antes de explorar las dimensiones
alimenticias, consideramos
un factor
biolgico importante, el cual afecta la
obesidad y la aparicin de enfermedades
crnicas en los pases en va de desarrollo
rpida en Asia y en frica. Dicho factor es la
agresin sufrida durante el desarrollo fetal e
infantil que podra influir en la susceptibilidad
a los cambios anteriormente mencionados,
dicha tendencia tambin influye en el
desarrollo y gravedad de enfermedades
crnicas en estos pases.
Orgenes evolutivos de la Salud y la
enfermedad: Preocupacin especial por
los pases con bajo y medio ingreso
econmico
Los patrones de cambio en las dietas y el
gasto calrico relacionados con la transicin
nutricional global, son particularmente
importantes dentro del contexto de teoras
actuales sobre el origen evolutivo de las
enfermedades en la vida adulta. Basados en
tres dcadas de investigacin, ahora se
reconoce que la susceptibilidad a la obesidad
y a enfermedades crnicas est influenciada
por la exposicin ambiental desde los
tiempos de la concepcin hasta la edad
adulta. Una extensa coleccin de literatura
ha demostrado que la insuficiencia
nutricional en el feto, desencadena un
conjunto
de
cambios
anatmicos,
hormonales y fisiolgicos que mejoran la
sobrevivencia en un ambiente pobre-en
28
recursos . Sin embargo, en un ambiente
postnatal con suficientes recursos, estas
adaptaciones en el desarrollo podran
contribuir al desarrollo de enfermedades.
Una de las evidencias ms fuertes sobre el
efecto a largo plazo de una restriccin
nutricional moderada o severa durante el
embarazo, proviene del seguimiento dado a
infantes nacidos despus de que sus madres
fueron expuestas a condiciones de
hambruna, tales como las experimentadas
en partes de Europa durante la Segunda
Guerra Mundial. Por ejemplo, AC Ravelli et
29
al. encontr altas tasas de obesidad entre
hombres y mujeres de 50 aos de eda,
cuyas madres fueron expuestas a la
hambruna Holandesa durante la primera
30
mitad del embarazo; y GP Ravelli et al.
encontr obesidad entre hombres de 19 aos
de edad, cuyas madres experimentaron
hambruna durante sus embarazos. De igual
manera, un seguimiento dado a los
migrantes refugiados Hmong revel tasas

ms altas de obesidad central entre los


nacidos en zona de guerra, con los efectos
amplificados en aquellos quienes migraron a
los Estados Unidos de Amrica en
comparacin a los que viven en un entorno
31
rural tradicional .
La teora del origen evolutivo del
desajuste se adapta adecuadamente a la
gran variedad de temas relacionados sobre
los desajustes que se discuten a
continuacin, los cuales emergen en nuestra
32-34
primera investigacin y posterior trabajo.
La teora de los orgenes evolutivos del
desajuste se ajusta estrechamente con los
amplios temas sobre desajustes que se
discuten ms adelante y los cuales surgieron
1,2
en nuestras primeras investigaciones y en
32-34
La teora del
trabajos posteriores.
desajuste durante el dficit nutricional
35
temprano, seguido por excesos posteriores
podra tener una importancia particular en
pases con bajo y medio ingreso econmico
que experimentan rpidos cambios sociales
y econmicos, esto debido a que el progreso
econmico amplifica el desajuste. Mucha de
la literatura sobre los orgenes evolutivos de
la salud y la enfermedad se enfoca en
enfermedades crnicas. Sin embargo, dada
la fuerte asociacin entre las enfermedades
crnicas y la obesidad, particularmente la
obesidad central, esta evidencia es
altamente relevante y provee fuertes
fundamentos para los esfuerzos dirigidos a la
prevencin de la obesidad en poblaciones
que han experimentado cambios en el
entorno nutricional como consecuencia de la
transicin nutricional.
Los mecanismos podran incluir efectos
36
en el
sobre el nmero de nefronas
pncreas, exposicin de glucocorticoides
subsecuente al estrs maternal, o un estado
nutricional
pobre
que
potencialmente
programan a la insulina y al eje hipotalmicopituitario para niveles altos de eficiencia
28
y cambios epigenticos. El
metablica
estrs de la madre y aspectos especficos de
la dieta (por ejemplo, ingesta de folatos y
otros donantes de metilo), pueden afectar la
37metilacin del ADN y la expresin del gen.
39
Estudios que se estn llevando a cabo en
lugares como India examinan el papel de la
ingesta de micronutrientes en la madre y su
efecto sobre los cambios epigenticos que
39,40
Una
afectan la adiposidad del nio.
investigacin en India ha proporcionado otras
ideas importantes. Por ejemplo, infantes
indios con madres con una nutricin pobre,
han nacido con dficit de peso, pero en
trminos relativos los dficits en masa

corporal magra son mayores que esos en


adiposidad. En aos posteriores, al
consumirse dietas modernas e hipocalricas
y dietas altas en grasas, los antes
previamente conocidos como bebes
delgados de grasa, tambin presentan una
41,42
mayor adiposidad central.
En base a estudios sobre los orgenes
evolutivos de la enfermedad, es aparente
que existe un fuerte componente de salud
intergeneracional. Mientras la mayora de la
literatura sobre los primeros orgenes de la
obesidad y el riesgo asociado se ha
enfocado en la desnutricin, existe evidencia
substancial que demuestra que el sobrepeso
en la madre y la obesidad durante el
embarazo, influyen en el riesgo de que los
hijos sufran de enfermedades. Por ejemplo,
la diabetes gestacional est relacionada con
la composicin corporal de los hijos y con un
aumento en el riesgo de que presenten
43,44
Por
resistencia a la insulina y diabetes.
lo tanto, hay preocupacin de que exista una
amplificacin intergeneracional del riesgo de
padecer diabetes. Las mujeres que sufrieron
de desnutricin durante la niez presentan
un mayor riesgo de padecer obesidad central
y de tener intolerancia a la glucosa durante la
vida adulta. Si estas condiciones afectan el
embarazo de la mujer, sus hijos presentarn
un mayor riesgo de desarrollar obesidad y
diabetes de forma temprana. A medida que
la diabetes se desarrolla a temprana edad,
se aumenta drsticamente la probabilidad de
que adolescentes y mujeres jvenes que
queden
embarazadas,
experimenten
complicaciones asociadas con la diabetes
gestacional y la hipertensin. Existe una
creciente evidencia que indica que la
obesidad
materna,
an
sin
estar
acompaada de diabetes gestacional, es un
factor de riesgo en la obesidad infantil a
travs de la relacin con una sobre nutricin
45
fetal (ver la resea de Fall ) .
Al otro extremo del espectro nutricional,
una corta estatura en la madre acta como
46,47
y
una limitacin fsica al desarrollo fetal,
el retraso en el crecimiento en los hijos
podra, a la vez, estar relacionado con un
48
aumento en el riesgo de sufrir obesidad.
Ms all del perodo fetal, la nutricin y
otros contribuyentes de la salud durante la
infancia, la niez y la adolescencia son
determinantes importantes de la composicin
corporal del adulto y del riesgo de sufrir
obesidad. A la luz del gran aumento en el
nmero de casos de sobrepeso y obesidad
en nios como en adultos, varios intentos se

han realizado para determinar las edades en


las cuales un rpido aumento de peso se
relaciona con obesidad en los aos
posteriores. Una gran extensin de literatura
relaciona un crecimiento rpido durante la
infancia con el riesgo de sufrir obesidad
luego durante la niez y durante la vida
49
adulta. Adems, un rpido aumento de
peso, especialmente desde la mitad de la
niez en adelante, se relaciona con un
aumento en el riesgo de presentar presin
arterial alta o intolerancia a la glucosa en
ayunas en jvenes adultos de pases con
50
Se ha
bajo y medio ingreso econmico.
presentado la preocupacin sobre promover
un rpido aumento de peso en nios que
estn desnutridos. En pases con bajo
ingreso econmico, la compensacin y la
recuperacin del crecimiento seguido de un
perodo de retraso en el crecimiento, es
deseable porque este est asociado con una
reducida morbilidad y por lo tanto una mejor
51-53
as como un mejor
sobrevivencia
54
Una preocupacin
desarrollo cognitivo.
importante sin embargo, es determinar si los
beneficios de un crecimiento acelerado bajo
estas circunstancias pesa ms que los
posibles riesgos a largo plazo. En base a los
anlisis de estudios de cohorte de nios
provenientes de cinco pases con bajo y
medio ingreso econmico, un rpido
aumento de peso durante los primeros 2
aos de vida tiene un nmero de beneficios.
Este est asociado con el desarrollo de la
masa corporal magra pero no con un
aumento en el riesgo de sufrir intolerancia a
la glucosa en ayunas o diabetes en jvenes
adultos
(datos
proporcionados
para
55
publicacin: e.g., Kusawa et al . ). A partir
de los resultados que demuestran que los
patrones de crecimiento en nios presentan
importantes consecuencias en el desarrollo
de la obesidad y enfermedades crnicas,
otra lnea de investigacin se enfoca en los
factores que contribuyen a o que protegen
contra el desarrollo temprano de adiposidad.
Al respecto, el papel potencial de los
programas de alimentacin temprana han
sido explorados, incluyendo el papel de la
lactancia materna y el de altas ingestas de
protena, grasa y sodio. Estos temas son
importantes a la luz de cambios dramticos
en la composicin de la dieta que caracteriza
muchas poblaciones en los pases en va de
desarrollo.
Por supuesto, temas relacionados a la
alimentacin temprana son importantes.
Algunos estudios demuestran un efecto
protector de la lactancia materna sobre el
desarrollo posterior de la obesidad y

56,57

mientras que
enfermedades crnicas,
otros estudios no demuestran ningn
58
efecto. De igual manera, una constante
ingesta alta en protenas durante la
alimentacin complementaria en los primeros
2 aos de vida, ha sido asociada con una
media ms alta de IMC y porcentaje de grasa
corporal a los 7 aos de edad en estudios de
59
cohorte de nios alemanes, mientras que
otros investigadores han sugerido una fuerte
asociacin entre una ingesta alta en
60
protenas y obesidad.
El consumo de grasa ( tanto en cantidad
como en composicin ) podra tambin jugar
un papel en el desarrollo de enfermedades
no transmisibles.
El estudio STRIP en
Finlandia demostr que una ingesta ms
baja de grasa total y de grasa saturada en la
infancia, resulta en niveles ms bajos de
colesterol en la sangre, colesterol LDL y en
niveles de triglicridos ( as como niveles
ms bajos de presin arterial) en nios hasta
los 14 aos de edad, an sin efectos sobre la
61,62
Alrededor del mundo,
altura, peso, o IMC.
el aumento en el consumo de aceites
vegetales ha aumentado la ingesta de cidos
grasos n-6 y el radio de cidos grasos n-6 a
n-3. Esta es una preocupacin porque una
ingesta alta de cidos grasos n-6 est
asociada con funciones alteradas del sistema
inmune, diferenciacin de los pre-adipositos
en clulas adiposas maduras y en cambios
en los patrones de depsito de grasa. Otro
estudio seala una relacin entre una ingesta
alta de sodio proveniente de frmulas
infantiles y alimentos de destete, y un
aumento en la presin sangunea durante la
63
edad adulta.

Cambios Alimenticios
El
conocimiento
que
emerge
de
investigaciones
sobre
los
orgenes
evolutivos, aborda nicamente una direccin
respecto al cambio hacia mayor obesidad.
Mientras que exposiciones tempranas e
insultos biolgicos parecen mejorar el efecto
adverso del cambio alimenticio, al final, los
cambios en el balance energtico y la
estructura completa de la dieta ha jugado un
papel principal en conjunto y por separado.
Aqu hablaremos primero respecto a
tendencias
ms
amplias
y
luego
regresaremos a los temas de pobreza y
disponibilidad. Esto asocia el conjunto de
cambios dinmicos en nuestro suministro de
alimentos con seguridad alimentaria.

Es importante entender cmo muchas


dietas han cambiado en pases con bajo y
medio ingreso econmico hasta converger
en lo que usualmente se conoce como La
Dieta Occidental. Esta es ampliamente
definida como alta en ingesta de
carbohidratos refinados, azcares, grasas, y
alimentos
de
origen
animal.
Datos
disponibles de pases con bajo y medio
ingreso
econmico
documentan
esta
tendencia en todas las reas urbanas y, en
aumento, en reas rurales. Las dietas ricas
en legumbres, otros vegetales y granos
gruesos estn desapareciendo en todas las
regiones y pases, y algunos principales
adelantos en el desarrollo de la tecnologa
estn asociados con este cambio.

La Revolucin de aceites comestibles y


de aceites vegetales. Las grasas proveen
importantes beneficios en trminos de
mejorar el sabor de los alimentos. Algunos
cientficos sugieren que la seleccin de
alimentos ricos en grasa en vez de los ricos
en
carbohidratos,
son
principalmente
determinados por mecanismos del cerebro
que pueden incluir niveles centrales de
neurotransmisores,
hormonas
o
1
neuropptidos. En las dcadas de 1950 y
1960 en los Estados Unidos de Amrica y en
Japn, tecnologa fue desarrollada para
remover de forma barata los aceites de las
semillas de aceite (e.g., maz, frijol de soya,
1
semilla de algodn, y semillas de palma).
Tecnologas de reproduccin para aumentar
el contenido de aceite de estas semillas,
acompa el proceso de cambio, y los
pases con ms altos ingresos econmicos
vieron un gran aumento en la disponibilidad
de aceites vegetales baratos. Esto fue
seguido por la eliminacin del cido ercico
del aceite de colza para crear un aceite ms
saludable como es el aceite de canola, el
cual fue acompaado por extensas
investigaciones
para
determinar
los
componentes buenos y los malos de cada
aceite comestible (e.g., grasas trans y cidos
grasos especficos). Para el 2012, aceites
poco costosos estaban disponibles a lo largo
de los pases en va de desarrollo. Entre
1985 y 2010, la ingesta individual de aceites
vegetales aument de tres a seis veces en el
mundo en va de desarrollo, dependiendo de
la sub-poblacin siendo estudiada. En China,
el cual tiene una moderada, pero no alta,
ingesta de aceite vegetal, las personas de 2
aos de edad o ms consuman, en
promedio, casi 300 caloras y ms de 30

gramos de aceite vegetal por da en el 2006.


64

Endulzantes Calricos.
Las dietas
alrededor del mundo son mucho ms dulces
hoy en da comparadas con las dietas del
65
pasado. Por ejemplo, el 75% de alimentos
y bebidas compradas en Los Estados Unidos
de Amrica contienen endulzantes calricos
adicionados y el americano promedio de 2
aos de edad y ms consume alrededor de
66,67
En Los Estados Unidos de
375kcal/da.
Amrica, uno de los pocos pases en los que
la cantidad de azcar adicionada en la dieta
68
investigaciones
han
es
estimada,
demostrado una estabilidad notable en la
ingesta de la cantidad de azcar adicionada
a los alimentos durante los ltimos 30 aos,
mientras que la cantidad de azcar
adicionada a las bebidas ha aumentado
66
De 1977 a 1978, dos
significativamente.
tercios del azcar adicionada en la dieta
Americana provena de los alimentos; hoy en
da, dos tercios proviene de las bebidas. Sin
embargo, este podra ser una subestimacin
ya que los estimados de azcar adicionada
proporcionados por El Departamento de
Agricultura de Los Estados Unidos de
Amrica ,excluyen los concentrados de jugo
de fruta los cuales son la fuente de azcar
que ha demostrado un aumento en consumo
durante la ltima dcada y ahora se
encuentra en ms del 10% de alimentos
americanos (datos no publicados). Mxico,
experiment una duplicacin en la ingesta de
bebidas calricas a ms de 21% de las
kilocaloras/da para todos los grupos de
edad de 1996 al 2002, ste es uno de los
pocos pases en va de desarrollo con datos
sobre los patrones de consumo de bebidas
32,69,70
Mientras
calricas y sus tendencias.
que datos de la dieta individual no estn
disponibles para la mayora de pases con
bajo ingreso econmico, datos nacionales
agregados sobre la disposicin de azcares
para el consumo humano (desaparicin de
alimentos o datos de balance de alimentos)
sugieren que este en una preocupacin
importante en todas las regiones del
65
mundo.
Cambio hacia un aumento en la ingesta
de alimentos de origen animal.
Las
71
y
primeras investigaciones de Delgado
otros en el International Food Policy
Research Institute, demostraron el inicio de
una revolucin ganadera en los pases en
va
de
desarrollo.
Subsecuentes
investigaciones han demostrado importantes
aumentos en la produccin de carne, cerdo,
productos lcteos, huevos y aves de corral

en pases con bajo y medio ingreso


72,73
La mayora de los aumentos
econmico.
globales respecto a los alimentos de origen
animal se han presentado en pases con bajo
y medio ingreso econmico. Por ejemplo,
India ha experimentado un aumento
importante en el consumo de productos
lcteos y China en el consumo de cerdos y
huevos.
El aumento en el consumo de productos
de origen animal presenta tanto efectos
positivos como efectos adversos a la salud.
Por un lado, para individuos pobres en
pases en va de desarrollo, unos cuantos
gramos extra de alimentos de origen animal
pueden mejorar significativamente el perfil de
la dieta. Por el otro lado, un consumo
excesivo de alimentos de origen animal est
asociado con una excesiva ingesta de grasas
74,75
saturadas y aumento en la mortalidad.

Reduccin en la ingesta de legumbres,


granos secundarios y otros vegetales.
Mientras que investigaciones sistemticas
significantes sobre la reduccin en el
consumo
de
estos
alimentos
nutricionalmente importantes no se han
llevado a cabo, es claro en base a estudios
de casos que el consumo de frijoles, de una
gama de productos a base de frijoles y de los
granos generalmente conocidos como
granos secundarios , tales como el sorgo y el
6,76,77
mijo, se ha reducido significativamente.
Esto ocurri desde los aos 60 a los 80 en
Los Estados Unidos de Amrica y, ms
recientemente, a lo largo de Asia y el resto
78
de las Amricas.
El comprender las razones de trasfondo
de las tendencias hacia un aumento en el
consumo de productos de origen animal, de
aceites y de endulzantes calricos y la
reduccin en el consumo de legumbres,
granos secundarios y otros vegetales, inicia
con comprender los cambios relativos en la
estructura de precios que han ocurrido desde
la Segunda Guerra Mundial. La mayora de
estos
cambios
tienen
un
propsito
relacionado con las polticas de agricultura
6,79
alrededor del mundo.

Cambios en los Sistemas Alimenticios


En los ltimos 10 a 15 aos, varios factores
han influenciado el suministro de alimentos
en pases individuales.
El sistema

alimenticio caracterstico de la mayor parte


del rea urbana, y de una creciente porcin
de reas rurales en pases con bajo o medio
ingreso
econmico,
ha
cambiado
drsticamente debido a 1) la distribucin
globalizada de tecnologa relacionada con la
produccin, transporte y mercadotecnia de
los alimentos, 2) los medios de comunicacin
y 3) el flujo de capitales y servicios. El
acceso a muchos productos nuevos de
alimentos y bebidas con caloras vacas se
relaciona con la economa actual y el
desarrollo social. La moderna tecnologa de
los alimentos ha proporcionado enormes y
variados beneficios incluyendo una reduccin
en el desperdicio de alimentos, un mejor
saneamiento y la reduccin de muchos
efectos adversos debido a la estacionalidad.
Lo mismo se aplica a los supermercados
modernos. Mientras que los beneficios
crticos
hacia
los
productores
y
consumidores debido a estos cambios
importantes son reconocidos, tambin aqu
se hace nfasis a algunos posibles efectos
adversos.
Un componente clave en los cambios
alimenticios es la moderna distribucin y
venta de alimentos. Esto se refleja en la
enorme introduccin de compaas de super
y mega-mercados a lo largo de pases en va
80
La mayora de pases
de desarrollo.
tambin poseen grandes cadenas de tiendas
de conveniencia. El mercado de productos
frescos ( mercado hmedo o mercado
abierto al pblico) est desapareciendo como
la principal fuente de alimentos en los pases
en va de desarrollo, y est siendo
reemplazado por largas cadenas de
supermercados a nivel regional y local, los
que usualmente forman parte de cadenas
multinacionales (e.g., Carrefour o Walmart)
o, en pases tales como Sudfrica y China,
por cadenas domesticas que funcionan y se
asemejan a las cadenas globales.
De
manera creciente, hipermercados (mega
tiendas) son la fuerza principal que dirigen
los cambios relacionados con el gasto de
alimentos en cualquier pas o regin. En
Amrica Latina, por ejemplo, la venta en los
supermercados de todos los alimentos al por
menor aument de 15% a un 60% en el
2000. Al comparar las ventas en Los
Estados Unidos de Amrica, , las
provenientes de la venta de alimentos al por
menor en supermercados represent el 80%
del total de ventas en el 2000. Este proceso
tambin se observa, en diferentes tasas, en
Asia, Europa Oriental, Medio Oriente y todas
las reas urbanas de frica . En el 2012
llevaremos a cabo un estudio a nivel nacional

del consumo alimenticio y su relacin con


diversos factores en India.
El reporte de un estudio realizado en
Guatemala sugiere que los cambios en el
entorno de alimentos podran aumentar el
consumo de alimentos procesados y de
81
menor calidad. Carlos Monteiro ha sido
particularmente claro al expresar su
preocupacin acerca del impacto que el
entorno moderno de alimentos ha tenido en
4,5,82
En efecto, su preocupacin
las dietas.
sobre el procesamiento de alimentos encaja
bien con el hecho de que cada vez, el
consumo de legumbres y granos secundarios
es reemplazado por el consumo de granos
refinados comprados en supermercados
modernos y tiendas de conveniencia, tiendas
que han ido introducindose en el rea
urbana de frica, Asia y la mayora de Medio
Oriente y Amrica Latina.
Los posibles efectos adversos de estas
tendencias estn asociados con el acceso
aumentado, en pases en va de desarrollo, a
alimentos procesados ms baratos que son
tambin ms altos en contenido de grasa,
azcares agregados y sal. Al mismo tiempo,
estas tendencias proporcionan algunos
beneficios. Por ejemplo, los supermercados
jugaron un papel decisivo en el desarrollo de
tratamientos
de
ultra-calor
para
la
pasteurizacin de la leche, lo cual le dio al
producto una mayor vida til ( no se requiri
de refrigeracin) y proporcion una fuente
segura de leche para todos los grupos
sociales. Los supermercados tambin fueron
clave en el establecimiento de normas de
83
seguridad alimentaria. Ms importante, por
medio de los supermercados se resolvi el
problema de mantener alimentos fros y, en
muchos casos, el de proporcionar productos
de ms alta calidad al consumidor urbano a
lo largo del ao. Otros factores incluye la
liberacin de la inversin extranjera directa,
la liberacin del comercio y la saturacin de
mercados occidentales, lo que ha empujado
a compaas en crecimiento ha otros
lugares.
Mejoramiento en la logstica y
mejores sistemas de contratacin usados por
los supermercados, les ha permitido ser
competitivos en cuanto a precio con los
puntos de venta ms tpicos en los pases en
va de desarrollo (las pequeas tiendas mam y pap y los mercados hmedos ya
sea mercados frescos o mercados abiertos al
pblico), competitivos en el precio de frutas,
vegetales y otros muchos productos.
Otro resultado proveniente de los cambios
globales en el consumo de alimentos es el

flujo ms libre de comercio asociado con la


Organizacin Mundial del Comercio. Por
ejemplo, las barreras impuestas a la
importacin de aceites comestibles han sido
reducidas, y la produccin de aceites
vegetales ha sido centralizada para competir
con productos importados y as bajar
significativamente los precios del aceite
vegetal en pases como China.
Estos cambios junto con inversiones
globales en agricultura durante el ltimo
medio siglo, han producido un cambio
grande en los precios relativos para
favorecer los alimentos de origen animal, los
aceites comestibles y otras materias primas
79
globales importantes, incluyendo el azcar.
En la informacin de soporte para esta
resea, disponible en lnea, la Figura S3
reproducida de la investigacin llevada a
cabo en el International Food Policy
Research Institute, hace nfasis en algunas
de las tendencias globales que han sido el
resultado de amplias inversiones en el sector
de alimentos de origen animal, y de cultivos
71,79
Adems
forrajeros alrededor del mundo.
en la informacin de soporte, Figura S4 se
hace nfasis del cambio real que China tuvo
en trminos del costo relativo de alimentos
seleccionados, basado en los datos
obtenidos en 330 comunidades y sus
84
mercados de alimentos.

Seguridad alimentaria y la doble carga de


desnutricin y obesidad
Esta transicin rpida respecto al ingreso
econmico y la ingesta de alimentos y el
gran cambio hacia un mayor consumo de
alimentos de origen animal, crea grandes
demandas de granos bsicos para la
alimentacin ganadera, sin tomar en cuenta
las necesidades de la poblacin pobre de
contar con el mismo tipo de alimentos.
Mientras que la sequa, los cambios
climticos y el aumento en la demanda de
etanol, han contribuido a los precios de
alimentos en el mundo, los cambios
estructurales a largo plazo se relacionan a la
demanda de alimentos de origen animal y su
impacto sobre el precio del maz, arroz y
trigo. Conjuntamente con la necesidad real
de contar con alimentos bsicos para la
poblacin pobr,e , la mercadotecnia, la
conveniencia y la disponibilidad de asuntos
tales como aceites comestibles de bajo costo
y alimentos con caloras vacas, han
animado a la poblacin pobre del rea
urbana a consumir alimentos de ms baja

calidad que son impulsores de la obesidad,


los cuales a su vez se cree son los alimentos
que ms procesamiento llevan aunque esto
an no se ha documentado. Estos cambios
tan complejos se reflejan en el surgimiento
de la obesidad junto a la hambruna, an en
los mismos hogares.
Las familias que se enfrentan a una
incapacidad para producir alimentos o para
comprar alimentos debido a un inadecuado
ingreso econmico, probablemente de las
opciones disponibles optaran por los
alimentos ms baratos por calora. Cuando el
costo de los granos bsicos se duplica o
triplica, la presin por ajustar las compras de
alimentos aumenta. Entre los temas ms
sobresalientes estn la vulnerabilidad de las
85
mujeres pobres al mando de la casa y la
combinacin del aumento en precio y la
volatilidad en mercados alimenticios globales
(unidos tambin con temas de cambio
climtico). Es importante tambin observar
que el cambio en los precios relativos
importa ms que el tipo de alimento. Si el
precio de alimentos altos en grasa, aceites,
azcar y productos de origen animal
disminuye,en
relacin
al
precio
de
legumbres, frutas y otros vegetales, stos
ltimos se vuelven menos atractivos.
A pesar de un crecimiento econmico
substancial,
grandes
desigualdades
permanecen en muchos pases de bajo y
medio ingreso econmico, y por lo tanto es
comn ver problemas de desnutricin, bajo
crecimiento, y deficiencia de micronutrientes
de la mano de un aumento en las tasas de
obesidad. Esta doble carga de desnutricin
y obesidad existe no solo entre pases y
86
comunidades, sino tambin dentro de los
87,88
inclusive en personas que
hogares,
parecen tener excesiva adiposidad junto con
deficiencias de micronutrientes , tales como
87la anemia debido a la deficiencia de hierro,
90
o falta de crecimiento y sobrepeso. Los
hogares con esta doble carga son ms
comunes en pases que experimentan
87,88
y
las
transiciones
nutricionales,
circunstancias podran ser el reflejo de
diferencias en cuanto a la asignacin de
alimentos relacionados a normas sociales
basadas en gnero o generaciones. Por
ejemplo, alimentos de alta calidad podran
ser dadas de preferencia a los hombres
adultos en vez de drselos a los nios. Pero
otros patrones podran tambin existir. En
China, por ejemplo, es comn para los
padres hacerles conciencia a sus hijos de la
estrategia nacional de tener solamente un
hijo
para
controlar
el
crecimiento

91,92

Individuos de diferentes
demogrfico.
generaciones podran tambin responder de
forma diferente a los cambios sociales y
econmicos, con las generaciones ms
jvenes adoptando patrones alimenticios
nuevos de forma rpida , mientras que los
ms viejos continan comiendo en formas
ms tradicionales (y muchas veces de forma
ms saludable).
Un desafo para los programas y polticas
alimentarias, es la necesidad de tomar en
cuenta la inseguridad alimentaria y la
hambruna sin adicionarle la carga de
sobrepeso y la obesidad. Esto es
particularmente desafiante dado el costo
relativamente bajo y la alta disponibilidad de
alimentos que son denso-calricos, pero con
bajos contenidos de micronutrientes. Una
vez ms, son los precios relativos lo que
realmente importa en estos casos. La falta
de atencin brindada a los granos
secundarios, las legumbres y otros vegetales
y la vasta atencin dada a los productos con
azcar, semillas de aceite, tecnologas de
aceites vegetales y productos de origen
animal baratos, han contribuido al cambio
global en la dieta.
En pases como Mxico, Brasil, Chile y
China, donde grandes avances se han
logrado en la lucha por
minimizar la
desnutricin aguda a travs de programas
dirigidos a sub-poblaciones vulnerables, en
stos pases la hambruna y la desnutricin
se
han
reducido.
Un
ejemplo
es
Oportunidades, el programa de transferencia
condicional de dinero en Mxico; ste
programa proporciona un estipendio y
alimentacin
complementaria
a
93,94
Se sabe que dichos
preescolares.
programas deben ser adaptados de tal
manera que sean dirigidos a tratar la
desnutricin, sin acelerar el desbalance
energtico y la obesidad entre sus
destinatarios como ha ocurrido en algunos
93,95
Por ejemplo, Chile continu
programas.
alimentando nios pequeos en sus varios
programas de alimentacin, an cuando la
mayora de ellos estaban adecuadamente
nutridos; estos programas no fueron
revisados para tratar asuntos relacionados al
desbalance energtico por algn tiempo
despus de que la desnutricin fue reducida
95
Para hacer frente a la
exitosamente.
obesidad infantil en Mxico, el gobierno
mexicano descubri que era necesario
reducir el contenido de grasa de la leche
distribuida en sus programas de alimentacin
conjuntamente con otros cambios.

EXPERIENCIAS ACTUALES Y MAYORES


INICIATIVAS

Programas alimentarios institucionales y


a larga escala

Una de las principales lagunas en el rea de


intervenciones relacionadas a la salud a
largo plazo que necesita ser cubierta, es la
evaluacin rigurosa de programas existentes
e iniciativas seguidas de mejoras para
aumentar su eficacia. En efecto, con una
excepcin, en el mundo no han habido
evaluaciones rigurosas o reseas de
intervenciones en trminos de su impacto en
la ingesta alimenticia u obesidad. La nica
excepcin es Mxico, donde los efectos del
bienestar y los programas de alimentacin
sobre la tendencia de obesidad fueron
93,95
La evaluacin fue designada
evaluados.
como parte de un largo estudio cuasiexperimental de bienestar en Mxico, y no
fue diseado para examinar el componente
alimentario.
Por lo tanto, es imposible
destacar de forma imparcial lo que podra y
lo que no podra funcionar. En esencia, no
existe ningn dato de la evaluacin de
actividades en los pases con bajo y medio
ingreso econmico.

Como se describe anteriormente en esta


resea, la mayora de las iniciativas, a largo
plazo, para abordar sistemticamente la
obesidad, tales como las encontradas en
Brasil, Mxico y Chile, se han enfocado en
98
las escuelas Brasil por ejemplo, requiere
que una porcin significante del gasto
provenga
de
alimentos
producidos
localmente. Algunos sistemas alimentarios a
larga escala se han enfocado en reas de
bajo ingreso econmico, tales como las que
proveen un bajo costo alimentario por medio
99
de cocinas comunitarias en el Per.
Sorpresivamente,
pocos
ejemplos
de
programas alimentarios a larga escala se
han enfocado en proveer una dieta saludable
que aborde preocupaciones por la obesidad
que existe en pases con bajo y medio
ingreso econmico.

La falta de tecnologa apropiada y de


ambientes adecuados que alimenten un
cambio benfico, es un asunto de salud
crtico. En muchas formas, sera ideal volver
a enfocar la atencin en stos temas y no en
lo que generalmente se percibe como
comportamiento irracional e ignorancia sobre
los patrones de ingesta alimentaria individual
y familiar. A lo largo del mundo, el principal
enfoque es en educacin. Este enfoque es
idntico a las formas en que los sistemas
agrcolas asistieron a los agricultores en todo
el mundo.
Ignorando los determinantes
ambientales, algunos asumieron que los
pobres
eran
ignorantes,
haraganes,
campesinos analfabetos quienes nunca
podran cambiar sin la tecnologa, , y los
programas sufrieron de problemas asociados
al mantener este enfoque. Al comprender
las tecnologas adecuadas versus las no
adecuadas,y la razn principal detrs de las
decisiones tomadas por los agricultores y
otros, el enfoque sobre el desarrollo de la
96
y la
agricultura cambi completamente
apreciacin, de la relacin existente entre la
adquisicin de conocimiento y la educacin
con la tecnologa y la extensin, se
.97
Sin embargo, en el sector salud
desarroll
y en el de educacin en salud pblica, se
mantiene la percepcin que las metas
establecidas sern alcanzadas al proveerse
las construcciones y la tecnologa.

Educacin: Etiquetado e iniciativas de


front-of-package
El etiquetado front-of-package
provee
informacin que ayuda al consumidor a
realizar la eleccin ms saludable de los
alimentos y estimula la reformulacin de
productos. Esto se inici globalmente con el
deseo de reducir las grasas saturadas y la
grasas trans, los agregados de sal y los
agregados de azcar en los llamados
alimentos con caloras vacas, y para mejorar
la ingesta de frutas, vegetales y granos
enteros mientras se limita la ingesta calrica.
El enfoque ms comn es el de promover
por medio de un programa internacional
encabezado por cientficos del Choices
International Foundation. Este enfoque de
modelos de producto-especfico perfil de
nutriente, ha desarrollado categoras de
alimentos especficos que cumplen con las
necesidades alimentarias nicas para el pas
y especficas por regin; tambin ha creado
criterios alimentarios por grupo de alimentosespecficos para demostrar qu opciones
100
representan
una
opcin
saludable.
Recientemente, el US Institute of Medicine
recomend un solo diseo de etiquetado
front-of-.package similar de alguna manera al
enfoque de Choices, pero las deliberaciones
101,102
estn an en proceso.
Existe bajo este sistema la necesidad de
reformular una vasta gama de productos

para mejorar su salubridad. Por ejemplo, hay


por lo menos 200,000 alimentos y bebidas
empacadas en los Estados Unidos de
67
La
Amrica con formulaciones nicas.
reduccin del contenido calrico y el
aumento de la calidad diettica de estos
productos est unido al
esfuerzo del
etiquetado front-of-package.

Regulaciones
con
respecto
a
mercadotecnia de alimentos y bebidas

la

La Organizacin Mundial de la Salud (OMS)


y otras organizaciones han solicitado
regulaciones que minimicen o eliminen la
mercadotecnia
de
alimentos
menos
saludables, y el considerar maneras de
controlar el consumo de bebidas azucaradas.
Brasil y Chile han iniciado controles sobre
la mercadotecnia de alimentos no saludables
con un cdigo nacional oficial de
mercadotecnia. Una segunda iniciativa se
relaciona con el control de bebidas
azucaradas. Un gran nmero de grupos de
salud alrededor del mundo ( tales como
esos preocupados por la diabetes, las
enfermedades del corazn y el cncer )han
solicitado una reduccin de la ingesta de
bebidas azucaradas. En algunos casos, esta
solicitud ha incluido los jugos 100%
naturales, y en todos los casos se han
incluido
las
bebidas
carbonatadas
azucaradas, bebidas frutales, bebidas
energizantes, bebidas deportivas y aguas
con vitaminas. Ms de 20 pases han
prohibido las mquinas expendedoras en
escuelas y han prohibido la venta de
productos menos saludables por parte de
vendedores
ambulantes
en
terrenos
escolares.
Mxico es uno de los pocos pases con
bajo o medio ingreso econmico que se ha
promovido agresivamente en contra de las
bebidas azucaradas y otras bebidas con alto
contenido calrico y menos saludables (e.g.,
leche entera versus leche con 1% de grasa).
En Mxico, el Ministerio de Salud cre un
conjunto de guas de bebidas que el
gobierno
utiliza
para
cambiar
los
procedimientos
en
sus programas de
32
alimentacin y bienestar en las escuelas.
Un rea an no abordada es la de alimentos
en su contenido de grasas saturadas y
azcares agregados. Llamada usualmente
comida chatarra o alimentos con un
excesivo contenido de caloras vacas , el
consumo de estos alimentos representa una

porcin en crecimiento de las ingestas


4,5,82,103
alimentarias alrededor del mundo.
Existe muy poca investigacin
que
demuestre lo que podra pasar con la ingesta
alimentaria si el costo de tales alimentos
aumentara. Ser que las personas
simplemente sustituiran estos alimentos por
otros alimentos con distinto tipo de
carbohidratos refinados o por alimentos
fritos? Se reducira el consumo de
caloras? Podra esto conducir a opciones
de alimentos ms saludables? Existe una
gran
necesidad
de
estudios
bien
monitoreados y evaluados a corto y largo
plazo de dichas actividades antes de
promoverlos, y existe la necesidad de
investigaciones que utilicen extensos datos
para poder entender cmo un cambio en
precios podra afectar la estructura de las
dietas.
Escuelas
Como se menciona anteriormente, los pases
alrededor del mundo se han enfocado en las
polticas de venta y alimentacin en las
escuelas. Ejemplos tan simples como los de
proveer agua potable. Estudios han
demostrado que an pequeos esfuerzos
con una inversin inicial y costos bajos,
105
pueden tener un impacto.

Iniciativas especficas por pas


Mientras existen temas nicos en muchos
pases, aqu nos enfocaremos en Mxico
debido a limitaciones de espacio. Mxico
experiment uno de los aumentos mundiales
ms altos en obesidad, diabetes y
enfermedades cardiovasculares en el
106-108
Este es uno de los
perodo 1990-2010.
pocos pases que persiguen agresivamente
esfuerzos a escala completa, para reducir la
velocidad de crecimiento y revertir la
tendencia de obesidad. Primero, el gobierno
abord las caloras provenientes de bebidas,
incluyendo caloras excesivas provenientes
de la leche entera, bebidas azucaradas y
aguas frescas que son fuertemente
azucaradas (jugos frutales, agua y azcar
32
agregada). Entre las principales acciones
recomendadas por la Secretaria de Salud del
Panel Beverage Guidance, estaba la
eliminacin de la leche entera en los
programas del gobierno y su reemplazo por
leche con 1.5% de grasa. Esto fue seguido
en el 2010 por el desarrollo de una
Estrategia para la Prevencin de la
Obesidad, la cual fue firmada por todos los

ministros y el presidente. Ms recientemente,


un acuerdo entre la mayor compaa de
alimentos de Mxico y el Ministerio de Salud
y de Educacin, elimin de las escuelas la
mayora de bebidas y alimentos con alto
contenido de azcar y de grasas saturadas.
El gobierno tambin estableci una iniciativa
de front-of-package para proporcionar
etiquetas saludables aprobadas por el
Ministerio de Salud en alimentos con un
contenido reducido de sal, azcar y grasas
saturadas,
conjuntamente
con
ms
componentes saludables.
Por el contrario, los pases de Asia
generalmente han hecho poco respecto a
este tema, Singapur y Tailandia son la
excepcin. En Tailandia, esfuerzos han sido
conducidos por nutricionistas claves y la
Princesa Maha Chakri Sirindhorn.
El
gobierno ha iniciado una serie de programas
de alimentacin infantil e iniciativas escolares
relacionadas a la prevencin de la obesidad.
Ellos han revisado el etiquetado de
alimentos, aumentado la promocin de frutas
y vegetales, y trabajado en la reduccin del
contenido de grasas y aceites en los
alimentos, pero ellos an no han invertido
recursos significativos o desarrollado un
programa integral.
En Amrica Latina, Brasil y Chile estn
iniciando un nmero de medidas; sin
embargo, los esfuerzos han y continuarn
teniendo resultados que estn en contra de
las
preocupaciones
de
la
industria
alimentaria, a medida que alimentos
altamente procesados y alimentos no
saludables se encuentran en escuelas y en
109
otras partes.

FUTURAS OPCIONES COMUNITARIAS Y


A LARGA ESCALA
Si quisiramos prevenir la obesidad y reducir
el rpido aumento de obesidad global, el
primer enfoque debe estar en el suministro
de alimentos y en el mejoramiento de la
calidad de las dietas mientras se reduce la
ingesta calrica total. En base a las
perspectivas de intervencin, programacin
y polticas, esta es el rea con mayor
potencial. Sern las intervenciones durante
el embarazo y la infancia la clave para
prevenir sobrepeso en el futuro? Pueden
dichas intervenciones trabajar sin mayores
cambios en el desbalance energtico y por
ende en las dietas de los aos futuros?

Un segundo pero de igual importancia


grupo de preguntas, se relaciona con el
mejoramiento de las dietas en todas las
edades. Podemos recobrar todos los
elementos saludables de las dietas perdidos
durante el ltimo medio siglo (e.g., frijoles o
legumbres procedentes de muchos pases,
productos de granos secundarios y de
granos enteros procedentes de algunos
pases, y vegetales procedentes de muchos
otros pases) ?. Cmo podemos reducir el
consumo excesivo de bebidas azucaradas y
de alimentos grasosos, salados y con altos
contenidos de carbohidratos refinados,
alimentos
llamados
alimentos
ultra
procesados por Monteiro, comida chatarra
por algunos, y alimentos con caloras vacas
4,5,68,110,111
Son los mtodos de
por otros? .
medida
en
los
presentes
sistemas
alimentarios adecuados o abordan nuestras
preocupaciones acerca de la calidad y
67
Mientras los
cantidad de las dietas?
cambios en los sistemas alimentarios estn
unidos a cambios alimentarios, los cambios
en los sistemas alimentarios globales son tan
profundos en los pases con bajo y medio
ingreso econmico que son discutidos
brevemente como una tercera preocupacin.
Una cuarta rea se relaciona con el sector
salud y su papel al abordar estos temas
alimentarios y nutricionales. Ser su papel
el de defender y trabajar para las
regulaciones o trabajar con otros para educar
al pblico? Quinto, encontramos inseguridad
alimentaria, mayores impedimentos entre los
pobres, y muchos de los temas de pobreza y
baja educacin afectan la obesidad as como
afectan de forma diferente,los problemas de
hambruna y desnutricin.
Qu puede
sugerir la literatura sobre inseguridad
alimentaria acerca de abordar temas de
obesidad en pases en va de desarrollo?
Alimentacin
directa,
cuidado
e
intervenciones de prevencin a nivel
comunitario
Qu opciones emergen de la teora del
origen de la evolucin de la salud y la
enfermedad? El considerar los orgenes
evolutivos de obesidad y enfermedades
crnicas es importante porque 1) existe una
fuerte evidencia que sugiere que la
exposicin a temprana edad est relacionada
con el desarrollo de riesgo de enfermedad en
la vida futura, 2) hay posibilidad de
amplificacin de riesgo intergeneracional y 3)
esfuerzos de prevencin pueden aprovechar
la plasticidad del mismo desarrollo que altera
la susceptibilidad a enfermedades para
intervenir
tempranamente
y
prevenir

obesidad. Como se indica por Peter


Gluckman, la mayor ventaja en trminos de
reduccin de riesgo se puede alcanzar a
travs de una intervencin a tiempo en la
35
fase plstica de desarrollo .
Los primeros 1,000 das.
Enfoques
actuales en la sobrevivencia de nios y el
crecimiento saludable durante el desarrollo
en ambientes pobres en recursos se
presentan durante los primeros 1,0000 das
112
Esto inicia con el embarazo, con
de vida.
atencin especial para asegurar una dieta
alta en calidad, incluyendo una adecuada
ingesta de micronutrientes, y para optimizar
la ganancia de peso durante el embarazo,
evitando ganancias de peso inadecuadas y
113
Sin embargo, ya que el inicio
excesivas.
del embarazo es importante, es de vital
importancia que las intervenciones optimicen
la salud y el estado nutricional de las madres
jvenes antes de quedar embarazadas. Esto
implica una necesidad de enfocarse en el
perodo desde la niez a la adolescencia
como tambin para promover crecimiento
lineal, minimizar ganancias de adiposidad
excesivas, y establecer patrones saludables
en la alimentacin y en la actividad fsica.
Recientemente se ha enfocado en nias
jvenes como un importante objetivo para
mejorar la salud (e.g., Center for Global
Development, Bill and Melinda Gates
Foundation, Start with a Girl: A New Agenda
for
Global
Health
[
http://www.cgdev.org/content/publications/det
ail/15154 ]. Este enfoque tambin es
importante a la luz del hecho que en varios
pases con bajo y medio ingreso econmico,
tales como Sudfrica y Guatemala, la
obesidad aumenta bruscamente en nias en
114
los aos seguidos a la menarqua, lo que
pone a las mujeres jvenes en riesgo de
sufrir complicaciones durante el embarazo
debido a la obesidad y a deficiencias
nutricionales.
Algunos de los efectos adversos
relacionados con la alimentacin merecen
una consideracin cuidadosa a la hora de
prepara
programas
y
polticas
de
alimentacin. Escasa evidencia proveniente
de ensayos clnicos aleatorios en lugares con
un alto ingreso econmico muestra que un
contenido ms alto en protena en las
frmulas infantiles est asociado con un
peso ms alto durante los primeros 2 aos
de vida, pero no presenta ningn efecto
115
y que el
sobre el crecimiento lineal
alimentar con una frmula enriquecida con
nutrientes a los infantes que son pequeos
para edad gestacional est relacionado con

un contenido ms alto de masa adiposa que


116
se presenta durante la mitad de la niez.
En Finlandia, un estudio aleatorio sobre la
alimentacin individual y estilos de vida para
reducir la ingesta de grasas saturadas
disminuy la prevalencia de sobrepeso en
117
Estos estudios
nias de edad escolar
demuestran el potencial que presenta la
modificacin alimentaria y cmo esto
disminuye el riesgo de sufrir obesidad. No se
cuenta con evidencia experimental sobre
intervenciones alimentarias para reducir el
riesgo de obesidad durante la infancia y la
niez en pases con bajo y medio ingreso
econmico. La mayora de ensayos sobre
intervenciones nutricionales se han orientado
hacia la mejora en el retraso de crecimiento
de nios desnutridos.
Se requiere de investigaciones para
definir la dieta de destete y dieta para la
primera infancia ms ptima que promueva
el crecimiento lineal y de masa corporal
magra mientras minimiza los excesos de
adiposidad. Un extenso cuerpo de literatura
ha explorado si la lactancia materna reduce
el riesgo de padecer obesidad en la niez y
generalmente han encontrado nicamente
pequeos o mnimos efectos protectores. Sin
embargo, es bien sabido que la lactancia
materna contribuye al crecimiento saludable
y a reducir retraso de crecimiento, el cual a
su vez est asociado con la presencia de
sobrepeso en poblaciones con bajo ingreso
118
Por lo tanto, la promocin de
econmico.
la lactancia materna es vlida en el contexto
de la prevencin de obesidad en pases con
bajo y medio ingreso econmico.
Por un lado se precia la importancia de
intervenir durante el embarazo e infancia con
el fin de prevenir obesidad en aos
119
pero por el otro lado, falta
posteriores;
especificar acerca de los componentes de
intervenciones potenciales exitosas. Esto
refleja una falta de conocimiento relacionado
con la prevencin temprana de obesidad en
pases con bajo y medio ingreso econmico.
Adems, investigadores estn empezando a
determinar la importancia relativa y el
impacto potencial de los efectos prenatales
versus los postnatales y la importancia
relativa de diferentes perodos (infancia,
niez, adolescencia). Debido a la aceptacin
relativamente reciente de las ideas
presentadas que soportan el desarrollo del
riesgo de sufrir enfermedades en el adulto y
la necesidad de estudios cohorte a largo
plazo para evaluar las intervenciones, no
existe an evidencia emprica que soporte
tales esfuerzos como una forma de

influenciar la obesidad y el riesgo de


enfermedades crnicas. Sin embargo, varios
ensayos han sido iniciados, pero an no se
han publicado. Por ejemplo, en Pune, India,
Yajnik y colegas han comenzado a
proporcionar suplementos nutricionales a
nias adolescentes antes y durante el
embarazo.
Claramente existe una gran necesidad no
cubierta de explorar las implicaciones de las
intervenciones basadas en los conceptos de
los orgenes evolutivos, pero es esencial
incluir una perspectiva del curso de vida que
reconozca riesgos intergeneracionales y la
importancia de la nutricin durante la infancia
y la niez. Dados los problemas persistentes
de una mala nutricin (retraso en el
crecimiento,
desarrollo
intelectual
deteriorado, aumento en la tasa de
morbilidad) que coexisten con el desarrollo
de obesidad en la niez, es esencial que las
intervenciones sean dirigidas hacia la
optimizacin del estado nutricional a travs
de una atencin cuidadosa de la calidad y
composicin de la dieta, con el objetivo de
aumentar el crecimiento lineal, eliminar las
deficiencias de micronutrientes y prevenir la
obesidad.
Enfoque en el suministro de alimentos
La pregunta que surge repetidamente es
por qu no podemos simplemente regresar a
los
componentes
anteriores
y
ms
saludables de las dietas tradicionales en
Asia, frica y otras regiones del mundo que
estn en transicin?
Aqu una serie de
opciones estn agrupadas en una forma
consistente con la usada por el International
Obesity Task Force.
Medidas fsicas relacionadas con los
alimentos. Existen formas de cambiar las
dietas hacia (o regresar a) componentes ms
saludables? Podemos aprender formas
para promover el consumo de legumbres y
otros vegetales que se asocian naturalmente
con el desarrollo de sistemas alimentarios?
Una preocupacin mayor a travs del mundo
es la prdida general de patrones
alimentarios saludables y la eliminacin de
componentes claves de la dieta. Se cree que
si los patrones alimentarios cambiaron
grandemente en un lapso de 10 a 20 aos,
stos podran estar listos para cambiar de
nuevo.
El primer problema se relaciona con los
precios
relativos
de
los
alimentos
consumidos como alimentos bsicos antes

del primer cambio alimentario en los pasados


20-50 aos.
Este cabio incluye granos
enteros, legumbres y otros vegetales, y
frutas que muchos escolares sintieron que
eran parte de la composicin de una dieta
saludable a travs del mundo antes de los
aos 60. Los precios relativos alrededor del
mundo han reducido el costo de alimentos de
origen animal, aceites, azcar y productos
79
La
eliminacin
de
relacionados.
subsidiarios en Los Estados Unidos de
Amrica y Europa podran no alterar de
forma apreciable los relativamente bajos
precios de alimentos de origen animal,
120,121
En
aceites, y endulzantes entre otros.
contraste, no existen datos sobre el papel
que los subsidiarios juegan en el cambio en
la estructura general de las dietas en pases
con bajo y medio ingreso econmico. Este
tipo de trabajo es necesario para entender
por completo si las intervenciones del
gobierno , las cuales son numerosas en la
mayora de pases de Asia, frica y Amrica
Latina, afectan adversamente la calidad de la
dieta y si estn relacionados con una
excesiva ingesta calrica. En 1989 una
conferencia se llev a Cabo en China la cual
discuti los problemas de obesidad en el
futuro, los grandes subsidiarios de carne
porcina alta en grasa y la ingesta reducida de
legumbres, especialmente de soya y
productos de soya en China. El Ministerio de
Agricultura de China subsecuentemente hizo
un esfuerzo pequeo por reducir el subsidio
de carne porcina. (Tomar nota que la
conferencia era un esfuerzo conjunto entre la
Academia China de Ciencias Mdicas y la
Academia China de Ciencias Agrcolas, los
Ministerios de Salud, Desarrollo Rural y de
78,120,121
Agricultura tambin participaron).
Actualmente no est claro si es posible
ajustar los precios relativos y las preferencias
a favor de alimentos ms saludables, pero
esto presenta una meta clave global a largo
plazo.
Uno de los principales objetivos en el
esfuerzo de mejorar rpidamente la salud
pblica ha sido la tributacin de alimentos y
bebidas seleccionadas, en especial las
bebidas azucaradas. Muchos pases han
iniciado
discusiones
acerca
de
la
implementacin, o han intentado agregar
tributacin a las bebidas azucaradas, y
algunas organizaciones mundiales, tales
como World Cancer Research Fund y World
Heart Federation, han hecho de esto una
causa principal en sus trabajos. Mxico
proporciona un ejemplo de cmo una
iniciativa del gobierno ha sido implementada
para controlar el consumo de bebidas

azucaradas en escuelas y por lo tanto reducir


el nmero de caloras consumidas por medio
32,69,70
Mundialmente, ms de 20
de bebidas.
pases han prohibido cualquier tipo de
bebidas azucaradas en las escuelas, y
alrededor de 12 han prohibido tambin los
jugos 100% naturales. Existe poca literatura
que soporte los beneficios potenciales de la
tributacin sobre el consumo de bebidas
7,12,122-125
azucaradas.
Monteiro ha planteado la pregunta
controversial de si es posible eliminar algo de
la fuerte dependencia de alimentos ultra
procesados.
l define alimentos ultra
procesados
como
aquellos
alimentos
provenientes de la confeccin de alimentos
procesados, tpicamente con el uso
sofisticado de aditivos para hacerlos
comestibles, sabrosos
y formadores de
hbitos. El siente que estos productos no se
asemejan en nada a los alimentos regulares
(e.g., productos tales como frutas y verduras
y carnes) , an cuando estos alimentos son
maniobrados, etiquetados y comercializados
4,5,82
para parecer saludables y frescos.
Monteiro reclama que los alimentos ultra
procesados son un problema porque ellos
fcilmente inducen a comer en excesos y
son una fuente principal de caloras vacas.
En muchas formas, este argumento refleja el
deseo de Michael Pollan y otros autores
alrededor del mundo quienes quieren ver un
regreso de la ingesta de productos bsicos
como frutas, vegetales, aves y otras carnes
pero no alimentos ultra procesados ( o el uso
126
muy limitado de este tipo de alimentos).
Dado el dominio de una larga y compleja
cadena en el manejo de alimentos desde la
granja hasta el consumidor, sometidos a
varios grados de procesamiento que afecta a
todos los alimentos, es difcil saber qu
etiquetar como un alimento ultra procesado.
Adems, lo prctico de estas iniciativas
desde una perspectiva ambiental y de
hambruna global deben ser an examinado.
En el caso de alimentos ultra procesados, la
pregunta de si es posible proveer alimentos
ms saludables a grandes poblaciones
alrededor del mundo an persiste. Para los
grupos lite, el ingreso econmico, el tiempo
y limitaciones de precio pueden no ser tan
restrictivos como para otros grupos
socioeconmicos, y existen indicadores que
demuestran un cambio hacia un mayor
consumo de alimentos ms naturales en el
grupo elite. Evidencia sobre esto incluye el
renacimiento
de
mercados
agrcolas
(mercados hmedos) a lo largo de los
Estados Unidos de Amrica y otros pases

con un alto ingreso econmico, crecimiento


del movimiento Slow Food , y la creciente
disponibilidad de alimentos orgnicos en el
suministro global de alimentos . Sin
embargo, la globalizacin del suministro de
alimentos, los avances tecnolgicos en
procesamiento y preservacin de alimentos y
el ultra procesamiento de stos est tan
avanzado que es imposible regresar a
formas ms simples y tradicionales de
obtener y preparar los alimentos.
Iniciativas voluntarias del sector privado.
Es posible trabajar con compaas de
alimentos nacionales y globales para
aumentar la calidad y reducir el contenido
calrico de alimentos procesados? Ser
que iniciativas voluntarias podran funcionar?
Ser que las compaas de alimentos
promovern polticas regulatorias y otros
cambios que aborden la obesidad global? Y
podemos tener xito en el mejoramiento de
las dietas si compaas globales (muchas de
las cuales son ms grandes que una nacin
en ingresos y bienes) no cooperan? Estas
son preguntas complejas que son casi
imposible de contestar, y la historia ha
demostrado que la cooperacin es posible
solo en algunos casos. Muchos utilizan el
ejemplo
de
la
batalla
contra
el
comportamiento de los fumadores y el uso
del tabaco como un enfoque a ser utilizado al
abordar los malos elementos del
127,128
Sin embargo,
suministro de alimentos.
mbito de aplicacin y alcance de las
compaas de alimentos es mucho ms
grande que el de las compaas de tabaco, y
la necesidad de todos los consumidores de
comer alimentos nos dirige a temas
complejos cuando el enfoque se dirige hacia
lo que muchos sienten en un punto esencialhay buenos alimentos que alientan y
malos alimentos de desalientan y no es
posible confiar en que los consumidores
coman una dieta saludable de forma
voluntaria .
Actualmente, varias iniciativas mayores a
nivel mundial se estn llevando a cabo. La
que parece ser ms prometedora es la
propuesta por 17 de las principales
compaas de alimentos en la cual proponen
reducir la ingesta total calrica.
Su
compromiso en los Estados Unidos de
Amrica es el de eliminar 1.5 trillones de
caloras del suministro total americano
presente en los alimentos procesados que
ellos vendern en el 2015. Ellos no han
hecho acuerdos explcitos con otros pases
sobre la cantidad exacta de calora a reducir;
sin embargo, ellos estn negociando un

acuerdo similar en Australia. El arreglo


americano est bajo la supervisin de
Healthy Weight Commitment Foundation
El
(http://www.healthyveightcommit.org/).
equipo del Food Research program de la
Universidad de Carolina del Norte (UNC) es
el evaluador oficial de este esfuerzo. An en
los Estados Unidos de Amrica, estos
gigantes globales controlan nicamente
alrededor del 25-30% del total de caloras
consumidas. Por lo tanto, existen preguntas
no solamente sobre la verdadera efectividad
de los cambios en los propios modelos de
venta de las compaas y productos sino
tambin en la distribucin al consumidor de
otros alimentos y bebidas empacadas y
procesadas y otras fuentes calricas.
Walmart est encabezando una segunda
iniciativa en los Estados Unidos de Amrica
en la cual ha comprometido a recortar la
cantidad de caloras vendidas, aunque sin
especificar una cantidad exacta o un fuerte
plan externo de evaluacin. Adems, o est
claro la manera en que Walmart trasladar
este compromiso a sus tiendas a nivel global.
No hay evidencia clara que demuestre
que estos compromisos voluntarios estarn
unidos a una reduccin en la ingesta
calrica, a una mejor calidad diettica o a
reducciones en la tendencia de obesidad,
an cuando se trate de las compaas
129,130
Hoy en da,
alrededor del mundo.
estudios sobre temas tales como el control
de los medios de comunicacin respecto a la
mercadotecnia dirigida a nios proporciona
poca evidencia de alguna disminucin
notable en el comercio de alimentos con
131
Adems, estos esfuerzos
caloras vacas.
voluntarios parecen estar enfocados en los
Estados Unidos de Amrica, Europa y otros
pases con alto ingreso econmico y no
dirigidos a los que presentan un bajo o medio
ingreso econmico.
Hay otro elemento clave en este asunto.
Las compaas de alimentos alrededor del
mundo son responsables por la mayor
porcin de ventas de ciertas categoras de
alimentos,
tales
como
las
bebidas
azucaradas en los pases con bajo y medio
ingreso econmico. Sin embargo, existe una
numero
cantidad
de
preparadores,
procesadores y distribuidores de alimentos a
nivel local. An cuando las compaas de
alimentos alrededor del mundo redujeran el
contenido calrico de sus productos, no est
claro si esos productos podran simplemente
ser reemplazados por los producidos por los
competidores a nivel local que presentan un

contenido calrico ms alto. Nuestro grupo


est tratando de determinar si podemos
medir el alcance de las compaas de
alimentos globales en pases tan diversos
como los Estados Unidos de Amrica y
China. En pases con un ingreso econmico
ms alto, donde el buen gobierno est
presente, es relativamente simple realizarlo;
sin embargo, a travs del mundo, los papeles
de las compaas globales se vuelven ms
obscuros y generalmente es imposible hacer
clculos exactos ya que la informacin
respecto a las propiedades no est abierta al
pblico. Adems, est el impacto indirecto de
estas compaas sobre el tema de cmo se
producen, procesan y distribuyen e incluso el
tipo de productos que las compaas quieren
132
comercializar como alimentos y bebidas.
Una publicacin hecho por JL Watson
demostr cmo la introduccin de McDonald
en Hong Kong, China, Taiwan, Japn y otros
pases asiticos afect por completo la
cultura del servicio de alimentos y la
preparacin
de
stos
en
otros
132
restaurantes.
Los Estados Unidos de Amrica y Europa
Occidental han implementado la seguridad
alimentaria y controles de etiquetado y
monitoreado cuidadosamente muchos de los
componentes de alimentos comercializados,
pero qu
pasara si las compaas
globales de alimentos y los agro-negocios
ve volvieran activos en pases con
economas en transicin y con bajo y medio
ingresos?.Como con el tabaco, ser que
las comidas chatarras y la comercializacin
poco tica se enfocarn en los pases con
bajo y medio ingreso econmico? Nuestro
equipo de la Universidad del Norte de
Carolina ha encontrado alguna evidencia de
esto en el campo de las bebidas
3
Condujimos un estudio de
azucaradas.
caso en las dos compaas productoras de
bebidas azucaradas ms influyentes del
mundo, la Compaa de Coca-Cola y la
PepsiCo, quienes conjuntamente controlan el
34% de las ventas de bebidas sin alcohol y el
69% del mercado de las bebidas
carbonatadas. Examinamos cmo ellos se
ajustan sus portafolios globales de
productos y en tres mercados crticos
(Estados Unidos de Amrica, Brasil y China)
del 2000 al 2010. Sobre una base global, los
ingresos totales y caloras vendidas per
cpita aument. En los Estados Unidos de
Amrica, tanto el total calrico per cpita
como las caloras por onza vendidas
disminuyeron, mientras lo opuesta se vea en
los mercados de Brasil y China. El total de
caloras per cpita aument grandemente en

China y en un menor grado en Brasil. Es


realmente posible que dichos cambios se
presenten en el consumo de muchas otras
categoras de alimentos. Es claro que la
disminucin en Kcal/onza en los Estados
Unidos de Amrica refleja un cambio hacia
una mayor comercializacin de productos
bajos en caloras. Podra tambin reflejar un
aumento en la demanda de bebidas con bajo
contenido calrico, pero no es posible
desenredar la oferta y la demanda. En Brasil,
a pesar del nfasis dado a la obesidad y un
disminucin grande de obesidad entre las
mujeres, no existe evidencia de un cambio
en los patrones de consumo (datos no
publicados).

Polticas de Salud Pblica


Dnde encaja el sistema de salud pblica en
todo este asunto? En muchos pases, el
sector mdico moderno representa un
contacto principal para los individuos durante
tiempos crticos de la vida (embarazos,
infancia y adultez). Tambin los mdicos
modernos gozan de buena reputacin. El
sector de salud pblica por lo tanto tiene un
importante papel que jugar a travs de su
contacto con individuos y familias en muchos
pases. Al mismo tiempo, cuando se refiere a
guas relacionadas a la obesidad, hay pocos
ejemplos a nivel provincial/estatal o nacional
en el cual este sector ha sido movilizado y
usado efectivamente para la prevencin de la
obesidad. Raramente hay evidencia que
demuestre que las enfermeras, mdicos y
otros profesionales de la salud planteen y
discutan
inteligentemente
los
temas
relacionados a una dieta apropiada y
patrones de actividad fsica.
Efectos negativos de los programas
actuales que se enfocan tradicionalmente
en la desnutricin. Como lo demuestran
las experiencias obtenidas en Mxico y
Brasil, el alivio de la pobreza y los programas
de alimentos pueden tener consecuencias
imprevistas, especialmente en ambientes en
los cuales los patrones de actividad se han
vuelto
ms
sedentarios.
Existen
actualmente programas de alimentacin y
nutricin que verdaderamente aumentan el
riesgo de obesidad en Asia, Medio Oriente y
frica? Qu se puede decir de otras
polticas microeconmicas? . Esto de nuevo,
est siendo investigado.
Como se puede observar en los reportes
de estudios realizados en Chile y Mxico,

existe la posibilidad de que los programas


actuales de alimentacin pueden enfocarse
en la reduccin de la hambruna y la
desnutricin, pero en vez de requerir caloras
adicionales, sus poblaciones objetivo podran
necesitar alimentos de ms alta calidad. El
resultado podra ser el aumento en la
93,95,133
Poco se
ganancia de peso y obesidad.
conoce sobre este tema a nivel mundial, ya
que el enfoque ha sido principalmente en la
prevencin o tratamiento de la desnutricin, y
los datos no han sido sistemticamente
evaluados respecto a los efectos potenciales
sobre el exceso en la ganancia de peso y
obesidad. A medida que los pases hacen su
transicin de una reducida hambruna y
pobreza hacia un mejor suministro de
alimentos, aumento de ingresos econmicos
e infraestructuras modernas, hay una
concomitante reduccin en la actividad fsica
y en la calidad de alimentos consumidos
factores que contribuyen claramente al
sobrepeso y la obesidad.

Pueden
las
escuelas
promover
cambios? Globalmente, ha habido grandes
cambios hacia el consumo de alimentos
precocidos
y
preparados,
altamente
procesados y con alto contenido de caloras
vacas. En muchos pases, el conocimiento
acerca de alimentos y las formas de
prepararlos y cocinarlos se han estado
perdiendo a medida que las nuevas
generaciones crecen cada vez ms
dependientes de alimentos preparados fuera
6,134
Para combatir este problema,
de casa.
El Reino Unido construy cocinas para
ensear cmo cocinar a nios y nias en
escuelas secundarias a lo largo del pas del
135-138
Pueden los jardines
2000 al 2010.
de las escuelas y los ejercicios de
enseanzas aumentar la comprensin de los
alimentos y la preparacin de los alimentos
fomentar en la siguiente generacin el gusto
por la cocina y el consumo de alimentos ms
sanos? Poco se conoce sobre esta opcin.
Pocos estudios sugieren que dichas
opciones
podran
funcionar,
pero
evaluaciones rigurosas an no existen. Sin
embargo, en Corea del Sur , una generacin
de amas de casa jvenes fue entrenada para
cocinar alimentos tradicionales que son
platos a base de vegetales sanos y con bajo
contenido de grasa. Esto fue asociado con
una mayor ingesta de vegetales y una menor
139,140
De igual manera,
ingesta de grasas.
existe evidencia que demuestra que en
Francia se entren a varias generaciones de

mujeres para que cocinaran con porciones


controladas, lo que podra haber influido en
la reduccin del tamao de la porcin en este
6,141,142
pas.
La comercializacin. La globalizacin y la
Organizacin
Mundial
del
Comercio
frecuentemente proponen un libre comercio
en el servicio de alimentos alrededor del
143
mundo . Se presentan efectos tales como
una reduccin en los precios de aceites
comestibles y un aumento en la ingesta de
estos aceites en China que pueden estar
unidos a acuerdos especficos, como los que
abordan
temas
sobre
barreras
de
comercializacin de algunos productos
importados. Sin embargo, la modernizacin y
el aumento en el comercio van de la mano
con el mejoramiento en la calidad de vida
que ningn pas estara dispuesto a
renunciar voluntariamente. Lo que hace falta
es un conocimiento sobre los componentes
especficos que gobiernan los acuerdos
comerciales que podran afectar de forma
adversa las dietas y los efectos de las
polticas comerciales y econmicas sobre los
patrones dietticos.
Comercializacin de productos poco
saludables en nios. Un rea primordial de
preocupacin se relaciona a cmo la
comercializacin de alimentos dirigidos a
nios contribuye a un ambiente obesognico. El papel de los medios de
comunicacin televisin, computadoras,
notebooks, o telfonos celulares se ha
expandido tanto en uso como en impacto.
Los medios de comunicacin tienen acceso
directo al consumidor, y la penetracin global
es tan grande que ninguna casa, villa o
sector urbano se escapa a l. Al mismo
tiempo, los productos mostrados en pelculas
o en las carteleras y en otras partes han
creado un ambiente en el cual nios y
adultos se ven invadidos por imgenes de
comidas y bebidas que estn causando
cambios globales en las demandas de
127,128,144,145
Por lo tanto, un
alimentos.
objetivo principal en el combate a la
obesidad es el control de los medios de
comunicacin, aunque todas las iniciativas
se han enfocado nicamente en la
comercializacin dirigida a los nios y no en
la comercializacin general, como ocurri
aos atrs con los esfuerzos realizados para
controlar la comercializacin del tabaco.
Podra por lo tanto haber lecciones
importantes provenientes de la historia del
tabaco que sean relevantes en el caso de los
alimentos.

Polticas del sector pblico respecto a los


servicios de alimentacin saludable. El
sector pblico alimenta a una enorme
cantidad de individuos en escuelas,
hospitales y departamentos del gobierno. El
mejorar la calidad de los alimentos servidos
en estas instituciones contina siendo una
98
Al igual que con la
medida clave.
comercializacin de alimentos, nicamente
mnimas evaluaciones de las iniciativas del
sector pblico y su relacin con la dieta y la
composicin corporal han sido completadas.

Etiquetado de Alimentos y Nutricin.


Etiquetado de alimentos est surgiendo
como una iniciativa global de gran
importancia. En Amrica Latina, Asia y frica
el enfoque no es nicamente solo sobre el
proveer paneles de informacin nutricional
de los alimentos, sino tambin el desarrollar
sistemas para identificar si un alimento o
bebida es considerada como saludable de
acuerdo a las costumbres alimentarias de
cada pas y plantear iniciativas globales para
reducir azcares agregados, grasas trans y
otros tipos de grasas saturadas as como el
sodio agregado en los alimentos, mientras se
fomenta el consumo de granos enteros,
100
frutas, legumbres y otros vegetales.
India, China, Brasil, Mxico, Sudfrica y
Chile estn considerando implementar
dichas iniciativas. Es una opcin muy
prometedora a medida que el suministro de
alimentos a nivel global se inclina
enormemente hacia el consumo de alimentos
procesados y empacados y a la compra de
alimentos en cadenas de tiendas, tales como
las tiendas de conveniencia, abarroteras,
supermercados o megamercados.

CONCLUSION
Durante el ltimo medio siglo, ha habido
grandes cambios respecto a cmo los
humanos comen y beben, la incidencia de un
desbalance
energtico,
sobrepeso
y
obesidad, y sobre una amplia gama de otros
problemas cardio-metablicos relacionados
con la nutricin. Desafortunadamente, no
contamos con los datos para documentar de
forma precisa la forma en que estos cambios
se comparan con otros a lo largo de la
evolucin humana. Sin embargo, desde
nuestra
perspectiva,
como
individuos
consientes de alcanzar una dieta y una

composicin corporal saludable, parece


como si muchos efectos adversos se han
acelerado durante las pasadas dcadas a lo
largo del mundo. Esto no significa que todos
los cambios que han ocurrido son percibidos
como dainos. En contraste, las mejoras
respecto a la conveniencia y seguridad de
alimentos y el aumento de las dietas
grasosas, azucaradas y saladas y las nuevas
e interesantes bebidas con grandes sabores
traen muchos beneficios. Sin embargo, es
importante evolucionar hacia una dieta ms
saludable, y en muchos casos, hacia dietas
menos procesadas con un mayor contenido
de nutrientes y hacia alimentos ms
saludables. Para prevenir problemas futuros
y para proveer para aquellos con
enfermedades no transmisibles relacionadas
con la nutricin (obesidad, diabetes, cncer y
otras) es imperativo mejorar los patrones
alimentarios alrededor del mundo. El
enfocarse en tratamientos mdicos, en la
reduccin del tabaco y en regular el
contenido de sodio en la dieta no detendr la
creciente epidemia de obesidad y muchos
otros problemas cardio-metablicos o todos
los problemas econmicos, de salud y otras
consecuencias que enfrentan los pases con
bajo o medio ingreso econmico. Acciones
efectivas requieren contar con evidencias
basadas en datos y programas y polticas de
evaluacin cuidadosa. Esta resea resume
una gran cantidad de trabajos que han sido
realizados en el ltimo medio siglo en
respuesta a las preocupaciones acerca de
cambios alimentarios rpidos que ocurren en
etapas alrededor del mundo.

Etiologa de la Obesidad en Nios: Naturaleza y Crianza


Joseph A Skelton, MD, MS. Megan B. Irby, MS, Joseph G, Gryzwacz, PHD, Gary Miller PHD
La investigacin cientfica a proporcionado una perspectiva increble de las causas y factores que
contribuyen a la obesidad infantil, un asunto biopsicosocial profundamente complejo. El modelo
ecolgico (Fig. 1) para comprender la obesidad es el que mejor capta los factores implicados que
se sobreponen. En este artculo, los autores proporcionan una breve visin dividida entre los
factores biolgicos (naturaleza) y los factores psicosociales y de comportamiento (crianza). Sin
embargo como con cualquier condicin compleja, la lnea entre los dos puede frecuentemente
borrarse.
Fig 1. Modelo Ecolgico de factores predictores de la obesidad infantil.

NATURALEZA
Los determinantes genticos y biolgicos del sobrepeso y la obesidad estn entrelazados. Con el
2
descubrimiento de la leptina en 1994, la comprensin de la regulacin energtica, apetito y
adiposidad ha explotado, y el campo se ha vuelto mucho ms complejo como resultado. Los

descubrimientos continuos implican otros contribuyentes, desde microorganismos intestinales


hasta el estrs.

Control neuroendocrino del peso corporal


En trminos simples, el control neuroendocrino del peso es un balance entre el control a corto y
largo plazo del peso, sobre todo de la ingesta energtica y el gasto energtico. Este balance puede
comprenderse de mejor forma cuando se divide entre el sistema nervioso central (principalmente
el cerebro) y el cuerpo (principalmente el tracto gastrointestinal y el tejido adiposo). 3-5
El control a corto plazo
El control a corto plazo del peso corporal se relaciona de gran manera con el control de la ingesta
energtica.3,5 El inicio de la comida est influenciada principalmente por el estimulo ambiental tal
como la comida, emociones, hora del da, y pares.6 Sin embargo, una vez la comida inicia, los
factores neuroendocrinos ejercen cierta influencia, afectando entonces el tamao de la comida,
la cantidad de energa que se ingiere, y el momento en que se termina la comida (Tabla 1).3, 5
Tabla 1
Seales involucradas en el control a corto plazo del peso corporal.
Nombre
Origen
Accin y efecto
Amilina
Pncreas
(clulas
); Reduce el tamao de la
secretada conjuntamente con porcin
a
travs
de
la insulina
mecanismos
del
tronco
enceflico
Colecistoquinina
Intestino (clulas-i)
Controla el tamao de la
porcin
disminuyendo
el
vaciamiento
gstrico,
estimula las contracciones de
la vescula biliar, tambin
activa los receptores vagales
para terminar la comida.
Grelina
Estmago
Potente
estimulador
del
apetito,
a
travs
de
mecanismos
del
sistema
nervioso central.
Pptido similar al glucagn
Intestino (clulas-L)
Estimula la liberacin de
tipo 1
insulina, reduce el apetito.
Oxintomodulina
Colon
Reduce el apetito
Polipptido pancretico
Pncreas
Reduce el apetito, al parecer
inhibiendo la actividad a nivel
pancretico, vescula biliar y
el tracto gastrointestinal.

Pptido YY (PYY3-36)
Intestino
(leo/colon), Reduce el apetito, enlentece
secretado conjuntamente con el vaciamiento gstrico.


el pptido similar al glucagn
tipo 1
En los individuos obesos, los niveles sricos de grelina estn bajos y, por si misma no parece ser un
factor que contribuya a la obesidad. Sin embargo, la grelina tiende a aumentar durante la prdida
de peso inducida por una dieta y puede explicar los altos niveles de hambre al hacer una dieta.8 La
mayora de las seales gastrointestinales a corto plazo tienen efectos locales, tales como el
enlentecer el vaciamiento gstrico y sobretodo la motilidad gastrointestinal proximal,7 y tambin
actan a nivel central, ya sea directamente o por medio de acciones vagales.3-5, 7
Control a largo plazo
El control a largo plazo se divide entre el cerebro y el cuerpo a travs de los niveles de adiposidad.
Estas seales de adiposidad del cuerpo actan para comunicar los niveles de almacenamiento de
energa a nivel central, los cuales actan para ajustar la ingesta y gasto energtico (Tabla 2)
Tabla 2
Seales que involucran control a largo plazo del peso corporal
Nombre
Origen
Accin y efecto
Adiponectina
Tejido adiposo
Estimula la sensibilidad a la
insulina,
disminuye
la
inflamacin
Pptido relacionado con
Ncleo arqueado
Incrementa
el
apetito,
agouti
(hipotlamo)
disminuye el metabolismo
Ncleo arqueado
Hipotlamo
rea
de
regulacin
energtica;
ubicacin
de
CART, POMC, AgRP, NPY
Neuronas de transcripcin
Ncleo arqueado
Reduce la ingesta energtica.
regulada de cocana y
(Hipotlamo)
anfetamina
Insulina
Pncreas
Reduce la ingesta energtica
Leptina
Tejido adiposo
Reduce la ingesta energtica
Hormona estimuladora de
POMC (ARC del hipotlamo)
Reduce al ingesta energtica
melanocito
Neuropptido Y
Ncleo arqueado
Aumenta el apetito, disminuye
el metabolismo
Orexina
Hipotlamo
Aumenta el apetito
Oxintomodulina
Colon
Reduce el apetito
Pro-opiomelanocortina
Ncleo arqueado
Libera
la
hormona

(hipotlamo)
estimuladora de melanocito,
reduce la ingesta energtica
Ncleo paraventricular
Hipotlamo
Apetito
y
regulacin
autonmica.

Las seales primarias del cuerpo son la leptina e insulina, ambas efectan el control a largo plazo
de la ingesta de alimentos y el metabolismo.5 La leptina se secreta en proporcin al contenido de

grasa de los adipocitos y regula las neuronas que controlan la ingesta de alimentos en el ncleo
arqueado.3-5 Los individuos obesos pueden tener una resistencia relativa a la leptina, similar a la
resistencia a la insulina, que contribuye a la obesidad.9, 10
Un descubrimiento importante en la comprensin del control de peso es la funcin endocrina del
tejido adiposo.11 La leptina tiene un papel importante en el control a largo plazo del peso corporal,
12
sin embargo tambin otras hormonas y citoquinas liberadas por el tejido adiposo afectan la salud
en general.
La principal regin del cerebro para el balance energtico es el ncleo arqueado, ubicado en el
hipotlamo, el cual controla la ingesta energtica (comer) y el gasto energtico (metabolismo).3-5
Adems de dirigir la influencia de los nutrientes circulantes indicando la saciedad (ej. Glucosa,
cidos grasos, y algunos aminocidos), el ncleo arqueado recibe seales de la leptina e insulina,
expresando receptores para la mayor parte de seales de adiposidad que regulan a largo plazo el
peso corporal.
El ncleo paraventricular es el mayor determinante del gasto energtico, sintetizando factores
anorexigenos como la hormona liberadora de corticotropina y la oxitocina, regulando por tanto la
respuesta del cuerpo al estrs. El hipotlamo lateral es responsable de los pptidos orexigenos, la
hormona concentradora de melanina, y la orexina. Otras reas clave del cerebro para controlar el
peso corporal tambin son influenciadas por las proyecciones hipotalmicas. El sistema
mesolmbico-hipotalmico influencia las respuestas hednicas y de gratificacin del cuerpo a la
alimentacin. Los centros autonmicos del tronco enceflico ejercen influencia a nivel del tracto
gastrointestinal Fig 2 muestra cmo el control del peso a corto y largo plazo a lo largo del cuerpo
y el cerebro est integrado.

Genes y otros factores que contribuyen a la obesidad


Aunque varios factores genticos que contribuyen a la obesidad han sido identificados en las ltimas
dcadas, solamente 176 casos de obesidad conocidos han sido relacionados con mutaciones
genticas en humanos.17 El mapa gentico de la obesidad humana del 2005 indica que 253 loci
recesivos estn relacionados con los fenotipos de la obesidad, con 127 genes candidatos. Estos
genes candidatos han sido identificados en cada cromosoma excepto en el Y.

Causas infecciosas
La causas infecciosas incluyen una forma de adenovirus (AD36) que causa un incremento en el
tejido adiposo en modelos animales.20-22 Aunque parece poco probable que la epidemia de la
obesidad sea resultado de un esparcimiento de la infeccin por adenovirus, si existe una relacin
entre ambos.
Microbiota Intestinal
Las teoras que relacionan la obesidad y la microbiota intestinal giran alrededor del uso de energa
de los alimentos ingeridos por parte de la flora intestinal, fermentacin de los alimentos en cidos
grasos listos para absorberse, y la influencia en el metabolismo en rganos perifricos.
Estrs
El estrs crnico afecta el estado del peso a travs de una regulacin anormal del eje hipotalmicopituitario-adrenal, lo cual causa un metabolismo anormal del cortisol.28 El Estrs puede ser
resultado de diferentes causas, por ejemplo, falta de sueo, desnutricin, depresin y estresantes
ambientales como la pobreza. Estos factores pueden estar relacionados con el riesgo de obesidad,
an el perodo prenatal. 29,30
Medicamentos
Varios medicamentos, particularmente los antipsicticos, causan ganancia de peso.31 Altas dosis
de glucocorticoides inhalados, glucocorticoides orales, antipsicticos, estabilizadores del humor
(litio), antidepresivos (triciclicos), anticonvulsivos (valproato, carbamazepina), anticonceptivos
orales e insulina y secretagogos de insulina son los ms comunes, pero hacen falta estudios en
nios. 32
Condiciones endocrinas
De los nios que son referidos para evaluacin por obesidad, las causas endocrinas solamente se
presentan en 2% a 3% de los casos.34 Tabla 3 lista los desordenes ms comunes.
Tabla 3
Causas endocrinas de la obesidad infantil
Hipotiroidismo
Deficiencia de la hormona de crecimiento
Sndrome de cushing
Insulinoma

Obesidad hipotalmica

Baja estatura y obesidad pero el peso se


encuentra bajo el percentil 95 para la edad.
Disminuye la velocidad de crecimiento lineal
con un aumento en la ganancia de peso, mayor
adiposidad central.
Disminuye la velocidad de crecimiento lineal,
incrementa la adiposidad central, estra
abdominal , resistencia a la insulina
Incrementa la ingesta de alimentos para
contrarrestar los bajos niveles de azcar en
sangre.
Hiperfagia, otros desordenes endocrinos;


Pseudohipoparatiroidismo tipo 1A

Mltiples deficiencias endocrinas

CRIANA
Aun cuando ha habido grandes descubrimientos sobre los determinantes biolgicos de la obesidad
en nios, el rpido aumento en la prevalencia de la obesidad apunta ciertamente a que los factores
ambientales son los que tiene mayor impacto. Las influencias externas en la obesidad varan por
etapa de la vida, circunstancia, y predisposicin gentica. Los cambios en los aspectos
nutricionales y de actividad de los nios y sus familias en las ltimas dcadas son los que han tenido
el mayor impacto en la actual epidemia.
Obesidad y el ciclo de la vida
Prenatal
Ambiente prenatal e in utero
El ambiente prenatal influye en el desarrollo fetal. El crecimiento fetal puede est determinado
por la cuenta celular, centros cerebrales maternos que controlan la saciedad y el apetito, y la
funcin endocrina aun antes de la concepcin. El estrs prenatal y la insuficiencia placentaria
pueden tambin influir en alterar la funcin pancretica y la sensibilidad a la insulina. Estos efectos
pueden persistir an en la edad adulta, aumentando el riesgo de las condiciones relacionadas a la
obesidad, tales como el sndrome metablico.
Desnutricin materna y deprivacin
La restriccin de nutrientes resultado de la desnutricin materna en los primeros dos trimestres
del embarazo se relacionan fuertemente con el peso al nacer y un mayor riesgo de obesidad en los
nios pequeos. Esto puede atribuirse a las anormalidades estructurales y funcionales del sistema
endocrino causado por la restriccin de nutrientes y alteracin de la homeostasis de insulina y
glucosa.
Diabetes materna
Varios estudios han investigado la exposicin prenatal a la diabetes in utero, mostrando un
incremento en la prevalencia de sobrepeso en la niez u obesidad si la madre era diabtica durante
el embarazo. Los potenciales mecanismos responsables de esta mayor prevalencia son la
hiperglicemia y la hiperinsulinemia causada por el pobre control glicemico de la madre diabtica.
Tabaquismo materno durante el embarazo
Los nios expuestos al humo de cigarrillo durante el periodo prenatal exceden con mayor frecuencia
el 90 percentil del IMC durante la adolescencia. Los mecanismos propuestos para esta asociacin
incluyen los efectos de la nicotina sobre la leptina y el apetito materno y un metabolismo oxidativo

fetal
anormal debido al dixido de carbono y compuestos de cianuro que se encuentran en el humo
de cigarrillo.

Peso materno y embarazo


El peso materno tanto antes como durante el embarazo, y la magnitud de la ganancia de peso
durante el embarazo, se vincula con un incremento en el riesgo de sobrepeso y obesidad en las
etapas posteriores. La obesidad materna, especialmente durante el primer trimestre, incrementa
de forma evidente el riesgo que un nio sea obeso a la edad de 4 aos. La ganancia de peso materna
durante el embarazo tambin se relaciona con una mayor probabilidad de obesidad en la niez.
Postnatal
Lactancia materna
La lactancia materna versus la alimentacin con formula es una decisin nutricional importante
que puede influir en el riesgo de obesidad infantil. La evidencia sugiere que la lactancia materna
reduce el riesgo de ganancia de peso peditrica; los nios que fueron alimentados con formula
tiene una prevalencia de obesidad de 4.5% comparado con 2.8% en los nios amamantados.68
Investigaciones ms recientes sugieren que la lactancia materna por 6 meses o ms tiene un efecto
protector modesto en contra de la obesidad en la adolescencia pero no en el sobrepeso. 69 En un
informe, la lactancia materna por ms de 6 meses se asoci con un menor riesgo de sobrepeso y
obesidad den los nios de 5 aos. 8
Los primeros aos postnatales
Como con la lactancia materna, la sobre alimentacin y las practicas de alimentacin en etapas
tempranas de la niez son factores que inciden grandemente en la obesidad infantil, influenciando
las concentraciones de leptina y la adiposidad en las etapas posteriores de la vida.70 La tasa a la
cual los infantes ganan peso durante los primeros meses de vida, y el tipo de alimentacin que
reciben (formula o lactancia materna) se relacionan con el peso ms tarde en la niez as como el
riesgo de enfermedad cardiovascular en la edad adulta. 61 Independientemente del peso al nacer y
el peso a la edad de 1 ao, una ganancia rpida de peso an en los primeros 4 meses de vida se
asocia con el incremento en el riesgo de sobrepeso a la edad de 7 aos.71
Alimentacin en la niez temprana y crianza
Los ambientes del hogar y social, los estilos de crianza, y las practicas de alimentacin de la familia
son las principales influencias en los comportamientos nutricionales en etapas tempranas de la
niez. 72-76 Aproximadamente dos tercios de las comidas consumidas por los nios provienen del
hogar. 77
Los nios que son criados por padres autoritarios que promueven la responsabilidad, monitoreo y
el ejemplo tienden a tener una mejor nutricin y menor IMC. 82 Las practicas de alimentacin
orientadas al nio, la motivacin en la nutricin positiva, y el consumo de frutas y verduras por
parte de los padres tambin estn asociados positivamente con el consumo de frutas y verduras en
sus hijos. 75 Esta informacin apoya la nocin que los factores familiares son componentes cruciales
en la prevencin y tratamiento de la obesidad peditrica.
Rebote de adiposidad

El perodo de rebote de adiposidad describe el momento en el cual la curva del IMC comienza a
aumentar despus de un punto muy bajo que ocurre entre los 5 y 6 aos. Los nios con peso normal
con al menos un padre con sobrepeso al momento del rebote de adiposidad tiene 5 veces mayor
probabilidad de ser obesos de adultos. Los nios que presentan el rebote de adiposidad antes tienen
5 veces ms de probabilidad de ser obesos en la adultez, y aquellos que ya tiene sobrepeso al
momento del rebote de adiposidad tiene 6 veces ms riesgo de ser obesos en la edad adulta. 89
Cambios en la familia
Es obvio que los cambios en la estructura familiar afectan la nutricin y los hbitos de actividad
fsica de la familia. Las comidas familiares, comida rpida, practicas de alimentacin en la niez
temprana, rutinas de sueo, estilo de crianza, uso de medios de comunicacin, actividad fsica
familiar, niveles de obesidad en los adultos, estado socioeconmico, e interaccin con los servicios
de salud son factores clave asociados con la obesidad den la niez y pueden ser moderados por
cambios en la familia. Las familias en los Estados Unidos han experimentado cambios sustanciales
mientras la epidemia de la obesidad avanza. En 1970, aproximadamente 85% de los nios vivan
con sus dos padres casados; para el 2010 se estima que esto se ha reducido al 66%, y la mayora de
cambios ocurrieron entre 1970 y 1990. Durante el mismo perodo, los nios que vivan en un hogar
solo con la madre incremento de 11% a 23%, con una diferencia significativa entre grupos raciales.90
Esto es importante debido a que los nios que viven en hogares solo con la madre tienen
sustancialmente mayor riesgo de vivir en pobreza, 91 mayor riesgo de obesidad en la niez y pobres
resultados en salud. 92,93 Durante este mismo periodo, ha habido un incremento sustancial en la
participacin de la mujer en la fuerza laboral, incrementando de 43% en 1970 a 66% en 2009.94 Sin
embargo, existe poca evidencia que relacione estos cambios en la familia con el riesgo de obesidad
en nios.
Estilo de vida y Ambiente
Dieta
Entre los factores dietticos vinculados a la obesidad, los alimentos altos en grasa y azcar son los
que se han estudiado con mayor frecuencia. Aunque el consumo excesivo de ciertos alimentos
llevan a la ganancia excesiva de peso y obesidad, otros patrones (ej. Consumo de una dieta alta en
frutas y vegetales) se cree son protectores en contra de la obesidad. Las frutas y vegetales tienen
mayor agua y contenido de fibra diettica, lo cual hace que tengan una baja densidad energtica.
Aunque su mecanismo de accin todava no es claro, el consumir una dieta alta en frutas y vegetales
puede ayudar a reducir el peso y la grasa desplazando los alimentos energticamente densos de la
dieta.95, 96 La fibra en las frutas y vegetales ayuda a reducir la ingesta total de energa iniciando la
saciedad97, 98 y alterando las hormonas postprandiales a travs de la reduccin en la carga glicemica
99,100
.
Otro aspecto que se puede tomar en cuenta son los cambios en el tamao de la porcin de los
alimentos, la cual ha incrementado en las ltimas dcadas.108, 109. Las tasas en incremento de la
obesidad
coinciden con un incremento en el consumo de azcares agregados.115 En nios y

adolescentes de 2 a 18 aos, aproximadamente el 20% de la energa total proviene de azcares


agregado en los alimentos y bebidas. 116 Recientes revisiones sistemticas van de no encontrar

evidencia a encontrar una evidencia fuerte que las bebidas azucaradas contribuyen
significativamente en el IMC de los nios. 117,118.
Actividad
En la epidemia de la obesidad es importante sealar que se ha identificado que las actividades
sedentarias estn aumentando 135-137. Por lo tanto los bajos niveles de actividad fsica en los nios
definidos como el no alcanzar las recomendaciones, son problemticas. 144.145 Esta anormalidad en
el balance energtico puede explicar mucho el aumento de la obesidad peditrica.
Sueo
El vnculo entre la obesidad peditrica, mayor grasa corporal y la duracin del sueo ha sido
ampliamente demostrada en la literatura. 146 La restriccin del sueo se asocia con un mayor
consumo de alimentos, incluyendo tanto comidas como refacciones 148,149 incrementando por tanto
el riesgo de obesidad. La falta de sueo puede tambin conducir a una disminucin de la actividad
fsica e incrementar los comportamientos sedentarios. 150, 151
Aun cuando la causa no se ha podido establecer, los estudios epidemiolgicos en nios han indicado
una asociacin definitiva entre la disminucin en la duracin del sueo durante la noche e
incremento de peso. El incremento en el IMC en los nios se asocia con una reduccin en la duracin
del sueo, lo cual puede deberse probablemente ms a un incremento en los depsitos en el tejido
adiposo. 154
Industrializacin y obesidad
La obesidad y los factores de salud asociados son una preocupacin a nivel mundial. El incremento
en el consumo de una dieta oriental implica que el comer azcar y grasa, alimentos altamente
procesados y energticamente densos ocurre a nivel global. Popkin155 describe la transicin
nutricional como algo que ocurre en diversas etapas, con la urbanizacin, crecimiento econmico,
y cambios tecnolgicos en el trabajo, ocio y procesamiento de los alimentos que conducen a los
cambios en las diferentes etapas. La obesidad es evidente en la etapa 4, o el perodo de la
enfermedad degenerativa, caracterizada por un incremento en el consumo de grasa, azcar y
alimentos procesados y una mayor presencia de tecnologa en el trabajo y ocio.
Los cambios sociales y econmicos en las comunidades, tales como la transicin de transporte fsico
a transporte mecanizado, introduccin de alimentos procesados y supermercados y acceso a la
televisin, tambin cambian la prevalencia de sobrepeso y obesidad.
El ambiente construido
Existe evidencia sustancial que muestra que las modificaciones en el ambiente construido
relacionado con actividad fsica y alimentacin son un factor importante en la obesidad infantil.157
Por ejemplo, las diferencias en los vecindarios en cuanto al acceso a la alimentacin influye en los
niveles
de obesidad 158-161 En adolescentes y adultos, la mejor disponibilidad de alimentos sanos

conduce a una alimentacin ms sana, incluyendo mayor cantidad de frutas y vegetales, menor
grasa diettica, y mejor calidad de la dieta 162-166 Por lo tanto, la disminucin en el riesgo de

obesidad en nios y adolescentes est asociada con un mejor acceso a los supermercados.

158, 159,

161, 167

Las escuelas desempean un papel importante en la nutricin infantil debido a que la mayora de
nios comen al menos una comida al da en las escuelas y pasan aproximadamente 6 horas al da
en la escuela. La presencia de un establecimiento de comida rpida a 0.1 milla de la escuela est
asociado con un incremento del 5% en la tasas de obesidad. 168
La urbanizacin tambin est asociada con la obesidad adulta, por lo que las comunidades con
aceras para caminar, intersecciones seguras, destinos accesibles, reas verdes que llaman la
atencin y transporte pblico han mejorado los niveles de actividad y la salud 169. Una declaracin
poltica de la Asociacin Americana de Pediatra ha hecho un llamado para abordar de forma
multidisciplinaria para construir comunidades que promuevan los estilos de vida activos en los

nios.171.
Resumen
La obesidad en la niez es un tema mdico complejo, que representa una interrelacin entre
factoresfsicosyambientales.Elcontrolneuroendocrinodelpesotienemltiplessituacionesenlas
cualeslavariacingenticapuedeinfluenciarelpesodeunapersona.Sinembargo,laevolucinno
saludabledelosambientesdealimentosyactividadhacolocadoalosniosenunmayorriesgode
obesidadyproblemasasociadosalpeso.

REFERENCIAS
Verdocumentooriginal.

Influencia del ambiente en la obesidad infantil:


Influencia tnica y cultural en contexto.
Shiriki K. Kumanyika
1. Introduccin
Ninguna discusin sobre los factores ambientales de la obesidad estara completa
sin considerar los factores culturales. Las actitudes y los comportamientos
relacionados con el tamao y la figura corporal se han comprendido a lo largo
del tiempo como algo culturalmente definido [1,2]. El contexto cultural de los
alimentos y la alimentacin tambin se encuentran bien establecidos [3,6] Los
tipos y cantidades de comidas y bebidas, sabores, texturas, combinaciones de
alimentos y usos tradicionales y significado de los alimentos marcan una
diferencia entre los grupos tnicos y sociedades, tiene significados simblicos,
crean interacciones sociales, y definen el placer y el castigo. Adems, en cada
tradicin cultural existen conceptos de cmo los alimentos se relacionan con la
salud, cuales alimentos se consideran dainos y cuales son protectores [3] Estas
influencias culturales aplican a los patrones de alimentacin de los adultos tanto
cmo a qu y cmo deben los adultos alimentar a sus hijos y cmo los nios son
criados para escoger sus alimentos. Estos aspectos culturales de los alimentos son
universales, an as sus expresiones difieren grandemente entre poblaciones,
clases y grupos, formados y condicionados por interacciones con los ambientes
fsicos as como las tendencias y eventos sociopolticos y econmicos. [3-6]
Las creencias culturales y prcticas relacionadas con los alimentos y la
alimentacin varan entre grupos tnicos, y estas diferencias pueden contribuir a
los diferentes patrones de obesidad en la niez y en la adolescencia relacionada
con su etnicidad. Este artculo remarca la evidencia sobre las bvariacines
relacionas con los grupos tnicos y como las variables culturales y otras
ambientales que varan entre grupos tnicos pueden interactuar. Se proporciona
una breve resea de las caractersticas relevantes de las poblaciones minoritarias
racial/tnica de EUA, seguida de informacin selecto sobre los factores que
influyen en la obesidad infantil en estas poblaciones durante la gestacin,
infancia, niez y adolescencia y la discusin de las influencias culturales y
ambientales.
2. Antecedentes
2.1 Clasificacin racial/tnica
Las clasificaciones utilizadas para definir las poblaciones minoritarias
raciales/tnicas se basan en la categorizacin auto reportada en el censo de

informacin de EUA [14] o en informacin similar recolectada de los servicios de


salud o los registros de programas de salud. La clasificacin ms utilizada y
amplia es: negro/Afroamericano, Hispano/Latino, Indio Americano y Nativo de
Alaska, Nativo de Hawaii, Asitico Americano y de las Islas Pacfico. Los
Hispano/Latinos incluyen a las personas nacidas en EUA e poblaciones de
inmigrantes que tienen su origen en Mxico, Puerto Rico, Cuba, Amrica Central
y Amrica del Sur y Espaa. [16].
2.2 Interpretacin de las diferencias racial/tnica.
Las variaciones tnicas incluyen variaciones en las actitudes y prcticas
culturales y tambin reflejan otros factores en los cuales las poblaciones
minoritarias difieren, entre ellas y de la mayora de poblaciones blancas. Estos
factores incluyen diferencias en la regin geogrfica de residencia o nivel de
urbanizacin, tamao de la familia, tipo de composicin del hogar, acceso a
servicios de salud y comportamientos relacionados a la salud, caractersticas del
vecindario incluyendo seguridad, nmero y tipo de servicios disponibles, y el
nivel de segregacin racial/tnica. La segregacin es ms alta en Afroamericanos
[22] lo cual agrava la pobreza de forma cualitativa [23] y generalmente limita las
opciones personales as como la flexibilidad para ejercer ests selecciones.
[24,25].
2.3 Diferencias tnicas en la prevalencia de obesidad
Como se describe en el resumen epidemiolgico realizado por Adair [18], de la
informacin obtenida de la Encuesta Nacional de Salud y Nutricin (NHANES, por
sus siglas en ingls) se muestra una prevalencia mayor de la promedio en nios
negros no-hispanos y mexicano americanos en comparacin con los nios blancos
no hispanos en la mayora de las edades [7]. En los nios varones el exceso de
obesidad es principalmente evidente en mexicanos americanos en las edades de
2 a 11 aos, comparados con los negros no hispanos o nios blancos en esos
grupos de edades. En las nias, el exceso de obesidad es evidente tanto en las
nias negras no hispanas y mexicanas americanas en todas las edades y es
particularmente evidente entre las nias negras no hispanas comparadas con las
otras nias a las edades de 6 a 19 aos. Esto sugiere que los factores
predisponentes que conducen al exceso de obesidad pueden diferir por gnero
as como el momento del desarrollo. Estas diferencias en las prevalencias
reflejan mayor profundidad que las tasas promedio de crecimiento en obesidad
en mexicanos americanos y particularmente en los nios negros no hispanos
durante las ltimas tres dcadas [27] y especialmente en nios a partir de los 6
aos y ms.

El NHANES solo reporta informacin especfica para la etnia negra no hispana,


blancos y mexicanos americanos. Las encuestas de comunidades selectas o
poblaciones basadas en escuelas, estudios de cohorte o informacin del sistema
de salud [28-33] claramente muestran un riesgo alto de obesidad que afecta
generalmente a los nios hispano/latinos y otras etnias propias de EUA, a
diferentes edades. En las poblaciones de inmigrantes, la prevalencia de obesidad
incremente a travs de las generaciones y con mayor tiempo de residencia en los
Estados Unidos. Por ejemplo, en informacin de un estudio grande en
adolescentes de EUA de diversos grupos tnicos, la probabilidad de ser obeso era
dos veces mayor entre los hispanos y los Asiticos Americanos que nacieron en
los Estados Unidos comparado con aquellos que nacieron en otro lado y que eran
nuevos inmigrantes [39]. Indirectamente, esto resalta el hecho que las
diferencias tnicas en la obesidad estn fuertemente determinadas por factores
ambientales.
3. Diferencias entre los grupos raciales/etnias en factores relacionados con la
obesidad en la niez
3.1 Gestacin e infancia temprana
La obesidad materna y la diabetes estn asociadas con que los infantes tengan un
peso al nacer ms alto. Aunque esto puede reflejar una predisposicin gentica
en la madre que se transfiere al infante, otros mecanismos relacionados con las
exposiciones fetales a la glucosa circulante o el control metablico del apetito o
la regulacin del balance energtico tambin son posibles [40-42]. Cualquiera
que sea, el mecanismo, la obesidad materna y la diabetes pueden ser algunos de
los riesgos ms altos de la obesidad en la niez en poblaciones minoritarias. La
prevalencia de obesidad es mayor en mujeres Afroamericanas, Hispanas/latinas y
Nativas Americanas en comparacin con mujeres blancas [7, 43,44], y la
prevalencia de diabetes durante el embarazo tambin es alta entre mujeres en
estos grupos tnicos as como en algunos sub grupos de mujeres Asiticas
Americanas. El bajo peso al nacer tambin se ha asociado con un riesgo
subsecuente de obesidad central pero no necesariamente con obesidad
generalizada durante la niez.
Un estudio con adolescentes con sobrepeso segn la temperatura ambiental al
momento del nacimiento provee ciertos indicios de los factores que pueden
influir durante la gestacin como predisponentes a un peso en exceso en mujeres
adolescentes Afroamericanas [47]. Este estudio fue motivado por una evidencia
de una posible relacin entre el desarrollo de la obesidad y la temporada de
nacimiento basado en estudios animales y algunas observaciones en humanos. Los
resultados indicaron que el tener sobrepeso estaba relacionado con una

temperatura ambiental alta en el segundo y tercer trimestre de gestacin y al


momento del nacimiento, en mujeres pero no en hombres. Los autores
determinaron diversos mecanismos que conducen a efectos diferentes en la
regulacin del apetito o del depsito de grasa variacin en los niveles de
melatonina asociados con el largo del da o efectos de la temperatura ambiental
o cambios estacionales en ingesta materna de carbohidratos y grasa.
La ganancia de peso rpida en el primer ao de vida puede predisponer al
desarrollo de la obesidad en la niez o posteriormente en la edad adulta, sin
importar el peso al nacer [48-50].

3.2 Niez y adolescencia


Los determinantes de la obesidad durante la niez y adolescencia incluyen las practicas
de alimentacin durante la niez, decisin de los padres sobre los tipos de alimentos
disponibles en el hogar el acceso de sus hijos a estos alimentos, el consumo de los nios
de alimentos altos en grasa y aguas gaseosas, las interacciones sociales alrededor de los
alimentos, cantidad de tiempo que ven TC, participacin en deportes o recreacin
activa, y la influencia de los padres como modelos relacionados con la alimentacin,
actividad fsica, y tamao corporal. Todas estas variables pueden contribuir con un alto
riesgo de obesidad en los nios en una o ms poblaciones minoritarias o al menos
considerar que son valiosas de ser estudiadas ms adelante [60]. Algunos ejemplos a
continuacin:
En el estudio de salud y crecimiento del Instituto Nacional de Corazn, Pulmn y Sangre,
el consumo de comida rpida estaba asociado con un mayor consumo de caloras [61] En
el estudio de Salud de California tanto el consumo de aguas gaseosas como el consumo
de comida rpida fue mayor en adolescentes Afroamericanos y en Latinos comparado
con los adolescentes blancos y Asiticos. [63] Los altos niveles de ver Televisin en nios
negros e hispanos han sido reportados en varios estudios relacionados con el uso de
medios [66.67] El ver televisin predispone a la obesidad porque es una pasatiempo
fsicamente inactivo y tambin porque expone a los nios a la publicidad de alimentos
altos en caloras y por lo tanto conduce a un incremento en el consumo de alimentos
altos en caloras.
Aunque el estilo ptimo de alimentacin por parte de los padres para prevenir la
obesidad no ha sido aclarado, el objetivo clave es preservar cualquier mecanismo innato
que regule el apetito que puede estar presente en la niez (ejemplo: no obligar a los
nios a comer cuando no tienen hambre o despus que sienten que han comido
suficiente) y ofrecer alimentos nutritivos tales como leche, fruta y vegetales y no aguas

gaseosas, chips, papas fritas o dulces [12.13] Tambin podran existir diferencias tnicas
importantes en los estilos de alimentacin durante las edades escolares y pre escolares,
por ejemplo, estrategias de alimentacin basadas en padre vs nio [68] o autoritarias vs.
no autoritarias [69] y como varias estrategias de alimentacin se relacionan con el
desarrollo de la obesidad.
La preocupacin paterna sobre el peso del nio puede ser un elemento relacionado con
los estilos de alimentacin, por ejemplo, la falta de percepcin que el nio tiene
sobrepeso o la percepcin que el nio con peso normal se encuentra desnutrido puede
llevar a una sobre alimentacin.
El tiempo de recreacin u ocio en los adultos Afroamericanos e Hispanos tienen
generalmente niveles de actividad fsica ms bajos en comparacin con los blancos,
especialmente en las mujeres [71,72], lo cual sugiere que el involucramiento familiar de
los nios en deportes y recreacin activa es limitado.
4.1 Entorno socio-cultural
La aceptabilidad cultural de comer en exceso puede estar condicionada por el pasado o
privacin econmica recurrente, por ejemplo festejar cuando los alimentos estn
disponibles [4]. La sabidura cultural relacionada con el evitar el hambre puede estar
fuertemente arraigada mientras que la relacionada con evitar la obesidad todava no ha
evolucionado. Los alimentos ms valorados pueden ser aquellos relacionados con la
capacidad de sobrevivencia, que fueron escasos o inaccesibles en el pasado, por
ejemplo, carne, grasas y azcares y que son emocionalmente utilizados como
recompensa. Varios de estos alimentos son altamente relacionados con un nivel social
alto, y por lo tanto fuertemente deseados como smbolos de integracin en la sociedad.
Estas preferencias o valores pueden persistir por generaciones aun cundo estos
alimentos de status se conviertan en baratos y abundantes. La naturaleza intrnseca
de recompensa de las grasas y azcares perpeta su ingesta [12]
Con relacin a la imagen corporal, la ausencia de prcticas culturales prominentes
relacionadas con el control de peso puede ser debido en parte a la valoracin del
tamao corporal que es positivo o neutral para un tamao corporal grande. Las actitudes
hacia la imagen corporal pueden ser permisivas para el desarrollo de la obesidad y han
sido documentadas claramente en los Afroamericanos [70,75-78]. El tener sobrepeso no
es significativo de no ser atractivo y no daa necesariamente la autoestima, an entre
las adolescentes [79]. El ser demasiado delgada puede ser relacionado con enfermedad
(por ejemplo, cncer, tuberculosis o VIH/SIDA) o ser un consumidor de drogas, o en el
mejor de los casos, tener reservas limitadas de grasa en caso de enfermedad o tiempos
difciles relacionados con no tener dinero para comprar alimentos. El sobrepeso puede
ser visto como un problema solamente cuando est evidentemente relacionado con

problemas de salud.
Las actitudes determinadas culturalmente tambin pueden influenciar la actividad fsica
o el sedentarismo. El inters en deportes o tradiciones de ser fsicamente activo pueden
ser favorables para la actividad de los nios cuando las opciones de actividad fsica son
seguras y accesibles. Por otro lado, el valor cultural que prevalece por la televisin y los
automviles como smbolos de status y signos de abundancia econmica (ejemplo: ser
capaz de comprar un carro o comprar una TV para el cuarto de los nios) puede
predisponer a un comportamiento sedentario. Las poblaciones que consideran ser
fsicamente activas durante el trabajo pueden buscar ser sedentarios y relajarse cada
vez que les es posible aun cuando sus trabajos no requieran de actividad fsica [80].
5. Interaccin cultura ambiente
Las influencias culturales de la predisposicin de la obesidad infantil sugiere la
necesidad de intervenciones culturalmente pertinentes [91,93,94]. Sin embargo, al
disear las intervenciones potenciales debemos preguntarnos qu tan importante es
enfocarse solamente en las actitudes corporales y creencias como objetivos potenciales
para el cambio versus el enfocarse en las circunstancias que incrementen o apoyen
algunas de estas variables culturales. Las influencias culturales no son variables estticas
que ocurren de forma independiente al contexto ambiental en el cual se encuentran
embebidas y con las cuales interactan [95]. Por lo tanto la consideracin de las
diferencias tnicas en la obesidad debe siempre referirse a aspectos sociales,
econmicos, poltico e influencia de medios. Adems tambin se debe considerar que los
comportamientos individuales relacionados con la obesidad, por ejemplo, seleccin de
alimentos o practicas de alimentacin responden a los contextos en los cules son
practicaos [82,96].
Conclusin
La observacin que la obesidad infantil es ms prevalente en poblaciones minoritarias
parece reflejar diferencias en una combinacin de factores que resultan en: 1) exceso
de obesidad y diabetes en mujeres adultas en estas poblaciones; 2) efectos
consecuentes en el ambiente gestacional y normas sociales con respecto al
establecimiento o expresin de una predisposicin subyacente para ganar peso en
exceso; 3) practicas de alimentacin de la infancia y de la niez que resultan en un
exceso en el consumo de caloras; 4) ingesta de alimentos y actividad fsica que se ven
influenciados por la cultura y el ambiente que resultan en una ganancia de peso excesiva
al inicio de la niez y adolescencia.

Determinantes de la
Obesidad y
caracterizacin de los
ambiente Obesognicos.
Curso: Abordaje integral de la obesidad en la niez
Modulo 1: Ambiente Obesigenico y Cambio de
Comportamiento

Las causas y los determianantes de la obesidad infantil estn arraigados en una


problematica biopsicosocial profundamente compleja. Se necesita un enfoque
ecolgico para comprender mejor la obesidad dado que captura los factores
superpuestos involucrados.

Introduccion
Aunque han habido grandes descubrimientos en los
determinantes biolgicos de la obesidad en nios, el rpido
aumento de la prevalencia de obesidad seala los cambios que
tienen el mayor impacto son ambientales.
Las influencias externas sobre la obesidad varan segn la
etapa de la vida, las circunstancias, y la predisposicin
gentica.
Los cambios en los entornos nutricionales y de actividad de
los nios y las familias en los ltimos han tenido el mayor
impacto en la epidemia actual.

Obesidad en el ciclo de vida


Desnutricion Materna
La desnutricion materna en los primeros 2 trimestres del embarazo est fuertemente
ligada al peso al nacer y a un mayor riesgo de la obesidad en los adolescentes.
La obesidad depende de anormalidades estructurales y funcionales del sistema
endocrino causado por la restriccin de nutrientes y la alteracin de la insulina y
homeostasis.
Diabetes Materna
Un aumento de la prevalencia de sobrepeso infantil se explica por medio de un cambio
en la hiperglucemia fetal y la hiperinsulinemia causada por la diabetes materna.
Tabaquismo materno durante el embarazo
Los nios expuestos al humo del cigarrillo prenatal son ms propensos a ser superar al
percentil 90 para el ndice de masa corporal.
El peso materno
El peso materno antes y durante el embarazo, y la magnitud de la ganancia de peso
durante el embarazo, estn relacionados con un mayor riesgo de obesidad.

Obesidad en el ciclo de vida


La lactancia materna
La lactancia materna de frente a alimentacin con frmula es
una decisin nutricional importante que pueden afectar el
riesgo de obesidad Infantil.
La lactancia materna es un factor protector contra la obesidad
ya que reduce el riesgo deganancia de peso.

Obesidad en los primeros aos de


vida
Tipo de alimentacion
La lactancia materna, la sobrealimentacin y la alimentacin
en la primera infancia son los principales contribuyentes a la
obesidad infantil, que influyen en las concentraciones de
leptina y ms tarde en la adiposidad del nio.
Velocidad de ganacia de peso
Independiente del peso al nacer y el peso a la edad de 1 ao,
el rapido aumento de peso, incluso dentro de los primeros 4
meses de la vida se asocia con un mayor riesgo de sobrepeso
en nios escolares.
El peso en la infancia tarda esta relcionado con enfermedad
cardiovascular y obesidaden adultos .

Alimentacin en la primera
infancia
Casi dos tercios de todas las comidas que consumen los nios
provienen de casa, por lo tanto, el ambiente del hogar y los
comportamientos en torno a la alimentacion dentro de la
familia son componentes importantes en el desarrollo de los
hbitos nutricionales de la infancia y tienen una innegable
influencia en la obesidad.
Las prcticas de alimentacin infantil centradas en un
estmulo nutricional positivo, y la ingesta alimentos sanos de
los padres tambin se asocian positivamente con el consumo
de frutas y verduras en nios.
Estos datos apoyan la idea de que factores familiares son
componentes cruciales en la prevencin y el tratamiento
peditrico la obesidad.

Cambios en la estructura familiar


Es intuitivo que los cambios en la estructura familiar afectan a
la nutricin y los hbitos de actividad fsica de familias.
Se ha asociado con la obesidad infantil factores como:
Las comidas y la actividad fisica de la familia
Las prcticas de alimentacin en la primera infancia
La educacion en casa y el estilo de crianza en casa
La exposicion a los medios de comunicacin
El estrato socioeconmico

Influencia de los hogares


El hogar es el nivel ms profundo de la influencia del medio
ambiente en el comportamiento de los nios donde se
combina lo sociocultural, fsico, econmico y influencias
polticas.
Influencias de los padres / cuidadores en hogar son
particularmente importantes para los niios preescolares y en
edad escolar por la formacion de habitos.
Las carctersticas de los hogares de bajos recursos que
pueden influir en el contexto de crianza son los hogares
encabezados por mujeres, padres jovenes con menores
niveles de educacin o hogares con ancianos a cargo de la
crianza de nios.

Influencia de los hogares


En general la capacidad y la motivacion de los padres para
proporcionar alimentos y bebidas saludables son influenciados por la
disponibiliad y el acceso de los alimentos.
La voluntad de proporcionar alimentos saludables tambin se ver
influida por las actitudes culturales subyacentes y las prcticas
habituales.
Las actitudes pueden estar relacionados con las percepciones
basadas de experiencias, creencias y valores etnoculturales
histricos o factores econmicos, como la inseguridad alimentaria, y
que pueden ser asociados con las habilidades de supervivencia
bsicas.
La receptividad al asesoramiento de profesionales de la salud puede
ser ignorado si contradice a las creencias y valores culturales, y
tambin puede estar limitada generalmente por la desconfianza en
el sistema de atencin de la salud.

Cambios en la dieta
Entre los factores dietticos relacionados con la obesidad, la
ingesta alta en grasas y alimentos con contenido de azcar
han sido los ms estudiados.
Frutas y verduras: Aunque los mecanismos de accin siguen
sin estar claros, comer una dieta rica en frutas y verduras
puede ayudar a reducir el peso y la grasa corporal mediante el
desplazamiento de alimentos de alta densidad energtica de
la dieta.
No hay estudios que muestren un empeoramiento de la
condicin de peso con un aumento en el consumo de de frutas y
verduras.

Patrones alimenticios
Se ha observado estudios realizados en los nios de los EUA y
Mexico entre 2 y 18 aos, que la densidad de energa de las
botanas saladas y dulces, bebidas endulzadas, papas fritas,
hamburguesas, pizzas y comida rpida, van en aumento.
El tamao de las porciones de los alimentos en la dieta
Americana han aumentado en los ltimos aos.
El consumo de azucares tambien ha aumentado en los ultimos
aos.
Casi el 30% de la ingesta total de energa es de azcares
aadidos en los alimentos y bebidas en nios y adolescentes ,
en algunos paises de America.
Revisiones sistemticas recientes afirman que las bebidas
endulzadas con azcar contribuyen de manera significativa al
aumento del IMC.

Cambios en la actividad fisica


Los argumentos de que la epidemia de obesidad es causada en
gran parte por la actividad fsica reducida y no la ingesta de
energa se basan en los datos de la encuestas nacionales que
indican que el consumo diario de energa no ha cambiado pero
el gasto de energa diaria ha disminuido y las actividades
sedentarias han aumentado.
En un informe de EUA, los nios que vieron ms de 4 horas de
televisin al da tuvieron un IMC ms alto, y los que vean
menos de 1 hora al da tuvieron los ms bajos.
En un estudio separado en la Ciudad de Mexico, se observo
que el riesgo de obesidad fue del 1,12 por cada hora de
televisin que se ve por da.

Conducta sedentaria
En general, los bajos niveles de actividad fsica, que se define por no
cumplir con los niveles recomendados, son el reflejo del aumento de
actividad sedentaria.
Se ha observado que la relacion entre las conductas sedentarias y la
obesidad en nios y jvenes, por ejemplo la relacion entre ver televisin
y la obesidad en nios es significativa.
Intervenciones dirigidas especficamente a reducir uso de televisin y los
videojuegos en nios de 8 a 9 aos produjo una mejora en la grasa corporal.

Existe la controversia en torno a que si la televisin, la reproduccin de


vdeo juegos, o el uso de computadoras conduce a la obesidad o
interfiere con la actividad fsica. El posible factor de confusin es el
consumo de refrigerios con alto contenido energtico, mientras que la
participacin en las conductas sedentarias.
La interrupcin en el balance de energa puede explicar gran parte del
aumento en la obesidad peditrica.

El entorno fisico (construido)


Los cambios en el entorno fisico son una probable explicacin
para la alta prevalencia de la obesidad.
Existe evidencia sustancial que demuestra que los cambios en
los entornos fisicos (construidos) con respecto a la actividad
fsica y la alimentacin pueden promover obesidad.
Por ejemplo las escuelas:
Las escuelas desempean un destacado papel en la nutricin de
un nio porque la mayora de los nios comen en menos 1
comida por da en la escuela y pasar unas 6 horas por da en este
entorno. La falta de acceso a instalaciones que promuevan
actvidad fisica y a alimentos saludables, se han relacionado con la
obesidad en escolares.

El entorno fisico
Cada vez hay ms conciencia de que los entornos fsicos
pueden influir en el desarrollo de la obesidad, y tambin que
estos son menos favorables para el control de peso en las
comunidades en las que los nios de bajos estratos
socioeconmicos y minoras tnicas.
El entorno de los barrios peatonales y comunidades con aceras,
cruces seguros y destinos accesibles, atractivos espacios verdes, y
el transporte pblico tienen mejores niveles de actividad y salud.

Areas urbanas
La expansin urbana tambin se asocia con la obesidad en
adultos.
Se ha documentado que en los colonias o barrios de bajos
ingresos hay menos acceso a supermercados u otros puntos de
venta que proporcionan acceso a una mezcla de productos
alimenticios saludables a precios razonables y una ms alta que
la exposicin a los restaurantes de comida rpida.

Dado que la publicidad de alimentos altos en caloras es visto


como una parte del ambiente fsico, los barrios con una alta
propaganda hacia la comercializacin se suman a los riesgos
contextuales para el desarrollo de la obesidad.

Factores culturales
Ningn anlisis sobre de las influencias ambientales y la obesidad
estaria completo sin la consideracin de los factores culturales.
El contexto cultural de los alimentos y la alimentacin se han
establecidos como causas de obesidad.
Los tipos y cantidades de alimentos y bebidas, los sabores, texturas,
combinaciones, y los usos y significados de los alimentos
tradicionales, transmiten significados simbolicos que crean
interacciones sociales, y definen el placer y el castigo.
Adems, en todas las tradiciones culturales existen conceptos de
cmo los alimentos se refieren a la salud, por ejemplo hay alimentos
que son considerados perjudiciales o protectores.
Estos influencias culturales influencian a los patrones de
alimentacin de los adultos, y como los adultos alimentan a sus
hijos y cmo los nios eligen los alimentos por s mismos.

Entornos economicos y politicas


de precio/impuestos
Dada la prevalencia desproporcionada de la pobreza, los
aspectos de la economa y la poltica econmica que estn
relacionados con la posibilidad de evitar el consumo excesivo
de caloras es una prioridad para evitar el riesgo de obesidad
infantil.
Aunque los precios de los alimentos han bajado la estructura
de la oferta de alimentos es tal que ahora los alimentos ms
baratos son los que tienen la ms alta densidad de energa.
Es asi que en este medio las personas con ingresos
discrecionales limitados o ingresos inestables pueden
depender de los alimentos con alta densidad de energa , y
estos alimentos aumentan la probabilidad de consumo
excesivo y por lo tanto, el aumento de peso.

La Industrializacion
Popkin describe las varias etapas dela transicin nutricional,
conforme avanza la urbanizacin, el crecimiento econmico y
tecnolgico, los cambios en el trabajo, la recreacion y la elaboracin
de alimentos.
La obesidad es evidente en la etapa 4, o el perodo de enfermedad
degenerativa, caracterizado por el aumento de la ingesta de grasas,
azcar y alimentos procesados y ms prominente presencia de la
tecnologa en el trabajo y la diversion.
La urbanizacion mejora los patrones de crecimiento en los nios,
tambin aumenta la proporcin de nios que estan por encima del
limites saludables.
Los grandes cambios sociales y econmicos en las comunidades,
tales como el cambo en la actividad fsica por el transporte
mecanizado, la introduccin de los alimentos procesados y
supermercados, y el acceso a la televisin y pantallas, aumentan la
obesidad y la prevalencia del exceso de peso en los nios.

Antecedentes de la Transicin
Nutricional
La urbanizacin es la causa principal del incremento de la
obesidad global y el sobrepeso en pases de medios-bajos
ingresos.
En el pasado dado que existan otros problemas nutricionales
era difcil poder predecir que la obesidad se convirtiera en una
pandemia.
Los estilos de vida como el cambio en la alimentacin y la baja
actividad fsica son fenmenos caractersticos de este proceso.
Cuando co-existe la malnutricin (enfermedad infecciosa) y
obesidad y sus comorbilidades (enfermedades crnicas), se
considera que existe una doble carga de la enfermedad como
parte de la transicin nutricional.

Caracteristicas de la Transicion
Nutricional
1. Cambios en los perfiles demogrficos y epidemiolgicos y por
determinantes dietericos y de actividad fisica de los paises
subdesarrollados que son similares a los de los pases
desarrollados.
Por ejemplo: en los ltimos aos, la obesidad, la diabetes y
otras enfermedades crnicas no transmisibles (ECNT) han ido
en aumento entre los pobres.

Caracteristicas de la Transicion
Nutricional
2. Cambios en los estilos de vida y acceso de alimentos
Las sociedades urbanas han incorporado estilos de vida
sedentarios y un consumo de alimentos ricos en lpidos,
azcar, pobres en fibras y micronutrientes.
En America Latina hay aumento en el acceso a los alimentos
densos en energa de bajo costo pero de alto va en aumento y
la actividad fsica est disminuyendo, ya que un gran nmero
de personas viven en zonas urbanas y se hacen menos
actividad fsica.

Por ejemplo el caso de Mxico

.1

Cambio en la curva de IMC en Mexico (1988-2006)


1988

.08

1999

.02

Kdensity BMI
.04
.06

2006

10

15

20

25

30

35
40
BMI (Kg/m2)

45

50

55

(*) Women 18-49y


Mexican Nutrition surveys (1988, 1999) and Mexican Health and Nutrition
survey (2006)

60

65

Prevalencias de sobrepeso y obesidad en 1999 y


2006 en nias y mujeres
Sobrepeso

Obesidad

80

1.2 pp/ao
69.3

70
61.0

60

14%
32.4

50

24.9

0.57 pp/ao

40

0.94 pp/ao

32.5

30
20
10

26.8
20.2

5.9
14.3

8.7

28.5

6.9

14%

9.2

33%
18.1

21.6

23.3

2006

1999

2006

36.1

36.9

1999

2006

0
1999

Nias 5-11

Adolescentes 12-19

Mujeres 20-49
Rivera y col, 2006

Cambio relativo en tres tasas de mortalidad


ajustadas de enfermedades crnicas en Mxico
(1980-98)
160
150

Hipertensin

140
Diabetes

130
120
110

Infarto agudo al miocardio

100

Cirrosis

90
80

Enfermedad Vascular cerebral

70
80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98
Rivera et al, 2002

Causas de muerte asociadas a la


obesidady estilos de vida
Los estudios epidemiolgicos indican que las
tres causas de la muerte son de mltiples
etiologas y el resultado de una variedad de
factores de riesgo.
Aunque la herencia juega un papel en las tres,
pero los causas de muerte comparten factores
de riesgo comunes tales como la obesidad,
ingestas alimentarias inadecuada (de alta
energa, la grasa, el colesterol y la ingesta de
hidratos de carbono) y la inactividad fsica.

En Mxico los principales factores de riesgo para


mortalidad pueden revertirse con cambios en la
dieta y los estilos de vida
Alta glucosa
*
Alto IMC
*
Hipertension
*
Uso de Alcohol
*
Tabaqusimo
*
(*) relacionadas a la dieta
Baja ingesta de F&V
*
Inactividad
*
Alto colesterol
*
High blood glucose

High BMI

High blood pressure

Alcohol use

Tobacco smoking

Low fruit and vegetable intake

Physical inactivity

High cholesterol

Contaminacin ambiental

Urban air pollution

Sexo no seguro

Unsafe sex

0
Stevens G, et al. 2008. PLoS Med 5(6): e125.

10

15

Cambios en el gasto en alimentos entre 1986 y


1998
50

Bebidas endulzadas
40

37.21

30

20

CH refinados
10

% cambio
entre 1986 1998

6.25

-10

-20

-30

-40

-18.75
-26.72
-29.33

Frutas y
verduras

Leches y
lacteos

Carnes y
Pollo
% de cambio

Source: Rivera-Dommarco J, Barquera et al. Public Health Nutrition, 2002:


5(1A), 113-122

Tendencia de consumo de bebidas en nios


Mexicanos entre 1999-2006
Soft Drinks

Sweetened juices and beverages

Whole Milk

Calories per capita (kcal)

400

343 Kcals

350

297 Kcals

300

16

250
200
150
100
50
0

Other

45

190 Kcals
165 Kcals
17

226

26

110
116
8
24

37
19

1999

2006

Nios 1-4 years

86

17
38

55

1999

2006

Nios 5-11 years

Soft Drinks include industralized carbonated and noncarbonated beverages with added sugar
Sweetened juices and beverages include juice and fruit beverages with added sugar
Source: Barquera S, et al. J Nutr 2008

158

Las implicaciones de la obesidad


Baja de productividad por enfermedad
Desarrollo humano en nios comprometida
Perdida de aos de vida saludables
Presencia de enfermedades crnico degenerativas
Baja calidad de vida
Empobrecimiento crnico
Estigma/Depresin
Muerte prematura

Causas de la Obesidad
1) Desbalance Energtico = + consumo de energa gasto de
energa
Hablemos de consumo de energa y como hemos
evolucionado en esta era que consumimos mas?
Hablemos de gasto de energa y como hemos evolucionado en
esta era como gastamos menos?
2) Orgenes evolutivos de la salud y la enfermedad
Predisposicin gentica cuando existe desnutricin que se
agrava por la exposicin a los cambios ambientales
Esta teora solo aborda la ganancia de peso.. Y es muy
simplista reducirlo a esta teora

Causa principal es..


3) Exposicin a ambientes obesigenicos (ambientes que promueven
obesidad) aumenta las oportunidades para tener estilos de vida poco
saludables que se reflejan en la salud de todos los grupos etarios y en
todas las poblaciones del mundo.
Muy asociado a

Cambios en la industria alimentaria, en la produccin y


consumo de alimentos que permite consumir mas por
menos.. Pero No mejor..
Aumento en el consumo de grasas animales y trans
Aumento en el consumo de alimentos con edulcorantes artificiales
(tiene consecuencias metablicas importantes)
Aumento en consumo de produccin de origen animal
Disminucin en el consumo de frutas y verduras y granos bsicos

Discutir y ejemplificar la situacin


en Amrica Latina
Estos cambios en la dieta han hecho que la industria se
adecue a las nuevas necesidades poblaciones
Actualmente existe:
Moderna distribucin de alimentos
Desplazamiento de alimentos artesanales
Desplazamiento de mercados locales
Introduccin de compaas transnacionales de distribucin y
venta de alimentos cadenas globalesProveen alimentos baratos de baja calidad nutricional

Tendencias de Mercadotecnia dirigida a nios


en el mercado
Los productos alimentarios dirigidos a los nios han
aumentado de manera considerable de 52 productos en
1994 a casi 500 en 2004).

De ochenta a 97% de los productos alimenticios dirigidos


a nios son de baja calidad nutricional.
La industria en los EUA invierte por ao cerca de $10,000
millones de dlares en publicidad dirigida a nios.
En promedio un nio recibe casi 40 mil estimulos de
anuncios por ao, 72% para promover cereales y dulces.

Fuente:Food Marketing to Children and Youth: Threat or Opportunity?, Institute of


Medicine, 2005

Responsabilidad del
Ambiente o del Individuo?
En algo el ambiente ha
cambiado que ha hecho que la
biologa humana y la conducta
se ajusten:
Los cambios en la forma de
vida (alimentacin,
transporte, actividad fsica,
recreacin, trabajo) han
creado un ajuste biolgico de
los seres humanos que van
desde la composicin
corporal hasta la tolerancia a
las bebidas azucaradas y el
azcar

Los cambios requieren no slo de modificacin de


conducta sino tambin de un entorno mas
saludable
Responsabilidad
Individual

Cambio en el ambiente
Estndares para instituciones/escuelas
gobernamentalesl; involucrar
negocios/abastecimiento
Aumentar en forma selectiva costos de productos
altos en grasa/azucarados; bebidas calricas
Polticas sociales/de salud para lactancia materna
como la norma
Limitar/abolir publicidad para nios
Adaptar de forma progresiva a todas las ciudades
para favorecer a los peatones/ ciclistas
Puska P, 2001

Interaccion cultura-ambiente
Las influencias culturales en la predisposicin a la obesidad infantil sugieren la
necesidad de intervenciones adaptadas a la cultura.
En el diseo de posibles intervenciones debemos preguntarnos cun importante
es centrarse nicamente en las actitudes culturales y creencias como objetivos
potenciales para el cambio frente a centrarse en el circunstancias que dan lugar
a o apoyan algunos de estos variables culturales.
Las influencias culturales no son variables estticas que pueden ocurrir
independientemente de los contextos ambientales en los que estn inmersos y
con el que interactan.
La consideracin de las diferencias culturales en la obesidad siempre debe
referirse a la poltica, y las influencias sociales, econmicas relevantes.
Cada vez ms, se reconoce que los comportamientos individuales relacionados
con la obesidad, por ejemplo, la eleccin de alimentos o las prcticas de
alimentacin infantil, son sensibles a los contextos en los que se practican.

Participacion en el Foro
El foro sera una espacio abierto de discusion donde se deber
realizar un anlisis crtico de los determinantes individuales y
ambientales asociados a la obesidad es especial las causas
econmicas, sociales y culturales. Para que la participacion sea
considerada se espera que la aportacion contenga un analisis critico
ejemplificada con situaciones o casos crticos donde se entrelacen
los diversos determinantes de la obesidad en los nios (No es
suficiente con mencionarlos los factores). Ademas de la
participacion individual se espera que el alumno tambien discutay
retroaliemnte otras dos opiniones y que el aporte sea de calidad y
promueva la discusin y la reflexion.
Se utilizara como referencia el material bibliogrfico y de revisin
proporcionado para este tema. Adems de que puede consultar otro
material de apoyo, y recuerde citarlo en su aporte.
El foro estara abierto hasta el 14 de julio.

Ensayo para el tema 2


Ensayo de dos cuartillas sobre las implicaciones de las
principales de complicaciones de la obesidad y discusin de
alternativas para identificar el mejor tratamiento de acuerdo a
las necesidades de los nios de acuerdo al modelo ecolgico
presentado en la sesin anterior y en congruencia con los
materiales revisados as como las discusiones en clase. Hay
que justificar porque se sugieren los diversos tratamientos.
La fecha limite para la entrega es el 21 de julio.

TheConsequencesofChildhoodOverweightandObesity
Daniels,StephenR.

Enesteartculosediscutenlosresultadosadversosdelaobesidaddurantelaniezyelriesgoque
losniosyadolescentesseconvertirnenadultosobesosyestnexpuestosaotrosproblemasde
salud.
Debidoaquelosjvenesdehoyconsobrepesoyobesidadpueden,enpromedio,vivirunavida
menossanayenltimainstancia,mscortasquesuspadres.Laepidemiaesuntemadeurgente
problemadesaludpblica.
Consecuenciasadversasalasaludennios
Enelcuadro1semuestranvariosproblemasdesaludasociadosconlaobesidad.

Cuadro1.Desordenesasociadosalaobesidad,porsistemacorporal

Problemascardiovasculares
Estudiosrecientesepidemiolgicosnacionaleshansugeridoquelosniosyadolescentesdehoy
tienennivelesdepresinarterialmselevadosquesuscontrapartesdedcadaspasadas.Conforme
los nios, en promedio, han adquirido mayor sobrepeso; su presin arterial en promedio ha
incrementado.
Lahipertrofiaventricularizquierda,oelincrementodegrosordelacmaradebombeo,esunfactor
deriesgoindependienteparaenfermedadcardiovascularenadultos.Elaspectomsimportantede
lacomposicincorporalqueafectaelventrculoizquierdoeslamasamagracorporal.Enlosnios
conhipertensinesencial(laformamscomndehipertensin)elndicedeMasaCorporal(IMC)
incrementado se asocia con hipertrofia ventricular izquierda ms severa. Por lo que, hipertrofia
ventricularizquierdapuedeserotrarutaporlacuallaobesidadpuedeincrementarelriesgoafuturo
deenfermedadcardiovascularennios.
Dos estudios patolgicos, Pathobiologic Determinants of Atherosclerosis in Youth (PDAY) y el
estudioBogolusa,permitieronaclararlarelacinentreelroldelaobesidadenelaparecimiento
temprano de arterosclerosis durante la niez. Mediciones de adiposidad (grasa) estuvieron
significativamenterelacionadasconlapresenciadelesionesarterosclerosas.
Enotroestudioutilizarontomografacomputarizadaatravsdeunhazdeelectronesparaevaluar
lapresenciadecalcioenlasarteriascoronariasdeadultosjvenes.Unodeloshallazgosdelestudio
fuequeelincrementodepesodurantelaniezyelIMCaumentadoeneladultojovenestuvieron
vinculadosaunriesgoincrementadodedepsitosdecalcioenlasarteriascoronariasenadultos
jvenes.
Desrdenesmetablicos
Elsndrome metablicoestprobablementeasociadacon un mayorriesgodelasenfermedades
cardiovascularesyladiabetes,inclusoenpersonasjvenes.
J.Steinbergerycolegashandemostradoquelaobesidadenlaniezestasociadacondisminucin
en la sensibilidad a la insulina e incremento en la insulina circulante y que estas anormalidades
persistenaneneladultojoven.Lainsulinacirculanteincrementadaenefectopuedeaumentarla
presinarterialylosnivelesdecolesterol.
Weiss y colegas reportaron que por cada incremento de media unidad del puntaje z en el IMC
(equivalentealincrementodemediadesviacinestndarenelIMC),resultaenelincrementodel
50%deriesgodepadecersndromemetablicoenniosyadolescentes.

LaAsociacinAmericanadelaDiabetessugierequeahorael45%deloscasosdiagnosticadosdiarios
dediabetesenniosyadolescentessondediabetestipo2.
ElProgramaNacionaldeEducacinsobreelColesterolhaidentificadoladiabetescomounriesgo
equivalente a la enfermedad arterial coronaria, lo cual significa que los pacientes con diabetes
enfrentanunriesgosimilardeuneventocardiovascularadversoafuturo,comolospacientesque
hansufridounataquealcoraznounaccidentecerebrovascular(derramecerebral)causadopor
unbloqueoarterial.Silosadolescentescondiabetestipo2tienenestemismoriesgoavanzado,ellos
pueden ser ms propensos a padecer ataques al corazn, accidentes cerebrovasculares o fallo
cardacoaunaedadmuytemprana.
Complicacionespulmonares
Laprevalenciayseveridaddelasmaennioshaincrementadoenlasltimasdosdcadas,denuevo
conunincrementoenparalelodelaprevalenciayseveridaddelaobesidadenlaniez.
M.A.RodrguezycolegasencontraronqueniosconunIMCporarribadel85percentiltienenun
riesgo incrementado de padecer asma, independientemente de la edad, sexo, etnicidad, estado
socioeconmicoyexposicinahumodetabaco.
Algunas de las asociaciones entre asma y obesidad son por un lado, la obesidad incrementa la
inflamacinlocualpuedecontribuiralaparecimientodelasmayporotrolado,elasmalimitala
capacidadpararealizaractividadfsicayadems,staestratadaconcorticosteroides,locualpuede
promoverlaobesidad.
Elexcesodeadiposidadabdominalpuedealterarlafuncinpulmonarpordosrazones,unaporque
incrementaelpesoenlapareddelmsculoyhuesoquerodeanlospulmonesyotraatravsdela
limitacindemotilidaddeldiafragma.
Lostrastornosrespiratoriosdelsueopuedenserunodelosmsimportantes,sinotambinesla
complicacinmdicamssubreconocidaenniosyadolescentesconsobrepeso.Lainterrupcin
delsueocausaexcesivasomnolenciaduranteelda,locualpuededisminuirlaprcticadeactividad
fsicayaumentarelriesgodeobesidad.Laexcesivasomnolenciadiurnapuedetambinafectarel
desempeo escolar y tambin ha sido asociada con problemas del aprendizaje y defectos de
memoria.Laapneaobstructivadelsueopuedetenertambinefectosadversoscardiovascularesa
largoplazo(hipertensin,hipertrofiaventricularizquierdaydisfuncindiastlica).
Desrdenesgastrointestinales

Laobesidadpuedecontribuiraenfermedaddelhgadoyreflujogastroesofgico.Laenfermedadde
hgado graso no alcohlica (depsitos de grasa en el hgado) y la esteatohepatitis no alcohlica
(inflamacindelhgadorelacionadaadepsitosdegrasa)sonreconocidascomocomplicacionesde
la obesidad en adultos. La mayora de pacientes con hgado graso no alcohlico tambin tienen
resistencia a la insulina. Es por ello, que se estima que aproximadamente el 50% de diabticos
adultostambinpadecendeesteatohepatitisnoalcohlicay19%decirrosis.Estosdesrdenesan
nohansidoestudiadosdeformaampliaenpacientesjvenes.
L.Murrayycolegasencontraronenunestudiode10,000adultosentre2059aosdeedad,que
estar por encima del peso normal incrementa la probabilidad de padecer acidez y regurgitacin
cida.Losadultosobesostenanhastatresvecesmsprobabilidaddepadecerdeestossntomas
quelosadultosconpesonormal.Estedesordennohasidoestudiadodeformaextensivaennios,
porloqueannoseconocesisteestvinculadoconlaobesidadenlaspersonasjvenes.
Anormalidadesesquelticas
Tibia vara o enfermedad de Blount, es una deficiencia mecnica en la placa tibial media en
adolescentes,lacualresultaenarqueamientodelatibia.Tibiavaraenadolescentesnoescomn,
perousualmenteafectaaniosconsobrepesoporencimadelosnueveaosdeedad.
Otroproblemaortopdicorelacionadoconlaobesidadenpacientesjvenes,eseldesplazamiento
de la epfisis de la cabeza femoral, la cual causa dolor imposibilitando el caminar y requiere de
operacinquirrgicaparaserresuelto.
Aspectospsicosociales
Aunquelosfactoresderiesgoparaladepresinenlosadolescentesnosonbienconocidos,unoque
sehaestudiado,sobretodoenlasnias,eslainsatisfaccincorporal.
Ladepresinporssolaseasociaconpatronesanormalesdeactividadfsicayalimentacinque
pueden resulten en obesidad a futuro; sin embargo, la obesidad tambin puede resultar en
problemaspsicosocialesquepuedenproducirdepresin.
Parecequelosniosyadolescentesobesostienendificultadesconlasrelacionesentrepares.Los
adolescentesconsobrepesosuelentenermenosamigos.
J.SSchwimmerycolegasreportaronquelosniosyadolescentesobesostienemenorcalidadde
vidarelacionadoconlasaludquesusparesnormopeso.Esms,lacalidaddevidarelacionadacon
saluddeniosyadolescentesconobesidaderasimilaraniosdiagnosticadosconcncer.
Otrosefectosadversosalasalud

La obesidad en mujeres con sndrome de ovarios poliqusticos puede exacerbar los trastornos
metablicos. Ellas estn con riesgo substancial de padecer diabetes tipo 2 y enfermedad
cardiovascular,aligualquelasmujeresconsndromemetablico.
Otracomplicacinimportantedelaobesidadeselpseudotumorcerebral,unacondicinenlacual
laconstantepresinintracranealresultaendoloresdecabezayavecesenvisinborrosayvmitos.
Lacomplicacinnoescomnenniosyadolescentesperopuedesermscomnenadultos.
Aspectoseconmicos
Detodoslosaspectoseconmicosasociadosconlaobesidad,talvezelmsimportanteeselcosto
relacionadoconlosproblemasasociadosalasalud.
Otro aspecto econmico relacionado con la obesidad puede iniciar durante la niez y continuar
durante la vida adulta. Los obesos son estigmatizados en muchas culturas como perezosos,
descuidados,feosoestpidos.Elgradodeestereotiposnegativosincrementaconformelaedady
pareceafectarmsaniasqueanios.Lasimplicacionesdelosestereotiposqueinicianenlaniez
sonacarreadasalavidaadulta.Lasmujeresobesassuelentenerunniveleducacionalmsbajo,
capacidadmsbajadeobteneringresos,mayorprobabilidaddepobrezayunaprobabilidadms
bajadecontraermatrimonio.
Rastreandoelsobrepesoyobesidaddurantelavidaadulta
Variosestudioshandemostradoquelosniosconsobrepesoestnmspropensosquesuspares
normopesoatenersobrepesodurantesuvidaadulta.SGuoycolegasencontraronenelestudio
longitudinalFels,queelIMCdeniosyadolescentesqueseencontrabaporencimadelpercentil
95,seconvertaenunpredictordesobrepesoyobesidadalaedadde35aosenunrangodel15
99porcientodelossujetos.Laprobabilidadincrementaconformemsavanzadoenedadelnioo
niaseconvierteenobeso/a.
Elvnculoentrelaobesidadenlaniezylospadresconsobrepesoyobesidadesprobablequesea
tantogenticoscomoambientales,ydesenredarlosdosesamenudodifcil.RobertC.Whitakery
varios colegas investigaron la relacin entre obesidad a diferentes edades durante la niez y en
adultosde2129aosdeedad.Entrelosresultadosdelestudioseencontrqueniosmayoresde
dos aos y adolescentes obesos tenan mayor probabilidad de ser adultos obesos. Tambin
encontraronqueunnioobesoconpadresobesos,eramsprobablequecontinuarasiendoobeso
durante su vida adulta. Los padres crean aspectos importantes en el ambiente de los nios,
incluyendoquetipodealimentosestndisponiblesyqueoportunidadestieneelniopararealizar
actividadfsicaodellevarunavidasedentaria.

Enfermedadymuerterelacionadasconobesidadenadultos
Losefectosmsadversosdelaobesidadenadultossonlaenfermedadcardiovascularyladiabetes.
Elcncerendometrial,cncerdepechopostmenopausia,cncerdecolonyderintambinhan
sidoasociadosalaobesidad.
Los efectos acumulativos relacionados a la obesidad pueden llegar a acortar la vida de aquellos
individuosafectados. Incluso,unartculopublicadorecientemente enelNewEnglandJournalof
Medicineplantealaalarmanteposibilidadqueelincrementoenlaprevalenciadelaobesidaden
niospuederevertirelincrementoestabledelaesperanzadevidaenlaeramoderna;porloquela
prevencindelaobesidadenlaniezesdeurgenteimportancia.

Prevention and Treatment of Pediatric Obesity: An Endocrine Society Clinical Practice Guideline
Based on Expert Opinion
Gilbert P. August, Sonia Caprio, Ilene Fennoy, Michael Freemark, Francine R. Kaufman, Robert H. Lustig,
Janet H. Silverstein, Phyllis W. Speiser, Dennis M. Styne, and Victor M. Montori
J Clin Endocrinol Metab. December 2008, 93(12):45764599
El Subcomit de Directrices Clnicas de la Sociedad de Endocrinologa identific la obesidad infantil como un
rea prioritaria que requiere guas de prctica y design a un grupo de trabajo para formular
recomendaciones basadas en la evidencia.
En consecuencia, el objetivo de estas directrices es resumir la informacin relativa a:
La gravedad de la obesidad peditrica y el sobrepeso
Los criterios de diagnstico
Los tratamientos disponibles y cuando aplicarlos
Las medidas disponibles para prevenir el sobrepeso y la obesidad
La fuerza de una recomendacin se indica con el nmero 1 (recomendacin fuerte, asociado con la frase
"recomendamos") o 2 (recomendacin dbil, asociado con la frase "le sugerimos"). La calidad de las pruebas
se indica mediante cuatro letras, siendo la letra Q el signo de calidad, de tal manera que QEEE denota una
calidad muy baja, QQEE baja calidad, QQQE calidad moderada y QQQQ evidencia de alta calidad.
1.0 El problema con la obesidad
El objetivo de las intervenciones en nios y adolescentes con sobrepeso y obesidad es la prevencin o
mejora de las comorbilidades relacionadas con la obesidad, por ejemplo, intolerancia a la glucosa y diabetes
tipo 2, el sndrome metablico, la dislipidemia y la hipertensin.
2.0 Diagnstico del sobrepeso y la obesidad
2.1 Se recomienda el uso del ndice de masa corporal (calculado como el peso en kilogramos dividido por la
altura en metros al cuadrado), con los percentiles normativos derivados por la CDC, como el mtodo
preferido para el diagnstico del nio con sobrepeso u obesidad (1QQEE).
2.2 Se recomienda que un nio sea diagnosticado con sobrepeso si el IMC es 85 percentil pero < al 95
percentil para la edad y el sexo y como obeso si el IMC es de 95 percentil para la edad y el sexo (1QEEE).
2.3 No se recomienda una evaluacin de rutina de laboratorio para las causas endocrinas de la obesidad en
los nios obesos o temprano para etapa medio puberal en adolescentes obesos, a menos que la velocidad
de crecimiento del nio, evaluada en relacin a la etapa de la pubertad y antecedentes familiares, este
atenuada (1QQEE).
2.4. a. Recomendamos la derivacin a un especialista en gentica para los nios cuya obesidad tiene una
etiologa sindrmica, especialmente en la presencia de alteraciones del desarrollo neurolgico (1QEEE).
2.4. b. Sugerimos que los padres de nios que han ganado inexorablemente peso desde la infancia temprana
y se han elevado por encima del percentil 97 de peso por 3 aos de edad, sean informados de la
disponibilidad de pruebas genticas MC4R. Sin embargo, la prueba es positiva en slo 2-4% de tales

pacientes que estn por encima del percentil 97 para el peso y en la actualidad no alteren el tratamiento
(2QEEE).
2.5 Se recomienda que los nios con un IMC de al 85 percentil sean evaluados por comorbilidades y
complicaciones asociadas (vase la Cuadro 1 y Fig. 1) (1QEEE).
Cuadro 1. Pruebas de cribado para las comorbilidades ms comunes de la obesidad

Figura
1.
Flujograma
para
el
diagnstico
y
tratamiento

3.0 Tratamiento de la obesidad


3.1 Recomendaciones de estilo de vida
3.1.0 Recomendamos que los mdicos prescriban y apoyen modificaciones del estilo de vida intensivo
(dietticas, de actividad fsica y de comportamiento) y que apliquen para toda la familia y el paciente de
manera apropiada a la edad y como requisito previo para todos los tratamientos de sobrepeso y obesidad
en nios y adolescentes (1QEEE).
3.1.1 Recomendaciones dietticas
3.1.1. a Se recomienda que los mdicos prescriben y apoyen los hbitos de alimentacin saludables, tales
como:
Evitar el consumo de alimentos ricos en caloras y pobres en nutrientes (por ejemplo, bebidas
azucaradas, bebidas deportivas, bebidas de frutas y zumos, ms la "comida rpida", y aperitivos
ricos en caloras) (1QQEE).
3.1.1. b Se sugiere que los mdicos prescriban y apoyen:
El control de la ingesta de caloras a travs de control de las porciones, de acuerdo con las
directrices
de
la
American
Academy
of
Pediatrics
[http://pediatrics.aappublications.org/cgi/reprint/117/2/544] (2QEEE).
Reducir la ingesta de grasas saturadas en la dieta de nios mayores de dos aos de edad.
Aumentar el consumo de fibra diettica, frutas y verduras (2QEEE).
Comer en horarios establecidos, comidas regulares especialmente el desayuno, y evitar
"pastoreo" o picoteo constante durante el da, especialmente despus de la escuela (2QEEE).
3.1.2 Recomendaciones de actividad fsica
3.1.2.1 Recomendamos que los mdicos prescriben y apoyen 60 minutos diarios de actividad fsica
moderada a vigorosa (1QQEE).

3.1.2.2 Sugerimos que los mdicos prescriban y apoyan una disminucin en el tiempo dedicado a actividades
sedentarias, como ver la televisin, jugar videojuegos, o el uso de computadoras para la recreacin. El
tiempo de pantalla debe limitarse a 1-2 h por da, de acuerdo la Academia Americana de Pediatra (2QEEE).
3.1.3 Recomendaciones psicosociales
3.1.3. a Se sugiere que los mdicos eduquen a los padres sobre la necesidad de los patrones de crianza
saludables relacionados con la alimentacin y la actividad. Los ejemplos incluyen el modelado de hbitos
saludables por parte de los padres, evitar dieta demasiada estricta, el establecimiento de lmites de
conducta aceptable y evitar el utilizar los alimentos como recompensa o castigo (2QEEE).
3.1.3. b Se sugiere que los mdicos investiguen y diagnostiquen los patrones de comunicacin intrafamiliar
no saludables y apoyen los patrones de crianza que tratan de mejorar la autoestima del nio (2QEEE).
3.2 Recomendaciones sobre farmacoterapia
3.2.a Se sugiere que la farmacoterapia (en combinacin con la modificacin del estilo de vida) slo se
considere si un programa formal de modificacin intensiva del estilo de vida no ha logrado limitar el
aumento de peso o para atenuar las comorbilidades en nios obesos. Los nios con sobrepeso no deben ser
tratados con agentes farmacoteraputicos solo s, comorbilidades graves significativas persisten a pesar de
la modificacin intensiva del estilo de vida. En estos nios, una historia familiar severa de diabetes tipo 2 o
factores de riesgo cardiovascular fortalece el caso para la farmacoterapia (2QEEE).
3.2. b Sugerimos que la farmacoterapia se ofrezca nicamente por mdicos con experiencia en el uso de
agentes contra la obesidad y que sean conscientes de la posibilidad de reacciones adversas (2QEEE).
3.3 Recomendaciones sobre ciruga baritrica
3.3. a Sugerimos que la ciruga baritrica se considera slo en las siguientes condiciones:
1. El nio ha alcanzado un estadio de Tanner de 4 o 5 de desarrollo de la pubertad y la estatura final
o casi final del adulto.
2
2
2. El nio tiene IMC > 50 kg/m o un IMC > 40 kg/m con comorbilidades significativas y severas.
3. Obesidad y comorbilidades graves persisten a pesar de un programa formal de modificacin del
estilo de vida, con o sin un uso de la farmacoterapia.
4. Evaluacin psicolgica confirma la estabilidad y la competencia de la unidad familiar.
5. Hay acceso a un cirujano con experiencia en un centro mdico que emplea un equipo capaz de
brindar seguimiento a largo plazo de las necesidades metablicas y psicosociales del paciente y su
familia y la institucin est ya sea participando en un estudio sobre los resultados de ciruga
baritrica o intercambiando datos.
6. El paciente demuestra la capacidad de adherirse a los principios de los hbitos alimentarios y de
actividad saludables (2QQEE).
3.3. b Recomendamos ir en contra de la ciruga baritrica para nios preadolescentes, adolescentes
embarazadas o en periodo de lactancia y para aquellas que planean quedar embarazadas dentro de los
prximos dos aos a la ciruga; para cualquier paciente que no ha dominado los principios de los hbitos
alimentarios y de actividad saludables; para cualquier paciente con un trastorno de la alimentacin no
resuelto, un trastorno psiquitrico no tratado o el sndrome de Prader-Willi (1QQEE).
4.0 Recomendaciones para la prevencin de la obesidad
4.1. a Recomendamos la lactancia durante un mnimo de 6 meses (1QQEE).
4.1.b Sugerimos que los mdicos promueven y participan en los esfuerzos para educar a los nios y padres
por medio de orientacin preventiva en un curso acerca de la dieta saludable y actividad saludable y
adems, que los mdicos animen a los sistemas escolares para impartir cursos de educacin para la salud
adecuados que promuevan hbitos de alimentacin saludable (2QQEE).

4.1. c Sugerimos que los mdicos promuevan y participen en los esfuerzos para educar a la comunidad sobre
los hbitos alimentarios y de actividad saludables (2QEEE).
5.0 Barreras sociales para la implementacin
Sugerimos que los mdicos promuevan:
5.1 Las polticas reguladoras destinadas a reducir la exposicin de los nios y adolescentes a la promocin de
eleccin de alimentos poco saludables en la comunidad (por ejemplo, mediante anuncios en los medios
dirigidos a los nios y adolescentes) (2QEEE).
5.2 El hecho de que los distritos escolares aseguran que slo alimentos y bebidas nutricionalmente
apropiadas estn disponibles para los nios en el entorno escolar, incluyendo la cafetera de la escuela y las
fuentes alternativas de alimentos, tales como las mquinas expendedoras (2QEEE).
5.3 La participacin de los padres en el diseo de programas sobre dieta y actividad fsica en las escuelas y
que las escuelas eduquen a los padres acerca de la justificacin de estos programas para asegurar su
comprensin y cooperacin (2QEEE).
5.4 Que los planificadores maestros de la comunidad diseen, rediseen y organicen las comunidades para
maximizar las oportunidades para caminar o ir en bicicleta de forma segura a la escuela, las actividades
recreativas y eventos deportivos y compras en la vecindad como medio para fomentar una mayor actividad
fsica (2QEEE).
5.5 Recomendaciones a los polticos para que stos ofrezcan incentivos para asegurar que los minoristas
pueden ofrecer frutas y verduras frescas de alta calidad asequibles para todos (2QEEE).

Creando Ambientes de Comida y Alimentacin Saludable: Abordaje Poltico y Ambiental.


Mary Story, Karen M Kaphingst, Ramona Robinson-OBrien, y Karen Glanz.
Introduccin
Este artculo presenta una visin de los ambientes alimentarios y las estrategias para crear
ambientes de alimentacin saludable. Inicialmente se presenta un marco conceptual, seguido de
una descripcin de los factores ambientales organizados por localidades especficas: hogar,
guardera, escuelas, lugares de trabajo, abarroteras al por menor, restaurantes u otros aspectos a
nivel macro tales como polticas de alimentos y agricultura y mercadeo de alimentos. Se resaltan
las desigualdades en el acceso a los alimentos entre grupos de bajos ingresos y las minoras. El
objetivo es que el lector comprenda cmo el ambiente influye en la seleccin de los alimentos y
resaltar las intervenciones y estrategias que promueven una alimentacin saludable a nivel
poblacional.
UN MARCO ECOLGICO
El comportamiento alimentario es realmente complejo y es resultado de una interaccin entre
diferentes influencias a travs de diferentes contextos. Un abordaje ecolgico es til para orientar
la investigacin y las intervenciones relacionadas con el comportamiento alimentario debido al
nfasis en vnculos multinivel, la relacin entre mltiples factores que impactan la salud y
nutricin y el nfasis en las relaciones entre personas y su ambiente (83, 88, 93).
INSTALACIONES Y LUGARES PARA UNA ALIMENTACION SALUDABLE
Hogares
Informacin de encuestas a nivel nacional muestran que los estadounidenses difcilmente
consumen dos tercios (68%) del total de caloras de alimentos preparados en el hogar (43). Una
variedad de factores dentro del ambiente del hogar han sido asociados con comportamientos
dietticos saludables; entre los factores ms importantes estn la disponibilidad y accesibilidad a
los alimentos saludables; la frecuencia de las comidas familiares; y la ingesta de los padres y las
practicas de crianza (en relacin a la dieta de los nios). Tanto la disponibilidad de alimentos en el
hogar (alimentos presentes en el hogar) y la accesibilidad (si los alimentos estn disponibles en
una forma o ubicacin que facilita su consumo, tales como frutas en la mesa) han sido asociados
positivamente con una ingesta diettica saludable en los nios (19, 42, 100) Colectivamente,
estudios demuestran que los alimentos saludables disponibles inmediatamente y su fcil acceso
dentro del hogar incrementan la ingesta saludable entre los nios y sus familias.
La influencias sociales dentro del hogar tales como un consumo diettico sano por parte de los

padres y hermanos, estilo de alimentacin autoritario (ej.; alto en establecer lmites pero tambin
en un alto nivel de crianza), y mayor frecuencia de comidas familiares promueven el consumo de
alimentos saludables en los nios y adolescentes. El consumo de frutas y verduras por parte de los
padres se ha asociado con el consumo de frutas y verduras (18, 27, 44) en los nios y puede ser el
predictor ms fuerte del consumo de frutas y verduras en los nios (18).
Otro factor que puede influenciar la ingesta diettica de los nios es el estilo de alimentacin de
los padres y las prcticas parentales. Un estilo de alimentacin autoritario ha sido asociado de
forma positiva con el consumo de leche y vegetales en nios en edad pre escolar (73), y el estilo de
educacin autoritaria en madres est asociado con la ingesta de frutas y vegetales en los
adolescentes (63).
La frecuencia en las comidas familiares puede tambin tener un efecto positivo en la ingesta
diettica saludable de los nios. Las investigaciones sugieren que la frecuencia de las comidas
familiares puede estar asociada positivamente con la ingesta de varias vitaminas y minerales,
frutas, vegetales, granos y alimentos ricos en calcio y menos comidas fritas y grasas saturadas y
grasas trans en los nios. (34, 71).
Guarderas
Los servicios de cuidado del nio representan una oportunidad valiosa para promover una
alimentacin saludable y energticamente balanceada para los nios. Aunque mucho se ha hecho
para crear ambientes de alimentacin saludable en las escuelas, de forma sorpresiva poco se ha
hecho o escrito relacionado con las guarderas. La investigacin que evala la calidad nutricional
de los alimentos y bebidas servidas a los nios en las guarderas ha sido limitada, y los pocos
estudios sugieren que la calidad nutricional debe ser mejorada (90). Adems, poca investigacin
de intervencin se ha llevado a cabo para cambiar el ambiente de alimentacin. Esta ha sido una
oportunidad perdida debido a que la mayora de nios menores de 5 aos (60%) pasan un
promedio de 29 horas a la semana en alguna forma de institucin para el cuidado infantil y 41%
pasa 35 o ms hora a la semana (52).
Escuelas
El ambiente de alimentacin escolar tiene un gran impacto en la ingesta diettica de los nios y
adolecentes ya que por lo menos dos comidas y refacciones se consumen en la escuela todos los
das (91). Los alimentos competitivos son todos los alimentos y bebidas que se venden fuera de los
programas federales de alimentacin e incluyen las mquinas expendedoras, men a la carta de la
cafetera, barra de snacks, tienda escolar y recaudaciones de fondos. Los alimentos competitivos
est ampliamente distribuidos en las escuelas; 9 de 10 escuelas los venden (99) y la mayora de los
alimentos y bebidas que se ofrecen son altos en grasa y azcares (45,99).

Recientemente, varios estados y distritos escolares han presentado regulaciones o legislaciones


para los alimentos competitivos (8), los cuales son ms restrictivos que las regulaciones del
Departamento de Agricultura de los EUA (USDA, por sus siglas en ingls) sin embargo difieren en el
tipo y alcance de las restricciones.
Una reciente iniciativa de poltica federal que tiene implicaciones en mejorar el entorno de
alimentacin escolar requiere que los distritos escolares que participan de los programas de
alimentacin escolar establezcan polticas de bienestar escolar que aborden la nutricin y la
actividad fsica.
Otro esfuerzo para mejorar la calidad de los alimentos en las escuelas podra incluir programas de
agricultura en las escuelas, los cuales vinculen a los agricultores locales para que provean de
alimentos frescos localmente producidos a los servicios de cafetera de las escuelas y un programa
de huertos escolares. Tambin existe la necesidad de educacin nutricional para complementar
los cambios a nivel escolar e incrementar las capacidades de los estudiantes para adoptar estilos
de vida saludables.
Programas despus de la escuela y programas de verano
Los lugares de programas para despus de la escuela son un ambiente importante para la
promocin de una alimentacin saludable. Ms de 6.5 millones de jvenes se encuentran en los
programas despus de la escuela, entre los cuales estn las escuelas, parques y centros
recreacionales, y clubs para nios y clubs de nias. Los nios afroamericanos y los hispanos son
ms propensos a participar en los programas despus de la escuela. Ms de la mitad (55%) de las
escuelas urbanas en reas con altas tasas de pobreza (55%) ofrecen programas escolares de
verano. (95) Estos servicios tambin llegan a millones de nios a travs del programa de asistencia
de alimentacin federal, tales como el programa de alimentacin en los programas despus de la
escuela, el cual proporciona refacciones gratuitas a los nios y adolescentes, y el programa de
alimentacin del programa de verano, el cual proporciona tiempos de comida y refaccin a los
nios. Se necesitan estudios para evaluar la calidad nutricional de las refacciones y las bebidas de
estos programas y las estrategias de intervencin para mejorar la alimentacin saludable en estos
programas.
Lugares de trabajo
As como las escuelas son para los nios, los lugares de trabajo son los lugares ideales para llegar a
los adultos ya que el 66% de los adultos en EUA tiene trabajo (12). El ambiente de trabajo
proporciona la oportunidad para promover tanto un cambio de comportamiento a nivel individual
como para un cambio fsico y social del ambiente de trabajo. La ingesta diettica ha sido
positivamente influenciada por estrategias del entorno tales como el incrementar la disponibilidad

y variedad de alimentos saludables (54), reducir el precio de los alimentos saludables en la


cafetera del trabajo (54) y en las mquinas expendedoras (32), y enviando mensajes por correo
electrnico sobre educacin nutricional (7).
Fortalecer el entorno social del lugar de trabajo tambin puede ser beneficioso (4, 86) El involucrar
a los empleados en la planificacin de programas y su implementacin y el obtener un apoyo de
supervisin y compromiso por parte de la gerencia son importantes para la sostenibilidad del
programa. (86) Las prioridades que deben incluirse en las prximas intervenciones orientadas a
los lugares de trabajo incluyen identificar y reducir las barreras al cambio organizacional y del
entorno, abordar factores sociales contextuales que dirigen las conductas y construir redes
expandidas de asociaciones comunitarias.
Abarroteras: Supermercados/ y pequeas tiendas de venta de comida.
La presencia de tiendas de comida, y la disponibilidad de productos saludables en esas tiendas,
son contribuyentes importantes a los patrones de alimentacin saludable entre los residentes de
un vecindario (41) Las abarroteras juegan un papel importante en la compra de alimentos: los
hogares realizan un promedio de dos visitas a la semana al supermercado, y el promedio de gastos
semanal de estos hogares en el supermercado era de $93 en el 2006 (29). Varios estudios han
encontrado una asociacin entre el acceso al supermercado y una alimentacin saludable (16, 60,
66). Powell y otros (76) encontraron que un mayor acceso a las cadenas de supermercados est
asociado con menor IMC en adolescentes y una mayor disponibilidad de tiendas de conveniencia
al por menor estaba asociada con mayores IMC y sobrepeso.
Desigualdades en el acceso a los alimentos en comunidades con bajos ingresos.
Las inequidades en los ingresos traen consigo varias desigualdades en el tema de salud en los
Estados Unidos. En general, los grupos de poblacin que sufren del peor estado de salud,
incluyendo la salud nutricional y obesidad, son aquellos que tienen las tasas ms altas tasas de
pobreza (96). Varios estudios han demostrado diferencias en la accesibilidad y disponibilidad a los
alimentos sanos en vecindarios de bajos ingresos (2, 58, 62, 66, 67). La falta de acceso a alimentos
saludables a precios razonables puede estar contribuyendo a las desigualdades en las
enfermedades crnicas relacionadas a la nutricin y las tasas de obesidad.
Entre las oportunidades para reducir las desigualdades se encuentran las iniciativas para fomentar
el desarrollo de las inversiones en abarroteras en comunidades de bajos ingresos. Las iniciativas
que han demostrado tener xito se caracterizan por un liderazgo poltico a los ms altos niveles y
una asociacin efectiva con organizaciones comunitarias no lucrativas. Otras estrategias
potenciales para obtener alimentos locales saludables en los vecindarios con bajos ingresos
incluyen el patrocinar mercados de agricultores del vecindario, abarroteras por cooperativa,

huertos comunitarios; incorporar alimentos saludables y recin producidos en las tiendas y tiendas
de conveniencia; que las iglesias y centros comunitarios compren los alimentos producidos por
agricultores locales y los vendan a los miembros de la comunidad que asisten a la iglesia o a los
eventos comunitarios; y que las clnicas comunitarias y los departamentos de salud pblicos den el
producto local a los pacientes durante sus visitas clnicas como parte de la iniciativa de promocin
de la salud (61).
Los esfuerzos federales, estatales y locales y las asociaciones publico-privadas son necesarias para
crear y facilitar programas de alimentacin nuevos y expandidos para ayudar a las reas que estn
desatendidas a desarrollar mercados de alimentos e incrementar su acceso a un abastecimiento
de alimentos saludables y asequibles. Debido a que existe poca investigacin sobre los programas
ms efectivos y prometedores en esta rea, se necesita de mayores esfuerzos en evaluacin e
intervencin.

ABORDAJES A NIVEL MACRO


Polticas de Alimentos y Agricultura de EUA
La agricultura y las polticas sobre alimentos deben estar alineadas con la salud pblica nacional y
las metas nutricionales. El propsito clave de las polticas sobre alimentos y agricultura debe ser el
bienestar y la salud de los habitantes. Un ejemplo de programa de alimentos implementado por el
estado es el Programa de Estampillas para Comida de EUA, este programa beneficia a 1 de 12
Americanos, o cerca de 24 millones de personas con bajos ingresos al mes, ms de la mitad de
ellos son nios. (30) Actualmente los beneficiarios de este programa obtienen beneficios
insuficientes para comprar los alimentos necesarios para una dieta saludable por un perodo de un
mes. El incrementar el acceso a alimentos saludables dentro de los programas de asistencia de
alimentos podra incluir el expandir los programas de cupones que permitan a los beneficiarios de
la ayuda alimentaria comprar frutas y vegetales, granos integrales y otros alimentos saludables en
mercados de agricultores locales y otras abarroteras; expandir los programas que proporcionan
productos locales frescos a las escuelas (84,85). Un cambio hacia polticas de agricultura ms
saludables que beneficien la salud del pblico que tambin incluyan el promover la sostenibilidad
de los sistemas de alimentacin locales y regionales para incrementar el acceso a alimentos ms
saludables. Adems, polticas federales y estatales que faciliten una mayor provisin de los
productos alimenticios locales y regionales, tales como frutas y verduras, a las guarderas y
escuelas, hospitales, bancos de alimentos y prisiones (26).
Aspectos econmicos y precios
El costo de los alimentos es el segundo aspecto ms importante que afecta la decisin de compra,

despus del sabor (35). Las regulaciones gubernamentales que afectan el precio son influencias
consistentes en la compra de frutas frescas, vegetales y carnes (79) Drewnowski (21,22) han
propuesto la hiptesis que los vnculos observados entre las tendencias en la disponibilidad de
alimentos y las tasas en aumento de la obesidad son mediadas por los aspectos econmicos de la
seleccin de alimentos. La estructura actual de precios de alimentos consiste en que los alimentos
altos en azcares y grasas proporcionan caloras a un menor costo (22). Por tanto las familias e
individuos con recursos limitados seleccionan alimentos energticamente densos altos en granos
refinados, azcar y grasa como una forma de ahorrar dinero. Las frutas y vegetales frescos son
ms caros en trminos de caloras que las grasas y azcares. Poco se sabe s las variaciones en los
precios son responsables de las diferencias en la calidad da la dieta y la condicin del peso. Una
reduccin del 10% en el precio de las frutas y vegetales incrementa el consumo en 7.2% (48) Por
tanto, el reducir el precio de los alimentos saludables incrementa su consumo.
Se necesitan ms estudios sobre los factores econmicos que influyen la conducta de comer y la
relacin entre la calidad de la dieta y los costos de alimentos. Esto tiene implicaciones importantes
en las estrategias para modificar el ambiente de alimentos, para las polticas nacionales sobre
alimentos, y para los programas de asistencia de alimentos dirigidos a poblaciones de bajos
ingresos.
Influencia del mercadeo y medios de comunicacin
Diferentes factores influencian el comportamiento de consumo de alimentos de los jvenes, uno
con mucha potencia es el mercadeo. Los jvenes viven en un ambiente saturado de medios de
comunicacin. Varias tcnicas y canales son utilizados para llegar a los jvenes, iniciando cuando
son infantes, para fomentar la fidelidad a la marca e influenciar el comportamiento de compra de
producto. La publicidad de alimentos dirigida a los nios se extiende ms all de la televisin, y se
encuentra prevalentemente en el internet (56) y se expande rpidamente en la tecnologa nueva
como telfonos celulares, mensajes instantneos, video juegos y los entornos virtuales de tres
dimensiones, frecuentemente bajo el radar de los padres de familia (17).
CONCLUSION
El mejorar los patrones dietticos y de estilo de vida y reducir la obesidad y reducir la obesidad
requerir de un esfuerzo de salud pblica sostenido, que aborde no solamente los
comportamientos individuales sino tambin el contexto ambiental y condiciones en las cuales las
personas viven y realizan sus elecciones. El cambio de comportamiento individual es difcil lograrlo
sin abordar el contexto en el cual las personas toman decisiones. Inicialmente, son necesarios
pasos significativos para realizar elecciones de alimentos saludables que estn disponibles,
identificables y asequibles para las personas de todas las tnicas y niveles de ingresos y en todo
tipo de ubicacin geogrfica (ej. Urbano, suburbano, rural) Nuestra mxima meta debiera ser

estructurar los vecindarios, hogares y ambientes institucionales para que los comportamientos
saludables se lleve a cabo.

Entrevista motivacional
The motivational interview

S. Lizarraga, M. Ayarra

RESUMEN

ABSTRACT

La entrevista motivacional es un tipo de entrevista,


centrada en el paciente, que busca ayudar a explorar y
resolver contradicciones sobre conductas o hbitos
insanos. Intenta aumentar la conciencia de los pacientes
sobre sus riesgos de salud y su capacidad para hacer
algo al respecto. Adems, cuida la salud mental de los
sanitarios porque incrementa la satisfaccin como profesionales y previene la sensacin de impotencia.
La fuerza de voluntad para cambiar un hbito o
conducta insanos es la motivacin que se tiene para
desear ese cambio, y su mayor motor est en la incomodidad de la persona entre lo que hace y lo que deseara hacer. Si ayudamos a que el paciente sea ms consciente de su situacin y sus deseos le facilitamos el
cambio y le resultar menos duro pagar su precio que es
el sufrimiento que tendr al dejar su conducta habitual.
El paciente es el protagonista y nosotros podemos
ser facilitadores de su proceso de cambio. A veces, es
difcil olvidarnos de nuestra tendencia habitual a conseguir rendimientos rpidamente y nos adelantamos al
ritmo del paciente. Segn el tipo de relacin que le ofrezcamos facilitaremos el cambio o lo entorpeceremos.
Una actitud emptica, en la que el paciente se siente
apoyado y no juzgado, favorece el cambio y, por el contrario, una insistencia en el cese del hbito puede generar resistencia al mismo.
Hay una serie de tcnicas que podemos aprender y
que nos ayudarn a mejorar la entrevista clnica motivacional. Existen, tambin, unas caractersticas del profesional sanitario que proporcionan el ambiente de
seguridad y apoyo ideal para el cambio: empata, calidez
emocional y autenticidad.
Palabras clave: Entrevista motivacional. Estadios
del cambio. Resistencias del paciente. Apoyo narrativo.
Relacin de ayuda.

The motivational interview is a type of interview,


centred on the patient, that seeks to help in exploring
and resolving contradictions concerning unhealthy
behaviour patterns or habits. It attempts to increase the
awareness of patients of the health risks they are
running and their capacity for doing something about
this. Besides, it fosters the mental health of the health
workers since it increases their satisfaction as
professionals and prevents a sensation of impotence.
The will power to change an unhealthy habit or
behaviour pattern is the motivation that one has to
desire such change, and its greatest driving force is the
discomfort in the person arising from the difference
between what he does and what he would like to do. If
we can help the patient to become more aware of his
situation and his/her desires, we will make change
easier for him and it will be less difficult for him to pay
the price represented by the suffering he will undergo
on giving up a habitual behaviour pattern.
The patient is the protagonist and we can facilitate
his process of change. At times, it is difficult for us to
forget our habitual tendency to try and obtain rapid
results, and we move ahead of the patient's rhythm.
Depending on the type of relationship that we offer him,
we will facilitate or hinder change. An empathetic
attitude, one in which the patient feels supported and
not judged, favours change and, on the contrary,
insistence on his abandoning the habit can generate
resistance to change.
There is a series of techniques that we can learn
and that will help us to improve the motivational clinical
interview. There are also certain characteristics in the
health professional that provide an ideal atmosphere of
security and support for change: empathy, emotional
warmth and authenticity.
Key words: Motivational interview. States of
change. Patients' resistance. Narrative support.
Relationship of help.

ANALES Sis San Navarra 2001; 24 (Supl. 2): 43-53.


Especialistas en Medicina Familiar y Comunitaria. Grupo Comunicacin y Salud de Navarra.
Centro de Salud de Huarte (Navarra).

ANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

Correspondencia:
Socorro Lizarraga
C/ Zarraondoa, s/n
Centro de Salud de Huarte
31620 Huarte
Tfno. 948 335080
Fax 948 335079
E-mail: soco_lizarraga@hotmail.com

43

S. Lizarraga, M. Ayarra

INTRODUCCIN
Una de las tareas prioritarias de los
profesionales sanitarios es promover comportamientos saludables en los pacientes,
tanto para mejorar su nivel de salud como
para prevenir enfermedades. Tradicionalmente, esta tarea se ha centrado en proporcionar informacin, ms o menos personalizada, con la idea de que una persona
bien informada desarrollar estilos de vida
ms saludables. Pero una buena informacin no es suficiente para provocar cambios en muchas personas como lo demuestra el alto nivel de tabaquismo de los
profesionales sanitarios. Esta tarea suele
provocar, con frecuencia, impotencia, frustracin y/o indignacin al comprobar el
poco caso de los pacientes a los bien
intencionados y fundamentados consejos1.
La motivacin, o deseo de cambio, para
modificar conductas y hbitos insanos
depende de muchos factores. Necesitamos
aprender a desarrollar habilidades que nos
faciliten trabajar la motivacin de los
pacientes.

MODELOS DE ENTREVISTA CLNICA


INFORMATIVO Y MOTIVACIONAL:
DIFERENCIAS
Las tcnicas motivacionales se basan
principalmente en el respeto al paciente, a
sus creencias y escala de valores2. Intentan
estimular la motivacin y favorecer el posicionamiento hacia hbitos sanos enfatizando los puntos de vista del paciente y su
libertad de escoger. No es posible motivar
a nadie a sacrificarse si no ve muy claro
que va a sacar beneficio. Tampoco nadie
empieza un cambio si no tiene claro que
podr con l, siendo muy subjetiva la percepcin de la magnitud de esta tarea.

Aunque existen otros modelos de


entrevista para el cambio de hbitos (coercitivo, argumentativo, persuasivo), destacamos las diferencias bsicas entre entrevista informativa clsica y entrevista
motivacional centrada en el paciente3
(Tabla 1).

MODELO DE ESTADIOS DEL


CAMBIO
Prochaska y Diclemente, estudiando
procesos de cambio en las personas,
encontraron que aquellas que consiguen
una mejora en sus estilos de vida pasan a
travs de una serie de estadios, cada uno
con una actitud mental y un tipo de motivacin diferentes. Describieron el modelo
de estadios de cambio (Fig. 1), tambin llamado rueda del cambio, donde stos se
sitan circularmente y no funcionan como
etapas en un solo sentido. Refleja la realidad de que, en cualquier proceso de cambio, la persona gira varias veces alrededor
del proceso antes de alcanzar un cambio
estable.
En la prctica clnica se observan altibajos en la posicin que va ocupando el
paciente en el continuo de la rueda del
cambio respecto a hbitos de salud insanos.
Cada estadio registra una actitud mental diferente e implica un tipo de motivacin tambin distinto:
Precontemplacin. En esta fase la persona no ve, o no quiere ver, ningn problema en su conducta como lo demuestran
frases del tipo de algo hay que morir, yo
soy fuerte y a m el alcohol no me hace
dao y mi abuelo muri con 95 aos y
fumaba.

Tabla 1. Modelos de entrevista clnica informativo y motivacional.


Modelo informativo
Da consejos expertos.
Intenta persuadir.
Repite los consejos.
Acta con autoridad.
Es rpido.

44

Modelo motivacional
Estimula la motivacin para pasar a la
accin.
Favorece el posicionamiento ayudando en
la reflexin.
Resume los puntos de vista.
Acta colaborando para ayudar a decidir
por el cambio.
Es de aplicacin progresiva.

ANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

ENTREVISTA MOTIVACIONAL

SALIDA PREMATURA

Contemplacin

INICIO

Precontemplacin

Recada

Determinacin
Cambios
activos
Mantenimiento

CONSOLIDACIN
Figura 1. Modelo de estadios del cambio.

Contemplacin. La persona empieza a


tener algunas dudas sobre su conducta.
Empieza a sopesar los pros y contras aunque no se ve todava con nimo de intentar
un cambio: Tendra que dejar el tabaco
porque llevo muchos aos fumando o Me
gustara hacer ms ejercicio pero me aburre.
Determinacin. En este momento de
la rueda la persona decide intentar un
cambio y requiere tener confianza en
poder controlar la nueva conducta: El da
de mi cumpleaos dejar de fumar.
Cambios. En esta fase se pone en
prctica la decisin tomada.
Mantenimiento. La persona ha de
concentrarse activamente en mantener el
cambio y consolidarlo ya que las tentaciones (atraccin por la conducta antigua)
estn presentes.
Recada. Se vuelve a la conducta anterior y a estadios anteriores, precontemplacin o contemplacin.
La ayuda que el profesional puede ofrecer a sus pacientes consiste en facilitar
avances hacia el siguiente estadio, conociendo que tienen necesidades y caractersticas diferentes en cada uno de ellos.
Podemos identificar en qu fase del proceANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

so se encuentra y ayudarle a ir transitando


dentro del crculo hacia el cambio de hbitos y su mantenimiento4.
Este modelo resulta muy til en atencin primaria por varias razones5:
Facilita un trabajo ms realista y eficiente al poder realizar un diagnstico
motivacional y una utilizacin de estrategias adaptadas a cada estadio; es decir, al
grado de motivacin para el cambio de un
hbito que presenta una persona en un
momento concreto.
Plantea una ayuda continuada, con
pequeos avances, alejada del todo o nada
que utilizamos habitualmente. Intervenciones breves pero pertinentes y repetidas a
lo largo de un periodo, ms o menos largo
de tiempo, pueden ser eficaces y gratificantes.
La recada no se considera un fracaso, del paciente ni del profesional, sino una
parte del proceso normal de cambio. Cada
recada no es la misma y representa un
avance hacia el xito del cambio ya que los
intentos fallidos sirven de aprendizaje que
acercan a la persona a la meta de consolidar un cambio.
45

S. Lizarraga, M. Ayarra

QU HACE CAMBIAR A LAS


PERSONAS
La motivacin, o deseo de cambio, flucta de un momento a otro y de una situacin a otra, y puede verse influida por
muchos factores. Los principios ms
importantes del cambio son los siguientes:
La motivacin intrnseca: la capacidad de cambio est en el interior de cada
persona y es poco susceptible de ser incrementada desde fuera por transfusiones
de voluntad. La voluntad no es otra cosa
que la motivacin para el cambio y los
sanitarios podemos ser facilitadores de
ese cambio.
La eleccin y el control propios: la
persona est ms motivada para hacer
cambios cuando se basan ms en sus propias decisiones que si una figura de autoridad le dice lo que tiene que hacer.
El autoconvencimiento auditivo: se
tiende a creer con ms fuerza aquello que
una persona se oye decir en voz alta a s
misma. Por esto es importante que el
paciente saque sus propios argumentos y
si los sanitarios se los repetimos ayudamos a que los oiga dos o tres veces (Dices
que quieres dejar de fumar porque te va
mal para la respiracin).
La autoconfianza o percepcin de
autoeficacia: si una persona cree que
puede cambiar ser ms fcil que lo consiga. Esto tiene gran influencia en la capacidad para iniciar una nueva conducta y
mantenerla como hbito.
La ambivalencia: quiero o no quiero
cambiar? Con frecuencia es el mayor obstculo para el cambio. Est presente en
casi todos nuestros actos y an ms en las
conductas adictivas (Querra adelgazar
pero me gusta mucho comer).
El traje a medida: cada persona necesita diferente ayuda dependiendo de la
etapa en que se encuentre en el proceso de
cambio.
La relacin interpersonal: La motivacin y la resistencia del paciente al cambio
pueden estar poderosamente influenciadas por el tipo de relacin interpersonal
que desarrolle el profesional de la salud. A
pocas personas les gusta que les digan lo
que deben hacer y las indicaciones u rde46

nes del sanitario pueden provocar oposicin al cambio (Tienes que dejar de
beber). Es importante aprender cmo
actuar para aumentar la conciencia del
paciente sin provocar su reactancia psicolgica (rechazo a perder libertad de decisin o actuacin).
Afortunadamente muchas personas
consiguen hacer cambios profundos en
sus vidas sin ninguna ayuda profesional.
Todos ellos comparten una serie de argumentos: no llegan a promover un cambio
por casualidad sino que van acumulando
buenas razones para iniciar una conducta
ms sana, y progresivamente aumentan su
compromiso y determinacin, cosa que les
permitir resistir el sufrimiento que tendrn cuando lo intenten5. Una buena informacin puede producir cambios en la conducta de ciertas personas pero en otras
muchas no. Motivar, o ayudar a cambiar, es
conseguir que el paciente descubra cules
son sus elementos o razones motivadores.

QU ES LA ENTREVISTA
MOTIVACIONAL
La entrevista motivacional (EM) es un
tipo de entrevista clnica centrada en el
paciente que, fundamentalmente, le ayuda
a explorar y resolver ambivalencias acerca
de una conducta o hbito insano para promover cambios hacia estilos de vida ms
saludables. Facilita que el paciente se posicione hacia el deseo de cambio6, tratando
de ayudarle a reconocer y ocuparse de sus
problemas presentes y futuros y potenciando su percepcin de eficacia. No pretende cambiar el estilo de trabajo de cada
profesional sino aportar herramientas que
permitan afrontar situaciones que no han
podido ser resueltas por las estrategias
habituales empleadas en promover cambios de conducta en los pacientes7.
La EM permite al profesional de atencin primaria provocar un aumento en la
motivacin del paciente teniendo en cuenta cul es su nivel de motivacin basal y
respetando siempre sus ltimas decisiones sin penalizarlo por ello. Es ms eficaz
decirle al paciente entiendo que te resulta
difcil controlar la comida que decirle si
no controlas la comida no entiendo para
qu acudes a la consulta a pesarte, ya que
ANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

ENTREVISTA MOTIVACIONAL

el hecho de acudir significa que no es indiferente a su situacin actual y algn tipo


de ayuda podremos prestar.

PRINCIPIOS GENERALES DE LA
ENTREVISTA MOTIVACIONAL
El terapeuta centrado en el paciente
necesita ofrecer tres caractersticas
decisivas para facilitar el cambio: empata,
calidez emocional y autenticidad.
Carl Rogers
La EM consta de una serie de elementos tericos y prcticos que tratan de
mejorar las habilidades de comunicacin
de los profesionales de atencin primaria.
Se basa en cinco principios:
Expresar empata. Significa aceptar y
respetar al paciente pero no, necesariamente, aprobarlo. Implica un cierto grado
de solidaridad emocional intentando comprender sus pensamientos y emociones
preguntndonos cmo me sentira yo en
sus circunstancias?, coincide la emocin
que yo tendra con la que l me expresa?,
cmo le transmito que le comprendo?8. La
respuesta emptica es una habilidad bien
definida que se adquiere con entrenamiento y permite comprender y aceptar lo que
el otro expresa9. Permite expresar, sinceramente, la solidaridad con gestos (tocar
ligeramente al paciente) y con palabras
(entiendo que te sientas mal por lo que ha
ocurrido). La empata es la espina dorsal
de la EM porque, ante el dolor que prev el
paciente por el cambio, el sentir que tiene
un apoyo emocional resulta muy til.
Desarrollar la discrepancia: lograr
que el paciente reconozca dnde se
encuentra y dnde querra estar respecto
al hbito o conducta a modificar. Interesa
aumentar su nivel de conflicto, especialmente entre la conducta actual y los valores importantes de su vida10. Trabajar la
emocin que genera la incomodidad de la
duda y/o conflicto es el mayor motor para
el cambio. Para aumentar la eficacia de la
entrevista es importante conseguir que el
paciente verbalice sus discrepancias.
Evitar argumentar y discutir con el
paciente sobre la conveniencia o utilidad
de un cambio porque esto le puede crea
ANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

resistencia. Los argumentos directos y los


intentos de convencerle tienden a producir oposicin ante las indicaciones, sugerencias u rdenes para el cambio. Esta
oposicin se llama reactancia psicolgica
(cuanto ms se empea el sanitario ms se
cierra el paciente), y surge con frecuencia
cuando la persona tiene la percepcin de
que su capacidad de eleccin est limitada
y, en general, cuando la sensacin de libertad se coarta11. Antes de informar es conveniente preguntar al paciente si tiene o
quiere informacin al respecto con frases
como quieres que te explique algo
sobre...? Tambin es importante no precipitarse con un cmulo de informacin
siendo ms til informar poco a poco e ir
preguntando qu te parece esto que te he
dicho?, centrndonos en los conflictos del
paciente.
Trabajar las resistencias del paciente
evitando las actitudes del sanitario que
pueden facilitarlas: tratar de imponer un
cambio por su bien, plantear implcita o
explcitamente que la relacin asistencial
conlleva la obligatoriedad de un cambio,
reir al paciente ante el no cambio, etc.
Apoyar y fomentar el sentido de autoeficacia. Creer en la posibilidad de cambiar
es un factor motivacional importante, ya
que tiene una gran influencia en la capacidad de iniciar una nueva conducta y en
mantenerla. Los resultados previos satisfactorios refuerzan la creencia del paciente
en su capacidad para conseguirlo y nuestra ayuda aqu puede estar en analizar con
l esos resultados potenciando su positividad (Es difcil dejar el alcohol del todo y
t lo conseguiste). No podemos olvidar
que el paciente es responsable de escoger
y realizar el cambio y nosotros le prestamos ayuda si lo desea.

TCNICAS DE APOYO NARRATIVO


Carl Rogers, cuya teora sobre las condiciones bsicas del terapeuta para la facilitacin del cambio en el paciente es la ms
claramente articulada y puesta a prueba12,
afirmaba que una relacin interpersonal
centrada en el paciente proporciona la
atmsfera ideal para el cambio al permitirle un anlisis de s mismo en un ambiente
seguro13. La amplia investigacin realizada
47

S. Lizarraga, M. Ayarra

de este tipo de comunicacin est permitiendo demostrar un impacto importante


en los resultados clnicos7 y en la satisfaccin de los usuarios14. Existen cinco tcnicas que ayudan a que el paciente pueda
sentirse aceptado y entendido, y que vaya
avanzando en verse a s mismo, y a la
situacin en que se encuentra, de una
forma clara como primer paso para el cambio:
1. Preguntas abiertas. Son aquellas que
no pueden contestarse solamente con una
o dos palabras a diferencia de las preguntas cerradas, por ej. Qu te preocupa al
ver estos anlisis? o cmo afecta el tabaco a tu vida? Este tipo de preguntas permiten y animan al paciente a explicarse
aumentando as su percepcin del problema. Una persona cuando habla elabora
informacin y emociones asociadas a lo
que va diciendo. Una buena manera de
comenzar una EM es con una pregunta
abierta del tipo ... qu aspectos de tu
salud te preocupan ms?
2. Escucha reflexiva. Es una de las habilidades fundamentales de la EM. Se trata
de averiguar lo que intenta decir el paciente y devolvrselo por medio de afirmaciones, que son frases sin interrogacin final.
Estas afirmaciones pueden ser de cinco
tipos:
Repeticin de alguna palabra dicha
por el paciente y que nos parece importante.

imprescindible de autoobservacin acerca


de lo que acaba de decir y sentir.15
Con la escucha reflexiva se trata de
intentar comprender y deducir lo que el
paciente quiere decir con exactitud.
3. Reestructuracin positiva. Significa
afirmar y apoyar al paciente, destacar sus
aspectos positivos y apoyar lo dicho por l
mediante comentarios y frases de comprensin. Sirve para rehabilitar su autoestima y el sentido de autoconfianza ( Debe
ser difcil para ti mantenerte sin cocana,
Pareces una persona muy optimista). A
medida que el paciente se siente escuchado y aceptado por el terapeuta, l se vuelve capaz de escucharse y aceptarse,
aumenta la comprensin y el control sobre
s mismo y su sensacin de poder16.
4. Resumir intentando destacar de lo
dicho por el paciente lo que nos parece
ms crucial.
5. Afirmaciones de automotivacin.
Favorecerlas y provocarlas mediante preguntas evocadoras que pueden ser sobre
diferentes aspectos:
Reconocimiento del problema: De
qu manera esto ha sido importante para
ti?
Expresin de preocupacin: Cmo te
sientes con tu forma de beber?
Intencin de cambio: Cules son las
razones que tu ves para cambiar?

Refraseo. Es como lo anterior pero


cambiando alguna palabra por sinnimos
o alterando ligeramente lo dicho para clarificarlo.

Optimismo por el cambio: Qu te


hace pensar que podras cambiar si lo
desearas? Una forma general de pregunta
es: Qu ms?

Parafraseo. Aqu se refleja lo dicho


con nuevas palabras porque el profesional
intuye el significado de lo hablado por el
paciente.

El que el paciente contine realizando


afirmaciones automotivadoras y analizando la ambivalencia depender, en parte, de
nuestra manera de responder siendo
importante hacerlo de forma que comuniquemos aceptacin, reforcemos la autoexpresin y estimulemos un anlisis continuo12.

Sealamiento emocional. Es la forma


ms profunda de reflexin y consiste en
decir frases que muestran sentimientos o
emociones: Te veo un poco triste, parece que esto que hablamos te emociona.
Silencios. Utilizados de forma adecuada tienen un potente efecto reflexivo en el
paciente porque de forma no verbal le
estamos indicando que le entendemos y
aceptamos. Permiten, tambin, un tiempo
48

El trabajo del profesional, en este tipo


de entrevista, es facilitar la expresin por
el propio paciente de los argumentos para
cambiar como forma de resolver su ambivalencia y que avance hacia una decisin
de cambio. Idealmente se trata de conseANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

ENTREVISTA MOTIVACIONAL

guir que el paciente quiera convencernos


de la necesidad de que l cambie6.

TCNICAS PARA INCREMENTAR EL


NIVEL DE CONCIENCIA RESPECTO
AL CAMBIO
Para que el dilogo sea fluido y eficaz
avanzando hacia la determinacin del
cambio las siguientes tcnicas sirven de
ayuda:
Reforzar de forma verbal y no verbal
las afirmaciones de automotivacin del
paciente.
Hacer decisin balanceada, que significa indicar los aspectos positivos y negativos de ambas conductas, antigua y nueva
a adquirir, que el paciente haya explicitado: Dices que beber alcohol tiene cosas
buenas como...y otras malas comoy tambin dices que no beber tiene como positivoy como negativo.
Provocar la elaboracin pidiendo
ejemplos concretos y especficos, clarificando el cmo, cundo, etc.
Utilizar los extremos imaginando la
peor de las consecuencias posibles.
Mirar hacia atrs y/o hacia delante.
Visualizar con el paciente cmo era antes
de adquirir el hbito y/o cmo se encontrar despus de abandonarlo.
Explorar valores realmente importantes para la vida del paciente (qu es
importante en tu vida?).
Utilizar la paradoja, hacer de abogado
del diablo17. Esta tcnica puede ser desbloqueadora de situaciones aparentemente
irresolubles pero es bastante arriesgada.
Requiere adiestramiento y no puede utilizarse con cualquier persona ya que precisa un cierto nivel de autoestima. Al ponerse el profesional del lado de los
argumentos del paciente ste puede observar desde fuera lo absurdo de su situacin. Tipos de intervenciones paradjicas
son: No creo que valga la pena que lo
intentes o Por lo que dices, probablemente en este momento lo ms acertado
es que sigas bebiendo lo mismo.
ANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

TRAMPAS A EVITAR
El conocimiento de las estrategias
generales tiles para afrontar la entrevista
motivacional implica comprender qu es lo
que no se debe hacer.
William R. Miller
Hay varias trampas que interfieren
rpidamente en el progreso del paciente
hacia el deseo del cambio. Son maneras de
encarar la entrevista que generan resistencias en el paciente12:
Pregunta-Respuesta. Significa formular preguntas que el paciente responde
con frases cortas y simples. Implican una
interaccin entre un experto activo y un
paciente pasivo y no facilita la reflexin y
elaboracin por parte del paciente. Se
evita con preguntas abiertas y escucha
reflexiva. Como norma general conviene
evitar el formular tres preguntas abiertas
seguidas.
Confrontacin-Negacin. Es lo ms
frecuente y la trampa que ms interesa evitar3-5. Cuanto ms enfrentemos al paciente
con su situacin, l se volver ms resistente y reacio al cambio con respuestas del
tipo No creo que sea tan serio el problema
porque olvide cosas cuando bebo.
Trampa del experto. Ofrecer, con la
mejor intencin, respuestas y soluciones
al paciente llevan, a ste, a asumir un rol
pasivo totalmente contrario al enfoque de
la EM.
Etiquetaje. Clasificar a un paciente
por un hbito con etiquetas que, a menudo, acarrean un cierto tipo de estigma en
la gente (Eres alcohlico). Los problemas se pueden analizar sin necesidad de
poner las etiquetas que provocan resistencias innecesarias.
Focalizacin prematura por lo que al
sanitario le parece ms importante mientras el paciente desea hablar sobre otros
temas que le preocupan y que son ms
amplios. Es importante evitar implicarse
en una lucha sobre qu tema es ms apropiado para iniciar la entrevista y el empezar con las preocupaciones del paciente
facilita la tarea. Si intentamos centrar rpidamente el tema, por ejemplo en una adic49

S. Lizarraga, M. Ayarra

cin del paciente, ste se distanciar y se


pondr a la defensiva.
Culpabilizacin. Desaprovechar tiempo y energa en analizar de quin es la
culpa del problema pone al paciente a la
defensiva. La culpa es irrelevante y conviene afrontarla con reflexin y reformulacin
de las preocupaciones del paciente.

ACTUACIONES ADAPTADAS A LOS


ESTADIOS DEL CAMBIO
El lema general es no adelantar nunca
al paciente ni forzarlo a que tome decisiones precipitadas. Para esto es fundamental
vencer nuestra ansiedad respecto a tener
que hacer algo enseguida y a obtener
resultados evidentes rpidamente. Debemos trabajar la motivacin de los pacientes desde una perspectiva estadio-especfica y no slo desde la consideracin de un
cambio hacia el estadio de accin.

Estadio de precontemplacin
La persona no considera la conducta
motivo de preocupacin aunque gente de
su entorno cercano sufra las consecuencias. En esta fase podemos intentar, previa
creacin de un clima adecuado, incrementar el nivel de contradiccin para que afloren motivos de preocupacin. Hay que evitar las resistencias, la informacin no
solicitada y la peticin de cambios prematuros, siendo importante aprovechar el
momento y la oportunidad de intervenir.

Estadio de contemplacin
Aqu el paciente ya considera el problema y la posibilidad del cambio pero la
ambivalencia puede cronificar este estadio
y hacerlo muy frustrante. Nuestra actuacin se centrar en desarrollar estrategias
adecuadas para moverlo hacia la determinacin sin olvidar que la toma de decisiones la hace el propio individuo y no tanto
por la informacin recibida. Las estrategias ms adecuadas parecen las tcnicas
de apoyo narrativo y tienen como finalidad
aumentar la disonancia cognitiva del
paciente (discordancia entre conocimientos y conducta) dentro de un clima emptico, ya que la persona se encuentra ms
receptiva a conectar con las implicaciones
50

personales que comporta el cambio. Son


tiles, en esta fase, el diario de salud y la
hoja de balance.
El diario de salud es un registro escrito
de la frecuencia con que suceden los
hechos que se quieren estudiar y otros
aspectos importantes relacionados con
ella. Ayuda al paciente a aumentar la autopercepcin sobre la conducta y sus consecuencias y al sanitario a realizar observaciones que le permitan proponer cambios
especficos en los hbitos. Es ms til y
preciso que la recogida de informacin sea
diaria en lugar de semanal.
La hoja de balance es un registro escrito de las razones para continuar igual y las
razones para desear el cambio. Sirve para
clarificar las dificultades y los beneficios
de la conducta y de cualquier cambio. En
su forma ms sencilla es una hoja de dos
columnas y resulta til dividirla en apartados sobre diferentes aspectos bio-psicosociales.

Estadio de determinacin hacia el


cambio
Aunque se haya decidido iniciar el cambio la ambivalencia no suele estar totalmente resuelta. Tenemos que evitar las prisas aunque resulte tentador insistir en esta
fase. Conviene evaluar la intensidad y el
nivel de compromiso para el cambio: Existe una valoracin realista, por parte del
paciente, de las dificultades presentes?
Tras valorar que haya indicadores de cambio y que el paciente lo haya verbalizado
podemos colaborar con l en la elaboracin
de un plan de accin aceptable, con objetivos concretos, tiles, alcanzables y medibles a corto plazo (Suprimir la ingesta de
alcohol o disminuirla?). El hecho de que el
paciente verbalice su compromiso de cambio aumenta las posibilidades de xito.

Estadio de accin, de cambios


activos
Aunque el paciente suele referir que
siente que ahora est tomando el control
de su vida, ste es un momento muy estresante y duro de sobrellevar por lo que
suele ser necesaria una ayuda prctica y
emocional. Debemos incrementar el sentiANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

ENTREVISTA MOTIVACIONAL

do de autoeficacia del paciente y podemos


ofrecerle informacin sobre otros modelos
que hayan tenido xito. Tanto en esta fase
como en la siguiente hay que estar muy
atentos para proporcionar apoyo, si fuera
necesario, y minimizar la frecuencia de las
recadas.

Estadio de mantenimiento
Tras un primer periodo de cambio, en
que est elevado el sentimiento de confianza en la propia capacidad para controlar la nueva conducta, aparece una crisis
de distinta intensidad en cada persona. En
esta crisis interviene, entre otros factores,
la aoranza por el placer asociado a la conducta que est abandonando. Para prevenir las recadas, que ya hemos comentado
que es un fenmeno muy frecuente, podemos evaluar con el paciente las situaciones de alto riesgo y desarrollar conjuntamente habilidades de afrontamiento para
consolidar la nueva conducta: Qu hars
cuando te ofrezcan tabaco?

Estadio de recada
Las recadas han de entenderse como
algo frecuente y normal en el proceso del
cambio e incluso necesario en un contexto
de aprendizaje como es el cambio de hbitos arraigados. Conviene distinguir entre
una cada ocasional, un simple resbaln, y
una recada mantenida. Una actitud por
nuestra parte clida, exenta de punicin y
con un mensaje claro de que un desliz aislado no tiene que implicar una recada puede
ser efectiva para reforzar el sentido de autoestima del paciente y que no abandone la
nueva conducta iniciada5. Conviene evaluar
los intentos previos de cambio y los sentimientos asociados a la aparicin de la conducta (culpa, enfado, placer, alivio de
estrs), as como la falta de habilidades para
afrontar la nueva conducta o la presencia de
situaciones estresantes del entorno.
Mientras que las estrategias motivacionales son ms importantes en los primeros
estadios del cambio (precontemplacin,
contemplacin y determinacin) el desarrollo de habilidades de afrontamiento y
un adecuado sentimiento de autoestima
son los aspectos fundamentales de los ltimos estadios (Tabla 2).
ANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

Como conclusin, sealar que la primera estrategia de la EM consistira en realizar una aproximacin al paciente que le
permita posicionarse respecto al hbito
insano. Esta primera tarea logra situar al
paciente en un estadio en el continuo del
cambio y permite el empleo de estrategias
comunicacionales adaptadas a cada necesidad. Posteriormente, persigue promover
una toma de conciencia por parte del
paciente de un hbito insano, aumentando
los niveles de contradiccin entre sus creencias y sus actos y, por tanto, aumentando los niveles de conflicto. Por ltimo,
trata de ayudar a hacer efectiva la voluntad que puede emerger de las sucesivas
entrevistas que se mantengan con cada
persona4,5.

ENTREVISTA MOTIVACIONAL BREVE


Las tcnicas de EM representan mayor
ayuda para los profesionales de atencin
primaria que para el resto debido a la continuidad de la asistencia que se presta.
Necesitamos tcnicas breves y eficaces
para aplicarlas en nuestra realidad de
tiempo de consulta escaso y gran variedad
de situaciones que requieren cambios conductuales profundos para su resolucin.
Hay dos principios bsicos que centran
este planteamiento:
1. Evitar la confrontacin con el paciente, situacin frecuente cuando nos centramos en informar y el paciente no est seguro de si desea el cambio.
2. Facilitar que el paciente verbalice
motivos de preocupacin por su conducta.
La entrevista motivacional breve puede
aplicarse en una entrevista corta, entre 30
segundos y 15 minutos. Estas breves intervenciones resultan eficaces y, adems,
incrementan nuestra satisfaccin como
profesionales.
Tiene cuatro momentos diferenciados:
Inicio de la entrevista: introducir un
tema/problema mediante una pregunta
abierta y previa solicitud de permiso
(Quieres que hablemos de?).
Exploracin de motivos de preocupacin: comporta que el paciente empiece a
elaborar sobre s mismo y le ayudamos
con tcnicas de apoyo narrativo (Qu difi51

S. Lizarraga et al

TAREAS
Priorizar el hbito y estadiarlo
Elaborar mapa de creencias
Trabajar la ambivalencia
Evitar y trabajar las resistencias
Aumentar la autoeficacia y la automotivacin

Contemplativo
Ve el problema pero
con muchas dudas

Aumentar las contradicciones entre


lo que hace y lo que desea

Determinacin
Dispuesto a cambiar

Que el paciente verbalice el


compromiso de cambio
Ayudar a elegir la mejor estrategia
Desarrollar un plan de actuacin
conjunto

EMPATA

Accin
Ha iniciado el cambio

Aumentar la autoeficacia
Informar sobre otros modelos que
hayan tenido xito

Mantenimiento
Mantiene el cambio

Prevenir las recadas


Aumentar la autoeficacia

Recada
Vuelve a la conducta
anterior

Reconstruir positivamente y ayudar


a renovar el proceso
Aumentar la autoeficacia y la
automotivacin

cultades crees que tienes para hacer ejercicio?).


Eleccin de opciones para el cambio
mediante preguntas abiertas y escucha
reflexiva (Dices que cuando empiezas un
rgimen te pones triste y apagada).
Finalizar realizando un sumario de lo
expresado por el paciente y preguntndole
si es correcto (Te he comprendido bien?).
Somos aquello que hacemos
repetidamente. La excelencia, pues, no es
un acto sino un hbito.
Aristteles.
Agradecimientos
A los pacientes de Huarte, que nos permiten aprender trabajando con ellos.
52

EMPATA

EMPATA

EMPATA

EMPATA

ESTADIOS
Precontemplativo
No ve el problema

EMPATA

Tabla 2. Tareas y estrategias adaptadas a los estadios del cambio.


ESTRATEGIAS
Apoyo narrativo
Evitar trampas
Reconocer resistencias

Lo anterior
Diario de salud
Hoja de balance
Hacer sumarios
Preguntas activadoras

Apoyo narrativo
Preguntas activadoras
Identificacin conjunta de
las situaciones de riesgo
y elaboracin de estrategias para afrontarlas
Sealamiento emocional
Reestructuracin positiva

BIBLIOGRAFA
1. BIMBELA JL. Cuidando al cuidador. Counseling
para mdicos y otros profesionales de la
salud (3 ed.). Granada: Escuela Andaluza de
Salud Pblica, 1998.
2. LOWES R. Patient-centered care for better
patient
adherence.
Family
Practice
Managementmarch 1998. http://www.aafp.
org/fpm/980300fm/patient.html.
3. FREIXA N. La entrevista con el enfermo
alcohlico. Estrategias motivacionales. Jano
2000; LIX: 1383-1384.
4. MCILVAIN H, KAY BOBO J, LEED-KELLY A, SITORIUS
MA. Practical steps to smoking cessation for
recorvering alcoholics. Am Fam Phys 1998;
8: 1869-1887.
5. CEBRI J, BOSCH JM. La peregrinacin por la
rueda del cambio tiene indulgencia sanitaria
plena. FMC 2000; 7: 233-236.
6. BOSCH JM, CEBRI J, MASSONS J, CASALS R.
Estrategias para modificar actitudes en el
ANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

ENTREVISTA MOTIVACIONAL

marco de la entrevista clnica la motivacin


para el cambio. Libro de ponencias del XIV
Congreso Nacional de la SEMFYC. Madrid
1994: 285-294.

11. BOSCH JM, CEBRI J. Reactancia psicolgica :


Fumar es un placer. FMC 1999; 6: 59-61.

7. SALTINI A, DEL PICCOLO L. Patient-centered


interviews in general practice. Recenti Prog
Med 2000; 91: 38-42.

13. ROGERS C. Psicoterapia centrada en el cliente.


Barcelona : Paidos 1986.

8. FUENTES J, ALONSO S. Aprendiendo a ser


emptico. FMC 2000; 7: 538-539.
9. BOSCH JM, CEBRI J. La Sra. Pesez en el pas
de los espejos de la atencin primaria. FMC
1999; 6: 451-454.
10. CEBRI J, BOSCH JM. Querer y no querer. El
dilema de la ambivalencia. FMC 1999; 6: 393395.

ANALES Sis San Navarra 2001, Vol. 24, Suplemento 2

12. MILLER WR, ROLLNICK S. La entrevista


motivacional. Barcelona: Paidos 1999.

14. PRADOS JA, CEBRI J, BOSCH JM. Comunicacin


centrada en el paciente: una aplicacin a la
clnica. FMC 2000; 7: 83-88.
15. BOSCH JM, CEBRI J. La Sra. Pesez en el pas
de los espejos de la atencin primaria (II).
FMC 2000; 7: 39-42.
16. ROGERS C. El poder de la persona. Mxico: Ed.
El manual moderno 1980.
17. CEBRI J, BOSCH JM. Mdico o abogado del
diablo? FMC 2000; 7: 320-322.

53

Introduccin a la
Entrevista Motivacional
Curso:
Manejo de la obesidad en la niez

Antedecentes
Tradicionalmente el cambio de conducta en
pacientes se ha centrado solo en proporcionar
informacin y esperar a que el paciente
cambie.
Necesitamos aprender habilidades que
promuevan la motivacin en pacientes.

Las tecnicas motivacionales


Se basan en respeto al paciente, respeto a sus
creencias y escala de valores.
Intentan estimular la motivacin y favorecer
estilos de vida saludable con base a los puntos
de vista del paciente y su libertad a escoger.
No es posible motivar a nadie si no se justifica
el sacrificio y se define muy claro el beneficio
a cambiar.

Modelo de los estadios de cambio de


conducta

Etapas del cambio de conducta


En la practica clnica el paciente se mueve en
torno a estas etapas.

Cada estadio requiere de una motivacin


diferente de acuerdo a la actitud del paciente.
La ayuda del profesional de salud se centra en
apoyar al paciente a moverse a diferentes
etapas de cambio.

Ventajas de utilizar este modelo


Facilita el trabajo de forma realista y eficiente
y se adecua a la necesidades del paciente de
acuerdo a su estadio.
Platea ayuda continua y se aleja del todo o
nada.
La recada no se considera un fracaso si no
una oportunidad de aprendizaje como parte
del proceso de cambio.

Qu hace cambiar a las personas?


La motivacin intrnseca:
el personal de salud
puede motivar el cambio
y la motivacin intrnseca
La eleccin y el control
propio.
El autoconvencimiento
auditivo: darle al paciente
argumentos propios.
La autoeficacia o
percepcin de
autoeficacia: creer que se
puede cambiar.

La ambivalencia: Se
quiere cambiar o no?
El traje a la medida:
ayuda dependiendo en la
etapa en la que se
encuentre.
La relacin interpersonal
que desarrolle el
profesional de salud con
el paciente.

Qu es la Entrevista Motivacional?

Es un tipo de entrevista clnica centrada en


el paciente que fundamentalmente le
ayuda a explorar y resolver ambivalencias
acerca de una conducta o un habito insano
para promover cambios hacia estilos de
vida mas saludables.

Para qu se usa la
Entrevista Motivacional?
La EM permite al profesional provocar un
aumento en la motivacin tomando en cuenta
su nivel de motivacin basal y respetando sus
decisiones sin penalizar o juzgar.

Principios generales de la EM
EMPATIA: aceptar y respetar al paciente (no
necesariamente aprobarlo). Es una solidaridad
emocional, intentar comprender sus emociones
y pensamientos.
DESAROLLAR DISCREPANCIA: Aumentar el nivel
de conflicto para que el paciente vea a donde
esta parado y los valores importantes de su vida.
Es importante que el paciente verbalice sus
discrepancias.

Principios generales de la EM
EVITAR LA DISCUSION: Evitar dar ordenes o
convencer o discutir porque esto crea
resistencia. Proveer informacin til si el
paciente lo autoriza
TRABAJAR LAS RESSITECIAS: no imponer
ningn cambio por el bien del paciente.
FOMENTAR LA AUTOEFICACIA: el paciente
decide cambiar o no y el profesional de la salud
solo le presta ayuda.

Tecnicas de la entrevista
Preguntas abiertas
Escucha reflexiva:
Repeticin de una palabra importante
Parafraseo
Refraseo
Sealamiento emocional
Silencios

Reestructuracin positiva: afirmar y apoyar al


paciente y destacar sus aspectos positivos

Tcnicas de la entrevista
Resumir: destacando lo mas importante
Afirmaciones: hacer preguntas evocadoras
Reconocimiento del problema
Expresin de preocupacin
Intensin de cambio
Optimismo por el cambio

Tcnicas para incrementar el nivel de


conciencia respecto al cambio
Reforzar de forma verbal y no verbal las
afirmaciones de automotivacin.

Hacer anlisis de balance (pros y contras).


Promover/provocar la elaboracin.
Utilizar extremos.

Tcnicas para incrementar el nivel de


conciencia respecto al cambio
Ejemplificar y mirar hacia atrs o adelante
como era la vida con o sin la conducta.

Explorar valores importantes para la vida del


paciente.
Utilizar la paradoja y convertirse en abogado
del diablo.

Trampas a Evitar
PREGUNTAS-RESPUESTAS: evitar la interaccin
entre un experto activo y un paciente pasivo
porque esto no conduce a la reflexin.
CONFRONTACIN: evitar confrontacin
porque el paciente se volver resistente.
EXPERTO: evitar dar consejos e informacin
sin que e paciente lo pida.

Trampas a Evitar
ETIQUETAR AL PACIENTE: evitar etiquetar al
paciente para evitar estigmas.
FOCALIZACIN PREMATURA: evitar enfocarse
en los temas que no son importantes para el
paciente.
CULPABILIZACION: evitar culpabilizar a nadie
de la conducta.

En resumen en la EM se debe:
1. Evitar el enfrentamiento con el paciente:
situacin frecuente cuando solo le damos
informacin y no sabemos si el paciente esta
listo para cambiar.
2. Facilitar que el paciente verbalice su
preocupacin o ambivalencia en torno a la
conducta.

Existen 4 fases en la EM
1. Inicio de la entrevista: Introducir un tema por medio
de una pregunta abierta y si se va a compartir
informacin es con previo permiso del paciente.

2. Exploracin de motivos de preocupacin: el paciente


empieza a explorar y los profesionales de la salud le
ayudan con tcnicas de apoyo.
3. Apoyo en la eleccin de opciones para el cambio.

4. Finalizar haciendo un resumen de la sesin y/o plan


de cambio y preguntar si es correcto.

La Entrevista Mo.vacional como Alterna.va para


Promover el Cambio de Conducta en Personas con
Sobrepeso, Obesidad y Diabetes

Margarita Safdie MSc, PhD


Consultora en Nutricion, Ac.vidad Fisica y
Promocion de la Salud

Antecedentes
La prevencin de enfermedades
crnicas necesita de inicia.vas
crea.vas que promuevan es.los
de vida saludables y provean a los
usuario de alterna.vas
sostenibles
Margarita Safdie

Antecedentes
Las personas no 4enen la capacidad, el
conocimiento y la mo4vacin para optar por
alterna4vas ms sanas y adoptar modos de
vida que propicien la buena salud
No es suciente con el reducir el grado de
exposicin de las personas a los factores de
riesgo de las ECNT y a sus determinantes

Margarita Safdie

Antedecentes
Tradicionalmente el cambio de conducta en
pacientes se ha centrado solo en proporcionar
informacin y esperar a que el paciente
cambie
Se ha demostrado que la informacin no es
suciente para modicar una conducta

Margarita Safdie

Cambio Permanente


Si las principales causas
de enfermedad en el
mundo son las conductas
de las personaspor qu
no se inuye en ellas para
evitar que se enfermen?
Margarita Safdie

Cambio Permanente
La conducta est
inuenciada por
diferentes niveles del
contexto, y la persona
no obedece a lo que se
le indica si no .ene
sen.do para ella y no se
considera capaz de
poder hacerlo
Margarita Safdie

Modelo de los Estadios de Cambio de Conducta

Pre-Contemplacin Contemplacin Preparacin Accin

Margarita Safdie

Mantenimiento

Recada

Etapas del cambio de conducta


En la prac4ca clnica el paciente se mueve en torno
a estas etapas
Cada estadio requiere de una mo4vacin diferente
de acuerdo a la ac4tud del paciente
La ayuda del profesional de salud se centra en
apoyar al cliente a moverse a diferentes etapas de
cambio

Margarita Safdie

Como cambiar los es4los de vida


La mo.vacin a cambiar se basa en que
la persona se posesione del deseo del
cambio con base a sus necesidades,
valores y prioridades

Margarita Safdie

Las tecnicas mo4vacionales


Se basan en respeto al paciente, respeto a sus
creencias y escala de valores
Intentan es4mular la mo4vacin y favorecer es4los
de vida saludable con base a los puntos de vista del
paciente y su libertad a escoger
No es posible mo4var a nadie si no se jus4ca el
sacricio y se dene muy claro el benecio a
cambiar

Margarita Safdie

10

Ambivalencia
Hay razones para cambiar y razones para NO
hacerlo
Es una experiencia humana NORMAL. Parte
comn y NATURAL en el proceso de CAMBIO
La falta de mo4vacin se puede ver como
ambivalencia NO resuelta

La AMBIVALENCIA es la situacin clave que se
4ene que resolver para que el cambio ocurra
Margarita Safdie

11

Clientes Ambivalentes
Pre-Contemplacin Contemplacin

Preparacin

Accin

Margarita Safdie

Mantenimiento

Recada

12

Ambivalencia
Cliente pensando en cambiar
Analiza los pros y la contras
Etapa normal en el cambio de conducta
Tiempo que se pasa en la ambivalencia varia

El papel del consejero o terapeuta = Ayudar


al cliente a incrementar las razones para
cambiar
Margarita Safdie

13

Que hace cambiar a las personas?


La resolucin de la ambivalencia:
La mo&vacin intrnseca: el
se quiere cambiar o no?
personal de salud puede
mo4var el cambio y la
El traje a la medida: ayuda
mo4vacin intrnseca
dependiendo en la etapa en la
que se encuentre
La eleccin y el control propio
El autoconvencimiento audi4vo: La relacin interpersonal que
darle al paciente argumentos
desarrolle el profesional de
propios
salud con el paciente
La autoecacia o percepcin de
autoecacia: creer que se
puede cambiar

Margarita Safdie

14

Mo4vacion
No es un problema de personalidad. Es un ESTADO de
disponibilidad o deseo de cambiar
Es un proceso dinmico, variable e inuenciado por
diferentes factores

Es la probabilidad de que una persona inicie


con.ne, y se comprometa con una estrategia
especca para cambiar

Margarita Safdie

15

Mo4vacion
Se u4lizan diferentes estrategias dependiendo de
la etapa de cambio o nivel de mo4vacin
Medida por el PLATICA de la persona en direccin
al cambio (DISCURSO DE CAMBIO)
La RESISTENCIA surge cuando el facilitador se
adelanta o se atrasa a la etapa de cambio de la
persona

Margarita Safdie

16

Cambio de conducta permanente


La adherencia al
tratamiento y el cambio
permanente a es4los de
vida saludables no se
consolidarn si no existe
la mo4vacin adecuada
que se base en las
necesidades del usuario
Margarita Safdie

17

La Entrevista Mo4vacional
La Entrevista Mo4vacional es un .po par.cular de
conversacin sobre el cambio, que se realiza de una
manera colabora.va y orientada a obje.vos
especcos de cambio, con par4cular atencin a los
propios argumentos de cambio del cliente/usuario;
siendo a su vez una intervencin evoca.va que
busca hacer surgir la propia mo.vacin y
compromiso intrnseco de la persona, mediante la
exploracin y resolucin de la ambivalencia
Margarita Safdie

18

La Entrevista Mo4vacional
Es un 4po de intervencin, centrada en el
usuario, que busca ayudar a explorar y resolver
contradicciones sobre conductas o es4los de
vida poco saludables relacionados con el
padecimiento del usuario

Margarita Safdie

19

La Entrevista Mo4vacional
Intenta aumentar la conciencia de los usuarios
sobre sus riesgos de salud y su capacidad para
hacer algo al respecto con base a las prioridades y
valores del usuario
El usuario se vuelve el centro de la entrevista y el
profesional de salud solo un facilitador

Margarita Safdie

20

La Entrevista Mo4vacional

La entrevista mo4vacional
provee las herramientas al
profesional de salud para
facilitar el cambio
fomentando una relacin
emp4ca con el usuario
favoreciendo que el mismo
se sienta apoyado y no
juzgado
Margarita Safdie

21

La Entrevista Mo4vacional

Rompe con el paradigma de la
tradicional consulta mdica en
la cual el profesional de salud
provee informacin y espera
que el usuario cambie de
conducta solo con base a la
informacin otorgada

Margarita Safdie

22

Que busca la Entrevista Mo4vacional?

Margarita Safdie

23


Que es la Entrevista Mo.vacional

Una forma igualitaria y emp4ca de ser con
manifestada a travs de tcnicas y estrategias
especicas, como la escucha reexiva
Que fomenta la toma de decisiones y el
establecimiento de una agenda de trabajo de
manera compar.da para ayudar a las personas a
explorar y resolver su ambivalencia sobre el cambio

Margarita Safdie

24


La Entrevista Mo.vacional:
Una forma renada de GUIAR

Resis4r el reejo de corregir
Habilidades clnicas bsicas
Resolver la ambivalencia de una
forma ms construc4va a favor del
cambio
Margarita Safdie

25

Ventajas de u4lizar este modelo


Facilita el trabajo de forma realista y eciente
y se adecua a la necesidades del paciente de
acuerdo a su estadio
Platea ayuda con4nua y se aleja del todo o
nada
La recada no se considera un fracaso si no
una oportunidad de aprendizaje como parte
del proceso de cambio

Margarita Safdie

26

El Tono de la Entrevista Mo.vacional


Sin juicios o cr4cas, emp4co y alentador.
Clima no-confronta4vo y de apoyo, en donde los
clientes se sienten seguros y en conanza para
expresar los aspectos posi4vos y nega4vos de la
conducta actual
La ambivalencia se explora profundamente y por lo
menos es parcialmente resuelta antes de avanzar
hacia el cambio

Margarita Safdie

27

28

Cuatro Procesos Fundamentales





PLANEAR



EVOCAR




ENFOCAR



INVOLUCRAR / ENTRELAZAR

Margarita Safdie

29


Espritu de la Entrevista Mo.vacional

Colaboracin: Fomenta una relacin de compaerismo y
trabajo en equipo, no de autoridad
Aceptacin: Enfa4za el valor nico de cada persona,
buscando ver el mundo desde su perspec4va, armando el
derecho y la capacidad de tomar las propias decisiones, y
buscando las propias fortalezas y sabidura interna
Compasin: Buscar el bienestar y crecimiento del otro
Evocacin: El cambio surge de la persona

Margarita Safdie

30

Contrario a
Autoridad. El profesional le dice al cliente lo que debe de hacer
desde una postura de experto y poder
Confrontacin. Se trata de imponer la toma de consciencia y la
aceptacin de la realidad que el cliente no puede ver o admi4r,
invalidando as las perspec4vas limitadas del cliente
Indiferencia. Inters propio, manipulacin
Educacin. Se busca abordar los dcits de informacin y/o
habilidades que el cliente aparentemente necesita para cambiar,
ofreciendo el insight que la persona necesita

Margarita Safdie

31

Para que se usa la


Entrevista Mo4vacional?


La EM permite al profesional provocar un
aumento en la mo4vacin tomando en
cuenta su nivel de mo4vacin basal y
respetando sus decisiones sin penalizar o
juzgar

Margarita Safdie

32

La Entrevista Mo4vacional
El profesional de salud aprende a respetar la
autonoma del usuario
Desarrolla una serie de capacidades que aumentan la
autoecacia en el usuario, hacindole ver que la
posibilidad de cambiar existe, que el cambio es
fac4ble y que se puede sostener
Se realiza de una manera colabora4va y evoca4va
que busca hacer surgir la propia mo4vacin y
compromiso intrnseco de la persona, mediante la
exploracin y resolucin de la ambivalencia
Margarita Safdie

33


En Resumen: 3 Elementos Esenciales de la
Entrevista Mo.vacional

1.La EM es un 4po par4cular de conversacin

sobre el cambio (consejera, terapia, consulta,


modo de comunicacin)
2.La EM es COLABORATIVA (centrada en la
persona, compaerismo, honra la autonoma, no
se basa en un rol de experto)
3.La EM es EVOCATIVA (busca hacer surgir la
propia mo4vacin y compromiso de la persona)
Margarita Safdie

34

Principios Generales de la EM
EMPATIA: Aceptar y respetar al paciente (no
necesariamente aprobarlo). Es una solidaridad
emocional, intentar comprender sus emociones y
pensamientos
DESAROLLAR DISCREPANCIA: Aumentar el nivel de
conicto para que el paciente vea a donde esta parado
y los valores importantes de su vida. Es importante que
el paciente verbalice sus discrepancias

Margarita Safdie

35

Principios Generales de la EM

EVITAR LA DISCUSION: Evitar dar ordenes o convencer
o discu4r porque esto crea resistencia. Proveer
informacin 4l si el paciente lo autoriza
TRABAJAR LAS RESSITECIAS: no imponer ningn
cambio por el bien del paciente
FOMENTAR LA AUTOEFICACIA: el paciente decide
cambiar o no y el profesional de la salud solo le presta
ayuda

Margarita Safdie

36

Trampas a Evitar en la EM
PREGUNTAS-RESPUESTAS: evitar la interaccin
entre un experto ac4vo y un paciente pasivo
porque esto no conduce a la reexin
CONFRONTACIN: evitar confrontacin porque
el paciente se volver resistente
EXPERTO: evitar dar consejos e informacin sin
que el cliente lo pida

Margarita Safdie

37

Trampas a Evitar en la EM

ETIQUETAR AL PACIENTE: evitar e4quetar al
paciente para evitar es4gmas
FOCALIZACIN PREMATURA: evitar enfocarse en
los temas que no son importantes para el
paciente
CULPABILIZACION: evitar culpabilizar a nadie de
la conducta

Margarita Safdie

38

Efec4vidad e Impacto
La Entrevista Mo4vacional est registrada
como una Intervencin Basada en la Evidencia
Ms de 200 inves4gaciones controladas en 7
pases, las cuales apoyan su efec4vidad para
promover cambios en una gran variedad de
conductas adic4vas, de es4los de vida
saludable y adherencia a los tratamientos de
salud

Margarita Safdie

39

Resultados de impacto
Los resultados de estas inves4gaciones siguen
concluyendo que la EM es ms efec4va que no
recibir tratamiento
Agregar EM a un tratamiento establecido, 4ende
a mejorar los resultados posi4vos de ste
La EM funciona mejor cuando los clientes estn
ms resistentes o menos listos para cambiar

Margarita Safdie

40

Ventajas
Breve (20 minutos a 4 sesiones de una hora cada una)
Mecanismos de accin especicables (se sabe que
funciona y cmo funciona
Generalizable para diferentes reas problema, puede ser
complementaria a otros mtodos de intervencin
Control de calidad
Se puede llevar a cabo por diversos profesionales y no
profesionales con el entrenamiento adecuado

Margarita Safdie

41

Conclusiones
Dado que la entrevista mo.vacional es una
intervencin efec.va esta puede marcar la
diferencia entre intenciones de cambio y
acciones de cambio y es una alterna.va para
para promover el cambio de conducta en
pacientes con Sobrepeso, la Obesidad y la
Diabetes

Margarita Safdie

42

LA TECNICA DE LA ENTREVISTA
MOTIVACIONAL
Margarita Safdie MSc, PhD
Consultora en Nutricion, Ac.vidad Fisica y
Promocion de la Salud

Margarita Safdie

44

Cuatro Procesos Fundamentales





PLANEAR



EVOCAR




ENFOCAR



INVOLUCRAR / ENTRELAZAR

Margarita Safdie

45

INVOLUCRAR

1.INVOLUCRAR La base relacional
ESCUCHAR entender el dilema y los valores de la
persona
Es.lo centrado en la persona
PARR habilidades centrales
Aprender esto primero

Margarita Safdie

46

ESCUCHAR
Fundamental para la EM Escucha Reexiva (Empana
Acertada, Escucha Ac4va)
Comunicacin efec4va mejores relaciones
interpersonales
Fomenta la auto-exploracin de la propia
percepcin y experiencia

Margarita Safdie

47

Qu es la Escucha Reexiva?
Escuchar el signicado detrs de las palabras de la
persona
Plantear hiptesis vs. formar suposiciones
Es hacer ms consciente el proceso de
decodicacin y compar4rlo con la persona
Fomentar una atmsfera de aceptacin y sin juicios

Margarita Safdie

48

Qu es la Escucha Reexiva?
La Escucha Reexiva man4ene a la persona
reexionando y hablando sobre el cambio
Demuestra que el profesional esta intentando
comprender
Enfa4za y refuerza las frases en direccin al cambio
la persona lo escucha dos veces
Disminuye la defensividad
Margarita Safdie

49

La EMPATA es
La habilidad de entender acertadamente la
perspec4va, sen4mientos, signicado y la propia
experiencia del cliente, (como si vieras a travs de
sus lentes de percepcin)
La habilidad de reejarle acertadamente esa
comprensin, como una manera de encarar a la
persona consigo misma
Con el obje4vo de que la persona experimente ser
escuchado, entendido y aceptado
Margarita Safdie

50

Cuatro Mtodos Bsicos: PARR

PARR
P Preguntas Abiertas
A Armar/Refuerzo posi4vo
R Reejar
R Resumir

Margarita Safdie

51

Cuatro Procesos Fundamentales





PLANEAR



EVOCAR




ENFOCAR



INVOLUCRAR / ENTRELAZAR

Margarita Safdie

52

ENFOCAR

1.Involucrar La base relacional
2.ENFOCAR ATENCIN ESTRATGICA
Establecer la AGENDA
Encontrar un punto de enfoque
Informacin y sugerencias

Margarita Safdie

53

Estableciendo la Agenda

Indagar la agenda del cliente


Qu te trae hoy por aqu?
Qu te es importante que revisemos hoy?
En qu te puedo ayudar hoy?
PREGUNTA MILAGROSA
Ofrecer un men
Pedir permiso para sugerir la agenda
Te parecera bien si tambin hablamos de . . .?
Margarita Safdie

54

IMPARCIALIDAD


Decisin consciente del profesional de
NO tratar de inuenciar la direccin,
decisin o cambio del cliente, sobre el
obje4vo de cambio o la forma de
alcanzarlo
Margarita Safdie

55

Cuatro Procesos Fundamentales





PLANEAR



EVOCAR




ENFOCAR



INVOLUCRAR / ENTRELAZAR

Margarita Safdie

56

EVOCAR

1. Involucrar La base relacional
2.Enfocar ATENCIN ESTRATGICA
3.EVOCAR La transicin a la EM
Reconocer la DISCURSO DE CAMBIO
Evocarlo
Responder estratgicamente para fortalecerlo

Margarita Safdie

57

RECONOCIENDO EL DISCURSO DE CAMBIO



Razones para perderla de vista No escuchar Enfoque
en el experto
Ocupado obteniendo informacin
En una bsqueda para probar un punto o
hiptesis
Monlogo del cliente
No reconocerla
No saber cmo responder ante ella
Margarita Safdie

58

Cuatro Procesos Fundamentales





PLANEAR



EVOCAR




ENFOCAR



INVOLUCRAR / ENTRELAZAR

Margarita Safdie

59

PLANEAR

1.Involucrar La base relacional
2.Enfocar ATENCIN ESTRATGICA
3.Evocar La transicin a la EM
4.PLANEAR
Negociacin de un Plan de Cambio
Consolidacin del Compromiso

Margarita Safdie

60


Negociando un Plan de Cambio
RECONOCIENDO LA DISPOSICIN PARA CAMBIAR:
Disminucin del discurso de permanencia y la defensividad
(discordancia)
Disminucin de la discusin o preguntas sobre el problema
Resolucin a favor al cambio
OJO con:
DISCURSO DE CAMBIO
Subes.macin de la
ambivalencia
Preguntas sobre el cambio
Dar sugerencias de
ms
Visualizacin
Direccin insuciente
Experimentacin / toma de pasos

Margarita Safdie

61


Negociando un Plan de Cambio y Fortaleciendo
el Compromiso
Iniciar Recapitulacin y p regunta clave para tantear

el agua
Reforzar la conanza Preguntas clave para evocar y
negociar
Dar informacin y sugerencias con permiso
Negociando un Plan de Cambio
Especicar metas
Considerar las opciones de cambio
Concretar el plan: Evaluar cursos alterna4vos de accin
Hacer surgir y reforzar el COMPROMISO
Margarita Safdie

62

Muchas Gracias
Preguntas ?
Margarita Safdie MSc, PhD
msafdie@hotmail.com

Gua de Desarrollo
Mdulo II: Actividad fsica para nios y adolescentes
I. Introduccin

La obesidad asociada con el sedentarismo y malos hbitos alimentarios, actualmente, es


una epidemia global. Lo ms preocupante es que estos hbitos se establecen e inician en
la mayora de los casos durante la niez y la adolescencia. Nios y adolescentes que al
llegar a su vida adulta, o a veces antes, presentan co- morbilidades que disminuyen la
calidad de vida e incrementan el costo de la atencin de salud en los pases.

De las diferentes alternativas que se han creado para el tratamiento de la obesidad, la


actividad fsica representa un factor fundamental, el cual debe ser confeccionado segn
la edad del nio o adolescente. Otra ventaja de la actividad fsica en este grupo de edad,
en forma de juego o actividad fsica estructurada, es que contribuye con el desarrollo.

En el presente mdulo se iniciar con la revisin de la epidemiologa de la obesidad, la


importancia de la actividad fsica como medida teraputica, las recomendaciones
internacionales de actividad fsica, la evidencia cientfica sobre la eficacia de los
programas e intervenciones de actividad fsica y finalizar con recomendaciones
prcticas de tipo de actividades a incluir en un programa de actividad fsica para nios y
adolescentes.

II. Competencia

Al finalizar el mdulo el participante ser capaz de disear diferentes tipos de


actividades fsicas como medida efectiva del abordaje clnico del nio con sobrepeso u
obesidad.

III. Objetivos especficos

Al finalizar este mdulo usted podr:


1.

Describir la epidemiologa y fisiopatologa de la obesidad y el rol de la


actividad fsica para lograr el balance energtico

2. Identificar los beneficios y las recomendaciones de la actividad fsica


3. Efectuar la evaluacin de la condicin fsica a nivel individual
4. Disear diferentes tipos de actividades fsicas con fines preventivos
5. Utilizar actividades adecuadas para el diseo de un programa de

actividad fsica para el control del sobrepeso y la obesidad en nios

IV. Contenidos
a. Tema 1: Epidemiologa y fisiopatologa de la obesidad y la influencia de

la actividad fsica

Lecturas bsicas

Ramrez-Zea, M. Epidemiologa de la obesidad en la niez y rol de la


actividad fsica en su fisiopatologa. Guatemala, 2013.

Sinopsis: En este documento se describe la situacin epidemiolgica de la


obesidad en la niez en la regin centroamericana y Repblica Dominicana,
los factores causantes directos y los determinantes, las consecuencias de la
obesidad en la niez y una breve introduccin a su prevencin y manejo
clnico.

Atlantis, E, Barnes EH, Fiatorone Singh, MA. Efficacy of exercise for


treating overweight in children and adolescents: a systematic review.
International Journal of Obesity (2006) 30, 10271040.

Sinopsis: Este artculo presenta una revisin sistemtica sobre la eficacia del
ejercicio como tratamiento de nios/adolescentes con sobrepeso realizada en
el 2004. Como conclusin, se logr observar una disminucin en el
porcentaje de grasa corporal a dosis altas de ejercicio (150-188 min/semana)
de intensidad moderada-alta en nios /adolescentes con sobrepeso; aun
cuando el nmero de estudios incluidos, cuyo diseo es robusto, fue
pequeo. Resultados sobre la eficacia en reduccin de peso corporal y
obesidad central son inconclusos.

b. Tema 2: Beneficios y recomendaciones de la actividad fsica en nios y

adolescentes y evaluacin de la condicin y actividad fsica.

Recursos bsicos:

Captulos 2 y 4: Recomendaciones mundiales sobre actividad fsica.


Organizacin Mundial de la Salud (OMS) 2010.

Sinopsis: En estos dos captulos del documento se presenta la importancia


de la salud fsica para la salud, la evidencia cientfica y las recomendaciones
de actividad fsica para nios de 5 17 aos de edad y su interpretacin y
justificacin.

Pate R, Oria, M, Pillsbury, L. Captulo 5: Fitness measures and health


outcomes in youth. Institute of Medicine (IOM). The National Academic
Press, Washington DC, USA, 2012.

Sinopsis: En este captulo se explora la relacin entre tests/ pruebas


especficas de campo para medir la resistencia cardiorespiratoria y los

resultados de salud en la juventud. La revisin literaria y recomendaciones


son brindadas por el Comit sobre medidas de aptitud y los resultados de
salud en la juventud del Institute of Medicine (IOM).

Video: Evaluacin de la condicin y actividad fsica del paciente


peditrico

Lecturas complementarias:

Bar-Or, O. Health benefits of physical activity during childhood and


adolescence. Series 2, number 4, of the PCPFS Research Digest. 1999.

Sinopsis: El propsito del artculo es examinar de forma breve la evidencia


existente para determinar si la actividad fsica mejorada durante la niez y la
adolescencia imparte beneficios de salud o reduce los factores de riesgo a
enfermedades crnicas en el adulto. Como conclusiones de la revisin se
obtuvieron que se requiere de mayor nmero de estudios a largo plazo para
establecer si la actividad fsica en la niez y adolescencia tiene un beneficio
en la salud del adulto y se observaron beneficios a corto plazo de nios y
adolescentes que tienen mayor riesgo de ECNT en una etapa posterior en la
vida.

Sirard, JR, Russell, P. Physical activity assessment in children and


adolescents. Sports Medicine 2001; 31 (6).

Sinopsis: Este artculo resume los puntos fuertes y las limitaciones de los
mtodos utilizados para evaluar la actividad fsica en nios y adolescentes.
Los resultados provienen de una revisin bibliogrfica realizada en
MEDLINE utilizando la observacin directa del movimiento individual
como el estndar de oro para medir actividad fsica.

Corbin, CB, Pangrazi, RP. Guidelines for appropriate physical activity


for elementary school children: 2003 Update

Sinopsis: Este documento constituye una declaracin de la posicin del


Consejo de Educacin Fsica para la Infancia (COPEC) de la Asociacin
Nacional para el Deporte y la Educacin Fsica, una asociacin de la
Alianza Americana para la Salud Educacin Fsica y Recreacin. En el
encontrar los lineamientos para actividad fsica apropiada para nios de
educacin primaria y su interpretacin, modelos de actividad fsica,
conceptos sobre el tema y recomendaciones para promover la actividad
fsica en escuelas, programas de educacin fsica y referencias
seleccionadas.

Weiss, MR. Motivating kids in physical activity. Research Digest, Vol.3


no.11, 2000.

Sinopsis: Este artculo adopta una postura de motivacin en la identificacin


de los factores que predicen fuertemente la actividad fsica en los nios. Se
presenta y discute un modelo sobre los factores que motivan a los nios y
jvenes a realizar actividad fsica. Adems, se proponen estrategias para
motivarlos a realizar actividad fsica basadas en mejorar la percepcin de
competencia, el apoyo social y el disfrute al realizar actividad fsica.

c. Tema 3: Programas de actividad fsica. Bases para la reduccin del

sedentarismo en nios y jvenes.

Lecturas bsicas:

Tarducci, G. Resumen del tema: Programas de actividad fsica para la


reduccin de la vida sedentaria.

Sinopsis: Este resumen tiene por objetivo brindar estrategias de promocin


de vida activa y caracterizar la actividad fsica de nios y jvenes, con el fin
de mejorar el abordaje preventivo de la obesidad a travs de mtodos no
farmacolgicos. El documento caracteriza la actividad de nios y la
actividad de adolescentes y enlista una serie de actividades propuestas para
cada grupo de edad.

Doak, C.M. et al. The prevention of overweight and obesity in children


and adolescents: a review of interventions and programmes. Obesity
reviews (2006)7, 111136.

Sinopsis: El presente artculo presenta una revisin de programas exitosos


para la prevencin de obesidad en los nios. La revisin se bas en
programas existentes a los cuales se evalu su efectividad, eficacia,
implementacin y la evaluacin de efectos adversos en estudios previos. La
revisin se limit a programas en escuelas con un anlisis cuantitativo que
utilizar resultados antropomtricos y que intervienen en el comportamiento
diettico y de actividad fsica.

d. Tema 4: Juegos y actividades sugeridas para programa de actividad

fsica

Lectura bsica:

Tarducci, G. Resumen del tema: Ejemplos de juegos dinmicos,


recreacin y actividad fsica adaptada.

Sinopsis: En este documento se presentan una serie de recomendaciones


prcticas para mejorar las habilidades de las personas que trabajan en
programas de actividad fsica y control del peso corporal. No es
tcnicamente un manual de actividades, sino una gua corta que oriente a las

personas que ejecutan programas de actividad fsica para la salud en nios y


jvenes.

Lectura complementaria:

Pecci, M.C.; Herrero, T., Lpez, M.; Mozos, A. Unidad 2: El juego en el


desarrollo infantil. Tcnico superior en Educacin Infantil. Reforma LOE.
CEO - El juego infantil y su metodologa. GS. Pgina 30 -50.

Sinopsis: En esta unidad se revisan la evolucin del juego durante el


desarrollo infantil, las aportaciones del juego a las dimensiones del
desarrollo y el papel del adulto en la estimulacin del juego.

Clasificacin de juegos. Madrid, Espaa 1992.

Sinopsis: En este resumen se presenta una clasificacin de juegos, su breve


descripcin y ejemplos de cada tipo. Adems, se concluye en la importancia
del juego para la adquisicin y el desarrollo de diferentes capacidades en la
esfera social del individuo.

Ministerio de Educacin. Primera parte: La importancia del juego libre


en el aprendizaje y el desarrollo infantil. La hora del juego libre en los
sectores. Una gua para educadores de servicios educativos de nios y
nias menores de 6 aos. Pginas 9-20. Biblioteca Nacional del Per, Per.

Sinopsis: En la primera parte de esta gua se presenta la evidencia cientfica


que sustenta el valor del juego para el desarrollo y el aprendizaje de los
nios. Se abordan los siguientes temas: La importancia del juego para los
nios pequeos, Relacin entre juego, aprendizaje y desarrollo infantil, A
qu se le llama juego?, los tipos de juego y la evolucin del juego durante
los primeros 6 aos de vida.

V. Actividades de Aprendizaje

Tema Actividad
Descripcin
Fecha
1
Revisin de Lecturas bsicas Revisar las lecturas bsicas y 25 - 1
complementarias (Ver referencia en diciembre
la seccin e contenidos).
1

de

Completar cuestionario

Contestar cuestionario disponible en 1 de diciembre


el aula virtual
Revisin de recursos bsicos Revisar
recursos
bsicos
y 2 8 de
complementarios (Ver referencia en diciembre
la seccin e contenidos).

Foro de discusin

Realizar aportes a foro de discusin 2 - 8


sobre recomendaciones de actividad diciembre
fsica en nios y adolescentes.

de

Revisin de lecturas

Revisar
lecturas
bsicas
y 9 15
complementarias (Ver referencia en diciembre
la seccin de contenidos).

de

Participar
virtual

Revisin de lecturas

en

conferencia Conferencia virtual en la cual el 12


expositor presentar en tiempo real diciembre
un tema que complementa lo
revisado por el estudiante con
anterioridad y se realiza un espacio
de consultas y recomendaciones al
experto al finalizar su presentacin.

Realizar las lecturas bsicas y 9 15


complementarias (Ver referencia en diciembre
la seccin de contenidos).

de

de

Elaborar
gua
recomendaciones
actividad fsica

de En esta actividad el participante 9 15


para plantear, disear, presentar y diciembre
comentar el material de otros
compaeros acerca de la elaboracin
de material educativo con mensajes
clave sobre recomendaciones de
actividad fsica para nios. El
material educativo podr ser digital
o audiovisual, el cual se disear
para su inmediata implementacin
en el mbito de desempeo de los
participantes. Adems, lo compartir
con el resto de compaeros en la
galera del aula virtual

de

VI. Conferencia Virtual

Conferencia virtual: Actividad fsica como estrategia de abordaje de la


obesidad en la niez
Fecha: mircoles 9 de diciembre 2015
Hora: 7:00 a 8:00 pm (Hora Centroamrica)
Sala Blackboard: Sala 4 (participantes)

Conferencista:
Gabriel Tarducci, MSc, PhD Profesor titular de la Universidad de ISALUD y de
la Universidad Nacional de La Plata en Argentina. El doctor Tarducci se
concluy recientemente el programa de doctorado en la Universidad de A
Corua, Espaa, Facultad de Educacin Fsica y en la Universidad de Buenos
Aires, Facultad de Farmacia y Bioqumica, rea Nutricin Humana. Ha
impartido numerosos cursos sobre actividad fsica y salud y tiene ms de 20

10

publicaciones en el tema. Ha sido colaborador de la Red de Actividad Fsica de


las Amricas, iniciativa del Center for Disease Control /World Health
Orgnization, e integrante del Consejo Asesor de la Organizacin Salud en
Familia de Espaa.

VII.

Evaluacin
En el siguiente cuadro se detalla la valoracin asignada a cada actividad del
mdulo:
Tema Actividad
1
2
3y4

Cuestionario
Foro
Gua de recomendaciones

Valoracin
6
14
15

Epidemiologadelaobesidadenlaniezyroldelaactividadfsicaensu
fisiopatologa
Autor:ManuelRamrezZea
Laobesidadenlaniezylaadolescenciaesunproblemadesaludpblicaserioanivel
mundial,incluyendolaregindeCentroAmricayRepblicaDominicana.Lapandemiade
obesidadsehaextendidoapasoaceleradoenlasltimas2a3dcadasentodoslosgruposde
edad,socioeconmicos,tnicosyenreasurbanasyrurales.Alrededorde43millonesde
niosmenoresde5aostenansobrepesoyobesidaden2010entodoelmundo,unaumento
de60%desde1990.Treintaycincomillonesdeesosnios(81%)vivanenpasesen
desarrollo.1
Laprevalenciadesobrepesoenniosmenoresde5aosvaraentre4.9y11.3%enlaregin
deCentroAmricayRepblicaDominicana(Figura1),deacuerdoalosdatosdelasencuestas
nacionalesmsrecientesrealizadasentre2005y2011.Laprevalenciaesmsaltaenreas
urbanascomparadoconreasrurales(entre0.5y3.7puntosporcentuales).
Desafortunadamentenosecuentacondatosanivelnacionaldelasituacindeniosenedad
escolar,conexcepcindeCostaRicadondelaprevalenciaenlaencuestanacionaldenutricin
de200809paraniosentre5y12aosfuede21.4%(>85percentil),6.5puntosporcentuales
msaltoqueenlaencuestaanteriorde1996.2Lasituacinfuesimilarenniosentre13y19
aos(prevalenciade20.8%).Esdecir,laprevalenciadeobesidadaumentaconlaedadyes
muyprobablequelasituacinenelrestodepasesdelareginseasimilar.
Figura1.PrevalenciadesobrepesoenlospasesdeCentroAmricayRepblicaDominicanaen
niosmenoresde5aos,segnelindicadorpesoparatalla>2Z,usandolosdatosde
referenciadeOMS.
12,0

11,3

10,0
8,3

8,1

8,0

7,9
6,2

6,0

5,8

5,7
4,9

4,0

2,0

0,0
PAN08*

DOR07

COR0809

BEL11

NIC0607 HON0506

ELS08

GUT0809

Fuente:WHOglobaldatabaseonchildhoodgrowthandmalnutrition(http://www.who.int/nutgrowthdb/database/en/)

Inclusoenpasesdondeanlaprevalenciadedesnutricincrnicaeselevada,comoelcasode
Guatemala,seestdandolacoexistenciadeproblemasnutricionales,causandounadoble
cargademalnutricinaniveldepas,hogaryhastaindividual.3Utilizandolosdatosdela
ltimaencuestanacional,20%dehogaresenGuatemalaconviveunniomenorde5aosde

edadcondesnutricincrnicayunamadreconsobrepesouobesidad.Adems,elproblemaes
anmsgraveenhogaresindgenas,dondelaprevalenciadehogarescondoblecargade
malnutricinesde28%.4

Factorescausalesdirectosydeterminantes
Laobesidadesunacondicinmultifactorialdefinidacomolaacumulacinexcesivade
depsitosdegrasacorporal,lacualescausadaporundesbalanceenergticopositivo(cuando
laingestadeenergaexcedeelgastoenergtico).5Individuosconpesonormaltienen
alrededorde25,000millonesdeadipocitos,mientrasqueaquellosconobesidadextrema
puedenllegaratenerentre60y80,000millones.Elaumentoenelnmerodeadipocitos
(hiperplasia)seempiezaadardesdelos12mesesdeedadycontinaduranteelcrecimiento.6
Elbalancepositivodeenergaeselresultadodefactoresgenticos,decomportamiento,
sociales,ambientalesyeconmicosydelascomplejasinteraccionesentreellos.7Unodelos
factoresmsimportantesqueestnmanejandolapandemiadeobesidad,incluyendolosnios
yadolescentes,eslaexposicinaunambienteobesognico.Dichoambientesecaracterizapor
permitirelfcilaccesoyexposicinconstanteaalimentosenergticamentedensosconalto
contenidodegrasasyazcaressimplesyporpromoverlavidasedentaria,relacionadaala
rpidaurbanizacinycrecimientodelapoblacinurbana,conunafaltadeplaneamientode
reasverdesylugaresderecreacin,lapromocindelusodemediosdetransporte
motorizadoyelaumentodetiempodedicadoavertelevisinyajuegosdevideo.8,9Estos
factorescausalesydeterminantessongeneralesencualquierpoblacin;desafortunadamente
nosecuentaconinformacinsobreculessonmsimportantesenlasdiferentespoblaciones
delospasesdelaregin.
Laprescripcindeejercicioesunaintervencinqueaumentaelgastoenergtico,preservala
masalibredegrasa(incluyehuesosymsculoesqueltico)yesefectivaparalareduccindela
grasacorporal.Laprescripcinde150a180minutossemanalesdeejercicioaerbicode
intensidadmoderadaafuerteesefectivaparareducirlagrasacorporalenniosy
adolescentesconsobrepeso.10Asuvez,esimportantereducireltiempoenactividades
sedentarias(e.g.,tiempofrenteaunmonitor),dadoquetodomovimientocuentayeltiempo
queunnioestsentadooacostado(gastocalricomnimo)debereducirsealmnimo
necesario.Eltiempomximoaldafrenteaunmonitordebesermenorde2horasaldaen
niosyadolescentes.
Sedebetomarencuentaquelosniosnosonunminiadulto,siendosusrespuestasal
ejercicioparticulares.Larespuestadelafosfocreatina(paraactividadesmuyintensasyde
cortaduracin)essimilaraladelosadultos.Tieneninmadurezdelsistemaanaerbico
(gluclisis).Estnbienadaptadosparaactividadesaerbicas.Usanlagrasacomosustratoen
mayorproporcinquelosadultos.Suactividadfsicahabitualtienepocaoningunarelacin
consucapacidadaerbica.Tienenmenorcapacidadparadisiparcalor.6
Losfactorescausalesdirectosdelaobesidadsonlosmaloshbitosalimenticiosquellevana
unaingestacalricaaltaylafaltadeactividadfsicadiaria.Esosfactoresderiesgo
conductualespuedenreducirseoeliminarsey,porende,sepuededecirqueelrpido
crecimientoenlaprevalenciadeobesidadenelmundoesaltamenteprevenible.11Sin
embargo,tratndosedeunproblematancomplejo,conmltiplesdeterminantesambientales
ysocioeconmicosyconconsecuenciastanprofundas,serequieredelacooperacin,

compromisoyvoluntaddetodoslossectoresdelasociedad(gobiernos,comunidad
internacional,accionistasdeempresasdealimentosybebidas,ONGsypblicoengeneral
entreotros)paraestablecerycumplirconlaspolticasyregulacionesdirigidasaproporcionar
unaalimentacinsaludableyaumentodeactividadfsicaenlapoblacin.Esesencialqueesos
estilosdevidasaludablesseconviertanenlasopcionesmssaludablesyfavorablesala
poblacinencuantoaaccesibilidad,disponibilidadyasequibilidad.9
Consecuenciasdelaobesidadenlaniez
Laobesidadesunaenfermedadrelacionadaconlanutricinqueaumentaelriesgodepadecer
enfermedadescrnicasnotransmisibles(ECNT),siendounfactorderiesgoparaeldesarrollo
dediabetestipo2,hipertensinarterial,dislipidemias,enfermedadescardiovascularesy
ciertostiposdecncer,entreotrasenfermedades.En2004seestableciquelaobesidadesel
quintofactorderiesgoquemsmuertescausaanivelmundial,instalndosedesdemuy
tempranaedad.12
Laobesidadyelsobrepesoylasconsecuenciasdesaludasociadasaestascondiciones,
tambinprovocanproblemasalaeconomadelpas,yaquepresentancargasfuertesalos
sistemasdesaludalincrementarseelcostodeatencinmdicaparapersonasobesas.Se
calculaqueelcostomdicodeunapersonaobesaes25%msaltoqueeldeunapersonacon
pesonormal,ydichocostoaumentamientrasmsobesosevuelveelindividuo.13
Prevencinymanejoclnico
Sesabequeentrminosdesaludpblica,laobesidadpuedeprevenirseendistintosniveles:a
nivelindividual,laspersonaspuedenreducirsuingestadegrasasyazcar,aumentarlaingesta
defrutasyverdurasyaumentarsuactividadfsicadiaria;yanivelpoblacional,dondese
requieredelsoportedelsectorpblicoyprivadoparaquelosindividuoscuentenconopciones
adietassaludablesyposibilidadesdeteneraccesoyfacilidadaunavidaconactividadfsica
regular.
Encuantoalaprevencinaniveldesaludpblica,laevidenciacientficamuestraqueexisten
variasintervencionesparaprevenirlaobesidadenniosyadolescentes.Dichasintervenciones
tienencomoobjetivoprincipalelmodificarlosmaloshbitosalimenticiosyaumentarla
actividadfsicadelapoblacin.14Estasintervencionesvarangrandementedependiendodel
lugardondeserealizan(e.g.,hogar,escuela)yeltipodeestrategiautilizadaencadalugar(e.g.,
modificacinalimenticia,promocindeactividadfsica).
Porotrolado,cabemencionarquelaindustriadealimentosybebidastambinjuegaunpapel
importanteenlaprevencindelaobesidad.Existencompromisosporpartededichaindustria
decubrirtemasdenutricinresponsabledentrodesuspolticasinternasdeproducciny
comercializacindeproductos.9Losgobiernosporsuparte,tienenlaobligacinticaymoral
develarporlasaluddelapoblacin,porloqueesdevitalimportanciaquelaspolticasy
regulacionesestablecidasparaprevenirlaobesidad,queenmuchoscasosenvuelven
directamentealaindustriadealimentosybebidas(regulacindelapublicidaddealimentos
pocosaludables,etiquetadonutricional,autoregulacinempresarialymedidasfiscales),sean
agresivasyestrictasyquesemonitoreesuimplementacincontinuayadecuada.
Tambinesimportantemencionarquehaysituacionesdondeserequierenosolamentede
estrategiasdeprevencindelaobesidadyelsobrepeso,sinotambinurgecontarconla
informacinrelevanteyactualizadareferentealtratamientoclnicodedichascondiciones.En

otraspalabras,serequieredeguasparapodertratarcorrectamentealosindividuosqueya
presentanobesidadosobrepeso,encuyocasoelobjetivoprincipaleslaprdidadepesoa
travsdeestrategiasdemodificacindelcomportamiento,aumentodelaactividadfsicayen
algunoscasos,tratamientofarmacolgicoy/oquirrgico.

Referencias

deOnisM,BlossnerM,BorghiE.Globalprevalenceandtrendsofoverweightandobesityamong
preschoolchildren.AmJClinNutr.2010;92:125764.
2
http://www.paho.org/cor/index.php?option=com_docman&task=doc_view&gid=67&Itemid=
3
LeeJ,HouserRF,MustA,deFulladolsaPP,BermudezOI.Disentanglingnutritionalfactorsand
householdcharacteristicsrelatedtochildstuntingandmaternaloverweightinGuatemala.EconHum
Biol.2010;8:18896.
4
RamirezZeaM.Datosnopublicados.
5
OMS.MarcoparaelSeguimientoyEvaluacindelaAplicacin.EstrategiaMundialdelaOMSsobre
RgimenAlimentario,ActividadFsicaySalud;2009.Disponibleen:
http://www.who.int/dietphysicalactivity/M&ESP09.
6
PowersSK,HowleyET,eds.Exercisephysiology:Theoryandapplicationtofitnessandperformance.
Sixthedition.2007.
7
PerezLG,ArredondoEM,ElderJP,BarqueraS,NagleB,HolubCK.EvidenceBasedObesityTreatment
InterventionsforLatinoAdultsintheU.S.ASystematicReview.AmJPrevMed2013;44(5):550560
8
LaCartadeTorontoparalaActividadFsica:UnllamadoGlobalparalaAccin;2010.Disponibleen:
http://www.icpaph2010.org
9
WHO.Obesityandoverweight.FactsheetNo.311;2013.Disponibleen:
http://www.who.int/mediacentre/factsheets/fs311/en/index.html
10
Atlantis,E.;Barnes,E.H.,andSingh,M.A.Efficacyofexercisefortreatingoverweightinchildrenand
adolescents:asystematicreview.IntJObes(Lond).2006Jul;30(7):102740.
11
ThomasB,GostinLO.TacklingtheGlobalNCDCrisis:InnovationsinLawandGovernance.JLawMed
Ethics.2013Disonibleen:http://scholarship.law.georgetown.edu/facpub/1205
12
WHO.Globalhealthrisks:mortalityandburdenofdiseaseattributabletoselectedmajorrisks.WorldHealth
Organization2009.
13
SassiF.ObesityandtheEconomicsofPrevention.FitnotFat.Disponibleen:http://www.oecd.org
HealthHealthpoliciesanddata
14
AgencyforHealthcareResearchandQuality.EffectiveHealthCareProgram.ChildhoodObesity
PreventionPrograms:ComparativeEffectivenessReviewandMetaAnalysis.ExecutiveSummary;2013.
Disponibleen:http://effectivehealthcare.ahrq.gov

Recomendaciones mundiales sobre actividad fsica para la salud

ACTIVIDAD FSICA PARA LA SALUD


9

2.1
Importancia de la
actividad fsica para
la salud pblica

La inactividad fsica constituye el cuarto factor de riesgo ms importante de


mortalidad en todo el mundo (6% de defunciones a nivel mundial). Slo la
superan la hipertensin (13%), el consumo de tabaco (9%) y el exceso de glucosa
en la sangre (6%). El sobrepeso y la obesidad representan un 5% de la mortalidad
mundial (1).
La inactividad fsica est cada vez ms extendida en muchos pases, y ello
repercute considerablemente en la salud general de la poblacin mundial, en
la prevalencia de ENT (por ejemplo, enfermedades cardiovasculares, diabetes o
cncer) y en sus factores de riesgo, como la hipertensin, el exceso de glucosa en
la sangre o el sobrepeso. Se estima que la inactividad fsica es la causa principal
de aproximadamente 2125% de los cnceres de mama y de colon, 27% de
la diabetes, y aproximadamente un 30% de las cardiopatas isqumicas (1).
Adems, las ENT representan actualmente casi la mitad de la carga mundial total
de morbilidad. Se ha estimado que, de cada 10 defunciones, seis son atribuibles a
enfermedades no transmisibles (2).
La salud mundial acusa los efectos de tres tendencias: envejecimiento de la
poblacin, urbanizacin rpida y no planificada, y globalizacin, cada una de las
cuales se traduce en entornos y comportamientos insalubres. En consecuencia,
la creciente prevalencia de las ENT y de sus factores de riesgo es ya un problema
mundial que afecta por igual a los pases de ingresos bajos y medios. Cerca de un
5% de la carga de enfermedad en adultos de esos pases es hoy imputable a las
ENT. Numerosos pases de ingresos bajos y medios estn empezando a padecer
por partida doble las enfermedades transmisibles y las no transmisibles, y los
sistemas de salud de esos pases han de afrontar ahora el costo adicional que
conlleva su tratamiento.
Est demostrado que la actividad fsica practicada con regularidad reduce el
riesgo de cardiopatas coronarias y accidentes cerebrovasculares, diabetes de
tipo II, hipertensin, cncer de colon, cncer de mama y depresin. Adems, la
actividad fsica es un factor determinante en el consumo de energa, por lo que es
fundamental para conseguir el equilibrio energtico y el control del peso (16).

2.2
Mandato en materia
de actividad fsica
para la salud

En mayo de 2004 la Asamblea Mundial de la Salud respald la resolucin


WHA57.17: Estrategia Mundial sobre Rgimen Alimentario, Actividad Fsica y
Salud (RAFS) (5), y recomend que los Estados Miembros desarrollaran planes de
accin y polticas nacionales para incrementar los niveles de actividad fsica de
sus poblaciones (5). Adems, en mayo de 2008 la sexagsima primera Asamblea
Mundial de la Salud respald una resolucin y plan de accin sobre prevencin y
control de las ENT (7).
El plan de accin insta a los Estados Miembros a aplicar directrices nacionales
sobre actividad fsica para la salud, y los alienta a desarrollar y poner en prctica
polticas e intervenciones que:


desarrollen y pongan en prctica directrices nacionales sobre actividad fsica


para la salud;
introduzcan polticas de transporte que promuevan mtodos activos y seguros
de transporte escolar y laboral (por ejemplo, a pie o en bicicleta);
obliguen a adaptar las estructuras urbanas para facilitar la actividad fsica
en los desplazamientos en condiciones de seguridad, y para crear espacios
destinados a las actividades recreativas.

El plan de accin insta a la OMS a prestar a los pases apoyo tcnico con el fin de
emprender o reforzar las iniciativas nacionales encaminadas a reducir los factores
de riesgo de ENT.

10

Recomendaciones mundiales sobre actividad fsica para la salud

2.3
Importancia de
las directrices
nacionales y
regionales sobre
actividad fsica

La existencia, en los pases de ingresos bajos y medios, de un nmero limitado de


directrices de mbito nacional sobre actividad fsica para la salud, la importancia
de la actividad fsica para la salud pblica y los mandatos mundiales recibidos
por la OMS en ese sentido para promover la actividad fsica y la prevencin de
las ENT evidencian la necesidad de elaborar unas recomendaciones mundiales
que aborden los vnculos entre la frecuencia, la duracin, la intensidad, el tipo y
la cantidad total de actividad fsica necesaria para prevenir las ENT.
Las recomendaciones mundiales fundamentadas cientficamente acerca de
los beneficios, modalidades, asiduidad, frecuencia, intensidad, duracin y
cantidad total de actividad fsica necesaria para mejorar la salud constituyen
una informacin esencial para los responsables de polticas que se interesan
por la actividad fsica a nivel de la poblacin y que participan en la elaboracin
de directrices y polticas de alcance regional y nacional sobre la prevencin y
control de las ENT.
El desarrollo y publicacin de directrices nacionales o regionales fundamentadas
cientficamente en materia de actividad fsica permite:







fundamentar las polticas nacionales sobre actividad fsica y otras


intervenciones de salud pblica;
determinar un punto de partida para la definicin de metas y objetivos de
promocin de la actividad fsica a nivel nacional;
fomentar la colaboracin intersectorial, y contribuir al establecimiento de
metas y objetivos nacionales de promocin de la actividad fsica;
sentar las bases para la adopcin de iniciativas de promocin de la actividad
fsica;
justificar la asignacin de recursos a las intervenciones de promocin de la
actividad fsica;
crear un marco de accin comn que rena a todas las partes interesadas en
torno a un mismo objetivo;
disponer de un documento basado en evidencia que permita a todas las
partes interesadas llevar a efecto sus polticas con una asignacin apropiada
de los recursos; y
facilitar la creacin de mecanismos nacionales de vigilancia y monitorizacin,
para seguir de cerca la evolucin de la actividad fsica en la poblacin.

11

Recomendaciones mundiales sobre actividad fsica para la salud

NIVELES DE ACTIVIDAD FSICA


PARA LA SALUD RECOMENDADOS
A LA POBLACIN
15

4.1
Introduccin

En la seccin siguiente se indican los niveles recomendados de actividad fsica


para tres grupos de edades: de 5 a 17 aos, de 18 a 64 aos y de 65 aos en
adelante. Estos grupos han sido seleccionados tomando en cuenta la naturaleza
y disponibilidad de evidencia cientfica relacionada con los aspectos de salud
seleccionados. Las recomendaciones no hacen referencia al grupo de edades de
menores de cinco aos. Aunque la actividad es beneficiosa para ellos, es necesario
investigar ms a fondo para determinar la dosis de actividad fsica que reportara
el mximo beneficio para la salud.
Cada seccin contiene:



observaciones sobre la poblacin destinataria;


un resumen descriptivo de la evidencia cientfica;
recomendaciones sobre la actividad fsica para la salud;
interpretacin y justificacin de las recomendaciones expuestas.

Las recomendaciones sobre actividad fsica para la salud revisten inters respecto
de los aspectos siguientes:





Salud cardiorrespiratoria (cardiopata coronaria, enfermedad cardiovascular,


accidente cerebrovascular, hipertensin).
Salud metablica (diabetes y obesidad).
Salud del aparato locomotor (salud sea, osteoporosis).
Cncer (cncer de mama, cncer de colon).
Salud funcional y prevencin de cadas.
Depresin.

En las Recomendaciones mundiales sobre actividad fsica para la salud se ha hecho


uso de los conceptos de frecuencia, duracin, intensidad, tipo y cantidad total
de actividad fsica necesaria para mejorar la salud y prevenir las ENT. El recuadro
1 contiene definiciones de estos y otros conceptos tiles. Se encontrar ms
informacin en el glosario del apndice 5.

Recuadro 1. Definicin de conceptos utilizados en la descripcin


de los niveles de actividad fsica recomendados
Tipo de actividad fsica (qu tipo). Forma de participacin en la actividad fsica. Puede ser de
diversos tipos: aerbica, o para mejorar la fuerza, la flexibilidad o el equilibrio.
Duracin (por cuanto tiempo). Tiempo durante el cual se debera realizar la actividad o ejercicio.
Suele estar expresado en minutos.
Frecuencia (cuantas veces). Nmero de veces que se realiza un ejercicio o actividad. Suele estar
expresado en sesiones, episodios, o tandas por semana.
Intensidad (Ritmo y nivel de esfuerzo que conlleva la actividad). Grado en que se realiza una
actividad, o magnitud del esfuerzo necesario para realizar una actividad o ejercicio.
Volumen (la cantidad total). Los ejercicios aerbicos se caracterizan por su interaccin entre la
intensidad de las tandas, la frecuencia, la duracin y la permanencia del programa. El resultado
total de esas caractersticas puede conceptuarse en trminos de volumen.
Actividad fsica moderada. En una escala absoluta, intensidad de 3,0 a 5,9 veces superior a la
actividad en estado de reposo. En una escala adaptada a la capacidad personal de cada individuo,
la actividad fsica moderada suele corresponder a una puntuacin de 5 o 6 en una escala de 0 a
10.
Actividad fsica vigorosa. En una escala absoluta, intensidad 6,0 veces o ms superior a la
actividad en reposo para los adultos, y 7,0 o ms para los nios y jvenes. En una escala adaptada
a la capacidad personal de cada individuo, la actividad fsica vigorosa suele corresponder a entre
7 y 8 en una escala de 0 a 10.
Actividad aerbica. La actividad aerbica, denominada tambin actividad de resistencia, mejora
la funcin cardiorrespiratoria. Puede consistir en: caminar a paso vivo, correr, montar en bicicleta,
saltar a la comba o nadar.

16

Recomendaciones mundiales sobre actividad fsica para la salud

GRUPO DE EDADES: DE 5 A 17 AOS


17

Poblacin
destinataria

Estas directrices son vlidas para todos los nios sanos de 5 a 17 aos, a menos
que su estado mdico aconseje lo contrario. Se alentar a los nios y jvenes
a participar en actividades fsicas que ayuden al desarrollo natural y sean
placenteras y seguras.
Siempre que sea posible, los nios y jvenes con discapacidades deberan cumplir
las recomendaciones. No obstante, convendra que consultaran a su dispensador
de atencin sanitaria para asegurarse de que conocen bien los tipos y cantidad
de actividad fsica apropiados para ellos, teniendo en cuenta su discapacidad.
Estas recomendaciones son aplicables a todos los nios y jvenes, con
independencia de su gnero, raza, etnicidad o nivel de ingresos. Sin embargo,
las estrategias de comunicacin o la forma de difusin y descripcin de las
recomendaciones pueden diferir, a fin de consiguir una eficacia mxima en
diversos subgrupos de poblacin.
Los niveles de actividad fsica recomendados para los nios y jvenes de este
grupo se aadirn a las actividades fsicas realizadas en el transcurso de la
actividad diaria habitual no recreativa.
Todos los nios y jvenes deberan realizar diariamente actividades fsicas en
forma de juegos, deportes, desplazamientos, actividades recreativas, educacin
fsica o ejercicios programados, en el contexto de la familia, la escuela y las
actividades comunitarias.
En el caso de los nios y jvenes inactivos, se recomienda aumentar
progresivamente la actividad hasta alcanzar los niveles indicados a continuacin.
Sera apropiado comenzar con pequeas dosis de actividad, para ir aumentando
gradualmente su duracin, frecuencia e intensidad. Hay que sealar tambin
que, si los nios no realizan actualmente ninguna actividad fsica, la prctica de
sta en niveles inferiores a los recomendados les reportar ms beneficios que
la inactividad.

Descripcin
resumida de la
evidencia cientfica
(911)

La evidencia cientfica disponible con respecto al grupo de edades de 5 a 17 aos


respalda la conclusin de que la actividad fsica reporta en general beneficios
fundamentales para la salud de nios y jvenes. Esta conclusin est basada en
los resultados de varios estudios, que han observado que el aumento de actividad
fsica estaba asociado a unos parmetros de salud ms favorables, y de trabajos
experimentales que han evidenciado una asociacin entre las intervenciones
de actividad fsica y la mejora de los indicadores de salud. Algunos de los
beneficios documentados son: mejora de la forma fsica (tanto de las funciones
cardiorrespiratorias como de la fuerza muscular), reduccin de la grasa corporal,
perfil favorable de riesgo de enfermedades cardiovasculares y metablicas,
mayor salud sea, y menor presencia de sntomas de depresin. (9-11)
La actividad fsica est relacionada positivamente con la salud cardiorrespiratoria
y metablica en nios y jvenes. Con el fin de examinar la relacin entre la
actividad fsica y la salud cardiovascular y metablica, el Grupo examin las
recensiones bibliogrficas de CDC (2008), Janssen (2007) y Janssen, y Leblanc
(2009). (9-11)
La relacin dosis-respuesta vincula el aumento de la actividad fsica a una mejora
de los indicadores de salud cardiorrespiratoria y metablica. En conjunto, la
evidencia observacional y experimental respalda la hiptesis de que una mayor
asiduidad e intensidad de la actividad fsica desde la infancia y a lo largo de la
vida adulta permite a las personas mantener un perfil de riesgo favorable y unas
menores tasas de morbilidad y de mortalidad por enfermedad cardiovascular
y diabetes mellitus de tipo 2 en algn momento de su vida. En conjunto, las
investigaciones parecen indicar que la prctica de actividad fsica moderada o

18

Recomendaciones mundiales sobre actividad fsica para la salud


vigorosa durante un mnimo de 60 minutos diarios ayuda a los nios y jvenes
a mantener un perfil de riesgo cardiorrespiratorio y metablico saludable. En
general, parece probable que un mayor volumen o intensidad de actividad fsica
reportar beneficios, aunque las investigaciones a este respecto son todava
limitadas. (9-11)
La actividad fsica est relacionada positivamente con la buena salud
cardiorrespiratoria en nios y jvenes, y tanto los preadolescentes como los
adolescentes pueden mejorar sus funciones cardiorrespiratorias con la prctica
del ejercicio. Adems, la actividad fsica est relacionada positivamente
con la fuerza muscular. Tanto en nios como en jvenes, la participacin en
actividades de fortalecimiento muscular dos o tres veces por semana mejora
considerablemente la fuerza de los msculos. Para este grupo de edades, las
actividades de fortalecimiento muscular pueden realizarse espontneamente en
el transcurso de los juegos en instalaciones apropiadas, trepando a los rboles, o
mediante movimientos de empuje y traccin. (9-11)
Los jvenes de peso normal que realizan una actividad fsica relativamente
intensa suelen presentar una menor adiposidad que los jvenes menos activos.
En los jvenes con sobrepeso u obesos, las intervenciones que intensifican la
actividad fsica suelen reportar efectos beneficiosos para la salud.
Las actividades fsicas que conllevan un esfuerzo seo mejoran tanto el contenido
en minerales como la densidad de los huesos. Determinadas actividades de
levantamiento de peso que influyen simultneamente en la fuerza muscular son
eficaces si se practican tres o ms das por semana. Para este grupo de edades,
las actividades de esfuerzo seo pueden formar parte de los juegos, carreras,
volteretas o saltos. Las publicaciones cientficas relacionadas con la fuerza
muscular y las pautas dosis-respuesta proceden de las recensiones bibliogrficas
de CDC (2008), Janssen (2007), y Janssen, Leblanc (2009).
En conjunto, la evidencia disponible parece indicar que la mayora de los nios
y jvenes que realizan actividad fsica moderada o vigorosa durante 60 o ms
minutos diarios podran obtener beneficios importantes para su salud. (9-11)
El perodo de 60 minutos diarios consistira en varias sesiones a lo largo del da
(por ejemplo, dos tandas de 30 minutos), que se sumaran para obtener la duracin
diaria acumulada. Adems, para que los nios y jvenes obtengan beneficios
generalizados habr que incluir ciertos tipos de actividad fsica en esas pautas de
actividad total (9-11). En concreto, convendra participar regularmente en cada
uno de los tipos de actividad fsica siguientes, tres o ms das a la semana:

ejercicios de resistencia para mejorar la fuerza muscular en los grandes


grupos de msculos del tronco y las extremidades;
ejercicios aerbicos vigorosos que mejoren las funciones cardiorrespiratorias,
los factores de riesgo cardiovascular y otros factores de riesgo de
enfermedades metablicas; actividades que conlleven esfuerzo seo, para
fomentar la salud de los huesos.

Es posible combinar estos tipos de actividad fsica hasta totalizar 60 minutos


diarios o ms de actividad beneficiosa para la salud y la forma fsica.
En el apndice 2 se encontrar una bibliografa detallada de los ttulos utilizados
por el Grupo para elaborar estas recomendaciones.

19

Recomendaciones

Para los nios y jvenes, la actividad fsica consiste en juegos, deportes,


desplazamientos, tareas, actividades recreativas, educacin fsica o ejercicios
programados, en el contexto de la familia, la escuela y las actividades comunitarias.
El Grupo examin las publicaciones anteriormente indicadas y recomend
que, con objeto de mejorar las funciones cardiorrespiratorias, la buena forma
muscular, la salud sea y los biomarcadores cardiovasculares y metablicos:

1. Los nios de 517 aos deberan acumular un mnimo de 60 minutos diarios de actividad fsica moderada o
vigorosa.
2. La actividad fsica durante ms de 60 minutos reporta beneficios adicionales para la salud.
3. La actividad fsica diaria debera ser, en su mayor parte, aerbica. Convendra incorporar actividades
vigorosas, en particular para fortalecer los msculos y los huesos, como mnimo tres veces a la semana.

Interpretacin y
justificacin

Hay evidencia concluyente de que la actividad fsica frecuente mejora


sustancialmente la forma fsica y el estado de salud de nios y jvenes. En
comparacin con los nios y jvenes inactivos, los que hacen ejercicio presentan
un mejor estado cardiorrespiratorio y mayor resistencia muscular, y una mejora
de su salud, y est suficientemente documentado que presentan menor grasa
corporal, un perfil de riesgo de enfermedad cardiovascular y metablica ms
favorable, una mejor salud sea, y una menor presencia de sntomas de ansiedad
y depresin.
La actividad aerbica debera constituir la mayor parte de la actividad fsica
diaria libremente escogida.
Estas recomendaciones representan el objetivo mnimo de actividad fsica diaria
para mejorar la salud y prevenir las ENT.
La adopcin de estas recomendaciones tiene un costo mnimo, fundamentalmente
relacionado con su adaptacin al entorno de cada pas y a sus modalidades de
comunicacin y difusin. Si se desea aplicar polticas integrales que faciliten
la consecucin de los niveles de actividad fsica recomendados, ser necesario
dedicar recursos adicionales.
Los beneficios de la actividad fsica y de la adopcin de estas recomendaciones
superan los posibles perjuicios. El riesgo existente puede reducirse
considerablemente incrementando progresivamente el nivel de actividad,
especialmente en nios inactivos.
Con el fin de reducir el riesgo de lesiones, se fomentar el uso de equipo de
proteccin (por ejemplo, un casco) en todos los tipos de actividad que pudieran
entraar ese riesgo (12).
Conviene sealar que, cuando la poblacin es fundamentalmente activa, las
directrices nacionales sobre actividad fsica no deberan promover un objetivo
que propicie una disminucin de los niveles actuales.

20

Tema 3
Programas de actividad fsica para la reduccin de la vida sedentaria
Autor: Gabriel Tarducci MSc. PhD.

I.

Introduccin

Desde hace algn tiempo, solo unas pocas dcadas (lo que en trminos de humanidad es
simplemente un suspiro), la vida ha ido cambiando dramticamente desde un contexto donde el
hombre dependi de la capacidad fsica para sobrevivir a otro altamente tecnificado, con
prescindencia casi total de movimientos corporales. Esta situacin, que a menudo parece
ventajosa, en realidad no lo es. Nuestro ser biolgico est diseado para el trabajo muscular. De
ello depende en gran medida el crecimiento, el desarrollo y el fortalecimiento del cuerpo (Deheer
1997). En apariencia, pero solo en apariencia, la gente es cada vez ms activa, concurre a parques
y gimnasios, practica deportes y se involucra en eventos masivos. La realidad es otra. A nivel
poblacional las personas son bsicamente sedentarias. Los nios, algo ms movedizos que los
adultos, igualmente son insuficientemente activos. La prueba es que la obesidad en nios y
jvenes va en aumento.
Este tiene por objetivo brindar estrategias de promocin de vida activa y caracterizar la actividad
fsica de nios y jvenes, con el fin de mejorar el abordaje preventivo de la obesidad a travs de
mtodos no farmacolgicos.
II.

Gasto de energa

Tradicionalmente se ha procurado lograr el equilibrio energtico entre ingesta de energa y gasto.


En nios, un componente importante del gasto est determinado por el anabolismo. Obviamente,
al estar en plena etapa de crecimiento y desarrollo, las reacciones anablicas, se llevan gran parte
del gasto total. Pero una parte del gasto total proviene (o debera provenir) de la actividad fsica.
Hay una relacin directa entre el porcentaje de energa gastada por la actividad fsica y la
prevencin de obesidad. Aprovechar cualquier oportunidad de la vida cotidiana para incrementar
el gasto de energa es siempre la opcin adecuada.
III.

Balance energtico

Existen dos formas de lograr el equilibrio de energa para evitar aumentar de peso y disminuir el
riesgo de sobrepeso u obesidad. Por un lado se puede disminuir la ingesta hasta que se equilibre
con el gasto. Como el gasto por lo general es muy poco debido a una vida extremadamente
sedentaria, entonces la ingesta debe reducirse al mnimo. Cualquier exceso por mnimo que sea,
se traduce en aumento de peso y de masa grasa. A esta estrategia podramos llamarla
conservadora.

Por otro lado, se puede lograr el equilibrio mediante el aumento del gasto de energa por la
actividad fsica. En estas condiciones, el eje de la estrategia pasa por el gasto de energa y no por la
ingesta. Incrementar la actividad fsica, obviamente se traduce en un gasto de energa mayor, pero
tambin produce un cambio en el componente del gasto. Mientas que en personas sedentarias el
principal gasto se debe al metabolismo basal y la termognesis, en personas activas, el
componente de actividad fsica del gasto aumenta en trminos relativos. Es decir, un porcentaje
mayor corresponde a este tem. Pero no ocurre solamente eso, sino que tambin, como
consecuencia de la actividad fsica y del gasto aumentado, se produce ms calor, lo que aumenta
la termognesis. Tambin la actividad fsica produce estrs mecnico (si es de suficiente
intensidad) lo que estimula la regeneracin de tejidos y con ello aumenta el gasto de energa por
anabolismo. Es decir, si una persona pasa de un estilo de vida sedentario a otro ms activo, los
cambios en el gasto de energa se potencian por los efectos directos e indirectos de la actividad.
Esto solo es posible mediante la actividad fsica. No existe estrategia farmacolgica o diettica que
logre estos beneficios.
Las actividades que se realizan con moderada o alta intensidad suelen producir grandes beneficios
sobre la grasa corporal, porque permiten mayor gasto de energa en la unidad de tiempo. Se ha
sealado que actividades de moderada o alta intensidad pueden producir una disminucin de la
masa grasa de forma significativa (Laguna 2013).
Lograr el equilibrio (o el balance negativo en el caso de nios obesos o con sobrepeso) tan
deseado mediante el incremento de la actividad fsica, es la mejor estrategia posible para el
abordaje de la obesidad infantil. Sin embargo esto de ninguna manera significa que se puede
descuidar la dieta. Lamentablemente, es muy fcil ingerir caloras y muy difcil gastarla en la
misma medida.
IV.

La actividad fsica en el nio

En el nio aparece el juego como motivador de muchas de sus conductas. La actividad ldica
forma parte de su mundo y condiciona en buena medida las posibilidades de aprendizaje. En el
mundo de la actividad fsica, los juegos dinmicos forman parte del gasto semanal de energa pero
lamentablemente, esto es cada vez menos frecuente, sobre todo en las ciudades. Los nios que
viven en zonas rurales suelen tener un patrn de actividad fsica ms elevado, entre otras cosas
por los juegos populares.
Pero hay que tener en cuenta que si bien el componente ldico es importante, hay que poder
manejar la intensidad y la duracin de las actividades de la forma ms adecuada para obtener
cambios en el nivel de adiposidad. En el cuadro siguiente se puede observar que si se mantienen
actividades lo ms intensas posibles se gastar ms energa y esto es independiente de la fuente
de combustible que se utiliza (Dodd 2007).

Otro punto a tener en cuenta es que las actividades reportadas mediante cuestionarios o
entrevistas suelen sobreestimar el gasto de energa en personas con sobrepeso. Por lo tanto es
importante, siempre que se pueda, utilizar mtodos para estimar el gasto de energa de la manera
ms fiable posible. Existen diferentes dispositivos que son simples y de bajo costo que pueden
utilizarse con la doble finalidad de medir el gasto y de estimular la realizacin de actividad fsica
(Sazonova 2011).
Las recomendaciones sobre actividad fsica en nios y jvenes se mantienen en 60 minutos de
actividad cada da de la semana. Inclusive este volumen podra incrementarse si el nio presenta
obesidad.
a. Caractersticas de la actividad fsica en el nio:

Basadas en juegos pre-deportivos


Poco sistemtica o no estructurada
Divertida
No competitiva en el sentido de que los adultos le dan a la competencia
Con reglas flexibles
Rica en demandas motrices, destrezas y habilidades
Preferentemente grupal
Incluyendo elementos como pelotas, aros, colchonetas y otros elementos de la naturaleza
como csped, rboles, accidentes del terreno, pendientes, etc.
De larga duracin con intensidades variables (Ej.: caminata o trote, seguido de carreras en
velocidad, fuerza de trepada, saltos en diferentes direcciones, lanzamiento de objetos,
etc.).

La actividad fsica forma parte de la vida cotidiana


Auto regulacin del esfuerzo

b. Caractersticas de la actividad fsica del adolescente:

Competitiva, deportiva
Asistemtica con cierta planificacin del entrenamiento
Con reglas claras
Grupal o individual
En lugares abiertos
Con alta exigencia metablica y de fuerza
Se recomiendo actividad fsica de modera a alta intensidad
De alto impacto (evitando lesiones)
El programa de actividad fsica se presenta como algo estructurado que se realiza
especialmente para producir adaptaciones (a diferentes niveles orgnico, estructural,
social, afectivo, etc.)
Esfuerzo programado

c. Actividades propuestas:

Actividades en grupo. En nios, juegos pre-deportivos, sin competencia formal. En pberes


deportes, juegos, vida en la naturaleza, excursiones, etc. Este tipo de actividades
realizadas en grupo siempre tienden a ser ms placenteras y se mantienen en el tiempo.
Los grupos de pertenencia adems, ayudan a disminuir la carga que significa destinar
tiempo semanal a la prctica de una actividad sistemtica.

Actividades escolares curriculares (Crdova 2013). La Educacin Fsica escolar es una


buena ocasin para incrementar el gasto de energa a travs de actividades formativas
sistemticas. Dependiendo de la realidad de cada regin, se deberan trabajar para
incrementar la cantidad de horas dedicadas a esta asignatura escolar. Esto est sealado
incluso por la Estrategia mundial de la OMS sobre rgimen alimentario, actividad fsica y
salud.

Actividades extracurriculares en el mbito escolar. Existe evidencia de que las escuelas


abiertas a la comunidad (Dobbins 2013) pueden cumplir un rol importante asociado a la
prctica deportiva en nios y jvenes. Generalmente, estas actividades son fciles de
implementar porque las escuelas estn ubicadas en barrios cercanos a las viviendas de los

chicos, son de bajo costo porque no requieren inversin en instalaciones y los materiales
deportivos suelen estar disponibles en la institucin.

Actividades en familia. Normalmente, cuando un nio presenta sobrepeso u obesidad


convive con otros miembros de su familia que estn en las mismas condiciones, o al
menos comparten el estilo de vida. Es muy probable que viva en un entorno poco
saludable. Del mismo modo, es probable que el grupo familiar tenga hbitos sedentarios.
La actividad fsica compartida entre padres e hijos, suele ser ms animada, motivadora y
facilita el espacio de encuentro familiar (Maffeis 1998). La falta de tiempo, suele ser la
excusa ms utilizada para justificar la falta de actividad fsica sistemtica. Si se proponen
actividades en familia el tiempo rinde mucho ms, porque los minutos y horas de actividad
son adems, tiempo compartido. Incluso, cuando la actividad se practica en familia, es
posible llevar un mejor control de la cantidad e intensidad de esa actividad. Los nios de
edad escolar, suelen responder bien a la propuesta de salir con los padres. La bicicleta, las
caminatas y la vida en la naturaleza son actividades que demandan importante gasto
energtico y pueden ser suficientemente divertidas para todos.

Con referentes de pares u adultos. Los adolescentes buscan referentes entre pares, por lo
cual es importante buscar un grupo de pertenencia donde sea habitual la prctica
deportiva (por ej. Clubes deportivos o asociaciones de fomento, grupos parroquiales, etc.).
Una figura adulta, diferente a los padres, tambin puede asumir el rol motivador para
realizar actividad fsica.

Reduzca al menos una hora diaria el tiempo de los nios frente al televisor o las
computadoras. Se sabe que una reduccin de al menos una hora diaria frente al TV implica
una elevacin del gasto de energa que aunque no sea significativa en trminos de balance
energtico, s lo es para iniciar un cambio de estilo de vida y romper el crculo del
sedentarismo. Justamente se trata de quebrar el estado sedente tantas veces como sea
posible durante el da (Gonzlez-Gros 2013).

Recuerde: a pesar de que los nios aparentemente son inquietos y se mueven, esta cantidad de
movimiento es insuficiente para compensar la dieta inadecuada. Pero sera un error comenzar por
restringir la dieta, sin antes, incrementar el gasto de energa.
Importante: si el nio tiene hbitos sedentarios y pasa muchas horas frente al TV, la mejor
estrategia es ir paso a paso, modificando paulatinamente las costumbres. Nadie pasa de
sedentario a muy activo de un da para el otro, y nuestros nios tampoco.

IV. Conclusin
El balance energtico se logra equilibrando la ingesta y el gasto de energa. Pero la estrategia ms
saludables es incrementar el gasto tanto como se pueda y luego a partir de ah, adecuar la ingesta.
La actividad fsica del nio debe ser diferente a la del adolescente. En el primero es asistemtica y
no competitiva, poco estructurada y ldica. Se recomiendan juegos dinmicos y juegos predeportivos.
Los adolescentes se benefician ms con actividades sistemticas, estructuradas y competitivas.
En nios es recomendable proponer actividades en familia con padres y hermanos. En
adolescentes se prefieren actividades con pares.
De preferencia incluir elementos como pelotas, aros, sogas, etc. Cualquier actividad fsica que
requiera elementos, enriquece la experiencia motora del nio y estimula la continuidad.
En nios es recomendable evitar la competencia temprana. Por tal motivo, el deporte formal, no
es el tipo de actividad de preferencia, aunque se ha demostrado que la prctica de algn deporte,
realizada en forma jugada no competitiva, produce resultados beneficiosos para la grasa corporal.

IV. Bibliografa
1. Dobbins M, Husson H, DeCorby K, LaRocca RL. School-based physical activity programs for
promoting physical activity and fitness in children and adolescents aged 6 to 18. Cochrane
Database Syst Rev. 2013 Feb 28;2:CD007651. doi: 10.1002/14651858.CD007651.pub2.
2. Dodd C. Energy regulation in Young people. J of sports science and medicine. 2007, (6),
327-336.
3. Sazonova N, Browning R, Sazonov E. Predictrion of bodyweight and energy expenditure
using point pressure and foot acceleration measurements. Biomedical engineering journal,
2011, 5, 110-115.
4. Cordova A, Villa G, Sureda A, Rodriguez-Marroyo JA, Martnez-Castaeda R, SnchezCollado MP. Source Energy Consumption, Body Composition and Physical Activity Levels in
11- to 13-Year-Old Spanish Children. Ann Nutr Metab. 2013 Oct 26;63(3):223-228. [Epub
ahead of print]
5. Departamento de Bioqumica, Biologa Molecular y Fisiologa, Facultad de Fisioterapia,
Universidad de Valladolid, Soria, Spain.
6. Deheeger M, Rolland-Cachera MF, Fontvieille AM. Physical activity and body composition
in 10 year old French children: linkages with nutritional intake? Int J Obes Relat Metab
Disord. 1997 May;21(5):372-9.
7. Maffeis C, Talamini G, Tat L. Influence of diet, physical activity and parents' obesity on
children's adiposity: a four-year longitudinal study. Int J Obes Relat Metab Disord. 1998
Aug;22(8):758-64.
8. Gonzlez-Gross M, Melndez A. Sedentarism, active lifestyle and sport: Impact on health
and obesity prevention. Nutr Hosp. 2013 Sep;28 Suppl 5:89-98. doi:
10.3305/nh.2013.28.sup5.6923.
9. Laguna M, Ruiz JR, Lara MT, Aznar S. Recommended levels of physical activity to avoid
adiposity in Spanish children. Pediatr Obes. 2013 Feb;8(1):62-9. doi: 10.1111/j.20476310.2012.00086.x. Epub 2012 Sep 7.

Tema 4
Ejemplos de juegos dinmicos, recreacin y actividad fsica adaptada
Autor: Gabriel Tarducci MSc. Ph.D

I.

Introduccin

La vida activa contribuye en gran medida al mantenimiento de la salud y la calidad de vida. Los
nios se benefician cuando invierten buena parte de su tiempo en actividades fsicas de forma ms
o menos sistemtica. Ms an, en el caso de los nios, la vida activa tiene doble importancia. Por
un lado, por los beneficios propios del gasto de energa, y por otro por el valor formativo que
representan las actividades ldico deportivas socializantes. Los hbitos y estilos de vida adquiridos
durante la infancia, seguramente perdurarn en la adultez. Pero esta afirmacin se basa en el qu
hacer. La pregunta siguiente sera entonces sera, cmo se debe hacer. Aqu aparece una
separacin entre el qu y el cmo. Segn el estado actual de conocimiento sobre actividad fsica y
obesidad, el qu no representa problema alguno. La mayora de los profesionales saben qu
hacer. Pero persiste la incertidumbre de cmo hacerlo. Hay una disociacin entre la teora y la
prctica.
En este documento se presentan una serie de recomendaciones prcticas para mejorar las
habilidades de las personas que trabajan en programas de actividad fsica y control del peso
corporal. No es tcnicamente un manual de actividades, sino una gua corta que oriente a las
personas que ejecutan programas de actividad fsica para la salud en nios y jvenes.
II.

Recomendaciones de actividad fsica en nios y jvenes

En nios con sobrepeso u obesidad, se recomienda acumular al menos 60 minutos de actividad


fsica diaria. El hecho de que la frecuencia sea diaria tiene implicancias que van ms all de la
actividad fsica y sus adaptaciones metablicas. Cuando un nio realiza actividad fsica, estimula
todas las funciones corporales y pone en marcha una maquinaria circulatoria, endcrina,
muscular, neurolgica, trmica, etc. Y lo que no es menos importante, estimula todas las funciones
cognitivas y socioafectivas. La actividad fsica eleva el metabolismo por encima del de reposo, y
esta elevacin perdura minutos posteriores a la actividad. Entonces, al aumentar la frecuencia
tambin aumenta la cantidad de minutos que permanece elevado el metabolismo, con el
consiguiente gasto energtico tambin elevado. Ms actividad fsica significa tambin ms
produccin de calor.
III.

El juego

Segn Huizinga, el juego es una accin u ocupacin libre, que se desarrolla dentro de unos lmites
temporales y espaciales determinados, segn reglas obligatorias, aunque libremente aceptadas,

accin que tiene fin en s misma y va acompaada de un sentimiento de tensin y alegra y de la


conciencia de -ser de otro modo- que en la vida corriente.
El juego es una actividad natural en el nio, con importantes implicancias educativas, formativas,
de desarrollo y crecimiento. El juego est presente desde el primer momento en la vida del nio
(Grellet 2000). Los juegos normalmente incluyen competencia, sea entre oponentes o para
alcanzar una meta. Las reglas son propias de cada lugar. De ah que sea casi imposible escribir un
manual de juegos que funcione en diferentes regiones. Un mismo juego puede tener tantas reglas
diferentes como lugares donde se juegue. Las reglas de los juegos se establecen al momento de
jugar y forman parte de una negociacin, an en el mundo infantil. En cambio, los deportes se
caracterizan por poseer reglas universales preestablecidas. Por ejemplo, al ftbol se juega igual en
Guatemala o en Japn.
El juego es una actividad totalmente libre, que los nios deciden practicar o no. Pero los nios
juegan an sin que los adultos lo adviertan. Adems es universal, porque no importa la cultura en
la que los nios crezcan, siempre existe el juego como actividad central de sus vidas. Pero para el
tema que nos ocupa en este curso, nos centraremos en los juegos motores con alta demanda
energtica, que a la vez contenga elementos enriquecedores como elementos deportivos,
elementos de la naturaleza, as como tambin juegos con participacin de otros nios.
La recreacin la mayora de las veces implica algn tipo de actividad ldica. En la actualidad las
actividades recreativas de los nios y jvenes son casi totalmente sedentarias. Esto est
directamente ligado al sobrepeso y la obesidad. Cambiar el patrn de recreacin hacia uno ms
activo, significa aumentar drsticamente el gasto de energa. Se recomienda aprovechar cualquier
ocasin de la vida cotidiana y del tiempo libre para gastar energa.
Durante muchos aos, se pens que la actividad fsica cotidiana, no programada con fines de
entrenamiento, no serva para mejorar la salud. Pero, de la mano de los cambios de estilos de
vida, qued claro que la salud y la actividad fsica cotidiana mantienen una relacin simbitica
interdependiente.
A la hora de proponer actividad fsica la creatividad tiene la palabra. Por ejemplo se ha observado
que los nios suelen ser ms activos cuando juegan con una mascota o salen a pasear con ella
(Wohlfarth 2013). Tambin se sabe que algunas estrategias multifactoriales que involucran
cambios dietticos, educacin para la salud y actividad fsica producen los mejores beneficios
(Bardach 2007).
Moverse suficientemente se transforma en una actividad protectora de la salud y contra el
aumento de peso corporal (Bingham 2013). Del mismo modo, aprovechar las pocas de receso
escolar para practicar podra traducirse en control ms fcil del peso corporal (Chin 2013,
Verstraete 2006).

Existe una publicacin muy interesante realizada por un consorcio de organizaciones


latinoamericanas que, ms all de ofrecer propuestas de actividades dinmicas, permite observar
el valor educativo formativo que las actividades compartidas tienen en la formacin del nio y de
los jvenes por lo cual sugerimos la lectura (Educapaz).

IV.

Ejemplos de actividades

3
a. Para nios de edad escolar
Desplazamientos entre escuela y hogar caminando. Se recomienda variar el camino para
combatir la rutina. Se puede enriquecer la actividad variando el tiempo. Por ej.: intentar
una vez a la semana completar el trayecto bajando un 10% el tiempo.
Utilizar escaleras frecuentemente, evitando siempre el ascensor. Si subir escaleras es
imposible, se puede simplemente bajar. Tambin se puede llegar en ascensor hasta cierto
nivel y luego completar por escaleras hasta el piso destino.
Hacer algn tipo de danza. Tanto nios como nias se benefician de estas actividades,
aunque son las nias quienes ms disfrutan de ellas. Sin embargo, cuando los nios se
involucran en danzas tradicionales, junto a otros compaeros, tambin pueden disfrutar
libremente del baile.
Experimentar la naturaleza circundante. Plazas, rboles, paseos, etc. Si se tiene acceso a
un espacio verde, conviene frecuentarlo al menos dos veces a la semana. Una buena
estrategia es aprovechar el trayecto desde la escuela hasta el hogar y detenerse unos
minutos all. Los juegos de plaza son motivadores. Estimular a los nios a usarlos permite
aumento del gasto de energa y de forma divertida. Cuidar del buen estado para evitar
accidentes.
Trotar de forma asistemtica. Incluir pequeas distancias. Los nios pueden y deben
realizar trotes o carreras, pero siempre que no sean competitivas y no supongan cumplir
con una duracin e intensidad predeterminada. Por ejemplo, se pueden realizar pequeos
trotes cuando se desplazan de un lugar a otro. Cada vez que se incluyan cambios de
velocidad, se estar agregando calidad a la actividad que ya de por s es positiva.
Pedalear entre puntos de inters (Ej.: casa-escuela o casa-club). Usar la bicicleta es una
actividad bien aceptada por todos los nios. Se pude ir en grupos con hermanos o amigos,
pero lo ms importante es el acompaamiento de los mayores. Se debe buscar un
trayecto seguro, libre de trnsito vehicular y con suficiente sealizacin. Siempre que se
pueda conviene subir desniveles para aumentar la exigencia de la actividad.
Pasear con mascotas. Se ha demostrado que poseer una mascota incrementa la actividad
de la familia. Los nios disfrutan de jugar y pasear con ellas.
Educacin fsica escolar. La OMS sugiere incluir Educacin Fsica escolar todos los das de

la semana. Pero si esta recomendacin no se puede cumplir, al menos es importante que


la clase que tengan sea lo ms activa posible. Para ello es importante trabajar en
capacitacin de los docentes tanto del rea especfica como de otras reas para que
compartan los objetivos a nivel institucional.
Utilizar las instalaciones escolares para incrementar la oferta de actividades, tanto en
horario de clases como en horarios post escolar. Se han reportado importantes beneficios
de la utilizacin de las instalaciones escolares sobre los hbitos de los nios. Adems,
dependiendo de la realidad regional, utilizar las escuelas para atraer a nios y jvenes es
una estrategia muy buena para disminuir tanto las horas de TV como las horas de calle.
Proponer juegos dinmicos. Existe un sinnmero de juegos populares de persecucin, de
agarre, de traslado, de acarreo, de carreras, etc. Cada uno adems, admite infinidad de
adaptaciones y variantes. Ser creativos es una premisa indispensable para motivar a los
nios a que jueguen y sobre todo a que continen en la actividad. Una recomendacin
bien prctica para mantener siempre a los nios con ganas de jugar: Hay que matar el
juego antes de que el juego muera! (en referencia a corta y variar el juego antes de que
los nios se aburran de jugar y ya no quieran seguir).
Actividades con pelotas. La pelota es el mejor ejemplo de lo que se denomina carcter
motivador del elemento. Es decir, cuando en un grupo de nios aparece una pelota
(baln) sin mediar ninguna indicacin, los nios corren, juegan, patean, saltan, trotan,
lanzan, atrapan, pasan, etc.
Juegos pre-deportivos. Son juegos que se caracterizan por tomar algn elemento propio
de un deporte, pero que se utiliza en otro contexto y con otras reglas. Por ejemplo, utilizar
una pelota de bsquet, en un juego que involucre pases y lanzamientos, pero no existe el
aro, el tablero, la cancha demarcada, etc. Otro ejemplo sera utilizar la pelota de futbol
pero para encestar en un aro de bsquet. En nios es muy importante respetar estos
aspectos de la relacin actividad fsica y deporte.
Tomar reglas de un deporte pero adaptarlas a nuevos juegos. Por ejemplo, desplazarse
botando la pelota como ocurre en el bsquet, pero en lugar de encestar, lanzar a un arco,
como ocurre en el hndbol. Todo ello sin involucrar al nio en competencia formal.

b. Para jvenes y adolescentes


Actividades recreativas dinmicas. Cualquier actividad que rompa el crculo del
sedentarismo.
Organizar salidas, excursiones o paseos con amigos, procurando pasar minutos en
espacios verdes.
Caminar o pedalear hasta el colegio y el club. Si no fuera posible, una buena estrategia es
caminar la mitad del camino.
Utilizar frecuentemente las escaleras en lugar del ascensor.
Promover la prctica de deporte escolar o extraescolar.

V.
1.
2.

3.

4.

5.

6.

Mantener una oferta de actividades dinmicas para los recreos escolares.


Juegos dinmicos mixtos, entre jvenes de ambos sexos.
Involucrarse en asociaciones o grupos de entidades confesionales o sociales. Por ejemplo,
parroquias, grupos de scoutismo, asociaciones vecinales, clubes sociales, etc.).
Participar de deportes formales.
Concurrir a gimnasios. Si esta actividad se realiza con amigos mucho mejor.
Experimentar la vida en la naturaleza.
Planes de ejercicios estructurados. Los adolescentes se benefician de actividad fsica
programada con fines de entrenamiento. Este tipo de actividad permite incrementar
suficientemente el gasto de energa de manera controlada y sistemtica.
Turismo aventura.

Bibliografa
Grellet C. El juego entre el nacimiento y los 7 aos: manual de ludotecaria. UNESCO,
Sector educacin. 2000.
Wohlfarth R, Mutschler B, Beetz A, Kreuser F, Korsten-Reck U.Dogs motivate obese
children for physical activity: key elements of a motivational theory of animal-assisted
interventions. Front Psychol. 2013 Oct 29;4:796. doi: 10.3389/fpsyg.2013.00796.
Bingham DD, Varela-Silva MI, Ferro MM, Augusta G, Mouro MI, Nogueira H, Marques
VR, Padez C. Socio-demographic and behavioral risk factors associated with the high
prevalence of overweight and obesity in portuguese children. Am J Hum Biol. 2013
Nov;25(6):733-42. doi: 10.1002/ajhb.22440. Epub 2013 Sep 3.
Chin JJ, Ludwig D. Increasing children's physical activity during school recess periods. Am J
Public Health. 2013 Jul;103(7):1229-34. doi: 10.2105/AJPH.2012.301132. Epub 2013 May
16.
Verstraete SJ, Cardon GM, De Clercq DL, De Bourdeaudhuij IM. Increasing children's
physical activity levels during recess periods in elementary schools: the effects of providing
game equipment. Eur J Public Health. 2006 Aug;16(4):415-9. Epub 2006 Jan 23.
EDUCAPAZ www.educarm.es/templates/portal/ficheros/.../97/educapaz1.doc

Clasificacin de los Juegos


Recreacin
El trmino recreacin proviene del latn recreatio, que significa restaurar y refrescar (la persona).
Son actividades fuera de las normales diariamente o deportes que se realizan en nuestro tiempo
libre, donde obtengas descanso, relajacin y distraccin que se realizan con el fin de obtener un
beneficio, ya sea fsico o mental.
La recreacin se asocia tambin con el factor intelectual y educativo. Investigaciones han
demostrado que los nios aprenden mucho ms en ambientes relajados, sin presin. Es por ello
que la recreacin es fundamental para el desarrollo intelectual de las personas. A la vez, el
recrearse proporciona en s, una forma de aprendizaje, a travs de experiencias propias y de la
persona en el exterior.
Intento de Clasificacin de los Juegos segn Moreno Palos
Profesor del INEF de Madrid de la signatura de juegos y deportes populares, elabor en 1992 la
siguiente clasificacin basada fundamentalmente en criterios asociados al mbito de la educacin
fsica:

De locomocin: carreras, saltos, equilibrios.


De pelota y baln: baloncesto, ftbol.
De lucha: lucha, esgrima.
De fuerza: de levantamiento, transporte, de traccin y empuje.
Nuticos y acuticos: pruebas de nado, vela, remo.
Con animales: luchas, caza.
De habilidad en el trabajo: agrcolas.
Diversos no clasificados.

Juegos Populares
Estn muy ligados a las actividades del pueblo llano, y a lo largo del tiempo han pasado de padres
a hijos. De la mayora de ellos no se conoce el origen: simplemente nacieron de la necesidad que
tiene el hombre de jugar. Es decir, se trata de actividades espontneas, creativas y muy
motivadoras. Su reglamento es muy variable, y puede cambiar de una zona geogrfica a otra con
facilidad; incluso pueden ser conocidos con nombres diferentes segn donde se practique.

Con el tiempo, algunos se han ido convirtiendo en un apoyo muy importante dentro de las clases
de Educacin Fsica, para desarrollar las distintas capacidades fsicas y cualidades matrices, o servir
como base de otros juegos y deportes.

Juegos Tradicionales
Son juegos ms solemnes, que tambin han sido transmitidos de generacin en generacin, pero
su origen se remonta a tiempos muy lejanos. No solamente han pasado de padres a hijos, sino que
en su conservacin y divulgacin han tenido que ver muchas instituciones y entidades que se han
preocupado que no se perdieran con el tiempo. Estn muy ligados a la historia, cultura y
tradiciones de un pas, un territorio o una nacin. Sus reglamentos son iguales,
independientemente de donde se desarrollen.
El material de los juegos es especfico de los mismos, y est muy ligado a la zona, a las costumbres
e incluso a las clases de trabajo que se desarrollaban en el lugar. Algunos de estos juegos
tradicionales con el tiempo se convirtieron en deportes, muy ligados a una regin llegando a
formar parte de las tradiciones culturales por ello, los denominaban Juegos o deportes
Autctonos. Ej. Lucha canaria, el slbo, el palo canario, la saga tira, pelota mano, etc.

Juegos de mesa
Los juegos con tablero, que utilizan como herramienta central un tablero en quien se sigue el
estado, los recursos y el progreso de los jugadores usando smbolos fsicos. Muchos tambin
implican dados o naipes. La mayora de los juegos que simulan batallas son de tablero, y ste
puede representar un mapa en el cul se mueven de forma simblica los contendientes. Algunos
juegos, como el ajedrez y el go son enteramente deterministas, basados solamente en la
estrategia. Los juegos infantiles se basan en gran parte en la suerte, como la oca, en el que apenas
se toman decisiones, mientras que el parchs es una mezcla de suerte y estrategia. El trivial es
aleatorio en tanto que depende de las preguntas que cada jugador consiga.

Conclusin
El juego es una actividad necesaria para los seres humanos teniendo suma importancia en la
esfera social, puesto que permite ensayar ciertas conductas sociales; a su vez es una herramienta
til para adquirir y desarrollar capacidades intelectuales, motoras, o afectivas y todo esto se debe
realizar de forma gustosa, sin sentir obligacin de ningn tipo y como todas las actividades se
requiere disponer de tiempo y espacio para poder realizarlo.

GUA DE DESARROLLO
Mdulo III: Diagnstico y tratamiento nutricional del paciente con sobrepeso y
obesidad
I.

Introduccin

En el nio, el estado de nutricin est estrechamente relacionado con su salud y es el que


permite la expresin de su potencial de crecimiento y desarrollo. La valoracin nutricional
constituye, por tanto, uno de los elementos ms fiables para determinar el grado de salud
de la infancia.
Las consecuencias clnicas de los trastornos nutricionales en el nio tienen una relevancia
especial al poder influir negativamente en su crecimiento. Tal es el caso de los trastornos
por exceso que obedecen a la incorporacin de energa por encima de las necesidades
funcionales, independientemente de que esta proceda de la ingesta excesiva de grasa,
carbohidratos o protena; el exceso se almacena en forma de grasa que puede llevar a
padecer obesidad. La tendencia de las sociedades actuales a la sobrenutricin y a la
obesidad han propiciado de futuras enfermedades crnicas en el futuro adulto y que sern
responsables de su morbimortalidad (obesidad, hipertensin arterial, ateroesclerosis,
diabetes, etc.).Por ello, su deteccin precoz, esto es en los primeros aos de la vida,
constituye la medida ms eficaz para su control.
II.

Competencia

Al finalizar el mdulo el participante tendr la capacidad de realizar diferentes


determinaciones a travs de herramientas diagnsticas y predictivas de
sobrepeso/obesidad, as como plantear un plan de trabajo individualizado como ruta
teraputica-nutricional, es decir, realizar una correcta valoracin, diagnstico y
tratamiento del nio afecto de sobrepeso/obesidad
III.

Objetivos especficos

Al finalizar este mdulo usted podr:

1. Elaborar una correcta historia clnica que le permita hacer un cribaje y valoracin del
estado nutricional del nio con sobrepeso y obesidad.

2. Aprender a detectar patologas asociadas a sobrepeso/obesidad as como su


prevencin y tratamiento.

3. Conocer los diferentes micronutrientes y no nutrientes utilizados con ms frecuencia


en nios con sobrepeso/obesidad infantil.

IV.

Contenidos

a. Tema 1: Cribaje /
sobrepeso/obesidad.

Valoracin

del

estado

nutricional

del

nio

con

Recursos bsicos:
Moreno Villares, Jos M. Captulo 47: XII Nutricin peditrica. Pginas 3-9.
Sinopsis: En este captulo del documento se presenta la valoracin nutricional en el
paciente en edad peditrica, presentando de forma sistematizada los pasos de la
valoracin nutricional del nio, haciendo nfasis en su aplicacin ordenada como
medio ms efectivo para orientar el diagnstico de un trastorno nutricional.
Lama More, Rosa A. Captulo 1: La obesidad en los nios. Un problema de todos.
Definicin y diagnstico de la obesidad. Pginas 9-26.
Sinopsis: En este captulo se revisan los estndares internacionales antropomtricos y
de composicin corporal en nios as como una revisin de los mtodos principales de
cuantificacin de la masa grasa, ms tiles en la prctica diaria.
The AVENA group. Alimentacin y valoracin del estado nutricional de los
adolescentes espaoles (Estudio AVENA). Evaluacin de riesgos y propuesta de
intervencin. I. Descripcin metodolgica del proyecto. Nutr. Hosp. (2003) XVIII (1)
15-28.
Sinopsis: El presente artculo muestra los resultados de la valoracin del estado
nutricional de adolescentes espaoles tomando en cuenta ocho diferentes reas:
nutricional, actividad fsica, condicin fsica, antropometra y composicin corporal,
estudio hematobioqumico, perfil genotpico e inmunolgico.
Lectura complementaria:
Wrnberg, J. et. al. The AVENA group. Estudio AVENA, alimentacin y valoracin del
estado nutricional en adolescentes. Resultados obtenidos 2003-2006.
Sinopsis: En el presente resumen se muestran resultados y conclusiones del estudio
AVENA realizado entre los aos 2003-2006.

b. Tema 2: Patologas
tratamiento.

asociadas a sobrepeso y obesidad infantil. Prevencin y

Lecturas bsicas:
Dalmau Serra J et al. Obesidad Infantil. COMORBILIDADES ASOCIADAS A LA
OBESIDAD. GUA SOBRE OBESIDAD INFANTIL. Pginas 296-299.
Sinopsis: En esta gua se muestran las complicaciones a corto y a largo plazo de la
obesidad infantil, entre las que destacan las alteraciones del metabolismo lipdico,
hipertensin arterial, sndrome metablico, entre otras.
Moris Lpez A. Captulo 11: Resistencia perifrica a la insulina. La obesidad en los
nios. Un problema de todos. Pginas: 201-209.
Sinopsis: El captulo trata de definir las causas y consecuencias de la resistencia de la
insulina.
Franchs Alonso M.; Ro Redondo Paz; Mateo Silleras B. Captulo 12: Alteraciones
lipdicas e hipertensin arterial en pacientes con obesidad infantil. La obesidad en los
nios. Un problema de todos. Pgina 211-224.
Sinopsis: El captulo define las alteraciones lipdicas en la obesidad infantil, as como la
hipertensin arterial.
Lecturas complementarias:
M.T. Morales San Jos; M.J. Pelez Gmez de Salazar. Captulo 26a:
Dislipemias.
Manual prctico de nutricin en pediatra. Comit de nutricin de la AEP.
Sinopsis: En el siguiente captulo se aborda los factores predisponentes a las
dislipemias, as como su clasificacin, evaluacin diagnstica y su tratamiento.
R. Merino Alonso de Ozalla. Captulo 26b: Hipertensin. Manual prctico de nutricin
en pediatra. Comit de nutricin de la AEP.
Sinopsis: En el presente captulo trata sobre las recomendaciones nutricionales en
casos de hipertensin arterial.

c. Tema 3: Intervencin nutricional


Lecturas bsicas:
Grupo Colaborativo de la SEEDO; Moreno B.; Barbany M.; Rubio A.M ; Salvad-Salas J.
Consenso SEEDO 2007 para la evaluacin del sobrepeso y la obesidad y el

establecimiento de criterios de intervencin teraputica. Med Clin (Barc)


2007;128(5):184-96.
Sinopsis: Este artculo aborda el diagnstico, clasificacin, epidemiologa, tratamiento
y co-morbilidades de la obesidad infantil; haciendo nfasis en los criterios de
intervencin teraputica.
Lectura complementaria:

Dalmeny K.; Hanna E.; Lobstein T.; Broadcasting bad health. Why food marketing to
children needs to be controlled. The International Association of Consumer Food
Organizations (IACFO), July 2003.
Sinopsis: Este artculo hace una interesante y necesaria reflexin sobre el rol de las
estrategias de marketing en la nutricin infantil.
V.
Actividades de Aprendizaje
Tema
Actividad
1
Revisin de lecturas bsicas

Descripcin
Revisar las lecturas bsicas y
complementarias
Completar cuestionario
Contestar cuestionario disponible
en el aula virtual
Revisin de lecturas y Revisar el material proporcionado
bsqueda de bibliografa
en contenidos y profundizar en el
tema a tratar.
Elaboracin de una actividad En esta actividad el estudiante
del seminario
deber investigar las principales
patologas asociadas en la obesidad
infantil, su abordaje y tratamiento.
Revisin de lecturas bsicas.
Revisar las lecturas bsicas
adjuntadas.
Caso clnico
Resolucin de caso clnico

1
2
2

3
3

VI.

Conferencia Virtual

Tema:(pendiente)
Fecha: mircoles 3 de febrero (pendiente confirmar)
Hora: 7:00 pm (Centroamrica)
Sala: Sala 4 (Participantes)

Fecha
13 al 19 de
enero
13 al 19 de
enero
20 al 26 de
enero
20 al 26 de
enero
27 de enero al
10 de febrero
3 al 10 de
febrero

Conferencista invitada:
Pendiente
VII.

Evaluacin
Tema
1
2
1, 2 y 3

VIII.

Actividad
Cuestionario
Actividad de seminario
Caso clnico

Valoracin
5
10
20

Experta del mdulo


Reina Llad, MD, MS. Mdico y cirujano con mster en pediatra y neonatologa con
ms de diez aos de experiencia en la atencin clnica peditrica. Ha coordinado el
programa Nios en movimiento en Palma de Mallorca desde el 2006 a la fecha y el
proyecto Ramallet sobre prevencin y tratamiento de sobrepeso y obesidad en
personas con Sndrome de Down de Atencin Temprana desde el 2012. Le fue
otorgado el ttulo de Antropometrista al finalizar y aprobar el curso de certificacin:
Internacional en Cineantropometria. Isak nivel I dictado por International Society of
Advancement of Kinanthropometry, USA.
La Dra. Llad ha sido la experta encargada de desarrollar los contenidos del presente
mdulo.

Definicin y diagnstico de la obesidad

Concepto de Obesidad
La obesidad se define como el exceso de masa grasa corporal, lo cual implica riesgo de padecer
complicaciones metablicas y problemas fsicos, psquicos y sociales. A corto plazo, las
consecuencias ms frecuentes en la infancia son las de tipo psicolgico y social. Adems, de
complicaciones metablicas (dislipidemias, resistencia a la insulina, hipertensin arterial,
intolerancia a los carbohidratos), tambin son habituales complicaciones ortopdicas, la esteatosis
heptica no alcohlica, la litiasis biliar, el reflujo gastroesofgico y el asma. Durante la vida
adulta, la morbilidad originada por la obesidad aumentar proporcionalmente al tiempo de
evolucin, la pre-disposicin individual-familiar y el grado y distribucin de la adiposidad.
Los grados de obesidad se podrn definir a partir de la estimacin directa e indirecta de la masa
grasa y, por otro lado, la distribucin de la misma ser la que determine el tipo de obesidad:
central, perifrica, intraabdominal, etc. A este respecto, el riesgo cardio-metablico que supone la
obesidad en nios y adultos se relaciona directamente con el grado de la misma, y sobre todo, con
la cantidad de grasa intraabdominal o visceral.
El ndice de Masa Corporal (IMC) (peso/talla2 = Kg/m2) es un ndice antropomtrico que se
correlaciona bien con la adiposidad, aunque tiene varias limitaciones. Este ndice es muy sensible
para el registro de aumento de masa corporal que, en determinadas edades, refleja
principalmente los incrementos de masa magra en lugar de los de masa grasa. Es til para la
deteccin o cribado poblacional de individuos con exceso de grasa corporal, pero no tanto a nivel
individual.
En nios y adolescentes es necesario el uso de tablas percentiladas para cada edad y sexo. Sin
embargo, el International Obesity Task Force (IOTF), con datos representativos de seis pases, ha
fijado definitivamente los puntos de corte internacionales para la deteccin de sobrepeso y
obesidad en nios y adolescentes, equivalentes a los que se usan en adultos 25 y 30 Kg/m2, para
cada edad y sexo (Tabla I). Estos puntos de corte son muy tiles desde el punto de vista
epidemiolgico. Sin embargo, para diagnosticar a un sujeto como obeso o con sobrepeso, es decir,
para precisar el grado de adiposidad y el tipo de distribucin de la misma a nivel individual, ser
necesario recurrir a otro tipo de medidas antropomtricas o incluso a mtodos ms sofisticados de
valoracin de la composicin corporal.

IMC 25 Kg/m2
Edad

Varones

Mujeres

IMC 30 Kg/m2
Varones

Mujeres

2
18.41
18.02
20.09
19.81
2.5 18.13
17.76
19.80
19.55
3
17.89
17.56
19.57
19.36
3.5 17.69
17.40
19.39
19.23
4
17.55
17.28
19.29
19.15
4.5 17.47
17.19
19.26
19.12
5
17.42
17.15
19.30
19.17
5.5 17.45
17.20
19.47
19.34
6
17.55
17.34
19.78
19.65
6.5 17.71
17.53
20.23
20.08
7
17.92
17.75
20.63
20.51
7.5 18.16
18.03
21.09
21.01
8
18.44
18.35
21.60
21.57
8.5 18.76
18.69
22.17
22.18
9
19.10
19.07
22.77
22.81
9.5 19.46
19.45
23.39
23.46
10
19.84
19.86
24.00
24.11
Tabla1: Puntos de corte internacionales para el
segn sexo y edad de 2 a 18 aos.

IMC 25 Kg/m2

IMC 30 Kg/m2

Edad

Varones

Mujeres

Varones

Mujeres

10.5
11
11.5
12
12.5
13
13.5
14
14.5
15
15.5
16
16.5
17
17.5
18

20.20
20.55
20.89
21.22
21.56
21.91
22.27
22.62
22.96
23.29
23.60
23.90
24.19
24.46
24.73
25

20.29
20.74
21.20
21.68
22.14
22.58
22.98
23.34
23.66
23.94
24.17
24.37
24.54
24.70
24.85
25

24.57
25.10
25.58
26.02
26.43
26.84
27.25
27.63
27.98
28.30
28.60
28.88
29.14
29.41
29.70
30

24.77
25.42|
26.05
26.67
27.24
27.76
28.20
28.57
28.87
29.11
29.29
29.43
29.56
29.69
29.84
30

IMC correspondiente a sobrepeso y obesidad,

Estndares Nacionales e Internacionales


Existen numerosos estndares nacionales e internacionales para la valoracin del comportamiento
graso; pero lo ms correcto y prctico es elegir el estndar poblacional que ms se adecue a la
poblacin que se pretende valorar, asegurndose de que sea fiable, ste actualizado y que la
metodologa utilizada para la estimacin coincida (incluyendo las frmulas predictivas para cada
grupo de edad).
Para la seleccin de referentes, sirvan las siguientes puntualizaciones:
1) Para cuantificar la adiposidad o la distribucin relativa de la misma, y comprobar si se
ajustan a la normalidad poblacional, se seleccionarn las grficas que ya existe para cada
mtodo en nios y adolescentes mediante: impedancia bioelctrica, pliegues cutneos,
permetros corporales, etc. Si el grupo es numeroso y se desea obtener resultado globales
se recomienda mtodos de campo antropomtricos o impedancia bioelctrica. Por otro
lado, si se desea cuantificar con exactitud la masa grasa corporal total o en algn lugar
localizado, a nivel individual o en un grupo reducido de pacientes, se deber seleccionar la
pletismografa por desplazamiento de aire (BOD POD), absorciometria dual por rayos X
(DXA) u otras tcnicas de imagen (RM, TAC).

2) Para monitorizar el cambio del IMC, del tejido adiposo o del permetro abdominal, puede
ser til la seleccin de grficas regionales o internacionales longitudinales actualizadas.
3) Para cuantificar la prevalencia de obesidad y sobrepeso en la poblacin o realizar un
cribado poblacional, sern tiles los puntos de corte del IOTF para el IMC.
ndice de Masa Corporal
El ndice de Masa Corporal (IMC) o de Quetelet, su creador, por encima de 30 (Kg/m2) se
correlaciona con un aumento en la morbimortalidad. El IMC no valora ni la composicin corporal
ni la distribucin de la grasa, siendo mal predictor de riesgo de salud para ciertos grupos,
incluyendo los jvenes que no han alcanzado su altura final, adultos muy delgados o muy
musculosos, mujeres embarazadas y ancianos.
Los valores del IMC varan en la niez y en la adolescencia dependiendo de la edad y el sexo. El
IMC tambin es el parmetro ms frecuentemente utilizado en nios para el cribado de exceso de
grasa corporal.
Variacin del IMC en Nios y Adolescentes
Relacin con la Masa Grasa
Los aumentos del IMC durante la poca del rebote adiposo (3 - 7 aos de edad) corresponden
principalmente con modificaciones de la masa grasa y no con las experimentadas por la masa
magra o la altura.
Las correlaciones entre el IMC y la grasa corporal son mucho mejores en las mujeres que en los
hombres, y tambin son mejores, en nias prepuberales que en aquellas que han comenzado la
pubertad. En ambos sexos, el incremento anual del IMC, sobretodo en la poca puberal y en las de
crecimiento rpido, se debe principalmente a aumento de la masa libre de grasa/talla2 tambin
contribuyendo algo al aumento del IMC pero en mayor grado en nias que en nios. As pues, se
puede considerar que los cambios anuales en el IMC durante la infancia y la adolescencia son
principalmente debidos a aumentos de la masa magra, ms que la masa grasa corporal.
En el estudio AVENA realizado en una muestra representativa de adolescentes espaoles, en un
subgrupo de 280 adolescentes (167 F y 113 M), con edades entre 13.0 y 17.9 aos, se describieron
las correlaciones entre el IMC y % Masa Grasa (MG) mediante DXA. Las conclusiones del estudio
son:
a) Un porcentaje considerable de adolescentes clasificados con sobrepeso y obesidad
mediante el IMC pueden no tenerlo/a.
b) Pese que existe correlacin entre el IMC y el %MG, un 25% de mujeres y un 29% de
hombres adolescentes con exceso de % MG no son identificados como tales por el
IMC.
c) El IMC no predice en adolescentes el %MG con fiabilidad a nivel individual, por lo que
solo debe utilizarse para cribado poblacional de obesidad y sobrepeso.

d) Los criterios del IOTF respecto a los puntos de corte de IMC para la prediccin de %MG
en adolescentes, no se han podido optimizar, resultando mejores que los que se
intentaron obtener mediante el estudio AVENA.
IMC y su Relacin con los Factores de Riesgo Cardiovascular
Un buen factor predictivo para la concentracin de HDL y de los niveles de colesterol en nios y
adolescentes, es el valor del IMC y sus aumentos. Otros autores han encontrado que el IMC y sus
aumentos son buenos predictores de cambios no deseables en tensin sistlica y diastlica, LDL,
HDL, triglicridos e insulina. Tambin se ha demostrado correlacin entre el IMC infantil y el
colesterol total y el LDL en la vida adulta. Vanhala et al. ha determinado que en nios con IMC
elevado tienen un odds ratio para la aparicin de sndrome metablico de 4.4 en comparacin con
controles sanos. Otros investigadores han encontrado incidencia de diabetes tipo 2 en la edad
adulta correlacionada con un IMC alto en la niez.
Los nios obesos presentan valores significativamente ms altos de actividad del plasmingeno
tisular inhibidor de la actividad del plasmingeno y fibringeno.
El estado inmunoinflamatorio tambin est relacionado con el IMC, la adiposidad y la enfermedad
cardiovascular.
Por otro lado, los nios obesos con IMC elevados han mostrado una baja compliance y baja
distensibilidad arterial en comparacin con controles sanos.
Cuantificacin de la Masa Grasa
Mtodos considerados como referencia para la cuantificacin de la masa grasa:
hidrodensitometra, pletismografa por desplazamiento de aire, tcnicas isotpicas,
absorciometra dual de rayos X (DXA) y otras tcnicas por imgenes como la RM (resonancia
magntica o la TC (tomografa computarizada).
A continuacin los mtodos ms empleados en nios y adolescentes para el estudio de la cantidad
y distribucin de la masa grasa:
a. Pliegues cutneos
Los pliegues cutneos son capaces de valorar la adiposidad corporal porque la grasa
subcutnea (40-60% del total) se puede cuantificar directamente con un medidor calibrado.
La valoracin que permite esta tcnica es la mera cuantificacin del grosor de los pliegues
cutneos como indicador del panculo adiposo. Puede interesar el valor puntual de un pliegue
en una localizacin exacta (bicipital); la suma de varios pliegues como reflejo general de
adiposidad; o incluso la relacin o proporcin entre la medida de algunos pliegues de zonas
troncales y el resto. Adems, de la medicin directa de los pliegues, se puede estimar el % MG
mediante el uso de frmulas predictivas adecuadas; como se muestra en las tablas a
continuacin:

Mujeres
%MG (Westrate & Durenberg)
%MG (Siri)
%MG (Lohman et al)
Densidad (Brook)
Densidad (Durain y Rahaman)
Densidad (Johnston et al)
Densidad (Deurenberg et al)
Densidad (Sloan et al)
Densidad (Wilmore & Behnke)
%MG (Slaughter eta al)1
% MG (Slaughter et al)2
%MG (Lean et al)
%MG (Bray et al) 1
%MG (Bray et al) 2

(553-7.3(Edad-10/D)-(514-8(Edad-10)
495/D-450
530/D-489
12063-0.0999 (LOG4Pliegues)
1.1369 - 0.0598 (LOG4Pliegues) (13-15.9 aos)
1.1549 -0.0678 (LOG4Pliegues) (16-19.9 aos)
1.144 0.06 (LOG4Pliegues)
1.1074 0.0504 (LOG4Pliegues) + 0.0016Edad
(Pubertad)
1.183 0.0813 (LOG4Pliegues)
(Postpubertad)
1.0764 0.00081Suprailiaco 0.00088Tricpes
1.06234 0.00068Subescapular 0.00039Triceps-0.00025Muslo
1.33 (Triceps + Subescapular) 0.013(Tricpes + Subescapular) 2.5
0.546(Triceps + Subescapular) + 9.7
(cuando > 35 mm)
0.61 (Trceps + Gemelo) + 5.1
0.730IMC + 0.548Triceps + 0.270Edad 5.9
7.66 + 0.22Subescapular +0.21Muslo + 0.64Biceps + 0.31Pierna
8.71 + 0.19Subescapular + 0.76Biceps + 0.18Suprailiaco + 0.33Triceps

Tabla 2: Ecuaciones para la estimacin del %MG a partir de los pliegues cutneos en mujeres
adolescentes.
Se han ideado muchas frmulas para la estimacin del %MG, la mayora lo han hecho calculando
primero la densidad corporal a partir del logaritmo de la suma de los cuatro pliegues (bceps,
trceps, subescapular y subprailiaco) y luego, mediante otra ecuacin, el % MG para densidad
corporal (Tabla 2 y 3)
Sin embargo, hay que puntualizar que la mayora de las ecuaciones para el clculo de % MG a
partir de los pliegues cutneos no son precisos a nivel individual, especialmente en los individuos
con mayor % MG.

Hombres
%MG (Westrate & Durenberg)
%MG (Siri)
%MG (Lohman et al)
Densidad (Brook)
Densidad (Durain y Rahaman)
Densidad (Johnston et al)
Densidad (Deurenberg et al)
Densidad (Sarria et al)
%MG (Slaughter eta al)1
% MG (Slaughter et al)2
%MG (Lean et al)
%MG (Bray et al) 1
%MG (Bray et al) 2

(562-4.2(Edad-2)/D)-(525-4.7(Edad-2)
495/D-450
530/D-489
1.1690-0.0788 (LOG4Pliegues)
1.1533-0.0643 (LOG4Pliegues)
(13-15.9 aos)
1.162 0.063 (LOG4Pliegues)
(16-19.9 aos)
1.166 0.07 (LOG4Pliegues)
1.0555 0.0352 (LOG4Pliegues) + 0.0038Edad
(Pubertad)
1.1324 0.0429 (LOG4Pliegues)
(Postpubertad)
1.1516-0.0658 (LOG4Pliegues)
(11-13.9 aos)
1.169 0.0693 (LOG4Pliegues)
(14-16.9 aos)
1.21 (Triceps + Subescapular) 0.008(Tricpes + Subescapular) 5.5
0.783(Triceps + Subescapular) 1.7
(cuando > 35 mm)
0.735 (Trceps + Gemelo) + 1
0.742IMC + 0.950Triceps + 0.335Edad 20
7.66 + 0.22Subescapular +0.21Muslo + 0.64Biceps + 0.31Pierna
8.71 + 0.19Subescapular + 0.76Biceps + 0.18Suprailiaco + 0.33Triceps

Tabla3: Ecuaciones para la estimacin del % de MG a partir de los pliegues cutneos en


hombres adolescentes.
b. Permetro de cintura
El permetro abdominal valora indirectamente la grasa a nivel abdominal y se muestra como el
mejor parmetro antropomtrico aislado a la hora de predecir el riesgo de sndrome
metablico asociado a sobrepeso en nios y adolescentes. El permetro de la cintura es mejor
predictor de riesgo cardiovascular que el IMC. Sus medidas se relacionan directa y muy
significativamente con la gras intraabdominal visceral.
La evolucin de la historia natural de la pre-diabetes tipo 2 en nios y adolescentes obesos, as
como la resistencia a la insulina y componentes del sndrome metablico (insulinemia basal,
ndice HOMA, lipemia, tensin arterial, leptina, etc.) se relacionan ms con el aumento de la
grasa visceral que con el exceso global de grasa corporal.
c. Impedancia bioelctrica
La Impedancia Bioelctrica (IB) se define como la resistencia que oponen los compartimentos
corporales al paso de una corriente dbil que pasa entre el tobillo y la mueca del mismo lado
del individuo. La IB o resistencia corporal es directamente proporcional a la talla e
indirectamente al rea transversal.
El inters creciente en la IB se fundamenta en que es una tcnica simple, porttil, rpida y no
invasiva, que demuestra buena correlacin con los compartimentos corporales. Hay que tomar
en cuenta que existen condiciones clnicas, como deshidratacin, edema y ascitis, que pueden
invalidar los resultados.
Las variaciones en la composicin y en las proporciones corporales dependientes de la edad
hacen que este mtodo necesite de una buena estandarizacin y de adaptacin de las

frmulas predictivas a cada poca de la vida. La IB valora de manera ms precisa y fiable el


compartimento acuoso que la grasa corporal. Con el resultado de la impedancia se estima el
agua corporal mediante una frmula, para luego calcular la masa no grasa (MNG), cuyo valor
se substrae del peso corporal para obtener la grasa corporal.
d. Pletismografa por desplazamiento de aire
Este mtodo es el ideal para medir la densidad corporal. El modelo ms actual es el BOD POD
que mide el volumen corporal. Tras medir el volumen corporal, descontando el pulmonar, se
calcula la densidad corporal (peso/volumen) y el porcentaje de grasa mediante las mismas
frmulas detalladas en las tablas presentadas en la seccin de pliegues cutneos.
e. Tcnicas isotpicas
Las tcnicas isotpicas que se utilizan actualmente para valorar la composicin corporal suelen
emplear agua marcada con uno o varios istopos estables, habitualmente H2 (deuterio)y/o
O18 (istopo estable de oxgeno), administrado por va oral o endovenosa.
Esta tcnica requiere un equipamiento caro, personal experto y un tiempo de espera de varias
horas hasta que el istopo se ha distribuido totalmente. Es la mejor tcnica para cuantificar el
Agua Corporal Total (ACT) y la MNG.
f. Tcnicas de imagen
La grasa que realmente importa metablicamente es la visceral o grasa invisible. Para
valorar este tipo de grasa los mejores mtodos son las tcnicas por imagen: resonancia
magntica y la absorciometra dual por rayos X.
i.
Resonancia magntica (RM)
Esta tcnica permite cuantificar el tejido adiposo utilizando imgenes seccionales de zonas
del organismo. La utilidad ms aparente de la RM en referencia al compartimento graso,
es la valoracin de la grasa intraabdominal. La exactitud en sus mediciones, la hace el
mtodo de referencia en relacin con la cuantificacin de la grasa visceral.
ii.
Absorciometra dual por rayos X (DXA)
La cuantificacin de los diferentes compartimentos corporales se realiza con este mtodo
segn la atenuacin que experimentan los haces fotnicos de rayos X en los tejidos que
atraviesan, con una radiacin equivalente a una centsima parte de la de una radiografa
simple. Sus ventajas principales son determinar tres compartimentos corporales (masa
sea, masa grasa y masa magra sin hueso) con precisin y exactitud, la capacidad para
cuantificar la densidad mineral sea y el empleo de una metodologa no invasiva y segura
que utiliza tiempos de medida relativamente cortos. La tcnica emplea un sistema de
escner que se desplaza desde la cabeza a los pies.
En la cuantificacin de la masa grasa, uno de sus inconvenientes ms importantes del DXA
es que las zonas donde los rayos atraviesan tejido con composicin mixta (hueso, grasa y
masa magra), asume una proporcin de masa grasa y magra similar a las zonas anejas al
hueso donde solo hay tejido graso y magro.

Comentario Final
En cada uno de los momentos en que se precise estimar la grasa corporal se deber seleccionar
cuidadosamente el mtodo de valoracin segn los objetivos del estudio (incluyendo las frmulas
predictivas), diseo metodolgico del mismo, aplicabilidad en la poblacin considerada, y
precisin y exactitud deseadas.
Referencia
Rodrguez, G. Fleta, J y Moreno, L. Captulo I: La obesidad en los nios. Un problema de todos.
Definicin y diagnstico de la obesidad. Pg.: 9 26.

RESISTENCIA PERIFERICA A LA INSULINA


Introduccin
La disminucin de la capacidad de la insulina para ejercer sus acciones biolgicas en sus tejidos
diana, fundamentalmente msculo esqueltico, hgado y tejido adiposo constituye la condicin
patolgica conocida como resistencia a la insulina.
Esta condicin aumenta la probabilidad de presentar diversas alteraciones que incrementan el
riesgo de padecer una variedad de sndromes clnicos, como la diabetes tipo 2, enfermedad
cardiovascular, hipertensin arterial (HTA), sndrome de ovario poliqustico (SOP), hepatopata
grasa no alcohlica, apnea del sueo y algunos tipos de cncer.
La resistencia a la insulina es una de las caractersticas definitorias de la diabetes tipo 2, junto con
la alteracin en la secrecin de insulina. La resistencia a la insulina de los tejidos perifricos
provoca, como consecuencia de la disminucin de sus efectos, un aumento de su produccin por
parte de las clulas B pancreticas, dando lugar a una situacin de hiperinsulinemia. Aunque en un
principio este mecanismo compensador consigue mantener la glucemia en lmites normales, en
algunos individuos acaba resultando insuficiente con el tiempo, lo que conduce a una alteracin
en la homeostasis de la glucosa. Cuando la aparicin de diabetes tipo 2 tiene lugar en la edad
peditrica, la patognesis es probablemente similar al de los adultos aunque con una evolucin
acelerada y de origen no del todo aclarado.
Diversos factores tienen influencia en el desarrollo de la resistencia a la insulina aunque no todos
son an bien conocidos:
Gentica: se ha puesto de manifiesto que algunos grupos tnicos, como los afroamericanos y los
hispanos de Estados Unidos, presentan mayor resistencia a la insulina, con independencia de otros
factores.
Distribucin de la grasa corporal: en nios puede apreciarse la existencia de grasa visceral desde
edades tempranas, y algunos estudios han sugerido su relacin con factores de riesgo metablico.
Los estudios a este respecto en poblacin adulta apoyan esta asociacin, sugiriendo que la
acumulacin de grasa en lugares como el msculo o el hgado, fuera del tejido adiposo, tiene
influencia en la resistencia a la insulina, lo que ha sido documentado en adultos sanos y en obesos
con diabetes tipo 2. Los adipocitos producen importantes mediadores relacionados con la
resistencia a la insulina, la diabetes tipo 2 y la enfermedad cardiovascular. Entre ellos destacan la
leptina, el TNF-, la IL-6 y la adiponectina. La adiponectina guarda relacin inversa con la
adiposidad infantil, pudiendo observarse un aumento de sus niveles y una mejora de la resistencia
a la insulina en nios que pierden peso. Asimismo, sus niveles guardan relacin inversa con el

acmulo de grasa en el tejido muscular.


Obesidad, sndrome metablico y resistencia perifrica a la insulina
En nios, no existen criterios unnimes para la definicin del sndrome metablico, se estima que
su prevalencia es baja. Sin embargo, esta percepcin cambia cuando se consideran aisladamente
los nios y adolescentes obesos, que un funcin de los criterios aplicados presentan una
prevalencia del sndrome metablico alrededor de 30-50% segn las series. Algunos autores han
documentado la relacin del sndrome metablico con el grado de obesidad.
La prevalencia real de diabetes tipo 2 en la poblacin peditrica an no est bien establecida. Si es
bien conocido, sin embargo, que una proporcin importante de los nios obesos se encuentran en
una situacin de pre diabetes, variando la prevalencia entre un 21-28%. Esta condicin se
caracteriza por niveles elevados de glucosa en ayunas (110-125 mg/dl) y/o alteracin en la
tolerancia a la glucosa, es considerada en adultos un estadio intermedio en el proceso de
desarrollo de diabetes tipo 2. An no est claro si esta alteracin en la homeostasis de la glucosa,
supone para los pacientes peditricos que la presentan, el mismo riesgo de progresin hacia este
tipo de diabetes. De sus dos componentes, el ms habitual en nios obesos es la alteracin de la
tolerancia a la glucosa, siendo menos frecuente la elevacin de la glucemia en ayunas.
Es sabido que las alteraciones en la homeostasis de la glucosa, como sucede en diabetes, se
asocian con aumento del riesgo cardiovascular. En tejidos donde el transporte de glucosa no es
dependiente de insulina, como el endotelio, las neuronas y las clulas mesangiales, la
hiperglicemia tiene un efecto deletreo mediado por un aumento en el estrs oxidativo.
Las concentraciones elevadas de la glucosa tambin influyen en la transcripcin gentica en las
clulas pancreticas, regulando no solo genes relacionados con el metabolismo lipdico e
hidrocarbonado y la produccin de insulina, sino tambin otros que codifican protenas implicadas
en el funcionamiento de las propias clulas B.
Influencia de la resistencia a la insulina en la patologa relacionada con la obesidad
Un estudio reciente llevado a cabo sobre nios y adolescentes obesos, encontr que la
sensibilidad a la insulina en los pacientes que reunan los criterios de sndrome metablico
propuestos (tres o ms de lo siguientes: hipertrigliceridemia, disminucin de C-HDL, hipertensin,
permetro de cintura elevado, intolerancia de glucosa), era un 62% menor que la de aqullos que
no reunan los criterios. Asimismo, se encontr que la sensibilidad a la insulina guardaba relacin
independiente y negativa con los niveles de triglicridos y la TA, y positiva con el C-HDL, lo que no
suceda con la grasa corporal.
Una de las consecuencias de la resistencia a la insulina es el incremento de la liplisis en el tejido

adiposo, aumentando as la llegada de cidos grasos al hgado. En este sentido, la resistencia a la


insulina se considera un factor patognico esencial en la hepatopata grasa no alcohlica, tanto en
nios como en adultos, lo que ha llevado a considerar esta enfermedad heptica un componente
ms del sndrome metablico. Su diagnstico en la poblacin infantil est aumentando,
especialmente entre los pacientes obesos o con diabetes tipo 2.
Otra condicin asociada con la resistencia a la insulina es el sndrome de ovario poliqustico (SOP).
Las adolescentes obesas con SOP presentan mayor resistencia a la insulina que aquellas sin SOP.
Mltiples mecanismos fisiopatolgicos han sido propuestos para esta asociacin siendo ms
aceptado que la hipersinsulinemia favorece una situacin de hiperandrogenismo. La insulina
aumenta la sensibilidad hipofisiaria al GnRH y, consecuentemente, la secrecin de LH, incrementa
la fijacin ovrica de IGF-1, lo que aumenta el efecto de la LH sobre la produccin ovrica de
andrgenos; de forma ms directa tambin estimula la sntesis de andrgenos en el ovario a
travs del receptor de la insulina o receptor del IGF-1; activa enzimas implicados en la sntesis de
andrgenos y disminuye la produccin heptica de globulina fijadora de hormonas sexuales, lo
que contribuye a unos mayores niveles de andrgenos libres circulantes.
A nivel vascular, la insulina estimula la produccin de xido ntrico por las clulas endoteliales, lo
que da lugar a vasodilatacin y aumento de flujo sanguneo. De este modo, aumenta la captacin
de glucosa por las clulas musculares. En las condiciones patolgicas que se acompaan de
resistencia perifrica a la insulina, existe una disfuncin endotelial caracterizada por la reduccin
de la actividad vascular dependiente de xido ntrico. Esta situacin puede contribuir a la
aceleracin del proceso aterosclertico y al desarrollo de enfermedad coronaria e hipertensin. La
unin de la insulina a su receptor activa dos cascadas de transduccin de seales; una mediada
por fosfatidilinositol-3-cinasa (P13K), bsicamente implicada en los efectos metablicos y
vasculares, y otra mediada por protein-cinasa activada por mitgenos (MAPK), implicada en la
seal mitognica. En los estados de resistencia a la insulina, la hiperglucemia, la dislipidemia y el
aumento de mediadores inflamatorios influyen en una menor activacin de la va P13K,
aumentando la de la va MAPK. La consecuencia es la aparicin de disfuncin endotelial asociada y
el aumento de factores prohipertensivos y atergenicos.
Implicaciones de la resistencia a la insulina en el tratamiento de la obesidad.
Las estrategias clsicas diseadas para el tratamiento de la obesidad en la edad infanto-juvenil han
tenido como objetivo prioritario el control de peso, recurriendo para ello a la restriccin calrica,
modificacin del comportamiento alimentario, actividad fsica y, en ocasiones, el uso de frmacos.
Sin embargo, este tipo de abordaje no se ha demostrado efectivo a nivel poblacional. Otras
estrategias ms recientes han priorizado en sus objetivos el control de las alteraciones metablicas
asociadas a la obesidad y la reduccin del riesgo de enfermedad crnica, ms all de la mera

reduccin del peso corporal.


Diversos estudios han sugerido que el incremento del nivel de actividad fsica en nios obesos
mejora su perfil de riesgo metablico y cardiovascular, reduciendo la grasa corporal y optimizando
su distribucin y reduciendo la glucemia en ayunas y la trigliceridemia. El ejercicio aerbico, es el
recomendado habitualmente en poblacin peditrica para analizar los efectos de la actividad
fsica, sin embargo a travs de la experiencia que se tiene pacientes adultos, se ha sugerido que los
ejercicios de entrenamiento de la fuerza muscular (entrenamiento con resistencia) pueden ser
tiles para mejorar la sensibilidad a la insulina, aunque no est claro si este efecto est en relacin
con la disminucin de la grasa corporal o participan otros mecanismos.
Con respecto al tratamiento diettico de la obesidad infantil, estudios recientes han puesto de
manifiesto diversos aspectos que matizan las recomendaciones tradicionales de carcter
fundamentalmente cuantitativo, centrados en la reduccin global de caloras y fundamentalmente
a expensas de la limitacin de la ingesta de grasas. Se ha referido cmo cambios cualitativos en los
componentes hidrocarbonados de la dieta pueden mejorar la sensibilidad a la insulina y a la vez
contribuyen al control del peso, siendo estos cambios ms eficaces que la disminucin a secas de
la proporcin de caloras procedente de los hidratos de carbono. Los alimentos de bajo ndice
glicemico disminuyen la demanda de altos niveles de insulina, con la consecuente mejora en la
situacin de resistencia insulinica. Esto ha sido documentado en nios y adolescentes obesos, al
igual que la eficacia de estos alimentos para contribuir al control del peso. En parte esto es debido
a que la ingesta de dietas con bajo ndice glicmico se asocia con una disminucin de la ingesta
calrica total diaria. De igual manera, la sustitucin de bebidas azucaradas por agua favorece la
mejora en los niveles de glicemia en ayunas y en la respuesta insulnica. La ingesta de fibra,
especialmente la soluble, tiene asimismo efectos beneficiosos sobre el control glucmico, adems
de promover una menor ingesta calrica debido a su efecto saciante. Los alimentos que producen
menores elevaciones de la glucemia postingesta son ms saciantes porque su tasa de digestin y
absorcin es ms lenta, por lo que los receptores de nutrientes del tracto gastrointestinal son
estimulados durante largos perodos de tiempo. Esto resulta en una prolongacin de las seales de
retroalimentacin sobre el centro de la saciedad a nivel central, a travs de mediadores como la
colecistoquinina y el pptido tipo glucagn-1. Sin embargo, tras el consumo de alimentos con alto
ndice glicmico, los niveles plasmticos de insulina se elevan llamativamente, lo que da lugar a
una rpida reduccin de las concentraciones de glucosa y cidos grasos, en ocasiones incluso por
debajo de los niveles de ayuno. Esto conduce a una sensacin de falta de suministro energtico,
que fcilmente se traducir en un aumento de la ingesta en las horas posteriores.
El tipo de grasa contenida en la dieta tambin tiene influencia sobre la sensibilidad a la insulina.
Los datos referidos en la literatura sugieren que la sustitucin de cidos grasos saturados (AGS)
por cidos grasos mono y poliinsaturados (AGMI, AGPI) tiene efectos beneficiosos, siempre que la

ingesta total de grasa no sea elevada. Un reciente estudio prospectivo realizado en poblacin
peditrica indica igualmente que la reduccin de la ingesta de AGS mejora la sensibilidad a la
insulina en nios. Tradicionalmente se ha considerado que el tipo de cidos grasos ingeridos
influye en la composicin lipdica de las membranas celulares y en su fisiologa, lo que puede
afectar a los transportadores de glucosa y a la sensibilidad de los receptores insulnicos. Pero no es
ste el nico mecanismo propuesto. Se ha observado que los AGPI suprimen la expresin de genes
lipognicos, siendo capaces de inhibir la lipognesis heptica y estimular la oxidacin de cidos
grasos, efectos que pueden mejorar la sensibilidad del hgado a la insulina. De todas formas, la
ingesta diettica no es el nico factor que condiciona la composicin lipdica y los tejidos, puesto
que tambin influyen factores genticos, hormonales y de estilo de vida que determinan
conjuntamente el grado de actividad de las enzimas implicadas en la desnutricin y elongacin de
los cidos grasos.
Escasos estudios han profundizado en el abordaje farmacolgico de la resistencia a la insulina en
nios obesos. Los resultados al respecto con el uso de metformina no han sido uniformes, en
general se ha observado un efecto beneficioso sobre el ndice de masa corporal y las
complicaciones metablicas de la obesidad.
Referencia
Lpez Ana Moris. La obesidad en los nios. Captulo 11: Resistencia perifrica a la insulina. Pg
201-209.

Alteraciones Lipdicas e Hipertensin Arterial en Pacientes con Obesidad Infantil

INTRODUCCION
Cuando hablamos de dislipemia en la obesidad infantil nos referimos a alteraciones del patrn de
lpidos plasmticos, ligadas al incremento de la grasa corporal, caracterizado por un aumento de
triglicridos (TG), as como de colesterol total (CT) a base de lipoprotenas de baja densidad (LDL) y
disminucin de lipoprotenas de alta densidad (HDL).
La hipertensin arterial (HTA) que acompaa a la obesidad viene definida por un aumento de la
presin sistlica y diastlica en respuesta a las alteraciones que surgen en las capas ntima y media
de las arterias por el acmulo de macrfagos cargados de lpidos (estras grasas) y formacin
posterior de placas ateromatosas; y en la capa muscular, en respuesta al trastorno
neuroendocrino secundario debido al acmulo patolgico de grasa corporal.
En este captulo se revisan los criterios diagnsticos de dichas alteraciones, los parmetros de
referencia y puntos de corte para su diagnstico, as como las evidencias cientficas en las que se
soporta el dao que ambas situaciones provocan a nivel arterial, condicionando su importancia
como factores de riesgo cardiovascular.

ALTERACIONES LIPIDICAS EN LA OBESIDAD INFANTIL


Fisiopatologa de la dislipemia
La dislipemia que acompaa al acmulo patolgico de grasa corporal se relaciona con las
hormonas que derivan del tejido graso, especialmente insulina, leptina y adiponectina, cuya
secrecin est alterada en la obesidad.
Niveles elevados de leptina, actan estimulando la liplisis para prevenir el acmulo graso en
tejidos no adiposos y evitar su efecto nocivo en la funcin celular. Este incremento de la oxidacin
leptina-dependiente se produce a travs del hipotlamo, va sistema nervioso simptico, y
contribuye a la hipertrigliceridemia de la obesidad y otros desrdenes metablicos.
La hiperinsulinemia y la resistencia a la insulina parecen ser el punto clave del sndrome
metablico (SM), ya que est implicada en la dislipemia, la hipertensin arterial, la disfuncin
endotelial y el estado pretrombtico. La insulina afecta principalmente a la sntesis de glucgeno y
a la lipognesis y cuando aumenta promueve deposicin de grasa, con el subsiguiente aumento de
la expresin de leptina. Es muy probable que la leptina sea una seal enviada desde los adipocitos
a los islotes pancreticos para que incrementen la secrecin de insulina cuando el contenido de
grasa aumenta y la sensibilidad a la insulina baja. Sin duda se necesitan ms investigaciones que
liguen o relacionen hiperleptinemia y resistencia a insulina, tanto en situaciones fisiolgicas como

patolgicas.
Finalmente, la adiponectina parece en nexo de unin entre la adiposidad, resistencia a la insulina
y metabolismo lipdico. Se trata de una hormona del tejido adiposo antiinflamatoria y
antiaterognica. En humanos, la concentracin de adiponectina se correlaciona negativamente
con el grado de adiposidad y la concentracin de insulina y directamente con el grado de
sensibilidad de la insulina, tanto en sujetos sanos como en diabticos.
La adiponectina aumenta la sensibilidad a la insulina mejorando la oxidacin lipdica tisular, de lo
que resulta en una disminucin de TG y cidos grasos circulantes y de sus contenidos en hgado y
msculo. Acta mejorando la accin de transportadores de glucosa (especialmente del glut-4)
para favorecer la captacin de la misma. Tambin aumenta la tirosin-kinasa de los receptores de
insulina, mejorando la accin de la misma y, por tanto, la utilizacin de glucosa y la oxidacin de
cidos grasos. Se han identificado receptores de adiponectina (adipo R1 y R2) en hepatocitos y
clulas musculares.
El sistema PPAR son un conjunto de protenas de la familia de los receptores de membrana que
median los efectos, a nivel gnico, de las hormonas esteroideas, los glucocorticoides, la tiroxina, el
cido retinoico y la vitamina D. Se conocen tres isoformas (, , ). En general el PPAR-, modula
la expresin de genes involucrados en el transporte lipdico heptico, en la hidrlisis de TG y
cidos grasos y en la homeostasis lipdica del corazn
En resumen, la disminucin de la adiponectina que acompaa a la obesidad justifica la alteracin
del perfil lipdico y del tono vascular, incrementando el riesgo aterognico. La hiperleptinemia
ligada al aumento de la masa grasa corporal favorece el incremento de la liplisis (con elevacin
de los lpidos plasmticos), la disminucin de la neoglucognesis y la resistencia a la insulina, a la
vez que provoca estimulacin simptica, responsable en parte de la hipertensin.
El Perfil Lipdico aterognico
Las alteraciones del perfil graso acompaan con frecuencia a la obesidad desde la infancia,
formando parte del sndrome metablico (SM), en ntima relacin con la insulinorresistencia.
Inicialmente, la hipercolesterolemia fue el factor ms implicado, al que progresivamente se
incorporaron otros.
La Academia Americana de Pediatra, en su informe de 1992 sobre diagnstico y prevencin de las
dislipemias en la infancia, pona especial nfasis en la deteccin de los niveles de colesterol total
(CT), sealando la necesidad de realizar un perfil lipdico en los nios mayores de 2 aos con
antecedentes familiares de ECV o hipercolesterolemia, as como en los obesos, hipertensos y
diabticos. En esta publicacin se aportaban los puntos de corte clasificando los hallazgos en
aceptables (CT< percentil 75, LDL > 110mg/dl), borderline (CT percentil 75-90 y LDL 110-119
mg/dl) y elevado (CT percentil 90, LDL >119 mg/dl).

Prediccin de la Ateromatosis del nio a la del adulto: Efecto tracking


Dos son los aspectos ms importantes a aclarar respecto a la dislipemia que acompaa a la
obesidad infantil: la dislipemia temprana supone un riesgo de presentar un perfil lipdico
patolgico en la edad adulta (tracking)? Y supone por s misma un riesgo de ateromatosis para el
propio nio?
La tendencia a mantener niveles similares de colesterol en la infancia y en la edad adulta se ha
demostrado en el estudio Muscarine en el que el 75% de los nios que presentaban un CT
superior al percentil 90 mantenan cifras superiores a 200 mg/dl a los 20 aos. Datos similares
(70%) fueron encontrados en el estudio longitudinal Bogalusa y en otros. Por ello se aconseja el
control y seguimiento de las dislipemias infantiles, especialmente en pacientes de riesgo.
Con respecto al comienzo de ECV en el nio, la lesin inicial es la estra grasa, caracterizada por un
acmulo de lpidos en los macrfagos de la ntima de las arterias. Contina con mayor acmulo en
los macrfagos y proliferacin de las clulas musculares lisas de los vasos. Ests clulas musculares
migran en la ntima y forman una lesin llamada placa fibrosa, responsable de la isquemia
miocrdica y del infarto, bien por obstruccin de la arteria, bien por rotura de la placa liberando
sustancias trombognicas.
Ms recientemente, se ha podido demostrar por mtodos no invasivos, como la medicin del
espesor de las capas ntima y media de la cartida por ultrasonido, que las lesiones vasculares
comienzan en la infancia, y que su intensidad se correlaciona positivamente con otros factores de
riesgo en nios de 8 a 18 aos, como hipertensin arterial y alteraciones en el test de tolerancia a
la glucosa, protena C reactiva, molculas de adhesin, adiponectina y perfil lipdico.
Seleccin de parmetros de perfil lipdico en el obeso
Han sido mucho los parmetros propuestos para establecer el perfil lipdico de nios con obesidad
Si analizamos los parmetros lipdicos incluidos en las distintas definiciones del SM en general y de
la infancia en particular, resumidos en la tabla 1, observamos como la triadas ms importante
(incluida en los criterios de la distintas definiciones de SM) se caracteriza por hipertrigliceridemia,
descenso de HDL-colesterol y aumento de las partculas LDL, especialmente las densas y pequeas.

Parmetros
Cook 2003

Triglicridos
>100 mg/NCEP*

HDL-c
<40mg/dl NCEP*

Tensin arterial
>percentil 90
National Higt Blood
Pressure Educat
Program
Ferranti, 2004
>1,1 mmol/l (>100g/dl)
<1.1 mmol/L (<50mg/dl) >Percentil 90
Cruz, 2004
>Percentil 90
<Percentil 10
>Percentil 95
NHANES III*
NHANES III**
National Higt Blood
Pressure Educat
Program
Weis, 2004
>Percentil 95
<Percentil 5,
Percentil 95, National
NGHS*
NGHS*
Higt Blood Pressure
Educat Program
Ford, 2005
>110 mg/NCEP*
<40 mg/dl NCEP*
>Percentil 90 National
Higt Blood Pressure
Educat Program
IDF, 2007
>110 mg/NCEP*
< 40 mg/dl NCEP*
>Percentil 90 o 95
National Higt Blood
Pressure
Educat
Program
Tabla 1: Parmetros lipdico y tensin arterial utilizado en la definicin del sndrome metablico en nios y
adolescentes.
*Aplicando tablas de referencia del National Cholesterol Education Program.
**Aplicando tablas de referencia del Nhanes III Study.
Conversin de mmol/l a mgr/Dl; se multiplican por 88.5 en los triglicridos y por 38.67 el colesterol total,
HDL-c y LDL-c.

HIPERTENSION ARTERIAL EN LA OBESIDAD INFANTIL


Concepto de Hipertensin
Se considera hipertensin (HTA) la elevacin de la presin sangunea por encima del percentil 90
para una determinada edad y sexo. De forma fisiolgica las cifras van aumentando hasta la
pubertad correlacionndose con la edad, peso y especialmente con la talla. Los valores de
referencia ms utilizados son los del estudio The fourth report of high blood pressure in children
and adolescent.

Fisiopatologa hipertensin arterial en la obesidad.


La asociacin entre la obesidad e HTA es conocida desde antiguo y figura entre las comorbilidades
del SM tanto en adultos, como en nios.
El hiperinsulinismo favorece la aposicin de lpidos en las arterias, disminuyendo su elasticidad.
Tambin es responsable de la vasoconstriccin y finalmente de la retencin de Na que, al
favorecer la hipervolemia conduce a HTA.
Pero, aunque la aparicin de la HTA parece relacionarse claramente con la resistencia a la insulina,
los mecanismos son, sin duda ms complejos. Por un lado existe una correlacin positiva entre las
tasas de insulinemia y las de tensin arterial.
Tambin influye la disminucin de la adiponectina (hormona reguladora del tono vascular) y el
incremento de la leptina, estimulando el sistema nervioso simptico.
La TNF- producida por el tejido adiposo periarterial de los obesos, determina como efecto
paracrino, el incremento de la produccin de cido ntrico, que dar lugar a la vasoconstriccin
arteriolar mantenida.
El hecho ms llamativo es la disminucin de la flexibilidad arterial, que se evidencia con un
incremento de la tensin sistlica. Ella aparece con frecuencia 3 veces superior cuando coexiste la
obesidad con resistencia a la insulina o diabetes mellitus-2 en adultos.
Una vez establecida la insulino-resistencia, se liberan en sangre sustancias con efecto
antidiurtico, lo que junto a su adicional estimulacin del sistema nervioso simptico (SNS), hacen
insensibles los vasos al estmulo vasodilatador.
El SNS tambin resulta estimulado por algunos de los factores que tambin condicionan la
obesidad y el SM como la ingesta excesiva, el estrs, la depresin o la ansiedad. Siguiendo la teora
de Bjorntorp, estos factores incrementan la produccin de cortisol, que es seguida de una
disminucin de la GH y hormonas sexuales, favoreciendo la hipertensin.
Otra de las comorbilidades de la obesidad, la elevacin del LDL- c, favorece la peroxidacin lipdica
en el endotelio, dando lugar a una alteracin de la expresin gnica de las clulas endoteliales,
provocando disminucin del xido ntrico que aumenta el tono vascular promoviendo el
reclutamiento de monolitos y linfocitos T a travs del aumento de la expresin de molculas de
adhesin y factores quimiotcticos.
Las LDL oxidasas alteran, pues, la estructura y funcin de la pared vascular, dando lugar a
vasoconstriccin e induciendo apoptosis de las clulas musculares lisas. La formacin de placas
ateromatosas condiciona un aumento de las resistencias vasculares perifricas. De esta forma, la
hipertensin y la dislipemia del nio con obesidad actan sinrgicamente justificando el riesgo de
ECV.

Catalogacin de la hipertensin
En el nio debido a las variaciones observadas durante el crecimiento, es necesario utilizar los
percentiles, aceptndose que por encima del 90 (del 95 para algunos expertos) se puede catalogar
de HTA. (Tabla 1)

Referencia
Margarita Alonso Franchs, Paz Redondo del Ro y Beatriz de Mateo Silleras. La obesidad en los
nios. Captulo 12: Alteraciones lipdicas e hipertensin arterial en pacientes con obesidad
infantil. Pag: 211-224.

Recomendaciones del Comit de Expertos relacionado con la Prevencin, Evaluacin y


Tratamiento del Sobrepeso y la Obesidad en la Niez y Adolescencia: Resumen del
Informe
Para revisar las recomendaciones sobre obesidad en la niez de 1998, se conformo un comit de
expertos con 15 organizaciones profesionales, las cuales nombraron a cientficos y clnicos para
conformar 3 grupos de escritura y revisar la literatura y los abordajes recomendados para la
prevencin, evaluacin y tratamiento. Debido a que las estrategias efectivas todava permanecen
poco definidas, los grupos utilizaron tanto la evidencia disponible como la opinin de expertos
para escribir las recomendaciones. El grupo de profesionales proporcion una calificacin de la
evidencia, para que los lectores pudieran apreciar las limitaciones de estas recomendaciones y
revisar o estar atentos a nuevos estudios que las refinen. La calificacin de las categoras se hizo
como sigue:
1. Recomendado con evidencia consistente (EC), eso quiere decir, varios estudios
generalmente muestran una asociacin consistente entre el comportamiento
recomendado y el riesgo de obesidad o balance energtico;
2. Recomendado con evidencia mixta (EM), quiere decir, algunos estudios demuestran
evidencia sobre beneficios en peso o balance energtico pero otros no mostraron una
asociacin significativa, o los estudios fueron pocos en nmero o pequeos en cuanto al
tamao de la muestra.
3. Sugiere, quiere decir, los estudios no han evaluado la asociacin de la recomendacin con
el peso o el balance energtico, o son pocos los estudios, pequeos en nmero, y/o sin
hallazgos claros; sin embargo, el comit de expertos piensa que estas recomendaciones
pueden sustentar el alcanzar un peso saludable y, si estudios futuros desaprueban tal
efecto, entonces estas recomendaciones podran tener otros beneficios y no causaran
dao.
CARACTERSTICAS EPIDEMIOLGICAS
Epidemia de la obesidad en la niez
El rpido incremento en la prevalencia de la obesidad en la niez ha alarmado a las agencias de
salud pblica, clnicos, investigadores y el pblico en general. En base a la medicin de peso y talla
de muestras representativas de nios de EUA evaluados aproximadamente cada 5 aos, la
prevalencia de obesidad ha incrementado de 5% en 1963 a 1970 a 17% en 2003 a 2004. Los
clnicos han tenido que enfrentar el abordar este problema con un nmero de pacientes que va
incrementando.
El sobrepeso y la obesidad se definen en base al IMC segn edad y sexo. El incremento en la
prevalencia de la obesidad se mide entonces en base a un punto de corte, el 95 percentil de IMC

para la edad y el sexo.

Caractersticas demogrficas
La epidemia de la obesidad afecta de forma desproporcionada algunos grupos raciales o tnicos.
En el 2003-2004, las tasas de prevalencia eran particularmente altas en las nias de raza negra
(24%) y en los varones Mxico Americanos (22%). Las tasas han incrementado en los nios
Americanos Nativos y Americanos Asiticos. Adems de todo, la pobreza se ha asociado con
mayores prevalencias de obesidad en los adolescentes, sin embargo, se han encontrado
diferencias entre subgrupos. Entre ms alto el nivel socioeconmico menor es la prevalencia de
obesidad entre nias blancas pero no en nias de raza negra.
Causas
Tanto los genes como el ambiente contribuyen con los riesgos de obesidad. Estudios en gemelos
han demostrado claramente un riesgo gentico, y el descubrimiento de la leptina, grelina,
adiponectina, y otras hormonas que influyen en el apetito, saciedad y distribucin de grasa
brindan un panorama de los mecanismos metablicos involucrados. Con tantas sustancias y
tantos sitios genticos asociados a la obesidad, el sistema es complejo, redundante y poco
probable de poder abordar con una simple intervencin a travs de medicamentos. Sin embargo,
los genes no significan un destino. As es como el comportamiento y el ambiente influyen
fuertemente en el riesgo de la persona de desarrollar obesidad. A nivel poblacional, el incremento
en la prevalencia es muy rpido como para ser explicado por un cambio gentico; por tanto parece
ms un resultado de cambios en los comportamientos de la alimentacin y la actividad fsica que
han cambiado el balance entre la ingesta energtica y el gasto energtico.

PANORAMA DE LA ATENCION CLINICA


Evaluacin universal del riesgo de obesidad
Aunque el IMC no es una medida precisa de la grasa corporal o del riesgo de la salud, este
representa la medida inicial que debe calcularse en la consulta a cada nio y debe servir como el
punto de partida para la clasificacin de riesgos a la salud. Los nios en la categora de peso
saludable (IMC en 5 84 percentil) tienen menor riesgo, sin embargo la obesidad en los padres, la
historia mdica familiar, y los comportamientos actuales relacionados con la dieta y la actividad
fsica pueden alterar la evaluacin. Estos nios y sus familias deben recibir apoyo para mantener o
establecer hbitos de vida saludables (prevencin). Los riesgos incrementan cuando los nios se

encuentran en la categora de sobrepeso, 85 al 94 percentil de IMC, y nuevamente se ve


influenciado por la obesidad en los padres, la historia mdica familiar, y los hbitos actuales en
estilo de vida, as como por la trayectoria de IMC y los factores de riesgo cardiovascular actuales.
Algunos de estos nios deben recibir consejera para la prevencin, sin embargo otros deben
recibir una intervencin un tanto ms activa. Los nios con un IMC mayor al 95 percentil (obesos)
tienen mayor probabilidad de presentar riesgos a la salud relacionados con la obesidad, y la
mayora de ellos deben ser orientados a enfocarse en prcticas para el control de peso. Los
profesionales de la salud deben utilizar su juicio en evaluar los riesgos a la salud, debido a que no
existe una frmula en la cual se pueda integrar el patrn de IMC, los antecedentes familiares, y los
comportamientos saludables para determinar el peso y la salud futura.
PREVENCION
Importancia
Los esfuerzos por prevenir la obesidad deben iniciar temprano en la vida, debido a que la obesidad
en la niez, especialmente en los nios mayores y aquellos con obesidad severa, es probable que
persista en la adultez. Por tanto, la infancia representa una oportunidad importante para
establecer comportamientos de alimentacin saludable y actividad fsica que pueden proteger al
nio de la obesidad en el futuro.
El objetivo de la prevencin de la obesidad deben ser todos los nios, iniciando desde el
nacimiento. Los comportamientos de estilo de vida para prevenir la obesidad, ms que las
intervenciones para mejorar el peso, deben promoverse en los nios con un IMC normal (5 al 84
percentil), y algunos nios en la categora de IMC de sobrepeso (85 a 94 percentil), dependiendo
del patrn de crecimiento y los factores de riesgo. Los clnicos deben saber que los nios tienen
mayor riesgo de obesidad cuando tienen un padre obeso o aquellos cuya madre tuvo diabetes
mellitus durante el perodo de gestacin del nio. De hecho los nios con 1 o 2 padres obesos
tienen mayor riesgo de ser obesos en la edad adulta, aun cuando su peso actual es normal.
Comportamientos a abordar
Los clnicos deben aconsejar a los pacientes y sus familias que adopten y mantengan los siguientes
comportamientos relacionados con alimentacin, actividad fsica y sedentarismo. Estos hbitos
saludables pueden ayudar a prevenir la ganancia de peso excesiva y es poco probable que causen
dao, basado en el conocimiento actual. Existe evidencia que apoya lo siguiente:
1. Limitar el consumo de bebidas azucaradas. (EC)
2. Promover el consumo de ditas con cantidades recomendadas de frutas y vegetales. (EM)
3. Limitar el tiempo de ver televisin y otros dispositivos de pantalla (La Asociacin
Americana de Pediatra recomienda que los nios menores de 2 aos no vean televisin y

4.
5.
6.

7.

despus de esa edad no ms de 2 horas de televisin al da) y eliminar la televisin y otros


dispositivos de pantalla del dormitorio del nio. (EC)
Comer desayuno todos los das (EC)
Limitar el comer en restaurantes, particularmente restaurantes de comida rpida (EC)
Promover comidas familiares en las que los padres y los nios coman juntos (EC) (las
comidas familiares se asocian con una dieta de mayor calidad y con una menor
prevalencia de la obesidad, as como tambin con otros beneficios psicosociales); y
Limitar el tamao de porciones (EC);

En relacin a la prevencin tambin se recomienda, basado en los anlisis de informacin


disponible y la experiencia, los siguientes comportamientos:
1. Consumir una dieta alta en calcio;
2. Consumir una dieta alta en fibra. ;
3. Consumir una dieta balanceada en macronutrientes (energa de grasa, carbohidratos y
protenas en proporciones adecuadas para la edad).
4. Promover la lactancia materna exclusiva los primeros 6 meses de edad y mantener la
lactancia materna despus de introducir los alimentos slidos hasta los 12 meses de edad
o ms.
5. Promover la actividad fsica moderada y vigorosa por al menos 60 minutos al da; y
6. Limitar el consumo de alimentos energticamente densos.
Implementacin
La complejidad de la prevencin de la obesidad se basa menos en la identificacin de
comportamientos saludables que deben abordarse y mucho ms en el proceso de promover en las
familias el cambio de comportamiento cuando los hbitos, cultura y ambiente promueven menos
actividad fsica y mayor ingesta energtica. Dar a las familias una lista de de hbitos de
alimentacin o de actividad fsica como si fuera una receta de antibiticos es una manera
tradicional de brindar atencin mdica y representa una forma poco efectiva de abordar el
problema.
El papel de la familia
Varios estudios sobre el tratamiento de la obesidad en los nios han demostrado la importancia
de la participacin de los padres en los programas de control de peso. El compromiso de los
padres y de otros cuidadores para ayudar al nio a desarrollar hbitos saludables y prevenir la
obesidad es muy importante. Los padres pueden servir como modelos, figuras de autoridad, y
moldeadores de conducta para inculcar a sus hijos hbitos de alimentacin y actividad fsica. Los

clnicos pueden tener influencia en los hbitos de los nios indirectamente enseando y
motivando a los padres a que usen su autoridad de forma efectiva. En los nios ms pequeos, los
clnicos deben enfocar la discusin en los comportamientos de los padres. La mayor
independencia en los adolescentes significa que los clnicos deben discutir los comportamientos
saludables con ellos directamente, sin embargo debe solicitar a los padres que mantengan un
ambiente saludable en el hogar.
Las acciones de los padres que apoyen los comportamientos identificados difieren con la edad del
nio, y el clnico puede proporcionar material adecuado para ayudar a los padres. Los clnicos
actan como consejeros en la prevencin y atencin de la obesidad. A continuacin se muestran
algunas tcnicas que pueden ayudar a mejorar los hbitos saludables en los nios y sus padres.

Comunicacin basada en el paciente


Las siguientes teoras asumen que las instrucciones del clnico sern efectivas para cambiar un
comportamiento solo si el padre o la familia reconocen que existe un problema potencial y
quieren abordarlo o prevenir ese problema. Por tanto, parte del trabajo del clnico es ayudar a
motivar a las familias. Las tcnicas de consejera se presentan como formas de promover los
comportamientos para la prevencin de la obesidad, pero las mismas puede aplicarse en el
tratamiento de la obesidad.
La teora de etapas de cambio define varias etapas cognitivas que preceden el cambio de
conducta. De acuerdo con esta teora, un apersona puede inicialmente no identificar un problema,
luego pasar a identificar el problema pero no pensar en abordarlo, luego planifica un nuevo
comportamiento y finalmente inicia con el nuevo comportamiento. El clnico puede ayudar a los
pacientes y sus familias a pasar a travs de estas etapas, ms que a prescribir un nuevo
comportamiento a aquellos que no estn listos. Las investigaciones muestran que los padres de los
nios con sobrepeso y obesidad frecuentemente no se han percatado de la condicin.
La tcnica de la entrevista motivacional, la cual tambin toma en cuenta la disponibilidad del
paciente a realizar el cambio, utiliza preguntas que no hacen juicios y la escucha reflectiva para
conocer las creencias y valores de los padres y el paciente. Al escuchar las preocupaciones del
paciente, el clnico puede motivar ms que imponer, y luego ayudar al paciente a formular un plan
que sea consistente con sus propios valores.
Las tcnicas cognitivas y de comportamiento puede ayudar a los pacientes y sus familias que
estn preparados para modificar comportamientos a lograr estos cambios. Los profesionales de la

salud pueden promover el establecer metas, monitorear los cambios de comportamiento


priorizados, y proporcionar una realimentacin positiva. Las metas iniciales deben ser fciles de
alcanzar, tales como iniciar con 15 minutos de actividad fsica o consumir solamente una porcin
de bebida azucarada cada da. La realimentacin por parte de los padres debe darse en funcin de
los cambios en las metas de conducta ms que en los cambios en el peso corporal y debe
realizarse en forma de apreciacin verbal o un privilegio que no sea comida. Los profesionales de
la salud y los padres deben enfocarse en los xitos y no en los fracasos.
El papel del clnico
Se recomiendan las siguientes prcticas:
1. Documentacin contina del IMC. Para documentar el IMC de forma consistente y precisa,
se debe contar con balanzas confiables para infantes y para nios, tallimetros adecuados
para la edad. Este equipo necesita de calibracin regular.
2. Establecer el procedimiento para brindar mensajes de prevencin de la obesidad a los
nios. Cuando el riesgo del obesidad es bajo, estos mensajes pueden promover una salud
apropiada o bienestar, ms que un control del peso. Por ejemplo, en una clnica en Maine
y Massachusetts se promueve el mensaje 5 2 1 0, el cual recuerda a las familias que deben
consumir 5 porciones de frutas y vegetales, no pasar ms de 2 horas frente a una
pantalla, incluir 1 hora de actividad fsica o juego activo, y consumir poco o ninguna bebida
azucarada. Los clnicos recuerdan estos mensajes a las familias en todas las visitas de
chequeo.
3. Establecer el procedimiento para el abordaje de los nios que tienen sobrepeso (85 a 94
percentil) y los nios obesos (95 percentil). Por ejemplo, cuando un nio tienen
sobrepeso, una prctica podra ser el revisar la historia familiar, la presin arterial del
nio, los niveles de colesterol, la historia de IMC a travs del tiempo y luego evaluar los
factores de riesgo basado en esa informacin.
4. Involucramiento y capacitacin de equipos multidisciplinarios, incluyendo enfermeras,
mdicos y personal administrativo para que todos conozcan sus responsabilidades y
habilidades respectivas;
5. Revisin de las fichas de los pacientes para establecer prcticas bsicas, para ayudar a
establecer metas para la mejora de las prcticas y luego medir los mejoras a travs del
tiempo.
El papel de la escuela y de la comunidad
El ambiente escolar y comunitario influye tambin en la prevencin de la obesidad. Los clnicos
pueden apoyar los programas escolares y comunitarios que ayudan a prevenir la obesidad a
travs de la abogaca local, estatal o nacional y pueden motivar a las familias de los pacientes a

que manifiesten sus preferencia a las escuelas a travs de organizaciones de padres y


maestros o reuniones de comits o directamente a los directores, maestros o directores de los
programas extra curriculares. En las escuelas se recomiendan clases adecuadas de educacin
fsica y perodos de receso y el establecimiento de estndares nutricionales de los alimentos
que se sirven en las escuelas, incluyendo alimentos en las mquinas expendedoras y otros
alimentos que compiten. Para mejorar el ambiente comunitario, los profesionales de la salud
pueden abogar por el establecimiento y mantenimiento de parques y centros recreacionales
apropiados, y pueden solicitar que las abarroteras locales ofrezcan alimentos saludables a
bajo costo.
EVALUACION
Riesgos
Cuando el IMC de un nio se encuentra por encima del 85 percentil, el clnico debe evaluar los
riesgos mdicos y de comportamiento antes de iniciar cualquier intervencin. Entre los riesgos
mdicos se incluye el riesgo de obesidad en el futuro o persistente, riesgo de condiciones mdicas
relacionadas a la obesidad, e identificacin de condiciones mdicas actuales relacionadas con la
obesidad. Riesgos de conducta en los cuales se incluye hbitos alimentarios actuales, y
comportamientos sedentarios que provocan el desbalance energtico. Estas evaluaciones deben
hacerse antes de implementar el tratamiento basado en conductas.
Evaluacin Mdica
Evaluacin de la grasa corporal
El percentil de IMC, aun que no es perfecto, es la medida de tamizaje recomendada para la
evaluacin de grasa corporal. No se recomienda la medicin de pliegues cutneos. Aunque estas
medidas proporcionan informacin sobre la grasa corporal y el riesgo de condiciones mdicas, no
son fiables ya que son difciles de medir de forma precisa sin una capacitacin cuidadosa y
experiencia los datos de referencia no estn disponibles.
De forma similar, la circunferencia de cintura no se recomienda. La medida de circunferencia de
cintura puede brindar informacin indirecta sobre la adiposidad visceral, la cual se correlaciona
con factores de riesgo cardiovascular y metablico, y es ms fcil de tomar que los pliegues
cutneos, pero los valores de referencia para nios que identifican el riesgo sobre y por arriba de
la categora de IMC no estn disponibles.
Las categoras del percentil de IMC guan la evaluacin del riesgo mdico; el peso entre el 5 y el 85
percentil es saludable, el 85 al 94 percentil sobrepeso, y 95 percentil es obesidad, y cuando es

mayor al 99 percentil indica una alta probabilidad de problemas mdicos asociados.


Obesidad en los padres
La obesidad en los padres es un factor de riesgo fuerte para que la obesidad del nio persista en la
adultez, especialmente en los nios pequeos. La vulnerabilidad gentica juega un papel
importante en el desarrollo de la obesidad. Aunque actualmente no es posible realizar pruebas
por genotipos especficos o adaptar el tratamiento en base a la informacin gentica, el saber que
existe un alto riesgo de obesidad en la familia, especialmente obesidad en los padres, debe
orientar a realizar mayores esfuerzos por establecer o mejorar los hbitos saludables.
Historia mdica familiar
Varias condiciones mdicas relacionadas con la obesidad son familiares. La historia mdica familiar
precie la diabetes mellitus tipo 2 o la resistencia a la insulina. La enfermedad cardiovascular los
factores de riesgo cardiovasculares (hiperlipidemia e hipertensin) tambin son comunes cuando
la historia familiar es positiva.
Evaluacin de problemas relacionados con el peso
Evaluacin
Las condiciones mdicas relacionadas con la obesidad afectan casi todos los sistemas en el cuerpo.
Una revisin de los sistemas y una evaluacin fsica representan una forma barata de realizar una
evaluacin de muchas de estas condiciones, aunque algunas de estas condiciones se presentan sin
sntomas o signos. A continuacin se mencionan las condiciones mdicas ms importantes
relacionadas con el peso, sus sntomas ms comunes y las pruebas de evaluacin ms apropiadas.
Problemas del sueo
La apnea del sueo obstructiva puede llevar a una hipertrofia del ventrculo izquierdo e
hipertensin pulmonar. Adems las alteraciones en el sueo conducen a falta de atencin, mal
desempeo acadmico, y enuresis. Esta condicin es uno de los problemas ms serios y es ms
frecuente en los nios que son severamente obesos. La prevalencia es alta en los nios obesos, y
puede presentarse en 50% de los adolescentes con obesidad severa. Los sntomas que pueden
identificar los padres son ronquidos altos con pausas en respiracin, sueo intranquilo, y
somnolencia durante el da. En la evaluacin fsica, pueden presentar hipertrofia tonsilar, aunque
la apnea del sueo puede darse sin hipertrofia tonsilar o an despus de haber removido los
adenoides o las amgdalas. El diagnstico se realiza a travs de polisomnografa. El tratamiento
deber incluir el retirar los adenoides o amgdalas si estos estn inflamados. Si este tratamiento no
es efectivo o no est indicado, entonces un neumlogo deber evaluar al paciente para darle una

terapia de presin positiva continua al paciente durante el sueo.


En el sndrome de hipoventilacin de la obesidad, el peso de la grasa sobre el pecho y el abdomen
limita la ventilacin; estos pacientes son extremadamente obesos. Estos pacientes presentan altos
niveles de dixido de carbono. Estos pacientes pueden tener niveles altos de hemoglobina y
hematocrito. Requieren de una continua terapia de presin positiva hasta que una prdida de
peso sustancial alivie el problema.
Problemas respiratorios
El asma puede presentarse con mayor frecuencia en los nios obesos. La falta de aliento y la
intolerancia al ejercicio pueden ser sntomas de asma, ms que signos de una mala condicin
fsica. El diagnstico se realiza de la misma forma. Los pacientes obesos necesitarn de una gua
sobre el manejo del asma durante la actividad fsica o los juegos al aire libre; para minimizar las
limitaciones durante el ejercicio.
Problemas gastrointestinales
La enfermedad del hgado graso no alcohlico (EHNA) es una condicin que cada vez preocupa
ms ya que es una condicin que ha ido incrementando su prevalencia con la obesidad y diabetes;
los cuales son factores de riesgo importantes. El trmino EHNA incluye la esteatosis simple,
esteatohepatitis, fibrosis y cirrosis resultado del hgado graso. La EHNA generalmente no presenta
sntomas, sin embargo algunos pacientes presentan dolor en el cuadrante superior derecho o
sensibilidad o una hepatomegalia leve. Los niveles de alanino aminotransferasa (ALAT) y aspartato
aminotransferasa (ASAT) que generalmente se encuentran elevados, son un buen examen. La
prdida de peso mejora los resultados de las pruebas hepticas y las caractersticas histolgicas, y
se estn llevando a cabo estudios sobre medicamentos. Cundo y con qu frecuencia se deben
realizar las pruebas de ASAT y ALAT no ha sido determinado; todava no hay recomendaciones
basadas en evidencia, el comit de expertos sugiere una evaluacin bi anual iniciando a los 10
aos de edad en nios con un IMC 94 percentil que presentan otros factores de riesgo. Este
esquema coincide con las recomendaciones de evaluacin en la diabetes. Los niveles de ASAT y
ALAT dos veces mayores a lo normal deben ser razn para consultar un especialista en hgado lo
antes posible.
Los clculos en la vescula son ms frecuentes en los nios obesos y con sobrepeso. Adems, la
perdida rpida de peso incrementa el riego de clculos en la vescula. Episodios intermitentes de
dolor tipo clico en el cuadrante superior derecho del abdomen son sntomas clsicos, pero el
dolor leve y el dolor epigstrico pueden tambin presentarse. En la evaluacin fsica, puede
observarse sensibilidad en el cuadrante superior. El ultrasonido puede identificar los clculos y la
colecistitis.

Varios problemas gastrointestinales pueden exacerbarse con la obesidad como el reflujo


gastroesofgico y el estreimiento.
Problemas endocrinos
La diabetes mellitus tipo 2 es una de las condiciones ms serias asociadas a la obesidad.
Aproximadamente 45% de los nios diagnosticados con diabetes mellitus presentan diabetes tipo
2 y no tipo 1. Los pacientes pueden no tener sntomas como poliuria y polidipsia;
consecuentemente, la identificacin requiere de evaluacin bioqumica para los nios en riesgo.
Los factores de riesgo son un IMC 85 percentil; historia familiar de diabetes; raza negra, hispano;
y otras condiciones relacionadas como el ovario poliquistico, acantosis nigricans o factores de
riesgo cardiovascular. La Asociacin Americana de Diabetes recomienda una evaluacin con
glucosa en ayunas cuando un nio presenta sobrepeso y tiene 2 factores de riesgo adicionales. El
tamizaje debe iniciarse en la pubertad o a los 10 aos de edad y deber llevarse a cabo cada dos
aos. Una glucosa en ayunas de 126 mg/dl o una glucosa al azar de 200 mg/dl son indicadores
de diabetes y requieren de una referencia al endocrinlogo pediatra. Los niveles de glucosa en
ayunas 100 mg/dl son considerados prediabetes, lo cual representa un riesgo futuro de diabetes.
El sndrome de ovario poliquistico se presenta en 8% de las mujeres jvenes entre 18 y 25 aos
de edad. Las mujeres con sndrome de ovario poliquistico tienen mayor probabilidad de ser
obesas. Perodos menstruales no frecuentes (< 9 ciclos) son el hallazgo ms importante al que hay
que darle seguimiento. Los hallazgos de la evaluacin fsica que son comunes son hirsutismo, acn
excesivo y acantosis nigricans. Las mujeres con ovario poliquistico frecuentemente presentan
resistencia a la insulina y diabetes tipo 2 y pueden tener sndrome metablico.
El hipotiroidismo es un tema de preocupacin entre los padres, pero esta condicin no causa
obesidad usualmente. La prevalencia es 1 caso por 1000. Los sntomas incluyen fatiga y
alteracin en el rendimiento escolar. El crecimiento lineal se detiene, lo cual es un signo
importante, y el bocio puede aparecer.
El sndrome primario de Cushing es extremadamente raro. La incidencia en la poblacin es de 2
casos por 1000000 anualmente, que aparece ms frecuentemente en la edad adulta que en la
niez. Debido a que la condicin se puede tratar, los clnicos deben estar atentos a los hallazgos
durante la evaluacin fsica como cara de luna y joroba de bfalo, sin embargo la obesidad
exgena tambin puede llevar a esta distribucin de grasa.

Factores de riesgo cardiovascular

Aproximadamente 13% de los nios con sobrepeso tienen presin sistlica elevada, y
aproximadamente 9% tienen presin sistlica alta. La presin arterial debe tomarse en todas las
visitas de monitoreo, y los clnicos deben contar con mangos grandes, los cuales se pueden utilizar
con nios severamente obesos. El Instituto de Corazn, Pulmn y Sangre (NHLBI) ha actualizado
las tablas definiendo los niveles de presin arterial elevados segn la edad, sexo y talla por lo cual
deben tenerse al alcance para una fcil referencia. Tres o ms lecturas sobre el percentil 95 ya sea
para la presin sistlica o la presin diastlica son indicadores de hipertensin. Para ms
informacin
puede
visitar
el
sitio
web
de
NHLBI
(www.nhlbi.nih.gov/health/prof/heart/hbp/hbp_ped.htm)
Las anormalidades en los lpidos se encuentran entre las condiciones mdicas ms comunes
relacionadas con la obesidad. Debido a su alta prevalencia, debe realizarse un perfil en ayunad
cuando el IMC se encuentra por arriba del percentil 85, an en ausencia de otro factor de riesgo.
Los niveles de colesterol total < 170 mg/dL son aceptables, los niveles entre 170 a 199 mg/dL se
encuentran en la categora de riesgo y los niveles 200 mg/dl son altos. Los niveles de
lipoprotena de baja densidad de <110 mg/dL son aceptables, los niveles de 110 a 129 mg/dL se
encuentran en riesgo, y los niveles 130 mg/dL son altos. Inicialmente se puede abordar el
problema con dietas bajas en grasa y colesterol; sin embargo, si los niveles permaneces
relativamente altos y no responden a los cambios en la dieta, un cardilogo pediatra o especialista
en lpidos puede evaluar los beneficios y riesgo s del uso de medicamentos. Los niveles anormales
de triglicridos, definidos como 110 mg/dL en adolescentes, y los niveles altos de lipoprotena
de alta densidad, definidos como 40 mg/dL responden al incremento en la actividad fsica.
Alteraciones psiquitricas
Los efectos de la obesidad en la calidad de vida pueden ser severos. La depresin es una
comorbilidad importante de la obesidad, y puede preceder o resultar de la obesidad. Los clnicos
deben investigar por ansiedad, insatisfaccin corporal, ingesta excesiva, fatiga, y dificultad para
dormir. El abuso sexual y fsico aumenta el riesgo de obesidad severa. Los jvenes que comen
compulsivamente o vomitan deben ser evaluados para considerar desrdenes de la alimentacin.
Alteraciones ortopdicas
Est demostrado que los nios y adolescentes obesos presentan ms fracturas y problemas
msculo esqueltico. Debido a que las lesiones y el dolor interfieren con la actividad fsica, es
necesario una intervencin temprana (incluyendo terapia fsica, cuando sea indicado) para reducir
la ganancia de peso en estos nios.
Alteraciones en la piel
La acantosis nigricans se presenta en aproximadamente 10% de los nios blancos obesos y en el

50% de los nios de raza negra. Aunque se asocia con hiperinsulinemia, la acantosis nigricans se
asocia de forma ms fuerte con un IMC alto. La intensidad de la acantosis nigricans disminuye con
la prdida de peso. Los nios severamente obesos pueden presentar una irritacin crnica e
infecciones en los pliegues de la piel.
Sndromes genticos
Los sndromes genticos que causan obesidad, como el sndrome de Prader-Willi, son
extremadamente raros. Los clnicos deben considerar su referencia para una evaluacin gentica,
especialmente cuando los nios son obesos y bajos de talla con retraso en el desarrollo.
Desafortunadamente, el diagnstico de estos sndromes genticos no modifica las opciones de
tratamiento.
Pruebas de laboratorio
La historia y la evaluacin fsica no permiten obtener una evaluacin efectiva de los niveles
anormales de colesterol, EHNA, y diabetes mellitus tipo 2. Por lo tanto estas condiciones deben
identificarse con pruebas de laboratorio. Se recomienda que los nios con un IMC entre el 85 y 94
percentil se les debe realizar un perfil de lpidos y, si los factores de riesgo estn presentes,
entonces una glucosa en ayunas, ALAT y ASAT deben medirse cada 2 aos para nios 10 aos. Los
nios con un IMC 95 percentil, se les debe realizar glucosa en ayunas, ALAT, ASAT cada dos aos
iniciando a los 10 aos, sin importar si se presentan otros factores de riesgo. La elevacin de ALAT
y ASAT por encima de 60U/L en dos ocasiones sugiere que es necesaria una evaluacin adicional,
probablemente atencin de un hepatlogo o gastroenterlogo pediatra.
Evaluacin de conducta
Meta
La evaluacin de conducta tiene dos propsitos. El primero es identificar las conductas del nio
relacionadas con la dieta y la actividad fsica que provocan el desbalance energtico y que pueden
modificarse. Y el segundo es evaluar la capacidad del paciente y/o de la familia para cambiar
algunos o todos estos comportamientos. Las familias deben tener tanto los medios como la
motivacin para realizar estos cambios. Por ejemplo, el nio se beneficiar al incrementar el juego
al aire libre pero, si no existen reas seguras o si los padres no perciben el beneficio del cambio, el
cambio no ocurrir y el nio fallar en el tratamiento. El clnico debe trabajar con la familia para
identificar los cambios en comportamiento que son apropiados y factibles.
Evaluacin diettica y de actividad fsica
Para la evaluacin de alimentacin, deben abordarse los siguientes comportamientos:

Frecuencia en el consumo de alimentos preparados fuera de casa, incluyendo


restaurantes, escuela o cafeteras del trabajo, y comida rpida o comida para llevar.
Onzas, tazas o latas de bebidas azucaradas que el nio consume cada da.
Porciones que son grandes para la edad (evaluacin cualitativa);
Onzas o tazas de 100% jugo de fruta que el nio consume cada da;
Frecuencia y calidad del desayuno;
Consumo de alimentos que son altos en densidad energtica, tales como los alimentos
altos en grasa;
Nmero de porciones de frutas y vegetales consumidas cada da y calidad de las
refacciones.

En cuanto a la evaluacin de la actividad fsica, los siguientes comportamientos deben tomarse


en cuenta:

Tiempo invertido en actividad fsica moderada cada da (incluyendo actividad fsica


organizada y actividad fsica no estructurada, incluyendo el juego), para estimar si la
meta de 60 minutos de actividad vigorosa moderada se alcanza todos los das;
Patrones de rutina de actividad, tales como caminar a la escuela o realizar trabajo de
patio;
Comportamientos sedentarios, incluyendo horas de televisin, video/DVD, y
videojuegos y uso de la computadora para determinar si hace uso de todo lo anterior
por ms de 2 horas al da.

Implementacin de la evaluacin del comportamiento


La identificacin de cambios de comportamiento realistas requiere de una evaluacin de recursos
prcticos y barreras. Parques en el vecindario, abarroteras, centros de recreacin, y nios del
vecindario con quienes pueda jugar pueden ayudar a desarrollar un estilo de vida ms saludable.
Los clnicos pueden contar con una lista de de los recursos disponibles en la comunidad que
atiende. Dentro del hogar las finanzas, el tiempo y otros cuidadores adems de los padres pueden
afectar los cambios de comportamiento.
Debido a que los cambios de comportamiento requieren de un compromiso por parte del paciente
y los miembros de la familia, la motivacin es lo ms importante pero tambin representa un
desafo en la atencin de la obesidad. La entrevista motivacional, es la tcnica que une la
evaluacin y la intervencin y proporciona un marco de comunicar los hallazgos fsicos y de
laboratorio. El clnico ayuda al paciente y la familia a establecer las prioridades, considerar que tan
frecuente los comportamientos fortalecen o afectan estas prioridades, y evaluar los recursos y las
barreras en las familias y su ambiente. A travs del proceso de evaluacin del comportamiento, el

clnico y las familias identifican las metas del tratamiento.


Si el nio o el padre es el objetivo del cambio de comportamiento depende de la edad del nio.
Cuando el nio es pequeo, los padres o cuidadores, deben ser responsables de dar al nio una
dieta saludable, limitar la cantidad de televisin o videojuegos, y crear oportunidades de juego
activo. Los padres no deben esperar que los nios escojan entre agua gaseosa y agua pura o que
apaguen la televisin al final de las 2 horas. Por tanto, los clnicos deben abordar las
preocupaciones y la motivacin con los padres cuando los nios son pequeos. Sin embargo, los
adolescentes generalmente tienen ms oportunidades fuera de casa para hacer elecciones sobre
alimentacin y actividad fsica. Sin embargo los padres pueden apoyar a los adolescentes
formando un ambiente en el hogar saludable, las preocupaciones y motivacin de los adolescentes
son esenciales en cualquier tratamiento de control de peso y deben ser el centro de la evaluacin
del clnico

Tratamiento
Objetivo
La principal meta del tratamiento de la obesidad es mejorar la salud a largo plazo a travs de
hbitos alimentarios a largo plazo. La sola implementacin de estos hbitos llevar a una mejora
en el peso (prdida de peso o mantenimiento del peso durante el crecimiento lineal) en algunos
nios, sin embargo algunos nios y adolescentes necesitarn de esfuerzos adicionales para
obtener este balance energtico negativo. Otros necesitaran de ayuda adicional a travs de
estrategias para la modificacin de conductas para desarrollar y mantener los hbitos saludables.
La salud emocional (buena auto estima y actitudes apropiadas hacia los alimentos y el cuerpo)
tambin es un factor importante. Para lograr sestas metas, el grupo que escribi sobre el
tratamiento recomienda que los proveedores de salud prescriban un tratamiento en etapas, con 4
etapas de tratamiento escalonadas en intensidad. Los pacientes pueden iniciar con la etapa menos
intensa y avanzar dependiendo de las respuestas al tratamiento, edad, grado de obesidad, riesgos
para la salud, y motivacin. Los proveedores pueden identificar algunos adolescentes obesos que
estn motivados para iniciar el cambio de comportamiento en una de las etapas menos intensa.
Este abordaje puede ser ms exitoso cuando la obesidad es ms severa, siempre t cuando el
paciente est motivado.
Resultados
El establecimiento permanente de hbitos de vida saludable es el mejor resultado, a pesar del
cambio en el peso, debido a los beneficios a largo plazo de estos comportamientos. La mejora en
las condiciones mdicas tambin es un importante signo de beneficios a la salud a largo plazo. La

medida de la mejora en el peso es el percentil de IMC, generalmente por debajo del 85 percentil,
aunque algunos nios se encuentran saludables en la categora de sobrepeso (85 a 94 percentil).
En general, en los nios menores y moderadamente obesos debe observarse un cambio en el peso
gradual que en los nios mayores y con obesidad severa. Cuando no mejora el peso o el percentil
de IMC del paciente como se desea en un perodo entre 3 a 6 meses de seguir el tratamiento, el
proveedor de salud y la familia debern considerar avanzar a la siguiente etapa ms intensiva del
tratamiento.
Tratamiento escalonado
El abordaje sistemtico propuesto por el comit de expertos integra los aspectos del tratamiento
que tienen evidencia que los sustente, sin embargo el abordaje como un todo no ha sido probado.
Este abordaje promueve intervenciones breves, en la clnica para el mayor nmero de nios con
sobrepeso y obesidad y luego una intensificacin de esfuerzos sistemtica, que se ajuste a la
capacidad de la clnica, la motivacin de la familia, y el grado de obesidad, con la etapa de
tratamiento ms agresiva considerada solamente para aquellos que no han respondido a otras
intervenciones.
Las clnicas necesitan estar preparadas para implementar un sistema de evaluacin; identificando
recursos, tales como nutricionistas peditricas o profesionales en comportamiento, o personal
capacitado en dieta y evaluacin de actividad fsica; e identificar recursos comunitarios y centros
de referencia, si hubiera disponibles. Para cada etapa del tratamiento de la obesidad, el comit de
expertos ha recomendado un proceso de implementacin, sugiriendo cmo el profesional de salud
de atencin primaria puede proporcionar esta atencin o identificar otros recursos de apoyo ms
all de la clnica.
Tratamiento de la obesidad por etapas
Etapa 1: Prevencin
Como primer paso, los pacientes con sobrepeso y obesidad y sus familias pueden basarse en los
hbitos de alimentacin saludable y hbitos de actividad fsica que forma parte de la estrategia de
prevencin de la obesidad. Sin embargo, el objetivo sera mejora el estado de IMC ms que
mantener un IMC saludable, y el profesional de la salud tendra que proporcionar un monitoreo
ms frecuente para motivar al paciente y su familia.
Los hbitos especficos relacionados con alimentacin y actividad son:
1. Consumir 5 porciones de frutas y vegetales cada da. Las familias debern
subsecuentemente aumentar a 9 porciones al da. Puede visitar el sitio web del
Departamento de Agricultura de Estados Unidos (USDA, por sus siglas en ingls):

2.

3.

4.

5.
6.
7.
8.
9.
10.

http://www.choosemyplate.gov; en el cual encontrar el nmero de tasas de frutas y


vegetales por da segn la edad y sexo. (EM)
Disminuir las bebidas azucaradas, tales como aguas gaseosas, bebidas deportivas, y
ponches. Idealmente, estas bebidas debieran de ser eliminadas de la dieta, aunque los
nios que consumen grandes cantidades de estas se beneficiarn de reducir su consumo a
una porcin por da; (EM)
Disminuir el tiempo de ver televisin (y otras formas de tiempo viendo una pantalla) a 2
horas por da. Si el nio tiene menos de 2 aos de edad, no debe existir tiempo de ver
televisin. Para ayudar con este cambio, la televisin debe ser removida del cuarto donde
el nio duerme; (EC)
Sea fsicamente activo 1 hora al da.(EM) El juego no estructurado es ms apropiado para
los nios pequeos. Los nios mayores deben de encontrar actividades fsicas que
disfruten, entre las cuales puede incluirse deportes, baile, artes marciales, montar
bicicleta y caminar. La actividad puede ser estructurada tal como clases de baile o no
estructurada, como bailar al ritmo de la msica en casa, y los nios pueden realizar
perodos cortos de actividad varias veces durante el da;
Preparar ms comidas en casa que comprar comidas en los restaurantes. (EM)
Comer en la mesa como una familia por lo menos 5 o 6 veces por semana; (EM)
Consumir un desayuno saludable todos los das; (EM)
Incluir a toda la familia en los cambios de comportamiento; (EM)
Permitir que el nio auto regule sus comidas y evitar comportamientos de alimentacin
que sean demasiado restrictivos (sobre todo en nios menores de 12 aos) (EC)
Ayudar a la familia a que adapten las recomendaciones de comportamiento a sus valores
culturales (sugerencia).

Para la implementacin de la etapa de Prevencin, debe tomar en cuenta lo siguiente:


1. Las familias y los proveedores de salud pueden trabajar juntos para identificar los
comportamientos que deben ser abordados. Las consideraciones incluyen los
comportamientos actuales que contribuyan grandemente al desbalance energtico, los
valores familiares y preferencias, la situacin financiera de la familia, vecindario, y horario,
y la motivacin del nio y la familia para realizar cambios particulares. Utilizando la tcnica
de entrevista motivacional, el profesional de la salud permite que el nio y la familia
determinen los comportamientos prioritarios, los cuales naturalmente integrarn la
situacin y los valores familiares.
2. Los pacientes puede que necesiten alcanzar los objetivos priorizados en etapas. Por
ejemplo: los nios obesos puede que necesiten iniciar con 15 minutos de actividad fsica
por da y trabajar hasta llegar a 60 minutos, o una familia puede elegir 3 metas al inicio y
expandir el nmero de objetivos a lograr con el tiempo;

3. Las visitas de seguimiento deben ajustarse a la familia en particular, y las tcnicas de


entrevista motivacional pueden ser tiles para establecer la frecuencia.
4. La etapa de Prevencin del tratamiento de obesidad se lleva cabo en la clnica;
5. Despus de 3 a 6 meses, si el nio no muestra una mejora apropiada, el profesional de la
salud puede ofrecerle el siguiente nivel o etapa, que es, el manejo estructurado del peso.
Etapa 2: Manejo estructurado del peso
Este nivel de tratamiento de la obesidad se distingue del de Prevencin menos por las diferencias
en cuanto a los comportamientos abordados y ms en el apoyo y estructura que se brinda al nio
para alcanzar estos comportamientos. Las metas especficas en alimentacin y actividad adems
de las metas de Prevencin son las siguientes:
1. Una dieta planificada o plan de alimentacin balanceada en macronutrientes, en
proporciones que son consistentes con las recomendaciones dietticas diarias,
enfatizando alimentos con baja densidad energtica (tales como las altas en fibra y agua)
(sugerencia);
2. comidas diarias estructuradas y refacciones planificadas (desayuno, almuerzo, cena y 1 o 2
refacciones programadas, sin bebidas o alimentos altas en caloras fuera de estos tiempos,
puede reducir la ingesta en exceso)(sugerencia);
3. reduccin adicional de televisin o actividades frente a una pantalla a 1 hora por da
(sugerencia)
4. Actividad fsica planificada, supervisada o juego activo por 60 minutos al da. (EM)
5. Monitoreo de estos comportamientos a travs del registro (por ejemplo, el paciente o los
miembros de la familia pueden registrar los minutos que ve televisin y pueden llevar un
registro de 3 das de los alimentos y bebidas que consume)(EC); y
6. un refuerzo planificado para alcanzar los objetivos propuestos (sugerencia).
Para la implementacin del manejo estructurado del peso, los siguientes aspectos deben
tomarse en cuenta:
1. el plan de alimentacin requiere de una nutricionista o clnico capacitado en crear este
tipo de plan de alimentacin para nios;
2. miembros de la clnica que manejen la entrevista motivacional y la enseanza de tcnicas
de monitoreo y reforzamiento pueden establecer los objetivos iniciales con las familias y
brindar el seguimiento;
3. algunas familias pueden necesitar de un psiclogo para que les ayude con las habilidades
de los padres para la crianza, resolucin de conflictos familiares, o motivacin;
4. dependiendo del nio y la familia, referir un terapista fsico o terapista del ejercicio que
pueda ayudar al nio y a la familia a desarrollar hbitos de actividad fsica;

5. vistas mensuales son apropiadas en este nivel;


6. algunos profesionales han encontrado til el realizar sesiones de grupo que pueden llegar
a ser ms efectivas y eficientes.
Etapa 3: Intervencin Integral Multidisciplinaria
Este abordaje incrementa la intensidad de cambios de conducta, la frecuencia en las visitas, y
los especialistas involucrados, para maximizar el apoyo a los cambios de conducta.
Generalmente, este tipo de programa exceder la capacidad de la clnica de atencin primaria.
Sin embargo, el clnico puede organizarse con otros especialistas y ofrecer este tipo de
programa. Los objetivos de alimentacin y actividad son generalmente las mismas de la etapa
de manejo estructurado del peso.
Para la implementacin de la intervencin integral multidisciplinaria, deben tomarse en
cuenta los siguientes aspectos:
1. Un programa estructurado en modificacin de conducta debe incluir como mnimo,
monitoreo de alimentacin, metas en alimentacin y actividad fsica a corto plazo, y
manejo de contingencia (EC);
2. Balance energtico negativo que sea resultado de los cambios en la alimentacin y la
actividad fsica (EM);
3. Participacin de los padres en las tcnicas de modificacin de conducta es necesaria en los
nios mayores de 12 aos. (EC) El involucramiento de los padres ser progresivamente
menor en los jvenes mayores;
4. Los padres debern ser capacitados tomando en cuenta las mejoras en el ambiente del
hogar (sugerencia).
5. La evaluacin sistemtica de las medidas corporales, dieta y actividad fsica deben llevarse
a cabo al inicio y en intervalos especficos durante el tratamiento (sugerencia).
6. Un equipo multidisciplinario con experiencia en obesidad infantil deber incluir un
consejero en comportamiento ( por ejemplo, trabajador social, psiclogo u otro proveedor
de salud mental, enfermera profesional), nutricionista, especialista en actividad fsica
(terapista fsico), y un profesional de la salud de atencin primaria que contine el
monitoreo de los aspectos mdicos y mantenga una relacin de apoyo con la familia;
7. Visitas frecuentes a la clnica, visitas semanales por un perodo de 8 a 12 semanas parecen
ser ms eficaces. (EC) Despus se pueden modificar a mensuales para mantener el
comportamiento.
8. Las visitas en grupo pueden ser ms costo-efectivas y tener mayor beneficio teraputico
(EM).
9. Los programas comerciales de manejo de peso pueden ser considerados, sin embargo el
profesional de la salud deber realizar una evaluacin a travs de la cual se asegure que

ese tratamiento es saludable y apropiado para la edad del nio.

Etapa 4: Intervencin en el tercer nivel de atencin


Intervenciones
Las intervenciones intensivas en esta categora pueden ofrecerse a algunos de los nios con
obesidad severa. Estas intervenciones van ms all de los objetivos de alimentacin saludable
y actividad fsica que son la base de las otras etapas. Los candidatos a considerar deben haber
intentado el control de peso a travs de la etapa de intervencin integral multidisciplinaria ,
deben tener la madurez para comprender los posibles riesgos, y deben estar dispuestos a
mantener la actividad fsica, y, si es consistente con la intervencin adicional, una dieta
saludable con un monitoreo de comportamiento apropiado. Sin embargo, la falta de xito de
la intervencin integral multidisciplinaria no debe ser el nico criterio para llegar a esta etapa
del tratamiento.
Las intervenciones que a continuacin se listan han sido utilizadas en adolescentes, y algunos
de los pacientes pueden ser candidatos para una de estas intervenciones. Las consideraciones
de cada una de estas intervenciones dependen del paciente y los recursos en el rea
geogrfica.
Medicamentos
Dos medicamentos han sido utilizados en adolescentes. La sibutramina es un inhibidor de la
captacin de serotonina que incrementa la prdida de peso en los adolecentes que estaban a
dieta y realizaban un programa de ejercicio, en relacin con los que solo hacan dieta y
programa de ejercicio. Los adolescentes que recibieron el medicamento perdieron
aproximadamente 3Kg ms que aquellos en el grupo control. 83,84 En un estudio, el uso de
orlistat, el cual causa malabsorcin a travs de la inhibicin de la lipasa entrica, llevo a una
menor ganancia de peso, comparado con la dieta y el ejercicio solamente, en adolescentes. 85
El efecto de estos medicamentos (estudiados con conjunto con la dieta y el ejercicio) ha sido
modesto. La FDA ha aprobado el uso de sibutramina en pacientes 16 aos y el orlistat en 12
aos.
Dieta muy baja en caloras
Existe poca evidencia del uso de dietas altamente restrictivas en nios o adolescentes. La dieta
restrictiva fue utilizada como el primer paso en los programas de manejo del peso en la niez,
seguida de una dieta moderadamente restrictiva.

Ciruga de control de peso


Debido al nmero en aumento de casos de obesidad severa, algunos centros ofrecen la ciruga
baritrica, ya sea a travs de un bypass gstrico o una banda gstrica. Este tratamiento
generalmente conduce a una prdida de peso y mejora de las condiciones mdicas. Sin
embargo, los riesgos perioperatorios, los riesgos nutricionales post operatorios, y la necesidad
de un compromiso de por vida de alimentacin hacen de este un abordaje inapropiado para
muchos. Los criterios de seleccin establecidos por Inge et al 88 incluyen un IMC 40 Kg/m2
con una condicin mdica o 50 Kg/m2; madurez fsica (generalmente nias de 13 aos y
nios 15 aos de edad); madurez emocional y cognitiva; y esfuerzos por perder peso por
de seis meses a travs de programas bien establecidos de prdida de peso. Los adolescentes
que se someten a estos procedimientos necesitan de una evaluacin cuidadosa antes de la
ciruga y de un apoyo nutricional y psicolgico despus de la ciruga.
Abordaje escalonado para pacientes individuales
Cuando el clnico identifica los riesgos en la salud que son resultado de grasa en exceso (la
mayor parte de pacientes con un IMC 95 percentil y varios pacientes con un IMC de 85-94
percentil), el clnico primero ofrecer la etapa de Prevencin. Si el nio y la familia ya estn
implementando estos comportamientos como parte de los esfuerzos de prevencin o si la
implementacin por 3 o 6 meses de la etapa de Prevencin no ha dado resultados, entonces el
paciente debe pasar a la etapa de manejo estructurado de peso. De forma similar, si 3 o 6
meses en el programa de manejo estructurado de peso, algunos pacientes no han alcanzado
las metas establecidas pueden pasar entonces as la fase de intervencin integral
multidisciplinaria. El tiempo de cada una de estas etapas debe adaptarse de forma individual a
las familias.
Los pacientes < 2 aos requieren de evaluacin y tratamiento distintos. Las medidas y trazo
del peso y talla no cambian pero, debido a que las curvas de crecimiento no incluyen los
percentiles de IMC, el peso para la talla deben graficarse; los nios con valores peso/talla
sobre el percentil 95 son clasificados como sobrepeso. El riesgo de exceso de grasa corporal
incrementa al incrementar los valores de peso para la talla sobre el percentil 95, sin embargo
todava no se han establecido los puntos de corte para definir obesidad. En esta edad, el
estado del peso de los padres es muy importante para evaluar el riesgo de obesidad futura y
predecir la obesidad en la adultez joven ms que el peso corporal actual del nio. Por tanto,
un nio de 18 meses con ambos padres obesos tiene un alto riesgo aun cuando su peso para la
talla actual se encuentre por debajo del percentil 95.
Hasta que se establezcan valores el crecimiento longitudinal individual, las restricciones
energticas diseadas para reducir el peso no se recomiendan para este grupo de edad. Sin

embargo, los proveedores de salud deben discutir los potenciales riesgos a largo plazo y deben
motivar a los padres a establecer estrategias de prevencin de la obesidad. Para los infantes
de 0 a 12 meses de edad, los pediatras pueden promover la lactancia materna exclusiva hasta
los 6 meses de edad y la lactancia materna continuada hasta los 12 meses de edad y ms,
despus de la introduccin de alimentos slidos. Los padres pueden ser motivados a ofrecer
alimentos nuevos repetidamente y evitar bebidas azucaradas (como las aguas gaseosas) y
snacks (papas fritas o papalinas). Se puede recomendar que la televisin no est dentro del
cuarto del nio. Cuando se identifiquen nios de 12 a 24 meses de edad con sobrepeso, los
proveedores de salud debern recomendar estrategias de prevencin adecuadas para la edad
del nio, como el evitar bebidas azucaradas y ingesta excesiva de jugos y evitar la ingesta
excesiva de leche (> 16 a 24 onzas de leche por da puede agregar energa o desplazar otros
nutrientes). Los profesionales de la salud pueden recomendar el que se consuman 3 comidas
al da en las cuales se comparta con la familia. Las familias no deben restringir lo que sus nios
comen en las comidas o refacciones pero deben estar seguros que toda la comida disponible
es saludable, con muchas frutas y vegetales. A esta edad, los nios frecuentemente consumen
2 refacciones adems de sus comidas, pero entre comidas y refacciones los padres pueden
ofrecerles agua cuando los nios tengan sed, en vez de darles de constante acceso a bebidas
altas en caloras como los jugos. Los nios deben tener acceso a los juegos activos, con
limitacin de televisin y DVD y no tener una televisin en su cuarto. Cuando el peso es
extremadamente alto, el infante o nio puede tener una condicin gentica asociada,
especialmente si la talla es baja o el desarrollo retardado.
ANEXO. RECOMENDACIOENS DEL COMIT DE EXPERTOS SOBRE LA EVALUACIN,
PREVENCION Y TRATAMIENTO DEL SOBREPESO Y LA OBESIDAD EN LA NIEZ Y
ADOLESCENCIA
Recomendaciones sobre la evaluacin
1. El comit de experto recomienda que los mdicos y profesionales de la salud aliados
realicen como mnimo, una evaluacin anual del estado del peso de todos los nios que
atienden y que esta evaluacin incluya el clculo de talla, peso (medida apropiadamente),
y del IMC para la edad y los grafiquen en las grficas de estndares de crecimiento.
2. En relacin a la clasificacin, el comit de expertos recomienda que los individuos de 2 a
18 aos de edad con un IMC 95 percentil para la edad y el sexo o un IMC 30 (el que sea
menor) debe considerarse obeso y que los individuos con un IMC 85 percentil pero < 95
percentil para la edad y el sexo debe considerarse con sobrepeso; este trmino reemplaza
riesgo de sobrepeso.
3. El comit de expertos no est de acuerdo con el uso a nivel clnico de los pliegues
cutneos para la evaluacin de la obesidad en los nios.

4. El comit de expertos no puede recomendar la toma de la circunferencia de cintura para


ser utilizada en la prctica clnica rutinaria, debido a que existe informacin incompleta y
falta de una gua especfica para su aplicacin clnica.
5. El comit de expertos recomienda que la evaluacin cualitativa de los patrones dietticos
para todos los pacientes peditricos se realice, como mnimo, en cada visita de nio sano
como una gua anticipatoria y que la evaluacin incluya la auto eficacia y disponibilidad de
cambio y la identificacin de las siguientes prcticas dietticas especficas, las cuales
pueden ser objetivo de ser modificadas: frecuencia de comidas fuera de casa en
restaurantes o establecimientos de comida rpida, consumo excesivo de bebidas
azucaradas, y consumo de porciones excesivas para la edad. Practicas adicionales que
deben considerarse evaluar durante la evaluacin diettica cualitativa son el consumo
excesivo de jugos 100% de fruta, consumo de desayuno (frecuencia y calidad), consumo
excesivo de alimentos que sean energticamente densos, bajo consumo de frutas y
verduras, frecuencia de comidas y patrones de refaccin (incluyendo calidad).
6. El comit de expertos recomienda que la evaluacin de los niveles de actividad fsica y
comportamientos sedentarios se realice en todos los pacientes peditricos, como mnimo,
en cada visita de nio sano como una gua anticipatoria y debe incluir las reas de a) auto
eficacia y disponibilidad de cambio, b) apoyo y barreras del entorno y sociales para
realizar actividad fsica, c) si el nio est alcanzando las recomendaciones de 60 minutos
de actividad moderada al da, y d) los niveles de comportamiento sedentario (incluyendo
horas de comportamientos tales como ver televisin y/o DVD, jugar videojuegos, y utilizar
computadora, en comparacin con el valor base de < 2 horas al da).
7. El comit de expertos recomienda que los mdicos y los profesionales de la salud
asociados obtengan una historia familiar sobre obesidad, diabetes mellitus tipo 2,
enfermedad cardiovascular (particularmente hipertensin), y muertes prematuras que
sean resultado de enfermedad cardiaca o evento cerebrovascular, para evaluar el riesgo
actual o futuro de comorbilidades asociadas con el estado de sobrepeso y obesidad del
nio.
8. El comit de expertos recomienda que a travs de la evaluacin fsica realizada y que, para
el nio identificado con sobrepeso u obesidad, se incluyan las siguientes medidas, adems
de las recomendaciones antes mencionadas sobre el IMC: a) pulso, medido en base a la
forma peditrica estndar; b) presin arterial, medida con un mango lo suficientemente
grande que cubra el 80% del brazo; y c) los signos asociados con comorbilidades del
sobrepeso y obesidad. La circunferencia de cintura no se recomienda para el uso rutinario.
Sin embargo una circunferencia de cintura grande puede ser indicador de resistencia a la
insulina y otras comorbilidades de la obesidad y puede ser til para caracterizar riesgos en
el nio obeso.
9. El comit de expertos recomienda que se realicen las siguientes pruebas de laboratorio en

la evaluacin de un nio identificado con sobrepeso u obesidad. Si en IMC est entre el 85


y el 94 percentil para la edad y el sexo sin otros factores de riesgo, entonces se debe
realizar un perfil de lpidos. Si el IMC est entre el 85 y 94 percentil con factores de riesgo
en la historia y el examen fsico, entonces debe realizarse ASAT, ALAT y glucosa en ayunas.
Si el IMC es > 95 percentil para la edad y el sexo, aun en la ausencia de factores de riesgo,
todos los exmenes mencionados en el percentil 85 al 94 con factores de riesgo deben
realizarse.
Recomendaciones para el tratamiento
1. El comit de expertos recomienda que todos los mdicos y profesionales de la salud
aborden el manejo del peso corporal y los aspectos relacionados con el estilo de vida con
todos los pacientes, sin importar el peso que tengan, por lo menos una vez al ao.
2. El comit de expertos recomienda que todos los nios entre 2 y 18 aos con valores de
IMC entre el 5 y 84 percentil sigan las recomendaciones de prevencin mencionadas en el
informe de prevencin.
3. El comit de expertos recomienda que el tratamiento del sobrepeso en nios se aborde en
base a un mtodo escalonado basado en la edad del nio, IMC, comorbilidades
relacionadas, peso de los padres y progreso en el tratamiento y que los profesionales de la
salud del primer nivel que atienden al nio y la familia se involucren en el proceso.
4. El comit de expertos recomienda los siguientes objetivos en la prdida de peso al
implementar el tratamiento escalonado; la recomendacin se basa en las
recomendaciones clnicas y el criterio debido a que existe una cantidad limitada de
evidencia: en la edad de 2 a 5 aos: IMC de 85 a 94 percentil: mantener el epso hasta que
el IMC sea menor del 85 percentil o la ganancia de peso disminuya y se refleje en la curva
de IMC; IMC > 95 percentil: mantener el peso hasta que el IMC est en el 85 percentil; sin
embargo, si la prdida de peso sucede con una dieta saludable, esta no debe exceder
1lb/mes (si se nota una perdida mayor, entonces el paciente debe monitorearse por
perdida excesiva de peso); el IMC > 21 o 22 Kg/m2 (raro, muy alto): perdida de peso
gradual, no debe exceder 1lb/mes; a la edad de 6 a 11 aos: IMC entre el 84 al 95
percentil: mantener el peso hasta que el IMC sea < 85 percentil o la ganancia de peso se
detenga; IMC 95 al 98 percentil: mantener el peso hasta que el IMC sea < 85 percentil o
una prdida gradual de peso de 1lb/mes; IMC > 99 percentil: la prdida de peso no debe
exceder en un promedio de 2lb/semana; edad de 12 a 18 aos; un IMC 85 al 94 percentil:
mantener el peso hasta que el IMC < 85 percentil; un IMC 95 al 98 percentil: prdida de
peso hasta que el IMC < 85 percentil, una prdida promedio no mayor a 2lb/semana; IMC
> 99 percentil: la prdida de peso no debe exceder un promedio de 2lb/semana.
5. El comit de expertos recomienda que, para todos los nios entre 12 y 18 aos de edad
cuando el IMC > 99 percentil, los mdicos o profesionales de la salud inicien el tratamiento

escalonado 1, 2 o 3, dependiendo de la disponibilidad de cambio del paciente.

Recomendaciones de prevencin
Recomendaciones a nivel del paciente
1. El comit de expertos recomienda que los mdicos y profesionales de la salud asociados
aconsejen a los nios de 2 a 18 aos cuyo IMC est entre el 5 y el 84 percentil lo siguiente:
a) limitar el consumo de bebidas azucaradas (EC); b) consuman dietas con las cantidades
recomendadas de frutas y vegetales (EM); c) limitar el tiempo de televisin y otros
dispositivos de pantalla permitiendo solamente dos horas al da de esta actividad (EC) y
remover estos dispositivos del dormitorio de los nios (EC); d) consumir un desayuno
diariamente (EC); e) limitar el comer en restaurantes, especialmente restaurantes de
comida rpida (EC); f) promover las comidas familiares en las cuales los padres y los hijos
coman juntos (EC); y g) limitar el tamao de las porciones (EC).
2. El comit de expertos tambin recomienda que los profesionales recomienden a las
familias el comprometerse con los siguientes comportamientos: a) comer dietas ricas en
calcio; b) consumir una dieta alta en fibra; c) consumir una dieta balanceada en
macronutrientes (energa de las grasa, carbohidratos, protenas en proporciones
apropiadas para la edad); d) iniciar y mantener la lactancia materna; e) realizar 60 minutos
al da de actividades moderadas a vigorosas para mantener el peso saludable; y f) limitar el
consumo de alimentos energticamente densos.
Recomendaciones a nivel de la prctica y la comunidad
1. El comit de expertos recomienda que los mdicos y profesionales de la salud asociados y
organizaciones profesionales a) aboguen ante el gobierno incrementar la actividad fsica
en las escuelas a travs de programes de intervencin desde el primer grado hasta
finalizar la secundaria y la universidad y a travs de la creacin de entornos escolares que
promuevan la actividad fsica y b) apoye los esfuerzos para preservar y mejorar los
parques como reas para actividad fsica, informar a las iniciativas locales sobre la
inclusin de caminos para caminar y ciclovas e instar a las familias a utilizar las opciones
locales informando y sugiriendo alternativas de actividad fsica a travs de las clnicas de
los doctores.
2. El comit de expertos recomienda el uso de las siguientes tcnicas para ayudar a los
mdicos y profesionales de la salud que deseen apoyar la prevencin de la obesidad a
nivel clnico, escolar y comunitario: a) comprometer activamente a las familiar con padres
obesos o diabetes materna, debido a que estos nios se encuentran en mayor riesgo de

desarrollar obesidad aun si actualmente tienen un IMC normal; b) motivar a una estilo de
crianza autoritario en relacin a incrementar la actividad fsica y reducir el
comportamiento sedentario; c) desalentar un estilo de crianza restrictivo relacionado con
la alimentacin; d) instar a los padres a planificar dietas y porciones saludables y e)
promover la actividad fsica en la escuela y en los centros de cuidado infantil (incluyendo
los programas extra curriculares).
Referencia:
Sara E. Barlow. Expert Committee Recommendations Regarding the Prevention,
Assessment, and Treatment of Child and Adolescent Overweight and Obesity: Summary
Report. Pediatrics 2007: 120; S164.