Está en la página 1de 599

SUMARIO GENERAL

BIOLOGA Y GEOLOGA..........4
GEOGRAFA E HISTORIA...................55
LENGUA Y LITERATURA...............................................65
EDUCACIN FSICA .......................................89
NUEVAS TECNOLOGAS APLICADAS AL AULA......96
INFANTIL Y PRIMARIA....107
DIDCTICA ........133
ECONOMA.........164
INGLS .......179

RECOPILACIN DE LOS PRINCIPALES MEDIOS DE


CULTIVO UTILIZADOS PARA EL CULTIVO DE
MICROORGANISMOS
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788

Un problema frecuente a la hora de disear experimentos que implican


el cultivo de microorganismos, es elegir el medio de cultivo ms adecuado para
que estos tengan un desarrollo eficaz. Existen una serie de medios de cultivo
que son selectivos o de aislamiento para algunos microorganismos, dentro de
estos, los ms importantes se citan a continuacin:

Medio de Bordet-Gengou: Enriquecido con sangre, se utiliza para el


aislamiento del Gnero Bordetella.
Medio Brucella: Es un medio rico utilizado para el cultivo de
microorganismos exigentes, especialmente para los del Gnero Brucella.
Aadindole determinadas sustancias puede utilizarse para el aislamiento
de anaerobios como Clostridium, Bacteroides, etc.
Medio de Butzler: Medio selectivo utilizado para el aislamiento de
Campylobacter.
Medio de carbn-extracto de levadura: Es un medio enriquecido utilizado
en el cultivo de las especies de Legionella.
Medio de transporte de Cary-Blair: Medio utilizado para el transporte de
anaerobios.
Medio con cetrimida: Se utiliza para aislar Pseudomonas y favorece la
pigmentacin de P.aeruginosa.
-5-

www.enfoqueseducativos.es

Medio Cled: Se utiliza para recuento y cultivo de muestras de orina.


Medio Columbia: Se utiliza para cultivo de microorganismos exigentes y
como base para preparar agar chocolate.

Medio de Chapman con manitol: Medio selectivo para Staphylococcus,


debido a la alta concentracin de NaCl, que permite diferenciar entre
microorganismos que actan o no sobre el manitol, debido a la presencia
de un indicador de pH.
Agar chocolate: Se utiliza para el crecimiento de microorganismos
exigentes y se prepara a partir de agar sangre sin solidificar que se
calienta a 80C.
Medio EMB: Es un medio que contiene eosina y azul de metileno,
desrrollado por Levine, y se utiliza para cultivar enterobacterias.
Medio de Feeley-Gorman: Es un medio enriquecido para el cultivo de
Legionella

pneumophila.

Medio de Francis: Es agar sangre con cistina para el crecimiento de


Francisella.
Caldo de Hajna: Medio de enriquecimiento para Salmonella y Sighella.
Lleva incorporado citrato y desoxicolato que inhiben el crecimiento de la
flora G (+).
Medio HBT: Medio selectivo utilizado para el aislamiento de Gardnerella
vaginalis.
Medio Hektoen: Es un medio selectivo diferencial indicado para el
aislamiento de Salmonella y Sighella. Las colonias aparecen de color azulverdoso, pudiendo tener un punto negro en el centro debido al SH2 las de
Salmonella.
Medio de Loeffler: Se utiliza para el cultivo de Corynebacterium.

-6-

www.enfoqueseducativos.es

Medio de Lowenstein-Jensen: Se utiliza para el cultivo de Mycobacterium.


Medio de MacConkey: Es un medio selectivo diferencial utilizado en el
aislamiento de enterobacterias, lleva sales biliares y cristal violeta que
inhiben a la flora G (+). Permite diferenciar entre microorganismos que
utilizan la lactosa y los que no la utilizan, debido a la presencia de un
indicador de pH en el medio.
Medio MH-IH: Se utiliza para aislamiento de L.pneumophila.
Medio de Mueller-Hinton: Es un medio enriquecido que se utiliza como
base para la realizacin de pruebas de sensibilidad a antimicrobianos.
Medio NYC: Se utiliza para cultivar especies exigentes del Gnero
Neisseria, como N.gonorrhoeae y N.meningitidis.
Medio PPLO: Se utiliza para aislamiento de Mycoplasma.
Medio de Roiron: Es un medio que contiene antibiticos y se utiliza para
cultivo de Candida y Trichomonas vaginalis (protozoo).
Medio de Sabouraud: Se utiliza para cultivo de hongos y levaduras
Medio

SS

(Salmonella-Sighella):

Medio

selectivo

diferencial

para

aislamiento de estos dos Gneros. Contiene verde brillante, sales biliares,


tiosulfato y citrato que inhiben a la flora G (+).
Agar sangre: Se utiliza para el cultivo de microorganismos exigentes y
para poner de manifiesto reacciones hemolticas.
Caldo de selenito: Se utiliza para el enriquecimiento de Salmonella.
Medio Skirrow: Se utiliza para aislamiento de Campylobacter.
Medio TCBS: Es un medio selectivo para el crecimiento de Vibrio.
Medio de Thayer-Martin: Se utiliza para el crecimiento de cepas exigentes
de Neisseria.
Medio de Tinsdale: Se ultiliza para el cultivo de Corynebacterium.
-7-

www.enfoqueseducativos.es

Medio de Todd-Hewit: Favorece el crecimiento de Streptococcus.


Medio o agar V: Se utiliza para aislar Gardnerella vaginalis.
Medio de Wauters: Se utiliza para aislar Y.enterocolitica.
Con esta compilacin de medios de cultivo no tendremos dudas a la
hora de elegir el ms adecuado para el tipo de microorganismo a cultivar.

-8-

www.enfoqueseducativos.es

NORMAS BSICAS DE
COMPORTAMIENTO Y MANIPULACIN
EN UN LABORATORIO

El trabajo en el Laboratorio requiere la observacin de una serie de


normas de de seguridad que eviten posibles accidentes debido a
desconocimiento de lo que se est haciendo o a una posible negligencia de
los alumnos y alumnas que estn en un momento dado, trabajando en el
Laboratorio.
Las normas las podemos dividir en:

NORMAL GENERALES DE COMPORTAMIENTO EN EL


LABORATORIO.
1. Cada grupo de prcticas se responsabilizar de su zona de trabajo y
de su material.
2. Es conveniente la utilizacin de bata, ya que evita que posibles
proyecciones de sustancias qumicas lleguen a la piel. Por supuesto
adems, evitars posibles deterioros en tus prendas de vestir.
3. Si tienes el pelo largo, es conveniente que lo lleves recogido.
4. Esta prohibido fumar, tomar bebidas ni comidas.
5. Ante cualquier duda preguntar al profesor, no improvises.

-9-

www.enfoqueseducativos.es

NORMAS PARA LA MANIPULACIN DE PRODUCTOS QUMICOS.

1. Antes de utilizar un compuesto, asegurarse bien de que es el que se


necesita, fijarse bien en las indicaciones del fabricante.
2. Como regla general, no coger ningn producto qumico. Tu profesor o
profesora te lo proporcionar, no improvises en el laboratorio.
3. No devolver nunca a los frascos de origen los sobrantes de los
productos utilizados sin consultar con el profesor, esto es una norma
bsica a cumplir.
4. Es muy importante que cuando los productos qumicos de desecho se
viertan

en

la

pila

de

desage,

aunque

estn

debidamente

neutralizados, debe dejarse que circule por la misma, abundante agua.


5. No tocar con las manos y menos con la boca, los productos qumicos.
6. No pipetear con la boca. Utilizar la bomba manual, una jeringuilla o
artilugio que se disponga en el laboratorio.
7. Los cidos requieren un cuidado especial. Cuando queramos diluirlos,
nunca echaremos agua sobre ellos; siempre al contrario, es decir,
cido sobre agua.
8. Los productos inflamables (gases, alcohol,ter, etc) no deben estar
cerca de fuentes de calor. Si hay que calentar tubos con estos
productos, se har al bao Mara, nunca directamente a la llama.
9. Si se vierte sobre ti cualquier cido o producto corrosivo, lvate
inmediatamente con mucha agua y avisa al profesor.

- 10 -

www.enfoqueseducativos.es

10. Al preparar cualquier disolucin se colocar en un frasco limpio y


rotulado convenientemente, nunca uno utilizado previamente que este
sucio
NORMAS BSICAS PARA LA MANIPULACIN DE LOS
ELEMENTOS DE VIDRIO EN EL LABORATORIO

1. Cuidado con los bordes y puntas cortantes de los tubos u objetos de


vidrio, inspeccionar siempre antes de usarlos
2. El vidrio caliente no se diferencia a simple vista del vidrio fro. Para
evitar quemaduras, dejarlo enfriar antes de tocarlo, esto os evitara
ms de un disgusto.
3. Las manos se protegern con guantes o trapos cuando se introduzca
un tapn en un tubo de vidrio.
4. Si tienes que calentar a la llama el contenido de un tubo de ensayo,
observa cuidadosamente estas dos normas:
Ten sumo cuidado y ten en cuenta que la boca del tubo de
ensayo no apunte a ningn compaero/a.
Calienta por el lateral del tubo de ensayo, nunca por el
fondo; agita suavemente.

- 11 -

www.enfoqueseducativos.es

Autor: Antonio Manuel Ciudad Real Nez


DNI 26221788

REFLEXIONES SOBRE EL CAMBIO CLIMTICO. UN TEMA DE


MODA.
Creo que nadie puede discutir que actualmente el cambio climtico es el
nuevo tema de moda, dentro de los crculos pseudos ecologistas, las
editoriales de los peridicos, los informativos de televisin y las revistas de
divulgacin.
La tristeza es que un problema que lleva acechando a nuestro planeta
desde que se produjera la Segunda Revolucin Industrial y que ya ha sido
denunciado por personajes relevantes dentro del mundo cientfico y divulgativo,
est de total actualidad desde que un personaje como All Gore Ex
vicepresidente de una de las naciones ms contaminantes del mundo, situado
en la primeras posiciones de ranking tan espectaculares como: Emisin de C
O2 a la atmsfera, consumo de agua Per. Cpita por habitante, productor de
residuos nucleares, etc. ganara el ao pasado el oscar al mejor documental por
su obra Una verdad incomoda. Adquirido recientemente por nuestro Ministerio
de Educacin por el mdico precio de 3 millones de Euros, para su difusin en
todos los centros de enseanza.
Pero esto no ha sido nada si lo comparamos con el reciente Premio
Novel de la Paz que se le ha concedido y por supuesto sin menospreciar a
nuestro querido Premio Prncipe de Asturias de la Concordia que tambin le ha
sido otorgado. Aunque nadie parece recordar que bajo su mandato EE.UU. se
neg a firmar el protocolo de Kyoto.

- 12 -

www.enfoqueseducativos.es

Dejando a un lado estas menudencias, tenemos que agradecer que


gracias a este nuevo Mesas del Ecologismo, se haya vuelto a discutir en todo
el mundo de cambio climtico, ya que es un problema que cada vez con ms
virulencia lo estamos sufriendo en nuestras propias carnes.
Solo hace menos de un mes hemos tenido en nuestra comunidad,
tormentas que ni siquiera los ms viejos del lugar recordaban, es el caso de las
lluvias caigas en Alcal de Guadara que adems se llevaron por delante a una
compaera y paisana. La gota fra este ao ha sido desastrosa para la
Comunidad Valencia si no que se lo pregunten a los vecinos de Calpe, El
Vergel y Beniarbeig. Estos son solamente dos ejemplos cercanos en el espacio
y en el tiempo, de los efectos que esta teniendo el calentamiento global del
planeta, por las emisiones de CO2, y de gases que favorecen el efecto
invernadero.
Pero si aumentamos nuestra perspectiva a nivel mundial, los efectos son
catastrficos y ya los estamos sufriendo aunque

estos sean menos

impactantes, el aumento de la temperatura de la tierra esta provocando:

Alteraciones en los ciclos vegetativos de los cultivos.


Aumento del nivel del mar.
Avance del desierto.
Extincin de especies.
La solucin a este problema es muy complicada ya que hay muchos

intereses creados alrededor de los factores que causan el Cambio Climtico.


Por supuesto la solucin pasa por una accin globalizada en la que todos los
pases se dirijan hacia u objetivo comn dejando a un lado intereses
econmicos, comerciales y polticos.
No quiero terminar esta reflexin sin agradecer a nuestro protagonista
principal. Sr. All Gore Muchas gracias, nuestro planeta se lo agradecer.
- 13 -

www.enfoqueseducativos.es

ALTERACIONES Y ERRORES CONGNITOS DEL


METABOLISMO
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V

Las enfermedades infantiles pueden estar provocadas por mutraciones en los


genes que codifican proteinas. Los nios que padecen un error congtito del
metabolismo pueden mostrar uno o ms signos y sntomas.

PERODO NEONATAL
Los errores congnitos del metabolismo suelen ser graves y a menudo mortales
si no se instaurta rpidamente un tratamiento adecuado.
Los lactantes suelen ser normale sal nacer, sin embargo solo unas horas despus
presenta un continuo deterioro. Este problema suele relacionarse con el sistema nervioso
central.

PASADO EL PERODO NEONATAL


Las primeras manifestaciones de los nios que padecen estas formas suelen ser
inespecficas y se atribuyen a lesiones perinatales.
Las manifestacionesd clnicas, como el retraso mental, los dficits motores y las
convulsiones son los hallazgos ms constantes en algunos ed estos nios.

1. DEFECTOS DEL METABILISMO DE LOS AMINOCIDOS


FENILALANINA O FENILCETONURIA CLSICA (FCU) Dficit
completo o casi completo del aminocido esencial en la alimentacin humana
fenilalanina hidroxlilasa. Las personas que padecen esta carencia, sufren de
retraso mental, estenosis pilrica o estrechamiento de la salida del estmago,
hiperactividad con movimientos carentes de finalidad, atetsis. Suelen ser ms
rubios que sus hermanos no afectados, de piel blanca y ojos azules.
HIPERFENILALANINEMIA MALIGNA El defecto reside en una de las
encimas necesarias para elaborar o reciclar el cofactor BH4. Se suele confundir
con la FCU, a los 3 meses presentan alteraciones neurolgicas como prdida de
sostn de la cabeza, babeo, dificultades para la deglucin y crisis mioclnicas.

- 14 -

www.enfoqueseducativos.es

HIPERFENILALANINEMIA BENIGNA Lactantes con niveles de


fenilalanina ligeramente elevados, no padecen sntomas.
TIROSINAElevacin moderada de la tirosina srica acompaada de una
afectacin del higado, los riones y el sistema nervioso central.Pueden presentar
sntomas a las dos semanas de vida o permanecer aparentemente sanos durante el
primer ao. Cuanto antes aparecen los sntomas, ms desfavorable es el
pronstico.
METIONINA Aminocido esencial en la dieta presente en la mayora de las
protenas.
Debida a dficit de homocistinuria , responde a dosis elevadas de vitamina B. Es
frecuente el retraso mental progresivo, presentan alteracioners esquelticas
parecidas a las del Sndrome de Marfan.
Por defectos de la formacin de metilcobalamina, en los primeros meses a
parecen vomitos, mala alimentacin, letargo hipotona y retraso del desarrollo.
Por dficit de homocistinuria, puede provocar episodios de apnea y convulsiones
mioclnicas.
CIOSTEINA-CISTINA Dficit de sulfito oxidasa, puede aparecer rechazo al
alimento, vmitos, convulsiones y retraso grave del desarrollo.
TRIPTFANO Enfermedad autonmica recesiva, hay un efecto exclusivo del
transporte de los aminocidos neutros de la mucosa intestinal y en los tubos
renales. Padecen fotosensibilidad cutnea.
ENFERMEDAD DE LA ORINA CON OLOR A JARABE DE ARCE
(EOJA) Presentan vmitos y rechazo al alimento, letargo y coma, hipertona y
rigidez muscular, la mayora de los lactantes sufre convulsiones e hipoglucemia.
GLICINA En la forma neonatal, aparece mala alimentacin, incapacidad para
mamar, hipotona profunda, letargo que puede progresar a coma profundo, apnea
y muerte.
En la forma infantil, despus de los 6 meses, es ms leve y el retraso mental no
es tan profundo.
SERINA Al poco de nacer aparecen retraso mental grave, convulsiones,
hipertona y microcefalia.
PROLINA E HIDROXIPROLINA Dficit de prolidasa, se producen lesiones
cutneas, dficit mental y motor, sensibilidad a las infecciones y laxitud articular.
ACIDO GLUTMICO Dficit de glutatin sintetasa. En su forma grave
provoca un trastorno autonmico recesivo con acidosis metablica crnica y
anemia hemoltica.
CICLO DE LA UREA E HIPERAMONIEMIA Los sntomas se relacionan
principalmente con trastornos de la funcin cerebral. Rechazo del alimento,
vomitos, la taquipnea y letargo que progresa rpidamente hacia el coma profundo.

- 15 -

www.enfoqueseducativos.es

HISTIDINA Dficit de hitidasa. Las manifestaciones consisten en trastornos


del lenguaje, retraso del crecimiento o retraso mental.
LISINA Dficit de glutaril CoA deshidrogenasa. La caracterstica principal de
la enfermedad es una discinesia y una distona progresiva, convulsiones, rigidez
generalizada.
ACIDO ASPRTICO (ENFERMEDAD DE CANAVAN) Trastorno
autonmico recesivo caracterizado por una degeneracin espongiforme de la
sustancia blanca cerebral, que conduce a una forma de leucodistrofia grave.

2. DEFECTOS DEL METABOLISMO DE LOS LPIDOS


TRASTORNOS DE LA OXIDACIN MITOCONDRIAL DE LOS CIDOS
GRASOS Se han identificado defectos genticos en casi todos los pasos de la
va de oxidacin de los cidos grasos; estos trastornos se heredan recesivamente.
La forma de presentacin consiste en un episodio de coma con peligro para la vida
e hipoglucemia inducida por un perodo de ayuno.
DFICIT DE ACIL-COA DESHIDROGENASA DE CIDOS DE CADENA
MEDIA Los pacientes presentan manifestaciones durante los 2-3 primeros aos
de vida, los sntomas consisten en vmitos y letargo, que progresan hacia el coma
o crisis convulsivas y el colapso cardiorrespiratorio.
DEFECTO DE TRANSPORTE DE CRNITINA EN LA MEMBRANA
PLASMTICA Dficit primario de carnitina. Miocardiopata progresiva, con
o sin debilidad de los msculos esquelticos, que empieza a los 2-4 aos.
DEFECTO DE LA VA DE TRANSFERENCIA DE ELECTRONES
Enfermedad que combina las caractersticas de la alteracin en la oxidadcin de
los cidos grasos y de varios aminocidos, como la leticina y la lisina. Produce
acidosis, hipoglucemia y miocardiopatia.
TRASTORNOS DE LOS CIDOS GRASOS DE CADENA MUY LARGA
Trastornos de causa gentica, provocados por la falta de formacin o
mantenimiento de los cidos grasos. Causan una incapacidad grave en la infancia.
Provoca el Sndrome de Zellweger, la enfermedad infantil de Refsum.
LA CONDRODISPLASIA RIZOMLICA PUNTEADA Presencia de focos
dispersos de calcificacin en el cartlago hialino del ojo que se asocia con
enanismo, cataratas y malformaciones mltiples.
ADRENOLEUCODISTROFIA (LIGADURA DEL CROMOSMA X) Las
manifestaciones iniciales ms frecuentes son la hi9peractividad, deterioro de la
discriminacin auditiva, alteraciones visuales, la ataxia, crisis convulsivas y el
estrabismo

- 16 -

www.enfoqueseducativos.es

3. TRASTORNOS DE METABOLISMO Y DEL TRANSPORTE DE


LAS LIPOPROTENAS
TRASTORNOS ASOCIADOS A HIPERCORESTEROLEMIA CON
TRIGLICRIDOS NORMALES Displidemias primarias, genticas. Obedece
a diversas mutaciones en el receptor de LDL que impide sus sntesis, reducen su
presencia en la superficie celular o merman su capacidad de unirse a la LDL e
interiorizarlas. Causa niveles altos de colesterol y enfermedades cardiovasculares
prematuras.
TRASTORNOS ASOCIADOS A HIPERCORESTEROLEMIA CON
ELEVACIN MODERADA DE TRIGLICRIDOS Suele aparecer a edad
adulta. El riesgo de cardiopata prematura es considerable.
TRASTORNOS ASOCIADOS A HIPERCORESTEROLEMIA CON
NIVELES EXTREMADAMENTE ELEVADOS DE TRIGLICRIDOS
sndrome de quilomicronemia familiar, dficit de liporotena lipasa. Se caracterza
por pancreatitis aguda.
TRASTORNOS
ASOCIADOS
A
NIVELES
REDUCIDOS
DE
CORESTEROL Manifestaciones de tipo neurolgico, abolicin de los reflejos
tendinosos profundos, disminucin de la sensibilidad vibratoria y propioceptiva en
la porcin distal de las extremidades inferiores, dismetria, ataxia y marcha
espstica.

4. DEFECTOS DEL METABOLISMO DE LOS HIDRATOS DE


CARBONO
MUCOPOLISACARIDOSIS Trastornos hereditarios causados por un dficit
de las encimas lisosmicas necesarias para le deglucin de los
glucosaminoglucano. Provocan un deterior mental y fsico progresivo.
DEFECTOS DEL
PIRIMIDINAS

METABOLISMO

DE

LAS

PURINAS

LAS

LAS PORFIRIAS Trastorno hereditario y adquirido que obedece a un dficit


parcial o casi completo de las encimas de la va de biosntesis. Se observan
episodios agudos de trastornos neurolgicos, fotosensibilidad cutnea.
HIPOGLUCEMIA Exceso de azcar en la sangre. Las principales secuencias
a largo plazo de una hipoglucemia intensa y prolongada son retraso mental,
actividad convulsiva. En el lactante pueden ser, cianosis, apnea, hipotermia,
hipotiona, mala alimentacin, letargo y convulsiones.

- 17 -

www.enfoqueseducativos.es

ANOMALIAS CROMOSMICAS: FIGURAS


Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V

Recopilacin de las principales anomalas cromosmicas detectadas en humanos


y que son causa enfermedades congnitas que afectan al desarrollo de los nios, y por lo
tanto a sus capacidades intelectuales.

DELECCIN

INVERSION

- 18 -

www.enfoqueseducativos.es

DUPLICACIN

MOSAICISMO

- 19 -

www.enfoqueseducativos.es

CROMOSOMA ANULAR

MONOSOMIA DEL CROMOSOMA 8

TRISOMIA DEL CROMOSOMA 11

- 20 -

www.enfoqueseducativos.es

- 21 -

www.enfoqueseducativos.es

EL MISTERIO DE LA VIDA HUMANA


Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V
La materia est constituida por elementos qumicos, de los 92 elementos
qumicos que hay en la naturaleza slo 30 son esenciales para los organismos vivos
(carbono, hidrogeno y oxgeno constituyen el 96,5 % del peso total).
La partcula ms pequea de un elemento es el tomo. La unin de tomos
(enlaces qumicos) forma molculas.
MOLCULAS
INORGNICAS

AGUA

MINERALES

GASES

MOLCULAS
DE LOS
SERES VIVOS
MOLCULAS
ORGNICAS

ENCMAS

CIDOS
NUCLEICOS

GLCIDOS

LPIDOS

PROTEICAS

Molculas llamadas
azcares o hidratos
de carbono, de los
que los seres vivos
obtienen la energa

El glucgeno es
convertido en
lpidos (grasas)
como reserva de
energa

Prcticamente todas
las funciones de los
seres vivos dependen
de las protenas.
Estn formadas por la
unin de Aminocidos.

Todas las reacciones


qumicas del organismo
Aseguran la transmisin de
estn mediadas por
la informacin gentica de
encmas.
unas clulas a otras.
Algunas encimas necesitan
Los nucletidos son las
a las coencmas (Vitaminas) unidades que componen los
para que acten de
cidos nucleicos.
transporte.

LOS CIDOS NUCLEICOS

cido desoxirribonucleico (ADN) Son unas macromolculas orgnicas, en


las que se almacena, replica y transcribe la informacin gentica de la clula del
organismo. Contiene los Genes (el material hereditario de la clula).
cido ribonucleico (ARN) Est asociado a la transmisin de la informacin
gentica desde el ncleo hacia el citoplasma, donde tiene lugar la sntesis de
protenas por los ribosomas. Hay tipos de ARN:
ARN mensajero (ARNm): copia la secuencia de nucletidos de los
genes de ADN del ncleo y la transportan al citoplasma, concretamente a
los ribosomas para la sntesis de protenas
- 22 -

www.enfoqueseducativos.es

ARN de transferencia (ARNt): lee la secuencia de ARNm y los


transporta uno a uno hasta los ribosomas.
ARN ribosmico (ARNr): forma los ribosomas

ARN nucleolar (ARNn): forma el ncleo, se emplea para la formacin


de ARNr

DOGMA DE LA BIOLOGA MOLECULAR


Replicacin del ADN progenitor en molculas hijas idnticas al DNA progenitor
Primera etapa Desenrrollamiento y apertura de la doble hlice
Segunda etapa Sntesis de dos nuevas hebras de ADN
Tercera etapa Correccin de errores.
Trascripcin, se transcribe la informacin gentica del ADN al ARNm, para ser
llevado al lugar de sntesis de las protenas (los ribosomas)
Traduccin, proceso mediante el cual el mensaje cifrado en el idioma de los tripletes
de base (cdigo gentico) es descifrado por los ARNt, sintetizndose en una protena.

ORGANIZACIN DEL MATERIAL HEREDITARIO

Los Cromosomas Tienen dos componentes principales: Protenas y ADN.


Tienen una doble hebra de ADN lineal. El ser humano tiene 23 pares de
cromosomas. Los genes (segmentos de ADN con la informacin necesaria para
sintetizar una protena) se localizan a lo largo de la hebra de ADN, cada gen
reside en un cromosoma particular y en una posicin especfica.

LEYES DE MENDEL

Leyes de la uniformidad: Cuando se cruzan dos lneas puras (fenotipos) que


difieren en las variantes de un determinado carcter, todos los hbridos presentan
el mismo fenotipo. Hay dos tipos de fenotipo, dominante y recesivo.
Ley de la segregacin: Las variantes recesivas enmascaradas, resultan del cruce
de dos lneas puras, reaparecen en la segunda generacin filial en una proporcin
3:1.

- 23 -

www.enfoqueseducativos.es

Ley de combinacin independiente: Los miembros de parejas allicas


diferentes se segregan o combinan independientemente unos de otros cuando se
forman los gametos.

LA MUTACIN
Cuando se produce un error en la trascripcin de la informacin gentica, y este
error persiste en la siguiente generacin, se produce una mutacin. Se pueden producir
mutaciones genminas (afectan a cromosomas completos), mutaciones gnicas
(modifican un solo gen), o mutaciones cromosmicas (ocurren en una parte del
cromosoma e involucran a varios genes).
Tipos de mutaciones gnicas:
Sustituciones Cuando un ncleo se sustituye por otro diferente
Inserciones Cuando se introduce uno o ms pares de nucletidos
Deleciones Consiste en la prdida de nucletidos.
Inversiones Un grupo de nucletidos de un gen son insertados en orden
inverso.
Mutaciones puntiformes:
Mutaciones errneasSe produce como consecuencia del cambio de
un nucletido por otro en la secuencia de ADN.
Mutaciones sin sentido Se originan cunado la situacin de un
nucletido en un triplete de ADN provoca la transformacin de un
codon de ARNm.
- 24 -

www.enfoqueseducativos.es

Desplazamiento de pauta de lectura Ocurre cuando hay una delecion


en la insercin de un nucletido durante el proceso de replicacin del
ADN.
Mutaciones silenciosasSon las que no producen ningn efecto
fenotpico.

- 25 -

www.enfoqueseducativos.es

FERMENTACIN ALCOHLICA EN LA LEVADURA


DEL PAN
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V
La fermentacin alcohlica, es uno de los procesos fundamentales de muchos procesos
industriales, en concreto los que implican la produccin de bebidas alcohlicas. Con
esta prctica sencilla desarrollaremos a pequea escala los procesos que implican la
trasformacin de un azcar en un alcohol.

OBJETIVOS DE LA PRCTICA
1. Conocer la biologa de las levaduras como responsables de la
fermentacin alcohlica.
2. Conocer el proceso de fermentacin alcohlica.
3. Estudiar las diferentes reacciones de la fermentacin alcohlica.
4. Observar que el resultado final de todos estos procesos es la
formacin de etanol.

MATERIALES A UTILIZAR
Levaduras del pan.
Azuzar (Glucosa).
Sacarmetro de Eihrn
Tubos de ensayo
Bicromato potsico
cido sulfrico diluido
Reactivo de Fehling

- 26 -

www.enfoqueseducativos.es

DESARROLLO DE LA PRCTICA
1. Preparar una disolucin con el azcar (glucosa).
2. Separar 3 ml. en un tubo de ensayo. (Esta muestra nos servir para
realizar la reaccin de Fehling y comprobar que es glucosa por su
poder reductor.
3. Disolver una punta de esptula de la levadura del panen el resto de la
glucosa.
4. Llenar el sacarmetro de Eihrn, cuidando que no queden burbujas de
aire para conseguir un ambiente de anaerobiosis.
5. A continuacin, observar el sacarmetro e ir anotando cada 10
minutos los valores observados para pasarlos a una grfica.
6. La

fermentacin

empezar

cuando

se

observe

un

burbujeo,

procedente del CO2. El CO2 se ir acumulando en la parte superior del


sacarmetro

Esta cmara ir aumentando a medida que se va

acumulando el CO2.
RESULTADOS Y CONCLUSIONES
Mediante este proceso de fermentacin hemos transformado glucosa en
etanol. Como podemos comprobar que nuestro proceso ha tenido xito.
1. Tomamos el tubo de ensayo en el que pusimos la muestra de glucosa
antes de echarle la levadura del pan.
2. Realizamos la Prueba de Fehling.
3. Esperamos que sea positiva.
4. Ahora tomamos unos 2 ml. de la muestra del sacarmetro.
5. Realizamos la Prueba de Fehling.
6. Esperamos que la reaccin sea negativa, ya que la glucosa se ha
consumido por las levaduras y se ha transformado en etanol, como se
ve en la reaccin de fermentacin.
- 27 -

www.enfoqueseducativos.es

7. Con esto comprobamos que haba glucosa al principio del proceso y al


final ha desaparecido.
8. Ahora vamos a comprobar que se ha producido etanol. Tomamos 2 ml.
de la solucin del sacarmetro y la ponemos en un tubo de ensayo.
9. Aadimos unos cristalitos de bicromato potsico.
10. A continuacin 2 ml. de cido sulfrico diluido.
11. Calentar (mejor al bao Mara). Debe formarse un compuesto
aromtico caracterstico, y se pone de manifiesto porque cambia de
color de amarillento a verdoso. Es una reaccin que nos indica que
existe etanol

- 28 -

www.enfoqueseducativos.es

IMPORTANCIA DE LA IMPRONTA GENTICA


Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V

ANORMALIDADES CROMOSMICAS.
Anormalidades de los cromosomas sexuales.
Alteraciones cromosmicas que afectan al vigsimo tercer par, que es el de los
cromosomas sexuales. Los hombres nacen con un cromosoma x o y extra, lo que
produce el genotipo xxy o xyy, no obstante las mujeres sobreviven si heredan un solo
cromosoma o incluso tres, cuatro o cinco.
Sndrome de Turner.
Sndrome Poli-X.
Sndrome de Klinefeiter.
Sndrome del superhombre.
Sndrome de x frgil.

Sndromes ms frecuentes:

Anormalidades autonmicas.
Anormalidades que se atribuyen a los 22 pares de cromosomas que son similares en
hombres y mujeres. Lo ms comn es que exista un cromosoma extra que aparezca
junto con uno de los 22 pares para producir tres cromosomas de ese tipo o trisoma.
La ms frecuente:
-

Sndrome de Down o trisoma 21.

Anormalidades genticas.
Muchos problemas genticos son rasgos recesivos que ambos progenitores portan y el
nio hereda ese gen perjudicial de cada progenitor. Tambin pueden ser producidas por
mutaciones, cambios en la estructura qumica que producen un nuevo fenotipo.

Fibrosis qustica.
Diabetes.
Distrofia muscular.
Hemofilia.
Fenilcetonuria.
Anemia o clula falciforme.
Enfermedad de Tay-Sachs.

Enfermedades recesivas ms frecuentes:

- 29 -

www.enfoqueseducativos.es

CONSULTA GENTICA, DETECCIN PRENATAL Y TRATAMIENTO DE


TRASTORNOS HEREDITARIOS.
Consulta gentica: Es un servicio que ayuda a los futuros padres a evaluar la
probabilidad de que sus futuros hijos padezcan o no defectos hereditarios. Es til
especialmente para parejas que tienen familiares con trastornos hereditarios o que ya
han engendrado un hijo anormal.
Deteccin prenatal de anormalidades hereditarias:
Amniocentesis: Se extrae una muestra de lquido amnitico del feto. Estas clulas
se examinan para determinar el sexo del feto y la presencia de anormalidades
cromosmicas como el sndrome de Down. Puede desencadenar abortos en un
porcentaje muy pequeo.
Muestreo de vello coritico: Recoge tejido y puede realizarse durante la octava o
novena semana de embarazo. El objetivo es el mismo que la amniocentesis.
Ultrasonido: til para detectar embarazos mltiples y defectos fsicos gruesos, edad
y sexo. Es un mtodo de exploracin del tero mediante ondas sonoras y se emplea
despus de la dcima semana de embarazo.

Tratamiento de los problemas hereditarios.


En la actualidad, los efectos devastadores de muchas anormalidades hereditarias pueden
minimizarse o controlarse si son detectados y tratados antes de que se haya producido
un dao serio. No obstante, los genetistas y mdicos tienen esperanzas de que muchos
defectos genticos para los que no existen tratamiento, pronto podrn ser curados.
INFLUENCIAS HEREDITARIAS EN EL COMPORTAMIENTO.

Mtodos es estudio de las influencias hereditarias.


Reproduccin Selectiva: Manipulacin de la estructura gentica en animales para
estudiar la influencia de los genes en la conducta. Investigadores han mostrado que los
genes contribuyen a desarrollar atributos como el nivel de actividad, la emocionalidad,
la agresividad y el impulso sexual en ratas, ratones y pollos.
Estudios familiares.
Se utilizan dos tipos de estudios familiares:
El diseo de gemelos: Determinar si los gemelos idnticos criados juntos son ms
parecidos entre s en diferentes atributos que los gemelos fraternos tambin criados
juntos.
El diseo de adopcin: Se enfoca en individuos adoptados que no tienen relacin
gentica con los otros miembros de sus familias adoptivas.
- 30 -

www.enfoqueseducativos.es

Cuando se estudian rasgos que una persona exhibe, los investigadores utilizan:

Indices de concordancia: Porcentajes de pares de personas en los que ambos


miembros del par muestran el rasgo si un miembro lo tiene.
Coeficientes de correlacin: Consiste en si un atributo de un gemelo se
relaciona sistemticamente con el de otro gemelo.

Contribuciones hereditarias a los trastornos del comportamiento y enfermedades


mentales.
Actualmente se piensa que existe una base gentica para algunas enfermedades
mentales (esquizofrenia, depresin, psicosis maniaco-depresiva) , comportamientos
antisociales, alcoholismo e hiperactividad. De hecho, se han descubierto marcadores
genticos de la esquizofrenia en 2 de los 23 pares de cromosomas humanos.
No obstante, el ambiente parece ser un elemento muy importante que contribuye a
generar estas condiciones, predisponiendo a desarrollar ciertas enfermedades o patrones
desviados de comportamiento.
Esto puede contribuir a prevenir la aparicin de trastornos con influencia gentica si se
aprende ms sobre los desencadenantes ambientales que precipitan estas perturbaciones.
HERENCIA Y AMBIENTE COMO CONSPIRADORES CONJUNTOS DEL
DESARROLLO.
-

Principio de canalizacin: Tanto los genes como el ambiente pueden limitar un


determinado factor que influir en el desarrollo de la persona.
Principio del rango de reaccin: El genotipo establece lmites los diferentes
fenotipos que se podran mostrar dependiendo de los ambientes.
Correlaciones entre genotipo y ambiente: nuestros genes va a influir en los
tipos de ambiente que experimentemos y lo harn de tres formas:
Correlaciones pasivas genotipo ambiente. La influencia del
ambiente y de la herencia estn interrelacionadas.
Correlaciones provocadoras genotipo ambiente. La herencia
afecta el carcter del ambiente social en el que se desarrolla la
personalidad.
Correlaciones activas genotipo-ambiente. En funcin de nuestros
genotipos nos veremos influenciados a elegir un ambiente social
u otro.

Las correlaciones pasivas son importantes al inicio de la vida, las activas van a
ejercer una mayor influencia a lo largo de la maduracin del nio mientras que las
provocadoras son las ms importantes y reaccionan a lo largo de toda la vida.

- 31 -

www.enfoqueseducativos.es

LA MATERIA DE LOS SERES VIVOS:


ELEMENTOS BIOGENETICOS
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V
Distintos elementos biogenticos se pueden combinar para dar lugar a molculas
que por estar presentes en la materia viva, se llaman biomolculas. Pueden ser tanto
inorgnicas (agua y sales minerales) como orgnicas.

Biomolculas orgnicas presentan una particularidad: glcidos, lpidos,


protenas y cidos nucleicos.

Biomolculas inorgnicas: agua y sales minerales.

1.1 Biomolculas orgnicas

Glcidos: estn formados por azucares de los que los seres vivos obtienen la
energa, se forman por la combinacin de carbono+oxgeno +hidrgeno y
tambin se llaman hidratos de carbono o carbohidratos.

Caractersticas de los glcidos ms importantes:


-

Glucosa: Est destinada a degradarse en las clulas y desprender energa.

Ribosa: forma parte de los cidos ribonucleicos.

Desoxirribosa: de ella va a depender toda la actividad de un ser vivo.

Lactosa: disacrido tpicamente animal. Constituye el nico elemento


que los animales pueden consumir en la primera poca de su vida
leche.

Sacarosa: se utiliza en la alimentacin como edulcorante.

Almidn. Se forma en los vegetales.

Glucgeno: Se sintetiza a partir de la glucosa y se acumula en el hgado


y en los msculos.

Celulosa: tpico de los vegetales.

- 32 -

www.enfoqueseducativos.es

* Lpidos: Este grupo de biomolculas orgnicas, est formado por una serie de
sustancias que slo tienen en comn dos caractersticas:
-

Tienen en su molcula carbono, hidrgeno y oxgeno y todas son


insolubles en agua y solubles en disolventes orgnicos.

No responden a una estructura qumica comn y sus propiedades


biolgicas son muy variadas.

Los ms importantes son:


-

cidos grasos

Las grasas

Los fotolpidos

Los esteroides

Los cidos biliares

* Las protenas: Son molculas polmeras formadas por la unin de otras ms sencillas
llamadas aminocidos. Solamente veinte van a formar parte de todos los seres vivos.
-

Especificidad de las protenas

Desnaturalizacin de las protenas

Funciones biolgicas de las protenas:


-

Funcin enzimtica

Funcin estructural

Funcin de transporte

Funcin hormonal

Funcin de defensa

Funcin de reserva

* Las enzimas: es el grupo de protenas ms variado y especializado: median todas las


reacciones qumicas que tienen lugar en las clulas.

* cidos nucleicos: Son las biomolculas ms importantes de la materia viva. De ellas


depende toda la actividad vital. Son responsables de la biosntesis de las protenas.

- 33 -

www.enfoqueseducativos.es

1.2 Biomolculas inorgnicas


* El agua: Compuesto ms abundante en los seres vivos.
-

Acta como disolvente.

Es termorreguladora.

Neutralidad

* Sales minerales: son compuestos inicos que contienen, al menos un anin y un


catin. En los seres vivos pueden estar en estado slido, o bien disueltas en agua, y por
tanto, ionizadas

- 34 -

www.enfoqueseducativos.es

LA PUBERTAD; CAMBIOS ANATMICOS Y


MADURATIVOS. EVALUACIN DEL PROCESO
MADURATIVO
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V

LA PUBERTAD FEMENINA
El inicio de la adolescencia es anunciado por dos cambios significativos en el desarrollo
fsico y mxima diferenciacin sexual
El pecho comienza a desarrollarse.
Comienza la aceleracin de la altura
Aparece el vello pbico
Obtencin mxima de fuerza
Mxima altura
Se produce la primera menstruacin (monarqua).
Se alcanza la estatura adulta
Desarrollo completo del pecho
Crecimiento completo del vello pbico
Cuerpo maduro de mujer adulta

Cambia la forma y el tamao y se entra en el crecimiento acelerado de la adolescencia


Se alcanza la pubertad, el punto de la vida en que se llega a la madurez sexual y se
puede engendrar un hijo.
LA PUBERTAD MASCULINA
El inicio de la adolescencia es anunciado por dos cambios significativos en el desarrollo
fsico y mxima diferenciacin sexual
Los testculos empiezan su desarrollo.
Aparece el vello pbico
El pene empieza a crecer.
Comienza la aceleracin de la altura.
Se produce la primera eyaculacin.
Mxima altura
Empieza a crecer el vello facial.
La voz comienza a hacerse ms grave
Crecimiento completo del pene
Mxima fuerza.
- 35 -

www.enfoqueseducativos.es

Se alcanza la mxima altura.


Crecimiento completo del vello pbico
Cuerpo maduro de hombre adulto.
Cambia la forma y el tamao y se entra en el crecimiento acelerado de la adolescencia
Se alcanza la pubertad, el punto de la vida en que se llega a la madurez sexual y se
puede engendrar un hijo.

LA REACCIN A LOS
TEMPRANA Y TARDA

CAMBIOS

PUBERTALES:

MADURACIN

Adems del cambio fsico tiene un impacto importante en el ajuste psicolgico que
complica la aceptacin social.
Reaccin de las chicas hacia la menstruacin
Reaccin de los chicos hacia la eyaculacin
Los cambios de humor
Las relaciones con los padres.
Efectos del momento de maduracin.
Diferencias de ajuste dependiendo del momento de maduracin.
El contexto puede modificar estos efectos de la maduracin.

EVALUACIN DE LA MADURACIN: PREMATUROA TRMINO


Es importante por muchas razones- ser capaces de determinar la maduracin o
duracin de la gestacin del recin nacido.
Tiempo y forma de sueo:
Llanto
Movimientos
Conducta alimentaria
Tono muscular
Postura
Rotacin de la cabeza
El signo de la bufanda
El reflejo de Moro
Flexin de la mueca
El reflejo de prensin
Enderezamiento del tronco
Reflejo de extensin cruzada
Extensin de las rodillas
Dorsiflexin del pie
El reflejo de prensin del pie
El reflejo de marcha
Suspensin ventral

- 36 -

www.enfoqueseducativos.es

El examen combinado de las caractersticas fsicas y neurolgicas (examen de


Dubowitz) da un margen de seguridad del 95 % para perodos de dos semanas:
Posicin
Flexin de la mueca
Dorsiflexin del tobillo
Flexin del brazo
Flexin de la pierna
ngulo poplteo
Maniobra taln a oreja
Signo de la bufanda
Control ceflico
Suspensin ventral

EL EXAMEN NEUROLOGICO
Busca detectar las alteraciones del sistema nervioso debidas al desarrollo anormal, las
lesiones o las infecciones, la valoracin del desarrollo del sistema nervioso y la
estimacin del potencial de desarrollo del nio.
Tests especiales
Examen de los nervios craneales y los sentidos
Obtencin de reflejos especiales
Estimacin del tono muscular
Valoracin del estado de alerta
Observacin: posicin, llanto, movimientos, vigilia y sueo
Otros factores que pueden influir en el estado del nio.
Historia clnica detallada: factores que pueden influir en la integridad y
desarrollo de su sistema nervioso.
EL PERIMETRO CEFLICO
Es una parte fundamental del examen del nio: el crecimiento de la cabeza depende del
crecimiento del contenido craneal, si el cerebro no crece normalmente hasta su
extensin completa la cabeza ser pequea. Un permetro ceflico inusualmente
pequeo orienta hacia la subnormalidad mental.
En una curva se representa el permetro ceffico, en otra el peso.
En el nio normal los datos del peso y el permetro ceflico deben ser
similares aunque los factores familiares pueden desempear un papel
importante.
En el caso de un nio gordo puede que no se correspondan en la grfica las
posiciones del peso y del permetro ceflico, la curva del permetro ceflico
ser ms baja.
En el grfico, las mediciones seriadas indican que la cabeza crece a una
velocidad normal.

- 37 -

www.enfoqueseducativos.es

LA TRAYECTORIA Y FACTORES DEL


CRECIMIENTO HUMANO
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V
El ser humano cambia continuamente durante las dos primeras dcadas de vida.
Durante la infancia estos cambios son ms rpidos que en cualquier otra etapa.
Cambios en el tamao del cuerpo. Las seales ms claras de crecimiento fsico
son los cambios de tamao del cuerpo del nio en general. Durante la infancia,
estos cambios son rpidos ms rpidos que en cualquier otra etapa despus del
nacimiento. Al final del primer ao, la altura del nio es un 50 % mayor que al
hacer; a los 2 aos es un 75 % mayor. El peso muestra ganancias similares. A
los 5 meses, el peso al nacer se ha duplicado, al ao se ha triplicado y a los 2
aos se ha cuadriplicado. El crecimiento disminuye al principio y mitad de la
niez. Los nios aumentan alrededor de 5 a 7,5 cm. de altura y 10 kilos de peso
cada ao. La pubertad conlleva una aceleracin repentina en el ritmo del
crecimiento. Como media, los adolescentes aumentan casi 20 cm. de altura y
alrededor de 20 kilos de peso para alcanzar el tamao de un cuerpo maduro.
Cambios en la estatura y el peso. Los bebs crecen muy rpido durante los
primeros dos aos, a menudo duplicando a los seis meses de edad el peso que
tienen al nacer y triplicndolo (hasta ms o menos 9,5 a 10 kg) hacia el final del
primer ao. A los dos aos de edad, tienen la mitad de la que ser su estatura
adulta final y han cuadruplicado el peso que tenan al nacer llegando a pesar
entre 12 y 13,5 kilogramos. Desde los dos aos de edad hasta la pubertad el
crecimiento es lento y constante; un promedio de 5 a 7,5 centmetros de estatura
y de 2,7 a 3,2 kilogramos de peso cada ao. Durante la niez media (de seis a 11
aos), puede parecer que los nios crecen muy poco; ya que en el transcurso de
un ao, 5 centmetros y 2,y kilogramos ms son difciles de detectar en un nio
de 1,20 a 1,40 metros de estatura y de 27 a 36 kilogramos de peso.
Cambios en las proporciones del cuerpo. El tamao global del nio aumenta,
pero las diferentes partes del cuerpo crecen a ritmos diferentes. Durante el
perodo prenatal, la cabeza es lo que se desarrolla primero del disco embrionario,
seguida de la parte inferior del cuerpo. Durante la infancia, la cabeza y el pecho
continan teniendo un crecimiento avanzado, pero el tronco y las piernas cogen
gradualmente rapidez. Aunque las proporciones del cuerpo de chicas y chicos
son parecidas en la infancia y en la niez, las diferencias importantes tpicas de
adultos jvenes aparecen durante la adolescencia. La ms clara es el
ensanchamiento de los hombros en relacin con las caderas en los chicos, y el
ensanchamiento de las caderas en relacin con los hombros y la cintura en las
- 38 -

www.enfoqueseducativos.es

chicas. La accin de las hormonas sexuales en el crecimiento esqueltico causa


estas diferencias. Los chicos acaban siendo ms altos que las chicas, y sus
piernas son ms largas en relacin con el resto del cuerpo. La razn ms
importante es que los chicos se benefician de dos aos extra de crecimiento
preadolescente, momento en que las piernas crecen con ms rapidez.
Cambios en la composicin del cuerpo. Los cambios ms importantes en la
composicin msculo-grasa del cuerpo ocurren con la edad. La grasa (la
mayora est debajo de la piel) comienza a aumentar en las ltimas semanas de
vida prenatal y contina despus del nacimiento, alcanzando el punto ms alto a
los 9 meses. Este aumento de grasa en el beb le ayuda a mantener constante la
temperatura del cuerpo.
Crecimiento del esqueleto. Los nios de la misma edad difieren notablemente
en los ritmos de crecimiento. Como resultado, los investigadores han construido
mtodos para medir el progreso hacia la madurez fsica. Estas tcnicas son tiles
para estudiar las causas y consecuencias de las diferencias individuales en el
crecimiento fsico. Tambin proporcionan estimaciones aproximadas de la edad
cronolgica de los nios en reas del mundo donde las fechas de los nacimientos
no se registran

DESARROLLO NERVIOSO Y PLASTICIDAD: EL MOTOR DEL


CRECIMIENTO.
El cerebro y sistema nervioso humanos constan de ms de un billn de clulas
especializadas que trabajan juntas para activar y coordinar el crecimiento y
funcionamiento.
Diferenciacin celular y formacin de las conexiones sinpticas
Influidas por los sitios a los que migran, las neuronas asumen funciones
especializadas, como las clulas de las reas visual o auditiva del cerebro.
Diferenciacin y crecimiento del cerebro
Al nacer, las reas ms desarrolladas son el tallo cerebral y el mesencfalo, que
controlan los estados de conciencia, los reflejos innatos y funciones biolgicas
vitales como la digestin, la respiracin y la eliminacin. Alrededor del
mesencfalo estn el cerebro y la corteza cerebral, que son las reas implicadas
de forma ms directa en los movimientos corporales voluntarios, la percepcin y
las actividades intelectuales superiores como el aprendizaje, el pensamiento y la
elaboracin de lenguaje. Las primeras reas del cerebro que maduran son las
reas motoras primarias que controlan actividades motoras simples como agitar
los brazos, y las reas sensoriales primarias que controlan procesos sensoriales
como la visin, la audicin, el olfato y el gusto.
Mielinizacin
A medida que las clulas cerebrales proliferan y crecen, algunas de las glas
comienzan a producir una sustancia cerosa llamada mielina, que forma una vaina
alrededor de neuronas individuales. Esta vaina de mielina acta como un aislante
que acelera la transmisin de los impulsos nerviosos y permite, por tanto, que el
- 39 -

www.enfoqueseducativos.es

cerebro se comunique de manera ms eficiente con las diferentes partes del


cuerpo.
Crecimiento del crneo. Los pediatras se preocupan de otro aspecto del
desarrollo del esqueleto cuando miden rutinariamente la circunferencia de la
cabeza de los nios durante la infancia. El crecimiento del crneo es rpido
durante los dos primeros aos debido al gran incremento del tamao del cerebro.
Desarrollo del cerebro
El cerebro humano es actualmente la estructura viva ms elaborada y eficaz de la
tierra. A pesar de su complejidad, en el nacimiento el cerebro est ms cerca de
su tamao adulto que cualquier otro rgano, y contina desarrollndose a un
ritmo asombroso durante los dos primeros aos de vida.
El desarrollo de las neuronas
El cerebro humano tiene de 100 a 200 billones de neuronas o clulas nerviosas
que almacenan y transmiten informacin, muchas de ellas tienen conexiones
directas con otras neuronas. Las neuronas se diferencian de otras clulas del
cuerpo en que no estn empaquetadas las unas con las otras. Hay huecos
pequeos o sinapsis entre ellas donde las fibras de las distintas neuronas se
acercan pero no se tocan. Las neuronas liberan sustancias qumicas que cruzan la
sinapsis, para mandar mensajes de unas a otras.
Desarrollo de la corteza cerebral
La corteza cerebral rodea el resto del cerebro, como la mitad de la cscara de una
nuez. Es la estructura ms grande del cerebro humano (el 85% del peso del
cerebro) y la responsable de la inteligencia nica de nuestra especie. La corteza
cerebral tambin es la ltima estructura cerebral en parar de crecer. Por eso se
cree que es ms sensible a las influencias del ambiente que cualquier otra parte
del cerebro.
Lateralizacin de la corteza. El cerebro tiene dos hemisferios -izquierdo y
derecho. Aunque son parecidos, no tienen las mismas funciones. Algunas tareas
las realiza mayoritariamente uno, y otras el otro. La especializacin de los dos
hemisferios se llama lateralizacin.
La especializacin de las reas del cerebro comienza pronto en la vida
La formacin reticular, una estructura en el tronco del cerebro que mantiene el
estar alerta y la consciencia, se mieliniza a lo largo de la niez.
Cuerpo calloso: conexin entre los hemisferios cerebrales.

- 40 -

www.enfoqueseducativos.es

NOCIONES BSICAS SOBRE EL METABOLISMO


CELULAR
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V
El metabolismo es un proceso fundamental para el desarrollo de la vida. Es el
resultado de dos tipos de procesos biolgicos:
Catablicos; genera energa a travs de la degradacin de los nutrientes y su
trasformacin en clulas ms sencillas.
Anablicos o sintticos; que permiten utilizar la energa obtenida para sintetizar
las molculas vitales para el orden y funcionamiento celular.
Las principales reacciones metablicas que se producen en los organismos vivos
son las siguientes.

REACCIONES METABLICAS
Reaccin de oxidacin-reduccin reacciones retransferencia de electrones en
las cuales el oxidante es la especie molecular que gana electrones al mismo
tiempo que energa, mientras que el reductor, el que se oxida es el que pierde.
Reacciones de condensacin dos o ms sustancias se unen para formar una
molcula ms compleja, con la consiguiente prdida de molculas de agua.
Reacciones de hidrlisis reaccin inversa a las de condensacin.
Reacciones de polimeracin Fusin de diversas molculas ms pequeas,
monmeros, para formar una mayor, pilmero.
Reacciones de esterilizacin un tipo de reaccin de condensacin en las que
la unin se establece por medio de la formacin de un enlace entre un grupo
carbxilo y un grupo hidrfilo.
Reacciones de isometizacin son reaciones de ordenacin interna de los
tomos de una molcula.
Reacciones de transferencia de grupos reacciones de intercambio o traspaso
de algn grupo funcional de una molcula a otra.
Reacciones de fosforilacin un caso particular de transferencia de grupos, lo
que se transfiere es un grupo fosfato.
- 41 -

www.enfoqueseducativos.es

LA RESPIRACIN CELULAR
La oxidacin de las molculas es la forma principal de que dispone las clulas
para obtener energa. El proceso de transformacin de la energa qumica de enlace,
contenida en glcidos, lpidos y proteinas para la formacin de molculas que contienen
gran cantidad de energa, recibe el nombre derespiracin. Hay dos tipos de respiracin:
Aerbica: requiere la presencia de oxigeno.
Anaerbica: se produce en ausencia de oxigeno.
Fases de la respiracin:
Gluclisis Conversin de una molcula de glucosa en dos de cido pirvico
Ciclo de Krebs A partir del cido pirvico, el catabolismo de la glucosa entra
en una fase definitiva, que supone la degradacin total del pirvico. Se producen
CO2 y H2O y un rendimiento energtico elevado.
Fosforilacin oxidativa Transporte de los hidrgenos obtenidos durante la
gluclisis, hasta su aceptor final.

- 42 -

www.enfoqueseducativos.es

PRUEBAS DIFERENCIALES PARA DETERMINAR


LA PRESENCIA DE ENZIMAS OXIDASAS
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V
Esta prueba sirve para determinar la presencia de enzimas oxidasas. La reaccin de la
oxidasa se debe a la presencia de un sistema citocromooxidasa que activa la oxidacin
del citocromo que es reducido por el oxgeno molecular que produce agua o perxido de
hidrgeno segn la especie bacteriana. El oxgeno acta por tanto como aceptor final de
electrones en la cadena transportadora de electrones. Por lo general, el sistema
citocromooxidasa slo se encuentra en los organismos aerobios, algunos anaerobios
facultativos y, excepcionalmente, en algn microaerfilo (Vibrio fetus), pero los
anaerobios estrictos carecen de actividad oxidasa. Asmismo, la presencia de oxidasa va
ligada a la produccin de catalasa, ya que sta degrada el perxido de hidrgeno que se
produce como consecuencia de la reduccin del oxgeno y cuya acumulacin es txica.
La prueba de la oxidasa se usa sobre todo para

Identificar todas las especies de Neisseria (+)

Diferenciar Pseudomonas de los miembros oxidasa negativos de las


enterobacterias.

El reactivo de la oxidasa ms recomendado es la solucin acuosa al 1% de diclorhidrato


de tetrametil-p-fenilendiamina (reactivo de Kovacs). Es menos txico y mucho ms
sensible que el correspondiente compuesto dimetilo (reactivo de Gordon y McLeod),
pero es ms caro. Este reactivo tie las colonias oxidasa positivas de color lavanda que
vira gradualmente a prpura-negruzco intenso.

- 43 -

www.enfoqueseducativos.es

Realizacin de la prueba:
1. Mtodo en placa directa

Agregar directamente 2-3 gotas de reactivo a algunas colonias. No inundar toda


la placa y no invertirla.

Observar los cambios de color. Con el reactivo de Kovacs la reaccin se produce


en unos 10-15 segundos, mientras que con el de Gordon y McLeod es dentro de
los 10-30 minutos.

2. Mtodo indirecto sobre papel

Colocar un trozo de papel de filtro de 3x3cm aproximadamente en una placa de


Petri.

Agregar 2-3 gotas del reactivo de Kovacs en el centro del papel.

Extender con el asa de siembra una colonia sobre el papel impregnado.

La reaccin de color positiva se produce a los 5-10 segundos.

- 44 -

www.enfoqueseducativos.es

BIOPATOLOGA DE LAS DEFICIENCIAS.


INADAPTACIONES
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V

Reflexin sobre el misterio de la vida humana, una gestacin interactiva

El hecho de la vida es de por si algo sorprendente, como a partir de unos


elementos primigenios comenz a producirse el milagro de la vida, que continua hasta
nuestros das. Como esos elementos solo unos pocos de los ms de cien que componen
el universo fueron capaces de interactuar entre s para producir estructuras cada vez ms
complejas: de elementos a molculas, la unin de molculas dio lugar a las primeras
macromolculas, que son las precursoras de las primares estructuras que se agruparon
para dar lugar a los primeros seres, virus y bacterias que se fueron haciendo cada vez
ms complejas hasta dar lugar a los primeros organismos, que siguieron evolucionando
siguiendo diferentes caminos hasta nuestros das, en los que existe una gran diversidad
biolgica.

No podemos olvidar en este punto el papel fundamental jugado por el agua como
caldo de cultivo de estas primeras reacciones, sin ella el milagro de la vida no habra
sido posible.

Desde el principio se fueron marcando unas pautas en la organizacin de los


seres vivos, estructuras ms sencillas se van agrupando para formar estructuras ms
complejas. As la agrupacin de aminocidos da lugar a las protenas, la unin de una
base nitrogenada un azcar y un cido fosfrico da lugar a un nucleotido que se agrupa
con otros para producir los cidos nucleicos ADN y ARN al igual ocurre con lpidos y
los glcidos los otros dos grupos de principios inmediatos orgnicos.

La naturaleza que es muy saba y ha procurado que muchos de estos mecanismos


de sntesis de biomolculas puedan darse en ambos sentidos es decir que de las
- 45 -

www.enfoqueseducativos.es

biomolculas tambin podamos llegar a las estructuras ms bsicas. Mediante diferentes


reacciones que se dan en los organismos y que en su mayora estn catalizadas por
protenas.

Cada una de estas biomolculas tiene una determinad funcin dentro de los
organismos:

As los glcidos son fuente de energa (glucosa), forman parte de la pared


celular de las celulas vegetales ( celulosa), etc,

los lpidos tienen una funcin estructural (colesterol), funcin estructural


y de reversa energtica ( grasas),etc,

las proteinas realizan las ms variopintas funciones captar el oxigeno (


hemoglobina), catalizar reacciones ( enzimas), etc.

los Acidos Nucleicos.

En cuanto a los cidos nucleicos juegan un papel primordial en la


perpetuacin de la vida que el ttulo del tema que nos ocupa.

Que sera de todos estos avances que se han realizado a lo largo de la historia
de la vida en la tierra si esos avances se perdieran.

Aqu juegan un papel importantsimo unas biomolculas que conocemos con


el nombre de cidos nucleicos, hace ms de cincuenta aos que Watson y Crick
describieron el misterio de la doble hlice de ADN y como la informacin esta
codificada en un simple conjunto de letras A-T-C-G, que representan las cuatro
bases nitrogenadas que constituyen el cdigo gentico ( Adenina- TiaminaCitosina y Guanina).

Esta forma de doble hlice permite al ADN copiarse sobre si mismo de tal
manera que de de una doble hebra (imaginaros una cremallera) se abre y se
copian dos hebras nuevas obtenindose, a partir de una cadena, dos cadenas
exactamente iguales. Tambin al abrirse permite ser leda y transportar su
informacin donde es necesaria, es decir, en la zona de codificacin de
proteinas, tarea que realiza en ARN.
- 46 -

www.enfoqueseducativos.es

Al ser la molcula que conserva la informacin que se va a transmitir de las


clulas madres a las hijas, y de los progenitores a sus descendientes el ADN
tiene que tener unos mecanismos potentes de correccin de errores que eviten
que la informacin se altere. A pesar de estos mecanismos en ocasiones se
producen errores lo que da lugar a las mutaciones.

- 47 -

www.enfoqueseducativos.es

SISMGRAFOS HISTORIA Y TIPOS


Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V

En los estudios realizados para conocer la estructura interna de nuestro planeta,


son fundamentales los anlisis los datos recogidos por los sismgrafos, por lo que es
interesante conocer tanto la historia como los diferentes tipos de sismgrafos que se han
utilizado desde los inicios de la ciencia de la sismologa.
El sismgrafo es el instrumento por excelencia utilizado por los sismlogos para
registrar los movimientos de la tierra, transmitidos a travs de las ondas ssmicas
producidas por los terremotos. Los sismgrafos fueron ideados a fines del siglo XIX y
perfeccionados durante el siglo pasado, hasta alcanzar el mayor grado de
perfeccionamiento con el desarrollo del sismgrafo electrnico; sin embargo, su
fundamentos bsicos permanecen inalterables.
Si somos realistas los orgenes de los sismgrafos, son ms antiguos que los
datos reflejados en el prrafo anterior, ya que en los siglos VIII-XI y fueron
ampliamente utilizados en la Repblica de China, pero no llegaron a occidente has
finales del XIX. Estos sismgrafos consistan bsicamente de una figura de dragn de
cuatro cabezas en cuyas bocas se colocaban bolas metlicas en equilibrio inestable. Al
producirse un sesmo y la correspondiente llegada de las ondas ssmicas, la bola
correspondiente a la direccin de llegada caa, indicando as la existencia del terremoto
y la direccin de la cual procedan.
A mitad del siglo XIX, se inici la construccin de los primeros sismgrafos
basados en el movimiento oscilatorio de los pndulos. En general, estos pndulos eran
de oscilacin vertical y consistan en una masa pendiente de un muelle que registra su

- 48 -

www.enfoqueseducativos.es

movimiento usando un estilete adosado a la masa y que dejaba una huella sobre una
placa de cristal ahumado. Se denominaron sismoscopios.

A fines del XIX se introduce una novedad el control del tiempo, siendo entonces
sus registros continuos sobre un papel ahumado adosado sobre un tambor. En 1890,
John Milne introdujo como novedad el pndulo inclinado en el cual los periodos de
oscilacin se incrementaban considerablemente. En 1915 con J. Shaw, Milne construy
un sismgrafo cuya masa de 0.5 kg permita obtener periodos de 18 segundos y
amplificaciones del orden de 200.
Hacia el ao 1900, E. Wiechert desarrollo un sismgrafo de respuesta horizontal
con un pndulo invertido que registraba las dos componentes. En 1922 J. Anderson
construye un sismgrafo de menores dimensiones que considera una masa que oscila
por torsin de una fibra metlica. En 1906, B. Galitzin construye el primer sismgrafo
electromagntico.
En los aos 30, Hugo Benioff desarrolla un sismgrafo basado en la variacin
de la reluctancia del sistema; es decir, variar el espacio existente entre un imn
permanente y una armadura metlica provista de una bobina que rodea al imn.
Desde el ao 1953 aproximadamente, se puede decir que se generaliza el uso de
relojes controlados por cristal de cuarzo que son los precursores de los sismgrafos
actuales.
El principio fsico de todos los tipos de sismgrafos se basa en la propiedad
fsica de un pndulo (masa suspendida de un hilo) que al producirse el movimiento del
suelo, este se desplaza con respecto a la masa suspendida en virtud de su inercia. Todos
estos movimientos deben ser registrados en funcin del tiempo y dependiendo del tipo
de movimiento al cual son sensibles (velocidad, desplazamiento o aceleracin). La
sismometra considera tres tipos de sismgrafos: mecnico, electromagntico y de
banda ancha.

- 49 -

www.enfoqueseducativos.es

Sismgrafos Mecnicos: Este sismgrafo es el ms simple y esta


constituido por un elemento detector del movimiento (sismmetro) y un
sistema de palancas que amplifican dicho movimiento.

Sismgrafos Electromagnticos. La nica variacin de este sismgrafo


en relacin al anterior, es que el desplazamiento de la masa produce el
movimiento relativo de una bobina en el campo magntico de un imn.
En este caso la parte mvil es el imn y en otros la bobina.

Sismgrafos de Banda Ancha. Por lo general, los sismgrafos eran de


dos tipos o registraban informacin ssmica en dos diferentes rangos de
frecuencia, periodos cortos (1 seg) y periodos largos (15-100 seg). El
primero adecuado para sismos que ocurren en el campo cercano y los
segundos en el campo lejano.

- 50 -

www.enfoqueseducativos.es

TRANSMISIN GENTICA HEREDITARIA


Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V

PRINCIPIOS DE LA TRANSMISIN HEREDITARIA.

Cuando un espermatozoide penetra en el vulo, ambos liberan su material


gentico y se forma un ncleo celular nuevo (cigoto) que contiene el cdigo para que de
una slo clula se desarrolle un ser humano.
El nuevo ncleo celular contiene 46 cromosomas compuestos por genes que son
las unidades bsicas de la herencia. Cada progenitor contribuye con 23 cromosomas
para cada uno de sus descendientes.
El cigoto comienza a reproducirse a s mismo por medio de la mitosis, justo
antes de cada divisin, la clula duplica sus 46 cromosomas y estos conjuntos se
mueven en direcciones opuestas, entonces se produce la divisin que da lugar a dos
clulas hijas, as cuando nace un nio, consta de miles de millones de clulas, que
forman msculos, huesos, etc..
Clulas germinales o sexuales.
Sirven para la produccin de gametos, espermatozoides en los hombres y vulos
en las mujeres y lo hacen mediante un proceso de meiosis, la clula germinal duplica
primero sus 46 cromosomas, los pares de cromosomas duplicados se separan para
formar dos clulas madre con 46 cromosomas, por ltimo la clula madre se divide de
modo que cada una de sus clulas hijas contenga 23 cromosomas nicos, de esta forma
un espermatozoide con 23 cromosomas se une con un vulo con otros 23 cromosomas
para formar un cigoto.
Debido al proceso de entrecruzamiento, que ocurre en las primeras fases de la
meiosis, se altera la composicin gentica de los cromosomas y aumenta el nmero de
variaciones posibles en los gametos de un individuo, por lo tanto desde el punto de vista
gentico cada individuo es nico.

Nacimientos mltiples.

- 51 -

www.enfoqueseducativos.es

Gemelos homocigcicos: Proceden de un mismo cigoto y ambos tienen la


misma carga gentica.
Gemelos dicigticos: Proceden de cigotos distintos por lo que su relacin
gentica es la misma que existe entre dos hermanos cualesquiera.

Hombre o mujer.
Observando el cariotipo de las clulas de hombres y mujeres observamos solo
una diferencia en cuanto a forma en la pareja 23 XX para mujeres y XY para hombres
definindose estos como cromosomas sexuales.
Qu hacen los genes?
Los genes se expresan mediante la produccin de protenas estando
influenciados por factores ambientales, habindose realizado a este respecto numerosos
estudios con gemelos monocigticos separados al nacer.
Cmo se expresan los genes?
Cinco patrones principales:
Herencia dominante-recesiva simple: Los genes que determinan una
caracterstica humana no son una mezcla de los alelos de sus progenitores sino
que un gen domina sobre otro y el descendiente se parece al progenitor que
contribuy con el gen dominante. Las personas cuyo genotipo de un atributo
consta de dos alelos de la misma clase son homocigticos, la persona que hereda
formas alternativas de ese alelo es heterocigtico.
Codominancia: Un gen no siempre sigue el patrn dominante-recesivo sino que
en ocasiones existe un compromiso entre los dos genes. Tambin ocurre cuando
uno de dos alelos heterocigticos es ms fuerte que el otro pero no oculta todo
sus efectos como la clula falciforme.
Herencia vinculada al sexo: Son determinadas por los genes localizados en los
cromosomas sexuales. La gran mayora de rasgos vinculados con el sexo son
producidos por genes recesivos que slo se encuentran en los cromosomas x, por
lo que el hombre tiene ms probabilidad de desarrollar estos rasgos al tener un
solo cromosoma x.
Impronta gentica: Es un proceso en el que pares de genes particulares son
marcados bioqumicamente de modo que slo un alelo de un progenitor se
expresa, sin importar su composicin. Existen pocos alelos con estas
caractersticas y no se da en todos los individuos. Se desconoce su significado
evolutivo.
Herencia polignica: Las caractersticas ms importantes no son determinadas
por un par de alelos sino por varios por, lo que existe una amplia gama de
- 52 -

www.enfoqueseducativos.es

diferencias individuales en los atributos humanos en los que tambin influye el


ambiente.

- 53 -

www.enfoqueseducativos.es

La ciudad lineal de Arturo Soria.


Diana Castilla Martnez.

Para abordar el crecimiento demogrfico vivido de Madrid a finales del siglo


XIX se planifican una serie de soluciones urbansticas de las cuales la ms novedosa
ser la teora de la ciudad lineal. El padre se esta teora era Arturo Soria y Mata, y la
principal novedad de su proyecto consistira en organizar el desarrollo urbano en base a
la importancia del transporte en la ciudad moderna.
Su propuesta de ciudad fue formulada en textos y artculos escritos que arrancan
de uno que public en 1882 y que parte de la idea de la linealidad del transporte
colectivo a la hora de disear una ciudad moderna. Esta originaria idea le lleva a crear
una ciudad formada por una banda urbana por cuyo centro circula el transporte pblico
y flanqueado a ambos lados por manzanas donde estn los edificios rodeados por zonas
verdes. La segunda idea es que esa ciudad debera de estar rodeada por naturaleza,
rompiendo as con la separacin campo ciudad. Las viviendas ocuparan muy poco
espacio y la mayora se destinara a naturaleza, evitando as que la poblacin no se
tuviera que desplazar al campo ni sintiera aoranza del mismo. Otra idea es que los
propietarios de las casas tambin lo seran de los campos que los circundan,
antecedindose Soria con esta idea a la ciudad jardn de Howard que aparecera 6 aos
despus e intentando unir el mundo rural con el urbano. Tambin se tena previsto que
algunas manzanas de viviendas se destinasen a servicios pblicos como hospitales,
cuarteles, colegios o parques de ocio.
En las propuestas de Soria se dispona que en el eje central hubiera hasta cuatro
lneas de transporte: una con trenes de gran velocidad que slo haran paradas en
- 56 -

www.enfoqueseducativos.es

trayectos largos. Otra con trenes entre 60 y 100 Km/h con paradas en distancias algo
ms cortas. Una tercera lnea con trenes a una velocidad entre 30 y 60 Km/h con
paradas en distancias an ms cortas y un cuarto nivel con lneas de tranvas entre 15 y
20 Km/h y con paradas mnimas. Tambin en este eje se dispondran unas
canalizaciones por donde circulara el agua potable, los desages, telfono y telgrafo.
El proyecto iba an ms lejos pues se tena la idea de unir ciudades histricas
mediante una ciudad lineal. Con esto, Soria proyecta una planificacin regional a base
de ciudades lineales e incluso plantea la posibilidad de unir las ciudades de Europa de
esta forma.
A tenor de lo expuesto se aprecia que es una teora bastante novedosa para su
poca, aunque tambin recuerda a las teoras de ciudades utpicas y a las barriadas de
casas rodeadas de jardines de Inglaterra y EE.UU.
Una vez esbozada la teora de Arturo Soria, la prctica no llegara a los lmites
propuestos.
Soria era empresario y diriga unas lneas de tranvas en Madrid y en 1892
consigue la concesin de un tranva de circunvalacin de Madrid que ira desde
Chamartn hasta Pozuelo de Alarcn. En base a esta concesin funda en 1894 la
Compaa Madrilea de Urbanizacin, cuyo objetivo era construir una ciudad lineal en
Madrid. Se propone la construccin de una ciudad de 50 Km. de longitud que uniera las
poblaciones que recorra ese tranva. En este sentido esta idea se aparta de la teora
propuesta ya que la teora hablaba de una ciudad lineal que uniera ciudades y en la
prctica slo una pueblos. A pesar de estas contradicciones, puso en marcha su
proyecto y fund en 1896 la revista Ciudad lineal, primera revista urbanstica del
mundo. En 1895 comenz a comprar terrenos a lo largo de una franja de 5 Km. en la
parte noreste de Madrid avanzando hacia el este. En 1899 comienza la construccin del

- 57 -

www.enfoqueseducativos.es

ferrocarril central, y en las primeras dcadas del siglo XX se empiezan a construir las
viviendas y las calles centrales y laterales. Huyendo de una construccin repetitiva, su
Compaa haba dado libertad para que cada propietario hiciera su casa a su gusto.
Aparecieron la central elctrica, la central telefnica, los colegios, los campos de
deportes, centros culturales y centros deportivos y de ocio. Se hace realidad una forma
de vida nueva, higinica y progresista que atrae a todas las clases sociales, y en ella
tienen su casa muchos profesionales liberales, entre ellos, el propio Arturo Soria.
En 1920 esta ciudad tena ya 4000 habitantes. La calle central estaba recorrida
por dos tranvas que desde 1909 seran elctricos.
Cuando acab de construir el primer tramo, de Chamartn a Viclvaro, empez a
planificar el segundo pero la subida de precio de los solares hizo imposible que los
pudiera adquirir, pidi apoyo estatal pero no le fue concedido construyndose slo 5 de
los 50 Km. planificados y concluyndose as una de las mayores propuestas urbansticas
a nivel mundial que estaba pensada para ir de Cdiz a San Petesburgo.

Para saber ms:


-

Tern Troyano, F: Historia del urbanismo en Espaa. Siglos XIX y


XX. Madrid, Ctedra, 1999.

Alonso Parara, Jos Ramn : La ciudad lineal de Madrid.

- 58 -

www.enfoqueseducativos.es

- 59 -

www.enfoqueseducativos.es

EL USO DIDCTICO DE LA OBRA DE LA GENERACIN DEL 27 EN LA


ENSEANZA DE HISTORIA DEL ARTE. UN EJEMPLO: JORGE GUILLN.
Autor: Fabio Lpez Conde. DNI: 26027889-P

El uso didctico de la obra de la Generacin del 27 en el mbito de la enseanza


de Historia del Arte se encuentra avalada por El Decreto 148/2002, de 14 de mayo, de
currculo de la ESO, el Decreto 231/2007, de 31 de julio, de ordenacin del currculo de
la ESO, la Orden 10/8/2007, que lo desarrolla, y el Decreto 208/2002, de 23 de julio, de
currculo de Bachillerato, que especifican que, entre otras, deben desarrollarse las
siguientes capacidades:

Entender las obras de arte en su globalidad, como exponentes de la creatividad


humana, susceptibles de ser disfrutadas por s mismas y valoradas como
documentos de una poca y cultura.

Desarrollar el gusto personal, la capacidad de goce esttico y sentido crtico y


expresar sentimientos propios ante obras de arte.

Utilizar un mtodo de anlisis que permita conocer bien las obras de arte,
desarrollando la sensibilidad y la imaginacin.

Valorar y disfrutar el patrimonio


artstico, contribuyendo a su
conservacin

rechazando

- 60 -

www.enfoqueseducativos.es

comportamientos o actitudes que lo deterioren.

De igual manera, el RD 1631/2006, de 29 de diciembre, de enseanzas mnimas


de la ESO, establece que el trabajo en las materias del currculo debe contribuir al
desarrollo de, entre otras, las siguientes competencias bsicas:

Competencia en el tratamiento de la informacin y competencia digital, que


incluye utilizar las tecnologas de la informacin y la comunicacin y supone el
uso de software y hardware para el aprendizaje, as como el empleo de Internet.

Competencia social y ciudadana, al favorecer la comprensin crtica de la


realidad histrica y social del mundo, al analizar sta desde una perspectiva
diferente a la habitual, la artstica, abriendo paso al alumno al mbito de los
anlisis multicausales, en tanto que el arte refleja la visin ntima y personal de
los autores que lo desarrollan.

Competencia cultural y artstica, que supone apreciar, comprender y valorar


crticamente diferentes manifestaciones culturales y artsticas, utilizarlas como
fuente de disfrute y enriquecimiento personal y considerarlas como parte del
patrimonio cultural de los pueblos.

Asimismo, la LOE 2/2006, de 3 de Mayo, en su artculo 19.2, especifica que se


trabajarn en todas las reas las tecnologas de la informacin y comunicacin; y en el
102.3 que las Administraciones educativas promovern la utilizacin de las tecnologas

- 61 -

www.enfoqueseducativos.es

de la informacin y la comunicacin estableciendo programas especficos de


formacin en este mbito.

Por otra parte, la Orden 21/7/2006, regula el procedimiento para la elaboracin


de los proyectos de incorporacin de las nuevas tecnologas a los centros T.I.C.

Finalmente, el fomento de la lectura de la prolfica Generacin del 27 en el


mbito educativo viene avalado por la Orden de 8 de Enero de 2007, por la que se
dispone la conmemoracin del ochenta aniversario de la constitucin del Grupo Potico,
en los centros docentes no universitarios de Andaluca. En dicha Orden, el artculo 4
establece la planificacin de actividades pluridisciplinares que relacionen este evento
cultural con la historia, la literatura, el arte, la investigacin, etc que se desarrollen
durante todo el ao y genere oportunidades de acercamiento a la figura de los poetas.

Nuestra propuesta didctica consiste en la aproximacin al estudio de las obras


de arte a travs de los textos de la Generacin del 27 que incidan en temticas de ndole
mitolgica, mediante el uso de las Tecnologas de la Informacin y Comunicacin y el
empleo de Internet.

La propuesta didctica que se propone en este artculo hunde sus races en un


hecho incontrovertible que ya ha sido estudiado desde diferentes pticas y mbitos por
autores del prestigio de Ruz de Elvira o Lasso de Vega y que, en sus trminos ms
amplios, expuso, ms recientemente Vicente Cristbal en un erudito artculo sobre el
tema: en el estudio de la presencia de la mitologa clsica en nuestra literatura
espaola est implicado lo griego, lo latino y lo hispnico, por cuanto que Grecia es la

- 62 -

www.enfoqueseducativos.es

creadora de esos mitos y algunas veces tambin la transmisora, la literatura latina es la


transmisora habitual y la literatura espaola es la receptora de los mismos.

En el caso concreto de la Generacin del 27, la poesa lorquiana ofrece ejemplos


vistosos de imgenes construidas con ingredientes mtico-clsicos, as como en la obra
de Luis Cernuda y Rafael Alberti, ms en su vertiente helenista que latina. Sin embargo
es especialmente notable la presencia del mito, an siendo tratado con la libertad y
desmitificacin que hacen gala sus escritos, en Jorge Guilln, el ms virgiliano de los
autores del Grupo del 27 y contrastado conocedor de los principales autores grecolatinos.

As

lo

demuestran

sus

trabajos

mitogrficos,

basados

en

Ovidio

fundamentalmente, como Dafne a medias, de Clamor; Dnae, de Final; Acten


que se salva, de Homenaje; Tiempo perdido, poemario sobre Ifis y Anaxrete, de
Homenaje, Ariadna en Nasos, de Y otros poemas; o sus poemas Al margen de
contenidos en Homenaje, que hacen referencia a autores como Homero, Safo, Sfocles,
Hipcrates, Platn, Aristfanes, Lucrecio, Cicern, Horacio, Sneca y Prudencio.

De esta forma, el empleo de la obra de autores del Grupo del 27 en el estudio de


la historia del arte, queda justificada por los siguientes motivos:

Permite comprender y profundizar los temas estudiados en la asignatura de


Historia de Arte y, asimismo, de otras materias.

Fomenta la aparicin de hbitos de lectura, de observacin, anlisis e


interpretacin, as como de reflexin, sntesis, comprensin y relacin.

- 63 -

www.enfoqueseducativos.es

Favorece el desarrollo de la imaginacin y de hbitos intelectuales y tcnicas de


trabajo relacionadas con la investigacin, as como la aproximacin cientfica al
mundo del arte.

No podemos concluir sin sealar que la aplicacin de las TICs en el mbito


educativo y, concretamente, en el estudio del arte constituye una herramienta didctica
muy eficaz y dinmica que posee un alto grado de motivacin en el alumnado. Por esta
razn, especialmente, el docente debe huir de su tentador empleo como recompensa o
como entretenimiento, y compaginar su uso con otro tipo de actividades contempladas
en las unidades didcticas de la materia o en la programacin didctica del curso.

BIBLIOGRAFA BSICA

BELTRN, M T: Los mitos y el arte, Actas del VIII Congreso Espaol de


Estudios Clsicos (Madrid, 23-28 de septiembre de 1991), Madrid 1994, III,
Pp. 373-378.

CAMACHO ROJO, J. M: La tradicin clsica en las literaturas hispnicas:


esbozo de un ensayo bibliogrfico, Florencia Iliberritana 2 (1991) 33-92.

COSSO, JM DE: Fbulas mitolgicas en Espaa, Madrid 1952.

CRISTBAL, V:
o Virgilio y la temtica buclica en la tradicin clsica, Madrid 1980.
o Mitologa clsica y cuentos populares espaoles, en M T.
HERNNDEZ LUCAS (CD.): Mitologa Clsica. Teora y prctica
docente, Madrid 1990, pp. 37-62.

DEBICKI, P: La poesa de Jorge Guilln, Madrid, 1973, pp. 286 SS.

GIL DE VIEDMA, J: Cntico: el mundo y la poesa de Jorge Guilln,


Barcelona, 1960, pp. 135-139.
- 64 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


CMO FOMENTAR LA LECTURA EN EL AULA
A nadie se le escapa la importancia que tiene que nuestros
alumnos lean por placer, por entretenimiento y por enriquecimiento
personal. En la medida de lo posible, los docentes debemos apoyar y
afianzar esta prctica en los alumnos.
Un momento esencial para consolidar el hbito lector es el
paso de la niez a la adolescencia. As, encontramos cmo aquellos
alumnos que lean con asiduidad en la Educacin Primaria, se pierden
como lectores al llegar a la Educacin Secundaria. La prdida de
lectores se produce por diversos motivos; entre ellos el cambio fsico
de los adolescentes. Aunque lo ms habitual es que no se haya
producido una evolucin gradual entre estos perodos educativos.
Muy a menudo tendemos en la etapa de Secundaria, los
profesores de Lengua Castellana y Literatura, a trabajar textos
clsicos de nuestra literatura. Sin ser desdeable el empleo de estas
obras, es aconsejable incorporar en nuestra prctica habitual otro tipo
de obras ms cercanas a los gustos e intereses de los alumnos.
Conforme se va desarrollando el hbito lector es menos drstico el
paso a obras clsicas.
La lectura, igual que otros contenidos del currculo, debe tener
unos objetivos bien definidos. Con la planificacin conseguimos que
nuestro plan de lectura no caiga en errores de improvisacin.

- 66 -

www.enfoqueseducativos.es

En el momento de seleccionar las obras que vamos a trabajar


con los alumnos hay que tener en cuenta algunos aspectos. Las obras
habr que elegirlas atendiendo al posible inters que pueden despertar
en el alumno, bien por el tema que desarrolle, bien por la forma
atractiva que presente el libro. Importante es tambin dar
protagonismo al alumno a la hora de elegir las obras. Cuando
elegimos un libro lo leemos con ms inters que si alguien nos lo ha
impuesto. El docente debe demostrar que se disfruta con la lectura, y
para demostrarlo es bueno que a menudo lea en voz alta ante la clase.
La puesta en comn de lo ledo entre todo el grupo es positivo.
Cuando un compaero nos da una opinin positiva sobre un libro
somos ms receptivos a su lectura.
En el tiempo de nuestra materia dejaremos al menos media
sesin semanal para leer en el aula. Cuando el alumno concluya un
libro tendremos una entrevista oral con l, con el fin de comprobar
que ha comprendido el libro. Tras esta entrevista, realizar una ficha
comentando la obra que ha terminado. Esta ficha ser colocada en un
lugar visible del aula. El boca a boca es muy importante a la hora de
elegir un libro. Muchos de nosotros compramos una obra porque
algn familiar o amigo nos la ha recomendado.
El tratamiento que demos a la lectura no ha de tener un
carcter punitivo, ya que lo que pretendemos es que esta actividad sea
atractiva al alumno. Con esto conseguiremos que integre esta prctica
en su quehacer diario. Muchas veces se ve solo como un medio para

- 67 -

www.enfoqueseducativos.es

aprobar la materia, y as muchos se dedican exclusivamente a conocer


algunas preguntas comunes sobre el libro para salvar un examen.
Siguiendo estas pautas veremos cmo nuestros alumnos van
incorporando la lectura. Poco a poco se ir convirtiendo en otra de sus
actividades de ocio. Y como es lgico, al afianzar este hbito
estaremos mejorando el rendimiento acadmico del alumno. No slo
mejorar su escritura ortogrficamente. Tambin lo harn su
comprensin y expresin escritas.

- 68 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez

CMO TRABAJAR LA EXPRESIN


ORAL EN EL AULA

Hasta no hace muchos aos la lengua oral no


haba sido objeto de estudio en la enseanza. En la
escuela nos habamos limitado al aprendizaje y uso de
la otra manifestacin de la lengua, la escrita. Se ha
hecho as de forma tradicional ya que se pensaba que
el aprendizaje de la lengua oral era una cuestin que
se aprenda en las familias o en la calle, y as, todos
pensbamos que los alumnos ya dominaban esta
habilidad. Los ltimos enfoques educativos nos
indican que esta idea no es sostenible actualmente
porque el alumno, como persona social, se encuentra
en su vida diaria con diferentes situaciones en las que
necesita expresarse oralmente, y utilizando distintos
registros.

- 69 -

www.enfoqueseducativos.es

En la sociedad en la que vivimos se hace


necesario tener una buena habilidad en el dominio de
la lengua oral. Da a da nos topamos con diferentes
entornos comunicativos en los que nuestra habilidad
comunicativa es fundamental. No slo hablamos con
amigos, ahora se nos hace necesario dominar lo oral
para

afrontar

entrevistas

de

trabajo,

realizar

oposiciones, pronunciar conferencias, etc.

No es preciso que en el aula trabajemos todas


las posibles situaciones en las que interviene la lengua
oral, sino solamente aquellas que ms se adecuan a
nuestro mbito. Por ejemplo los debates, reuniones,
entrevistas, etc.
Lo que debemos tener en cuenta a la hora de
planificar nuestras actividades dentro del aula son
aspectos como los siguientes. No seamos impacientes
ante los resultados de nuestros alumnos. Es sabido
que

para

desarrollar

una

buena

habilidad

comunicativa oral sern necesarias muchas sesiones


en el aula. Por eso no debemos desesperar ante las
- 70 -

www.enfoqueseducativos.es

primeras adversidades. Los alumnos conseguirn los


objetivos a largo plazo.
Las primeras sesiones de expresin oral las
dedicaremos fundamentalmente a que el alumno
conozca el funcionamiento de stas. Al principio es
muy normal que el alumno se sienta algo perdido ante
la actividad, pero con el tiempo asimilarn cmo es la
marcha habitual de estos ejercicios. Los objetivos que
pretendamos conseguir con estas prcticas han de
poder ser evaluados para as corroborar el grado de
consecucin de los mismos.
Los alumnos han de ser conscientes de que su
uso oral de la lengua es importante. Al principio es
normal que piensen que no han de aprenderlo porque
creen que ya lo dominan. Tras algunas sesiones
seguro que lo vern desde otra perspectiva.
Cuando evaluemos la expresin oral de
nuestros alumnos debemos fijarnos no solo en que su
discurso sea correcto desde el punto de vista
gramatical, sino que tambin debemos atender a la

- 71 -

www.enfoqueseducativos.es

fluidez de su discurso, tan importante como el aspecto


anterior.
Con

estas

indicaciones,

los

alocados

discursos de nuestros alumnos irn adquiriendo de


forma paulatina una mayor correccin y fluidez.

- 72 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


CMO TRABAJAR LA COMPRENSIN ESCRITA EN EL AULA
Es muy importante en nuestra labor docente otorgar un lugar destacado al
aprendizaje de la comprensin escrita de nuestros alumnos. Es sabido que algunas de
las carencias del alumnado es consecuencia de una mala comprensin.
A menudo nos topamos con escritos que no contestan a lo que se les pide.
Solemos achacar estos errores a falta de estudio; sin embargo, muy a menudo, la falta
de coherencia entre lo que preguntamos en ejercicios de clase o exmenes es debida a
problemas de comprensin.
Para mejorar el aprendizaje de nuestra aula son muchas las actividades que
podemos desarrollar con el grupo. A medida que vayamos avanzando en stas iremos
mejorando la comprensin de nuestros alumnos y, en consecuencia, mejoraremos su
rendimiento acadmico.
Las habilidades que entran en juego a la hora de mejorar la comprensin son,
entre otras, la memoria o la anticipacin. Para que el alumno las adquiera son muchos
los materiales que podemos emplear, desde el libro de texto hasta la prensa diaria.
La prctica ms habitual a la hora de trabajar la comprensin escrita es la
realizacin de resmenes o la resolucin de preguntas relativas a un texto. Pero no
debemos desdear otras como preguntas de respuesta verdadero o falso, los conocidos
como kloze (que son los tradicionales ejercicios de rellenar huecos), comparar textos
que relaten la misma noticia, etc.

- 73 -

www.enfoqueseducativos.es

Los textos que deber ser prioritarios en nuestra labor son aquellos con
los que se topar el alumno en su vida social. No hay que olvidar los
textos literarios, pero textos como hojas de reclamaciones u rdenes
del da, son ms tiles para el conjunto de alumnos ya que los prepara
para su incorporacin a la vida en sociedad.
Si vamos incorporando estas prcticas veremos como el
rendimiento del alumno mejora. A medida que ste comprenda mejor
lo que lee podr demostrar todo su potencial.

- 74 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


EL USO DE INTERNET EN LA ASIGNATURA DE LENGUA
CASTELLANA Y LITERATURA
Somos muchos los que hemos pensado que los nuevos medios
de comunicacin quedaban fueran de nuestro alcance, que no ramos
capaces de utilizarlos para desarrollar nuestra actividad docente. Sin
embargo, a poco que profundicemos en estos nuevos medios veremos
las enormes posibilidades que nos abren en nuestra labor docente. Es
indiferente cul sea nuestra especialidad, ya que las actuales
tecnologas pueden sernos tiles a todos los profesionales de la
enseanza.
En el presente artculo me centrar en algunas de las
posibilidades que se pueden obtener con el manejo de Internet en
nuestra clase de Lengua Castellana y Literatura. Alguno de los
recursos tambin puede ser aplicado a otras reas.
Uno de los primeros interrogantes que se nos plantea al
intentar desarrollar actividades con nuestros alumnos en el aula de
informtica es si las tareas que realicemos con ellos contribuirn al
desarrollo del alumno en nuestra rea, o si por el contrario, lo nico
que conseguiremos es que adquiera conocimiento sobre el uso de un
determinado software.

- 75 -

www.enfoqueseducativos.es

Muchos de nosotros, al intentar desarrollar actividades con el


ordenador, nos hemos limitado al uso de algunos procesadores de
texto. Otras veces, hemos intentado que busquen informacin en
Internet, casi siempre sobre algn autor literario de los que contempla
nuestro currculo.
En la actualidad hay unas propuestas muy atractivas para
utilizar las nuevas tecnologas en el aula. De entre ellas me destacar
tres, centradas en el uso de Internet. No es este sitio para explicar su
desarrollo concreto en el aula. Me limitar a presentarlas y a explicar
sucintamente cmo desarrollarlas con nuestros alumnos.
La primera de ellas se conoce como Treasure Hunt, Bsqueda
del Tesoro en espaol. Esta actividad consiste en ofrecer a los
alumnos una serie de preguntas. Se les proporcionan adems unas
pginas de Internet que previamente ha visitado el profesor. Para
seleccionar las direcciones de pginas web debemos tener en cuenta el
nivel y edad de nuestros alumnos. Dependiendo de stas podremos
seleccionar unos sitios en los que puedan leer directamente la
respuesta a las preguntas, o podremos seleccionar otros en los que
ellos deban inferir la respuesta a partir de la lectura de la informacin
que proporcione la web.
Con esta actividad conseguiremos que los alumnos mejoren su
comprensin de textos, al tiempo que logramos que adquieran
informacin de primera mano sobre un aspecto propio de su currculo.

- 76 -

www.enfoqueseducativos.es

Pero,

al

tiempo

que

alcanzamos

estos

objetivos,

tambin

desarrollaremos destrezas de bsqueda de informacin.


No obviemos que a partir de esta actividad podemos tambin
desarrollar otra que consistira en que los alumnos realicen sus
propias Bsquedas de Tesoro.
La segunda actividad que podemos aplicar en el aula de
informtica, y utilizando Internet para su desarrollo, es la conocida
como Webquest. stas, creadas por Bernie Dodge, estn orientadas a
que los alumnos trabajen en grupo y se dediquen a la elaboracin de
informacin. En las Bsquedas de Tesoro la actividad fundamental es
la bsqueda de la informacin. En las Webquest, en cambio, es ms
importante la elaboracin de esa informacin. El docente es el
encargado de preseleccionar los contenidos que luego utilizarn los
alumnos en la web. Se pretende que mejoren su conocimiento sobre
algn aspecto concreto del currculo. Con esta actividad se trabaja la
bsqueda de informacin, la seleccin de sta y la elaboracin de los
contenidos trabajados. La tarea final puede consistir en exponer la
informacin que han ido trabajando.
La ltima actividad que comentar ser la conocida como
blog. Es muy importante el desarrollo que estn teniendo estos en los
ltimos tiempos. El uso ms frecuente que de estos se conoce es
utilizarlos como los antiguos diarios que algunos guardbamos con
celo en un cajn. Actualmente estos diarios son utilizados por
escritores, periodistas, personas annimas, etc. Creando uno nuestros

- 77 -

www.enfoqueseducativos.es

alumnos pueden ir trabajando ejercicios de expresin escrita, bien de


forma individual o bien de forma colectiva. Cualquier ejercicio de
composicin de textos puede ser aplicado al uso de los blog, pero a su
vez conseguimos que este ejercicio sea atractivo al alumno ya que lo
que ellos van trabajando puede ser visto por el resto de compaeros, o
por cualquiera que visite el sitio en Internet.
No slo los alumnos pueden hacer uso de estos blog. Es
recomendable que tambin nosotros como docentes, demos ejemplo.
Para ello podemos crear uno de estos diarios. En l no
desarrollaremos nuestras vivencias, sino que podemos aprovecharlo
para poner en l material que queramos que reciban nuestros alumnos:
Textos relacionados con nuestra materia como apuntes y materiales
curriculares, obras de consulta, enlaces que puedan visitar para
mejorar su conocimiento de algn aspecto concreto del currculo,
crtica de libros, etc.
Con estas propuestas slo se pretende que veamos algunas de
las mltiples posibilidades que ofrece Internet para trabajar desde
nuestra rea de Lengua Castellana y Literatura. No deberamos tener
temor en aplicarlas ya que con ellas contribuiremos enormemente a
mejorar el aprendizaje de nuestros alumnos.

- 78 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


ENSEAR LITERATURA
La enseanza tradicional de literatura consista en
ofrecer un exhaustivo estudio por las principales obras, autores
y periodos literarios. En este sentido, las obras eran modelos
ideales a los que haba que imitar. Actualmente se persigue otro
fin en la enseanza de la literatura. Se intenta que el alumno
adquiera la conocida como competencia literaria. Esta
competencia consiste en identificar los rasgos principales de los
gneros, reconocer una obra como representativa de un periodo
determinado, etc. En definitiva, crear lectores eficientes.
Siguiendo estos nuevos planteamientos, nosotros como
docentes debemos coordinar diferentes actividades con nuestro
grupo. No consiste solo en que leamos obras cannicas en el
aula, sino que tambin debemos acometer otros retos como
hacer comentarios, asistir a representaciones teatrales, incentivar
la creacin de textos, etc.
Con este planteamiento, nuestra principal finalidad ser
crear en el alumno un hbito lector. Si conseguimos que
nuestros alumnos lean para su enriquecimiento personal
conseguiremos que vayan desarrollando, paulatinamente, su
competencia literaria.

- 79 -

www.enfoqueseducativos.es

Es crucial que trabajemos la comprensin de textos


literarios. En muchas ocasiones los alumnos no comprenden las
lecturas que imponemos. Por este motivo debemos ayudar a su
comprensin. Cuando el adolescente vaya desarrollando su
capacidad de compresin necesitar menos colaboracin por
nuestra parte.
Para hacer ms atractivo el hecho literario el alumno
debe acercarse sin prejuicios al texto. Si logramos que vea la
literatura como algo cercano conseguiremos que lea con ms
naturalidad. Para ello apoyaremos sus creaciones personales. El
alumno tiene que escribir por placer esttico. Sus textos los
trabajaremos como otra de las lecturas del curso.
Si logramos que se pierda el miedo al hecho literario,
conseguiremos que ms alumnos se acerquen a l. Y dejaremos
el estudio de la historia de la literatura, con todos sus datos
culturales, para cuando hayan logrado poseer una competencia
literaria adecuada a su edad.

- 80 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


IMPORTANCIA DE LA ORTOGRAFA EN LA ENSEANZA
DE LA LENGUA
Hasta hace no muchos aos la ortografa tuvo un papel
primordial en la enseanza de la lengua. Cuando los docentes
corregamos los textos de nuestros alumnos hacamos especial
hincapi en que todos los vocablos estuvieran escritos de forma
correcta. Debido a que hemos estado muy atentos a este aspecto hay
otros que se nos han escapado. As, a menudo, hemos conseguido que
el alumno complete un texto sin errores ortogrficos, pero nos hemos
topado con que lo escrito es totalmente incomprensible.
Hoy da no se busca solo la falta de errores ortogrficos. Es
ms grave que el alumno cometa tres o cuatro faltas de ortografa o
que carezca de coherencia su trabajo? Nuestro enfoque, sin
menospreciar el aspecto ortogrfico, ha de englobar, a su vez, otros
elementos. De este modo, apreciaremos e incidiremos en la
importancia de que sus textos posean adecuacin y fluidez.
Para mejorar la ortografa del alumnado, que es el asunto que
nos interesa en este artculo, no hay un mtodo infalible. Si
encontrramos alguno no existira el problema. Por este motivo, es
aconsejable trabajar con varios mtodos: Dictados, ejercicios con
palabras, lecturas, etc.

- 81 -

www.enfoqueseducativos.es

Por otro parte, una de las claves para trabajar la ortografa es


la lectura. Si logramos que se lea asiduamente, conseguiremos rebajar
el nmero de errores ortogrficos. Aunque no siempre sea as, en la
mayora de los casos vemos cmo los alumnos que ms leen cometen
menos faltas.
A pesar de que basemos nuestro mtodo en la lectura, no
debemos desdear el uso de normas ortogrficas. Cuando acudamos a
estas procuraremos que no sean una serie ilimitada que memorizar, e
intentaremos que las deduzca el propio alumno a travs
de la observacin. A cuantos ms casos puedan ser aplicables, y
cuantas menos excepciones tengan, sern ms tiles a los ojos del
aprendiz.
Un elemento que nunca hay que olvidar es el diccionario.
Buscando palabras en l conseguimos que el alumno las vea
correctamente escritas. Cuanto ms se usa el diccionario mejores
resultados se obtienen en cuanto a precisin ortogrfica.
Bien es cierto que cuando corregimos exmenes, ejercicios o
redacciones, nos es ms sencillo sealar los errores ortogrficos que
otros como los de coherencia. Los alumnos estn acostumbrados a
esto y por eso suelen prestar ms atencin a la escritura de los
vocablos que a las relaciones que se establecen entre ellos. Nosotros
como docentes, debemos cuidar de que sus textos se adecuen a la
ortografa, pero siempre sin olvidar los otros aspectos comentados
supra.

- 82 -

www.enfoqueseducativos.es

EL ESPAOL COMO LENGUA EXTRANJERA.

En las ltimas dcadas, el inters por aprender la lengua


espaola por parte de los hablantes de otras lenguas ha crecido de
manera notable. Esto favorece a los alumnos que han cursado los
estudios de Filologa espaola porque puede ser una de las posibles
salidas profesionales. De hecho, en algunas licenciaturas de Filologa
ya se programan asignaturas dedicadas al tema, existen posgrados y
algn doctorado sobre esta enseanza.

Ensear una lengua como extranjera debera significar abrir


puertas a otros mundos ms o menos lejanos: los de las personas que
hablan esa lengua como propia. Cualquier grupo humano es diverso y
heterogneo, como lo es cualquier lengua. En el caso que nos ocupa,
es evidente que los mundos que se piensan y que hablan en lengua
espaola son muchos y diversos, dado su mbito lingstico a uno y
otro lado del Atlntico.

Por otra parte, los intereses y las motivaciones de quienes


aprenden espaol son tambin variados. No es lo mismo pensar en
una clase de lengua espaola en Tokio, por ejemplo, en la que el
profesor es un hablante nativo (espaol) y los estudiantes son un
grupo homogneo de jvenes ejecutivos, con un alto nivel de
competencia

de

la

lengua

que

aprenden,

con

finalidades

empresariales, que pensar en una clase de lengua espaola en Jan a


la que asisten inmigrantes de procedencias diversas, con variadas
motivaciones.

El aula de lengua extranjera se presenta, pues, como un


contexto de comunicacin donde confluyen, al menos, dos realidades
- 83 -

www.enfoqueseducativos.es

socioculturales. Por una parte, la de quienes aprenden (que puede ser,


a su vez, internamente diversa); y, por otra, la que el profesor o
profesora de la lengua extranjera presenta a travs de la lengua objeto
de enseanza y aprendizaje.

Esta confluencia puede adquirir diversas formas y diferentes


dinmicas. La manera de abordar la enseanza del espaol como
lengua extranjera ha desarrollado metodologas muy interesantes, que
emergen de las fuentes de la psicolingstica, la sociolingstica y las
corrientes gramaticales de tipo funcional y comunicativo.

Mara del Carmen Lpez Bayona.

- 84 -

www.enfoqueseducativos.es

LAS FUNCIONES Y EL DESARROLLO DEL LENGUAJE Y


SUS DIFERENTES NIVELES
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V
Antes de analizar cualquier problema relacionado con el
lenguaje y buscar su recuperacin, es importante saber las
funciones y desarrollo del lenguaje en el nio.

Funciones del lenguaje

Funcin emotiva:

la comunicacin emotiva es la primera base

antes de hablar.

Funcin ldica:

Funcin apelativa:

el momento en el que descubre el dar


nombre a las cosas. (todava no hay funcin comunicativa).

Funcin verbal:

Funcin simblica: a travs de la interaccin con el entorno se


va fraguando el desarrollo del lenguaje.

Funcin estructural: a la vez se va metiendo en la estructura de

el juego sonoro con el que empieza a articular es


una funcin preparatoria, importante para predecir un futuro
trastorno del lenguaje.

la palabra-frase como seal de seales es ya una


accin que le permite la toma de contacto con la realidad.

su propia lengua, repitiendo primero, despus verbalizando su


pensamiento.

Funcin de socializacin:

Funcin de personalizacin:

Funcin

an no es un instrumento de dilogo
pero un elemento ms en el conocimiento.
el lenguaje oral le permite
alcanzar el desarrollo de su personalidad.

sobreimpuesta

aprendizaje:

adems de
aprendizaje, es una funcin sobreimpuesta. La persona lleva fundida
con su realidad humana la necesidad de hablar.

La comunicacin total: la completan junta al lenguaje, la kinsica


(los gestos, las posturas y las maneras de realizar un determinada
accin) y el paralenguaje (cualidades de la voz).

Desarrollo del lenguaje: hay un proceso evolutivo del


lenguaje que a pesar de dificultades ambientales o externas,
- 85 -

www.enfoqueseducativos.es

cumple sus etapas. Este proceso se divide en etapas


arbitrarias que sirven para saber cundo nos encontramos
ante un retraso; la comprensin que se inicia pronto y es
global, y la expresin.

Etapas evolutivas

Primera etapa: 9 a 18 meses: lenguaje simblico e


intencional que carece de la primera articulacin. El la etapa la
palabra-frase.

Segunda etapa: 18 a 24 meses: va creciendo el lxico y el


aprendizaje del sistema fonolgico. Aparecen las primeras frases de
dos palabras.T

Tercera etapa: 2 a 3 aos:

adquiere los signos morfolgicos.


El lxico crece mucho. La estructura lingstica alcanza un nivel
aceptable.

Cuarta etapa: 3 a 6-7 aos:

Quinta etapa: 6-7 a 12-13 aos:

se produce al interiorizacin
del habla, que le permite verbalizar sus pensamientos y a una
progresiva integracin social.

aprende el lenguaje
escrito y va integrando nociones de categoras abstractas.

Niveles bsicos del lenguaje:

Nivel lxico:

Nivel

es el ms orientador. Una mala


estructuracin seala dficit mental, o profundos problemas a nivel
receptivo o expresivo.

Nivel articulatorio:

indica el punto de partida del lenguaje de un nio.


Un nivel escaso seala dificultades a nivel de simbolizacin,
memorizacin o relacin con el ambiente.

estructural:

es el menos significativo. Cuando no hay


causas aferentes, centrales o eferentes, los trastornos a este nivel
son slo reflejo de una deshabilidad gentica o familiar.

- 86 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


LOS TALLERES LITERARIOS
Los talleres literarios son una prctica que podemos
desarrollar en el aula para ayudar a mejorar la expresin escrita del
alumnado. Hay que sealar que no siempre es necesario que el taller
sea literario. Se puede tambin aplicar a la composicin de escritos no
literarios. En el presente artculo solo interesa comentar la prctica de
los literarios.
Lo esencial del taller es encontrar un espacio en nuestro
horario lectivo con el grupo. En la sesin o sesiones que dediquemos
a ste fomentaremos la expresin escrita con fines literarios. Es
sabido que si perfeccionamos la expresin literaria, contribuiremos, a
su vez, al dominio de la competencia comunicativa.
El primer punto a tener en cuenta es qu tipo de texto escribir.
A los alumnos se les hace ms sencillo producir discursos narrativos.
Una vez decidido ste, hay que seleccionar el motivo o asunto central.
Se puede imponer un tema prefijado para todo el grupo o podemos
dar libertad, pero siempre aconsejando antes de la eleccin.
La funcin que desempea el docente en esta actividad es
fundamental. Nuestro papel es del asesoramiento individualizado.
Aunque el grupo sea muy numeroso podemos dedicar tiempo a todos.
Lo ideal es realizar supervisiones cortas de los textos. Para eso

- 87 -

www.enfoqueseducativos.es

visitaremos el pupitre del alumnado, y comentaremos con l qu est


haciendo, qu intencin persigue Leeremos lo que ha producido
hasta ese momento e indicaremos unas correcciones, por ejemplo que
revise la introduccin, que aprecie el nmero de veces que aparece
una misma palabra, etc.
Las tcnicas que existen actualmente para redactar son
variadas. En el taller podemos usar algunas de ellas. Si utilizamos
siempre la misma corremos el riesgo de que la composicin de textos
se vea como algo montono. Lo ms habitual es que cada una
produzca su discurso de forma individual. Otras veces podemos
trabajar tcnicas: El 1+1=1, que consiste en imaginar un objeto nuevo
a partir de dos conocidos; reelaborar un cuento tradicional y adaptarlo
a nuestro tiempo; escribir una historia entre dos, esto es, un alumno
comienza redactando un prrafo, y a continuacin su compaero
contina la historia componiendo otro prrafo. Los dos se alternarn
el discurso durante el ejercicio.
No debemos improvisar en estas clases. En la medida
de nuestras posibilidades atenderemos el mismo tiempo a cada
alumno. Importante es tambin que esta prctica la desarrollemos
siempre en el aula. Si lo convertimos en actividad de casa no
lograremos nuestros objetivos. Es fundamental que el docente
supervise y tenga reuniones con los futuros escritores, con el fin de
que asimile los procedimientos de creacin literarios.

- 88 -

www.enfoqueseducativos.es

EL TRABAJO DE LA FUERZA
EN LA
EDAD ESCOLAR
Manuel Moyano Lpez

1.

Ldo. Ciencias de la Actividad Fsica y el Deporte.

CONCEPTO DE FUERZA.
Desde la perspectiva de la actividad fsica y el deporte, la fuerza representa la capacidad que

tiene un sujeto para vencer o soportar una resistencia. Esta capacidad del ser humano viene dada como
resultado de la contraccin muscular. Para Tous (1999), el msculo es el motor del sistema locomotor
humano que tiene la capacidad de generar una tensin sobre las palancas seas; es decir, dispone de una
capacidad de fuerza.

En el siguiente cuadro expondremos algunas definiciones de diferentes autores:


AUTOR/FECHA
Knuttgen y Kraeemer (1987)
Porta, (1988)
Hahn (1988)

Harre (1994)

DEFINICIN
Capacidad de tensin que puede generar cada
grupo muscular a una velocidad especfica de
ejecucin.
Capacidad de generar tensin intramuscular.
Capacidad del ser humano de superar o actuar en
contra de una resistencia exterior basndose en
procesos nerviosos y metablicos de la
musculatura.
Capacidad de un sujeto para vencer y soportar una
resistencia

La fuerza hemos de entenderla como una capacidad fsica bsica (CFB) ms, integrante
fundamental de la condicin fsica (CF) de todo sujeto. Por otro lado,
representa un contenido propio del rea de conocimientos de la Educacin
Fsica, dentro del bloque de contenidos de Condicin Fsica y Salud, segn
establece el Real Decreto 1631/2006, de 29 de diciembre, por el que se
establecen las enseanzas mnimas para la Educacin Secundaria Obligatoria.

- 90 -

www.enfoqueseducativos.es

2.

CONTROVERSIAS EN RELACIN AL TRABAJO DE FUERZA EN LA EDAD


ESCOLAR.
El entrenamiento de fuerza en la edad escolar ha sido y sigue siendo motivo de controversia

entre los especialistas de la actividad fsica y el deporte, fisilogos, mdicos e investigadores.

Varios han sido los organismos relacionados con la salud y la actividad fsica en edades
tempranas, los que han dado su opinin sobre el tema, en ocasiones de manera confrontada. Como
muestra lo que aconseja la Academia de pediatra (1983) que nos viene a decir que el entrenamiento de
fuerza en edad prepuberal carece de efecto y que los mayores beneficios se logran en la etapa prepuberal.
A menudo se escuchan comentarios sobre este tema que sitan en un lugar complicado al trabajo
de fuerza, como son:
- El entrenamiento de fuerza disminuye la flexibilidad articular.
- El entrenamiento de fuerza interfiere el crecimiento infantil.
- El entrenamiento con cargas es causa de la mayora de las lesiones.
- El entrenamiento de fuerza afecta negativamente al corazn del nio/a.

Por el contrario, la National Strengh and Conditioning Association (1985) mantiene opiniones
totalmente encontradas a las anteriormente mencionadas. Ya que afirma que si se pueden obtener
ganancias en edad prepuberal, siempre que se realice un entrenamiento adecuado, eliminando los posibles
riesgos de lesin; adems el entrenamiento de fuerza produce beneficios psicolgicos, como mejora de la
propia imagen y aumento de la propia autoestima.

- 91 -

www.enfoqueseducativos.es

A pesar de esta controversia, nosotros aconsejamos el trabajo de esta cualidad fsica bsica en
base a estas edades en base a tres grandes intereses:
- Aumento de la eficacia motora: es evidente la estrecha relacin que existe entre un nivel
ptimo de fuerza y un momento de eficacia motora del sujeto.
- Adopcin de posturas correctas: dado que los msculos juegan el papel de tirantes de las
palancas seas, es incuestionable el papel que una musculacin armnica y equilibrada juega en el ajuste
postural, tan importante en la edad de crecimiento.
- Reduccin del riesgo de lesiones: unos correctos niveles de fuerza reducen en buena medida el
riesgo de lesiones musculares, tendinosas e incluso articulares.

Para que todo lo dicho anteriormente se consiga es bsico que el trabajo de fuerza se efecte de
forma compensada y que no existan diferencias anormales de fuerza entre los diferentes grupos
musculares del cuerpo humano. En cualquier caso, no podemos obviar que el desarrollo de fuerza implica
una serie de riesgos que es importante conocer, controlar y evitar. Entre las precauciones y medidas a
tomar destacan: la higiene postural, especialmente de la columna vertebral, los ejercicios de

- 92 -

www.enfoqueseducativos.es

compensacin, el dominio de la tcnica del ejercicio, la eleccin correcta de la sobrecarga, el


calentamiento correcto,

3.

TIPOS DE FUERZA Y MEDIOS A UTILIZAR PARA SU DESARROLLO.


Lo primero que tenemos que tener en cuenta en el trabajo de la fuerza con nios y nias, es que

no podemos desarrollar todas las manifestaciones de la fuerza, ya que no todas tienen relacin directa con
la consecucin de una Condicin Fsica que gire en torno a la salud. Una vez dicho esto centraremos
nuestro trabajo en el desarrollo de la Fuerza-Velocidad y la Fuerza-Resistencia, siempre teniendo en e
cuenta que debemos de empezar por un trabajo de Fuerza General.
El trabajo de la Fuerza General ir dirigido a lograr que el aparato locomotor se desarrolle y se
mantenga en las mejores condiciones, manteniendo un equilibrio postural adecuado, y lograr el tono
muscular ptimo y las fibras musculares adaptadas a soportar eficazmente la fatiga muscular generada por
esfuerzos de la vida cotidiana y del deporte que se practica.

Para trabajar la fuerza en jvenes Prraga (2002) establece una serie de criterios que hemos de
tener en cuenta:
-

Evitar el riesgo de lesiones. El material de entrenamiento ser adecuado al nio y


nia.

El entrenamiento favorecer la formacin integral y armnica del alumnado, se


realizar de una forma variada, atractiva, evolucionar progresiva y gradualmente y
cumplir

el

principio

de

continuidad.
-

Los ejercicios sern ejecutados a lo


largo de toda la amplitud del
movimiento,

dando

especial

importancia a las contracciones


dinmicas concntricas.
-

Se debe aprender la tcnica correcta de cada ejercicio antes de incrementar la carga.

- 93 -

www.enfoqueseducativos.es

Asegurar una recuperacin adecuada a los esfuerzos realizados.

Los medios que podemos utilizar para desarrollar la fuerza con los alumnos y alumnas son
muchos, precisamente es esta variedad la que nos permitir trabajar la fuerza de mltiples formas y
enfoques. Estos medios pueden ser los siguientes:
-

Objetos y aparatos simples: cuerdas, mstiles, bancos suecos, espalderas, balones


medicinales, lastres, escalera horizontal y vertical.

Autocargas: es el medio ms importante por la relacin F

desarrollo

corporal, es decir, la fuerza del sujeto est directamente relacionada con su peso, de
cara a prevenir y evitar lesiones. Por lo que se erigen como los ms adecuados en el
mbito escolar. Dentro de este tipo de ejercicios, destacamos los multisaltos, as
como los desplazamientos no habituales (cuadrupedias, reptaciones, trepas, etc.)
-

Ejercicios por parejas: el compaero puede actuar como oposicin, lucha,


traccin,Es importante que los integrantes de la pareja sean aproximadamente del
mismo peso, estatura y nivel de fuerza.

Juegos de fuerza colectivos: aquellos en los que intervienen ms de dos personas,


como el sogatira, pirmides humanas, transportes,

Circuit-training: se trata de un entrenamiento que recorre una serie de etapas o


estaciones dispuestas de forma circular. Hay de dos tipos: por tiempo o por
repeticiones. Es muy buen mtodo ya que permite trabajar al alumnado de forma
individualizada, con ejercicios sencillos que garantizan la participacin de todos.

Habilidades y destrezas deportivas que requieren fuerza: Gimnasia Deportiva


(equilibrio invertido, volteos, rondada, paloma de manos, acrosport,), Judo,
Atletismo (lanzamientos, saltos,), Actividades en la Naturaleza (escalada,
senderismo, MTB,), Rugby, Lucha (canaria o leonesa), etc.

4.

REFERENCIAS BIBLIOGRFICAS.

Berd-Michael Schneider: Education Physique et Sport, n 210. (1988).

- 94 -

www.enfoqueseducativos.es

Bravo J., Durn J., Campos J. y Martnez J.: Atletismo (III) Lanzamientos. Comit Olmpico
Espaol (1993).

Durn Piqueras, J. P.: Manual Bsico de Atletismo (Tomo II Lanzamientos). Real Federacin
Espaola de Atletismo. Madrid (2000).

Garca Manso, J.M.: La fuerza. Gymnos. Madrid. (1999).

Garca Manso, J.M., Navarro Valdivieso, M. y Ruiz Caballero, J.A.: Bases tericas del
entrenamiento deportivo. Principios y aplicaciones. Gymnos. Madrid. (1996).

Lenz, G. y Losch, M.: Methodical development of young javelin throwers. Modern athlete and
coach. (2002).

Prraga, J.: Curso sobre preparacin fsica en el deporte base. IAD. Mlaga. (2002).

Rius Sant, Joan: Metodologa y tcnicas de atletismo. Paidotribo. Barcelona (2005).

Torres, J: Manual del preparador de voleibol Nivel I: programa de preparacin fsica. Federacin
Andaluza de Voleibol. (2002).

- 95 -

www.enfoqueseducativos.es

Jos Marcos Resola Moral. Profesor de Educacin Secundaria, Psicologa-Pedagoga.


Carmen Orihuela Vega. Profesora de Educacin Secundaria, Informtica.

LOS BLOGS EN LA ACCIN TUTORIAL


Los blogs son una herramienta que nos permiten, sin tener grandes
conocimientos informticos, la oportunidad de estar presentes en internet para poder
contar/comunicar lo que deseemos. Es una ventana al mundo verstil, inmediata y fcil
de utilizar.
Existen gran variedad de herramientas que nos permiten la creacin y
mantenimiento de un blog, muchas de ellas gratuitas.
Estas herramientas de mantenimiento de weblogs se clasifican en dos tipos:

Aquellas que consisten en un programa informtico que se instala en un servidor


y permite la gestin del blog. Al ser un programa, este tipo de herramientas nos
van a permitir muchas opciones de configuracin del blog. Su manejo ser ms
complejo.

Aquellas que, a travs de internet, nos permiten de manera gratuita la creacin y


mantenimiento de nuestro blog. Los blogs que creemos con esta opcin nos
permitirn muchas menos opciones de configuracin. Los blogs se crean a partir
de plantillas. Por otro lado su uso es mucho ms sencillo que si utilizamos un
programa especfico.

Independientemente que nos decidamos por una opcin o la otra todos los blogs
tienen unos elementos comunes:
Post: se denomina de esta manera a cada entrada o artculo que se escriba en el blog.
Enlaces: es comn en los post encontrar enlaces a otras pginas web en las que
poder encontrar informacin complementaria al tema del que trata el artculo.

- 97 -

www.enfoqueseducativos.es

Fotografas, vdeos, podcast: adems de texto, en los artculos se pueden utilizar


fotografas, vdeos y grabaciones de audio con las que completar el artculo.
Comentarios: se permite a cualquier usuario que visite el blog aadir un comentario
sobre un artculo.
Categoras: dentro de la estructura del blog suele haber un apartado en los que
encontramos los blogs organizados por diferentes campos: temporalmente, por
categoras, etc. Adems suelen tener un apartado de enlaces a otros blogs que el autor
considera interesantes.
USOS DIDCTICOS DE LOS BLOGS.
La aplicacin de los blogs en el aula responde a diversas modalidades,
dependiendo de los objetivos y las necesidades del contexto escolar. De La Torre (2006)
realiza una sencilla clasificacin mostrando tres modalidades de edublogs:

Blogs de asignaturas en las que el profesor va publicando noticias y pide


comentarios a sus alumnos.

Blogs individuales de alumnos en los que se les pide entradas peridicas.

Blogs grupales, donde los alumnos publican entradas de forma colectiva a modo de
equipo de redaccin.
Desde Educastur (2007) nos sugieren distintas situaciones de enseanza-aprendizaje

en las que podemos utilizar blog:

Blog de aula, asignatura o tema. Pgina personal del profesorado, un complemento a


las clases presenciales, con propuestas de actividades complementarias.

Blog personal del alumnado: a modo de diario individual.

Taller creativo multimedia: individual o colectivo, sobre argumentos sugeridos o


libres.

Gestin de proyectos de grupo, donde el profesor o profesores de distintas materias


o centros asesoran al grupo en la realizacin de trabajos de investigacin.

Publicacin electrnica multimedia.

Gua de navegacin, donde se comentan sitios de inters, noticias y aportaciones en


forma de crtica o comentario de los mismos.
- 98 -

www.enfoqueseducativos.es

ACCIN TUTORIAL Y BLOGS

La accin tutorial es un proceso de ayuda y de orientacin que lleva a cabo el


profesor tutor para contribuir al desarrollo integral del alumno (Arnaiz, 1992). La tutora
se define como la atencin continua y permanente que el profesor tutor, en coordinacin
con el resto de profesores, tiene la intencin de conocer a fondo y ayudar a orientar
personal, escolar y acadmicamente a cada alumno/a en funcin de sus caractersticas,
intereses y necesidades personales.
La accin tutorial se lleva a cabo en cada centro mediante un plan de orientacin
y accin tutorial, documento incluido en el proyecto curricular de centro que constituye
el marco de referencia para todos los componentes de la comunidad escolar y en una
programacin anual de actividades de orientacin y accin tutorial que se realizan
teniendo presente las necesidades de orientacin y accin tutorial que tiene cada grupo
clase. Esta programacin se materializa en un conjunto de actividades, grupales e
individuales, para alumnos, equipos educativos y familias que se ponen en prctica en
horario lectivo por parte de los tutores.
En la accin tutorial ha predominado el uso de materiales de papel y lpiz, con
leves acercamientos a los materiales multimedia. En la actualidad las tecnologas de la
informacin y comunicacin constituyen un recurso didctico que nos ayuda y facilita la
labor tutorial. Existen diferentes recursos digitales tales como las pginas webs, las
webquest, los cazatesoros, las wiki, los blogs y las folsonomas.
Qu usos pueden tener los blogs en la accin tutorial? Partiendo de la propuesta de
Estrella Rdenas (2007), hemos reflexionado sobre su uso en la accin tutorial y
hayamos que podemos utilizarlos para:

Portafolio de accin tutorial. Cada tutor puede elaborar un listado de actividades a


realizar en la hora semanal de accin tutorial, tanto en formato digital como en
papel. La posibilidad de incluir vdeos e imgenes enriquece las tareas tutoriales.
Como las necesidades de accin tutorial para cada grupo son distintas, este recurso
digital nos permite individualizar la accin tutorial.
- 99 -

www.enfoqueseducativos.es

Lugar de reflexin y debate colectivo sobre la marcha del proceso de aprendizaje en


las distintas reas, sobre la convivencia y participacin de los alumnos en clase y en
el centro escolar. El desarrollo de la accin tutorial exige momentos de reflexin y
bsqueda de soluciones consensuadas entre los alumnos y su equipo educativo,

mediando el tutor. Un lugar para anotar los acuerdos alcanzados y realizar un


seguimiento de ellos pueden ser los blogs. A travs de este espacio en la web, las
familias pueden aproximarse al conocimiento real del proceso de enseanza
aprendizaje del grupo donde se encuentra escolarizado su hijo e implicarse en la
educacin de su hijo o hija.

Panel informativo de la accin tutorial de un grupo: tanto para actividades


informativas o formativas, el profesorado puede establecer noticias y enlaces con
recursos de la web que contribuyan al desarrollo de la accin tutorial. Informar
sobre temas de inters para los estudiantes que contribuyen a su orientacin
personal, profesional o acadmica.

El blog como un diario de la Accin Tutorial. Informar de lo que se va haciendo en


la tutora semanal. Cada grupo clase puede ir realizando un diario de clase que
recoja las actividades realizadas semanalmente en la hora de tutora acompaada de
comentarios, sugerencias y funcionalidad de lo tratado para la vida cotidiana. El
delegado Tic del aula ser el encargado de realizar los comentarios al blog.

BIBLIOGRAFA
Arniz, P. (1995): La tutora, organizacin y tareas. Barcelona: Gra.
De La Torre, A. (2006): Web educativa 2.0. Edutec, Revista electrnica de tecnologa
educativa n 20.
Educastur (2007): Blogs y Educacin. http://blog.educastur.es/blogs-y-educacion/
Rodenas,

E.

(2007):

La

accin

tutorial

travs

del

blog.

http://estrellarodenas.nireblog.com/post/2007/01/03/la-accion-tutorial-a-traves-del-blog3.

- 100 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


PREPARACIN DE UNA WEBQUEST
De entre las posibilidades pedaggicas que nos ofrece Internet, una de las que
ms eco ha tenido en la comunidad educativa, ha sido la Webquest. Son muchos los
docentes que han puesto en marcha sus propios proyectos, mientras que otros han
aprovechado recursos ya publicados.
La Webquest sirve para que el alumnado, tras explorar la Web, sea capaz de
presentar una exposicin de lo aprendido en el medio. Es una tarea que se enmarca
plenamente en el mbito de las nuevas tecnologas. No debemos pensar que solo
podemos trabajarla en la materia de Informtica. Si diseamos bien nuestra Webquest es
aplicable a cualquier rea.
Antes de desarrollar la actividad en el aula, los docentes tenemos que preparar
concienzudamente la futura bsqueda. Primero elegiremos el tema que vamos a
proponer para investigar sobre l, y una vez que tengamos este, seleccionaremos los
sitios de Internet que consideremos ms apropiados para completar con xito la
Webquest.
Para escoger una u otra Web podemos recurrir a los buscadores. A travs de
ellos realizaremos una lista con los lugares que mejor se adecuen a nuestro propsito.
Esta lista es importante porque ser el principal referente del alumnado para recoger
informacin durante su navegacin por la Red.

- 101 -

www.enfoqueseducativos.es

Las pginas podemos grabarlos en un disco y entregarlas a nuestros alumnos.


Con ello evitamos perjudicar a aquellos que no posean conexin a Internet en casa. Con
un ordenador y el disco se puede trabajar tambin fuera del aula.
Al aula la dividiremos por grupos, con la intencin de que cada uno de ellos
busque, seleccione y elabore sus conclusiones. stas sern presentadas al final del

ejercicio. No obstante, esta tarea final no ha de ser la nica que preparen. Durante las
visitas a las pginas habrn de contestar a preguntas de ejercicios, realizar esquemas,
etc. Todo esto elaborado por el profesor y con el propsito de facilitar la tarea final.
Es cierto que el desarrollo de una Webquest requiere tiempo. No es sencillo
concluirla con prisas. Es necesario dar tiempo al alumno para que navegue por los
lugares que le hemos proporcionado, para que lea y reflexione sobre la informacin que
recibe, para que escoja aquello que considera principal, y para que elabore sus
conclusiones. Es lgico que esto nos ocupe al menos una semana de clase.
Podemos recortar el impacto horario que puede tener en nuestra materia. Para
ello daremos al alumnado un disco con las pginas grabadas. Con este disco podr
trabajar la actividad en casa. Si ninguno de los miembros del grupo posee ordenador, se
orientar al alumno hacia aquellas entidades que facilitan el acceso gratuito a Internet.
As pues, nuestra Webquest necesitar de sesiones en el aula y de trabajo fuera
de ella. En la primera clase comenzaremos la investigacin, donde el docente guiar los
pasos del alumnado. Tras esta, ya estn preparados para proseguir en casa. Aqu
avanzan hacia la meta. Cuando regresemos al aula, pondremos en comn nuestras
experiencias y dificultades. El profesor dar las ltimas indicaciones, y as el alumno
concluir en casa.

- 102 -

www.enfoqueseducativos.es

Si todo ha ido bien, veremos a cada grupo exponer, bien por escrito bien a travs
de Internet, el resultado de su trabajo. Habrn aprendido contenidos propios de nuestra
materia, habrn mejorado destrezas como la sntesis o la comprensin escrita, y,
adems, conseguirn progresar en el uso de Internet.

- 103 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


LOS BLOGS EN LA ACCIN TUTORIAL DE SECUNDARIA
Es este un tema de total actualidad en nuestro sistema educativo. No debemos
conformarnos, en nuestra labor docente, con repetir patrones de actuacin. A nuevos
tiempos se imponen nuevos sistemas de accin.
La accin tutorial es una de las funciones fundamentales del docente. En esta
actividad es primordial tener una buena comunicacin con todos los agentes implicados
en el proceso educativo. Por un lado, la relacin con nuestros alumnos se produce
dentro del aula, o en el Centro educativo. Por otro lado, no hay que obviar el contacto
con los padres.
La comunicacin con padres y alumnos se puede desempear de muy diferentes
formas. En este artculo slo me centrar en un nuevo medio que est de plena
actualidad. Este medio son los blogs. Para los no iniciados, diremos que son como
diarios abiertos al mundo. Estos diarios estn instalados en Internet. Cualquiera que
acceda a la red puede utilizarlos.
Se hace muy atractivo este medio porque a travs de l podemos tener un
contacto directo e inmediato con padres y alumnos. Nosotros, como tutores, crearemos
un blog, y aqu iremos instalando noticias y hechos referidos a nuestra tutora que
puedan ser relevantes para nuestro curso.
Centrndonos en el asunto que nos preocupa, detallar algunas propuestas que
pueden sernos tiles a la hora de desarrollar nuestra labor tutorial. A los alumnos, que
son los primeros implicados en el proceso educativo, facilitaremos la direccin en que
se haya nuestro blog. Aqu colgaremos algunos datos que son importantes para ellos,
como por ejemplo: Las normas del Centro, el horario del grupo, las materias en las que

- 104 -

www.enfoqueseducativos.es

se encuentran matriculados, etc. El alumnado podr acceder libremente a estos datos,


pero adems, podr comunicarse con nosotros como tutor. Si encuentra algn problema
en su adaptacin puede enviarnos su problema. As, el trato con el tutor se hace ms
rpido e ntimo. Tambin los alumnos pueden compartir sus experiencias en este medio.
Donde ms atractivo se muestra el uso del blog, es en la comunicacin con los
padres y de nuestros alumnos. Ya sabemos que muchos de nosotros tenemos poco
tiempo para ocuparnos de asuntos ajenos a nuestro trabajo. Muchos padres trabajan
maana y tarde, y por eso se les hace imposible visitar al tutor en el Centro. El tutor
puede colgar en el blog datos muy interesantes. Incluso los padres podrn hablar con l
enviando un mensaje, a pesar de que lleguen tarde a casa. En el blog podemos mostrar
el horario de sus hijos, las faltas de asistencia o retrasos, las notas de exmenes,
alumnos expedientados por motivos de conducta, etc.
Es importante que los padres estn al tanto del uso del blog, y por supuesto se
hace necesario que posean conexin a Internet en casa. Solucionaremos con este mtodo
uno de los principales problemas que tenemos actualmente en nuestra accin tutorial.
Esto es, la comunicacin con los padres y madres de nuestro alumnado. El contacto
personal siempre ser necesario, pero no hay que desdear el uso de las nuevas
tecnologas y poder adaptarlas a la nueva realidad que nos toca. Sabemos que muchos
padres son receptivos a nuestros consejos, pero por motivos laborales no tienen acceso a
nosotros hasta que llegan las temidas notas. Especialmente para esos padres est
pensado el uso del blog en la tutora.

- 105 -

www.enfoqueseducativos.es

LAS COMPETENCIAS BSICAS EN LA EDUCACIN


INFANTIL.
Conchy Ungo Tavira.
D.N.I:26493210-Q

El desarrollo del concepto de competencia viene directamente ligado a una


serie de reflexiones en torno al currculo, de plena actualidad en Espaa y el resto de los
pases europeos.

La Ley Orgnica 2/2006, de 3 de mayo, de Educacin define en su


artculo 6 que el currculo es el conjunto de objetivos, competencias bsicas,
contenidos, mtodos pedaggicos y criterios de evaluacin de cada una de las
enseanzas. El proceso de desarrollo de la Ley conllevar la definicin de estas
competencias bsicas por parte de las administraciones educativas.

La reflexin sobre lo que los nios deben haber adquirido al finalizar la educacin
obligatoria, para enfrentarse con xito a los retos y demandas de la sociedad actual, ha
de poder dar respuesta a mltiples interrogantes y exigencias entre los que podemos
destacar:

Necesidad de preparar a los jvenes a vivir en un mundo en continuos


cambios sociales, culturales y econmicos, con exigencia de nuevos
aprendizajes, modelos de globalizacin, sociedad de la informacin y del
conocimiento

La crisis permanente de los contenidos formativos, que pronto quedan obsoletos


ante el rpido avance del progreso cientfico-tcnico y las nuevas
circunstancias econmico-sociales que conlleva.

Es necesario, frente al cmulo de conocimientos, ser capaz de identificar cules


son los realmente relevantes para los ciudadanos en esta sociedad del cambio.
- 108 -

www.enfoqueseducativos.es

Superar la lgica acumulativa de los currculos ante la aparicin de nuevos


contenidos, para dirigir el proceso hacia la formacin de personas con
capacidad de aprender a aprender.

El trmino competencia en educacin ha sido definido de muy diversas formas y


por muy diversos autores. Pero a modo de resumen podemos definirlo como el
desarrollo armnico del intelecto, de la inteligencia emocional y de la posesin
de las habilidades y destrezas necesarias para aplicar y desarrollar los

conocimientos adquiridos en cualquier contexto o situacin, todo ello, sustentado


en valores ticos, morales y culturales, comnmente aceptados en el contexto social
en el que nos desenvolvemos

Por tanto la competencia hace referencia a la capacidad de poner en funcionamiento,


de forma globalizada, los conocimientos, las destrezas y las actitudes adquiridas en
distintos contextos:

Constituye un saber hacer. Incluye un saber pero que se aplica.

Supone un saber hacer susceptible de adecuarse a la diversidad de contextos.

Posee un carcter integrador, de modo que cada competencia abarca

conocimientos, procedimientos y actitudes.

Se construyen con la interrelacin de saberes de los diferentes mbitos

educativos.

El trmino competencia se ha abierto camino con una facilidad


pasmosa entre programaciones, currculos, evaluaciones..

A parir de ahora debemos incidir ms en evaluar no slo conocimientos y destrezas


sino en formar en competencias, as recurriendo a un diccionario de psicologa
encontramos una clarsima distincin entre competencia y habilidad:
- 109 -

www.enfoqueseducativos.es

La habilidad es la capacidad de ser realmente eficiente en una tarea, mientras que


la competencia es la potencialidad de serlo dadas ciertas condiciones.

Ser competente es ser hbil en la realizacin de tareas, de actividades, pero no


tal y cmo han sido enseadas, sino ms all de ello, ser capaz de afrontar, a partir de
las habilidades adquiridas, nuevas tareas o retos que supongan ir ms all de lo
aprendido. Evaluar si alguien es competente es comprobar su capacidad para
reorganizar lo aprendido, para transferirlo a nuevas situaciones o contextos.

Pero debemos tener tambin muy clara la diferencia que existe entre una

competencia y una competencia bsica:

Una competencia es la forma en que una persona utiliza todos sus


recursos

personales

(habilidades,

actitudes,

conocimientos

experiencias) para resolver de forma adecuada una tarea en un contexto


definido.

Una competencia bsica es la firma en la que cualquier persona


utiliza sus recursos personales (habilidades, actitudes, conocimientos y
experiencias) para actuar de manera activa y responsable en la
construccin de su proyecto de vida tanto personal como social. El
conjunto

de

competencias

bsicas

constituyen

los

aprendizajes

imprescindibles para llevar una vida plena.


Las competencias para las que vamos a formar en la escuela no estn
previamente en los alumnos, son construcciones sociales que deben ser interiorizadas a
travs de la educacin.

Una competencia ser un conjunto de recursos potenciales: saber


qu, cmo, cundo y por qu, que posee una persona para enfrentarse a
- 110 -

www.enfoqueseducativos.es

problemas propios del medio natural, fsico y social en el que se


desenvuelve.
Las competencias tienen tres finalidades:

Integrar los diferentes aprendizajes, tanto los formales, incorporados a las


diferentes reas o materias, como los no formales.

Permitir a todos los estudiantes integrar sus aprendizajes, ponerlos en relacin


con distintos tipos de contenidos y utilizarlos de manera efectiva cuando les
resulten necesarios en diferentes situaciones y contextos.

Orientar la enseanza, al permitir identificar los contenidos y los criterios de


evaluacin que tiene carcter imprescindible.

Para lograr cada una de las competencias hay que trabajar de forma globalizada,
tal y como establece el Decreto 107/92, de 9 de junio por el que se establecen las
enseanzas bsicas de Educacin Infantil.

Pero ahora llegamos a una nueva cuestin, y es saber qu competencias debemos


ensear y evaluar, cundo y cmo hacerlo.

En cuanto a las competencias que deben ensearse, teniendo en cuenta el


monogrfico sobre competencias

de cuadernos de pedagoga N 370,

son las

siguientes;

Relacionadas con el escenario educativo, competencias para


gestionar el conocimiento y el aprendizaje, ser un aprendiz
permanente.

Debemos ensear a los nios y las nias a saber cundo, dnde y cmo
buscar informacin, ser capaces de seleccionarla en funcin de unos objetivos,
procesarla y elaborarla adecuadamente para despus utilizarla. A travs del
trabajo por proyectos en Educacin Infantil, buscamos informacin en diferentes
fuentes, lo ms variadas posibles, las familias, las otras seos, internet, libros en
- 111 -

www.enfoqueseducativos.es

las bibliotecasesta informacin hay que tratarla, elaborarla, organizarla


para ir construyendo nuestros aprendizajes.

Respecto al escenario profesional y laboral, competencias para


ser un profesional eficaz.

Esta competencia parece que queda fuera de nuestras capacidades cmo


podemos formar un buen profesional si nuestro material son nios y nias de 3 a
5 aos?. Pues no podemos saber el camino profesional que tomarn cuando sean
mayores, pero un buen profesional no solamente implica una formacin
especfica, sino una serie de habilidades sociales, para trabajar en equipo, debe
colaborar, confiar en los dems, deber insertarse en el contexto social en el que
trabaje y desde este punto de vista lo abordaremos en la escuela de infantil,
haciendo trabajos en grupo, colaborando unos con otros, trabajando diferentes
habilidades sociales, normas, valores..

Respecto al escenario comunitario, competencias para la


convivencia y las relaciones interpersonales para ser un
ciudadano participativo y solidario.

En esta sociedad en la que vivimos es necesario y fundamental educar a


ciudadanos capaces de convivir con la diversidad social, extraer de ella riquezas
y valores, cuya base fundamental ser la negociacin y el dilogo. Trabajaremos
desde la educacin infantil las relaciones interpersonales, las habilidades
sociales para formar personas ntegras y capaces de integrarse en el medio que
les rodea de una forma ajustada y facilitada.

Respecto

al

escenario

personal,

competencias

autoestima y el ajuste personal; ser una persona feliz.

- 112 -

www.enfoqueseducativos.es

para

la

Uno de los objetivos principales de la educacin infantil es el desarrollo de


la personalidad, la cual tiene su base en tres pilares bsicos: el desarrollo de la
identidad, la autonoma y la autoestima. Todo ello es trabajado desde las
escuelas de educacin infantil, y desarrollaremos igualmente la capacidad de
expresar sentimientos y emociones al igual que ponerse en el lugar del otro a
travs de numerosas actividades de inteligencia emocional.

Partiendo de estas competencias clave, se han desarrollado las competencias


bsicas:

Segn el citado informe DeSeCo son tres los criterios para seleccionar una
competencia como bsica o esencial:

Que contribuya a obtener resultados de alto valor personal y social.


Que sean aplicables a un amplio abanico de contextos y mbitos
relevantes.
Que sean importantes para todas las personas para superar con
xito las exigencias complejas.
Esto quiere decir que las competencias bsicas tienen que ser beneficiosas para la
totalidad de la poblacin independientemente del gnero, condicin social, cultural y
entorno familiar, igualmente deben respetar los valores de la sociedad en que se
inscriben y contribuir a la formacin de ciudadanas y ciudadanos democrticos, justos y
solidarios.

En definitiva, entendemos por competencias bsicas aquellas que van a permitir a


la persona, en esta sociedad del conocimiento, lograr una realizacin de su ser
individual, social (ciudadana activa) y su inclusin en el mundo laboral.

Las competencias bsicas seleccionadas por la UE y el MEC son ocho:


- 113 -

www.enfoqueseducativos.es

Competencia en comunicacin lingstica.


Competencia matemtica.
Competencia en el conocimiento y la interaccin con el mundo
fsico.
Tratamiento de la informacin y competencia digital.
Competencia social y ciudadana.
Competencia cultural y artstica.
Competencia para aprender a aprender.
Competencia de autonoma e iniciativa personal.

Los criterios que han permitido seleccionar estas competencias son


tres:
Estn al alcance de todos y todas.
Son comunes a muchos mbitos de la vida.
Son tiles para seguir aprendiendo.

- 114 -

www.enfoqueseducativos.es

LOS PROYECTOS DE TRABAJO EN EDUCACIN


INFANTIL.
Conchy Ungo Tavira.
D.N.I:26493210-Q

El desarrollo infantil es un proceso dinmico, sumamente complejo, que se


sustenta en la evolucin biolgica, psicolgica y social. Como bien establecen
autores y teoras significativas del aprendizaje; Piaget y su teora gentica, Vygotsky
y su teora social, Feuerestein y Bronfenbrenner y sus teoras contextuales

Los primeros aos de vida constituyen una etapa de la existencia


especialmente crtica, ya que en ella los nios y las nias se desarrollan en todos
los planos; perceptivo, motriz, cognitivo, lingstico y social, que posibilitarn una
equilibrada interaccin con el mundo que les rodea.

En este proceso dinmico y

rpido debemos crear las interconexiones

neuronales base de futuros aprendizajes.

El currculo de Educacin Infantil establece que la perspectiva globalizadora es


la estrategia metodolgica ms idnea para el tratamiento de los diferentes
contenidos y experiencias educativas. Los proyectos de trabajo son una modalidad
de globalizacin, que parte fundamentalmente de las necesidades, intereses y
motivaciones de los alumnos y alumnas.

Los proyectos se dividen en varias fases bien claras y diferenciadas:

1. ELECCIN DEL TEMA

El tema es elegido bien por una propuesta de los alumnos, por votacin
precedida de asambleas de argumentacin sobre la importancia de trabajar el tema,
por eleccin de entre una serie de temas propuestas por el docente, (el docente
propone temas que sabe que son del inters de los nios y nias ya que escuchamos
- 115 -

www.enfoqueseducativos.es

sus conversaciones en situaciones de juego libre, juego simblico, asambleas.).


Creando situaciones fantsticas o problemticas ( cartas, personajes imaginarios,
cajas de sorpresa, mensajes, telegramas) que el alumnado tenga que resolver,
noticias,

pelculas,

teatros,

dramatizaciones,

salidas,

actividades

complementarias.

Estos temas son el objeto del proyecto, y girando en torno a ellos, se produce la
programacin por parte nuestra, de los maestros y maestras. Tomando como referentes
los conceptos que tenemos que trabajar. (da lo mismo trabajar el nmero 2 con las 2
orejas de Platero o con 2 pelotas, o con 2 hojas cadas de los rboles)

Tenemos que tener en cuenta que la programacin base, la cual realizamos en


un primer momento puede sufrir diferentes modificaciones fruto de la investigacin que
realizamos, y , lo que pensbamos en un primer momento, puede ser modificado, por lo
que estamos en continuos conflictos cognitivos, tanto los nios y las nias como los
maestros y maestras. Por lo que realizamos al finalizar el proyecto una evaluacin
retrospectiva del mismo.

2. QU SABEMOS?

Para propiciar aprendizajes significativos en nuestro alumnado, tenemos que


partir de sus ideas previas, de lo que saben y conocen sobre el tema a trabajar. A partir
de sus conocimientos previos, consensuamos lo que queremos saber e investigar sobre
la temtica en cuestin. No hay que presuponer que el nio o la nia de una cierta edad
sabe esto o aquello de un tema, o le tengo que ensear esto o aquello. Es realmente,
cuando detectamos las ideas previas cuando sabemos lo que ellos y ellas saben y lo que
quieren saber.

Esta fase la solemos realizar a travs de dilogos, expresiones libres y


preguntas, en las asambleas y en juegos simblicos. Es lo ms divertido del proyecto,
ver como argumentan y dan sus propias ideas sobre las cosas, exponen su manera de ver
el mundo.
- 116 -

www.enfoqueseducativos.es

Esta fase no es nada fcil, puesto que una de las caractersticas de los nios y
nias de estas edades es su egocentrismo, ellos hablan sobre lo que en cada momento
ms les preocupa por lo que es bastante frecuente que los temas haya que irlos
reconduciendo a travs de preguntas por parte del docente. En esta fase todos hablan
menos nosotros y nosotras, las maestras y maestros. Nosotros y nosotras estamos
anotndolo todo y lo preguntando todo para tirarles de la lengua

3. QU QUEREMOS SABER?

Una vez que sabemos de dnde parten los nios y sus motivaciones e intereses,
es el momento idneo para saber lo que quieren saber, convirtindose esto en los
objetivos del proyecto que debemos de formular y programar los maestros y maestras.
De esta forma podemos incluir algunas cosillas que creamos que son importantes y se
han quedado en el tintero, de forma que las planteemos y parezca que han surgido de
ellos mismos. ( para eso somos nosotros/as los adultos)

Este qu queremos saber debemos de darle respuestas a travs de la siguiente


fase.

4. CMO PODEMOS SABERLO? INVESTIGAMOS Y APRENDEMOS.

Este apartado no es ni ms ni menos que la metodologa a emplear, y como


toda metodologa incluye los elementos metodolgicos.

Debemos de pensar y programar:

CMO VAMOS A IR APRENDIENDO?; a travs de las diferentes actividades que


les vamos a proponer a los nios y nias; asambleas, psicomotricidad, juegos motores y

- 117 -

www.enfoqueseducativos.es

musicales, rincones, talleres, literatura infantil, expresin musical, salidas,


celebraciones, actividades complementarias
Para ello debemos tener en cuenta:

DNDE LO VAMOS A REALIZAR?; organizacin espacial


.
EN QU ORDEN LO VAMOS A HACER?; organizacin temporal.

QU NECESITAMOS?; materiales y recursos.

QUIN NOS VA A AYUDAR? ;Buscamos fuentes de informacin, pensamos en


quin nos puede ayudar a saber lo que nos hemos propuesto, estas fuentes de
informacin deben ser lo ms variadas posibles; las dems seos, los paps y las
mams, las familias(hermanos, abuelos, tos, primos.), internet, diccionarios, videos,
libros, poesas, cuentos, visitas, salidas, noticias, canciones.

A los maestros y maestras, entre otras muchas tareas nos corresponde la


secuenciacin de los contenidos, la formulacin de los objetivos, garantizar que los
procedimientos sean variados, que se trabajen todas las expresiones, se desarrollen
todas las inteligencias, se trabajen todas las competencias, se desarrollen todos los
lenguajes, y se aprenda en el marco de la motivacin, la autonoma, la libertad

5. QU HEMOS APRENDIDO?

Este apartado corresponde ni mas ni menos que a la evaluacin, hay que evaluar
lo que hemos aprendido de forma divertida, lo que nos ha costado ms trabajo, lo que
nos ha costado menos, lo que ms nos ha gustado, lo que volveramos a repetir.

Y reflejamos nuestro trabajo en un documento final, el cual forma parte del


trabajo durante el proyecto este documento puede ser variado:

- 118 -

www.enfoqueseducativos.es

cartas.

Libros.

Murales.

Canciones.

Teatros o dramatizaciones.

Libro del proyecto.

Etc..

- 119 -

www.enfoqueseducativos.es

ACTIVIDADES PARA LA BIBLIOTECA DE AULA Y/O


CENTRO.
Conchy Ungo Tavira.
D.N.I:26493210-Q

Teniendo en cuenta el acuerdo de lectura y bibliotecas escolares,


del 23/1/07, y la Orden ECI/979/2007, de 3 de abril, por la que se

convoca el concurso nacional de buenas prcticas para la


dinamizacin e innovacin de las bibliotecas de los centros
escolares para el ao 2007realizaremos una serie de actividades encaminadas
al fomento de la lectura entre los escolares como:

1. Dotacin de material a las diferentes bibliotecas de aula y de centro.


2. Establecer un sistema de prstamo de libros.
3. Realizar una gua de nuestra biblioteca que contenga:
a. mascota y nombre de la biblioteca.
b. informacin sobre los recursos de la biblioteca.
c. cmo estn organizados.
d. iconos.
e. planos.
f. cmo se localizan.
4. Inauguracin de la Biblioteca Escolar (con corte de cinta por parte de un
adulto significativo: antigua maestra/o, abuela/o; reparto de octavillas
para publicitar)

- 120 -

www.enfoqueseducativos.es

5. Visitas guiadas.
6. Jornadas de puertas abiertas.
7. Ambientar y decorar la biblioteca cada trimestre, utilizando un centro o
tema de inters.
8. Taller de padres/madres para el forrado, catalogacin
9. Talleres de elaboracin de libros y cuentos con los trabajos de los
alumnos/as.
10. Revista escolar, en donde los alumnos-as presentan obras monogrficas,
reseas
11. Calendario lector (temticas para cada mes del ao).
12. Semana del cmic.
13. Semana de autor/a.
14. Feria del libro.
15. Concursos de fotografa.
16. Concurso de citas clebres.
17. Concurso entre ciclos de ilustracin, relatos, narraciones, cuentos,
redacciones, diseo de pginas webs
18. Concurso de dibujo mi biblioteca ideal.
19. Taller de impresin.
20. Taller de creacin literaria.
21. Taller de biblioterapia o libroterapia.
22. Taller de bibliocorrespondencia.
23. Encuentros con jvenes escritores.

- 121 -

www.enfoqueseducativos.es

24. Encuentros de autor/a, ilustrador/a.


25. Visitas reeditores, periodistas
26. Visitas abuelo me lees! O seccin yo recomiendo
27. Visitar una imprenta o un peridico.
28. Distinguir los libros de consulta.
29. Exposiciones.
30. Rincn de la poesa.
31. Hora del cuento, cuentacuentos.
32. Club de la lectura.
33. Teatros de marionetas; adaptaciones teatrales de un cuento clsico.
34. Celebracin de efemrides (da del libro, da de la lectura en Andaluca,
da de la paz, da de la mujer)
35. Maratn de cuentos.
36. Museo de cuentos.
37. Trabajar con libreras:
38. Seminarios permanentes de promocin lectora para realimentarnos de
conocimientos y experiencias.
39. Libro viajero.

El rpido crecimiento de la cantidad de informacin disponible requiere hoy ms


que nunca formar lectores crticos que puedan seleccionar e interpretar la cantidad de
mensajes que reciben a travs de los ms variados canales y presentados en diferentes
soportes.

- 122 -

www.enfoqueseducativos.es

Es por ello imprescindible dotar a nios y jvenes de hbitos de


lectura.

La biblioteca escolar es un recurso educativo al servicio del currculo y el


proyecto educativo del centro y se concibe en la actualidad como un espacio dinmico
de recursos y servicios de informacin que cumple un papel primordial en el proceso de
enseanza y aprendizaje.

- 123 -

www.enfoqueseducativos.es

LA TEORA DE LAS INTELIGENCIAS MLTIPLES Y LA


EDUCACIN INFANTIL.
Conchy Ungo Tavira.
D.N.I:26493210-Q

La teora de las inteligencias mltiples es un modelo propuesto por


HOWARD GARDNER en el que la inteligencia no es vista como algo unitario, que
agrupa diferentes capacidades especficas con distinto nivel de generalidad, sino como
un conjunto de inteligencias mltiples, distintas e independientes.

GARDNER define la inteligencia como "la capacidad de resolver problemas o


elaborar productos que sean valiosos en una o ms culturas".

Se

ampla el campo de lo que es la inteligencia y reconoce lo que todos

sabamos intuitivamente, y es que la brillantez acadmica no lo es todo. A la hora de


desenvolvernos en esta vida no basta con tener un gran expediente acadmico. Hay
gente de gran capacidad intelectual pero incapaz de, por ejemplo, elegir bien a sus
amigos y, por el contrario, hay gente menos brillante en el colegio que triunfa en el
mundo de los negocios o en su vida personal. Triunfar en los negocios, o en los
deportes, requiere ser inteligente, pero en cada campo utilizamos un tipo de
inteligencia distinto. No mejor ni peor, pero si distinto. Dicho de otro modo, Einstein no
es ms inteligente que Michael Jordan, pero sus inteligencias pertenecen a campos
diferentes.

GARDNER define la inteligencia como una capacidad. Hasta hace


muy poco tiempo la inteligencia se consideraba algo innato e inamovible. Se naca
inteligente o no, y la educacin no poda cambiar ese hecho. Tanto es as que en pocas
muy cercanas a los deficientes psquicos no se les educaba, porque se consideraba que
era un esfuerzo intil.

- 124 -

www.enfoqueseducativos.es

Al definir la inteligencia como una capacidad GARDNER la


convierte en una destreza que se puede desarrollar. GARDNER no niega
el componente gentico.
Todos nacemos con unas potencialidades marcadas por la gentica. Pero esas
potencialidades se van a desarrollar de una manera o de otra dependiendo del medio
ambiente, nuestras experiencias, la educacin recibida, etc.

Por ejemplo, ningn

deportista de elite llega a la cima sin entrenar, por buenas que sean sus cualidades
naturales. Lo mismo se puede decir de los matemticos, los poetas, o de la gente
emocionalmente inteligente. Debido a eso todos estamos capacitados para el amplio
desarrollo

de

nuestra

inteligencia,

apoyados

en

nuestras

capacidades

potencialidades.

TIPOS DE INTELIGENCIA
HOWARD GARDNER aade que igual que hay muchos tipos de problemas que
resolver, tambin hay muchos tipos de inteligencia. Hasta la fecha HOWARD
GARDNER y su equipo de la Universidad de Harward han identificado nueve tipos
distintos:

1. Inteligencia lingstica, la que tienen los escritores, los poetas, los buenos
redactores. Utiliza ambos hemisferios.

2. Inteligencia lgica-matemtica, la que utilizamos para resolver problemas


de lgica y matemticas. Es la inteligencia que tienen los cientficos. Se
corresponde con el modo de pensamiento del hemisferio lgico y con lo que
nuestra cultura ha considerado siempre como la nica inteligencia.

3. Inteligencia espacial, consiste en formar un modelo mental del mundo en


tres dimensiones, es la inteligencia que tienen los marineros, los ingenieros, los
cirujanos, los escultores, los arquitectos, o los decoradores.

4. Inteligencia musical, es naturalmente la de los cantantes, compositores,


msicos, bailarines.
- 125 -

www.enfoqueseducativos.es

5. Inteligencia corporal-cinestsica, o la capacidad de utilizar el propio


cuerpo para realizar actividades o resolver problemas. Es la inteligencia de los
deportistas, los artesanos, los cirujanos y los bailarines.

6. Inteligencia intrapersonal, es la que nos permite entendernos a nosotros


mismos. No est asociada a ninguna actividad concreta.

7. Inteligencia interpersonal, la que nos permite entender a los dems, y la


solemos encontrar en los buenos vendedores, polticos, profesores o terapeutas.

8. Inteligencia emocional es formada por la inteligencia intrapersonal y la


interpersonal y juntas determinan nuestra capacidad de dirigir nuestra propia
vida de manera satisfactoria.

9. Inteligencia Naturalista, la que utilizamos cuando observamos y


estudiamos la naturaleza. Es la que demuestran los bilogos o los herbolarios.

Todos tenemos las ocho inteligencias en mayor o menor medida. Al


igual que con los estilos de aprendizaje no hay tipos puros, y si los hubiera les resultara
imposible funcionar. Por ejemplo, un ingeniero necesita una inteligencia espacial bien
desarrollada, pero tambin necesita de todas las dems, de la inteligencia lgico
matemtica para poder realizar clculos de estructuras, de la inteligencia interpersonal
para poder presentar sus proyectos, de la inteligencia corporal - kinestsica para poder
conducir su coche hasta la obra, etc.

HOWARD GARDNER enfatiza el hecho de que todas las inteligencias son


igualmente importantes. El problema es que nuestro sistema escolar no las trata por
igual y ha entronizado las dos primeras de la lista, (la inteligencia lgico - matemtica y
la inteligencia lingstica) hasta el punto de negar la existencia de las dems.

Para GARDNER es evidente que, sabiendo lo que sabemos sobre estilos de


aprendizaje, tipos de inteligencia y estilos de enseanza es absurdo que sigamos
insistiendo en que todos nuestros alumnos aprendan de la misma manera.

- 126 -

www.enfoqueseducativos.es

La misma materia se puede presentar de formas muy diversas que permitan al


alumno asimilarla partiendo de sus capacidades y aprovechando sus puntos fuertes.
Pero, adems, tenemos que plantearnos si una educacin centrada en slo dos tipos de
inteligencia es la ms adecuada para preparar a nuestros alumnos para vivir en un
mundo cada vez ms complejo.

Dado que el aprendizaje en Educacin Infantil es un aprendizaje


globalizado, y pretende realizar en los nios aprendizajes significativos y
funcionales, realizaremos actividades para favorecer y potenciar los
distintos tipos de inteligencias.

- 127 -

www.enfoqueseducativos.es

CUENTOS PARA SENTIR.


Conchy Ungo Tavira.
D.N.I:26493210-Q

LA CAJA DE LOS BESOS.


Hace ya un tiempo, un hombre castig a su hijo pequeo de tres aos por
desperdiciar un rollo de papel dorado para envoltura.
El dinero le era escaso esos das, por lo que explot en furia cuando vio al
nio tratando de envolver la caja.

A la maana siguiente el nio regal a su padre la caja envuelta y le dijo:


esto es para ti, papi. l se sinti avergonzado, pero cuando abri la caja y la
encontr vaca otra vez grit con ira, acaso no sabes que cuando se le da un regalo
a alguien se supone que debe haber algo dentro? el pequeo volte hacia arriba el
rostro y con lgrimas en los ojos: oh papi, no est vaca! Yo sopl besos dentro de
esa caja y todos son para ti.

El padre se sinti morir, rode con sus brazos el pequeo cuerpo de su hijo y
le suplic que lo perdonara.

Dicen que el hombre guard esa caja dorada cerca de su cama por aos y que
siempre que se senta derrumbado, tomaba de la caja un beso y recordaba el amor
que su hijo haba depositado en ella.
- 128 -

www.enfoqueseducativos.es

De alguna forma, cada uno de nosotros/as hemos recibido alguna caja llena
de amor incondicional y de besos de nuestros hijos, amigos, familia.nadie podr
tener jams una propiedad ms grande y hermosa que esa.

SUSANA NUNCA TIENE MIEDO.

sabes que el coco, los vampiros y las brujas malas no existen?.Susana tambin lo
sabe, es una nia traviesa pero tambin muy muy valiente.

Una noche, sus padres salieron a cenar, y ella se qued con su ta Kitty.
A la hora de cenar su ta la llamaba para que dejara los juguetes y se sentara
en la mesa a cenar, pero ella no le haca caso y su ta muy enfadada se acord de que
a Susana de pequea le daba miedo el coco, y entonces se lo coma todo y no
dejaba nada en el plato .Entonces la ta Kitty la amenaz y le dijo:
-

Si no te pones a cenar llamar al coco.

Susana muy valiente le dijo:

Yo lo buscar y con mi raqueta de tenis le dar una paliza que vers.

Lo busc y busc por todas partes pero el coco no apareci por ningn sitio.
Volvi al comedor y le dijo a su ta:
- Ves cmo no existe el coco? Y su ta le dijo:
- No existe, pero tienes que cenar y obedecerme.
- 129 -

www.enfoqueseducativos.es

Susana obedeci a su ta y se puso a cenar. Cuando termin se puso a jugar otra


vez, un poco ms tarde su ta Kitty le dijo:
- Vamos Susana, ya es hora de dormir, recoge todos los juguetes. Pero Susana
segua sin hacer caso. Su ta le dijo:
- Pues si no te duermes llamar al vampiro, entrar por la ventana y te comer.
Susana sali corriendo y abri todas las ventanas de la casa a ver si entraban los
vampiros, pero ya cansada de esperar y viendo que all no ocurra nada le dijo a su
ta:
- Ves ta como tampoco existen los vampiros?
Y ella le dijo:
- Contigo no se puede nia. Y con mucho cario la llev a la cama, le puso el
pijama, la tap y le apag la luz, se sent a su lado y le dio la mano. Susana
agarrndola muy fuerte le dijo:
- Ta Kitty, t no vayas a tener miedo, que las brujas malas, tampoco existen.

- 130 -

www.enfoqueseducativos.es

Aprender es el juego ms
emocionante de la vida, no es
trabajar.
Aprender es una recompensa,
no un castigo.
Aprender es un placer, no una
tarea.
Aprender es un privilegio, no
una negociacin o una carga.
(GLENN DOMAN).

La verdadera educacin consiste en obtener lo


mejor de uno mismo. Qu otro libro se puede
estudiar mejor que el de la humanidad?
(GANDHI)

Autor: Antonio Manuel Ciudad Real Nez


DNI 26221788

LA EDUCACIN SEXUAL EN LA ADOLESCENCIA DESDE


EL PUNTO DE VISTA DOCENTE.
La educacin sexual, es una materia fundamental a la hora de formar a
nuestros alumnos. Esta incluida en el currculo como tema trasversal, Decreto
148/2002 y 231/2007 por el que se establecen las enseazas mnimas
correspondientes a la Enseanza Secundaria Obligatoria.
Los Temas Transversales incluyen una serie de valores de gran
importancia para el desarrollo evolutivo e integral de los alumnos. Por ello, se
contemplarn a lo largo de todas las reas curriculares de una manera
continuada, y no como un rea concreta e independiente.
Aunque debido al incesante aumento, tanto de los embarazos no
deseados, como del uso de la pldora del da despus entre nuestros alumnos.
Parece interesante abordar este problema de forma directa, a travs de una
accin formativa en la que su eje fundamental sea la educacin sexual. Sin, por
supuesto, dejar de lado su carcter transversal dentro del currculum. Esta
accin lo que pretende es reforzar los contenidos que, transversalmente, ya
han podido adquirir los alumnos en las diferentes materias que componen su
currculo, y completar las posibles lagunas.
Pero para poder disear una accin formativa que tenga efectos
positivos debemos de afrontarla desde tres puntos de vista diferentes.
- 134 -

www.enfoqueseducativos.es

El punto de vista de los docentes, en su papel de educador. Para realizar


esta tarea formaremos un grupo de trabajo en el que se incorporarn
profesores de las asignaturas que ms relacin pueden tener con la Educacin
Sexual: Profesor de Ciencias de la naturaleza, Educacin Fsica, Educacin
para la Ciudadana y los Derechos Humanos, Educacin tico Cvica y el
Orientador. Tambin tendrn cabida los profesores que se quieran involucrar
en este proyecto. Est equipo ser el encargado de disear las acciones
formativas, establecer las prioridades sobre las actitudes y conocimientos,
desarrollar el proyecto, evaluarlo y presentar un informe de resultados.
El punto de vista de los alumnos, con sus diferentes condiciones
personales, econmicas, sociales, etc. Ellos son los destinatarios de la accin
formativa por lo que tendremos que tenerlos en cuenta desde el principio, ya
que sino se involucran en l, su realizacin no tiene ningn sentido.
Por ultimo y no menos importantes los padres. Como pilar fundamental
de la formacin integral de sus hijos y como ltimos sufridores de los posibles
consecuencias negativas que una mala educacin sexual puede tener para sus
hijos, embarazos no deseados, enfermedades de transmisin sexual, etc.
Una forma de abordar esta accin formativa seria la realizacin de
talleres especficos sobre los problemas que los alumnos, padres y profesores,
crean ms importantes.
La mejor forma para poder detectar las necesidades educativas que
puede tener nuestro alumnado es a travs de cuestionarios directos sobre sus
comportamientos sexuales, sus conocimientos sexuales y por ultimo una
propuesta abierta de proposicin de dudas que puedan tener en torno al sexo.

- 135 -

www.enfoqueseducativos.es

Una vez analizados los cuestionarios y sus propuestas de preguntas,


pasamos a disear la accin formativa. El Grupo de Trabajo presentar la
accin al Equipo Directivo, para que posteriormente sea aprobado por el
Claustro y el Consejo Escolar, se incluya en el Proyecto curricular de centro.
Tras su aprobacin mantendremos una reunin con los padres y pasaremos a
realizar la intervencin y su posterior evaluacin.
Un ejemplo de una accin formativa seria el siguiente:
1. TITULO
Mtodos anticonceptivos, tipos, ventajas e inconvenientes de cada uno de
ellos, modo de empleo.

2. DESARROLLO.
Pasar dos cuestionarios uno relacionado con sus conocimientos acerca
de la sexualidad y otro acerca de sus conductas sexuales.
Escribir en un folio todas las preguntas relacionadas con el sexo que
quisieran que fueran respondidas.
Con todos estos datos nos ser ms fcil poder plantear tanto los
objetivos como los contenidos de las sesiones.
PRIMERA SESIN: Dividimos a los alumno por grupos de cinco y les
repartimos diferentes mtodos anticonceptivos, preservativos, diafragma, DIU,
espermicidas, pldoras anticonceptivas y pldora del da despus, les dejamos
unos minutos para que familiaricen con ellos, que los manipulen, antes de
explicar las caractersticas de cada uno de ellos y las ventajas y los
inconvenientes que tienen, analizando cada mtodo desde su doble funcin

- 136 -

www.enfoqueseducativos.es

evitar embarazos no deseados y prevenir la transmisin de enfermedades de


transmisin sexual.
SEGUNDA SESIN: En esta sesin nos centraremos en el preservativo
masculino. Explicaremos sus caractersticas, fiabilidad, modo de empleo y
retirada.

Realizaremos

simulaciones

de

colocacin

extraccin

del

preservativo, con voluntarios tanto chicos como chicas.

TERCERA SESIN: Por ltimo explicamos todo lo relacionado con el ciclo


menstrual, la ovulacin y el riesgo tan grave que supone calificar de no frtiles
los das del periodo, o los inmediatamente anteriores y posteriores. Y
establecemos una ronda de preguntas para que no se queden en el tintero
ninguna duda de lo expuesto en las sesiones anteriores.

- 137 -

www.enfoqueseducativos.es

EDUCACIN AMBIENTAL UN TEMA


TRANSVERSAL
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V

Con este artculo haremos un repaso de los principales objetivos de la educacin


ambiental

Qu es la Educacin Ambiental?
Objetivos de la Educacin Ambiental
Qu tipo de actividades se deben realizar?
Tcnicas Educativas
Para quien esta orientada la Educacin Ambiental

1. Qu es la Educacin Ambiental?
De acuerdo a la definicin de la Organizacin de las Naciones Unidas ONU (1977),
es "un proceso dirigido a desarrollar una poblacin mundial que est consciente y
preocupada del medio ambiente y de sus problemas y que tenga conocimientos, actitud,
habilidades, motivacin y conductas para trabajar ya sea individual o colectivamente, en
la solucin de los problemas presentes y en la prevencin de los futuros". De acuerdo a
la definicin propuesta por la Comisin Nacional del Medio Ambiente - CONAMA
(1994) en la ley de Bases del Medio Ambiente, la Educacin Ambiental es un "proceso
permanente de carcter interdisciplinario, destinado a la formacin de una ciudadana
que reconozca valores, aclare conceptos y desarrolle las habilidades y actitudes
necesarias para una convivencia armnica entre seres humanos, su cultura y su medio
biofsico circundante".

2. Objetivos de la Educacin Ambiental


Los objetivos de la educacin ambiental se relacionan con:
- Conciencia: ayudar a las personas y a los grupos sociales a adquirir mayor
sensibilidad y responsabilidad frente al medio ambiente.
- Conocimientos: ayudar a adquirir una comprensin bsica sobre el medio ambiente,
sus problemas, funcionamiento y sus relaciones y nuestra presencia en l.
- Actitudes: ayudar a adquirir valores, inters y disposicin para la proteccin y
mejoramiento del medio ambiente.
- Aptitudes: ayudar a adquirir habilidades para la identificacin, prevencin y solucin
de problemas ambientales.
- 138 -

www.enfoqueseducativos.es

- Participacin: ayudar a actuar individual y colectivamente en el cuidado y


mejoramiento del medio ambiente.

3. Qu tipo de actividades se deben realizar?


Es interesante sealar que, de acuerdo a estudios sistematizados por la Agencia de
Proteccin Ambiental de los Estados Unidos (EPA), se ha logrado conformar la
"Pirmide de la Experiencia", que indica lo siguiente: Las personas recuerdan un 10%
de lo que leen; 20% de lo que escuchan; 30% de lo que ven; 50% de lo que escuchan y
ven; y un 90% de lo que dicen realizando alguna cosa. Con esto se comprueba que es de
vital importancia realizar actividades tanto simuladas como prcticas, llevar a los
participantes a VIVIR lo que le estamos enseando. Respecto a las estrategias
educativas a ser utilizadas, de acuerdo a los objetivos y caractersticas de la educacin
ambiental, se sugiere la siguiente secuencia: - iniciar la actividad educativa a partir de la
subjetividad, indagando las creencias, motivaciones, opiniones y representaciones de los
educandos; por ejemplo a travs de la construccin de mapas conceptuales, grupos de
discusin, dinmicas de percepcin del entorno, expresin de emociones y sentimientos.
- una vez identificadas los conocimientos y actitudes previas, se debe "remover" estos
conocimientos para posibilitar nuevos aprendizajes; por ejemplo, a travs de actividades
de dramatizacin, juego de roles, debates calricos, que generan conflicto,
contradicciones y promueven un pensamiento divergente. - para superar las
contradicciones se requiere de actividades de reestructuracin del conocimiento, con
una interaccin guiada que permita aclarar actitudes, definir conceptos, buscar
soluciones fundamentadas; por ejemplo a travs de anlisis de documentos,
exposiciones, investigacin en terreno y entrevista
4. Tcnicas Educativas
Esto puede ser realizado a travs de distintas tcnicas educativas: - Mdulos de
enseanza - aprendizaje: donde a travs de una secuencia estructurada de actividades o
situaciones de aprendizaje se facilita el logro de determinados aprendizajes. Por ejemplo
una investigacin sobre una determinada problemtica ambiental (contaminacin del
aire, erosin de suelos), que comprenda trabajo en terreno, registro de observaciones a
travs de una hoja de chequeo, recopilacin de informacin de prensa, anlisis
estadsticos, entrevista a autoridades y profesionales de instituciones competentes,
diseo de material de difusin de informacin, exposicin de resultados. - Tcnicas
expositivas y estudio dirigido: que permite sintetizar informacin dispersa y compleja,
presentar experiencias y guiar la bsqueda de conocimientos profundizar un tema. Discusin grupal: para la identificacin de un problema, clarificaciones conceptuales. Estudio de caso: presenta una situacin mediante documentos o reportajes
seleccionados, para su anlisis por parte del grupo, permitiendo ver alternativas de
solucin frente aun problema ambiental. - Encuestas y entrevistas: permiten captar
actitudes de un determinado pblico, respecto a un tema especfico. - Interpretacin
ambiental: es una forma de comunicacin que busca despertar el inters y curiosidad
respecto a un proceso o problema ambiental.
5. Para quien esta orientada la Educacin Ambiental
- 139 -

www.enfoqueseducativos.es

La educacin ambiental est destinada a toda la poblacin, entendiendo que el cuidado,


conservacin, preservacin y mejoramiento del medio ambiente es una labor donde
todos tenemos responsabilidad (hombres, mujeres, durante su niez, juventud, vida
adulta y tercera edad) desde las distintas funciones y roles dentro de la sociedad
(padres/madres, trabajadores, profesionales, funcionarios pblicos, duea/o de casa,
autoridad, etc.).
Resulta fundamental que la formacin ambiental sea parte de nuestro proceso
educativo, de modo de actuar en consecuencia con los conocimientos, valores y
actitudes adquiridos, permitiendo as actuar no slo en la solucin de problemas
ambientales, sino sobretodo en su prevencin.
Dentro del actual marco educativo, la educacin ambiental puede y debe ser
desarrollada coherente con la necesidad de formar personas integrales, capaces de actuar
constructivamente en la solucin de sus problemas.

- 140 -

www.enfoqueseducativos.es

NECESIDAD DE UN PROYECTO DE EDUCACIN


PARA LA PAZ EN LOS CENTROS ESCOLARES
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V
La educacin cumple un importante papel en el desarrollo de la Cultura de Paz y
No violencia, caracterizada por la convivencia y por los principios de libertad, justicia
social, democracia, tolerancia y solidaridad, que rechaza la violencia, se dedica a
prevenir los conflictos en sus races y busca soluciones positivas y alternativas a los
grandes desafos del mundo moderno. A esta tarea no es ajeno nuestro Sistema
Educativo que tiene, entre otras finalidades, la formacin en el respeto de los derechos y
libertades fundamentales y en el ejercicio de la tolerancia y de la libertad dentro de los
principios democrticos de convivencia.
La educacin constituye, como factor de progreso, de cohesin social y de
desarrollo, la base esencial de la Cultura de Paz y uno de los pilares sobre los que se
fundamenta cualquier proyecto de futuro para afrontar con xito los procesos constantes
de cambio de nuestra sociedad. Los principios en que se basa el Plan Andaluz de
Educacin para la Cultura de Paz y No violencia se concretan en cuatro mbitos
pedaggicos de actuacin:
1. El aprendizaje de una ciudadana democrtica, dirigida a la formacin
de ciudadanos y ciudadanas responsables, facilitando los conocimientos y
competencias necesarias para hacer posible una participacin activa; creando las
posibilidades de dilogo y de reflexin, de resolucin no violenta de los conflictos,
as como los espacios de consenso, comunicacin y de interaccin que susciten la
toma de conciencia de los derechos y deberes de cada uno, de las normas de
comportamiento y de los valores compartidos, as como de las cuestiones ticas
implcitas en cada una de nuestras acciones y en las problemticas actuales.
Formacin que, orientada a la construccin de la Paz, debe considerarse como un
proceso constante en tres dimensiones estrechamente ligadas: una dimensin
cognitiva (asimilacin de ideas, conceptos, sistemas...), una dimensin social
(conjunto de actitudes propias de las prcticas democrticas ejercidas en distintos

- 141 -

www.enfoqueseducativos.es

momentos y en todas las etapas de la vida) y una dimensin afectiva


(reconocimiento e interiorizacin de valores).
2. La educacin para la paz, los derechos humanos, la democracia y la
tolerancia, como verdadero aprendizaje social, permite no slo la adquisicin
de los conocimientos esenciales sobre la sociedad y la mejor forma de participar en
ella (aprender a vivir consigo mismo, con los dems y con la naturaleza), sino que
exige tambin la adquisicin de aquellos conocimientos y estrategias de
transformacin, de conducirse por nuevos valores, socialmente construidos, que
respondan con creatividad a las nuevas problemticas planteadas en el presente y
en el futuro. En la actualidad la Educacin para la paz, los derechos humanos, la
democracia y la tolerancia es considerada -tanto a escala regional como
internacional-no slo como una necesidad de las sociedades para hacer frente a los
cambios y buscar alternativas a los problemas mundiales, sino como la finalidad
esencial del derecho a la educacin.
3. La mejora de la convivencia escolar, unida estrechamente a la
organizacin y funcionamiento de los centros como la suma de interrelaciones
entre los elementos que la componen, como un sistema abierto imbricado en la
sociedad y como un espacio institucional que a travs de la cooperacin resuelve
favorablemente los conflictos que en ella se dan desde la autonoma y la
responsabilidad compartida.
4. La prevencin de la violencia, a travs de la mejora de la cultura y
clima escolar, del desarrollo de habilidades sociales y comunicativas, el
aprendizaje y prctica de las diferentes tcnicas de resolucin pacfica de los
conflictos, del desarrollo de la inteligencia emocional y la aplicacin de programas
globales de educacin para la paz con la implicacin y participacin directa de
todos los miembros de la Comunidad Educativa y de los ms amplios sectores
posibles de la sociedad.

El primer compromiso que debe adquirir cualquier proyecto pacifista


contemporneo es potenciar la Paz en todas sus manifestaciones posibles, desde las
individuales a las internacionales, desde las relaciones familiares a las relaciones
- 142 -

www.enfoqueseducativos.es

polticas, desde los sentimientos a las decisiones econmicas, etc. Existen multitud de
realidades de Paz que deben ser reconocidas -estudiadas e investigadas-y potenciadas.
Las acciones cotidianas, efectivamente, estn repletas de prcticas pacficas que dan
sentido a nuestras vidas y permiten que los individuos, los grupos, las sociedades y la
humanidad en su conjunto puedan afrontar con relativo xito gran parte de los retos con
los que se enfrentan. La comunidad escolar no slo no es una excepcin a esta regla
sino que adems constituye un mbito donde, gracias a la predisposicin y a las
acciones de todos los miembros de la Comunidad Educativa, la mayora de los
conflictos se regulan pacficamente por medio del dilogo, la cooperacin, la
solidaridad y la ayuda mutua.
La Cultura de Paz es un concepto mucho ms amplio que la simple ausencia de
violencia. Los estudios de la comunidad cientfica internacional sostienen que la
violencia es evitable pues no es innata en el ser humano y debe ser combatida en sus
causas econmicas, sociales y culturales, permitiendo avances considerables en la
comprensin de sus diversas formas al asociarla con la insatisfaccin de las necesidades
humanas. En la actualidad, la superacin de la violencia en cada una de sus
manifestaciones -a cuyos efectos lamentablemente no escapan algunos centros
educativos-constituye una de las principales prioridades de las polticas tanto de los
organismos internacionales como de los gobiernos.
Por otro lado, la formacin de una ciudadana capaz de afrontar creativa y
positivamente los desafos del mundo contemporneo, como la globalizacin de la
economa, el fenmeno de la inmigracin o los graves desequilibrios estructurales que
sufren las sociedades actuales, constituye una finalidad primordial de las actuales
polticas educativas en todo el mundo.

La Cultura de Paz se define, por otro lado, tal como se expresa en la Declaracin
y Programa de Accin aprobada por la Asamblea General de Naciones Unidas en el
verano de 1999, como un conjunto de valores, actitudes, tradiciones, comportamientos
y estilos de vida orientados a conseguir metas en ocho esferas:
-

Cultura de paz a travs de la educacin.

Desarrollo econmico y social sostenible.


- 143 -

www.enfoqueseducativos.es

Respeto de todos los derechos humanos.

Igualdad entre hombres y mujeres.

Participacin democrtica.

Comprensin, tolerancia y solidaridad.

Comunicacin participativa y libre circulacin de informacin y

conocimientos.
-

Paz y seguridad internacionales.

La Cultura de Paz es, en definitiva, una cultura de la armona social fundada en


los principios de libertad, justicia y democracia, de tolerancia y solidaridad, que rechaza
la violencia; procura prevenir las causas de los conflictos en sus races y dar solucin a
los problemas mediante el dilogo y la negociacin; y garantiza a todos el pleno
ejercicio de todos los derechos y los medios para participar plenamente en el desarrollo
de su sociedad. En sntesis, es la cultura fundada en el respeto al derecho humano a la
paz.

- 144 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


EL CURRCULUM INTEGRADO DE LAS LENGUAS
Bajo este complejo ttulo se esconde una realidad que cada da se nos hace ms
cercana. El currculum integrado de las lenguas es una puesta en comn y un conjunto
de decisiones comunes de los docentes encargados de impartir las materias lingsticas.
En el actual sistema educativo, el papel que desempean las lenguas extranjeras
es de total importancia. Cada da se destaca con ms nfasis la funcionalidad de que el
alumnado sea capaz de expresarse en alguna lengua extranjera.
Con el desarrollo de estas enseanzas, se plantea, desde la prctica docente, cul
es el mejor mtodo para alcanzar el ansiado objetivo de conseguir que el alumnado sea
capaz de utilizar la lengua extranjera.
Bajo esta nueva realidad tiene sentido el ttulo del presente artculo. Con
currculum integrado de las lenguas se propone trabajar al unsono desde todos los
departamentos que imparten materias lingsticas. No slo los profesores de las lenguas
extranjeras son los encargados de planificar este currculum, los docentes de la materia
Lengua Castellana y Literatura tambin han de colaborar con el resto de docentes de
lenguas extranjeras.
As, los profesores han de encontrar puntos comunes en sus enseanzas para
desarrollar este currculum. No resulta sencillo alcanzar un consenso, debido a que el
alumno que empieza a aprender una segunda lengua extranjera ya posee un amplio
bagaje en su lengua materna, el espaol en nuestro caso. Por este motivo, es
fundamental el dilogo entre los especialistas. No obstante, podemos encontrar algunas
actividades que se pueden desarrollar en las dos materias. Las ms recurrentes son
- 145 -

www.enfoqueseducativos.es

aquellas en las que se trabaja la expresin, tanto escrita como oral del alumnado. S
tendremos que tener en cuenta que los resultados sern diferentes en las dos lenguas. En
lengua castellana conseguiremos que el alumnado desarrolle discursos orales o escritos
de cierta complejidad, dependiendo de su nivel educativo, mientras que en la segunda
lengua, las producciones, orales o escritas, sern de una mayor sencillez.
Cuando al alumno se le introduce una tercera lengua, tambin es posible trabajar
su currculum de forma integrada. Ahora el problema ser mayor, porque cada una de
las tres lenguas se haya en un estadio diferente de aprendizaje. Sin embargo, si
conseguimos agrupar contenidos, conseguiremos que el alumno sea consciente de que la
competencia comunicativa es la misma, independientemente de cul sea la lengua que
utilicemos.
Si conseguimos que el alumnado comprenda que el trato que han de recibir las
lenguas es el mismo, conseguiremos, por ejemplo, que no sea tan reacio a ciertas
actividades que se trabajan desde la materia de Lengua Castellana. Por ejemplo, a los
ejercicios de expresin oral. En estos ejercicios, el alumno piensa, muy a menudo, que
no aprende nada. Piensa que ya domina el idioma. Sin embargo, cuando trabajamos
estos ejercicios en un idioma extranjero no tiene esa sensacin de perder el tiempo.
Cuando agrupemos contenidos de las diferentes materias lingsticas, tendremos
en cuenta que estos se trabajarn en diferentes niveles. Aqu es fundamental la
participacin entre los docentes implicados.
Agrupando, y trabajando contenidos afines, el alumno desarrollar su
competencia comunicativa. Todas las lenguas se vern beneficiadas, incluso cuando no
sean ellas las que estn en contacto con el alumnado.

- 146 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez


INSTRUMENTOS DE EVALUACIN: LAS PRUEBAS LIBRES
Cuando los docentes queremos verificar el grado de consecucin de los objetivos
previstos, recurrimos a una serie de instrumentos que nos facilitan esta labor. Para
observar si el alumnado ha aprendido los contenidos del currculo solemos realizar una
prueba escrita. Son mltiples los modelos de pruebas escritas que podemos desarrollar.
En el presente artculo me centrar en las conocidas como pruebas libres.
Las pruebas libres se caracterizan porque no hay que escoger la respuesta entre
varias propuestas por el examinador. El examinado es el encargado de construir su
propia contestacin. Con esta prctica el alumnado demuestra su capacidad de expresin
escrita. Adems, los partidarios de este tipo de pruebas argumentan que el alumno debe
realizar una labor de sntesis, en algunas ocasiones, o de razonamiento en otras.
Al tener que desarrollar un tema por escrito, son pruebas en las que eliminamos
el factor suerte. Incluso, se hace ms difcil copiar que en aquellas pruebas de respuesta
cerrada, es decir, en aquellas en las que el alumno escoge una opcin de entre varias
propuestas. Como inconveniente a las pruebas de respuesta abierta podemos aportar su
dificultad de correccin. Tenemos que tener muy claros los criterios que vamos a seguir
para puntuar cada pregunta.
Los detractores de las pruebas de respuesta abierta aducen que los criterios de
correccin son variables en stas. Esto es, si despus de corregir los escritos de nuestros
alumnos vemos que no ha sido bien diseada, y como consecuencia los resultados han
sido excesivamente negativos, podemos variar los criterios de correccin y as las

- 147 -

www.enfoqueseducativos.es

calificaciones sern ms positivas. Esta libertad no la tenemos a la hora de realizar las


conocidas pruebas objetivas. En estas la forma de calificar es muy clara.
A la hora de planificar nuestras pruebas libres, son muchas las opciones de las
que disponemos. Podemos decidirnos por disear preguntas de respuesta breve, o bien
desarrollar cuestiones de respuesta ms amplia. La ventaja que encontramos con las
preguntas de respuesta breve es que podemos abarcar una parte ms amplia del temario
de nuestra materia. Tanto en unas como en otras, es crucial que preveamos su forma de
calificacin, con lo que conseguiremos una menor ambigedad en la valoracin de la
prueba.
Si la persona que corrige la prueba no es la misma que la dise, ser
recomendable que la segunda elabore una serie de posibles respuestas. Se trata de
presentar una solucin ideal, con lo que objetivamos la visin del corrector.
A las pruebas de las que nos ocupamos siempre se les ha achacado su falta de
objetividad a la hora de la valoracin. Para paliar esta carencia se han diseado varios
mtodos de correccin. Mientras que algunos evalan las preguntas de una forma
intuitiva, otros tienen un plan muy detallado para evaluar objetivamente la respuesta.
En la medida de lo posible, sern dos o ms profesores los encargados de
corregir los escritos del alumnado. Aunque este punto es difcil de conseguir, es bueno
que nos acostumbremos a evaluar de forma conjunta. Con esto, veremos las diferencias
y semejanzas con nuestros colegas.
Para acabar, debemos saber qu vamos a valorar en estas respuestas. Si es el
contenido de la pregunta o es la expresin escrita del alumno.

- 148 -

www.enfoqueseducativos.es

Todo lo dicho supra, nos ayudar a la hora de elaborar pruebas de respuesta


abierta. Siempre intentaremos minimizar el impacto de los posibles puntos negativos
que encontramos en estas.

- 149 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez

INSTRUMENTOS DE EVALUACIN: LAS PRUEBAS OBJETIVAS

Cuando llega el momento de evaluar al alumnado, es decir, de comprobar el


grado de consecucin de los objetivos que nos habamos propuesto, recurrimos a las
diferentes tcnicas que conocemos como profesionales de la educacin.

La prctica ms habitual para evaluar al alumno es la realizacin de pruebas


escritas. En el presente artculo interesa resaltar uno de los tipos de prueba escrita ms
comn: Las pruebas objetivas.

Antes de comenzar a ver sus caractersticas, conviene que sepamos qu son


exactamente las pruebas objetivas. stas son pruebas en las que el docente presenta al
alumnado una serie de respuestas agrupadas en torno a diferentes preguntas. El alumno
debe elegir de entre las diferentes alternativas aquella que l considere correcta.

Estas pruebas han tenido tradicionalmente muchos detractores, ya que las


consideran artificiales y poco apropiadas para que el alumno desarrolle su expresin.
Tambin se les ha achacado que priman a aquellos alumnos que no han estudiado, y
pueden, gracias al azar, pasar la prueba.

Sin embargo, tambin son muchos los aspectos positivos que conllevan estas
pruebas. El tiempo de correccin es menor que en las pruebas en las que hay que

- 150 -

www.enfoqueseducativos.es

desarrollar contenidos. Adems, la calificacin es ms objetiva y clara que en otro tipo


de pruebas.
En las pruebas objetivas, la labor del docente es fundamental. Es l el encargado
de desarrollar pruebas en las que el alumnado no pueda contestar por simple asociacin
verbal. Los diferentes tems deben ser creados para que el alumnado deba reflexionar
sobre cul es la respuesta correcta. No olvidemos que a veces habr ms de una
contestacin adecuada.

En las pruebas objetivas, al no necesitar desarrollar cuestiones relativas al


temario, es ms fcil comprobar el grado de conocimiento del alumnado de toda la
materia. Al necesitar menos tiempo para responder a los tems, se pueden hacer pruebas
ms largas y exhaustivas del contenido de la materia.

De entre las diferentes formas que pueden adoptar las pruebas objetivas, hay dos
que son destacables: Las de respuesta V/F (Verdadero/Falso), y las de eleccin mltiple.
En las primeras, el alumnado debe escoger solo entre dos opciones V/F. Se ha criticado
mucho a estas pruebas porque cualquier alumno puede contestar, e incluso superar la
prueba. Los partidarios de estas pruebas argumentan que si la prueba est bien
construida, y se establecen un nmero apropiado de tems, los resultados sern
plenamente objetivos. Se recomienda, adems, que en la correccin sumen
negativamente las respuestas incorrectas. Con esto evitamos que el alumno conteste al
azar porque sabe que restar si su eleccin es errnea.

- 151 -

www.enfoqueseducativos.es

Por otro lado, las pruebas de eleccin mltiple dan una mayor libertad al docente
para comprobar el grado de conocimiento de sus alumnos. En estas pruebas la seleccin
de respuestas puede responder a distintos criterios. Podemos ofrecer una serie de tems
verdaderos para seleccionar el ms correcto; elegir ms de una respuesta; ninguna de las
opciones es correcta; etc.

No pretendo hacer una defensa de este tipo de pruebas. Solo pretendo que
estemos abiertos a aplicarlas en el aula. No deben ser las nicas pruebas con las que
evaluemos a nuestros alumnos. Si hiciramos eso estaramos obviando algunas
capacidades que se deben alcanzar, como por ejemplo la expresin escrita. Tampoco
podemos negar que son las ms apropiadas en determinadas situaciones. Pensemos si
no, en momentos en los que debamos evaluar a un gran nmero de personas y en un
tiempo limitado. En general, son apropiadas cuando la persona que las elabora y la
persona que las corrige no es la misma.

- 152 -

www.enfoqueseducativos.es

Autor: Manuel Nevado Gmez

LA PRENSA EN EL AULA

La prensa es uno de los recursos didcticos de mayor importancia para la materia


de Lengua Castellana y Literatura. Muy a menudo, los docentes recurrimos a ella con la
intencin de que nuestros alumnos y alumnas amplen su comprensin textual.
Una de las ventajas que presenta la prensa respecto a otros medios impresos, por
ejemplo el libro de texto, es que conecta al alumno con el mundo. Los discursos que
contiene un peridico remiten a hechos actuales. Adems, si la prensa es local,
situaremos a los lectores en un punto cercano a los problemas que afectan a la
comunidad de la que ellos forman parte.
Son variados los tipos de prensa que podemos encontrar. De entre ellos, nos
interesan fundamentalmente dos: Los diarios locales y nacionales impresos, y stos
mismos en digital, es decir, en Internet.
Se puede trabajar en el aula no slo la estructura del medio, sino que tambin
podemos desarrollar actividades de anlisis, comprensin y valoracin del contenido.
No olvidemos que el conocimiento de los medios de comunicacin es un objetivo
fundamental del sistema educativo.
En los diarios encontramos diferentes secciones. Algunas de ellas son fijas,
mientras que otras varan. El alumno debe ser capaz de identificar las diferentes partes
del peridico. Por ejemplo, ha de ser capaz de localizar las noticias deportivas con slo
echar un vistazo rpido.

- 153 -

www.enfoqueseducativos.es

Sabemos que leer un peridico es una actividad que requiere una lectura
diferente a si leemos otro tipo de escrito. Para desarrollar esta habilidad el alumno ha de
diferenciar la estructura de las noticias: Gracias a esto podr avanzar a travs de las
pginas del diario.
Como fuente de actualidad que es la prensa, el alumno se ha de habituar a
consultarla para estar documentado. Es claro que, dependiendo de las edades y
aficiones, cada uno se fijar en una seccin concreta.
Por ltimo, el alumnado ha de ser capaz de discriminar aquello que es noticia de
aquello que es opinin.
Analizando y comentando el contenido del peridico conseguiremos que se
consigan todos estos objetivos. Pero an podemos incluir actividades de expresin
escrita a partir de este medio. No slo es til para mejorar la comprensin lectora.
De entre las posibilidades que nos ofrece para la expresin escrita, podemos
destacar la creacin de noticias, artculos de opinin, cartas al director, etc.
Especialmente atractivas son estas ltimas.
Como tarea final podramos elaborar un peridico o revista de Centro. Para ello
es conveniente haber introducido al alumno en el mundo periodstico. No es fcil la
redaccin y publicacin de una revista de Centro. Exige un amplio trabajo por parte del
docente y por parte del alumno; Sin embargo, la recompensa es tan grata que
olvidaremos las horas de dedicacin. Es una buena actividad motivadora, ya que todos
nos sentimos satisfechos al ver que nuestros textos son ledos. Se pueden incluir tanto
producciones literarias como textos ms cercanos a la sociedad del alumno.

- 154 -

www.enfoqueseducativos.es

PROGRAMA DE MEDIACIN DE IGUALES


Justificacin:
Autor: Antonio Manuel Ciudad Real Nez
DNI 26221788V
En el momento presente, el tema que preocupa ms a los docentes que imparten
sus enseanzas en la Enseanza Secundaria Obligatoria, es sin duda, la convivencia escolar.
Esto ha hecho que pasen a un segundo lugar el fracaso escolar, la metodologa o el proceso
de enseanza-aprendizaje.

En nuestras escuelas, se producen cotidianamente problemas que alteran el clima


de las aulas y del centro en general. Estos problemas inherentes al mbito escolar y a otros
mbitos de la vivencia de nuestros alumnos, obstaculizan el logro de los objetivos para los
que la escuela fue creada.

Son cada vez son ms frecuentes los casos de incumplimiento de las normas de
convivencia: faltas de respeto al profesorado y personal del centro, actitudes violentas hacia los
compaeros y el profesorado, el abandono de los estudios o de algunas asignaturas, el poco
cuidado de los materiales propios y del centro, el deterioro del mobiliario escolar, la poca
limpieza de patios y clases, el desorden y la falta de silencio para poder trabajar en las aulas, el
consumo o la venta de drogas en los centros, los casos de intimidaciones (bullying) que con
una frecuencia creciente se estn produciendo, etc.

Tambin es cierto que muchos alumnos encuentran en la escuela un lugar donde poner
de manifiesto los problemas relativos a otros mbitos de su vida, tales como la soledad, la
desestructuracin familiar, la rebelda, la violencia social, la falta de normas claras en las
familias, modelos de conducta negativos, etc.

La escuela est integrada por personas de distintas edades, formacin e intereses


que realizan diversas tareas. Por la naturaleza de sus funciones estas personas conviven en la
escuela durante varias horas al da.

- 155 -

www.enfoqueseducativos.es

La escuela no acta separada del medio en el que vivimos. Es una comunidad activa
que forma parte de la sociedad y sus miembros tienen los mismos problemas personales y
sociales que el resto de la poblacin. Por eso no podemos extraarnos de que en la escuela
se originen conflictos ni que repercutan o se desarrollen otros en ella, provenientes del medio
social.
Si bien esta problemtica no es nueva, en el siglo XXI se observa gran preocupacin e
intensos debates en la esfera nacional e internacional, acerca de los conflictos que aparecen
en la escuela, capaces de generar violencia.
El Informe del Defensor del Pueblo sobre Violencia Escolar (1999), nos ofrece los
siguientes datos:

El aula es el escenario en el que se da un mayor porcentaje de

conflictos.

En 1 y 2 de ESO es donde se encuentra mayor nmero de

incidencias.

Es muy importante observar que los alumnos/as cuentan en un

60% a sus propios compaeros los problemas que sufren frente a un 15% que
nicamente se lo cuentan a sus profesores. Y de nuevo un 65% acuden a sus
propios compaeros para solicitarles ayuda en situacin de riesgo.
Sin animo de caer en una visin negativa de la escuela y de nuestros alumnos y
alumnas, y sin la casustica de violencia que se producen en un grado extremo en otros pases,
el Equipo tcnico de Coordinacin Pedaggica cree que es momento de prevenir antes de
llegar a grados ms agudos ante los problemas de convivencia.
Desde esa misin de prevencin que debe tener la escuela, es lcito que intentemos
dar respuestas a la problemtica de convivencia escolar que nos afecta a todos. Pero como
todo en la vida y mucho ms en la escuela si no creemos en lo que hacemos poco podremos
conseguir. Esta situacin que vivimos en la escuela es algo que nos atae y nos preocupa a
todos, as que por qu no intentarlo? Si puede solucionar, en parte, el problema y permitirnos
desarrollar nuestro trabajo y nuestra vocacin con ms comodidad.
A grandes rasgos, este Programa de Mediacin entre iguales, no pretende ser la
panacea, la receta, que solucione definitivamente estos problemas, pero si que creemos que
puede ser una forma de prevenir de forma creativa y participativa estas situaciones contrarias a
la convivencia, ya que el Programa se plantea con el indispensable concurso de los propios
alumnos y con la ayuda del profesorado y de forma especial, la intervencin de los Defensores

- 156 -

www.enfoqueseducativos.es

del Menor, los Jefes de Estudio, los Orientadores de los Centros o cualquier profesor/a
interesado y preocupado por el tema.
Muchos de los conflictos y problemas que surgen en el contexto escolar y entre los
propios alumnos no son conocidos, y muchos de ellos, ni sospechados por los docentes. Se
trata, pues, de preparar a un grupo de alumnos y alumnas para sean mediadores entre sus
propios compaeros. Por tanto no se tratara de un grupo de chivatos o confidentes de los
profesores o el Jefe de Estudios, sino alumnos que ejercen la mediacin entre sus propios
compaeros e intentando solucionar ambientes de clases hostiles, conflictos de convivencia o
incumplimiento de las normas de convivencia. Su actuacin no ser nunca punitiva, sino
mediadora y dialogante.
Este Programa de Mediacin entre iguales se subdivide a su vez en dos
subprogramas, que atienden a cada Ciclo de Secundaria, pero que se complementan:
Programa de alumnos ayudantes (1 y 2 de ESO) y

Programa de alumnos

mediadores de conflictos (3 y 4 de ESO).

PROGRAMA DE MEDIACIN
ENTRE IGUALES

Programa de
alumnos ayudantes
(1 y 2 de E.S.O.)

Programa de
alumnos mediadores de conflictos
(3 y 4 de E.S.O.)

- 157 -

www.enfoqueseducativos.es

LA VIOLENCIA EN EL ENTORNO ESCOLAR


Mari Carmen Gmez Jimnez
ltimamente cada vez que ponemos la T.V. o abrimos el peridico nos
encontramos con una noticia relacionada con la violencia, tanto en entornos
escolares como familiares.
La pregunta ms habitual que se puede hacer un ciudadano de a pie es
qu est pasando en esta sociedad?, qu est pasando con nuestros
jvenes?. Pregunta compleja, pues ni los expertos tienen respuesta para ella.
Actualmente nuestra sociedad est experimentando muchos cambios en
muy poco tiempo. Algunos de ellos nos han proporcionado beneficios, pues nos
hacen la vida cada vez ms fcil, pero tambin nos han trado problemas que
nos resultan nuevos y no sabemos resolver. Uno de estos cambios es en cuanto
a los roles que jugamos en la sociedad, pues hemos pasado de la represin
ms absoluta a la libertad ms exagerada.
La escuela de antao era una institucin muy respetada, en la que se
empleaba una disciplina, en ocasiones, bastante dura, donde asistan slo unos
pocos privilegiados y donde el concepto habitual se resuma en la letra con
sangres entra.
Ahora la escuela ha pasado a un segundo plano, es una institucin
donde hay que ir porque es obligatorio permanecer en ella hasta los 16 aos,
donde todo el mundo cree que tiene derecho a todo y obligacin de nada y, a
pesar de todo, se ha relegado sobre ella la obligacin de educar y socializar a
- 158 -

www.enfoqueseducativos.es

todos los ciudadanos, no contando, a veces, para ello con ayuda de padres y de
otras instituciones de la sociedad.
El trmino violencia se est produciendo en diversos mbitos de la
sociedad, no slo en el escolar; ltimamente estn aumentando los casos de
violencia en el seno de las familias. Y es que son estos dos entornos los que
influyen sobremanera en el desarrollo de los jvenes.
Los jvenes violentos acostumbran a mostrar comportamientos violentos
desde pequeos, pero los adultos que los rodean creen que estn pasando una
fase y que cuando crezcan se les pasar.
Podemos destacar una serie de factores que pueden influir en el
comportamiento agresivo, como haber sido vctima de abuso fsico y/o sexual,
haber estado expuesto a la violencia en el hogar, factores genticos, la
exposicin a la violencia en los medios de comunicacin, consumo de drogas y
alcohol, separacin o divorcio de las familias, etc.
Estos factores se ven condicionados tambin por otra variable como es la
baja autoestima, ya que se considera el maltrato como un mecanismo de
defensa ante la propia inseguridad.
Normalmente estos chicos agresivos forman parte de grupos con los
mismos comportamientos, poseen una fuerte conciencia de grupo y una baja
autoestima, por lo que necesitan llevar a cabo este tipo de conductas para
fortalecerse frente al resto de compaeros y ser aceptados en la pandilla.
Pero llegados a este punto, podramos aadir dos variables ms que
influyen en este tipo de comportamientos. Por un lado, la falta de autoridad o
- 159 -

www.enfoqueseducativos.es

de establecimiento de lmites por parte de los padres, fomentando con ello que
los chicos tengan muy baja tolerancia a la frustracin, ya que no estn
acostumbrados a recibir un NO por respuesta. Y, por otro lado, el gran desfase
curricular que presentan cuando llegan a la adolescencia. Nos centraremos un
poco en este aspecto.
Cuando los jvenes llegan a la Educacin Secundaria Obligatoria, donde
existen una serie de normas que hay que cumplir, como horarios, tareas,
respeto a los dems, normalmente no las aceptan, pues ellos no estn
acostumbrados a recibir y seguir instrucciones. Pero si a esto le aadimos, que
se van descolgando, curricularmente hablando, del sistema educativo, cada vez
les interesa menos lo que all se pretende. Es decir, cuanto mayor es el desfase
curricular de estos alumnos/as, mayor probabilidad tendrn de presentar
conductas violentas.
Por otro lado, no podemos culpar slo a los chavales y a sus padres; los
profesores han perdido su autoridad, bien por las situaciones que se dan casi a
diario, de maltrato de alumnos/as a profesores/as o, bien porque no quieren
complicarse la vida y hacen la vista gorda ya que se ven desamparados por el
resto de instituciones sociales.
Ahora bien, ante esta problemtica que est tan de moda, debemos
contribuir todos, toda la sociedad, para que todos nuestros jvenes, que son el
futuro, se desarrollen de manera adecuada; entre todos debemos proponer
medidas y llevar a cabo actuaciones para paliar esta problemtica.

- 160 -

www.enfoqueseducativos.es

El profesor/a debe recuperar su reconocimiento social, tener autoridad


para combatir situaciones violentas. Los centros deben contar con normas
claras, en las que los alumnos participen en su elaboracin y se responsabilicen
de ellas.
Desde los centros educativos debemos atender las necesidades reales de
nuestros alumnos/as, motivarles, elaborar adaptaciones curriculares para
aquellos que lo necesiten, proponer medidas de atencin a la diversidad, etc.
Debemos crear lneas de trabajo comunes entre escuela y familias y
proponer disciplinas coherentes.
Por otro lado, los padres no deben ser amigos de sus hijos, deben
aceptar su papel de padres, y asumir que educar no es decir SI a todo, tambin
es decir NO, fijar normas y supervisarlas, en definitiva son los responsables de
los actos de sus hijos, y no deben relegar la educacin de stos slo a la
escuela, ellos deben contribuir, en su trabajo conjunto con el profesorado, a
que sus hijos se integren y adapten lo mejor posible a nuestra sociedad.

BIBLIOGRAFA Y DIRECCIONES WEBS


IX SEMINARIO INTERNACIONAL SOBRE VIOLENCIA Y SOCIOLOGA DE LA
VIOLENCIA. Congreso sobre la violencia y escuela (6 y 7 de octubre de 2.005).
BOTO, NGELA (30-09-07): ttulo completo del artculo. Donde nace la
violencia. Suplemento El Pas, (35-39).
www.solohijos.com. Blog de aplicaciones. Ramo, Arturo (16-10-06): Violencia

escolar y autoestima.

"American Academy of Child and Adolescent Psychiatry". Informacin para las


familias. Nmero 55.

- 161 -

www.enfoqueseducativos.es

Autor: Antonio Manuel Ciudad Real Nez


DNI 26221788

LA EDUCACIN SEXUAL EN LA ADOLESCENCIA DESDE


EL PUNTO DE VISTA DOCENTE.
La educacin sexual, es una materia fundamental a la hora de formar a
nuestros alumnos. Esta incluida en el currculo como tema trasversal, Decreto
148/2002 y 231/2007 por el que se establecen las enseazas mnimas
correspondientes a la Enseanza Secundaria Obligatoria.
Los Temas Transversales incluyen una serie de valores de gran
importancia para el desarrollo evolutivo e integral de los alumnos. Por ello, se
contemplarn a lo largo de todas las reas curriculares de una manera
continuada, y no como un rea concreta e independiente.
Aunque debido al incesante aumento, tanto de los embarazos no
deseados, como del uso de la pldora del da despus entre nuestros alumnos.
Parece interesante abordar este problema de forma directa, a travs de una
accin formativa en la que su eje fundamental sea la educacin sexual. Sin, por
supuesto, dejar de lado su carcter transversal dentro del currculum. Esta
accin lo que pretende es reforzar los contenidos que, transversalmente, ya
han podido adquirir los alumnos en las diferentes materias que componen su
currculo, y completar las posibles lagunas.
Pero para poder disear una accin formativa que tenga efectos
positivos debemos de afrontarla desde tres puntos de vista diferentes.
El punto de vista de los docentes, en su papel de educador. Para realizar
esta tarea formaremos un grupo de trabajo en el que se incorporarn
profesores de las asignaturas que ms relacin pueden tener con la Educacin
Sexual: Profesor de Ciencias de la naturaleza, Educacin Fsica, Educacin
para la Ciudadana y los Derechos Humanos, Educacin tico Cvica y el
Orientador. Tambin tendrn cabida los profesores que se quieran involucrar
en este proyecto. Est equipo ser el encargado de disear las acciones
formativas, establecer las prioridades sobre las actitudes y conocimientos,
desarrollar el proyecto, evaluarlo y presentar un informe de resultados.
El punto de vista de los alumnos, con sus diferentes condiciones
personales, econmicas, sociales, etc. Ellos son los destinatarios de la accin
formativa por lo que tendremos que tenerlos en cuenta desde el principio, ya
que sino se involucran en l, su realizacin no tiene ningn sentido.
Por ultimo y no menos importantes los padres. Como pilar fundamental
de la formacin integral de sus hijos y como ltimos sufridores de los posibles
consecuencias negativas que una mala educacin sexual puede tener para sus
hijos, embarazos no deseados, enfermedades de transmisin sexual, etc.
Una forma de abordar esta accin formativa seria la realizacin de
talleres especficos sobre los problemas que los alumnos, padres y profesores,
crean ms importantes.
La mejor forma para poder detectar las necesidades educativas que
puede tener nuestro alumnado es a travs de cuestionarios directos sobre sus
comportamientos sexuales, sus conocimientos sexuales y por ultimo una
propuesta abierta de proposicin de dudas que puedan tener en torno al sexo.
- 162 -

www.enfoqueseducativos.es

Una vez analizados los cuestionarios y sus propuestas de preguntas,


pasamos a disear la accin formativa. El Grupo de Trabajo presentar la
accin al Equipo Directivo, para que posteriormente sea aprobado por el
Claustro y el Consejo Escolar, se incluya en el Proyecto curricular de centro.
Tras su aprobacin mantendremos una reunin con los padres y pasaremos a
realizar la intervencin y su posterior evaluacin.
Un ejemplo de una accin formativa seria el siguiente:
3. TITULO
Mtodos anticonceptivos, tipos, ventajas e inconvenientes de cada uno de
ellos, modo de empleo.
4. DESARROLLO.
Pasar dos cuestionarios uno relacionado con sus conocimientos acerca
de la sexualidad y otro acerca de sus conductas sexuales.
Escribir en un folio todas las preguntas relacionadas con el sexo que
quisieran que fueran respondidas.
Con todos estos datos nos ser ms fcil poder plantear tanto los
objetivos como los contenidos de las sesiones.
PRIMERA SESIN: Dividimos a los alumno por grupos de cinco y les
repartimos diferentes mtodos anticonceptivos, preservativos, diafragma, DIU,
espermicidas, pldoras anticonceptivas y pldora del da despus, les dejamos
unos minutos para que familiaricen con ellos, que los manipulen, antes de
explicar las caractersticas de cada uno de ellos y las ventajas y los
inconvenientes que tienen, analizando cada mtodo desde su doble funcin
evitar embarazos no deseados y prevenir la transmisin de enfermedades de
transmisin sexual.
SEGUNDA SESIN: En esta sesin nos centraremos en el preservativo
masculino. Explicaremos sus caractersticas, fiabilidad, modo de empleo y
retirada. Realizaremos simulaciones de colocacin y extraccin del
preservativo, con voluntarios tanto chicos como chicas.
TERCERA SESIN: Por ltimo explicamos todo lo relacionado con el ciclo
menstrual, la ovulacin y el riesgo tan grave que supone calificar de no frtiles
los das del periodo, o los inmediatamente anteriores y posteriores. Y
establecemos una ronda de preguntas para que no se queden en el tintero
ninguna duda de lo expuesto en las sesiones anteriores.

- 163 -

www.enfoqueseducativos.es

CMO FUNCIONA LA COMUNICACIN EN LA MENTE DEL


CONSUMIDOR?
Mara Moral Moral

I- INTRODUCCIN
La importancia de conocer, qu es lo que pasa por la mente del consumidor a la hora
de adquirir un producto, es de gran inters para cualquier empresa, debido a que le
permite disear de un modo ms efectivo y eficiente su poltica de comunicacin y
publicidad. Adems, de determinar qu caractersticas o atributos del producto son ms
relevantes o proporcionan un mayor valor aadido al cliente.
Por ello, es importante conocer cul ha sido la evolucin de los Modelos de
Comunicacin desarrollados hasta nuestros das, prestando especial atencin al
Modelo de Cuadrcula (FCB) desarrollado por Vaughn.
Hay que tener presente que dichos modelos no son ms que una gua de orientacin de
los procesos que intervienen en la decisin de compra de un individuo, ya que,
prcticamente es imposible determinar perfectamente, todos los factores o variables
que pueden intervenir debido a su carcter social.

II- EVOLUCIN DE LOS MODELOS DE COMUNICACIN


La evolucin de los modelos de comunicacin ha atravesado por diferentes fases:
1- En un primer momento, se desarrollaron los modelos de caja negra, que
trataban de estudiar los efectos de la publicidad sin tener en cuenta el procesamiento
interno que se produce en la mente del consumidor, de ah el nombre de caja negra.
2- Posteriormente, se evolucion hacia el Modelo Cognitivo ( C ), basado en la
idea de que el consumidor procesa toda la informacin o los argumentos positivos o
negativos que recibe, de modo que los mismos, son los elementos que persuaden y
llevan a la intencin de compra, sin la influencia de otros elementos que no sean los
puramente cognitivos o racionales.
3- Sin embargo, en una tercera etapa el Modelo Afectivo (A) plantea
simplemente que la publicidad slo genera unos sentimientos o emociones en el
consumidor, provocando un afecto que lleva a la intencin de compra sin el
procesamiento de argumentos racionales, es decir, la simple exposicin a unos
estmulos es la que nos lleva a la accin.
4- La unin del Modelo Cognitivo y Afectivo, dio lugar a los Modelos
Persuasivos de Jerarqua (CA) basados en la idea de que el comportamiento o la futura
accin del consumidor esta condicionada, tanto por elementos cognitivos como
afectivos, conduciendo a diferentes modelos de procesamiento, donde la idea central
de todos ellos, es que las personas responden a los mensajes siguiendo un orden
secuencial:
- Primero es necesario informar.
- En segundo lugar, crear sentimientos o actitudes favorables, que den
como resultado un comportamiento dirigido a la intencin de compra.
- 165 -

www.enfoqueseducativos.es

La principal limitacin de estos modelos, es que fruto de diversas investigaciones se


ha demostrado que los consumidores no siempre siguen la secuencia descrita, y por
ltimo, no todos los individuos procesan la informacin del mismo modo.
5- Los Modelos Dinmicos de Post-eleccin (CEA), introduce la idea de que
las actitudes pueden conformarse despus de la compra, y la informacin procedente
de la publicidad puede combinarse con nuestra propia experiencia, conformando unas
actitudes mucho ms fuertes y persistentes en el tiempo. A diferencia del modelo
anterior, ahora se introduce el efecto de la experiencia.
6- Y en ltimo lugar, los Modelos Integradores (CAEA), los cuales paso a
explicar ms ampliamente en el siguiente apartado.
III- MODELOS INTEGRADORES (CAEA): Concepto y Clases
El objeto de estos modelos es integrar los Modelos de Jerarqua (CA) y los Modelos de
Post-eleccin (CEA). Parten de la premisa de que la publicidad puede generar un
comportamiento ya sea antes y/o despus de que el individuo pruebe el producto o
servicio, y por tanto, adquiera una experiencia.
El modelo integrado propone unos patrones de respuesta cuando el individuo es
expuesto a la publicidad:
- Secuencia de Conocimiento- Afecto- Comportamiento: coincide con el
modelo tradicional de jerarqua de efectos.
- Secuencia de Conocimiento - Experiencia o prueba - Afecto Comportamiento
- Secuencia de Conocimiento - Experiencia Experiencia..
Dentro de los mismos existe una tipologa de dos modelos:
1- Modelo integrado de repuesta (Smith y Swiyard, 1982): este modelo sugiere que el
grado de aceptacin de la informacin contenida en un mensaje, la creacin de
actitudes, comportamientos, depende en buena medida, de la fuente de informacin
utilizada por el individuo.
La aportacin principal de este modelo es considerar que la publicidad genera un
grado de aceptacin del mensaje bajo, cuando sta es la fuente de informacin que el
individuo utiliza. Ese reducido nivel de aceptacin conlleva a que el individuo busque
fuentes de informacin alternativas con las que apoyar las decisiones tomadas. De este
modo se puede encontrar:
- Individuos no interesados en el producto, es decir poseen una baja
implicacin hacia el mismo, donde las creencias o actitudes fuertes hacia la
marca sern creadas por medio de la experiencia, con la prueba del producto
tras un determinado nmero de ocasiones.
-Individuo est interesado, siente curiosidad, es decir, se encuentra realmente
implicado con el producto o servicio anunciado, las actitudes y creencias se
formarn rpidamente basadas en la experiencia de la prueba o bien por el
contenido de la informaciones recogidas por diversas fuentes.
- 166 -

www.enfoqueseducativos.es

Para aquellos productos de compra rutinaria o bien aquellos cuyo coste para el
consumidor no es muy elevado, la posibilidad de realizar una prueba, y por tanto, de
adquirir el producto ser mayor, de este modo, la influencia y efectos de la publicidad
sern ms significativos que en aquellos bienes con un alto precio, de compra menos
habitual, ya que las consecuencias de una decisin equivocada son fciles de reparar
por el individuo, simplemente no volviendo a comprarlo la prxima vez que visite el
establecimiento.
Una vez que el individuo ha probado el producto, el grado de aceptacin, de
conformidad con el contenido del mensaje, ser elevado, llevando a la preferencia por
la marca o producto en cuestin, conduciendo de este modo, hacia un compromiso de
compra, sin embargo si los efectos de esa experiencia son negativos, desencadenaran
efectos totalmente contrarios y perjudiciales para los intereses de la empresa.
Como novedad este modelo considera la prueba del producto como un procedimiento
de recogida de informacin del individuo, a travs del cual podamos, valorar el grado
de aceptacin y de adecuacin a las necesidades manifestadas por los consumidores,
permitiendo introducir las mejoras oportunas.
En ltimo lugar, el Modelo de Cuadrcula FCB (Vaughn, 1980,1986), el cual paso a
desarrollar a continuacin ms ampliamente.

IV- EL MODELO DE CUADRCULA (FCB): Un Anlisis en Profundidad


La finalidad de este modelo, al igual que la de los diferentes modelos que he
desarrollado hasta el momento, es la de contribuir a una mayor comprensin de las
diferentes opciones a la hora de planificar, crear, aplicar y controlar las acciones del
marketing y en particular, de la publicidad.
El modelo integra las tradicionales teoras expuestas anteriormente, con una teora en
la cual el grado de involucracin del individuo es variable, es decir el individuo,
aprende unos conocimientos, siente emociones o impulsos y por ltimo, acta, en
ingls, Learn - Feel - Do (FCB), de ah el nombre o iniciales del modelo.
De este modo, Vaughn propuso la construccin de la siguiente matriz, con cuatro
cuadrantes, existiendo dos variables:
- El grado de motivacin del individuo en el procesamiento de la informacin
si se trata de un individuo puramente cognoscitivo o bien guiado por
emociones ( pensamiento- sentimental).
- El grado de implicacin o involucracin con el producto o servicio, el cual
depender en gran medida de la complejidad o importancia que para el
individuo tenga el mismo.
La combinacin de esas variables da lugar a la siguiente matriz:

Alta implicacin
Baja implicacin

Pensamiento

Sentimiento

Pensador
Hacedor

Afectivo
Reactor

- 167 -

www.enfoqueseducativos.es

Se puede observar como la parte izquierda se encarga de una funcin cognitiva, como
propona los Modelos Cognitivos ( C ), mientras que la parte derecha del grfico se
ocupa de una funcin afectiva o sentimental, Modelos Afectivos (A), sin embargo se
introduce como variable el grado de implicacin del individuo.
La matriz anterior permite establecer cuatro estrategias:
1- Estrategia informativa: esta implica facilitar un alto grado de informacin ya
que, el producto o servicio en cuestin es de una alta implicacin e importancia,
como podra tratarse la adquisicin de un coche y adems, se trata de un
consumidor denominado como pensador, es decir, es reflexivo, analiza cada
uno de los argumentos que le llega, estudia los aspectos positivos y negativos del
producto, para finalmente llevar a cabo una decisin completamente razonada y
argumentada.
2- Estrategia afectiva: la decisin sobre el producto es puramente sentimental o
emocional, se trata de individuos movidos por las emociones, modas, deseo de
pertenencia a un grupo de referencia, por el placer, son los denominados
consumidores sentimentales, no basan sus decisiones en argumentos lgicos,
sino en los impulsos que reciben cuando son objeto de un estmulo, por ejemplo
una imagen o la msica impactante de un spot, la presencia de un famoso en un
anuncio. Ello conlleva que el individuo fcilmente cambie de producto,
podremos cambiar la actitud sin necesidad profundizar en las cualidades del
producto, simplemente destacando aquella que resulte ms atractiva para un
individuo o colectivo.
3- Estrategia de formacin de hbitos: el individuo es cognitivo, se mueve por
argumentos convincentes y slidos, de este modo, a pesar de tratarse de
productos con una baja implicacin, las decisiones son tomadas en base a unas
convicciones que pueden estar basadas en conocimientos previos a la compra,
proveniente de terceros o a la propia experiencia fruto de la prueba del producto.
Si el producto es del agrado del consumidor y responde a sus expectativas, se
crear un vnculo fuerte basado en argumentos racionales que sern difcilmente
modificables, ya que este individuo no atender a mensajes superficiales y sin
contenido, sino que si la decisin de compra final se decanta hacia la
competencia, ser porque nuestro producto es inferior o bien, porque no se
adecua a las exigencias del cliente.
El consumidor en este modelo, es denominado activo, la estrategia de
comunicacin ir dirigida a recordar el producto, el valor de la marca que puede
ser de gran ayuda para crear un hbito y una lealtad hacia la compaa, se podra
resumir la idea de esta estrategia en que el objetivo es Hacer - Conocer - Sentir
(Do - Learn Feel).
4- Estrategia de satisfaccin o hedonista: en este tipo de estrategia el objetivo
es diferente del expuesto anteriormente, ahora ser Hacer - Sentir - Conocer (Do
- Feel - Learn). El individuo se mueve exclusivamente por el placer o
satisfaccin personal que le confiere el consumo del producto, mientras que los
argumentos racionales no intervienen para nada en el procesamiento que realiza
- 168 -

www.enfoqueseducativos.es

de la informacin. El consumidor recibe el nombre de reactor, solo reacciona o


acta hacia aquellos bienes o servicios que le proporcionan placer o bienestar, su
consumo esta limitado en el tiempo, se trata de productos de baja implicacin, de
compra rutinaria, de bajo coste en algunos casos, como podran ser el tabaco, las
bebidas, golosinas, etc.
La estrategia de comunicacin en este caso ira dirigida a captar la atencin del
consumidor, con mensajes tentadores adaptados convenientemente en funcin
del pblico objetivo, perodo del ao, etc.
En conclusin, este modelo tiene la peculiaridad de afirmar que las decisiones se
establecen en funcin del conocimiento, emociones e implicaciones que posea cada
individuo dando lugar a procesamientos especficos.

V- CONCLUSIONES Y APORTACIONES DEL MODELO DE CUADRCULA


Entre las principales aportaciones que supone el desarrollo del Modelo de Cuadrcula
de Vaughn se encuentra:
- Ayuda en el establecimiento de una clasificacin de las diferentes opiniones,
preferencias, del consumidor teniendo en cuenta una serie de categoras de productos.
- Permite estimular la realizacin de preguntas e hiptesis sobre opciones de
investigacin de los productos bajo un contexto competitivo.
- Podemos considerar el acto de compra como emocional, racional, etc,
pudiendo de este modo realizar sugerencias y afirmaciones ms persuasivas y
convincentes.
- Es posible la elaboracin de mapas de productos clasificndolos segn la
matriz expuesta anteriormente, debiendo reclasificar los productos cada cierto tiempo
debido al cambio en ciclo de vida de los mismos.
En resumen, el procesamiento de la informacin que realiza cada individuo es
complejo y difcil de determinar a priori, por tanto, slo es posible establecer unas
lneas en torno a las cuales suponemos que desarrollar el proceso de decisin.
Este modelo de Vaughn, abre la posibilidad a una profundizacin del mismo,
evaluando esas categoras de productos y procesamientos que los individuos realizan
en funcin del pas, grupo social, cultura, etc, de modo que podamos conocer al detalle
todo aquello que condiciona las decisiones de compra.
VI- BIBLIOGRAFA
Barry, T.E. y Howard, D.J: A review and critique of the hierarchy of effects in
advertising, International Journal of Advertising, 9,2, 1990.
Bech, George E. & Bech, Michel A: Publicidada y promocin: perspectiva de la
comunicacin de Marketing Integral. Ed: Mc Graw-Hill
Bign, E. (2003). Promocin comercial. Esic editorial, Madrid.
Duncan; Moriarty: A communication-based
relationships
Journal of Marketing; Apr 1998; 62, 2

marketing

- 169 -

www.enfoqueseducativos.es

model

for

managing

Greenwald; Leavitt: Audience Involvement in Advertising: Four Levels. Journal of


Consumer Research, Junio 1984.
Maclnnis, Moorman, & Jaworski: Enhancing and Measuring Consumers Motivation,
Opportunity, and Ability to Process Brand Information From Ads. Journal of Marketing
Oct 1991.
MacKenzie, Scott B., The Role of Attitude Toward the Ad as a Mediator of Advertising
Effectiveness: A Test of Competing Explanations , Journal of Marketing Research,
Mayo 1986.
Reid: Performance Auditing Of Integrated Marketing Communication (IMC) Actions
And Outcomens. Journal of Advertising, vol. 34, no. 4 2005.
Reid, Luxton, & Mavondo: The Relationship Between Integrated Marketing
Communication, Market Orientation, And Brand Orientation. Journal of Advertising,
vol. 34, no. 4, 2005.
Smith, R.E. y Swinyard, W: Information response models: an integrated approach,
Journal of Marketing, 46, invierno, 1982.
Vakratsas; Ambler: How advertising works: What do we really know?. Journal of
Marketing; Junio 1999.
Vaughn (1980): How Advertising Works: A planning Model. Journal of Advertising
Research, 5 Oct 1980.
Vaugnh (1988): How Advertising Works: A planning Model Revisited. Journal of
Advertising Research, Feb/Marz 1988.

- 170 -

www.enfoqueseducativos.es

EL PAPEL DEL AUDITOR EN LA LEY CONCURSAL


Mara Moral Moral

I- INTRODUCCIN
La Ley Concursal 22/2003 de 9 de Julio, pretende romper con la inadecuacin de la
legislacin a la realidad social y econmica de nuestro tiempo, recogiendo en un solo
texto legal los aspectos materiales y procesales del concurso, sin ms expcepcin de
aquellas normas que por su naturaleza han exigido el rango de ley rganica.
La unidad del procedimiento de concurso se consigue gracias a la flexibilidad que la ley
lo dota, lo cual, permite su adecuacin a diversas situaciones llevando a la satisfaccin
de los acreedores, finalidad esencial del concurso.
La declaracin de concurso proceder en caso de insolvencia del deudor comn.
Si se produce tal declaracin, durante el concurso los administradores concursales estn
legitimados para ejercer las acciones de responsabilidad contra los administradores,
auditores y liquidadores, sin necesidad de previo acuerdo de la junta o asamblea de
socios.
Las funciones y competencias que la Ley les otorga es fundamental para el correcto
desarrollo del procedemiento y para la satisfaccin de todas las partes que intervienen
en el mismo.

II- COMPOSICIN DE LA AMINISTRACIN CONCURSAL


La administracin concursal, con carcter general, estar integrada, segn se establece
en el art. 27, por:
1. un abogado con experiencia profesional de, al menos, cinco aos de ejercicio
efectivo.
La presencia de un abogado en la administracin concursal ha sido recibida
con elogios por los Colegios de Abogados y por parte de la doctrina, por
considerar que aunque el concurso tiene como base un hecho econmico, no
es menos cierto que se trata de un proceso judicial en el cual son precisos los
conocimientos jurdicos para contribuir a agilizar y garantizar la buena
marcha del mismo; sin embargo es criticada por algunos sectores, y por otra
parte de la doctrina que no encuentra justificada la poltica legislativa
seguida para ello, ya que el ejercicio profesional de cinco aos no garantiza
en absoluto conocimientos especiales en esta materia (a pesar de que en el
punto tercero del mismo artculo se seala que estos profesionales
acreditarn en todo caso su compromiso de formacin en la materia
concursal), en el proceso ya intervienen profesionales del derecho como los
letrados de las partes, el Ministerio Fiscal, el Secretario Judicial, y sobre
todo el Juez altamente especializado, al menos en teora.

2. un auditor de cuentas, economista o titulado mercantil colegiados, con


una experiencia profesional de, al menos, cinco aos de ejercicio efectivo.

- 171 -

www.enfoqueseducativos.es

Es decir, un profesional especializado en materia econmica, un profesional


econmico; pero dado que estos profesionales, pueden pertenecer a distintas
titulaciones oficiales, y que pueden estar colegiados o no, la ley es ms
amplia en este tema. Cita, con carcter expreso, tres profesionales:
Auditores de cuentas, economistas y titulados mercantiles, donde la
situacin
puede ser distinta para cada uno de los
profesionales citados.
Respecto a los auditores de cuentas, la Ley Concursal (art. 27.p.3) dice
que sern los que hayan manifestado su disponibilidad para el desempeo
de tal funcin al Registro oficial de auditores de cuentas, por lo que slo
quienes sean auditores de cuentas inscritos en el Registro oficial formarn
parte de las listas que ste mandar al juzgado mercantil, y en las que
obviamente slo constarn los auditores con cinco aos de ejercicio
profesional, y que certificar el propio Registro.
Respecto a lo que la ley denomina economistas, no parece posible que
sea una lista cerrada, pues para estar colegiado, se ha de estar en posesin de
algunos de los siguientes ttulos de doctor o licenciado en: Ciencias Polticas
y Econmicas (Seccin de Economa), Ciencias Polticas, Econmicas y
Comerciales (Seccin de Econmicas y Comerciales), Ciencias Econmicas
y Empresariales, Administracin y Direccin de Empresas, Ciencias
Actuariales y Financieras, Economa, e Investigacin y Tcnicas de
Mercado; por lo que lgicamente si cualquier de estos titulados no
nombrados expresamente en la Ley Concursal estn colegiados en el
Colegio de Economistas, o pueden estarlo, tambin podrn formar parte de
la administracin concursal como profesionales econmicos.
En cuanto a los titulados mercantiles, el problema se plante en la
tramitacin parlamentaria de la ley, pues en el Proyecto se haca referencia
al profesor mercantil, siendo sustituida por la alusin ms amplia de
titulado mercantil colegiado. Para estar colegiado, segn el Colegio Central
de Titulados mercantiles y empresariales se puede ser: perito, profesor o
intendente mercantil, actuario de seguros, diplomado o licenciado en
ciencias empresariales, o licenciado en administracin de empresas. Quienes
tradicionalmente han actuado como expertos contables han sido los titulares
mercantiles desde 1922, aunque desde 1988 tambin se haban incorporado,
a travs de las intervenciones judiciales de empresas en suspensin de
pagos, los auditores de cuentas, stos con el objeto de verificar la imagen
fiel del patrimonio y la verdadera situacin financiera de las empresas.
La redaccin de este art. 27 no es clara, y deja amplio margen a cualquier
tipo de interpretacin sobre la confeccin de las listas de estos profesionales;
pero no en el caso de que se trate de un auditor de cuentas. Pero adems, no
seala en qu supuestos el Juez escoger uno de estos profesionales, o si
luego se unificarn las listas, o en qu orden se escoger una determinada
lista, y dentro de ellas, cual ser el orden a seguir. No se duda de la
imparcialidad del Juez, pero los criterios o las normas bsicas deberan
haber sido establecidas con mayor concrecin.
- 172 -

www.enfoqueseducativos.es

3. un acreedor que sea titular de un crdito ordinario o con privilegio general,


que no est garantizado, a quin nombrar el Juez tan pronto le conste la
existencia de acreedores con tales condiciones.
Una incompatibilidad, que ha de tenerse en cuenta es que el acreedor no
podr ser competidor del concursado ni formar parte de un grupo de
empresas en el que figure entidad competidora, pues se trata de carcter
propio del acreedor.

FUNCIONES Y COMPETENCIAS DEL AUDITOR


1. Facultades que complementan, o sustituyen, a las del deudor
En el supuesto de intervencin, la administracin concursal tendr que autorizar o dar su
conformidad a los actos del deudor, y en el caso de suspensin del deudor en el uso de
sus facultades de administracin y disposicin sobre el patrimonio, la administracin
concursal tomar directamente las decisiones.
Dentro de estas facultades podramos diferenciar:
a) Gestin del patrimonio, reguladas en los artculos del 42 al 72. Entre los que
se recogen por ejemplo en el art 46: la obligacin de supervisin y formulacin de las
cuentas anuales.
b) Ejercicio en un proceso judicial de cualquier clase, recogidas en algunos
artculos de la Ley como Artculo 40 en el que figura el derecho a solicitar el cambio de
situacin de intervencin o suspensin de las facultades del deudor.

2. Facultades como administradores y liquidadores del patrimonio del deudor


El Ttulo IV de la ley se titula Del informe de la administracin concursal y de la
determinacin de las masas activa y pasiva del concurso, en referencia clara al acto
central y ms importante de la administracin concursal.
Este informe se presentar en el plazo de dos meses desde que se acepte el cargo,
aunque el juez puede ampliar el plazo en un mes basado en circunstancias
extraordinarias, y su estructura est legalmente establecida en el art. 75.
La estructura del informe ser la siguiente:
1. Anlisis de los datos y circunstancias del deudor:
Con el objeto de cumplimentar lo dispuesto en este precepto, la
Administracin Concursal deber exponer, como primer punto de su
informe, un anlisis sobre los datos aportados por el deudor en el momento
de solicitar el concurso, esto es la Memoria expresiva de la historia
econmica y jurdica del deudor, de la actividad o actividades a que se haya
dedicado durante los tres ltimos aos y de los establecimientos, oficinas y
explotaciones de que sea titular, de las causas del estado en que se encuentra
- 173 -

www.enfoqueseducativos.es

y de las valoraciones y propuestas sobre la viabilidad patrimonial. El


artculo 75 habla de anlisis y no de opinin que es lo que requera el
artculo 8 de la Ley de Suspensin de Pagos de 1922 y, por consiguiente, los
Administradores debern realizar un examen de los datos aportados por la
concursada en su solicitud, pero no emitir una opinin sobre los mismos.
2. Estado de la contabilidad del deudor y, en su caso, juicio sobre las cuentas,
estados financieros, informes y memoria.
La misin de los Administradores en esta parte del informe se circunscribe
a manifestar su opinin sobre la llevanza de la contabilidad por parte del
deudor concursado, mostrando su opinin si se ajusta o no al Plan General
de Contabilidad y a los Principios de Contabilidad Generalmente
Aceptados; el procedimiento seguido en cuanto a la tenencia de Libros; los
Libros Oficiales que se llevan en la Compaa y si se ajustan a lo dispuesto
en los artculos 25 y siguientes del vigente Cdigo de Comercio;
El estado de la contabilidad de ejercicios anterioresLas cuentas anuales; los informes de gestin y de las auditoras, en su
caso, correspondientes a los tres ltimos ejercicios, con un espacial nfasis
en el ltimo ejercicio.
Juicio sobre las cuentas; los estados financieros y los informes
contenidos en la Memoria y, asimismo, sobre los cambios patrimoniales
significativos operados con posterioridad a las ltimas cuentas anuales
formuladas y presentadas y sobre aquellas operaciones que por su
naturaleza, objeto o cuanta, excedan del giro o trfico ordinario del deudor.
En definitiva, lo que la Ley Concursal exige en este apartado del informe es
que los Administradores Concursales expongan su opinin sobre el criterio
que les merecen los comentarios que el concursado hace al presentar la
solicitud que se le declare en concurso y que resulten de la documentacin
aportada en cumplimiento de lo dispuesto en el artculo 6, apartado 3.
El nico inconveniente de estas obligaciones impuestas a los
Administradores Concursales es la falta de tiempo para realizar una labor
tan ingente en la primera fase del procedimiento, hasta que se presenta el
informe.
3. Memoria de las principales decisiones y actuaciones de la Administracin
Concursal.
El extremo tercero del informe tiene por objeto explicar las principales
decisiones que ha tomado la Administracin Concursal y de que manera las
ha adoptado; cuantas de ellas han sido ejecutadas o estn a punto de ello y
los resultados obtenidos.
Se inicia la Memoria con la exposicin de la fecha en que los
Administradores Concursales aceptaron el cargo y tomaron posesin del
mismo, trasladndose a la Empresa para iniciar su labor; aperturar las
cuentas; circularizar a los acreedores para que comuniquen sus crditos; dar
las instrucciones a la entidad concursada en orden a su funcionamiento, a fin

- 174 -

www.enfoqueseducativos.es

de que se ajusten a las normas del concurso, en su actuacin; principales


decisiones adoptadas, etc.
La importancia de esta Memoria est en que, mediante ella, se puede
conocer la actividad desplegada por la Administracin Concursal tanto en la
propia administracin como en la gestin del patrimonio; problemas que han
debido solventar; decisiones importantes adoptadas y si stas se han tomado
de forma unnime por los Administradores o ha habido disidencias, lo que
puede tener trascendencia a la hora de asumir responsabilidades.
En esta Memoria se expondr lo que la Administracin Concursal ha hecho,
lo que est haciendo y las medidas adoptadas y acciones realizadas para
procurar la continuidad en la Empresa concursada, si ello es posible.
4. Conclusiones y Exposicin Motivada.
La Administracin Concursal cerrar esta parte del informe con unas
conclusiones, mediante exposicin motivada, relativas a la Memoria
aportada; a la situacin patrimonial del deudor; a las propuestas sobre
viabilidad patrimonial y, en su caso, al Convenio y a los datos y
circunstancias que pudieran ser relevantes para la ulterior tramitacin del
concurso.
En sntesis, el informe de la Administracin Concursal debe comprender los
siguientes extremos:
1. Anlisis de la Memoria presentada por el deudor, con la solicitud del
concurso.
2. Anlisis de las Cuentas Anuales de los tres ltimos ejercicios y de los
estados financieros, as como del estado de la contabilidad.
3. Formulacin de las cuentas anuales si no lo hubiera hecho el deudor.
4. Memoria de la Administracin Concursal sobre actuaciones y decisiones
adoptadas.
5. Exposicin motivada de la Administracin Concursal sobre situacin
patrimonial, continuidad y, en su caso, convenio, as como datos y
circunstancias relevantes.
6. Documentacin complementaria: Inventario del Activo y Lista de
Acreedores.

BIBLIOGRAFA
- Ley Concursal 22/2003, de 9 de Julio.
- La Administracin Concursal en la nueva Ley 22/2003, de 9 de julio. Boletn
del Ilustre Colegio de Abogados de Madrid.Octubre 2005 3.a poca N.o 31
- Cuentas Anuales de la Sociedad Concursada e Informe de la Administracin
Concursal. Corporate Convernance Conflicts And Corporate Insolvency: II Harvard
Complutense Seminar on Business Law. Carmen Pastor Sempre.
- 175 -

www.enfoqueseducativos.es

- La Adminstracin Concursal. Publicacin del Centro de Estudios Jurdicos ao


2004. M Asuncin Barrio Calle.
- La Nueva Ley Concursal: Aproximacin prctica a las novedades de la Ley
concursal. Jos Manuel Calavia Molinero Catedrtico de Derecho Mercantil Universitat
de Barcelona "MAZARS & ASOCIADOS; ABOGADOS Y ASESORES FISCALES,
S.L." Septiembre 2004.
- Responsabilidad de la administracin Concursal. Ponencia deRicardo de Angel
Ygez 5 Congreso Nacional de la Asociacin Espaola de abogados especializados en
responsabilidad civil y seguro. Noviembre 2005.

- 176 -

www.enfoqueseducativos.es

EL SOFTWARE LIBRE: EL VALOR DE SU DIFUSIN


Mara Moral Moral

La evolucin experimentada en el campo de las Nuevas Tecnologas ha llevado al


desarrollo de numerosas aplicaciones, programas, equipos, pero sobretodo destaca la
aparicin de un software alternativo, popularizado entre los internautas por su
gratuitidad y libertad de uso, rompiendo as, el monopolio establecido por las grandes
compaas como Microsoft, se trata del Software Libre.
Software Libre se refiere a la libertad de los usuarios para ejecutar, copiar, distribuir,
estudiar, cambiar y mejorar el software. De modo ms preciso, se refiere a cuatro
libertades de los usuarios del software:
1- La libertad de usar el programa, con cualquier propsito.
2- La libertad de estudiar el funcionamiento del programa, y adaptarlo a las
necesidades. El
acceso al cdigo fuente es una condicin previa para esto.
3- La libertad de distribuir copias, con lo que puede ayudar a otros.
4- La libertad de mejorar el programa y hacer pblicas las mejoras, de modo que
toda la comunidad se beneficie.
En este sentido hay que destacar, que la cooperacin existente entre los usuarios de
Software Libre es uno de los pilares de este software. Existen comunidades virtuales por
todo el mundo dedicadas a ayudar y a colaborar contiunamente con los usuarios ms
inexpertos, as como a difundir este tipo de software y desarrollar continuamente
mejoras y nuevas utilidades para el mismo.
Entre las ventajas que presenta este tipo de software se encuentran las siguientes:
1- No tiene ningn coste para el usuario.
2- Libertad de uso y de instalacin.
3- Independencia tecnolgica.
4- Soporte y compatibilidad a largo plazo.
5- Existencia de formatos estndar. Evitando la aparicin de incompatibilidades
entre versiones.
6- Mayor nmero de aplicaciones y utilidades.
7- Actualizaciones y mejoras del software continuas.
8- Adaptacin a las necesidades del usuario.
En cuanto a los inconvenientes existentes son los siguientes:
1-Dificultad inicial para una persona con conocimientos limitados de
informtica.
2- Excaso apoyo tcnico de los fabricantes de hardware para que sus dispositivos
funcionen con este software, siendo cada vez menos frecuente ya que las empresas se
estn interesando en el software libre.
3- Incompatibilidades derivadas del funcionamiento de drivers u otras
aplicaciones.
4- Idioma: la mayora de documentacin tcnica se encuenta en ingls, aunque
existen trabajos como el Proyecto Lucas para la traduccin de los mismos.
- 177 -

www.enfoqueseducativos.es

5- Baja difusin y uso por parte del usuario medio.


6- Percepcin de una mayor complejidad en su uso y en la resolucin de
problemas.
Sin embargo, a pesar de las importantes ventajas que para el usuario existen, su difusin
y conocimiento por la mayora de internautas es todava reducida. No tenemos ms que
preguntar a cualquier amigo o conocido, si lo ha utilizado alguna vez, siendo la
situacin ms habitual la del total desconocimiento.
Ese desconocimiento ha llevado a que la utilizacin de este software sea an escasa.
Existe una alta percepcin de que se encuentra dirigido hacia usuarios expertos o
avanzados, su configuracin puede representar algn problema pero los avances y
desarrollos realizados han llevado a una reduccin de su complejidad, incrementando
ampliamente el nmero de aplicaciones y utilidades en relacin al sistema operativo
Windows.
Por ello, uno de los principales puntos donde la Administracin Educativa debe incidir
con carcter prioritario, es la difusin del uso y conocimiento del Software Libre. Los
mismos valores que impregnan todo el sistema educativo tales como la cooperacin, la
difusin del conocimiento, el afn de superacin, de investigacin y de mejora, han
llevado a constituir los origenes de la filosofa del Software Libre, sustentado su
desarrollo en la colaboracin desinteresada de toda la comunidad internatua.
Otra de las razones, por la que su conocimiento el alumnado es importante, se debe, a la
creciente utilizacin que se producir en un futuro no muy lejano del mismo, no slo
por la Administracin Pblica que ya lo esta utilizando, sino tambin por las entidades
empresariales y sociales de nuestro pas.
En un mundo cada vez ms competitivo y globalizado, las empresas se encuentran ante
la prioridad de ser ms eficientes y eficaces en sus procesos productivos. El Software
Libre supone una herramienta idnea para ganar en competitividad.
El ahorro en costes es vital si queremos ser competitivos y destacar frente a nuestro
rival, y el Software Libre representa aquella arma eficaza para afrontar los nuevos retos
de competitivadad. Por ello, a pesar de que en algunas organizaciones esta siendo poco
explotada en un futuro se presume que sea ampliamente utilizada.
En consecuencia, ante un panorama donde el uso y utilizacin del Software Libre ser
cada vez mayor, es necesario que como usuarios prestemos la debida atencin al
aprendizaje y dominio de este tipo de software, superando el natural miedo del ser
humano a lo desconocido.

Bibliografa:
www.gnu.org
www.cnice.es
www.guadalines.org
www.softwarelibre.net
www.libroblanco.com
www.mityc.es/DGDSI/Servicios/Software
- 178 -

www.enfoqueseducativos.es

Nmero 2 noviembre -2007


JOSEFAMOLINAFERNANDEZ

DNI:26234714V

HABILIDADESINTEGRADAS:
Ladefinicinquepodemosdarleaesteconjuntodehabilidadespuedeserlasiguiente:
Lacombinacindedosomshabilidadcomunicativasdentrodeunamismatarea.
Utilizando este mtodo podemos hacer que el estudiante se aproxime ms a la vida
real, donde se integran todas las habilidades comunicativas. Aparte de esto cabe
mencionarlosiguiente:
9
9
9
9
9
9

Continuidad.
Realismo.
Aproximacin.
Variedad.
Reciclamiento.
Confianza.

Lamayoradelascombinacionesdehabilidadesejemplificanelusodepresentaruna
habilidadreceptivainterpretativaantesdepediralosestudiantesqueproduzcanalgo,
es decir, proporcionar comprenhensible input antes de pedirles que produzcan
algn output. En este sentido es aconsejable para el listening que antes hayan
hechounspeakingounreadingoinclusounwritting.
SUGERENCIASPRCTICAS:
Algunas combinaciones tiles de dos habilidades comunicativas pueden ser las
siguientes:
9
9
9
9
9

Listeningyspeaking.
listeningyreading.
readingywritting.
speakingywritting.
listeningywritting.

Siqueremoscombinarmsdedoshabilidadesalgunasmastilesson:
9
9
9
9

speaking/reading/writting/speaking.
listening/writting/speaking/writting
reading/writting/listening/speaking.
listening/speaking/reading/writting.
BIBLIOGRAFIA: READ, C (1985). INTEGRATING THE SKILLS IN
MATTHEWS,AETAL.(EDS).
www.enfoqueseducativos.es

180

Nmero 2 noviembre -2007

JOSEFAMOLINAFERNANDEZ

DNI:26234714V

SENECA:UNAHERRAMIENTAMUYUTIL:

Seneca es la aplicacin que la consejera de Educacin de la Junta de Andaluca ha


desarrollado para que los profesores puedan hacer la gestin administrativa de
nuestralabordocente.
Seneca puede ser usado por todo tipo de centros: de primaria, de secundaria, de
adultos o de educacin en rgimen especial. Tambin puede ser usado por los
profesores,equiposdirectivos,elpersonaldeadministracin
QuPODEMOSHACERENSENECA?

Introducirnuestrohorario.
Ponerlascalificacionesdenuestrosalumnos.
Emitirlosboletinesdenotas.
Faltasdeasistenciaalaclase.
Emitirlosinformesdefaltasdeasistencia.
Comportamientolosalumnos.
Diversidad.
Integracin.

Pero no solo podemos introducir estos datos, sino que todo el que desee puede
conectarse y consultar esta informacin: otros profesores, padres o los propios
alumnos.
COMOACCEDEMOSASENECA?
nicamente deberemos tener un ordenador con acceso a internet, un navegador
comofirefoxomozilla.
No es necesario saberse la direccin de sneca ya que se encuentra dentro de la
pginawebdelajuntadeAndalucaypodemosaccederaellamedianteenlaces.

www.enfoqueseducativos.es

181

Nmero 2 noviembre -2007


Setratadeunaherramientamuytilparalacontinuainformacindepadres,elnico
inconvenienteeselteneraccesoalanuevatecnologas.
www.juntadeandalucia.es/educacion/seneca.

www.enfoqueseducativos.es

182

Nmero 2 noviembre -2007

JOSEFAMOLINAFERNANDEZ

DNI:26234714V

TECNICASANTESDELWRITTING:

Algunastcnicasquepodemosllevaracaboantesdeempezarunaactividadbasadaen
elwrittingpuedenserlassiguientes:
9 Lluviadeideas:
Puedeseroraloescrita,tambinengruposoindividual.Elpropsitoeshacer
quelosestudiantespienseneneltemapormediodepreguntasosimplemente
diciendoalgunaideaconectadaconeltema.
9 Looping: escribir sin parar. Despus de escribir un rato se para, reflexiona y
resumeloquehaescritoencadafrase.Estaactividadpermiteconcentrarseen
elcontenidoyolvidarsedelaforma,almenostemporalmente.
9 Cubing: nos aproximamos al tema desde seis puntos de vista: descripcin,
comparacin,asociacin,anlisis,aplicacinyargumentacin.
9 Classical invention: muy relacionado con el cubing. Temas/objetos/palabras
sondefinidasycomparadasconotras.
9 Debatinganddiscussing:presentaroralmentelosdosargumentosdeuntema
enparejasoengrupos.
9 Experiencingthetopics:visitandolugaresantesdeescribirsobreellosohablar
sobreexperienciaspersonalesenrelacinconeltema.
9 Fantasizing/mediating/mindtransportation:pensarlibrementesobreeltema.
9 Lecturing
9 Reading.
BIBLIOGRAFIA:
BYRNE,D.(1988).MODERNENGLISHPUBLICATION.LOMGMAN.
READ,C.(1985).INTEGRATINGTHESKILLS.MATTHEWS.

www.enfoqueseducativos.es

183

Nmero 2 noviembre -2007

ANAB.TUNLPEZ
DNI:26.485.972T

PORQUESONLOSIDIOMSYMETAFORASTANIMPORTANTES?

Losidiomsylasmetforassonunapartemuyimportantedeunidiomayeneste
caso del ingls. Y son importantes, porque son muy comunes y aparecen en cualquier
conversacincotidiana,encualquiertexto,etc.
Alseralgotanusual,ytancomn,losjvenesalumnosdebenaprenderdeformagradual.
Nodebedejarsesoloparaalumnosquetenganunnivelaltodeingls,sinoquedebeirse
aprendiendopocoapoco.Sernecesariograduarlosidiomsyelegirlosmsfcilesde
recordar para los alumnos principiantes dejando los ms complejos para aquellos que
tienenunmayorconocimientodelingls.

Tambin es obvio que los peridicos y ciertos libros utilizan muy a menudo
metforas,porejemplo:TimeismoneyquerespondeclaramentealpatrnAesB.Las
metforas son un recurso literario que consiste en la identificacin de un elemento con
otro,yaseaporquetienenunparecidooporcualquierotrarelacin.

Cuando un alumno aprende este tipo de construcciones en otro idioma, por


ejemplo en ingls su conocimiento del idioma es ms realista y se asemeja ms al que
utilizan los nativos. El ingls de este alumna/o sonar ms natural cuantos ms idioms
conozcaycuandoseacapazdeexpresarmetforasquelosnativosutilizannormalmente.

BIBLIOGRAFIA:WRIGHT,T(2.000).IdiomsOrganise.LanguageEnglishPublications.

www.enfoqueseducativos.es

184

Nmero 2 noviembre -2007

ANABELNTUNLPEZ
26485972T

ALGUNASCONDICIONESPARAELAPRENDIZAJEDEUNALENGUAEXTRANJERA

Adems de las teoras de Piaget sobre el aprendizaje es necesario destacar


otras ideas que son muy importantes en el proceso de aprendizaje de una lengua
extranjera.

Algunasdelascaractersticasatenerencuentadelosindividuosquequieren
aprenderotrolenguasonlaedad,elconocimientodelalengua,factoresquetienen
queverconelaprendizaje,factoressocialesyafectivos,capacidadlingsticadeL1y
L2, necesidades e intereses y para finalizar su aptitud y motivacin a la hora de
aprenderunalenguaextranjera.

SegnLenneberg,hayunaedadhastalaquelosniossoncapacesdeaprender
de manera eficiente una lengua (factores biolgicos). l pone como lmite los trece
aosyaseguraqueapartirdeesafechalosniospierdenplasticidadparaaprender.
Conestaprdidaaprenderunalenguaextranjerasehacemsdifcil.

Tambinlasnecesidadesdecadanio/personaporaprenderesdistinta.Noes
lomismoalguienquederepentecambiadepasportrabajoyseveinmersoenotra
culturaylanecesidadimperiosadeaprenderesalenguatanrpidocomoseaposible
queaquellosalumnosqueestudianunalenguaextranjeradurantealgunashorasala
semanaperoluegocontinanconsuvida(utilizandosulenguamaterna).

Otro punto vital es el inters que el individuo tenga por la lengua extranjera.
Nios, adolescentes y adultos tienen intereses diferentes. Por ejemplo los
adolescentes estn ms interesados en deportes, msica, y entretenimiento pero
tambin en las relaciones personales y en actividades competitivas. Pocos valorarn
(msalldeunasbuenasvacaciones)laoportunidaddeaprenderypracticarlalengua
extranjerahastaquenopasealgntiempoyseconviertanenadultos.

El ltimo punto a tener en cuenta que voy a desarrollar en este artculo es


aptitud. Segn Stern (1983), l distingue tres tipos de aptitudes a la hora del
aprendizaje: la aptitud hacia la comunidad y las personas que hablan el idioma
extranjero, aptitudes hacia la lengua que va a estudiarse y en tercer lugar la aptitud
haciaelaprendizajedeidiomasperotambinhacialosidiomas.

Todoslostemasquehecitadoalprincipiodeesteensayosonimportantespero
yosloheseleccionadoalgunosdeellosparadesarrollarlosbrevementeaqu.Yolos
he elegido porque la motivacin es algo que influye positivamente en el aprendizaje
peronotienenadaquever,porejemplo,conlahabilidadolacapacidaddeaprender
idiomas (que puede considerarse ms o menos innato segn los investigadores que
consultemos).

MCLAREN,N.&MADRID,D.(1996)AHandbookforTEFL.Marfil
www.enfoqueseducativos.es

185

Nmero 2 noviembre -2007

ANABELNTUNLPEZ
26.485.972T

EUFEMISMOSYPALABRASCOLOQUIALESREFERIDASALASDROGAENINGLS

Antes de empezar este ensayo, me gustara resaltar mi sorpresa mientras llevaba


acaboesteartculo,elgrannmerodepalabraseningls,yaseabritnicooamericano
referidas a las drogas. Algunas veces se trata de eufemismos mientras que en otros
casossonpalabrasqueseutilizandeformacoloquial.

Laprimerapalabraesanfetamina(eninglsamphetamine).Lapalabra
coloquialesampperoademsheencontradoAcomoabreviaturapara
anfetamina.
El trmino Abomb hace referencia a un cigarrillo de mariguana que
tambincontieneheronauopio.
AcapulcogoldotambinAcapulcoserefiererefierealamariguanade
altacalidadcultivadaenMjico.
AcidHead es un trmino que designa a alguien que toma droga L.S.D.
regularmenteyqueestfrecuentementebajosuinfluencia.
Angieyangelsonpalabrasparadenominarlacocaina.
Artillery man se refiere a un drogadicto que se inyecta directamente
narcticosenvena.
Ashes,babyytambinmarisontrminoscoloquialesparamariguana.
Banjitambinserefierealamariguanaperosedicequeesunapabraque
provienedeunidiomaafricano.
Author es un drogadicto conocido por poder escribir prescripciones
aceptablescomomediodeobtenerdrogas.Lomismoparascribe.
Backedupytallseutilizanparaalguienintoxicadoporlasdrogas.
Badtripdesignaunamalaexperienciacondrogas.(Seampliaacualquier
malaexperiencia).Generalmenteseempleaensituacionescoloquiales.
Bagman es un trmino para un vendedor de mariguana o de drogas
ilcitas.
Ball significa en sentido coloquial absorber narcticos a travs de las
membranasdelosgenitales.
Bamdesignaunamezcladebarbitricosyanfetaminas.
Bamboozled, banjaxed, basted, batted, battered intoxicado por
elalcohol.
Bangarefeer,fumaruncigarrillodemariguana.
Barbesunapastillaocpsuladebarbitricos.Normalmenteseutilizaen
plural. Otros sinnimos para esta palabra son blockbuster blunt,
candy,greendragon,marshmallowreds,kingkongpills,etc.

www.enfoqueseducativos.es

187

Nmero 2 noviembre -2007


Estos son algunos de los trminos que he encontrado referidos a tipos de
drogas, drogadictos y abusos de drogas incluido el alcohol. Debido a la gran
especificacin y el gran nmero de palabras desarrollaren otro artculo otra
partedemiinvestigacin.

SPEARS,RICHARDA.(1991)SlangandEuphemism.Penguin

www.enfoqueseducativos.es

188

Nmero 2 noviembre -2007

ANAB.TUNLOPEZ
26.485972T

ESCRIBIRCONUNPROPSITO

Cuando pedimos a nuestros alumnos que escriban una redaccin muchos de ellos
confesaranquenosabendequescribir.Ungrannmerodealumnospordiferentes
razones o por su inexperiencia se concentrara en terminarlo de cualquier manera.
Para conseguir motivarlos y que escriban es necesario cambiar la idea que los
estudiantestienendeestahabilidad.

En primer lugar es necesario dirigir la atencin de los estudiantes a pensar


durante unos momentos como deben escribir, por ejemplo que tiempos verbales
necesitarn, el campo semntico, etc. y como organizar sus ideas. Esto es un paso
definitivoparaqueenelfuturoseancapacesdeseguirsupropiopatrnalescribiruna
redaccin.Losprofesoresdebenevitardecirasusestudiantesquedebenonodeben
hacerduranteesteproceso.Lomsimportanteesquelosalumnosaprendanahacerlo
y que confen en esta manera de trabajo, para que en el futuro tengan xito en sus
clasesoencualquierotraactividadquenecesiteutilizarsuescritura.

Para evitar que los estudiantes se sientan frustrados en este proceso, los
profesores debemos recomendarles hacer un borrador que les ayude a organizar las
ideasysuestructura.

Solo cuando los alumnos dominen un patrn para escribir se sentirn ms


segurosdesimismosynoestarntanpreocupadosporlanotaquevanaobtenerysi
condisfrutarconelensayoquevanaescribir

Bibliografa: HUNT D. ( 1984 ) Teaching with a Purpose University of Missouri,


ColumbiaHougronMifflinCompany,Boston.

www.enfoqueseducativos.es

189

Nmero 2 noviembre -2007

ANABELNTUNLPEZ
26.485.972T

EUFEMISMOSYPALABRASCOLOQUIALESREFERIDASALASDROGAENINGLS(II).

Comocontinuacinaunartculoanteriordelmismonombrepretendoseguir
enumerando y explicando muchos de los trminos empleados para referirse a
drogas,drogadictoseintoxicaciones.

Bewitched significa intoxicado por alcohol. Se utiliza especialmente en


Estados Unidos y es una expresin que se utilizaba ya a principios de
1700shastalaactualidad.
Big bloke es cocaina. Es una forma coloquial que en ingls rima con
coke.SeempleaenEstadosUnidosenlosbajosfondosyenelmundo
delasdrogas.Tambinconelmismosignificadoblortyboogerjuice.
Bigdaddyesuntrminocoloquialparaherona.
BigHotambinbigHarryserefierealaherona
BigOybrownstuffsontrminosquehacenreferenciaalopio.
Bingoed , que sufre una intoxicacin de alcohol, que ha bebido
demasiadobingo.AbitonseusaenGranBretaayenEstadosUnidos
en1800s1900s.
Birdwood, mariguana. Se utiliza desde mediados de 1990s en Estados
Unidos.
Blocked se utiliza tanto en Estados Unidos como en Gran Bretaa y
designaunaintoxicacinporalcoholopordrogas.Tambinboxedup.
Blomboll es un trmino coloquial britnico que significa borracho. Se
empleabaen1800s.Tambinblottersignificaborrachoyseempleen
Estado Unidos hasta 1990s.Otros trminos con este significado son
bombed,drunkard,buffyandbrewster.
Blue acid designa la droga denominada L.S.D. Se sigue utilizando en
nuestros das. Tiene el mismo significado blue cheer y la expresin
provienedelnombredeunamarcadedetergentequetenaestecolor.
Bodypackaging hace referencia a una prctica de contrabando de
cocanaenlaqueelindividuosetrabaunnmerodepequeospaquetes
envueltosengomaparaposteriormentevomitarlasodefecarlasdespus
decruzarlafrontera.
Bombo hace referencia a un vino barato. Expresin coloquial
australiana.
Broccoliesunnombrecuriosoparalamariguana.Sigueutilizndoseen
laactualidad.
Brown rine se utiliza para la herona. Posiblemente como rima para
heroine.Seutilizabaaprincipiosde1900s.
Bulljivehacereferenciaalamariguanademalacalidad.Seutilizabaen
1900senEstadosUnidos.
www.enfoqueseducativos.es

190

Nmero 2 noviembre -2007


Bummer designa una mala experiencia con las drogas. Sigue
utilizndosehoyendaenEstadosUnidos.

Antesdefinalizaresteartculomegustaraindicarquetodosestostrminos
expuestos aqu y la primera parte son slo una pequea porcin de la
inmensacantidaddepalabrasreferidasaestetema.

SPEARS,RICHARDA.(1991)SlangandEuphemismPenguin

www.enfoqueseducativos.es

191

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEADNI:11801891Q

BREVEHISTORIA.EDUCACINDELOSNIOSSORDOS.

Lasteorasmsmodernasmencionanqueellenguajeo,almenos,elinstintode
comunicacin es una caracterstica innata en todo ser humano. De hecho, mucho
antesdequeexistieseellenguajehablado,loshombresprimitivosyasecomunicaban
pormediodegestos,sonidosyotrossignos.

Nuestraespeciefueevolucionandoysuformadecomunicartambin.Aparecila
palabrayquienessiguieronutilizandolasseascomolenguanaturalfueronlossordos
ylosmudos.Aristtelesdecaquelenguajeyhablaeranunamismacosa.Segnl,la
sordera era sinnimo de falta de inteligencia. Incluso la Iglesia crea que el sordo no
tenaalma.

HastafinalesdelsigloXVInohubounapersonaquesepreocuparapblicamente
delaspersonassordas.QuienfinalmentelohizofueelmdicoGirolamoCardano.En
el mismo siglo Pedro Ponce de Len sigui los estudios de Cardano. Ms tarde
apareci Juan Pablo Benet, que enriqueci y desarroll el mtodo; hasta llegar a
figuras claves como Laurent Clerc (maestro sordo de sordos en Francia) y Thomas
Gallaudet(EstadosUnidos).AmbosunieronsusrecursosyfundaronlaUniversidadde
Gallaudet en 1864, que fue la primera y nica universidad del mundo para personas
consordera.

Tendremosqueestardeacuerdoqueelprincipalelementoeducadoreslafamilia
yaqueesenelsenofamiliardondeseaprendenhbitosbsicos,dondeseempiezaa
socializar el ser humano, pero ellos solos sin la atencin especializada que pueda
guiarlesparaayudaralaspersonascondiscapacidadauditivapuedeserunautntico
fracaso.

La educacin especializada requiere de un primer estudio o evaluacin, que, en


este caso va a ser muy difcil de conseguir; ya que el nio sin haber tenido contacto
con especialistas utilizar formas de expresin alternativas, que quizs pasen
desapercibidas para el profesor. No obstante, es primordial el plantearse unos
objetivosymediosclarosparalograrunaeducacinespecializadaexitosa:

www.enfoqueseducativos.es

192

Nmero 2 noviembre -2007


a) Lasanticipaciones.stassonfundamentalesparaindicaralapersonasordaqu
vaapasar.
b) Instruccindentrodeunarutina.
c) Actividadesconuninicioyfinclaros.
d) Instruccinsecuenciada.
e) Proveeralalumnodeexperienciasprcticasenambientesnaturales.
f) Utilizarelmaterialadecuadoparacadacaso.

Encuantoalosmediosoelmaterial,tenemoselLenguajedesignos(LSE)cuyos
objetivosson:
o Expresarseconmensajescortos,sonmsfcilesdeentender.
o Comprendermensajessencillos.
o Comunicarse para tener un conocimiento de las necesidades de la
comunidadsorda.

Lacolocacindelosalumnosenlaclaseessiempremuyimportante,perocuando
existaunalumnoquenecesiteutilizarlaLSEparaentenderse,losalumnosdebern
situarseenlaclasedemodoquepuedanverseentodomomentoysobretodoal
profesor.

Referenciasbibliogrficas:

CharlesMorris(2003)MorrisSignosLenguajeyConducta.
MariaAngelesRodrguezGonzalez(1992)Lenguajedesignos.
http://www.faqmac.com

www.enfoqueseducativos.es

193

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA11.801.891Q

COMOMEJORARLAATENCINENNUESTROSALUMNOS.

Antesdenadadeberamosempezarpordefinirqueconsideramosporatencin,
es la capacidad que permite a un individuo concentrarse en la ejecucin de una
actividaddirigidaaconseguirunobjetivo.Cuandounalumnopresentaunnivelbajode
atencinconcentracinpuedeserporalgunadeestascausas:

1. Elalumnonorecibeestmulosapropiados
2. Faltademotivacinhacialaactividad,bienporquenolegusta,bienporqueel
ambientequelerodeaespropicioparanoatender.
3. Algntipodealteracincerebral,conlocualestaramoshablandodeunnio
conNecesidadesEducativasEspeciales.

Mevoyacentrarenlasdosprimerasdondesetienenquedarciertascondiciones
paraqueseproduzcaunniveldeatencinadecuado:

Descanso.
Oxigenacin.
Estimulacin.

Eldescanso,esuntemaenelquelosprofesores,nopodemosinfluirdirectamente.
Sonlospadreslosquedebenplantearunhorariodetrabajoydescansoparasushijos
consensuadoentreambaspartes.Paraconcienciarlosdeello,seroportunohaceruna
brevereseaenlosprimeroscontactosconlospadres.

www.enfoqueseducativos.es

194

Nmero 2 noviembre -2007


Ya existen casos de centros y profesores que utilizan tcnicas de relajacin para
captarlaatencindesusalumnos.Estastcnicassebasanprincipalmenteenelcontrol
de la respiracin y la correccin postural. Esto no slo les valdra para mejorar su
atencin sino para poder controlar otros tipos de situaciones que les puedan causar
ansiedad.

Cuando se trate de una actividad que exija mucha concentracin es aconsejable


dividirlaenpartesparaquesepuedanintercalarbrevesdescansosyasnocansaralos
alumnos.

Porltimo,sedeberaintentarenloposible,eliminartodoslosestmulosquesean
irrelevantesparalarealizacindelatareaencuestin.

Algunosejerciciosdeatencinconcentracinpodranser:

Ejerciciosdediscriminacinvisual.
Completarfrases.
Sinnimosantnimos.
Juegosdememoria.
Localizarobjetos.
Localizarcaractersticas,etc.

Para llevar a cabo esta actividad debe existir un procedimiento y un


entrenamiento:

El profesor realiza la tarea dando las instrucciones en voz alta para que el
alumnolassiga,esconvenientequeellosmismosselasrepitanparaasinteriorizarlas
haciendounaautoinstruccinquelesllevaradarserefuerzoellosmismosdeltipode:
Estoyamesale
correctoases
Este entrenamiento junto con el elogio del profesor, que siempre es bien
acogido,ayudaaeliminarlafaltadeatencinenlosalumnosqueeselmotivoprincipal
deobtenermalosresultadosacadmicos.
www.enfoqueseducativos.es

195

Nmero 2 noviembre -2007


Referencias:

www.educa.aragob.es
LeyvaSanjun,P.(2007)Juegosdeatencin,juegosdeinteligencia.
JuliaGarcia,(2006)Mejorarlaatencindelnio

www.enfoqueseducativos.es

196

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA11.801.891Q

COMOSUPERARLAANSIEDADENLOSEXAMENES

Cuantas veces no hemos dicho o hemos odo de nuestros compaeros o


alumnos,mehepuestotannervios@quemehequedadobloquead@,peroquees
enrealidad,nerviosoansiedadporverelresultado,pornosaberquevaapasar.Este
es un trastorno frecuente que padece un 20% de estudiantes de niveles medios y
superiores, el cual influye negativamente en los resultados y por supuesto en el
rendimiento.

Si consideramos que es la ansiedad, ese ponerse nervioso, es una reaccin


normalysana.Todoelmundolaexperimentaencircunstanciasdepeligro,exmenes
tantoescritoscomoespecialmenteoralesoenmomentosdepreocupacin.

Enestassituacionesnuestroorganismosedispara,empezamosarespirarcon
dificultad,nossudanlasmanos,nostiemblalavoz,elcoraznpalpitamsrpidodelo
normalyestoseempeoracuandopensamosquepodemosfracasar,entoncestodoes
peor.

Pero en realidad es una defensa de nuestro organismo. La ansiedad es una


activacin o aceleracin del organismo que daas una respuesta adecuada antealgo
quelapersonaentiendecomopeligroso.Estaactivacines,aveces,unaventaja,pues
prepara para la accin y reaccin rpida si fuera necesario. Siempre y cuando los
nivelesdeansiedadseanmoderados,sinoesasytenemosunnivelaltodeansiedad
nos provocar una sensacin de malestar, dolor de cabeza o de estmago,
palpitaciones,tensin,quenotienenbasefisiolgica,sinopsicolgica.

www.enfoqueseducativos.es

197

Nmero 2 noviembre -2007


Comosegeneralaansiedaddependedelareaccindecadaunadelaspersonasa
lasdistintassituacionesquenospodamosenfrentar,peronormalmenteesatravsde
trescanalesderespuesta:
Mediantelospropiospensamientoquealimentanlarespuestadeansiedad:
mequedarenblancoenelexamen
seguroquesuspendoelexamen
novoyapoderdecirloquetengoquedecir
Pordiversossistemasfisiolgicos:
Sudoracin.
Palpitaciones.
Sensacindenudoenelestmago.
Tensinenelcuelloyespalda.
Temblorenlaspiernas
Medianteunarespuestamotoraodeconducta:
Movimientosrepetitivosdeobjetoscomobolgrafos,anillos.
Tenerquecomerdulces,especialmentechocolate.
Evitar hacer un examen no presentndose o buscando excusas
paranohacerlo.
Comerselasuasymuchasotrasquepodramosnombrar.

Qupodemoshacerparacontrolarlasituacin?

1. Conocercualessonlospensamientosquenosabordan,sabercualesson
lasrespuestaquenuestroorganismodaalosmismosmediantenuestro
sistemafisiolgicoyculesnuestrarespuestamotoraoconductual.
2. Escribirloquesucedeenlostresaspectos.
3. Establecidaslascoordenadastenemosqueactuarfrenteaellas.
4. Actuaciones:
a. Mesientocomopienso,soyloquepienso,porlotantodesechar
lospensamientosnegativosycatastrofistas.
b. Centrarlaatencinenelexamenoaquelloquenospreocupay
producelaansiedad.
c. No compararnos con los compaeros, cada uno tiene sus
cualidades.
d. Repetirse a s mismo que es normal estar nervioso, que la
tranquilidadllegarenunosinstantes.
e. Dedicar el tiempo y la atencin necesaria a comprender
preguntas.Avecesserespondemalpornohaberledobien.
f. Darseautoinstruccionespositivas.
g. Haceralgntipodeejercicioderelajacin.
www.enfoqueseducativos.es

198

h.
i.
j.
k.

Nmero 2 noviembre -2007


Practicaralgndeporte.
Controlarlarespiracin.Hacerejerciciosderespiracinventral.
Pasear.
Desarrollarelautocontrol.

Pero lo ms importante de todo es tener claro que hemos estudiado, que


hemospreparadonuestroexamenaconcienciayqueconocemosbieneltemario.As
losnerviosylaansiedaddesaparecenmsrpidamente.

Referencias:
AnaMuoz,(2006)Autoterapia:Guaparasanarlasemociones
StephenArterburn,(2006)Takecontrolofwhatscontrollingyou:aguidetopersonal
freedom.
www.comosuperarlaansiedad.com

www.enfoqueseducativos.es

199

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA11.801.891Q

CONSIDERACIONESATENERENCUENTA

En el proceso didctico el elemento central es CMO actuar, ensear y


aprender. Se establecen bases inherentes a la actividad docente tales como la
racionalidad, planificacin y eficacia. Donde se plantean los objetivos de aprendizaje
enlosqueanalizarelcmo.

El docente entre otras habilidades debe distinguir el significado de actividad,


mtodo,tcnica,estrategiayprocedimiento.Fundamentarracionalmenteelmtodo,
conocerestrategiasydisearlas,teniendociertasprecisionesconceptuales,comoson
los trminos referidos al proceso didctico en su totalidad (mediacin: referida al
profesor, contenidos de la enseanza, mediacin mediada, interaccin y
comunicacin) o los trminos que hacen referencia a un elemento del proceso
didctico(actividad,tareayprocedimiento,mtodo,estrategia).

Losprincipiosmetdicosdelaaccindidcticaempiezanconladeterminacin
delmtodo,estaeslaoperacinmsimportante.Lametodologadidcticaesjustificar
racionalmente el mtodo. Despus tendramos la adecuacin de la finalidad, la
adecuacin del alumno partiendo del nivel de desarrollo cognitivo y promoviendo
aprendizajes significativos mediante la adecuacin del contenido y el contexto. El
enfoque didctico debe incluir contenidos sociales y fomentar el aprendizaje
socializado.

Lasestrategiasdidcticasparaabordarlostemasconlamayoreficaciaposible
variarn si estn enfocadas al profesor, al alumno, al contenido o al contexto. Las
estrategiasreferidasalprofesorson:
a. Estrategiassegnsufuncinenelprocesodidctico.
i. Prepararelcontextooambientedeaprendizaje.
ii. Informaralosalumnossobrelosobjetivos.
iii. Centrarymantenerlaatencin.
iv. Presentarlainformacin.
v. Organizarlosrecursos.
vi. Disearlasrelacionesdecomunicacin.
b. Tcnicasenlasqueelprofesoreselcentrodeatencin.(estrategiasdocentes)
www.enfoqueseducativos.es

200

Nmero 2 noviembre -2007


i. Enseanzadirecta.
ii. Enseanzarecproca,discusinprofesoralumnoyrazonamiento.
c. Estrategiasexpositivas:directamenterelacionadasconelprofesor:
i. Elresumen.
ii. Larepeticin.
iii. Lafocalizacin.
iv. Laclarificacin.
v. Laspreguntas:niveldedificultad,mododepresentacin.
d. Objetivosaconseguirconlautilizacindelatcnicaadecuada.
i. Objetivosreferidosalcontenido.
ii. Objetivosreferidosalalumno.
e. Condicionesparaqueestaestrategiadidcticaseaeficaz.
i. Niveldedesarrollodelalumno.
ii. Promoverlamotivacindelalumno.
iii. Promoverlaaplicacinprctica.
iv. Adecuarlaestructuradelcontenido.
Las estrategias referidas al alumno: adaptacin de las estrategias de enseanza a las
caractersticasdelaprendiz.
En el modelo cognitivo se han diseado dos tipos de estrategias: cognitivas y
metacognitivas.
a. Estrategiasdelenfoquecognitivo:
i. Resolucindeproblemas.
ii. Autoinstruccin.
iii. Autogestindelaprendizaje.
iv. Pensamientoenvozalta.
b. Estrategiasdelaprendizaje:
i. Estrategiasparaobteneryelaborarinformacin:plandetrabajo,
estrategiadelectura,estrategiasdeescucha.
ii. Estrategiasparafijaryretenerlainformacin.
iii. Estrategiasparareproduciroexponerlainformacin.
c. Estrategiasreferidasalcontenido.
i. Actividadesrelacionadasconelcontenidodeaprendizaje.
ii. Estrategiasorecursosdidcticosdeaprendizaje.
1. Esquemaconceptual.
2. Redessemnticasoconceptuales.
3. Mapascognitivosoconceptuales.
iii. Procedimientosdeenseanza:Inductivos,deductivos,analticos
ysintticos.
d. Estrategias referidas al contexto. Dentro del contexto, el centro de atencin
son las relaciones entre los agentes del proceso didctico, esto es profesor,
alumno y alumnos entre s. La dimensin social de estas estrategias es su
caractersticadiferencial.
i. Modalidades de las estrategias referidas al contexto: tutora
entrecompaerosyelaprendizajeengrupocooperativo.
www.enfoqueseducativos.es

201

Nmero 2 noviembre -2007


ii. Segnlaimplicacindelalumnoseproducenmodificacionesen
el rendimiento acadmico que afecta a diversos factores
cognitivos.
iii. Estrategiasdecolaboracin.
iv. Estrategias relacionadas con el desarrollo del aprendizaje:
actividadesderegulacinydeorganizacin.

Estas estrategias debern tenerse en cuenta a la hora de realizar la


planificacindelcursoescolarporpartedelosprofesores,poresoestanimportantela
preparacin del profesor, el conocimiento de las cualidades de los alumnos, el
contenidoyporsupuesto,elcontextoquerodeaatodalasituacin.

Referenciasbibliogrficas:

ClaudiomouraCastro,AimeeVerdisco2004.Comomejorarlaeducacin.
MarleneD.Lefever.2005.Estilosdeaprendizaje.
BettyOsman.2004.Problemasdeaprendizaje.

www.enfoqueseducativos.es

202

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA.DNI:1180189Q

EDUCACIONPARALASALUD.UNTEMATRANSVERSAL

Desde principios del siglo XX la salud ha sido un tema que se ha intentado


introducir en la escuela pero sobre todo se ha hecho en el rea de Ciencias y desde
entonces se pretenda incluir la higiene, la sexualidad, efectos de las drogas como el
alcoholylosnarcticosolaprevencindeenfermedades.

A mediados de siglo XX la OMS defini la salud como el estado de completo


bienestar fsico mental y social y no slo la ausencia de enfermedades. Es en este
momentocuandodaungirolaformadetratarlasaludenlaescuela,porqueyano
ofrecesolamenteinformacinsinoquelesofrecelaspautasparaquepuedanelegirlas
quemslesinteresenparasuformadevida.Laescuelacambiaentresdimensiones
con respecto a la salud: social, la forma de relacionarse los miembros que la
componen.Fsica,lainfraestructuraesmuyimportanteenelentorno.Ypsquica,que
serefierealclimaoambientequeserespiraenelaula.

Todas las asignaturas estn programadas con contenidos transversales, que


recogenunconjuntodeactitudesyfuncionesqueabordantodotipodeproblemas.No
secienaunasoladisciplinasinoquerelacionanatodasellasconlaconsecucinde
unmismoobjetivo.

LacartadeOttawa,1986,sobrelosderechosyobligacionesparaaumentarel
controlsobrelasaludymejorarlasebaseenestascincoestrategias:

Desarrollarprogramasqueapoyenlasalud.
Crearentornosfavorecedoresdelasalud
Desarrollarlasaptitudesylosrecursosindividuales.
Reforzarlaaccincomunitaria
Orientaralosserviciosdesalud.
www.enfoqueseducativos.es

203

Nmero 2 noviembre -2007


La declaracin de Yakarta realizada en 1997, confirma estas estrategias pero
ademsaadelossiguientesenfoques:
Esmseficazhacerunenfoqueglobalparaeldesarrollodelasalud.
Teneroportunidadesparasuaplicacinenescenariosadecuados.
Participacindelaspersonasesesencial.
Laeducacinesnecesariaparaconseguirlaparticipacin.
El concepto de escuela para la salud acepta estas estrategias y fija entre sus
objetivosprincipales:
Desarrollarlasaluddelalumnoysuentornofamiliarysocial.
Promulgaractitudesyconductassaludables.
Colaborarconlasmedidasestablecidassocialmente.
Cambiarciertoscomportamientosdainosoperjudiciales.
Estrecharlarelacinfamilia,escuelacomunidad.
Participar de manera activa en los proyectos comunitarios para
aumentarsueficacia
REFERENCIASBIBLIOGRFICAS:
o
o
o
o
o
o

LadeclaracindeYakarta1997
LacartadeOttawa,1986

www.enfoqueseducativos.es

204

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA11.801.891Q

GLOBALIZACIN,UNIDADESDIDCTICAS,BLOQUESDECONTENIDOS....

Uno de los mtodos ms estudiados y ms comentados es la globalizacin o


mtodo global. La renovacin didctica va a ir paralela al descubrimiento de las
potencialidades del nio, sin olvidar que l o ella son el punto central agente de su
aprendizajedebenllegarateneresaideaglobalconunagradacinqueenocasiones
parece incoherente pero que los docentes han demostrado que es absurdo ensear
exclusivamente por la va analtica y que no es coherente aislar nociones y materias
comosinohubieraningnnexoentreellos,estoesloqueproducelaGLOBALIZACIN.
Este mtodo se caracteriza por tener una articulacin psicolgica y no una
clasificacin lgica de este forma surge el principio de la concentracin. Todos los
mtodos tienen esta caracterstica en comn, pero entre todos ellos destaca LA
ESCUELADEDECROLYYLOSCENTROSDEINTERES.Decrolypartadelabasedequeel
mejor sitio para el aprendizaje era su propio entorno y que el nio no poda hacer
visiones analticas de todo sino que lo vea de forma globalizada, primero sncresis
(fusin de elementos) despus anlisis (divisin uno por uno) por ltimo sntesis
(construirunaunidad).
Decrolyensuestudioconlosniosanormalesdiferenci:
Centrosdeinters.
Articulacindeloscentrosdeinters.
Ladidcticadeloscentrosdeinters.
Valordeloscentrosdeinters.
En este anlisis radica el xito de Decroly ya que el punto de partida didctico
sonaquellasnecesidadesqueafectanalserhumanocondeficienciaosinella,deun
modomsinmediato.
Devaudlecontraargumentabaconotraclasificacinporestimarquecarecade
sentidoespiritualista.
OtrosmtodosquesiguenlaspautasdeDecrolyson:
El Plan Morrison se desarrolla en EEUU, los principios que la rigen estn
basados en la comprensin cientfica de la naturaleza del educando, que
asimilatodoshomogneosynofragmentadosporellolaprimeratareadel
www.enfoqueseducativos.es

205

Nmero 2 noviembre -2007


docente es dividir el programa en unidades. Es totalmente anloga a los
centrosdecrolianos,conladiferenciadequeseaplicaalaescuelamedia.
The Lincoln School de la Columbia University (New York). Los principios
fundamentales eran dividir el programa en unidades de trabajo que se
correspondenprcticamenteconloscentrosdeinters.
Los complejos en la escuela sovitica, su carcter es polticosocial. La
escuela debe constituir una fuerza impulsora destinada a plantear
cotidianamenteanteeldiscentelacuestindesusrelacionesconlosdems
y a forzarlo a resolverla de un modo justo. Esta pedagoga pasa por la
escueladetrabajo,unaculturapolitcnicaconuncarcterproductivodonde
ensear y educar mediante el trabajo son la base de la vida escolar y la
esenciapedaggicasovitica.Yporltimollegamosalmtododecomplejos
que subrayaba la ciencia al servicio de la civilizacin proletaria. Colocaban
todoelcomplejodesaberensufuncinsocial,peronoenlaculturadela
personalidad.
Programa mnimo y plan septenal sugerido por Bouchet, asegura que
asimilamosconmsrapidezaquelloqueyaposeemos,ocurreasdebidoal
desarrollocontinuado,inherentealservivo.Seutilizaenlaescuelaprimaria
yseorganizaenuncicloseptenaldemodoanlogoalmtodoconcntrico.
Elniodesdeelprincipioconocelametaalaquetienequellegar,partirn
denocionesesencialesyellosdecidirnelordenyeltiempoadedicar.Esun
desarrollocrecienteyprogresivo.
La concentracin de las materias en la cole des roches creada por
socilogosfrancesesybasndoseenelhumanismosocial,entiendenquela
enseanzaliterariaesalgofundamental.ParacontestaralosPorqudelos
alumnos ven necesario el estudio previo del lugar donde un pueblo se
habaformado,despuslahistoriadeestepueblo,suhistoria,literaturaarte
etc.Esteenfoqueseutilizmsconlaescuelamedia,elementalosuperior.
Libro nico, maestro nico. Son dos acepciones que se pueden considerar
de distintas formas. El primero la que nos interesa es que se trata de un
textoguia que garantiza la adaptabilidad y se presenta con caractersticas
propias de una sana didctica, unificando las diversas materias. Por otro
lado el maestro nico se puede considerar para todas las materias de un
determinado curso de escolaridad (horizontal) o nico para todos los aos
deundeterminadogradodeenseanza

Esta breve visin a cerca de algunos mtodos utilizados, nos har hacer una
eleccincorrectaantenuestrasprogramacionesyantenuestrosfuturosalumnos.

Referenciasbibliogrficas:

ArielPennisi(2001),Laglobalizacin
www.enfoqueseducativos.es

206

Nmero 2 noviembre -2007


MyriamInesawadg.andMarcoRaulMejia,J.(2004).Educacinpopularhoy:en
tiemposdeglobalizacin.Paperback
MiguelSaez,(1996)Globalizacin,desarrollohumanoyeducacin

www.enfoqueseducativos.es

207

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA11.801.891Q

HORARIOS,ESFUERZO,RELACIONADOS?

Eltiempoescolarplanteaunconflicto,porunladolasreivindicacionesdelos
profesoresyporotroelplanteamientodeltiempocomoobstculoparaelcambio.

Considerandocualessonlaspeoresymejoreshorasdeldaparaeltrabajo,hay
estudios que determinan que la peor hora del da para el esfuerzo, es lo que
vulgarmente se ha llamado la siesta del carnero, es a ltima hora de la maana y la
segundapeoraprimerahoradelamaana.Asuveztambinseindicanlasmejores
horasquesonlasdemediamaanaylasdemediatarde.

Si pensamos en una organizacin, empresa o similar, nos encontramos que


todos buscan un mayor nmero de horas dedicadas a la misma con el fin de que se
puedan obtener mayores beneficios, llegando en algunos casos a la explotacin por
parte del empresario de los trabajadores. La misin de los centros de enseanza
obligatoriaalfinyalcaboessocializar,llevaralosalumnosdeltrabajodiscontinuoa
unaregularidad.Sinembargoapareceunaparadoja,queeslasiguiente,elcentrova
buscando la rigidez en cuanto al horario y trabajo, mientras que la sociedad va
buscandolaflexibilidadeneltiempodedicadoaltrabajo.

Estosucedeasenlasociedad,sitenemosencuentaquetodosdependemosde
todos,loscambiosvanainfluirenlafamiliaenloscentroseducativosyporsupuesto
enlasociedadlaboral.

Lafamiliahasufridograndescambiosencuantoasuestructura,noencuantoa
su relacin con el docente, sta sigue siendo la misma pero por distintas

www.enfoqueseducativos.es

208

Nmero 2 noviembre -2007


circunstancias. En un principio se deba a desconocimiento por parte de la familia
ahorasedebeafaltadetiempo.

Laestructurafamiliarhacambiadotantoensuformacomoensufondo,tiende
a la nuclearizacin, es ms pequea, puede ser monoparental y no busca el
relacionarse, sino por el contrario,el aislamiento. Se plantea la posibilidad de que el
pblicodependiendodelaescuelatomeladecisinsobrelaorganizacintemporal.

El profesorado como colectivo laboral busca una reduccin de tiempo de


trabajo con mayor provecho y menor esfuerzo y plantea una jornada matinal
basndoseenquedeesamanera,losniospasanmstiempoconsusfamiliasytienen
mstiempoparaactividadesextraescolares,perorealmentenoesloqueleconvienea
los alumnos. Se regulariza una situacin sin tener en cuenta las circunstancias del
alumno/a,como:
Suscapacidades.
Procedenciadediferentesfamilias.
Diferentesexperienciasvividas.
Distintasmotivaciones
Nos debemos preguntar entonces dnde queda el planteamiento que se hacen los
docentes que deben tener en cuenta lo ya aprendido, lo ya vivido para desde ese
puntocomenzarconelprocesodeenseanzaaprendizaje.

El tiempo escolar no es continuo y monotnico, slo interesa esa parte en la


queseaprendeyseensea,poresodebemosconsiderarquecuantomslargoesel
tiempo escolar, ms distendido es el trabajo escolar y viceversa, deberamos
centrarnosrealmenteeneltiempoqueinfluyealaeducacin:
Tiempodeclase.
Tiempodeinteraccinconelprofesor.
Depermanenciaenelcentro.
Detrabajoescolar.
Entornoalcentro.
Deaprendizaje.
Todo esto sin mezclar las necesidades de alumnos profesores familias, porque
cmo cambiamos la jornada del profesor sin modificar la del alumno. Habra que
buscarsolucionestalescomodividiralosalumnosporsusnecesidadesycapacidades,
introducir ms profesorado, flexibilizar la manera de ensear, pero entonces los
centroseducativosnopodransocializar,nopodranglobalizar,nopodranadiestrar.

www.enfoqueseducativos.es

209

Nmero 2 noviembre -2007

Los cambios horarios afectaran de una forma positiva a unos y negativa a


otros,perosiemprellegaramosalamismaconclusin,dependedelaimplicacinque
tengacadaunodelosmiembrosrelacionadosconelprocesoparaquelainfluenciasea
positivaonegativaenelcolectivoquealfinyalcabomsnosimportalosjvenesalos
quedebemosensearcomoexpertosenlaeducacin.

Referencias:
http://mallorcaweb.net/oce/oce02_03
BernabTiernoJimnez(1997)Delfracasoalxitoescolar.
http://wwweducoweb.com/tecnicasestudio

www.enfoqueseducativos.es

210

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA11.801.891Q

INFORMEPISA,UNAREALIDADPORLAQUEPASAMOSTODOS,OSLONMEROS.

D. Julio Carabaa catedrtico de Sociologa de la Educacin en la Universidad


Complutense, escribi para el peridico El Pas el 06/03/2006 El informe Pisa mala
guaparalaLOE.

Segnexplicaensuartculoexistenvarioserroressobreestosinformes:
1. Demuestranquenuestrosistemaesundesastre.
2. Esteinformeidentificalascausasdelasdiferenciasdelospases.
3. Sirvendeguaparalospolticos.

Segnelcatedrtico,estoserroressedebenanohacerunacorrectainterpretacin
delosnmeros:
LospasesdelaOCDEexceptoMxicoyTurquaposeenunosresultadoscercanosa
lamediaqueestsituadaen500,mientrasqueEspaasesituenel2000enel492de
media en lectura y en el 2003 en el 485 en matemticas. Pero estos nmeros son
promedios. Se pueden considerar como equivocados si miramos por autonomas,
dondeelPasVasco,CataluayCastillalenenel2003,seposicionaronporencimade
lamediaen15o20puntosyAndalucasesitapordebajoconunos470puntos.

EuropaPresspublicael4dediciembreLaJuntavinculaqueAndalucaseala
CCAApresentadaalPISAconpeoresresultadosasuretrasohistricoLaConsejera
deeducacinDCandidaMartinezvemejorableslosdatos,yreseaquelaLEAya
contienelasmedidasnecesariasparapodersolucionaresteproblema.

www.enfoqueseducativos.es

211

Nmero 2 noviembre -2007

LaspruebasPISAseaplicancada3aoselao2000fuesobrelectura,el2003
sobrematemticasyel2006sobreciencias,aunquetodosdebemosentenderquesi
fallalacomprensinlectoratodolodemsfallaalmismotiempo.

Losalumnosalosqueseleshacenestaspruebassonelegidosenfuncindesu
edad,15aos.PISAcontinuarelseguimientodurantelosaos2009,2012y2015.

Segn el Sr. Julio Carabaa no estamos a la cola sino al nivel medio de la


OCDE.Perolosresultadosandalucesestnahylosresultadosdenuestrosalumnos
tambin.Todostenemosqueponerdenuestraparte,padres,comunidadeseducativas
yalumnosparacambiaralaalzaestosresultados.

Referenciasbibliograficasyweb:
www.mec.es/mecd/gabipren/documentos/files/informeespaolpisa2006.pdf
www.ince.mec.es/oub/pubintn.htm50k
Elpais06/03/2007ElinformePisamalaguaparalaLOE.
LOE2/2007,3mayo.

www.enfoqueseducativos.es

212

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA.DNI:11801891Q

MAPASCONCEPTUALESHERRAMIENTASDEESTUDIO.

Quesunmapaconceptual?Seleconsideracomouninstrumentodeestudio
que puede representar el conocimiento de forma sencilla y prctica. Utiliza grafos o
dibujospararepresentarconclaridadmensajesconceptualesquepuedantenercierta
complejidad.

Este tipo de aprendizaje tiene sus comienzos en las Teoras de David Ausubel
basadasenelaprendizajesignificativoycoherenteelcualsebasaentresprincipios:

1. Conceptos claros y bien relacionados para que el alumno pueda ver con
claridadcualeslarelacindeunaideaconotra.
2. Dichos conceptos deben estar basados en los conocimientos previos del
alumno.
3. Esta forma de ver los temas puede ser motivadora para el aprendizaje del
alumno,ademsdeteneruncomponentevisualimportante.

www.enfoqueseducativos.es

213

Nmero 2 noviembre -2007


Aunquenotodaslaspersonastienenlamismacapacidaddesintetizarydecaptar
la idea ms importante de un tema junto con las secundarias, es una forma visual y
amenadeintentarlopocoapoco.

Una vez que nuestros alumnos ven positiva esta forma de aprendizaje, nuestra
tareaesponerasualcancetodoslosmediosposiblesparaquesealomsfructfera
posible. Primero tendremos que darles ciertas ideas de cmo hacer un mapa
conceptual:
1.
2.
3.
4.
5.
6.
7.
8.
9.

Identificarlasideasprincipalesylassecundarias.
Establecerlarelacinentreunasyotrassinrepetirlasenelmapa.
Determinarelordenjerrquicoentrelosconceptos.
Seleccionar las ideas que puedan tener el mismo valor y que por lo tanto se
encuentrenenelmismonivel.
Escribir sobre las lneas una palabra enlace que determine cul es la relacin
entrelosconceptos.
Insertar imgenes que puedan enriquecer el significado y entendimiento del
tema.
Inventarejemplosquepuedanaclararmslainformacin.
Utilizarcoloresqueestablezcandiferenciasentrelasrelaciones.
Representarlosconceptosdesdeelmsgeneralalmsconcreto.

Estetipodeherramientasepuedegenerarmanualmenteodeformaautomtica.
Existenprogramasparadicharealizacintalescomo:

http://www.knowledgemanager.it/
http://www.mindmapper.com/
http://freemindsourceforge.net/wiki/index.php/Main_page

Al utilizar este tipo de herramienta no slo estamos construyendo un


aprendizajesignificativosinoquetambinestamosintroduciendoanuestrosalumnos
enlasTICutilizadasparasupropioaprendizaje.

www.enfoqueseducativos.es

214

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA11.801.891Q

MULTICULTURALIDADENLASAULASQUPODEMOSHACER?

En estos ltimos tiempos nuestras aulas estn recibiendo un gran nmero de


alumnosprocedentesdediversospases.Familiasquevienenbuscandounlugarmejor
donde vivir, donde sus hijos puedan formarse y desarrollarse dentro de sus propias
costumbresyenlibertad.

Nuestros centros deben acogerlos de la mejor forma posible por ello, el equipo
tcnicodeCoordinacinPedaggicaeselencargadodehacerlaacogidaclidaaeste
tipodealumnado.Elprimerpuntoatenerencuentaeslacomunicacin.Paraello,se
solicitaunprofesordesulenguanativaytodoaquelmaterialquenospuedasertila
lahoradetransmitirleelconocimientoadecuado.

En el momento de la solicitud del profesorado nativo vendrn a hacer una


evaluacininicialsobreelconocimientodelespaolparaestablecerelnivel0,1,2,3.
En funcin de este anlisis se elaborar la propuesta de ATAL (Aulas Temporales de
AdaptacinLingstica)

Se les hace una evaluacin previa para determinar si existe otro tipo de
problemascomoretrasoensucompetenciacurricularoalgntipodeNEE,ademsdel
idioma, afortunadamente sus nicas carencias estn en el idioma y un retraso por
tenerunaescolarizacintarda.

El profesor nativo les ayudar en lo posible con el idioma, pero en aquellas


clasesqueelequipodirectivodecidaqueelalumn@puedeestarsl@estarapoyado
pormaterialvisualsuficienteparaelentendimiento.

Lostutoresdecadaunodelosniosseencargarndequeeltrabajodeestos
alumnosnoseaindividualalprincipio,sinoqueestguiadoporsuscompaeros,para
ello ser necesario dividir las clases en grupos de trabajo cooperativo, para que
www.enfoqueseducativos.es

215

Nmero 2 noviembre -2007


adems de ayudarles a socializarse, la transmisin de conocimientos pueda ser
realizadademaneramsamenaconloscompaeros.

Losniosestarnacompaadosenlosprimerosdastantoenelcentrocomo
ensusalrededoresparaquesepuedanfamiliarizarloantesposibleconlosmismosy
potenciarassuautonoma.

Otro aspecto que no se debe descuidar es la colocacin en la clase. Se debe


evitarqueestosalumnossesientenenlapartedeatrsdelaclaseoenloslaterales
paraquenosesientanaislados.

Unavezrealizadasestasactuacionesconlosalumnosextranjeros,enelcentro
se realizar un sociograma para determinar el grado de aceptacin que tienen estos
nios en el entorno, detectamos que los ndices de aceptacin o rechazo no son
diferentesalrestodelapoblacin,inclusolosniosinmigrantesobtienenunndicede
aceptacin mayor a los alumnos autctonos, por lo que el hecho de ser inmigrante,
generalmente,noeslacausademayoromenorsocializacinenelaula.

ElcontactodeltutorconlafamiliayelequipodeCoordinacinPedaggicaser
constante.

El papel del tutor en el aula es muy importante porque sirve de modelo


lingstico, dinamizador, interlocutor y corrector, para facilitar la comprensin y
expresinoraldelalumnadopertenecienteaotrasnacionalidades.

Se le dar toda la informacin sobre el centro, el calendario escolar y todos


aquellostemasdeintersensupropialengua.

Los objetivos generales que se nos tienen que plantear como profesionales se
basarnen:
Trabajar para conseguir un espacio cultural comn que no suponga prdidas de
identidad, erradicar los aspectos culturales que nieguen los derechos bsicos
universalesdemujeres,dehombres,deniasydeniosyaquesedeberpropiciarel
derechoylalibertadaabandonarono,partedesupropiacultura.
www.enfoqueseducativos.es

216

Nmero 2 noviembre -2007

Perotambinconsideraremosotrosobjetivosmsespecficoscomo:

1.Facilitarlaescolarizacinalosniosyniasdefamiliasextranjeras.
2.Potenciarelaprendizajedelalenguaespaola.
3. Favorecer la convivencia fomentando el encuentro y difusin de valores
democrticos.

Comorecursosmsusualespodemosdestacar:

o DICCIONARIOS: De espaol (lengua materna del alumno), de imgenes, de


lenguacastellana.
o LAMINASSOBREDISTINTOSTEMASIMPORTANTES.
o MAPAS, CARTELES, POSTALES U OTROS ELEMENTOS DECORATIVOS DE LOS
PAISESDEPROCEDENCIA.
o PLANOS,POSTERS,CALENDARIOS,FOLLETOS...
o MATERIALAUDIOVISUAL.
o LECTURASCOMPRENSIVAS.
o CUADERNOSDELECTOESCRITURA
o PROGRAMASINFORMTICOSCOMOCLIC.

LostemasquesetratenenelperiododeATALserntodosaquellosqueseande
mera importancia para el desarrollo de la vida normal de los nios. El alumnado
extranjerodebepermanecerconsugrupoclaseelmximonmerodehorasposibles,
pues hemos comprobado que la interaccin con sus compaeros es uno de los ms
valiososinstrumentosparaelaprendizajedelalengua.Porlotanto,loscontenidosy
actividadesqueseplanteensernlosmismosteniendoencuentadistintosnivelesde
dificultad.

Referenciasbibliogrficasyweb.

www.enfoqueseducativos.es

217

Nmero 2 noviembre -2007


o Cortina, A. (1999) Ciudadanos del mundo. Hacia una teora de la ciudadana.
Madrid,Alianza.
o Diaz,C.(1999)Diezpalabrasclaveparaeducarenvalores.Madrid:Fundacin
EmmanuelMounier.
o Etxeberria,F.(2000)PolticaseducativasenlaUninEuropez.Barcelona:Ariel.
o GarcaRoca,J.(2001)Escuelasolidaria,EspacioPopular.MadridCCS.
o Blanco Barrios, M. (2001) El alumnado extranjero: un reto educativo. EOS.
Madrid.
o www.cephuelva.net

www.enfoqueseducativos.es

218

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA.DNI:11801891Q

Elqueaprendeyaprende,yno
practicaloquesabe,escomoel
quearayaraynuncasiembra.
Platn

PROFESORESYPADRES

La tarea de los profesores es transmitir conocimientos, pero Qu hacemos


cuandoesonolopodemosllevaracabo?educarenvalores,peroCmomantenerlos
siencasanosefomentan?potenciarlaimaginacin,peroCmodesarrollarla,sinose
lee?ensearapensar,Cmohacerlosinoestninteresadosenello?.

Esto es ser profesor pero para ello necesitamos una gran dosis de ilusin,
vocacin, entrega, intuicin, motivacin y otras muchas cosas ms que necesitamos
transmitir a nuestros alumnos para poder contestar a todas las preguntas arriba
indicadas.

Enungrannmerodeocasiones,lasociedadleexigealmaestroprimeroyal
profesordespusfuncionesquelospadresdeberanhaberdesarrolladoanteriormente
encasa,peroporelcontrarioloquenosencontramossonniosyjvenesqueobien
estnacargodelosabuelosoestnsolos,porloquesumejormaestroeslatelevisin,
elordenadorolaGameboy.

Losprofesorestendremosquehacerdepadresydedocentesalmismotiempo
trabajandodentrodelhorariolectivoyfueradelparapoderrenovarconocimientos,
www.enfoqueseducativos.es

219

Nmero 2 noviembre -2007


utilizar las nuevas tecnologas y preparar materiales para hacer las clases lo ms
atractivasposibles.

La transmisin de conocimientos la haremos de forma interesante para ellos,


hacindoles ver que lo que les enseamos es til. Los valores tendrn que verlos
primero en nosotros, despus en el centro y por ltimo desarrollarlo con sus
compaerosparaquepuedanseguirfomentndolos.Laimaginacinyelpensamiento
quizssealoquetenganmsdormido,peroparadespertarlotendremosquebuscarlo
queaellosrealmentelesgustaparamotivarles.

El mejor equipo de formacin sera el formado por padres, alumnos y


profesorestodostrabajandoenlamismadireccinconlosmismosobjetivos,paraello
debemostenerelmximocontactoyrespetounosconotros.
Referencias:
LOE2/2007de3deMayo
www.euroresidentes.com/colegio/tecnicas_de_estudio/estudios_colaboracion_padres
_profesores.htm
FidelSebastinMediavilla(1998)padresyprofesores.

www.enfoqueseducativos.es

220

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA.DNI:11801891Q

QUSEESPERADELOSOPOSITORESELPROXIMOAO?

El prximo Julio, tendremos la prueba de fuego, un examen en el que


compaeros, personas trabajando ya para la administracin nos evaluarn y dirn si
nuestra formacin ha sido suficiente o no para poder enfrentarnos a las situaciones
cotidianasenelaula.Unavezquehayamospasadoesaprueba...

Se espera encontrar personas preparadas en todos los aspectos tcnicos,


psicolgicos, metodolgicos y por supuesto, temticos, artsticos, animadores, etc,
adems de tener responsabilidad, ser puntuales, tener afn de trabajo y voluntad.
Frenteaniospreocupadosmsporsuapariencia,saliralrecreoosalirdeclaseque
poraprender.

Poresto,entreotrosnospodremosencontrarproblemastalescomo:

1.
2.
3.
4.
5.
6.

Faltadedisciplina.
Problemticaentreiguales.
Faltadematerial.
Faltademotivacin.
Pocotratooningunoconlospadres.
Programaspocoajustadosalarealidadetc.

Nuestrosconocimientosademsdelosculturalesserntodoslosrelacionadoscon
eldesarrollodelapersona,salud,educacinenvalores,educacinvialentreotros,por
lotantoesperandenosotrosunexcelentenivelcientficoquedebemosconsideraren
dos aspectos por un lado, como expresar los conocimientos y por otro los
conocimientopropiamentedichos.

www.enfoqueseducativos.es

221

Nmero 2 noviembre -2007


La formacin psicopedaggica tambin se dividir en dos aspectos, la formacin
general y la manera de transmitirla para que le llegue a nuestros alumnos
adolescentes.

Por ltimo el proceso de culturalizacin de nuestros alumnos debe ser tan


completo como sea posible, por lo tanto, nuestra formacin debe ser todava ms
amplia sin dejar que se quede atrs en ninguno de los posibles avances que puedan
surgir,deahquetodoslosprofesoresenmayoromenorgradodebanconocerlasTIC
lomsposible.

Teniendoestemarcoenmentelonicoquenosquedaespensarenlasatisfaccin
quenosllegacuandonuestrosalumnossoncapacesdeutilizarlasestrategiasqueles
hemosenseadoocuandovemosqueesosvaloresqueintentamosinculcarlespocoa
pocovandandosufruto.

Referencias:
JoaquinCalvoSotelo,(1981)Cincohistoriasdeopositoresyoncehistoriasmas
www.opositor.com

www.enfoqueseducativos.es

222

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA.DNI:11801891Q

SOMOSREALMENTEINNOVADORESENLASAULASOYALOFUERONANTES?

ClestinFreinetnacien1896ymurien1966,empezatrabajarcomopastor
deganadoyterminsiendounmaestroenpedagoga.Fueunodelosimpulsoresdela
NuevaEducacinolaEscuelaModerna.

Entresusinnovacionesseencuentranyaen1928laimprentaenlaescuelayla
correspondenciainterescolarentreotrasmuchasmsestrategiasdeaprendizajeque
ayudaronaalumnosnomuyagraciadossocialmente.

ParaFreinettenaunagranimportanciaelenriquecimientoconlaexperiencia
enelentornoporellosumetodologaestababasadaenlaclasepaseoEstoes,los
alumnossalanaobservaryanalizarloquelesrodeaba.Unavezquevolvanalaula
esaobservacineraexpuestaoralmenteyanalizada,paraqueelprofesorlaescribiese
enlapizarraydespuslosalumnoslacopiasenensuscuadernos.

Igual que Decroly, ambos se preocupaban por el estudio del medio, la


diferenciaseencuentraencomoabordacadaunolasituacin.Freinetlespermitela
realizacin de textos libres a la hora de hablar de sus experiencias, por lo que
podramos decirqueloquetrataesdeunirlo yaconocidodelalumnoconelnuevo
aprendizaje.Yaestosalumnos,tenanundiarioescolardifundidoanivelfamiliar,por
loquelosniosaprendanhaciendo.

Tantolostextosoralesproducidosparaexplicarsusexperienciascomolosque
despustenanquecopiarparalacreacindesusfichasoBibliotecadelaescuelapara
poder utilizarlas en otras experiencias, todas ellas son medios de comunicacin que
sirvenparalasocializacindelosalumnos.

www.enfoqueseducativos.es

223

Nmero 2 noviembre -2007

Freinetnoslosebasenlalectoescritura,tambinhizoalgunoscambiosen
lamatemticasloqueelllamaba,elclculovivooelclculodeaccinsobrelascosas,
por ello cre una cooperativaen la escuela que les serva para su propio beneficioy
pararealmenteaplicarelclculoaloquenecesitaban.

Nuestra metodologa quiere basarse en la motivacin, la participacin pero


comoFreinetdijonosepuedeobligarabeberauncaballoquenotienesedporeso
elaprendizajedebenacerenelalumno,esl,elquedebequereraprendermovidopor
unanecesidadinterior.Cuandoestanecesidadsurge,apareceelensayoylgicamente
elerrorcomopartepositivadelproceso.Lapruebadefinitivasurgircuandoelalumno
despus de haber imitado varias veces lo que debe aprender, como sucede en el
aprendizajedeidiomas,seacapazdeproducirloporelmismoensituacionessimilares.

Referenciasbibliogrficasyweb:
www.educar.org/articulos/Freinet.asp
mx.geocities.com/celestinfreinetmx/4k
www.decroly.org
CelestineFreinet.EscuelamodernaFrancesa.UnapedagogadeSentid

www.enfoqueseducativos.es

224

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA.DNI:11801891Q

TEMASTRANSVERSALES:EDUCACINALCONSUMIDOR

Cuantasvecesnohemosescuchadodenuestrosjvenesmequierocomprar
conlaseguridaddesaberqueesoquesequierencomprarprecisamentenoleshace
falta.
El consumo est tan presente en nuestra sociedad sobretodo en los das
relacionados con la Navidad que ha llegado a unos puntos en los que se trata de
acumularproductosquenosenecesitandeformaautmataeirreflexivaporfaltade
educacin al respecto. Nuestra labor como profesores es dotar a los alumnos de
instrumentosdeanlisishaciaelexcesodeconsumodeproductosinnecesarios.
Pero nos encontramos con una dicotoma un poco difcil de tratar que es la
asociacinquesehaceentreestasdosideas.
Dinero.
Felicidad.
Haciendo un anlisis sociolgico sobre este tema, ya que la enseanza es una
formadesocializacin,encontramosqueDineroFelicidadComprasKarlMarxlo
define como la sociedad con la necesidad de producir bienes y servicios para
satisfacerse,deahsuteorabasadaenelmaterialismo.
Porotrolado,encontramoslaTeoradeMaxWeberenlaqueestablece:clasey
statusdeterminadasporloeconmicoylosocial.
Si nos fijamos en los valores y los sentimientos que produce esta actividad
podemosencontrar:
Valor simblico: normalmente para las mujeres es un ritual ir de compras,
casisiempreunidoarelacioneshumanasyaqueiracompaadaporalguien
unamigo/a,pareja,unfamiliarytendrcontactoconundependiente/a.
Valor estimulante de las compras cuando no van relacionadas a una
necesidad primaria pueden ser por actos de compensacin, celebracin,
reconocimientoonarcisismo.

www.enfoqueseducativos.es

225

Nmero 2 noviembre -2007


Sentimiento de culpa producido por la manipulacin que pueden hacer los
mediosdecomunicacinoporelhechodeseruncompradorcompulsivo.
Estas actuaciones suponen un conjunto de relaciones econmicas, sociales
especialesytambinsuponeuntipodecompraespecialdependiendodelacultura,el
trabajo,elniveladquisitivoylaclasesocialalaquepertenezca.
Estasdiferenciasenunaulasonpalpables,enelmomentoqueunjovenmuestra
a sus amigos el ltimo modelo de mvil, o la marca de zapatillas ms conocida.
Nuestra labor en el aula es intentar evitar situaciones violentas comparativas que
puedan daar a aquellos alumnos menos favorecidos econmicamente e intentar
educarenelconsumoalosquestienenposibilidadesparaello.
Segn la psicloga especialista en psicologa positiva, Beatriz Vera los mejores
momentosdenuestravidasuelenocurrircuandonuestrocuerpoonuestramentehan
alcanzadoellmitedesuesfuerzovoluntarioparaconseguiralgovalioso.
Si pensamos que el hecho de comprar puede ser un placer en el momento de
hacerlo, pero luego se va a convertir en un problema porque nos va a producir
sentimientodeculpaporadquirircosasquenonecesitamos,loqueestamoshaciendo
es justo lo contrario pasar de la felicidad a la infelicidad. Siguiendo este esquema,el
dineronopuedecomprarlotodo.Porlotanto,esaeslaideaquedebemostrasmitira
nuestrosalumnos.Paraellodeberemosplantearobjetivossimilaresaestos:

Ayudar a que los alumnos descubran y den prioridad al ser y no al tener


comomediodeencontrarlafelicidad.
Ensearlesadistinguirentreloprecisoyloexcesivo.
Apreciarloqueyaposeenporsuutilidad.
Mostrarleslosmensajespublicitariosdeformacrticaparaquesepandistinguir
loverdaderodelofalsoyquepuedanactuarlibrementealahoradecomprar.

REFERENCIASBIBLIOGRAFICAS:
FrancisWheel(2005)KarlMarx.
AnthonyGiddens(2002)PoliticsandSocilogyinthethoughtofMaxWeber
www.psicologiapositiva.com/noticias.html
www.edusalud.com

www.enfoqueseducativos.es

226

Nmero 2 noviembre -2007

ANABELNTUNLPEZ
26485972T

ELAPRENDIZAJEDELINGLS.

Elinglssehaconvertidoenelidiomaenelquelaspersonasdemuydistintos

pases y culturas se comunican entre s. Se ha convertido por tanto en una lingua


franca.EnquidiomasecomunicaraunapersonasdeFrancia,otradeAlemaniay
unespaol?Definitivamenteeningls.

Adems,elinglsestambinunidiomaqueproporcionaaccesoalaeducacin,

alatecnologayalainvestigacin.Dehecho,elinglseselidiomaqueseutilizapara
las publicaciones cientficas. Y qu decir del comercio? Personas de campos muy
distintossabenquetendrnpocasposibilidadesdetenerxitosinosecomunicanen
ingls.Aspodemosverjvenesyadultosintentandoaprenderinglsacualquierhora,
condiferentesmtodosycondistintosniveles.Todasestaspersonasnecesitanutilizar
elinglsporpropsitosacadmicos(EAP).

Elinglsenlaeducacinabarcamuchosaspectoscomoporejemplocmose

aprendeunidiomaextranjero,actividadesparalasclases,evaluacin,etc.Tambinse
contraponentrminoscomoadquisicindeunidiomayaprendizajedeuidioma.
Aparentemente pueden parecer semejantes pero todo lo contrario. Adquisicin
supone un proceso inconsciente mientras que el aprendizaje requiere deseo,
conscienciayunesfuerzoporhablarunalenguanueva.

Enresumen,elinglssehaconvertidoenlasegundalenguaolenguaextranjera

(enalgunoscasoseslomismo)quecadavezmspersonasempleancomomediode
comunicacinennegocios,comercio,viajes,etc.
BIBLIOGRAFA:

www.enfoqueseducativos.es

227

Nmero 2 noviembre -2007


McLAREN,N.&MADRID,D.(1996)
AHandbookforEFL
EditorialMarfilS.A.

www.enfoqueseducativos.es

228

Nmero 2 noviembre -2007

ANABELNTUNLPEZ
26485972T

FRASESIDIOMTICASENINGLSCONUNEQUIVALENTEENESPAOL(I).

Aunque el ingls y elespaol no parecen tener aparentemente muchas cosas

encomn,heseleccionadoalgunosidiomsofrasesidiomticasquesonuncalcola
unadelaotrayseutilizanensituacionescotidianasdenuestravida.

Paraempezar,yporestrictoordenalfabticocitar

fromAtoZconsuequivalentedelaAalaZparareferirseaalgoquese
hahechocompletamente.
La expresin ABC se utiliza en ambos idiomas para indicar un
conocimientomuyelementalomuybsico.
Otra expresin muy conocida eson red alert que tambin utilizamos en
espaoltraducidacomoenalertaroja.
Tambin en espaol usamos la expresin conocer todas las respuestas
tienesuequivalenteenknowalltheanswers.
Ser la manzana de la discordia tiene una expresin en an apple of
discord.Segnlamitologagriega,lamanzanafuearrojadaentrelosdioses
porEris,diosadeladiscordiayfuereclamadaporAfrodita,AteneayHera.
Podemos hallar algunas expresiones relacionadas con brazo en ambos
idiomas.Astenemos:
armadohastalosdientesyarmedtotheteeth.El
idiomseremontaalaEdadMedia.
el brazo (largo) de la ley y the (long) arm of the
law. Se trata de un idiom utilizado en situaciones
informalesyhacereferenciaalpoderoautoridadde
lasfuerzaspoliciales.
Ser el brazo derecho de alguien y be someones
rightarm.Significaquealguieneslaprincipalayuda
oapoyodealguien.

Estassonalgunasdelasexpresionesqueheencontradoquetienenuna
misma traduccin en ingls y espaol y adems siguen utilizndose en la
actualidad.

www.enfoqueseducativos.es

229

Nmero 2 noviembre -2007


BIBLIOGRAFA:TheWordworthDictionaryofIdioms(1994)WordworthEditionsLtd.

www.enfoqueseducativos.es

230

Nmero 2 noviembre -2007

ANABELNTUNLPEZ
26485972T

FRASESIDIOMTICASENINGLSCONUNEQUIVALENTEENESPAOL(II).

Como continuacin a mi anterior ensayo sobre los idioms con similar


significado en espaol, seguir enumerandoalgunos delos que heencontrado que
cumplenesterequisito.

Paraempezarcitar:

gofrombadtoworse,nuestrofamosoirdemalenpeor.
Abagofbones,unsacodehuesosseempleademanerainformalpara
hacerreferenciaaunapersonaqueestmuydelgada.
Otra expresin que tiene un equivalenteen espaol es if you cant beat
them, join them. Significa que cuando no puedes convencer a tus
oponentesparaquecambiesusideas,lomssensatoesquetcambieslas
tuyas.Secorrespondeconsinopuedesvenceralenemigo,neteal.
Tambin es muy conocido el idiom get out of the bed on the wrong
side.Equivalealdicholevantarseporelladoizquierdodecama.Significa
empezareldaconmalhumoroconmalpie.
Saved by the bell se corresponde con salvado por la campana. (A
menudo se utiliza como interjeccin). Rescatado de una situacin
desagradable o difcil por algo que hace que la situacin acaba. Esta
expresin proviene de la campana que marca el final de un asalto en un
combatedeboxeo.
Tambin he encontrado algunas frases idiomticas relacionadas con
better:
Betterlatethannever,enespaol,msvaletarde
quenunca.
Get the better of (someone), sacar lo mejor de
alguien.
To have seen better days, haber visto mejores
das/haber tenidos mejores das. Significa estar en
unasituacinpeordelaqueestabaenelpasado.
Como ltimo ejemplo, citar la expresin have a big mouth que se
correspondecontenerlabocademasiadograndeoserunbocazas.

Haymuchasmsexpresionesconsignificadosytraduccionesmuysimilares
enlosdosidiomas.Heintentadoescogeralgunasdelasquesonmsconocidas,
mscomunesyademssiguenestandovigentes.

www.enfoqueseducativos.es

231

Nmero 2 noviembre -2007

BIBLIOGRAFA:TheWordworthDictionaryofIdioms(1994)WordworthEditionsLtd.

www.enfoqueseducativos.es

232

Nmero 2 noviembre -2007

ANABELNTUNLPEZ
26485972T

HAMLET Y LA RELIGIN: ALGUNOS EJEMPLOS DONDE SE HACE REFERENCIA A


CREENCIASRELIGIOSAS(I).

Para empezar debemos tener en cuenta el principal argumento de la novela

para clarificar esta cuestin. De hecho, el argumento se refiere a la venganza por la


muerte del padre del prncipe. As pues, a primera vista podemos ver como el tema
estencontradiccinconlabasedelcristianismo.

Lanovelasecomplementaconalgunostiposdecomportamientostalescomola

venganza,elincesto,elasesinato,etc.

Unodelosprincipalestemasdelaobraeslavenganza:

Lavenganzalaproponeelfantasma(Yhasdevengarme,cuandoescuches,

I.5, lnea 12). Es extrao para nosotros el hecho de que la venganza la proponga el
espritu ya que el cristianismo considera los espritus como seres celestiales. Nada
malopuedevenirdeellos.

La venganza se le propone a Laertes. l quiere vengarse del asesino de su

padre,queademshasidoelcausantedelamuertedesuhermana.Mstardelseda
cuentadequetendrquepagarsupecadoenelcieloyquenotienemaneraalgunade
deshacersedesupecado.(IV.5).

Otro tema importante es el fantasma (o espritu) que podemos encontrar en

soy el espritu de tu padre (I.5) y un poco despus cuando dice asesinato torpe,
como lo es el asesinato en el mejor caso; pero ste ms torpe, extrao y
desnaturalizado(I.5).Elfantasmaharegresadodelamuertealavidayahoraesten
elmundodelosvivos.

www.enfoqueseducativos.es

233

Nmero 2 noviembre -2007


El ltimo tema que voy a desarrollar en este ensayo est relacionado con el

purgatorio. El espritu es un alma atormentada que ha venido del purgatorio para


incitarasuhijoparaquelleveacabosuvenganza,locualnoesalgocristiano.Regresa
paraquejarsedequenohasidosuficiente.

LasautoridadeseclesisticasrechazanenterraraOfeliaenlaiglesia,locuales

algonormaldebidoasustatussocial.Estasautoridadesdelaiglesianopermiteneste
entierroyaqueellasehasuicidado.Esms,inclusolosenterradoresdicenquesiella
nohubiesepertenecidoalanobleza,ellanohabrasidoenterradaentierracristiana.

En resumen, estos son algunos de los temas que he encontrado relacionados

conlareliginampliamentedesarrolladosenHamlet.

BIBLIOGRAFA.SHAKESPEARE,W.HAMLET.EditorialPlaneta.

www.enfoqueseducativos.es

234

Nmero 2 noviembre -2007

ANABELNTUNLPEZ
26485972T

ACOGIDAYATENCINALALUMNADOEXTRANJERO

Losprofesorestienenqueadaptarsecontinuamenteanuevassituaciones.En
losltimosaoscadavezmsinmigrantescruzannuestrasfronterasparabuscaruna
vidamejorparaellosyparasushijos.EstosnioscuandolleganaEspaanosiempre
conocen nuestra lengua y la lengua se convierte en una barrera para poder
comunicarseconelrestodesuscompaeros.

Los alumnos inmigrantes se enfrentan a una ruptura con su mundo anterior.


Hanperdidotodossusreferentesytienenqueadaptarseaunanuevavida,unnuevo
idioma, un nuevo colegio, nuevos amigos, etc. Deben integrarse en una escuela
desconocidayunoscompaerosyunprofesorquenohablansuidioma.Realmentees
unasituacintremendamentedura.

Los alumnos inmigrantes deben sentirse iguales al resto de sus compaeros.


Debenaprender,aunquesuaprendizajesercomplicado.

Estos alumnos suelen sentirse desorientados y sienten miedo y desconfianza


perosobretodotemoraserrechazados.Necesitamossensibilizarnosysensibilizarala
comunidadeducativasobrelarealidaddeestosalumnos.

Por otro lado, la llegada de alumnos inmigrantes a un centro puede ser una
oportunidad de enriquecimiento para todos. Puede ser una gran ocasin para
aprendersobreotrasculturas,otrosidiomasyotrasformasdevida.

Parafinalizar,lallegadayacogidadeunnuevomiembroanuestraclaseesuna
maneradehacerquenuestrosalumnosaprendanelrespetohaciaotraspersonascon
idiomas,costumbres,yculturasdistintasalasnuestras.

BIBLIOGRAFA:

Didcticadelespaolcomosegundalengua.BloqueII.CursoANPEALMERIA2004

www.enfoqueseducativos.es

235

Nmero 2 noviembre -2007

APRENDIZAJEATRAVSDELORDENADOR.

MTERESAPREZMONTALBN
DNI75070922A

Larevolucinqueseestnproduciendoenlaenseanzaconlaintroduccindel
ordenadorcomoherramientadetrabajoocupahoygranpartedelasprogramaciones
delosprofesoresenloscentroseducativos.Unodelosprincipalestemsquetenemos
quedefinireslainstruccinasistidaporordenador(CAI).

Lapodemosconsiderarcomounaformadeenseanzaquetienedosobjetivos
principales:

1. El primero es que el ordenador se utiliza como el primer vehculo para dar


informacin.

2. Elsegundoafirmaqueelalumnoyelordenadorestnencomunicacindirecta
elunoconelotro.

La aplicacin de las nuevas tecnologas a la educacin engloba una gran


cantidaddeactividadescomplejas.Elmarcosugeridoparaentendersuaplicacinenla
enseanzadependedeconsiderarelordenadorcomo:

1. Untutor.

2. Unaherramienta.

www.enfoqueseducativos.es

236

Nmero 2 noviembre -2007


3. Unalumno.

Los tipos de actividades que podemos hacer con el ordenador son los
siguientes:

RELLENARHUECOS:estaactividadesunadelasmsutilizadasenlaadquisicin
deunidiomaextranjero,tambinllamadaeliminacinparcialdeinformacin.
Las principales caractersticas que podemos encontrar en este tipo de tareas
sonlassiguientes:

o Longitud del texto: los programas varan en la longitud del texto.


Algunos de ellos conectan textos de aproximadamente 100300
palabras,otrosproponenunnmerodepreguntasenunejercicio,pero
slotresocuatrolneas
o Elementos que se tienen que eliminar: algunos programas eliminan
palabrassueltas,ofrasesenteras.
o Flexibilidad: hay programas informticos que se pueden utilizar slo
como exmenes, permitiendo al alumno intentar un nmero
determinado de veces hacer una actividad, otros hacen que el
estudiante utilice el programa como un tutorial o simplemente para
explorar.
SECUENCIACIN: otra actividad que tambin nos resulta familiar es la
reordenarciertoselementosquenosvienendados.

UNIRELEMENTOS:selepresentaalalumnodoslistadepalabrasofrasesque
tienequeunirsegnlarelacinqueexisteentreellos:puedensersinnimos,
antnimosetc

stas son algunas de las sugerencias que hacemos en este artculo, pero
evidentemente hay otras aplicaciones que podemos hacer con los ordenadores en
nuestras clases. Todo depende del tiempo que tengamos y de las caractersticas de
nuestrosalumnos,alosquehayqueadaptarleslasactividadessegnsusnecesidades.
(Decreto142/2002de14demayo)

REFERENCIAS:
www.enfoqueseducativos.es

237

Nmero 2 noviembre -2007

VV.AA(1993)JuegossinBarreras.Barcelona.
Sanchez Manzano, E.(1993) Psicopedagoga y Educacin Especial. Universidad
Complutense.Madrid.
Freinet,C.(1974)ModernizarlaEscuela.Laia.Barcelona.
Decreto231/2007de31dejulioporelqueseregulanlosprincipiosbsicosde
laeducacinsecundaria.

www.enfoqueseducativos.es

238

Nmero 2 noviembre -2007

CARACTERSTICASDELPROFESOR.

MTERESAPREZMONTALBN
DNI75070922A

Todos los elementos que intervienen en la enseanza son importantes, pero


quiz el profesor es uno de los componentes decisivos de cualquier proceso de
formacin, ya que es el encargado de proveer informacin para satisfacer las
necesidadesdelosalumnos.

Acontinuacinseexponenlasconsideracionesqueparecenmsrelevantesen
relacinconelprofesor:

LA ACTITUD Y APTITUD DEL PROFESOR: estos dos elementos son claves para
que el proceso pedaggico alcance los objetivos. El profesor debe conocer la
materia, pero adems su predisposicin para ensear debe ser positiva. En
cambio, cuando la actitud del profesor hacia sus alumnos es negativa los
resultadossonmsdesfavorables.

LA EMPATA: este concepto es distinto de simpata o antipata. Se puede


definircomolafacultaddeponerenlapieldealguien.Estafacultadsirvepara:

9
9
9
9

Identificarnecesidadesyelperfildelosalumnos.
Escogerlosmtodosmsadecuados.
Saberloquepiensanlosalumnos.
Ayudarlosaconseguirlosobjetivos.

ASPECTOSQUEPOTENCIANLOSRESULTADOSDELPROFESOR:elprofesorque
quierequelaenseanzaqueelproporcionaseadecalidad,debemejorardaa
da.Paraellotieneque:
www.enfoqueseducativos.es

239

Nmero 2 noviembre -2007

9 Implementartodo(objetivos,mtodos,medios)deformaperidica.
9 Trabajar como un equipo coordinado con sus compaeros de
departamento.

De esta manera, el docente est recibiendo continuamente feedback de sus


alumnos,loqueleayudaparaprepararmejorlasclasesysatisfacerlasnecesidadesdel
alumnadoquetieneasucargo.

REFERENCIAS:

Marchago, J. (1991). El Profesor y el Autoconcepto de sus Alumnos. Escuela


Espaola,Madrid.
Morales,P.(1998)LaRelacinProfesorAlumnoenelAula.PPC.Madrid.
Osborne,RyP.Freyberg.RolesdelProfesor.Madrid.
Cian,L.(1995)LaRelacindeAyuda.CCS.Madrid.

www.enfoqueseducativos.es

240

Nmero 2 noviembre -2007

CLASIFICACINDELASESTRATEGIASDIDCTICAS.

MTERESAPREZMONTALBN
DNI75070922A.

Lasestrategiasdeformacinodidcticasnosonotracosaquelaplanificacin
delasformasenquelosalumnosdebenaprenderyquelesconducirnalosobjetivos.
stascombinanlosdiferentesmtodos,tcnicasyprocesosquepuedenserutilizados
para ensear, las actividades, los materiales o instrumentos empleados en la
formacin.(Decreto231/2007de31dejulio)

Sepuedenclasificarsegndiversoscriterios:

SEGNLAFORMADERAZONAMIENTO:

9 Mtodos deductivos: consisten en una serie de razonamientos


encadenados,formuladosporelprofesor.
9 Mtodosinductivos:sonmsparticipativosporqueelprofesortieneel
papeldefacilitadorytienequeconseguirquelosalumnosaprendande
supropiainteraccin.
9 Mtodos analgicos: se presentan datos concretos con el objetivo de
compararelementos.

SEGNLAACTIVIDADDELOSALUMNOS:

9 Mtodos pasivos: el peso del proceso de enseanza recae en el


profesor.
9 Mtodosactivos:elpesorecaeenlosalumnos.

SEGNELTRABAJODELALUMNO:

www.enfoqueseducativos.es

241

Nmero 2 noviembre -2007


9 Trabajoindividual.
9 Trabajocolectivo.
9 Trabajomixto.

Existeunagranvariedaddemtodospedaggicos,peroesaconsejableutilizar
unacombinacindevariosalavezenunamismaclase.

REFERENCIAS:

Guerrero Sern, A. (1995) Manual de Sociologa de la Educacin. Ed. Sntesis.


Madrid.
BeltrnLlera,J.(1993)Procesos,EstrategiasyTcnicasdeaprendizaje.Sntesis.
Madrid.
Croll,P.(1995)LaObservacinSistemticaenelAula.LaMuralla.Madrid.
lvarezRojo,V.(1984)DiagnsticoPedaggico.Alfar.Sevilla.

www.enfoqueseducativos.es

242

Nmero 2 noviembre -2007

CMOSEPUEDEEXPRESARLAPOSESINENINGLS?

MTERESAPREZMONTALBN.
DNI75070922A.

El Decreto 231/2007 de 31 de julio, por el que se regulan los principios


generales del presente currculum para la enseanza secundaria, establece en su
artculo 6 que el alumno debe desarrollar una serie de competencias y habilidades
bsicasparasupreparacineducativa.Unadeellasestrelacionadaconlaadquisicin
deconocimientoslingsticosquelepermitancomunicarseoralmenteyporescritoen
lalenguaextranjeraqueseestestudiando,comoesennuestrocasoelingls.

Cuandolagenteemprendeelestudiodeunidiomaextranjero,lahabilidadms
importante que deben desarrollar es la de interaccionar con los dems, utilizar el
sistemadellenguajequeellosconocenparatransmitirinformacin.Adems,tambin
deber aprender a interpretar el significado de un mensaje especfico en un contexto
determinado.

Esteobjetivodebeseralcanzadoporque,deotramanera,podramosnollegar
a ser completamente competentes en ese idioma. Por lo tanto, in nuestras clases
debemosponerenprcticasactividadesrelacionadasconelmtodocomunicativo.

Sin embargo, para ser capaces de mantener una conversacin, necesitamos


algunasherramientasparatransformarnuestrosconceptosenpercepciones,esdecir,
necesitamosestructurasgramaticalesparadarleformafsicaanuestrasideas.Deesta
manera,lagramticatieneunpapelesencialenlaadquisicindeotraslenguas.

UnelementogramaticalesencialparaPrimeroDeBachilleratoenEspaaesel
conceptodelaposesin(algoperteneceaunapersona,lugarocosa).Enestaetapa,
ellossoncapacesdeusarlossiguientespatrones:

www.enfoqueseducativos.es

243

Nmero 2 noviembre -2007

Unamaneradeexpresarposesinesutilizandoelapstrofe().Inlagramtica,
elgenitivosajnocasoposesivo(tambinllamadosegundocaso)esunadelas
formasquetenemosparasealarqueunnombreeselposeedordeotro:

Janetsjacket
TheBaskervilleshound
JanicesandPhillsdog

Sihablamosdeunposeedorinanimado,laconstruccinperifrsticaconOFes
laformausualdeexpresarestesignificado:

Thecostftheoperationwasenormous.
Wheresthelidofthesaucepan?

Desafortunadamente,nohayunanormaabsolutaquenosdigasitenemosque
utilizarunauotraestructura,ylareglasencillaquedicequeslopodemosutilizars
conpersonasesunageneralizacinmuyamplia:

Thebookscover
Thedogsname

www.enfoqueseducativos.es

244

Nmero 2 noviembre -2007


Paraexpresarlaposesineninglstambinpodemosemplearverboscomolos
siguientes: BELONG TO, OWN, POSSESS, HAVE o HAVE GOT. Los dos ltimos
necesitan ser aclarados en este artculo en trminos de su uso: ambos son
correctos (y aceptados en ingls britnico y americano) HAVE GOT
generalmente se prefiere en Inglaterra, mientras que la mayora de los
hablantesenlosEstadoUnidossedecantanporHAVE:

Doyouhaveacar?
Hehasntgotanyfriends.

Finalmente,podemosmencionarelusodelosPRONOMBREPOSESIVOS(tales
comomine)ylosDETERMINANTEPOSESIVOS(comoporejemplohis,our):

Thisbookishis.
Myhouseisalreadypainted.

Paraconcluirdiremosquelaposesineninglsnoesunconceptogramatical
difcil de entender, e incluso es mucho ms fcil para Bachillerato. Sin embargo,
deberamos animar a nuestros estudiantes a que las utilizaran en diferentes
situacionessimplementeparaserinnovadores.

REFERENCIAS:

www.enfoqueseducativos.es

245

Nmero 2 noviembre -2007


Greenbaum, S. and Quirk, R. (1990). A students grammar of the English
language.London:Longman.
Onions, C. (1974). Modern English Syntax. London: Routledge and Kegan Paul
Publishers.
Rosenbach, A. (1992) Genitive Variation In English: Conceptual Factors In
SynchronicAndDiachronicStudies.WalterdeGruyter.
Schelesinger, I. (1998) Cognitive Space and Linguistic Case: Semantic and
SyntacticCategoriesInEnglish.CambridgeUniversityPress.

www.enfoqueseducativos.es

246

Nmero 2 noviembre -2007

CULESLADESTREZAQUEPLANTEAMSPROBLEMAS?

MTERESAPREZMONTALBN
DNI75070922A.

Te resulta familiar la siguiente situacin? Tu ingls est progresando


adecuadamente,conoceslagramticabien,lalecturacomprensivanoesdifcilparati,
te comunicas bastante fluidamente, pero ESCUCHAR Y ENTENDER TODAVA ES UN
PROBLEMA!

La Orden de 10 de agosto de 2007 que regula el currculum para las lenguas


extranjeras en educacin insiste en la inclusin en nuestras clases de las cuatros
destrezasporexcelenciaquelosalumnostienenquedesarrollar:

Listening:escuchar
Speaking:hablar
Writing:escribir
Reading:leer

Primeramente,debemosrecordarqueescucharesprobablementelatareams
difcil para casi todos los estudiantes de ingls. Por esto, por qu los estudiantes la
considerancomoalgoimposibledeadquirir?

El ms grande inhibidor para que los alumnos desarrollen esta destreza


apropiadamente es EL BLOQUEO MENTAL. Mientras ellos estn escuchando, de
repente ellos creen que no estn entendiendo nada de lo que se estn diciendo, en
www.enfoqueseducativos.es

247

Nmero 2 noviembre -2007


otraspalabras,ellosseconvencenasmismosdequenosoncapacesdeseguirelhilo
conductor de la conversacin y finalmente desconectan. En este punto, muchos
alumnos simplemente TRADUCEN una palabra en particular. Y esto es una gran
tentacin para ellos. Sin embargo, cuando traducen, se concentran en el proceso de
traduccinyseolvidandelhablante.As,estasituacinlesimpideentendernadaen
absoluto.

ENSAYAR es un comportamiento habitual que los oyentes muestran, lo que


demuestra que ellos no estn escuchando de forma efectiva: ellos dedican toda su
atencinenprepararelsiguientecomentario.

LomismosepuededeciracercadeSOARDESPIERTO,cuandolosestudiantes
estn pensando en otras cosas diferentes a lo que se suponen que tienen que estar
escuchando.

Puestoqueestasituacinpuedeocurrirfcilmenteenclase,aqupresentamos
algunosconsejosquepuedensertiles:

Esconvenientequeintentemosconvencerlosquenoentenderestbien,yque
lo ms importante es escuchar ingls tan a menudo como sea posible
(canciones,programasgrabadosdelaradioeinternet).Sinembargo,estono
significa que ellos tengan que escuchar toda una pelcula entera en versin
originalydeltirn.Ellosdeberanhacerestaactividadcuatroocincovecesala
semana y en periodos cortos. Para que esta estrategia funcione bien, los
alumnos no deben esperar mejorar casi instantneamente, sino que ellos
debentenerpacienciayesperarlosresultadosalargoplazo.
Ellos tienen que mantenerse en calma cuando no sean capaces de seguir las
ideaspresentadas.
Esimportanteescucharparaentenderlasideasprincipalesdelaconversacin.

Comopodemosdeducirdetodoesto,elcontrasteentreoryescucharpuede
ser tan diferente como el da y la noche. La comunicacin efectiva es el principal
objetivoenlasconversacionesysinosotrosnointentamosescucharcuidadosamente,
podremosestareliminandounamaneratildeadquirirnuevosconceptos.

www.enfoqueseducativos.es

248

Nmero 2 noviembre -2007

Laclaseesellugarenelqueaprendemos,ylaclaseesellugarparaescuchar,
WilliamH.Armstrong.

REFERENCIAS:

Canale, M. (1983) From Communicative Competence To Communicative


LanguagePedagogy.NewYork:Longman.
Doughty, C. and Pica, T. (1984) Information Gap Tasks: Do They Facilitate
SecondLanguageAcquisition?18thAnnualTESOLConference.Houston.
Faerch, C. and Kasper, G. (1983) Strategies in Interlanguage Communication.
London:Longman.
Jakobson, R. (1963) Principles And Practice In Second Language Acquisition.
Oxford:PergamonPress.

www.enfoqueseducativos.es

249

Nmero 2 noviembre -2007

EDUCACINDEADULTOS.

MTERESAPREZMONTALBN
DNI75070922A

La educacin es un derecho para todas las personas, hombres y mujeres,


independientemente de su edad, en todo el mundo. La educacin contribuye a
garantizar un mundo ms seguro, ms sano, ms prspero, mas tolerante y
simultneamentealprogresosocial,econmicoyculturaldelospueblos.

Segn La Declaracin Mundial sobre Educacin para Todos, la educacin


bsica deber proporcionarse a todos los nios, jvenes y adultos. Para este fin, se
tendrn que aumentar los servicios ya existentes y, a su vez, tomar medidas
coherentes para reducir las desigualdades educacionales y suprimir las
discriminacionesenelaccesoalasoportunidadesdeaprendizaje.
Losenfoquesactivosyparticipativossonespecialmentevaliososparaasegurar
la adquisicin de conocimiento y para permitir al individuo desarrollar todas sus
habilidades.
La educacin de adultos siempre ha sido considerada una de las mejores
formasparalograrquetodoloanteriormenteexpuestopuedallevarseacabo.Ahora,
enestacambiantesociedadtenemosqueserconscientesdelanecesidaddeactualizar
constantemente nuestro conocimiento acerca del mundo que nos rodea. En este
contexto,laeducacinbsicadelosadultos(rdende10deagostode2007porla
que se regula el Plan Educativo de Formacin Bsica para Personas Adultas) y su
formacincontinua,constituyenunaherramientaesencial.
Comosinnimodeenseanza,diversosautoreshanutilizadoeltrminodePROCESO
DECAPACITACIN,quetienecomoprincipalobjetivocambiar,reorganizarymejorar
ciertos aspectos de las actitudes y comportamientos de las personas. Es necesario
lograr cambios fundamentales de actitud para que, a su vez, haya cambios
permanentesdecomportamiento.Estoquieredecirquesinoseproduceunreajuste
entrelosconocimientosyaadquiridosylanuevainformacin,nosepuedehablarde
aprendizaje. Adems, estos nuevos datos tienen que estar en un nivel superior de
dificultad.Estosepuedeilustrarconelsiguientediagrama:

www.enfoqueseducativos.es

250

Nmero 2 noviembre -2007

Se puede decir que toda conducta humana es resultado de un proceso de


aprendizaje,elcualsemanifiestacomounamodificacindeconductaalcompararlas
actitudes, habilidades y conocimientos que tenan las personas antes de ponerlas en
unasituacindeaprendizajeylaquepuedenmostrardespusdeella.Esimportante
que el instructor gue a los participantes para que relacionen los conocimientos
adquiridosconlasexperienciaspreviasconelobjetodedarunsentidoalaprendizaje.

REFERENCIAS:

GarcaCarrasco,J.(1997)EducacindeAdultos.Ed.Ariel.
Medina Rivilla, A y C. ( 1995) Enseanza y Currculum para la Formacin de
PersonasAdultas.EdicionesPedaggcias.
Usher, R y I. Bryant. (1992) La Educacin de Adultos como Teora, prctica e
Investigacin.EdicionesMorata.FundacinPaideia.

www.enfoqueseducativos.es

251

Nmero 2 noviembre -2007

ELARTEDECONTARHISTORIAS.

MTERESAPREZMONTALBN.
DNI75070922A

Contarhistoriasnoesslounmedioparalograunfinenconcretosinounfin
en s mismo. Los profesores no cuentan historias slo para que los alumnos puedan
aprenderciertaspalabrasyestructuras,sinoparadivertirseyrecibirinformacinoral.
Cuandoestamosenseandoaniosqueestnenlasetapasinicialesdelaescuelala
fuentedeinformacinmsdirectaquetieneneselprofesor.Comosegundoobjetivo
podramos introducir historias con vocabulario especfico y otros elementos
pertenecientesalsegundoidioma.

Sin embargo, deberamos tener en cuenta que esta tcnica no es slo una
excusaparaaprendervocabularionuevo,oparajugaralaltimahoralosviernes,sino
que es una forma de comunicacin utilizando en idioma extranjero, una manera de
acercarse al conocimiento de los estudiantes, sus esquemas y pensamientos,
combinndolosconlarealidaddelaula.

Las razones que tenemos para utilizar esta herramienta en clase son las
siguientes:

Primeramente, la narracin como gnero literario es el primero que entra en


contactoconlosnios.

En segundo lugar, los cuentos son universales (Mandler, Scribner, Cole and
DeForest,1980)comolatelevisinolosjeans.

Tercero,contarhistoriasesunadelasmsantiguasydivertidasdelastcnicas
que los padres utilizan para introducir el lenguaje y aspectos culturales a sus
hijos, y al mismo tiempo es una forma ptima de mantener la atencin y el
intersdelosnios.
www.enfoqueseducativos.es

252

Nmero 2 noviembre -2007

Por otra parte, apoya todas aquellas teoras sobre la adquisicin del lenguaje
de una manera natural tales como las de Krashen COMPREHENSIBLE INPUT
HYPOTHESIS,elusodelarepeticinylamemorizacincomoherramientasde
aprendizaje.

Por ltimo, las historias nos ayudan a crear un contexto lingstico y


extralingsticobastanteamplioquehaceusodeloselementostextualestales
comolareferencia,deixis

Sin embargo, bastante a menudo los profesores no saben cmo explotar un


cuentoenclase.Aqupresentamosalgunaspistasquenospuedenayudar:

Proporcionaralosalumnosdibujosparaquelosordenen.
Mostrarlesdibujosparaquepuedanimaginarlahistoria.
Hacermmicaconelcuento.
Dartrozosdelahistoriadesordenadosparaelloslosordenenadecuadamente.
Hacerpreguntasparacrearpartedelahistoria.
Decirles a los alumnos que cuenten la historia utilizando apoyo visual y
vocabulario.

Amododeconclusin,podemosdecirquecontarcuentossepuedeconsiderar
comounamaneraacertadaderomperconlarutinadenuestrasclasesyascrearuna
atmsferamotivadoraypropiciaparaelestudio.

REFERENCIAS:

Velorio. J.J. (1995). Los Temas Transversales. Claves de la Formacin Integral.


Santillana.
BeltrnLlera,J.(1993)Procesos,EstrategiasyTcnicasdeAprendizaje.Sntesis.
Madrid.
Rodari, G. (1984) Gramtica de la Fantasa (Introduccin al arte de Contar
Historias).Argos.Vergara.Barcelona.

www.enfoqueseducativos.es

253

Nmero 2 noviembre -2007

ELCINECOMOMEDIODIDCTICO

MARATERESAPREZMONTALBN
DNI75070922A

Elcinees,paramuchaspersonas,todavaalgoparallenarlosratosdeocio,no
unelementovivoeintegradordelsaber.Poreso,convienecorregiresavisin,porque
elcinepuedesertilparalaformacin.(Decreto231/2007de31dejulioartclo6)

Entendemosporcineelartedecomponeryrealizarpelculasparaproyectarlas,
cuyo epicentro se sita en la posibilidad de reproducir fotografas enmovimiento. El
cinesepudeutilizarcomoinstrumentoparaensearatravsdelaimagen.Esposible
explotarelmensajepedaggicodeunbuennmerodepelculas.Integrarelcineenla
formacinsignificaensearavercine.

El cine tiene un papel creciente en los procesos de enseanzaaprendizaje, al


igual que el video y la imagen, ya que pueden mejorar el clima comunicativo del
grupo. En definitiva, el cine puede ser considerado como una fuente que facilita la
comprensin de los contenidos, ayuda a acercarse a procesos de investigacin,
despiertalacapacidaddecrticaymuestratodoeldocumentosusceptibledeanlisisy
valoracin,sinolvidarlafuncindinamizadoraqueposee.

Concretandoanms,podemossintetizaragrandesrasgossusfunciones:

1. Fomentarlaparticipacin.
2. Ampliarelmarcodeexperienciadelalumno.
3. Motivar el aprendizaje por descubrimiento a travs del contacto con la
realidadcomunicacional.
4. Provocar comportamientos imitativos, ya que las pelculas pueden actuar
comoinductoresrecomportamientos,actitudesyvaloresdelasociedad.

www.enfoqueseducativos.es

254

Nmero 2 noviembre -2007

Como podemos ver, las funciones del cine en la enseanza hacen de ste un
recursocuyousorequiereunagranresponsabilidad,puesactacomomotivadorhacia
elaprendizaje.

REFERENCIAS:

Guilford, J.P. (1977) La Naturaleza de la Inteligencia Humana. Paids. Buenos


Aires.
Freinet,C.(1974)ModernizarlaEscuela.Laia.Barcelona.
VV.AA.(1994)LenguajesAlternativos.CEPE.Madrid.

www.enfoqueseducativos.es

255

Nmero 2 noviembre -2007

ELPORTFOLIOEUROPEODELASLENGUAS.

MTERESAPREZMONTALBN
DNI75070922A

Se trata de un documento propuesto por el Consejo de Europa en el que


aquellos que estn aprendiendo o han aprendido un idioma extranjero bien en el
colegioofueradelpuedanrecopilaryreflexionarsobresusexperienciasculturalesy
deaprendizaje.

En trminos generales el portfolio es una herramienta importante y til para


describirlosnivelesdeaprendizajerequeridosporlosactualesparmetros,exmenes
ycontrolesperidicosparafacilitarunacomparacinentrelosdiferentessistemasde
calificaciones. Para ese fin, el Consejo de Europa ha desarrollado un marco europeo
connivelesdereferenciacomunes.

Afortunadamente, se estn de acuerdo en cuanto al nmero y naturaleza de


esosnivelesenlosquelosalumnospuedenincluirseasmismosteniendoencuenta
cmodesarrollanlasdestrezasbsicasenlalenguaextranjera:ingls,francs,alemn,
checoydems.

Tradicionalmente los niveles de aprendizaje estaban divididos en bsico,


intermedio y avanzado. Esta divisin es la que impuls la siguiente diferenciacinen
seisnivelesdiferentes:

www.enfoqueseducativos.es

256

Nmero 2 noviembre -2007

Bsico:A1yA2
Intermedio:B1yB2.
Avanzado:C1yC2.

Esta escala global sencilla hace ms fcil comunicar las caractersticas


especficas del sistema a usuarios no especializados en el tema y a su vez
proporcionar orientaciones bsicas a los profesores y a aquellos que diseen los
currculos. Sin embargo para orientar a los profesores, alumnos y otros usuarios del
documento, se necesita una visin mucho ms detallada presentada en la forma de
HOJADEAUTOEVALUACIN,mostrandoaslascategorasdelusodellenguajepropias
decadaunodelosseisniveles.

El portfolio europeo de las lenguas tiene como objetivos las siguientes


premisas:

1. motivaralosalumnosmidiendosusesfuerzosparaampliarsuconocimientode
lalenguaextranjera.
2. proporcionarunarecopilacindelasdestrezaslingsticasyculturalesqueellos
hanadquirido.

El portfolio contiene un PASAPORTE DE LENGUAS que es actualizado por su


correspondienteusuario.Seleproporcionaunatabladondeloellapuedenofrecer
una descripcin de sus competencias lingsticas de acuerdo con el marco comn
europeo.

EstedocumentotambinpresentaunadetalladaBIOGRAFALINGSTICAenla
quesedescribelasexperienciasdelusuarioencadaunadelaslenguasextranjerasque
conoce y domina. Est expresamente diseada para promocionar una poltica de
plurilingualismo.

www.enfoqueseducativos.es

257

Nmero 2 noviembre -2007

Finalmente, encontramos el DOSSIER donde tenemos ejemplos de trabajos


personalestalescomoescritos,grabaciones

El portfolio puede ser muy til para los estudiante de cualquier edad puesto
quehacequelosusuariosaprendanporsmismos,esdecir,animaeldesarrollodela
autonomaenelprocesodeenseanzaaprendizaje.Serautnomosignificasercapaz
de tomar decisiones independientemente de lo que los dems puedan o no hacer.
(Decreto231/2007de31dejulio)

REFERENCIAS:

TheEuropeanPortfolioofLanguages.(2001)London.
Guilford, JP. (1977) La Naturaleza de la Ineligencia Humana. Paids. Buenos
Aires.
Marn Ibez, R. (1977) Principios De La Educacin Contempornea. Ediciones
Rialp.Madrid.

www.enfoqueseducativos.es

258

Nmero 2 noviembre -2007

ELUSODEFLASHCARDS(POSTERS)ENCLASE.

MTERESAPREZMONTALBN
DNI75070922A

Alguien dijo una vez: Una imagen vale ms que mil palabras. Nosotros
estamos de acuerdo con esta idea, ya que lo que la gente ve es almacenado en su
memoriadurantemuchomstiempo,yadems,lesproduceungranimpacto.Estoes
por lo que los profesores deberan utilizar flashcards en clase, puesto que pueden
considerarseunaayudavisualmuyvaliosaparapresentarinformacin.

Unaflashcardesuntrozopequeodepapel,ounatarjetadepresentacinque
tieneporunodesusladosunapalabranuevaescritaenelidiomaextranjeroquese
estestudiando,yporelotroladoencontramosotrapalabraexpresadaenelidioma
materna del alumno. Howard Gardeners teora de la inteligencia mltiple les
recuerda a los profesores que hay muy varios estilos de aprendizaje dentro de una
misma clase. La investigacin que l hace indica que los profesores deberan tener
como objetivo atraer a todos los alumnos en algn momento dentro del curso
acadmico.Esparticularmenteimportanteatraeraaquellosalumnosquedisponende
unainteligenciavisual,yaqueunagranmayoradenuestrosestudianteslaposeen.As
estaremos atendiendo a la diversidad, como expone el Decreto 231/2007 de 31 de
julio.

Porconsiguiente,losposterssondegranayudaencadaunadelasetapasde
clase. Son, por otro lado, una gran herramienta para llevar a cabo las siguientes
actividades:

Para presentar, practicar y reciclar vocabulario, expresiones idiomticas y


aspectos gramaticales cuando queramos dejar a un lado por un da nuestros
libros de texto u otros materiales. Las flascards utilizadas en estos contextos
aumentanlamotivacindelosalumnosy,portanto,leshaceaprenderdeuna
manera ms abierta. Adems, es incluso ms interesante si los profesores
hacen que los alumnos elaboren sus propios materiales que pueden ser
www.enfoqueseducativos.es

259

Nmero 2 noviembre -2007


llevadosacasapararepasar.Conestolosalumnossernmsconscientesdel
hecho de que deben aprender a ser responsables de su propio proceso de
enseanzaaprendizaje(mtodocentradoenelalumno,leselprotagonistade
nuestraclase).

Tambinsonbastanteefectivascuandoelprofesornotienetiemposuficiente
paradesarrollarunaclasederepasocompleja.

Cuando los alumnos se familiarizan con este tipo de actividades utilizadas en


clase,lasflashcardspuedenutilizarseparaqueaquellosqueterminenantesla
tareapropuestacomotrabajoextra.

Otroposibleusoqueselepuededaresparaquelosalumnospuedanrepasar
ellosmismossinlaayudadelprofesor.Esunaformadeautoevaluacin,quees
tambinnecesariaparapodercomprobarelprogresoquevanhaciendo.

Finalmente,mencionaremosalgunasposiblesactividadesquepodemosutilizar
enclase:

PONERAPRUEBALAMEMORIA:elprofesorcolocaunposterenelsueloenun
crculoylosalumnostieneunminutoparamemorizarlainformacin.Luego,en
grupos, ellos tienen dos minutos ms para escribir tantos nombres como
puedanrecordar.

ACTIVIDADES DE TPR: es necesario pegar las tarjetas por la clase para


seguidamente,nombrarunadeellas.Despus,losalumnosdebensealarlao
acercarse a ella. Una actividad alternativa podra ser que los alumnos den las
instruccionesasuscompaeros,parahaceraslaclasemsinteractiva

ACTIVIDADESDEIDENTIFICACIN:primero,tienesquecubrirlatarjetaconun
trozo de papel y lentamente se lo vas quitando. Despus, los estudiantes
adivinan cul es. De forma alternativa, cubre la tarjeta muy rpido para que
ellosslopuedanecharunvistazo.

Amododeconclusin,losprofesoresdeberanevitarpensarYorealmenteno
necesito este material, o No son tiles. Sin embargo, ellos deben considerarlas
comounamaneradeproporcionarvitalidadanuestrasclasesparamotivaranuestros
alumnos.
www.enfoqueseducativos.es

260

Nmero 2 noviembre -2007

REFERENCIAS:

Decreto231/2007de31dejulio.
Freinet,C.(1974)ModernizarlaEscuela.Laia.Barcelona.
VV.AA.(1993)JuegossinBarreras.Barcelona.
VV.AA(1994)LenguajesAlternativos.CEPE.Madrid.
Prado,D.(1988)TcnicasCreativasyLenguajeTotal.Ed.Narcea.Madrid.

www.enfoqueseducativos.es

261

Nmero 2 noviembre -2007

ELUSODELASNUEVASTECNOLOGASENCLASE

MTERESAPREZMONTALBN.
DNI75070922A

Porqudeberanlosprofesoresintroducirelusodelasnuevastecnologasen
clasecomounaherramientapedaggica?SegnelDecreto231/2007de31dejulio,
dondeseexponenlasdirectricesdelnuevocurrculodeeducacinsecundaria,unode
losaspectosquesetienenquecuidarestosdaseselusodeordenadoresytodoloque
ello conlleva. As que los primeros que tienen que actualizar sus habilidades con las
nuevastecnologassonlosprofesores.

Generalmente se tiende a asumir que si los contenidos curriculares son


presentadosenformatodigital,losalumnossesentirnmuchomsatradoshaciala
informacinexplicada.Sededucequelasfuentesdidcticasinteractivassonbastante
eficaces,puestoquelasnuevasgeneracionesdealumnoshancrecidoenunambiente
enelqueloscontextosaudiovisualessonimportantsimos,dejandolostextosaparte.

El universo que encontramos en Internet es extremadamente fascinante: all


todoessorprendenteeimpredecible,perosobretodo,absolutamentereal.

Es bastante obvio que las nuevas tecnologas no pueden ocupar el lugar de


todas las actividades llevadas a cabo en clase por los profesores, sino que pueden
constituirunaayudaexcelenteenmuchasocasiones.

Elaprendizajeinteractivotienenumerosasdefiniciones,yaquenohayuntipo
nico.Podramosdecirquesetratadeelaprendizajellevadoacaboatravsdelas
nuevastecnologas.

www.enfoqueseducativos.es

262

Nmero 2 noviembre -2007

Como profesores que somos, ICTs pueden conllevar enormes beneficios en


nuestras clases. Desde un punto de vista educacional, el uso de ordenadores aporta
dinamismoalasclases,haciendoquelosalumnoscontrolenmssupropioprocesode
aprendizaje, y tambin les motiva. Podemos dar un ejemplo muy ilustrativo: el
proyectoSMILE(LenguajedeSignosyActividadesMultimedia)fuecreadoparagente
sordaparaqueellospudieranestimularsushabilidadeslectorasy,comoconsecuencia,
reducir as sus problemas cuando intentaran aprender las reglas gramaticales de un
idioma.

Silosalumnosentranenunaclaseconesaactitudtanpositiva,elpotencialde
aprendizajeseveaumentado,ycomoconsecuencia,existenmsoportunidadespara
aprenderfueradelentornoescolar.

PortantoesvitalconsiderarlosICTscomounaherramientadisponibleparael
profesor, el cual tiene que verla como efectiva cuando se usa combinada con otras
tcnicas ms tradicionales, tales como leer textos y responder algunas preguntas,
buscarinformacin,prepararactividadesorales

Loscolegiosestnutilizandolosordenadorescadavezmsenlaactualidaden
la enseanza y en el aprendizaje de nuevos conocimientos, puesto que las nuevas
tecnologaseinternetyahanllegadoaloscolegioseuropeos.Dehecho,unaencuesta
europeaacercadelosprofesoresdemuestraqueconun96%deseguridadcasitodos
loscolegioseuropeostienenaccesoainternet.Adems,enningnpaslacifraestpor
debajodel90%.

Sin embargo, cules son las barreras ms importantes para el uso de las
nuevastecnologasenclase?ComoexponeWernerB.KorteyTobasHising,enEuropa
muypocosprofesoresseoponenalaintroduccindeestasherramientas.Un16%de
ellos piensan que su uso no aporta ningn beneficio. Eso es as debido a su falta de
entrenamientoenestecampoy,naturalmente,laactituddelosprofesoresinfluyeen
subuenuso.As,estosdosaspectossepuedenconsiderarcomograndesobstculos.

Por el contrario, la gran mayora de profesores europeos contemplan las


ventajas desu inclusin para as permitira losalumnos hacer actividades y practicar
www.enfoqueseducativos.es

263

Nmero 2 noviembre -2007


con el idioma (80%). Los problemas restantes estn relacionados con dificultades de
infraestructurayequipo:accesoalabandaanchadeinternettodavanoesposibleen
todos los centros. De hecho, los centros situados en areas densamente pobladas
tienen ms facilidades para tener este tipo de infraestructura que aquellos que se
encuentranenciudadespequeasopueblos.

A modo de conclusin, podemos imaginarnos el tipo de cambios que la


introduccin de las nuevas tecnologas va a provocar o est provocando en la
educacin, si no lo est haciendo ya en la actualidad. Formatos diferentes de
contenido se adaptarn a la situacin de cada alumno. Podremos aprender en la
cocina, o en el coche, mientras viajamos En el futuro, como ciudadanos de LA
SOCIEDAD DE LA INFORMACIN tendremos que adaptar nuestras vidas a esta
sociedad,queestnencontinuocambio.

REFERENCIAS:

VV.AA(1993)JuegossinBarreras.Barcelona.
Sanchez Manzano, E.(1993) Psicopedagoga y Educacin Especial. Universidad
Complutense.Madrid.
Freinet,C.(1974)ModernizarlaEscuela.Laia.Barcelona.
Decreto231/2007de31dejulioporelqueseregulanlosprincipiosbsicosde
laeducacinsecundaria.

www.enfoqueseducativos.es

264

Nmero 2 noviembre -2007

ESTILOSDEAPRENDIZAJE

MTERESAPREZMONTALBN
DNI75070922A

Enprimerlugartenemosquedecirquelosalumnosaprendendeformasmuy
diversasenfuncindesusexperienciasacadmicasanteriores,desusinteresesyde
susituacinactual.Elxitodeestetipodeactividadesdeformacindepende,engran
medida, del conocimiento de esas necesidades, as como de sus caractersticas,
actitudes e intereses. (Decreto 142/2002 de 14 de mayo por el que se regula la
atencinaladiversidad).

Debido a que la enseanza es considerada como un proceso que provoca


ciertoscambiosenelindividuo,esimprescindiblequelaactitudseapositiva.

El estilo de aprendizaje de los alumnos condiciona el estilo de enseanza del


profesor, y viceversa. En relacin a esto, podemos resaltar la existencia de distintos
modelos de aprendizaje que determinarn, al mismo tiempo, diferentes mtodos de
enseanza.

Dejando atrs los dos mtodos principales de enseanza (cognotivismo y


conductismo),losmodelosdeaprendizajefundamentalesson:

LAREACCINCONDICIONADADEPAULOV:paraaprendertienequeexistiruna
relacin causaefecto entre una accin especfica y un resultado. Segn este
modelo, la enseanza se basa en la repeticin de una serie de actividades
seguidasdepremiosocastigos.

ELCONDUCTISMODETHORNDIKE:elalumnoaprendecuandoestmotivado
para ello y que el aprendizaje se consolida a travs de la repeticin. Por lo
www.enfoqueseducativos.es

265

Nmero 2 noviembre -2007


tanto,esimprescindiblequeelprofesorsepacmomotivarasusalumnospara
queelprocesodeenseanzaaprendizajesedecorrectamente.

ELPSICOANLISISDEFREUD:lasemocionesysusefectosenlaconductadelos
seres humanos explican comportamientos difciles de entender. Lo que
queremos decir es que los problemas personales influencian las relaciones
entre alumnos y entre stos y los profesores. Como consecuencia, es
importante que el alumno trabaje a gusto, se deben utilizar mtodos
pedaggicostalescomolastutoras

LAVADESLDESCUBRIMIENTODEDEWEY:laenseanzasebasaenlaaccin,
enlasolucindeproblemasqueelalumnodebedescubrirporsmismo.

LA CONSTRUCCIN DEL INDIVIDUO SEGN PIAGET: el alumno aprende a


travs de la reconstruccin interna de toda la informacin que recibe. Esta
reconstruccin tiene que ser efectiva y para ello, debemos utilizar mtodos y
mediospedaggicos.Estaefectividadtambindependedeldesarrollocognitivo
delalumno.

Amododeconclusin,alahoradeprepararclasesdebemosreflexionarsobre
lasactitudesdelosalumnosantelaformacin,ascomodelasaptitudesyactitudes
msefectivasdelosprofesores.

REFERENCIAS:

Rodrguez Espinar, S. (1993) Teora Y Prctica De La Orientacin Educativa.


PromocionesyPublicacionesUniversitarias.S.A.Barcelona.
Tapia,A.(1997)MotivarparaelAprendizaje.Edeb.Barcelona.
HerasMontoya,L.(1997)ComprenderelEspacioEducativo.Aljibe.Mlaga.
AlonsoGallego, Money, P. (1995) Los Estilos de Aprendizaje. Mensajero.
Bilbao.

www.enfoqueseducativos.es

266

Nmero 2 noviembre -2007

www.enfoqueseducativos.es

267

Nmero 2 noviembre -2007

LACOMUNICACIN

MARATERESAPREZMONTALBN
DNI75070922A.

Para ser un buen docente debemos ser capaces de comunicarnos


correctamente,yaquedenosotrosdependequeelalumnoentiendanuestraspalabras
ono.(Decreto231/2007de31dejulio)

La comunicacin es el proceso mediante el cual los emisores receptores de


mensajes interactuan en un contexto social determinado. Ellos intercambian
informacin, que es el conjunto de datos, hechos o acontecimientos percibidos,
recogidosoregistrados.

Paraquenuestrasclasesseanefectivasdesdeunpuntodevistacomunicativo,
debemostenerencuentaquelacomunicacininterpersonalaconteceendosniveles:

1. verbal:atravsdelaspalabras.
2. noverbal:atravsdelasexpresionesfaciales,gestos,intensidad,modulacin
delavoz,aparienciafsica

Parece que slo una pequea parte de la posible conducta comunicativa es


verbal,mientasquelamayorparteescomunicacinnoverbal.Sehanhechoestudios
alrespectoyaparecenlossiguientesresultadosexpresadosenporcentajes:

7%comunicacinverbal
38%comunicacinvocal
55%expresinfacial.

www.enfoqueseducativos.es

268

Nmero 2 noviembre -2007

Con todo esto queremos decir que la comunicacin entre los alumnos y los
profesores depende en su gran parte en los llamados COMPONENTES
PARALINGSTICOS. De entre ellos vamos a destacar LA VOZ. sta se puede definir
como una segunda imagen. Las seales vocales pueden afectar drsticamente el
significado de lo que se dice y a cmo se recibe elmensaje, es decir, la misma frase
dichaenvariostonosdevozocondeterminadaspalabrasenfatizadaspuedetransmitir
mensajesmuydiferentes.

Por esta razn, el docente debe prestar mucha atencin a el volumen que
utilizacuandohabla,suentonacin,laclaridad,velocidad,yporltimodebecuidarsu
fluidez.

Amododeconclusin,eldocentedebetenerencuentatodosestosfactoresa
la hora de explicar en clase y por lo tanto, si su voz es su principal herramienta de
trabajo,debecuidarla.

BIBLIOGRAFA:

Foster,T.R.(1993)101MtodosparaGenerarIdeas.Ed.Deusto.Bilbao
Horst,N.(1995)PsicologadelaConductadelProfesor.Herder.
GuerreoOlid.P.(1998)EvaluacindelAprendizaje.UNED.Madrid.

www.enfoqueseducativos.es

269

Nmero 2 noviembre -2007

LAINTELIGENCIAEMOCIONAL.

MARATERESAPREZMONTALBN
DNI75070922A

Las emociones tienen un papel muy importante en nuestro aprendizaje, en


todaslasetapasdelavida.Esobvioquemuchasdenuestrasemocionesnosallanarn
elcaminohaciaelaprendizajeyotrasloobstaculizarn.Apriori,podramosdecirque
estadosanmicoscomolaalegra,elentusiasmooelcorajenosimpulsanparallevar
adelante cualquier proceso de aprendizaje. Sin embargo, la tristeza, el miedo o la
clerainvalidanelprocesodeaprendizaje.

EltrminoInteligenciaEmocionalserefierealacapacidadhumanadesentir,
entender, controlar y modificar estados emocionales en uno mismo y en los
dems. Por algo, en francs, se dice aprender "par coeur", de corazn, cuando se
memoriza algo. Las emociones y los sentimientos son esenciales en todo
aprendizaje.

Daniel Goleman (La inteligencia emocional en la empresa. Ed. Vergara.


ApndiceI. pg.385)haadpatadoelmodelodeSaloveyyMayerincluyendocinco
aptitudesbsicasemocionalesysociales:

Conocimiento de uno mismo: Saber qu se siente en cada momento y


utilizaresaspreferenciasparaorientarnuestratomadedecisiones.
Autorregulacin: Manejar las emociones de modo que faciliten la tarea
entre manos, en vez de estorbarla; recobrarse bien de las tensiones
emocionales.

Motivacin: Utilizar nuestras preferencias para orientarnos y avanzar


hacia los objetivos, para tomar iniciativas y ser muy efectivos y para
preservarfrentealoscontratiempos.

www.enfoqueseducativos.es

270

Nmero 2 noviembre -2007


Empata:Percibirloquesientenlosdems,sercapacesdeverlascosas
desde
su
perspectiva.

Habilidades sociales: Manejar bien las emociones e interpretar


adecuadamentelassituaciones;interactuarsindificultad.

El aprendizaje de los alumnos de competencias emocionales va a permitirles


alcanzarunmayordesarrollopersonal,unaumentoensuaprendizajeyunamejoraen
laconvivenciaenlasaulas.Enlaactualidad,losRealesDecretosquedesarrollanlaLey
Orgnica de Educacin recogen en su Anexo el desarrollo, entre otras, de
competencias para las relaciones interpersonales, para la autonoma personal y para
aprenderaaprender.

REFERENCIAS:

Bisquerra, Rafael (2000) Educacin emocional y bienestar. Barcelona: Praxis.


Goleman, Daniel (1997) Inteligencia emocional. Barcelona: Kairos.
Damasio,Antonio(2005)EnbuscadeSpinoza.Barcelona:Crtica.

www.enfoqueseducativos.es

271

Nmero 2 noviembre -2007


LAPRENSAESCRITA.

MARATERESAPREZMONTALBN
DNI75070922A

La prensa escrita es un recurso muy til en el aula ya que ofrece una gran
cantidad de datos, noticias y opiniones sobre temas de actualidad. As, debe ser
considerada como material habitual en la formacin. (Decreto 231/2007 de 31 de
julio)

Suutilizacinpuedeintegrarseendossentidos:

1. Convirtindolosenobjetodeestudio.
2. Paraestudiarlarealidadcontempornea.

Para hacer uso de los documentos de prensa de manera eficaz, habra que
tenerseencuentaunaseriedepautas,queexponemosmuybrevemente:
a)Consideracionesgenerales:laprensanodebeserutilizadacomounjuguete,nose
tratadeahoranosquhacervamosajugar,sinodeprogramaractividadesen
elaula.
b) La seleccin propiamente dicha: el documento que elijamos debe adecuarse a
nuestrosobjetivos,aladisponibilidadoelaccesoquetenemosadichainformacin.
c) Evaluacin de los documentos: antes de presentar ciertos documentos en clase
debemoshacernoslassiguientespreguntas:
Ayudaraalcanzarlosobjetivos?
Incorporaelementosdecomparacinyreflexin?,etc
La metodologa que debemos seguir en el aula a la hora de aplicar las tcnicas de
trabajoconprensaseajustaalosiguiente:
1)Activa:facilitaeltrabajoconjuntoentreeldocenteyelgrupodeaprendizaje:se
investiga,sedescubre...

www.enfoqueseducativos.es

272

Nmero 2 noviembre -2007


2) Dialogante: en la medida en que se utiliza la interaccin comunicativa como
medio para asociar a los alumnos en la elaboracin de su propio proceso de
aprendizaje.
3)Grupal:sepotenciaeltrabajocooperativo.
4)Flexibleyabierta,porqueessusceptibledemodificaciones.
5)Investigadora,yaqueseutilizaeltrabajoyeldescubrimientoparaqueelgrupode
aprendizajeanalicelosproblemas.

Consideramos que esta metodologa acta cubriendo un amplio abanico de


influenciascuyosefectosseproducenenelmbitocognitivo,enelafectivosocial,el
creativodinmicoyenelmbitorelacional.

REFERENCIASBIBLIOGRFICAS

MARTNEZPIS,F;NEZ,T.YSNCHEZDELVILLAR,G.(1995):Lastcnicasde
cooperacin activa en la Enseanza Secundaria, Sevilla, Consejera de
EducacindelaJuntadeAndaluca.
MIRAVALLES,L.(1985):Iniciacinalperiodismoescolar,Salamanca,Institutode
CienciasdelaEducacin.
NEZ,T.YLOSCERTALES,F.(1995):Elgrupoysueficacia.Tcnicasalservicio
deladireccinycoordinacindegrupos,Barcelona,EUB.
PREZ SERRANO, G. (1985): El anlisis de contenido de la prensa, Madrid,
UNED.
ROTGER, B. Y ROQUE, J. (1982): Cmo leer la prensa escrita, Madrid, Escuela
Espaola

www.enfoqueseducativos.es

273

Nmero 2 noviembre -2007

LASFOTOGRAFAS

MARATERESAPREZMONTALBN
DNI75070922A.

Lafotografaeselartedefijaryreproducirpormediodereaccionesqumicas
lasimgenesrecogidasenelfondodeunacmaraoscura(RealAcademiadelaLengua
Espaola). Actualmente, tenemos la suerte de contar no slo con fotografas
tradicionales,sinoquetambinhacemosbuenusodelasimgenesobtenidasatravs
decmarasdigitales.

La fotografa digital ha conseguido una gran calidad de imagen y adems se


trabajamsrpidamenteconellasporquelonicoquetenemosquehacerescapturar
la imagen y descargarla en nuestro ordenador para manipularla. Por otra parte, no
tienen ya un coste elevado. Por lo tanto, suponen un medio rpido y sencillo de
obtenerimgenes.

Enelmbitoeducativolacmaradigitalaadecreatividadalaformacinyest
especialmenteindicadaparalarealizacindeejerciciosdeexpresin,decomunicacin
odeejemplificacin.Tambinfavorecelaretencindeideasydatosimportantes.

Para Santos Guerra la imagen es figura, representacin, semejanza u


aparienciadeunacosa,esteautornossealaalgunasdelasfuncionesdidcticasdela
imagen:

Funcinmotivadora:rompeconlamonotona.
Funcin vicarial: se aplica en los casos en los que el objeto no se pueda
trasladaralaula,comoporejemplouncohete,obradearteetc
Funcinexplicativa.
Funcinfacilitadota.
Funcinesttica.
Funcincomprobadora:sepuedeverificarlainformacin.
www.enfoqueseducativos.es

274

Nmero 2 noviembre -2007


Funcin sugestiva: los alumnos son libres de interpretar lo que estn viendo,
aumentandoassucreatividad.
Funcinrecreativa.

Utilizandolasfotografasenclasepodemosaumentarlaatencindenuestros
alumnos,acercarlosaunarealidaddedifcilacceso,aunquenoseadaptenbienalos
grandesgrupos.(Decreto231/2007de31dejulio)

REFERENCIAS:

MARTNEZPIS,F;NEZ,T.YSNCHEZDELVILLAR,G.(1995):Lastcnicasde
cooperacin activa en la Enseanza Secundaria, Sevilla, Consejera de
EducacindelaJuntadeAndaluca.
MIRAVALLES,L.(1985):Iniciacinalperiodismoescolar,Salamanca,Institutode
CienciasdelaEducacin.
Guilford, J.P. (1977) La Naturaleza de la Inteligencia Humana. Paids. Buenos
Aires.
Freinet,C.(1974)ModernizarlaEscuela.Laia.Barcelona.
VV.AA.(1994)LenguajesAlternativos.CEPE.Madrid.

www.enfoqueseducativos.es

275

Nmero 2 noviembre -2007

LASVENTAJASDELTRABAJOENGRUPO.

MTERESAPREZMONTALBN
DNI75070922A

En el reformado currculo para la enseanza del ingls en Espaa, se


recomiendaponerenprcticaelaprendizajecooperativoycolaborador.Comotodos
sabemos, la enseanza y el aprendizaje del ingls en clase se caracteriza por la
comunicacinylaprcticaquetienenlugarentrelosalumnosyelprofesor,ascomo
entrelosalumnosmismos.(Ordende10deagostode2007).

Aspues,comoprincipalformadeaprendizajecooperativo,eltrabajoengrupo
es beneficioso para desarrollar competencias comunicativas, ya que no slo
incrementalacantidaddeprcticalingsticaporpartedelalumno,sinoquetambin
lesayudaadesarrollarsusentidodelaparticipacinyautonoma,quesonmuytiles
paranuestrasociedadhoyenda.

Enestesentido,lagentequepodraserreticentealahoradehablardelantede
unagranaudienciaahoratienesuoportunidadparacontribuir.Dehecho,paraelrea
de lenguas extranjeras, sta es la nica manera que tenemos de asegurar que los
alumnosobtenganlaprcticaquenecesitan.

De acuerdo con Wilkins, la interaccin lingstica es una actividad de


colaboracinquetienelugarenlascoversacionesdelavidarealdondeencontramos
lossiguienteselementospertenecientesalprocesodecomunicacin:

Elhablante
Eloyente
Elcontexto.

www.enfoqueseducativos.es

276

Nmero 2 noviembre -2007

Por lo tanto, en una clase de ingls, la comunicacin y las actividades de


simulacindeberanllevarseacaboatravsdelacooperacinentreelprofesorylos
alumnosoentrelosestudiantesmismosactuandocomoparticipantesenelprocesode
comunicacin; esto tiene la finalidad de hacer las clases ms interactivas y ms
cercanasalarealidad.Eltrabajoindividualnopuedellevaracaboestaprctica.

Considerandolainformacinanterior,podramosdecirquelosalumnostienen
un papel ms activo en clase puesto que el trabajo en grupo hace hincapi en las
habilidadesparalanegociacindesignificado(Krashen,1985).Comoconsecuencia,la
motivacin aumentarpuesto quecambia el ritmo de la clase y los alumnos pueden
mejorarsuprocesodeaprendizajegraciasalascontribucionesdesuscompaeros.

Amododeconclusin,afirmaremosqueeltrabajoengrupodeberautilizarse
siempre que sea posible para que los alumnos se puedan comunicar y puedan
interactuar ms para intercambiar y compartir informacin entre ellos. De esta
manera,laenseanzasermsfructferayefectiva.

REFERENCIAS:

Rodrguez Espinar, S. (1993) Teora Y Prctica De La Orientacin Educativa.


PromocionesyPublicacionesUniversitarias.S.A.Barcelona.
Tapia,A.(1997)MotivarparaelAprendizaje.Edeb.Barcelona.
HerasMontoya,L.(1997)ComprenderelEspacioEducativo.Aljibe.Mlaga.

www.enfoqueseducativos.es

277

Nmero 2 noviembre -2007

PORQUYCMOSEDEBERAUTILIZARLAPIZARRA?

MTERESAPREZMONTALBN
DNI75070922A

En clase los profesores pueden contar con muchas y tiles herramientas para
transmitirinformacinasusestudiantes.QuizunadelasmsutilizadaseslaPIZARRA
(quepuedeserdevarioscolores,entreellosblanca).

Apesardeserlamspopularenelcolegio,hayungrannmerodeprofesores
quenohacenusodeella,simplementeporquepuedepareceranticuadooinclusono
sabencmosacarletodoelrendimientoposible.

Por lo tanto, nos gustara desgranar aqu algunas de las razones en las que
podemos pensar para utilizar la pizarra de forma efectiva. Como una herramienta
visual altamente importante, puede ayudar al docente a llevar a cabo las siguientes
actividades:

PARA PROPORCIONAR NUEVA INFORMACIN: esta actividad consiste


bsicamenteen:

Presentargrficos,cuadros
Proporcionarreferenciasbibliogrficas
Hacerunresumendelosprincipalestemasquesevayanatratar
Paraescribirnuevasydifcilespalabras

www.enfoqueseducativos.es

278

Nmero 2 noviembre -2007


PARACOMUNICARSE:enesteapartadopodemossealarquelapizarraestil
paramotivarlainteraccinentrelosalumnos,animarlosparaqueestimulenla
cooperacin como mtodo eficaz de aprendizajes, para recordar aspectos
importantes

PARA EVALUAR: generalmente la pizarra nos sirve de gran ayuda para dar
retroalimentacin inmediata a los alumnos y adems para controlar el
progresoquevanhaciendoenclase.

OTRASRAZONES:finalmente,podemosproporcionarunamayorretencindel
material,hacerdelaclaseunambientedivertidoyrelajadoyreducirloscostes
deimpresinyascontribuiralamejoradelmedioambiente.

Unavezqueyahemosresumidoestasideasimportantes,eselmomentodedar
unaseriedeconsejosparamejorarnuestrousodelapizarra:

Se debe planificar y estructurar el trabajo que expresamos en la pizarra. Es


conveniente que hagamos un boceto de cmo quedara la pizarra con la
informacinquevamosaimpartir.
Setienequeincluirepgrafes,grficosyotrosmtodosdenfasisparasubrayar
informacinimportante.
Elprofesordebemoverselosuficienteparaquetodospuedanverloquehay
escrito.
Sedebeescribirdemaneralegibleylobastanteseparadacomoparanocrear
confusin. Quiz queris observar la pizarra desde el fondo de la clase para
comprobarqueseentiendetodo.
Esaconsejableponermaterialimportanteenaquellaszonasdelapizarraque
sonmsvisiblesparalosalumnos.
Finalmente,borratodalatizademaneraquenoquedenrestosdelaspalabras
anteriores,yaquesepodranconfundirconlanuevainformacin.

Para terminar, si nosotros la utilizamos correctamente, nuestros alumnos


recordarnlosdatosmsfcilmente,puestoquesehademostradoqueelserhumano
retienenmejorsivenloquedebenmemorizar,msqueleyendooescuchando.

REFERENCIAS:

www.enfoqueseducativos.es

279

Nmero 2 noviembre -2007

MenchnBelln,F.(1993)DimensinCreativa.Santillana,Madrid.
MarnIbez,R.(1972)PrincipiosdelaEducacinContempornea.Ediciones
Rialp.Madrid.
HerasMontoya,L.(1997)ComprenderelEspacioEducativo.Aljibe.Mlaga.
Tapia,A.(1997)Motivarparaelaprendizaje.Edeb.Barcelona.

www.enfoqueseducativos.es

280

Nmero 2 noviembre -2007


PRINCIPIOSDELAPRENDIZAJE.
MTERESAPREZMONTALBN
DNI75070922A.

RubnArdila,PedagogoquehadesarrolladoSistemasdeCapacitacin,resume
losfundamentosdelosprincipiosdelaprendizaje,comosigue:
Primer principio: El refuerzo ms efectivo en el proceso del aprendizaje es
aquelquesiguealaaccinconunamnimademora.Laefectividaddelesfuerzo
disminuye con el paso del tiempo, y muy pronto no tiene casi ninguna
efectividad.

SegundoPrincipio:Lamximamotivacinparaelaprendizajeselogracuando
la tarea no es demasiado fcil ni demasiado difcil para el individuo, pues as
lograsatisfaccin.

Tercer Principio: El aprendizaje no es proceso simplemente intelectual, sino


que tambin emocional. El individuo tiene metas en el proceso de aprender
quedebenserclarasyprecisasparaqueseanmotivadoras.

Cuarto Principio: Aprendemos a travs de los sentidos, especialmente de


sentido de la vista y del odo, por lo que se deben considerar como recursos
paraeldesarrollodeesteproceso.

Quinto Principio: Generalmente lo que aprendemos lo vinculamos con lo que


sabemos, es decir, partimos de encuadres particulares para darle valor a la
enseanza.

SextoPrincipio:Regularmenteaprendemosunacosaalavez.Porello,setrata
dedelimitarlomsclaramenteposible,lasdistintasunidadesdeaprendizaje.

www.enfoqueseducativos.es

281

Nmero 2 noviembre -2007

Sptimo Principio: Cada persona aprende en grados distintos o a velocidades


diferentes dependiendo de sus conocimientos, habilidades y desde luego al
niveldeinteligenciaqueposea.

Comopodemosver,elaprendizajeesunaactividadbastantecomplejaquehay
que cuidar mucho para que se pueda dar de manera efectiva. Lo ms importante es
adaptar nuestra metodologa a las necesidades especficas de nuestros alumnos.
(Decreto142/2002de14demayodondeseregulalaatencinaladiversidadenla
educacinsecundaria)

REFERENCIAS:

Rodrguez Espinar, S. (1993) Teora Y Prctica De La Orientacin Educativa.


PromocionesyPublicacionesUniversitarias.S.A.Barcelona.
Tapia,A.(1997)MotivarparaelAprendizaje.Edeb.Barcelona.
HerasMontoya,L.(1997)ComprenderelEspacioEducativo.Aljibe.Mlaga.
AlonsoGallego, Money, P. (1995) Los Estilos de Aprendizaje. Mensajero.
Bilbao.

www.enfoqueseducativos.es

282

Nmero 2 noviembre -2007

USODETRANSPARECIASENCLASE

MARATERESAPREZMONTALBN
DNI75070922A

Latransparenciaesunalminadeacetatotransparente.Esconsideradacomo
elmaterialmssencillo,directoycomnquesepuedeproyectar.

Esunmaterialutilizadoparalarealizacindeesquemasygrficos,porqueen
ellasedebeincluirlamnimaymssignificativacantidaddeinformacin.

Entresuscaractersticaspodemosdestacarlassiguientes:

Buenavisibilidad:setienequerealizardetalmaneraqueseavistasinesfuerzo
desde los ltimos puestos del aula con letras GRANDES y dibujos con trazos
gruesos.
Claridad:elcontenidodebeseridentificadoporlosalumnossinproblemas.Por
esolosdatosdebenestarbienseparados.
Sencillez:debemosincluirpocosdatosybienordenados.
Equilibrio: las diferentes partes de la transparencia deben guardar cierta
proporcin.
Nitidez:utilizartiposdeletrasfcilesdereconoceryentender.
nfasis: tiene como objetivo atraer la atencin del espectador hacia la
informacin.

Tenemosdosmtodosespecficosparaconfeccionartransparencias:

Porcopiadeloriginal.
Porcreacindirectasobreeloriginal:estosepuedellevaracabopormediodel
ordenadorodeformamanual.

www.enfoqueseducativos.es

283

Nmero 2 noviembre -2007


Lasventajaseincovenientesquepresentason:
ventajas

incovenientes

o Sonfcilesdeusar.
o Sonfcilesdeconfeccionar.
o Se pueden utilizar tanto en
grandes como en pequeos
grupos.
o Se proyectan con luz
ambiente.
o Ordenan y esquematizan los
contenidos.
o Seadaptanacualquiertema.

o Requieren
equipo
de
proyeccin.
o La transparencia no es
efectiva para transmitir mucha
informacin.
o Las ilustraciones en color son
caras.

Finalmente,yaquetienemsventajasqueincovenientes,seraaconsejableque
elprofesorutilizardevezencuandoestemtododidcticotradicionalparadesviarla
atencindelosalumnosdeloslibrosdetextohaciaalgodiferente.

REFERENCIAS:

www.enfoqueseducativos.es

284

Nmero 2 noviembre -2007


MARTNEZPIS,F;NEZ,T.YSNCHEZDELVILLAR,G.(1995):Lastcnicasde
cooperacin activa en la Enseanza Secundaria, Sevilla, Consejera de
EducacindelaJuntadeAndaluca.
MIRAVALLES,L.(1985):Iniciacinalperiodismoescolar,Salamanca,Institutode
CienciasdelaEducacin.
NEZ,T.YLOSCERTALES,F.(1995):Elgrupoysueficacia.Tcnicasalservicio
deladireccinycoordinacindegrupos,Barcelona,EUB.
PREZ SERRANO, G. (1985): El anlisis de contenido de la prensa, Madrid,
UNED.
ROTGER, B. Y ROQUE, J. (1982): Cmo leer la prensa escrita, Madrid, Escuela
Espaola

www.enfoqueseducativos.es

285

Nmero 2 noviembre -2007

LOSNUEVOSPROGRAMASDECUALIFICACINPROFESIONALINICIAL

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

ElConsejodeEuropareunidoenLisboaenelao2000definilasnuevas
lneas que deberan seguir las polticas de los pases miembros de la Unin
Europea. Dentro de estas directrices se remarc la necesidad de favorecer el
desarrollo deciudadanos/ascapacesdeadaptarsealosrpidos cambiosquese
estnproduciendoenelmbitosocial,econmicoyprofesional.Enestesentido
elsistemaeducativoyformativodecadapasjuegaunpapeldestacadoentanto
encuantounadesusfinalidadesfundamentalesesgarantizareldesarrolloglobal
delossujetosentodassusdimensiones.
Por tanto uno de los grandes objetivos es fomentar el aprendizaje
permanente. De esta forma se permitira a los/as ciudadanos/as moverse
librementeenentornosdeaprendizaje,movilidad,oprofesionales,potenciando
al mximo sus conocimientos y aptitudes. El aprendizaje permanente debe
garantizaralosmiembrosdelasociedadpoderadaptarsealosgrandescambios
econmicos, sociales y profesionales, para poder participar activamente y con
garantasdexitoeneldesarrollodelasociedad.
LaLeyOrgnica2/2006,de3demayo,deEducacin,adoptaesteespritu
europeo y establece una serie de iniciativas tendentes a facilitar la formacin y
la profesionalizacin de su alumnado, al mismo tiempo que intenta situarse
dentrodelamediaeuropeaencuantoaxitoacadmicoserefiere.
Los Programas de Cualificacin Profesional Inicial forman parte de este
conjunto de medidas prevista en esta ley orgnica. El objetivo fundamental de
esta medida es potenciar la adquisicin de las competencias profesionaes
propias de una cualificacin de nivel uno de la estructua del Catlogo Nacional
deCualificacionesProfesionales,ascomofavorecerlainsercinsociolaboralyla
www.enfoqueseducativos.es

286

Nmero 2 noviembre -2007


mejora de las competencias bsicas para proseguir estudios en las diferentes
enseanzas. Estos programas estn dirigidos al alumnado mayor de diecisis
aos que no hayan obtenido la titulacin correspondiente a la Etapa de
Educacin Secundaria Obligatoria. No obstante, tambin pueden participar en
estos programas aquellos sujetos de quince aos que habiendo cursado el
segundo curso hayan repetido ya alguna vez y no est en condiciones de
promocionaratercero.
Los Programas de Cualificacin Profesional Inicial se estructuran en tres
mdulos:
a.

Mdulos especficos, en los que se abordan las competencias

profesionalescorrespondientes.
b.

Mdulos formativos de carcter general, cuya finalidad es

aumentarlascompetenciasbsicas.
c.

Finalmente aquellos mdulos dirigidos a la consecucin del ttulo

deGraduadoenEducacinSecundaria.
El alumnado que, al finalizar el programa, consiga alcanzar las
competenciasbsicasylosobjetivosgeneralesdeetapapodrnobtenerelttulo
deGraduadoenEducacinSecundaria.
Los Programas de Cualificacin Profesional Inicial aportan una serie de
novedadesconrespectoalosquepodramosllamarcomosusantecesores,los
ProgramasdeGarantaSocial(PGS):
Estos programas permiten la obtencin del Ttulo de Graduado en
EducacinSecundaria,mientrasquelosPGSnopermitanestaopcin.
Aumentan el intervalo de edad de inicio del programa, ya que los/as
alumnos/asinclusodequinceaospuedenaccederalosmismos.
Ofrecen al alumnado la posibilidad de certificar aquellos mdulos
obligatorios que superen. De esta forma esta certificacin tendr efectos de
acreditacin de las competencias profesionales adquiridas en relacin con el
SistemaNacionaldeCualificacionesyFormacinProfesional.

www.enfoqueseducativos.es

287

Nmero 2 noviembre -2007


Bibliografa:
*LeyOrgnica2/2006,de3demayo,deEducacin.
*Decreto231/2007de31dejulio,porelqueseestablecelaordenacinylas
enseanzascorrespondientesalaeducacinsecundariaobligatoriaenAndaluca.

www.enfoqueseducativos.es

288

Nmero 2 noviembre -2007

CMOHACERQUELOS/ASALUMNOS/ASTMIDOS/ASPARTICIPENENCLASE?

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

En el actual sistema educativo la participacin en clase es fundamental. La


participacin del alumnado juega un papel primordial con las actividades orales,
practicandoasloquehanaprendido.Peroesteaspectoenelprocesodeaprendizaje
noestanfantsticoyrealporqueencontramosestudiantesconautnticosproblemas
detimidez.
La enseanza de la lengua inglesa durante mucho tiempo fue considerada
similaralaenseanzadelaslenguasclsicas.EstabarespaldadaporelllamadoSilent
Meted donde el maestro/a era el principal protagonista de la obra. Despus de un
largo perodo de tiempo, la situacin cambi en cierta manera y ahora, ya hay dos
protagonistas,elprofesoryelestudiante.
Pero,quocurreconaquellosestudiantesquenosoncapacesdeparticiparen
clase por su timidez y que a causa de esto se bloquean constantemente?. En estos
casos,tenemosqueencontrarlacausaporlaqueelalumnonopuedehablarenclase.
Estasituacinsepuededarpordosrazonesprincipalmente:enprimerlugar,porque
noconocelalenguaytemeequivocarsecuandohable,yotrosqueconocenlalengua
peronecesitanalgoqueloshagatomarlainiciativaparaexpresarseeningls.
Enelprimercaso,tenemosqueaveriguardondeestesevacodeinformacin
yadaptarsuconocimientodelalenguaalniveldelaclase.Esmuyimportantevalorar
sus aciertos y no prestarle tanta atencin a sus fallos. El trabajo en grupo les puede
servirdemucho,perohayquetenercuidadoconlascaractersticasdedichogrupo.
www.enfoqueseducativos.es

289

Nmero 2 noviembre -2007


Enelsegundocaso,nopodemosobligaralapersonaaquehableporqueeso
provocara una situacin de ansiedad mucho mayor. La accin de hablar debe
producirse de forma natural. Pero nosotros podemos ayudar ofreciendo temticas
atractivasy,porsupuesto,valorandopositivamentelaparticipacindelapersona.Es
esencialnoponeraesaspersonasjuntoconotrasquepuedenrelegarlasaunsegundo
plano.
Noesfciltrabajarconlatimidez,peroelsecretoestenencontrarsuraz,su
razn.Eslanicamaneraquehaydecaminarhaciaunasolucin.Parasersincerael
problema podra ser minimizado si se trata con ayuda psicolgica y pedaggica. No
podemostrabajarsolos.
Bibliografa:
*RodrguezEspinar,S.(1993).TeorayPrcticadelaorientacineducativa.Barcelona.
PPU.
*Montan,J.yMartnez,M.(1994).Laorientacinescolarenlaeducacinsecundaria.
Barcelona.PPU.
*Martnez Muoz, M. (1995). La orientacin del clima del aula. Departamento de
PedagogaAplicadadelaUAB.Barcelona.

www.enfoqueseducativos.es

290

Nmero 2 noviembre -2007

DOCENCIAYTUTORA.DNDEESTNLOSLMITES?

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Gran parte del profesorado que son tutores/as o lo han sido durante un ao
acadmico lo saben: Dnde establecemos los lmites entre las lecciones y los
problemas y los asuntos relacionados con nuestra funcin tutorial?. La pregunta es
muycomplejaperolarespuestaclaracomoelagua.LaLeyOrgnica2/2006,de3de
mayo,deEducacinestablecequelaaccintutorialesinherentealafuncindocente.
Estoquieredeciralgomuysencillonoimportasiun/aprofesor/aestutor/ao
no.Losasuntoseducativossonmsimportantesquecualquieroperacinmatemtica
oconceptogramatical.Aunqueestonoquieredecirquetengamosquedejaraunlado
nuestra materia a cada vez que se produzca un tema controvertido en clase. El
alumnado es muy listo y se aprovecha de los/as tutores/as buenos/as y
comprensivos/as.Puedesonarunpocoextraoperopodemosdarunclaroejemplode
ello.
Soytutoradeungrupode2deESO,tenemostreshorasdeinglsalasemana,
dos de ellas son a ltima hora. Estas dos horas son terribles, estn cansados,
hambrientos y la ltima cosa que quieren hacer es dar ingls (o cualquier otra
materia).Lamejorcosaqueellos/aspuedenhacerescrearunasituacincomoesta:
tutora, tutora, tenemos un problema!. A veces, incluso son ms directos estamos
cansadosynoqueremosdaringls,vamosahablardelsexo,delasdrogasodeloque
sea!,tansimplecomoeso.

www.enfoqueseducativos.es

291

Nmero 2 noviembre -2007


Estossonsustemasfavoritos,sexo,drogasyviolencia.Hablamosdeelloenlas
tutoras que tenemos una vez a la semana, al igual que tambin lo hacemos sobre
tcnicas de estudio, relaciones entre compaeros de clase, pero ellos saben que a
nosotrosnosinteresasusrelacionessocialesypersonalesyportanto,intentansacar
estostemastantasvecescomopuedan.
Loquetenemosquesaberescundoexisteverdaderamenteunproblemaquedebe
ser tratado con urgencia, y cundo se nos est dando una excusa para perder la
clase. En estas situaciones es conveniente hablar de esos temas pero en nuestro
caso usando la lengua inglesa, en conclusin, hacer un trato, dejar a un lado la
materiayhaceralgomsdivertidoconlostemasqueaelloslesgusta;aunquesies
posibleevitarhablarsiempredelaviolencia,elsexo,lasdrogas.Afortunadamente
nuestroslibrosymaterialesdidcticoshancambiadoeintentanreflejarelmundo
realdeunamaneramuyapropiadaasuedad.Ypodemosporelloanticiparnosasus
actividadeschantajistas.
Finalmente, es importante que ellos se sientan a gusto con la figura del/a
tutor/a y , si no lo somos, con el profesor/a pues somos su soporte, no debemos
olvidarnosdequesomoseducadoresyquealgunosnios/asnocuentanconelapoyo
familiarquenecesitan.Esnuestraresponsabilidadestarahenlosmomentosmalosy
buenos.

Bibliografa:
*BISQUERRA, R. Y ALVAREZ, M. (1999): Manual de Orientacin y tutora. Barcelona:
Cisspraxis.
*GALVE,J.L.(2002):OrientacinyAccintutorial.Madrid:Cepe.
*MEC(1990).LaOrientacineducativaylaIntervencinPsicopedaggica.Madrid:
ServiciodePublicaciones.DireccingeneraldeRenovacinPedaggica.

www.enfoqueseducativos.es

292

Nmero 2 noviembre -2007


*MEC (1992): Orientacin y Tutora. Materiales curriculares para la Educacin
Secundaria.Madrid:ServiciodePublicaciones

ESCRIBIR:CMOYCUNDO?

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Cundo debera nuestro alumnado comenzar a escribir en ingls? La


respuesta es clara: tan pronto como estn preparados para hacerlo. No importa la
longitud de sus palabras, oraciones o prrafos. Lo importante es escribir para que
expresenloquesienten,loquequieren,loquesaben,loquenecesitan...
Es muy importante hacerles conscientes de la importancia de escribir en
cualquierlengua.Enprimerlugar,tienenqueserconscientesdehacerloensulengua
materna y despus en la lengua que aprendan. Tambin es necesario darles la
oportunidad de demostrar lo que saben y lo que no saben, es decir, tenemos que
tomar en consideracin que se van a cometer errores, pero que va a ser la nica
maneradequeaprendanalgo.
Debemos ser permisivos con expresiones incorrectas,errores de coherenciay
cohesin,perosiempreteniendoencuentaelnivelconelqueestamostrabajando.En
cualquier caso, el reforzamiento positivo ser importante para evitar miedo y as
conseguirquecontinenescribiendo,loquesea,ejercicioocomposicin,elpropsito
eselmismo.
Algunas actividades que se pueden proponer en los niveles ms bsicos de la
ESO son: traducciones simple banana, pltano, escribir una palabra de forma
correctakichent,kitchen,crucigramas,sopadeletras,ahorcado.
www.enfoqueseducativos.es

293

Nmero 2 noviembre -2007


Poco a poco iremos avanzando con actividades como: traducciones, rellenar
huecos,completarlasoraciones.Estasactividadessonmuybsicas,peropocoapoco
podemos ir avanzando hacia otras ms complejas. Una de ellas sera apuntar tres o
cuatropalabrasenlapizarraquetenganqueverconlaunidaddidcticaqueestamos
tratando,yqueconesaspalabrasescribanoracionesounahistoriasimple,aunqueno
tengamuchosentido.
FinalmenteperonomenosimportantesonlosgrupossuperioresdelaESOyde
Bachillerato. Tambin tiene un cierto grado de dificultad el pensar en nuevas
actividades de escritura con ellos. Se supone que a estas alturas tienen un amplio
vocabulario, conocen muchas estructuras y la tarea ms encomendada es la de:
escribe una composicin entre 100 y 150 palabras sobre uno de estos temas. Esto
puedesertilperopodramosaadiralgnelementomsoriginalcomopuedeserno
establecerunlmitedepalabras(asvemosqulmiteseponenellosmismos),elegir
temas ms apasionantes y dejar a un lado los famosos Tu programa de televisin
favorito,Tusvacaciones.

Bibliografa:
*Scheurweghs,G.(1999).Present.dayEnglishSiyntax.Longman.London.
*Kruisinga,E(2000).GrammarandIdiom.Groningen.
*LarsenFreeman,D.(2000).Techniquesandprinciplesandlanguageteaching.
Oxford:Oup.

www.enfoqueseducativos.es

294

Nmero 2 noviembre -2007

USODELASTICSENELPROCESODEENSEANZAYAPRENDIZAJE

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Vivimos en una sociedad caracterizada fundamentalmente por los rpidos y


continuoscambiosqueseproducenencualquieradesusmbitos.Eneltranscursode
variasdcadashemospasadodeunasociedaddesinformadaaunasociedadmarcada
y dominada por el llamado cuarto poder. Los medios de comunicacin ejercen un
fuerteimpactoentrelosciudadanosobligndolesadesarrollarestrategiasdirigidasa
seleccionar, organizar y analizar la gran cantidad de informacin procedente de esos
medios.
EnelterrenoeducativolasllamadasNuevasTecnologasdelaInformaciny
la Comunicacin (en adelante NTICs) estn propiciando un cambio de roles y de
perfilestantodelprofesoradocomodelalumnado.Elpapeldelprofesoradocomo
mero transmisor de informacin no es compatible con esta nueva tecnologa. El
docente del Siglo XXI deber ir compaginando progresivamente los recursos
educativostradicionalesconnuevasestrategiasdesoportedigital.Sinembargo,de
nada servira contar con una potente infraestructura si no se aprovechan las
enormes potencialidades educativas de las nuevas tecnologas. De esta forma se
considera imprescindible la introduccin de estos contenidos en los proyectos
formativos de los futuros profesionales de la enseanza, as como una revisin y
actualizacindelacarreraprofesionaldelosactualesdocentes.
Porotraparte,elalumnadodelaeradigital,debeirmodificandosuperfilen
el proceso de enseanza y aprendizaje como mero receptor de contenidos. Las
NTICsobliganalosdiscentesdehoyendaaadoptarunpapelprotagonistaensu
propioprocesodeaprendizaje,detalformaquelainteraccinconesoscontenidos
www.enfoqueseducativos.es

295

Nmero 2 noviembre -2007


requerir una retroalimentacin (se traduce como feedback, por si no lo sabas)
continua.
La aplicacin de las NTICs al proceso de enseanzaaprendizaje lleva consigo
unaseriedeventajasentrelasquepodemossealarlassiguientes:
+Rapidezenlatransmisindeinformacin.
+Gracias a las nuevas herramientas tecnolgicas el envo de informacin se
puederealizarmasivamenteydemanerainstantnea.
+ElusodelasNTICsfavoreceyexigeenelprocesodeenseanzayaprendizajeun
procesodecomunicacinmultidireccional

Profesorado

Alumnado

Alumnado

+Ahorroenergtico(menorusodelpapel).
+Acceso a una gran cantidad de informacin. Sin embargo, este hecho debe
hacer al usuario de estas tecnologas una persona tremendamente selectiva puesto
quenotodalainformacinquesepuedeextraerestilenelprocesodeenseanzay
aprendizaje.
+Potencialaautonomadelalumnado.

www.enfoqueseducativos.es

296

Nmero 2 noviembre -2007


+El uso de las NTICs favorece la atencin de la diversidad de condiciones del
alumnadodeloscentroseducativos.Deestaformapodemosutilizarunavariedadde
recursostecnolgicosparaatenderdesdeelalumnadoconalgntipodediscapacidad
fsica(deficientesvisuales,auditivos,motricos,etc.),cognitivahastaaquelalumnado
con alguna desventaja sociocultural (alumnado inmigrante, alumnado procedente de
ambientessocialesdesfavorecidos,etc.).

A pesar de todas estas ventajas, al hablar de las NTICs en los procesos de

enseanzayaprendizajetambinencontraremosaspectosmenospositivosquevana
influirnegativamenteenelusodeestosrecursos:
+Falta de disponibilidad de recursos. A pesar del mundo global en el que nos
encontramos no todo el mundo tiene posibilidad de acceder a los nuevos recursos
tecnolgicos(Internet,ordenadores,etc.).
+Falta de formacin en el mbito de las NTICs. Dice un viejo refrn No se
puede empezar la casa por el tejado. Efectivamente no podemos empearnos en
comenzarautilizarestasnuevasherramientassipreviamentenosehallevadoacabo
un proceso de formacin adecuado. En caso contrario y, como estamos observando
habitualmente,nosencontramosconunmalusodeestastecnologastantoporparte
delprofesoradocomoporpartedelalumnadoloquerepercutenegativamenteenel
resultadodelprocesodeenseanzaaprendizaje.
+Faltadeconfianzaenlosrecursostecnolgicos.Apesardelapotencialidadde
estosrecursosmuchosdocentesdudandelaeficaciadelosmismos,hechoprovocado
fundamentalmenteporelmiedoquemuestranaperdersuprivilegiadaposicinenel
procesodeenseanzayaprendizaje,dondeseconsiderancomolafuenteprincipalde
conocimiento.

BIBLIOGRAFA:

www.enfoqueseducativos.es

297

Nmero 2 noviembre -2007


*CABERO ALMENARA, J. (2003): Las nuevas tecnologas aplicadas a los procesos de
orientacineducativa.Bermejo,B.yRodrguez,J.(2003):Laorientacineducativayla
accintutorialenlaenseanzasecundaria.Sevilla:GID.
*BARBA,C.yCAPELLA,S.(2003):Lawebquest:unaaventuradelconocimient.Aula
TIC,n8,pp12.
*PANTOJA, A. (2002): El modelo tecnolgico de intervencin psicopedaggica.
RevistaEspaoladeOrientacinyPsicopedaggica,vol.13,n2,pp189210.

www.enfoqueseducativos.es

298

Nmero 2 noviembre -2007


PORQUHAYALUMNOS/ASQUENOAPRENDENINGLS?

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Es verdad que hay una gran cantidad de estudiantes que tras muchos aos
asistiendoaclasesdeinglsnoentiendenlosconceptosyestructurasmsbsicas
delalenguainglesa,ynosotroscomodocentesdelalenguaextranjeranosabemos
quhemoshechomalconellos/asyconnostros/asmismos/as.
Un aspecto esencial que debemos tener presente es que aprendemos si
entendemos.Sinocaptamoslaideaoelconceptoquizspodemosmemorizarlo,pero
en un corto periodo de tiempo lo olvidaremos, es inevitable. Por eso debemos
asegurarnosdequeelalumnadoentiendacadacosaqueenseamosenlaclase.Una
forma de hacerlos entender es utilizar ejemplos, presentaciones atractivas de
vocabulario, por ejemplo, a travs de dibujos, flashcards y materiales autnticos
(entradasdecine,billetesdemetro,etc.).
Unapresentacinmontonadecadaleccinsinunainformacincomprensiva,
puede provocar lo que estamos viendo hoy en da: que muchos/as estudiantes
abandonanlaasignaturaantesdequeacabeelprimertrimestre.Porltimo,perono
menos importante es el uso del material extra que se le puede ofrecer a aquel
alumnadoquenopuedealcanzarelnivelexigidoenelcurso.
El reforzamiento positivo sin duda ser esencial y bienvenido para todo el
mundo.

Bibliografa:
www.enfoqueseducativos.es

299

Nmero 2 noviembre -2007


*Defior,S.(1990).Dificultadesdeaprendizaje.Aljibe.Mlaga.
*Beltrn , J. (1995). Trastornos de aprendizaje. Diccionario de Ciencias de la
Educacin.Anaya.Madrid.
*Greenbaum,S.AndQuirk,R.(1990).AStudentsGrammaroftheEnglishLanguage.
Longman.London.
*Howat,A.(1984).AstoryofEnglishlanguageteaching.Oxford:Oup.

www.enfoqueseducativos.es

300

Nmero 2 noviembre -2007

NAVIDADESDIFERENTES:APLICACIONESDIDCTICAS

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Estas fiestas son muy apropiadas para hacer tantas cosas distintas en clase pero
tambin tenemos que ser conscientes de que podemos caer en la monotona de
todos los aos, y que podemos pensar en nuevas tareas, proyectos y de esta
maneradejaraunladolastpicastarjetasdenavidad,porejemplo.Nosonmalas,
en absoluto, porque cada cosa que quieran crear ser bienvenida, pero es bueno
queabransumenteacosasnuevas.
Afortunadamentecontamosconlaayudadelasnuevastecnologas,sinirmslejos
Interneteslomscercanoatodos/as.Podemossugeriralalumnadoquebusque,
quenavegueyqueencuentreelregalomssorprendente,lacosamsextraa,etc.
relacionadaconlanavidad.
Hayquetenerencuentaelniveldelgrupo,noeslomismotrabajarcon1y2dela
ESO que con 3, 4 o Bachillerato. Aunque tambin es cierto que una misma
actividadpuedeadaptarseacadaunodelosniveles.
Creacin de Postales Navideas utilizando fotografas extradas de Internet, en
lugardeltpicodibujonavideo.
Decoracin de un rbol de navidad con la fotografa del alumnado pegada en las
bolas.
Adaptacindelaletradeunvillancico,utilizandosintonasactuales.
Elalumnadodeotrospasesqueestnennuestrocentrojuegantambinunpapel
muy importante. Pueden hablarnos de sus costumbres en lo que se refiere a

www.enfoqueseducativos.es

301

Nmero 2 noviembre -2007


comidas, bebidas. La figura de Papa Noel y los Tres Reyes Magos, del Beln y del
rboldeNavidad,sontambintemasquepodemosexplotar.
Para los grupos de Bachillerato o 4 de la ESO, las actividades mencionadas
anteriormentepuedenhacersetambin.
Peropodemosirmsallanymiraresasfiestasconotrosojos,porejemplodesde
el punto de vista del consumismo. Se puede pedir al alumnado que navegue por
Internet y que busque el regalo ms caro que pueda encontrar, las ofertas de
hoteles para das sealados como Nochevieja...y con toda esta informacin se
puedeelaborarunabuenaexposicin,unanunciocurioso,osimplementehacerun
buendebate.
Esmuyimportantecrearunabuenaatmsfera,especialmente,estosdas.Muhcos
de nosostros /as podemos estar tristes, no sentirnos bien por razones diversas,
otroslasdisfrutanapesardelcambioquehansufridoafinalesdelsigloXXyfinales
delXXI,entodocaso,tenemosqueserrespetuososconsusemocionesyopiniones.
Bibliografa:

Blzquez Entonado, F. Et al (2002). Didctica General. Pearson


educacin.Madrid.

Rodrguez Diguez ,j.L. y Sevillano Garca, ML. (2002). Diseo,


desarrolloeinnovacindelcurrculoenlasinstitucionesedcuaivas.Ed.
Universitas.Madrid.

Coll, C. Palacios, J. y Marchesi, A. (1990). Desarrollo psicolgico y


educacin.Alianza.Madrid.

www.enfoqueseducativos.es

302

Nmero 2 noviembre -2007


LA ENSEANZA DEL INGLS EN EL ALUMNADO CON NECESIDADES EDUCATIVAS
ESPECIALES.

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Hoy en da en nuestras clases de ingls tenemos grupos hetereogneos con


diferentes niveles de competencia curricular y por tanto con diferentes niveles de
conocimientodelalenguainglesa.
Desdemipropiaexperiencia,tengoqueconfesarqueesmuydifciltrabajarcon
estudiantesconnecesidadeseducativasespeciales,ocomoactualmentesehapasado
adenominaralumnos/asconnecesidadesdeapoyoeducativoespecfico,yqueestn
junto a otros que no necesitan tantas ayudas para trabajar y comprender la nueva
lenguaqueselesestenseando.Perodeigualmaneraesmuycuriosoobservarde
qumaneraestoschicos/assoncapacesdetrabajarconelrestodelaclasesinestar
desplazados. Algunas veces no es fcil encontrar la manera de hacerlo pero no es
imposibleenabsoluto.
Esmuyimportantehaceralalumnadoconscientedesusituacinconrespecto
al resto de la clase. Tenemos que ser conscientes de cul es su nivel de ingls y
tambin en el resto de las materias. Necesitamos ayuda tutorial y pedaggica para
preparar actividades apropiadas, para ver cul es su desarrollo a lo largo del curso y
utilizarloscriterioseinstrumentosdeevaluacinadecuados.
Unavezquehemosobservadolascapacidadesdeestosalumnos/as,debemos
de empezar a trabajar con ellos de forma individual, pero tambin podemos
prepararlesactividadesparaquelashaganconelrestodelalumnado,engruposoen
parejas,unavezalasemana,odependiendodelritmodelalumnado.

www.enfoqueseducativos.es

303

Nmero 2 noviembre -2007


Estos momentos son muy importantes para ellos/as porque se sienten
integradosenelgrupo.
La elaboracin de los materiales debe ser preparada cuidadosamente. El
alumnado con necesidades especficas de apoyo educativo no son bebs, algunos/as
disfrutan trabajando con dibujos pero otros se sienten avergonzados con ello, por lo
tanto en vez de usar esos dibujos podemos usar fotografas. Otras veces es bueno
pediraalgncompaeroquetrabajeconellos/ascomounguaominiprofesor(tutora
entre iguales), es una buena forma de hacer que los/as compaeros/as se sientan
motivadosconel/laalumno/aencuestin.
Bibliografa:
*Defior,S.(1990).Dificultadesdeaprendizaje.Aljibe.Mlaga.
*Beltrn,J.(1995).Trastornosdeaprendizaje.DiccionariodeCienciasdelaEducacin.
Anaya.Madrid.
*AguileraJimnez,A.(2000).Atencinaladiversidadenlaeducacin.Kronos.Sevilla.

www.enfoqueseducativos.es

304

Nmero 2 noviembre -2007


HABLARENINGLSDELANTEDETODALACLASE.

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Una de las metas ms importantes que tratamos de conseguir por parte de


nuestro alumnado es hablar delante del grupo sin sentirse mal, nerviosos o incluso
quedarse en blanco. Pero eso no es nada fcil. Podemos permanecer con un grupo
duranteunaoacadmicoynoobtenernadadealgunodeellos:niunaoracin,niuna
simplerespuestaoniunasolapalabra.
Nuestra intencin como docentes y educadores es hacer que nuestro grupo
exprese sus conocimientos y tambin sus ideas o lo que quieran al reto de
compaeros/as, sin tener que sentirse atemorizados, pero eso es muy difcil, casi
imposible, pero no solo para ellos sino tambin para nosotros. Cmo hablar, cmo
movernos,cmomiraralagente,etc.ylasituacinsevuelveanpeorsilotenemos
quehacerconnivelesmsaltos,comoporejemplo,bachilleratodondeelalumnadoes
adulto. Por lo que deberamos pensar tambin en sus miedos y tratar de evitar esas
situacionesviolentasquepuedencausarefectosnegativosensuprocesodeenseanza
yaprendizaje.
Algunos de los procedimientos que podemos utilizar son: reforzamiento
positivo,trabajoengrupoeinclusoelusodelalenguamaternaenaquellassituaciones
enlasquelapersonanoescapazdeexpresarseeningls.
Otro aspecto importante a tomar en consideracin es el tratamiento de los
errores, esto es, no prestarles demasiada atencin o, al menos, no hacer que el
alumnadosesientaavergonzadodehaberlocometido.

www.enfoqueseducativos.es

305

Nmero 2 noviembre -2007


Los erroresse incluyendentro delproceso deenseanzay aprendizaje, y son
necesariosjustoparaevitarlosenelfuturo.
El reforzamiento positivo puede hacerse de dos maneras: socialmente, con una
simplesonrisaoalgngestoqueloshagasentirsecmodos,ymaterialmente,con
calificacionescomopositivosquesontanatractivosparaellos.
El trabajo en grupo, mencionado anteriormente, es un buena forma de
practicar porque en cierto modo se sienten sanos y salvos rodeados por sus
compaeros/as; aunque tenemos que ser cuidadosos en la formacin de los grupos.
Deben incluirse estudiantes tmidos pero tambin aquellos/as a los/as que no les
importa hablar en pblico y as motivarlos con su comportamiento. Por ejemplo, el
portavozdelgrupopuededecidirquienresponderacadaunadelascuestionesque
seplantearnenlaactividad.
La manera en la que los errores sean tratados ser muy importante para
ellos/as.Debemosdetratarlosconnaturalidad,independientementedelaimportancia
delmismo.Nuestracaraytonodevozselesgrabarenlamemoria.
Porltimo,esnecesariodejarloshablarenespaolsinosabencmocontinuar
eningls,loimportanteesquehablenyque,pocoapoco,ganenelcontrolsobres
mismos.

Bibliografa:
*LarsenFreeman,D.(2000).Techniquesandprinciplesandlanguageteaching.
Oxford:Oup.
*Pawley,A.andSyder,F.(1983).Twopuzzlesforlinguistictheory.NativeLike
selectionandnativelikefluency.Languageandcommunication.London:Logman.
*Howat,A.(1984).AstoryofEnglishlanguageteaching.Oxford:Oup.

www.enfoqueseducativos.es

306

Nmero 2 noviembre -2007

ELUSODELVELOENLASNIASMUSULMANAS

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO
D.N.I.:78.681.742F

Aunqueparezcamentiraynosconsideremospersonasconlamenteabiertay
tolerantes y otras muchas otras cosas ms, estos temas son portadores de cierta
polmica en algunos lugares y de mucha en otros. Desafortunadamente es as y no
sabemosdurantecuantotiempolascosascambiarnperonoalavelocidadalaque
debieran.

Situviramosqueplantearunapreguntapodramosrealizarladeestamanera:
Hayalgodemaloenquelasniasmusulmanasllevenelveloenclase?,odeforma
msradical:Sedeberapermitirelusodelveloenlaschicaspracticantesdelareligin
musulmana?. Sea el planteamiento de la pregunta como sea la respuesta debe ser
tajanteydefinitiva:S.Quproblemahayenello?.Porsuertevivimosenunestado
dederecho,estoes,libreynotienesentidolaprohibicindeunacosaas.

Laescuelayelinstitutosondoslugaressededelaeducacinyformacindelos
niosyadolescentesdesdeelpuntodevistapersonalyprofesional.Esdecir,seforma
a la gente para que adquieran conocimientos sobre Ciencias, Lengua, Literatura,
Idiomas, y tantas otras cosaspero tambin se ensean valores y principios. Se
apuestaporunaeducacinparalaigualdadytolerancia,paralapazylasalud.Elno
permitir que una persona lleve una prenda de vestir que va de acuerdo con unas
creencias religiosas y forma de vivir echa por tierra todo el trabajo que realizan
profesores,maestros,orientadoresytantaotragetequesevuelcaenellargoproceso
deeducacindenuestrosjvenes.
www.enfoqueseducativos.es

307

Nmero 2 noviembre -2007

El problema tiene un trasfondo de ndole familiar en muchas ocasiones,


comentarios racistas en boca del padre, del hermano mayor, el vecino etc. que son
captadasporloschicosyavecessetraducenencomentariosyexpresionesquequizs
nosonpropiasdesuedad.Ejemploscomo:Sinosotrosvamosasupasnosobligana
ponernos velo. Ellos no se adaptan a nuestra cultura, por qu tenemos que
adaptarnosnosotrosalasuya?,yotrasmuchasquesegeneranenconversacionesde
adultos,enlacalle,televisin

Simplementedebemostomarmedidasdesdetodoslosmbitosposible:casa,calle
y escuela. Tenemos que ser tolerantes y no caer en el error que han cado otros.
Aprovechemos esta sociedad multicultural en la que vivimos y apliqumoslo a la
educacin,.Llevarveloesunaopcinqueestah.Dejemosquecadaunovivasu
vida y su religin de la mejor manera. La libertad es el tesoro ms preciado que
tenemosteniendoencuentaquemilibertadacabadondeempiezaladelotro.

Bibliogrficos:
*Besal,X.(2002).Diversidadculturalyeducacin.Sntesis.Madrid.
*QuintanaCabanas,J.M.(1990).SociologadelaEducacin.Dikinson.Madrid.

www.enfoqueseducativos.es

308

Nmero 2 noviembre -2007

LATELEVISINYSUSLIMITACIONESCOMOAPLICACINDIDCTICA

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Los medios de comunicacin de masas ejercer una gran influencia en el


procesodesocializacindelasjvenesgeneraciones.Sonmuchoslosescritossobre
todosestosmediosenlosqueseanalizanlosprocedimientosatravsdeloscuales
soncapacesdedirigirlasconductasycomportamientosdelossereshumanos.Pero
dentro de este conjunto de medios destaca uno de manera muy especial. La
televisin se ha convertido en los ltimos aos un fenmeno social de gran
importancia. Es lgica, por tanto, la necesidad de llegar conocerla de la mejor
maneraposibleparapoderutilizarlamsracionalmente.Dadalatrascendenciaque
haadquiridoestemedio,sehaceimprescindibleordenarsuusoyproduccinsegn
la razn, y no segn otro tipo de intereses que seguro que un medio como ste
siempreestnaflorando.
Latelevisinesunmediotcnicodelquenosiempresehaceunusocorrecto,
desde el punto de vista educativo. Esta afirmacin no es bien acogida por un gran
nmerodepersonasargumentandoquelatelevisintienenimsnimenosqueuna
finalidad mercantil. Sin embargo, y sin negar lo anterior, podemos afirmar que la
televisin sobrepasa los lmites del mbito econmico y empresarial para ocupar un
lugar de privilegio en la transmisin de la cultura y en el proceso educativo y de
socializacin. Es por ello, que debe ser motivo de preocupacin para todos:
empresarios,profesorado,padres/madres,etc.

www.enfoqueseducativos.es

309

Nmero 2 noviembre -2007


Elusodelatelevisincomoaplicacindidcticaestsometidoaunaseriede
limitacionesquelosprofesionalesdelaenseanzadebenconocer:
1) Limitaciones de carcter temporal. Las omisiones informativas suelen ser,
por eso, frecuentes y habituales. Parcializan la realidad interpretada por la propia
limitacindelmedio.
2)Loquenohapodidofilmarseograbarse,loquelascmarasnohanpodido
captar, es como si no hubiera existido. Lo enlatado puede ser considerado como
contenidodelaquyahora.
3) Las imgenes, sobre todo en el caso de que no haya neta y oportuna
complementariedad con la palabra hablada, restan capacidad de atencin a los
mensajesverbales.
4) Hay un claro predominio de la imagen sobre la palabra. Se estn
imponiendo,incluso,lossumariosenimgenessinpalabras.
5)Elconjuntodelasimgenesenmovimiento,delassecuenciasgrabadaspara
TV,siguemslalgicadelaemocinquelalgicadelarazn.
6)Lamayorpartedelostelespectadorestieneseriasdificultadesparacaptary
retener aspectos esenciales de las informaciones emitidas. La fugacidad noticiosa
impide retroceder en busca de referencias interesantes que no han sido bien
percibidas.
7) Por las caractersticas del propio medio, en TV es ms difcil establecer la
deseablediferenciacinentrehechosyopiniones.
8)LosespaciosinformativosdeTV,seguramenteporlainfluenciaconcomitante
delosdemsespaciostelevisuales,tiendenespectacularizarseElesfuerzoporcaptary
entretener al espectador, se realiza en detrimento de la precisin y la objetividad
informativas.
9)EsmuydifcilenTVtratartemasdeinformacinconprofundidad,selimitan
a emitir fugaces destellos informativos. El problema del tiempo y el espacio son
www.enfoqueseducativos.es

310

Nmero 2 noviembre -2007


evidentes,loquelimitalacalidaddelainformacinemitidaydeterminadaunavisin
particularporpartedelostelespectadores.
10) En TV, slo se alude principalmente a acontecimientos de inters
generalizado,portrivialesquesean.Yadems,slopuedehacerseconunnmerode
ellos muy limitado. Lo que no vende no se proyecta normalmente, cayendo muchos
falsamenteenlacuentadequesinosaleenTVnotieneimportancia,noesmoda...
Sin nimo de ser reduccionista aqu se plantean esta serie de limitaciones,
quedebenayudaralasinstitucioneseducativasareflexionaryadarsecuentadeque
nopuedenpermanecerpasivasanteelpoderdeestemediodecomunicacin.Todo
lo contrario el objetivo debe ser educar en un consumo racional e inteligente del
medio,incrementandoelsentidocrticodelasaudienciasyenseandoadescifrarlos
cdigostelevisivos,

Bibliografa:
*ORREA, R.I. (2001): La sociedad mesmerizada. Medios, nuevas tecnologas y
concienciacrticaeneducacin.Huelva:ServiciodePublicacionesdelaUniversidad
deHuelva.
*MANDER, J. (1984): Cuatro buenas razones para eliminar la televisin. Mxico
Barcelona:Gedisa.

www.enfoqueseducativos.es

311

Nmero 2 noviembre -2007

ENFRENTARSEALAMONOTONA

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Entodoslostrabajosyenelnuestrocomomaestros,profesoresyeducadores,
nosenfrentamosconelpasodelosaosaloquepodemosdenominarsndromedel
docentequemado,cansadooamargado.Ypocoapocopordesgraciaesasensacin
de estar amargado aparece antes entre docentes mayores y no tan mayores: en
personasquenollevanmsdecuatroocincoaosdedicndoseaesto.

Esa apata que el docente padece es algo que sin querer se manifiesta y los
alumnoslopercibenalalegua.Yesoesprecisamenteloquenopodemosdemostrar
delante de ellos porque se aprovecha de dicha circunstancia para no trabajar,
comportarsemalenelaulaynodejaraloscompaerostranquilosesdecirfavorece
elabandonodelrea.Asqueloprimeroquetenemosqueaprenderesanodemostrar
que las cosas nos son indiferentes y que estamos hartos de ver todos los das lo
mismo.Apartirdeahempezaremosacrernoslonosotrosmismos.

Lo ideal es que analicemos las situaciones que nos hacen estallar.


Probablementeseanaqullasdondeelordenyelsilenciobrillanporsuausencia.Una
vez hallada la raz del asunto podemos pensar en crear normas para cambiar la
situacin: cambiar la distribucin de la clase, hacer pequeos tratos para que
permanezcancalladosmstiempoetc,esdecirpremiandoconpequeosdetallesese
www.enfoqueseducativos.es

312

Nmero 2 noviembre -2007


buen comportamiento, aunque sin dejar que el chantaje cobre protagonismo en
ningunasituacin.

Los malos resultado y el bajo nivel de la clase tambin es algo que acaba
amargando al profesor, que siente como el mundo se le viene encima cuando pasa
horasyhorasintentandoexplicarlomismoyveenlosejerciciosyexmenesqueno
sirve para nada. Cuando buscamos material extra para poder apoyar nuestras
explicaciones y empleamos tanto tiempo en seleccionar las actividades que resulten
ms atractivas y luego vemos que no se molestan ni en mirarlos, es cierto que dan
ganas de marcharse del aula. Y eso ao tras ao y dcada tras dcada marca. Pero
tambin es cierto que en la mayora de los casos aunque sea slo un alumno s que
parececomprenderloquehemosexplicado.Squelovemoscopiandoenlapizarray
asintiendoconlacabeza.Aunqueseasloporesealumnotenemosquevolveralda
siguienteconesperanza.

Tenemosquevalorarlaspequeascosasquesevanhaciendobieneintentardejar
aunladolomalocadavezquesalgamosdeesaclase.Lostutoresdelosgruposylos
dems compaeros/as de trabajo nos pueden ser de ayuda para ver qu tcnicas
emplean.Unapuestaencomndelosmtodosquecadaunoutilizaespositiva.Os
jvenespodemosaprenderdelosmsveteranos.Laexperienciaeslamadredela
ciencia.

Finalmente debemos de hacer hincapi en los beneficios que nos pueden


aportarloscursosdeformacinpermanentedelprofesorado.Elapoyodelafamiliaes
tambin algo primordial y el reconocimiento social tambin Son muchos los
comentarios que se hacen injustamente sobre la figura del dicente que lejos de
provocargracia,pesananmssobrelapersona.Tampocodebemosdejaraunladola
posibilidad de motivar con los programas de mejora de los rendimiento escolares,
puestosenmarchadesdeenerodeestemismoao.
www.enfoqueseducativos.es

313

Nmero 2 noviembre -2007


Bibliografa:
*LeyOrgnica2/2006,de3demayo,deEducacin.
*Ley17/2007,de10dediciembre,deEducacindeAndaluca.
*Esteve,JM.(1998).ElMalestarDocente.Ed.Aljibe.Mlaga.

www.enfoqueseducativos.es

314

Nmero 2 noviembre -2007

TRABAJOINDIVIDUALVS.TRABAJOCOOPERATIVO.

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Desde que la Pedagoga tradicional empez a ser estudiada el papel del


trabajoindividualsehaconsideradocomolabasedelaenseanzaydelaprendizaje.
De esta manera, el alumnado trabaja de una manera individual con un objetivo
particular:conseguirobjetivosdiferentesaldelrestodelgrupo.
Pocoapoco,hanidoapareciendoalgunasteoraseideasrelacionadasconla
interaccinsocialcomoestrategiaparaelaprendizajeyelcambio.Unclaroejemplo
es Vygotsky que sigui una perspectiva constructivista. Este autor resalt la
importancia de las ayudas que el estudiante puede recibir del resto de
compeeros/as, dando por supuesto que el aprendizaje empieza en los otros y
despusencadapersonademaneraindividual,esdecir,desdelointerpersonalalo
intrapersonal.
Sin embargo, no siempre hay una relacin entre interaccin social y
aprendizaje. La nica situacin interactiva que puede provocar el aprendizaje es
aquella en la que se lleva al alumnado a situaciones donde no podra llegar sin la
ayudadeotraspersonas.EsloqueVygotskydenominZonadeDesarrolloPrximo.
Como comentaba anteriormente, no todo trabajo en grupo facilita el
aprendizaje del alumnado y mejora la vida en el aula. Hay trabajos en grupo (mal
enfocados, planificadosoguiados) quelleganaentorpecerelaprendizajeyprovocar
insatisfaccinyfaltadearmonaenlaclase.Desdeunpuntodevistaconstructivo,el
trabajo cooperativo representa la forma ms eficaz de trabajo en grupo. La
cooperacinconsisteentrabajarjuntosparaalcanzarobjetivoscomunes.Portantoen

www.enfoqueseducativos.es

315

Nmero 2 noviembre -2007


una situacin cooperativa, los individuos procuran obtener resultados que sean
beneficiososparaellosmismosyparalosdemsmiembrosdelgrupo.
Sinembargoparaqueelaprendizajecooperativoresulteeficazesnecesario
tenerencuentalossiguienteselementosqueeldocentedeberincorporarensu
grupoclase.
1.La interdependencia positiva. Los miembros de un grupo debern tener
claroqueeltrabajodecadaunodeellosbeneficianosloalmismosinotambin
alosdemsmiembros.
2.La responsabilidad individual y grupal. El grupo debe asumir la
responsabilidad de alcanzar sus objetivos, y cada miembro ser responsable de
cumplirconlapartedeltrabajoquelecorresponda.
3.Tcnicasinterpersonalesydeequipo.Eldocentedebeensearalgrupode
alumnos/asalgunasprcticasinterpersonalesygrupalesimprescindibles.
4.Evaluacin grupal. Desde el punto de vista de este elemento, el grupo
debeanalizarenqumedidaestnalcanzandolasmetasymanteniendorelaciones
detrabajoeficaces.
Laadecuadaconjugacindeestoselementosdarcomoresultadoentreel
alumnado, por un lado un incrementos de relaciones positivas entre el grupo,
favoreciendoelespritudegrupo,relacionesmssolidariasycomprometidasyuna
mejor valoracin de la diversidad. Por otro lado, el trabajo cooperativo incidir
positivamente en los resultados acadmicos, fomentando un mayor esfuerzo por
lograr un buen desempeo, aumentando el rendimiento y la productividad del
grupo, incrementando el tiempo de dedicacin a las tareas y por ltimo
acrecentandolamotivacinintrnsecadelalumnado.
Para terminar es necesario hacer referencia al nuevo papel que juega el
docentedentrodelaestructuracooperativa.Lejosdedebilitarsuposicinfrenteal
grupoclase,lafortaleceprecisamentealconvertirseenelprincipaldinamizadorde
la vida del aula, estableciendo objetivos, reglas y orientaciones bsicas. Sin
embargo, un cambio de tal envergadura requiere un cambio de actitud as como
www.enfoqueseducativos.es

316

Nmero 2 noviembre -2007


una formacin tericoprctica en torno a la filosofa implcita en la propuesta,
modelosdeaprendizajeeducativomsacordesconella,paradigmasmotivacionales
que apoyen sus enunciados, teoras del desarrollo acerca de la socializacin
interactivay,fundamentalmente,unentrenamientoenaquellasdestrezasprcticas
quegaranticensuposterioraplicacinacadaunadelassituacionesdeaula.
Bibliografa:
*Coll,C.,Palacios,JyMarchesi,A.(1990).Desarrollopsicolgicoyeducacin.Madrid.
Ed.Alianza.
*Nuez,T.yLoscertales,F(1996).Elgrupoysueficacia.Barcelona.EUB

www.enfoqueseducativos.es

317

Nmero 2 noviembre -2007

ACTIVIDADESESCRITASCMOCORREGIRLAS?

NOMBRESYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Hace muchos aos y por qu no decirlo ahora tambin, era y es comn ver
muchashojasdeejerciciosyexmenesllenasdecolorrojoconextraasanotaciones,
palabras y notas, tan difciles de entender que causan de todo menos un efecto
positivo: frustracin por parte del alumnado y el consecuente miedo a hacer la
siguienteactividad,composicin,examenotareaqueselepida.
Esciertoqueelcolorrojoesllamativo,eincluso,agresivoenciertomodo.No
provoca el mismo efecto, si lo comparamos con el verde o, incluso, el naranja o el
morado.Ahestelprimerpasoaseguircuandocorrijamosunaactividadporescrito
debemos de dejar a un lado el bolgrafo rojo y usar por ejemplo, el verde. Es muy
sencilloyelefectoqueprovocaesbastantepositivo.Tenemosqueevitarelnegrooel
azulquesepuedenconfundirconloquehayanescritolosalumnos.
Otro aspecto a tener en cuenta sera el uso de abreviaturas para indicar qu
tipodeerrorsehacometido,porejemplo:
MymothergoedtothesupermarketlastMonday.Loquedebemoshaceres
subrayar la palabra incorrecta y poner el tipo de error que se ha cometido (en este
casogrammatical)
Goedgr.

www.enfoqueseducativos.es

318

Nmero 2 noviembre -2007


Una lista breve con los tipos de errors (gramaticales, ortogrficos, etc.) y su
forma abreviada se les da a los alumnos al comienzo del curso. As, de esta manera
ellossabrnexactamentequtipodeerrorhancometido.Ladecisindeponerlesono
la respuesta correcta o la opcin correcta a lo que han hecho mal depende de la
decisindelprofesor.Loidealseraquelosalumnosfuerancapacesporsmismosde
corregir dicho error, pero eso depender tambin del tiempo que queramos o
podamos dedicar a dicha correccin. El tiempo no debera de ser un problema en
cuantoaltratamientodeloserroresconcierne,esdecir,noimportasiempleamosms
tiempo del que en un principio habamos planeado, porque lo importante es que el
alumnoseaconscientedesuerrorydeestamaneraintentecometerlounavezyotra
vez.Cuandoesoserroressonencontradosyanalizadosporelpropioalumnadoesms
difcilquelosolviden.
Otro aspecto importante es la presencia de las anotaciones y comentarios.
Aunquelaactividadhayasidouncompletodesastretenemosqueserpositivosytener
encuentasuesfuerzo.Tenemosqueevitarexpresionescomomuymalycambiarlas
porlaprximavezsaldrmuchomejor.Ellossabenquesutrabajonohaestadobien
peroquehemosvaloradosuesfuerzoyesolesayudademanerapositiva.
Finalmente,nonospodemosolvidardelosquehanhechounbuentrabajo.Los
felicitaremosporqueselomerecen.Unaideaatractivapuedeserladedibujarlescaras
divertidasparadarlesunapizcadevitalidadyoptimismoatodosengeneral.
Bibliografa:
*LarsenFreeman,D.(2000).Techniquesandprinciplesandlanguageteaching.
Oxford:Oup.
*Pawley,A.andSyder,F.(1983).Twopuzzlesforlinguistictheory.NativeLike
selectionandnativelikefluency.Languageandcommunication.London:Logman.
*Howat,A.(1984).AstoryofEnglishlanguageteaching.Oxford:Oup.

www.enfoqueseducativos.es

319

Nmero 2 noviembre -2007

EL USO DE LA LENGUA INGLESA EN LOS GRUPOS DE ENSEANZA SECUNDARIA


OBLIGATORIA

NOMBREYAPELLIDOS:ANAMARAVICARIAMORENO

D.N.I.:78.681.742F

Se puedeusar el ingls en un grupo de la ESO durante todo el tiempo que


dura la clase de ingls? Mi respuesta es clara: puede hacerse, pero no sera una
buena idea porque en la ESO nuestro nivel de ingls no es tan bueno como para
mantenerunaconversacinconstanteyfluidaniconelprofesorniconelrestodel
grupo,porlotanto,tenemosqueconsiderarqueelmejormtodoseraunamezcla.
Pero, cunto tiempo deberamos dedicar a hablar en ingls y cunto en
espaol?.Nohaytiempo.Dependerdelniveldelaclase,nmerodeestudiantestipos
deactividadesydificultadesdelastareasquedesarrollemosenclase.
Unbuenejemplopuedesereste:enunaclasedetreintaalumnosde2delaESOa
las dos de la tarde un viernes. Hablamos en ingls o en espaol?. Aunque
hagamos un gran esfuerzo para hablar en ingls todo el tiempo, el resultado ser
seguroenvano,porquenuestrosalumnosalumnosestarnexhaustos.Lasolucin
seraexplicarlapartetericaeningls,peroreforzaresasexplicacionesenespaol,
porquesuscabezasestarncerradas.
Otracuestin,deberamosdejarloshablarenespaoldurantetodalaclaseen
ese caso? No. Podemos dejarlos con ciertas estructuras y expresiones difciles para
ellos y al mismo tiempo haremos una traduccin de dichas estructuras que no han
sabidotraducir.
Finalmente,comoconclusindebemossealarquetodoslosgruposnosoniguales
y que todas las circunstancias no son similares. Debemos tener en cuenta que

www.enfoqueseducativos.es

320

Nmero 2 noviembre -2007


nuestratareaesensearingls,quenuestrosestudiantesnosoninglesesquehay
quetenermuchapaciencia!.
Bibliografa:
*LarsenFreeman,D.(2000).Techniquesandprinciplesandlanguageteaching.
Oxford:Oup.
*Pawley,A.andSyder,F.(1983).Twopuzzlesforlinguistictheory.NativeLike
selectionandnativelikefluency.Languageandcommunication.London:Logman.
*Howat,A.(1984).AstoryofEnglishlanguageteaching.Oxford:Oup.

www.enfoqueseducativos.es

321

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q

CONSEJOSPARALOSDOCENTESANTEELACOSOESCOLAR.
Estos consejos van dirigidos a los educadores para afrontar un posible caso de
acoso escolar. Aunque se trata solamente de orientaciones generales, stas pueden
ser muy tiles para los docentes, los cuales tienen que adaptarlas a cada caso
concreto:
1. Prestaratencinalarelacindelosalumnosenlospasillosyenelpatio,enel
recreo,enelcomedor(enlasllamadaszonascalientes).Noolvidemosque
lospeoresmomentossesufrencuandolosprofesoresnoestnpresentes.
2. Fijarse en las pintadas en las puertas de baos y paredes para ver qu
nombresaparecenahnormalmenteyqutextoacompaaalosnombres.
3. Estaratentoalanoparticipacinhabitualensalidasdelgrupo.
4. Darle importancia a las risas o abucheos repetidos en clase contra
determinadosalumnos.
5. El absentismo sistemtico en algunos alumnos puede indicar que no quieren
acudir por miedo y que no se atreven a decirlo. Sobre todo cuando ese
absentismoseadeunsoloalumno.
6. Estar atentos a aquellos alumnos que sean diferentes, tanto por su forma de
sercomoporsuaspectofsico.
7. Conceder importancia al alumno que se queje de forma insistente de ser
insultadooagredido.
8. Prestaratencinsicomentaquelerobansuscosasenelcolegioosicadada
explicaquepierdesumaterialescolar.
9. Investigarloscambiosinexplicablesdeestadosdenimo:tristeza,aislamiento
personal,lgrimasodepresinsinmotivoaparente,irritabilidad.
10. Observarsiexistenescasasonulasrelacionesconloscompaeros.
11. Fijarseenlasevidenciasfsicasdeviolenciacuyoorigenelalumnonoalcanzaa
explicar.
12. Darle importancia a las quejas somticas constantes del alumno: dolores de
cabeza,deestmagoodeotrotipocuyacausanoestclara.
13. Fijarse en las variaciones del rendimiento escolar, con prdida de
concentracin.
14. Estaralertasinosencontramosconquejasdelospadresquedicenquesuhijo
noquiereiralcolegio.
www.enfoqueseducativos.es

322

Nmero 2 noviembre -2007

Son muchos los detalles que hay que percibir para identificar un caso de acoso
escolar.stosnosonlosnicosconsejosquehayqueseguir,puestoquecadacasode
abusoesdistintoycadanioacosadopuedereflejaronoelacosodeformadistinta.
En algunos casos, es tanto la vergenza del nio vejado que ni siquiera muestra
sntomaalgunodetalvejacin,sinoqueactadeformanormal.Laidentificacinde
un caso de bullying es una tarea conjunta de padres, educadores y de las propias
vctimas,lascualestienenquedistinguirentrebromasoabusos.

Bibliografa:
RODRGUEZ,N.(2004).Guerraenlasaulas:cmotrataraloschicosviolentosy
alosquesufrensusabusos.
OLWEUS,D.(1998).Conductasdeacosoyamenazasentreescolares.

www.enfoqueseducativos.es

323

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q
ATENCINALALUMNADOEXTRANJERO.
LaAdministracinEducativatratadeatenderalalumnadoextranjerodesdeun
enfoqueintercultural,esdecir,considerandolaigualdaddeoportunidadesparatodos
losmiembrosdelasculturasminoritarias,dentrodeunascondicionesdeaceptacin,
toleranciaysolidaridadqueseexigenparaponerenprcticalaempataycomprensin
enelprocesodeintegracindelapoblacininmigranteenlasociedadquelosacoge.
Elalumnadoinmigrantepresentalassiguientesnecesidades:
Poseenunpatrnculturaldiferentealaculturadeacogida.
Lalenguamaternaesnormalmentemuydistintaalaespaola.
Las condiciones socioculturales y econmicas a las que han estado o estn
sometidosderivanennecesidadeseducativasquesemanifiestanenelmedio
escolar.
Las condiciones de vida y subsistencia que la familia posee (itinerante o poco
estable)condicionanlosprocesoseducativosdelosmenores.
SegnelPlanAndaluzdeEducacindeInmigrantesdelaConsejeradeEducaciny
Cienciapublicadoenel2001(IPlanIntegralparalaInmigracinenAndaluca2000/04),
losobjetivosylasmedidasqueserecogensonlassiguientes:
a) Facilitar la escolarizacin de todas las nias y nios pertenecientes a familias
inmigrantes, en las mismas condiciones que el alumnado andaluz. Se intenta
conseguir mediante la divulgacin, entre las familias y colectivos de
inmigrantes, de los aspectos bsicos del proceso de escolarizacin y
organizacin del sistema educativo en Andaluca y de las convocatorias de
becasyayudasalestudio.
b) Favorecer que los centros elaboren Proyectos de Centro interculturales que
faciliten y promuevan procesos de intercambio, interaccin y cooperacin
entre las culturas. Para esto es necesaria la formacin y asesoramiento
especficoalprofesoradodeloscentrosqueatienenalalumnadoinmigrante.
c) Potenciar programas de apoyo para el aprendizaje de la lengua espaola; por
ejemplo, mediante la creacin de aulas temporales de adaptacin lingstica
(ATAL).
www.enfoqueseducativos.es

324

Nmero 2 noviembre -2007


d) Facilitarelaprendizajedelalenguamaternaparaqueelalumnadonopierdasu
culturadeorigen.
e) Favorecer un clima social de convivencia, respeto y tolerancia, en especial en
laszonasqueacogeninmigrantes,fomentandoqueloscentroseducativossean
unncleodeencuentroydifusindelosvaloresdemocrticos.
f) Potenciar el desarrollo de acciones de formacin integral de los alumnos y
alumnasinmigrantesadultos,interviniendodeformaespecialsobrelospadres
ymadrescuyoshijosestnescolarizadosenlaeducacinbsica.
La propuesta de la interculturalidad representa un reto para todas las
institucionessocialesyparatodaslasadministracionespblicas.Portanto,lalabor
del centro educativo tiene que verse reforzada por actuaciones en el mbito
sociocomunitariodeotrasinstituciones,administracionesyasociacionessinnimo
delucro.

Bibliografa:
CONSEJERA DE EDUCACIN Y CIENCIA (2001). Plan Andaluz de Educacin de
Inmigrantes.
BOJA(BoletnOficialdelaJuntadeAndaluca).

www.enfoqueseducativos.es

325

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q

ENSEANZADELAGRAMTICA.
En la enseanza de la gramtica podemos destacar dos mtodos: el mtodo
deductivoyelinductivo.Elmtododeductivopartedelaenseanzadelasreglaspor
parte del profesor mientras que en el inductivo es el alumno el que tiene que
deducirlasmedianteelanlisisdeciertosejemplos.
Elprimerpasoenelmtododeductivoeslapresentacindelrasgomediante
una actividad oral o escrita donde abunden ejemplos. A continuacin, el profesor
explicarlaestructuragramaticalysufuncin,terminandoconlaprcticanecesariay
la produccin comunicativa del aspecto enseado. Por tanto, los pasos a seguir son:
presentacin,explicacin,prcticayproduccin.
Elmtodoinductivocomienzadeigualformaconunapresentacindeuntexto
autntico,yaseaoraloescrito.Estetextoesobservadoyanalizadoporelestudiante,
extrayendo sus propias hiptesis para ver qu reglas definen al rasgo no slo en la
forma sino tambin en la funcin. El profesor comprueba el acierto de esas reglas,
interviniendoencasodequenofuerancorrectas.Losltimospasossonsimilaresalos
del mtodo deductivo. Por tanto, las pautas a seguir son: presentacin, observacin,
hiptesisyexplicacin,prcticayproduccin.
Comoesobvioelmtodoinductivoesmslentoporqueenlhayqueesperar
a que el alumno formule sus propias consideraciones sobre el rasgo gramatical. As
pues, este mtodo no es el ms adecuado para aquellos profesores que no tengan
demasiada paciencia. Sin embargo, a la larga es un mtodo mucho ms efectivo
porquecuandounapersonadescubrealgoporsmisma,lofijaensumenteyesdifcil
quellegueaolvidarlo.
Paraapoyarelestudiodelagramticaesmuytiluncompendioescritoenla
lengua materna del estudiante incorporado al final del libro de texto del alumno, ya
que le va a servir de material de consulta, hacindolo ms autnomo a la hora de
estudiarencasa.
Lasposiblesactividadesparaelaprendizajedelagramticasonmuyvariadas:
rellenar huecos, transformar frases, traducir, corregir frases errneas, juegos, etc.
Fundamentalmente tenemos que recordar que estas actividades no deben ser
www.enfoqueseducativos.es

326

Nmero 2 noviembre -2007


montonas o aburridas, sino que busquen la forma de implicar al alumno en el
desarrollodelasmismas.

Sea cual sea el planteamiento metodolgico que sigamos en el aula, la


enseanza de la gramtica de la lengua materna o de lenguas extranjeras es bsica
paraqueelalumnohable,escribayleadeformacorrecta.

Bibliografa:
HARMER,J.(1983).LaPrcticadelaEnseanzadelIngls.
HEARN,I.&GARCS,A.(2003).DidcticadelIngls.

www.enfoqueseducativos.es

327

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q
NIVELESDECONCRECINCURRICULAR.
En Espaa el currculo es diseado en primer lugar por la Administracin
CentraldelEstadoqueestableceelllamadoDiseoCurricularBasedondesedefinen
todos los elementos de forma genrica, siendo a su vez adaptado por las
administracionesautonmicasalaspeculiaridadesdecadacomunidad.Enunsegundo
niveldeconcrecinintervienenloscentroseducativosqueutilizanlasnormascitadas
adecundolas a su propia realidad en un Proyecto de Centro donde intervienen los
distintos departamentos didcticos que definen la programacin de cada material.
Finalmente ser el propio profesor quien establezca un Proyecto Curricular de Aula
quecontienelasdistintasUnidadesDidcticasqueterminandedesarrollarelcurrculo
inicialdefinidoporlasadministracioneseducativas.
Elprofesor,portanto,siguelossiguientespasosensuprcticadocente:
Analiza la realidad educativa en la que ha de intervenir: tiene que conocer el
centro educativo, los recursos y facilidades con los que cuenta, el entorno
sociocultural(sisetratadeunpueblopequeoodeunaciudad,lafuentede
ingresos de la mayora de los habitantes, etc.), y por supuesto, tiene que
conocer las caractersticas de los alumnos: cules son sus intereses,
necesidades y motivaciones, sus entornos familiares yresultados acadmicos,
etc.
Considerarlosobjetivos,contenidos,orientacionesmetodolgicasycriteriosde
evaluacinquelaautoridadeducativaleproponeenrelacinasumateriayal
nivelqueensea.Estepasoesfundamentalporquesetratadelasdirectrices
que el profesor tiene que seguir, aunque tiene que adaptarlas a las
caractersticasdelarealidadeducativaenlaqueseencuentra.
Este anlisis conduce al profesor a decidir una forma concreta de actuacin
didctica que se ver plasmada de forma ordenada y sistematizada en una
programacin del curso y nivel que imparta. Esta actuacin didctica estar
coordinadaconelrestodelosprofesoresqueimpartenelrestodelasmaterias
alosmismosalumnos.
Esta programacin est compuesta por distintas unidades didcticas, que
finalmentesonexplicadasenelaula.

www.enfoqueseducativos.es

328

Nmero 2 noviembre -2007


Durantelaimplementacindelasunidadesdidcticas,elprofesoriranalizandoy
reflexionando todos los elementos a tener en cuenta de forma que pueda ir
mejorandoyadaptandosutrabajoespecficamentealosestudiantesdesuclase.
Por tanto, la prctica educativa evoluciona y cambia segn las circunstancias y
necesidadesdelosalumnos.Nosetratadealgofijoeinamoviblepromulgadoporlas
autoridadeseducativas,sinoquelosprofesorescontamosconbastantelibertadpara,
dentro de las pautas marcadas, actuar de la mejor forma para la consecucin de los
objetivosmarcados.

Bibliografa:
LOE2/2006.
GIROUX, A. (1988). Los Profesores como Intelectuales: Hacia una pedagoga
crticadelaprendizaje.

www.enfoqueseducativos.es

329

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q

LOSASPECTOSSOCIOCULTURALES.
De acuerdo a la LOE los aspectos socioculturales forman parte del currculo
para la enseanza de lenguas extranjeras, tanto en Enseanza Primaria, Enseanza
Secundaria Obligatoria y Bachillerato. Los elementos socioculturales van a estar
conectados con las situaciones de comunicacin planteadas, as como al lenguaje
utilizadoentalescircunstancias.
A travs de la lengua extranjera se reflejan las reglas y hbitos de conducta
propios de los pases donde se habla (frmulas de interaccin social, respeto y
cortesa, etc.) y cmo varan en funcin de la situacin de comunicacin. El lenguaje
utilizadodeberesponderalosusoscoloquialesoformalescompartidosporhablantes
coninteresesyedadesparecidas,demaneraquedesdeelprincipionoseproduzcan
mensajes lingsticamente correctos, pero inapropiados desde la perspectiva
sociocultural.
Losmensajesenlenguaextranjeratambinllevanunacargasocioculturalque
se deriva de interpretar la realidad de formas diferentes a la nuestra (costumbres,
servicios pblicos, relaciones familiares, ropas, conservacin del entorno, etc.). Se
tendrnencuentalosaspectosculturales(geogrficos,histricos,literarios,artsticos,
etc.)msrelevantesdelospasesdondesehablalalenguaextranjera.
El acercamiento a los aspectos socioculturales partir de las comparaciones
entrelasformasdevidapropiasconlasdeotrospases,paradespuspoderanalizar
hechos socioculturales exclusivos de esos pases que no son susceptibles de
comparacin. El uso de materiales autnticos y las situaciones contextualizadas de
simulacin contribuirn a trabajar estos contenidos de forma natural y espontnea,
aprovechando situaciones en las que sea posible el contacto directo con personas
nativashablantesdelalenguaextranjera.
Sefomentarnactitudesderespetoycuriosidadanteotrasculturasytambin,
de valoracin de la nuestra. Se desarrollar el sentido crtico y reflexivo ante los
estereotipos y prejuicios. Se valorar positivamente el enriquecimiento que otras
culturas aportan a la nuestra o viceversa, como el derivado de las relaciones con
hablantesdeotraslenguas.Sepuedenconsiderardiversosgradosdeprofundizacin,
abordarlos en distintos momentos, integrarlos con otros contenidos, presentarlos en
www.enfoqueseducativos.es

330

Nmero 2 noviembre -2007


unidades didcticas interdisciplinares, adaptarlos al alumnado con necesidades
educativasespeciales,etc.
Estos aspectos socioculturales deben ser considerados como objetivos
didcticos, actitudes y procedimientos que orientan el trabajo de los contenidos
socioculturalesenelaula.

Bibliografa:
LOE2/2006.
Decreto231/2007del31deJulioparaEnseanzaSecundariaObligatoria.
COLL,C.(1987).PsicologayCurrculum.

www.enfoqueseducativos.es

331

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q

LAIMPORTANCIADEAPRENDERINGLS.
YyoparaququieroaprenderinglssinovoyairnuncaaInglaterra?Estaes
la tpica pregunta que nos hacen los alumnos y que nos obliga a darles una serie de
explicacionesquejustificanlaimportanciadeaprenderingls.
Porsupuesto,lestenemosquedecirquelotienenqueaprenderporqueesalgo
obligatorio para ellos, ya que forma parte de su currculum acadmico, pero no slo
una lengua extranjera sino incluso dos, en la mayora de los casos ingls y francs.
Como esta explicacin sigue siendo algo intangible para ellos, tenemos que buscar
explicacionesmscercanasasusnecesidades,interesesomotivaciones.Porejemplo,
qu msica les gusta o cules son sus videojuegos favoritos. En muchos de esos
videojuegos, las rdenes a seguir para la realizacin del juego aparecen en ingls
porquelaspersonasqueloshandiseadohanpensadoentodoelmundoycomola
lenguainglesaeslamsinternacional,estaspersonashanescritolasinstruccionesin
ingls.Todosellosconocenexpresionescomo GameoveroNextplayer.Almismo
tiempo son capaces de memorizar e incluso cantar con buena pronunciacin algn
estribilloeninglsdealgncantanteogrupomusical.Ellosnosabensiquieraloque
estn diciendo, pero les gusta repetir las palabras. Por tanto, es algo sumamente
agradableparanuestrosalumnospoderentenderloquedicelacancineinclusoms,
puesunavezqueaprendenunacancin,nuncalavanaolvidar.
Luego podemos darles otras explicaciones de tipo ms prctico como que la
lengua ms hablada en todo el mundo no es el ingls sino el chino porque tiene un
mayornmerodehablantesalserloschinoslapoblacinmsnumerosa;sinembargo,
la lengua ms utilizada internacionalmente es el ingls porque es la lengua de los
negocios, de las relaciones internacionales, de las publicaciones sobre los avances
mdicos o cientficos, de la poltica, del arte, de la economa y por supuesto, de las
comunicaciones.
Porejemplo,aunquenuncaviajenalextranjero,siseencuentranconunguiri
enlaplayaystelespreguntaalgunaindicacin,sabiendoinglspodrnayudaraesa
persona y al mismo tiempo, sentir gran satisfaccin personal al ser capaces de
comunicarse con personas extranjeras. Adems, como nunca se sabe el trabajo que
desempearn en el futuro, cuanto ms preparados estn para la competitividad
existente en el mercado laboral, mucho mejor para ellos. Incluso si trabajan de
www.enfoqueseducativos.es

332

Nmero 2 noviembre -2007


camarerosodeconductoresdeautobusesurbanos,vananecesitarnocionesbsicas
deinglsparapoderatenderalosclientes.
Aprenderunalenguaextranjeraodos,otodaslasquesepueda,noshaceser
ms independientes, en el sentido en que nos podemos mover por el mundo, tener
accesoamuchasfuentesdeinformacin,yahoraquenohaybarrerasylasdistancias
no existen, los idiomas aumentan nuestra libertad y disponibilidad en todo tipo de
circunstancias.
Paraacabar,podemosdecirqueelhombrequehabladoslenguasvalepordos.

Bibliografa:
LOE2/2006.
RealDecreto1631/2006del29deDiciembre.
Decreto231/2007del31deJulio.

www.enfoqueseducativos.es

333

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q

REPERCUSINDELASNUEVASTECNOLOGASENLASOCIEDADYENLAEDUCACIN.

LasTecnologasdelaInformacinylaComunicacin(TIC)sonincuestionablesy
estnah,formanpartedelaculturatecnolgicaquenosrodeayconlaquedebemos
convivir.IncluimosenelconceptodeTIClosmediosdecomunicacindetodotipo:los
medios de comunicacin social (mass media) y los medios de comunicacin
interpersonales tradicionales con soporte tecnolgico como el telfono, fax
Cambiantes, siguiendo el ritmo de los continuos avancescientficos, contribuyenala
rpida obsolescencia de los conocimientos y a la emergencia de nuevos valores,
provocandocontinuastransformacionesennuestrasestructuraseconmicas,sociales
y culturales, e incidiendo en casi todos los aspectos de nuestra vida: el acceso al
mercadodetrabajo,lasanidad,lagestinburocrtica,lagestineconmica,eldiseo
industrialyartstico,elocio,lacomunicacin,lainformacin,lamaneradepercibirla
realidadydepensar,etc.Sugranimpactoentodoslosmbitosdenuestravidahace
cadavezmsdifcilquepodamosactuareficientementeprescindiendodeellas.
Sus principales aportaciones a las actividades humanas se concretan en una
seriedefuncionesquenosfacilitanlarealizacindenuestrostrabajos,talescomo:
Acceso fcil a una gran cantidad de informacin, sobre cualquier tema y en
cualquier formato (textual, icnico, sonoro), especialmente a travs de la
televisineInternet.
Procesorpidodetodotipodedatos:lossistemasinformticos,integradospor
ordenadores, perifricos y programas, nos permiten realizar cualquier tipo de
proceso de datos de manera rpida y fiable: escritura y copia de textos,
clculos,creacindebasesdedatos,tratamientodeimgenes
Canalesdecomunicacininmediata,paradifundirinformacinycontactarcon
cualquierpersonaoinstitucinenelmundomediantelaedicinydifusinde
informacinenformatoweb,correoelectrnico,videoconferencias,etc.
Gran capacidad de almacenamiento de informacin en pequeos soportes
comoCDsoUSBs.

www.enfoqueseducativos.es

334

Nmero 2 noviembre -2007


Automatizacin de tareas, mediante la programacin de las actividades que
queremosquerealicenlosordenadores,queconstituyenelcerebroycorazn
detodaslasTICs.
Interactividad. Los ordenadores nos permiten dialogar con programas de
gestin, videojuegos, materiales formativos multimedia, sistemas expertos
especficos,etc.
TodaslasaportacionesdelasTICsqueacabamosdemencionarsontotalmente
aplicablesalcampodelaenseanza,yporesto,formanpartedelquehacerdiario
enlasaulas.MuchosdeloscentrosescolarescuentanconlacalificacindeCentro
TIC, y en la prctica, las ventajas de contar con las nuevas tecnologas en el aula
son incontables; por ejemplo, nuestros alumnos tienen acceso rpido y fcil a
cualquier fuente de informacin mundial. Pueden mantener contacto con
cualquier persona en cualquier parte del mundo, lo cual les ayuda a ampliar sus
conocimientos y a practicar el dominio de una lengua extranjera. Mediante los
ordenadores en el aula, los alumnos pueden procesar gran cantidad de
informacinmediantelosprogramasinformticos,talescomoWordoExcel,yles
puedenservirparadisearyorganizarsuspropiosmaterialesdeestudio.
Comosepuedever,lasventajasdelaintroduccindelasnuevastecnologasen
elaulasoninfinitas,aligualquemuyatractivasparanuestrosalumnos,porloque
elprofesoradotienequehacerusodeestasventajas.

Bibliografa:
HARGREAVES, A. (2003). Replantear el cambio educativo. Un enfoque
renovador.
SEZ VACAS, Fernando (1997). Innovacin tecnolgica y reingeniera en los
procesoseducativos.
ECHEVERRA,Javier(2001).LasTICeneducacin.

www.enfoqueseducativos.es

335

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q

PRINCIPIOSDEACTUACINDELMEDIADOR.

La Mediacin Escolar es una tcnica de resolucin de conflictos tendente a


resolverlosproblemasdeconvivenciaenloscentroseducativos.Encuantoaloquela
MediacinEscolarserefiere,stavienecaracterizadaporunconjuntodeaccionesque
seemprendenparaintentarquelaspartesimplicadasenunconflictolosolucioneny
lleguenaacuerdos,deformarespetuosayconelmayorgradodesatisfaccinmutua
posible. Ahora bien, la Mediacin Escolar no cabe considerarla como una panacea,
como una tcnica por s sola autosuficiente. Para crear aulas ms pacficas y
caracterizadas por el desarrollo de valores como la cooperacin, la tolerancia, la
comunicacin y la expresin emotiva, ser necesario contar con un conjunto de
medidas adicionales como la participacin en la elaboracin de las normas, el
entrenamientoenhabilidadesdecomunicacinoeltrabajocooperativo.
LosEquiposdeMediacinEscolartienencomofiguramsvisiblealMediador,
cuyaactuacindebeestarpresididaporlossiguientesprincipios:
a) Valentaycapacidadderesistencia:Frentealcatastrofismoopasotismo,el
mediador debe apostar por la constancia y la paciencia, negndose a
naturalizardeterminadassituacionessociales.
b) Dinamismo y preocupacin por los dems: El mediador es una persona que
tiene capacidad e inters en comprender la complejidad del conflicto, y en
ayudaralaspartesaque,almenos,intentenresolverlo.
c) Prudencia y discrecin: El mediador debe ser prudente en su anlisis e
intervencin, lo que no significa que tenga que actuar con pasividad o
pusilanimidad. Al mismo tiempo, tiene que ser discreto en sus actuaciones,
garantizandoelsecretodelasconfesionesdelaspartes.
d) Confidencialidad:Esunprincipioclaveentodamediacin.Todoloquesediga
durante el proceso de la mediacin debe quedar blindado entre los
participantes,amenosquestosdecidandaraconocerdeterminadosaspectos
delamisma.
e) Independencia e imparcialidad: El mediador debe mantenerse siempre
independiente, tanto respecto a las parte como de cualquier otra instancia
www.enfoqueseducativos.es

336

Nmero 2 noviembre -2007


ajena al conflicto. En este sentido debe evitar las posibles estrategias de
seduccinocomplicidadporalgunadelaspartes.
f) Preparacin:Esprecisoqueelmediadorcuenteconunaampliapreparacinen
anlisis de conflictos y en conduccin de procesos grupales, es decir, en
relacioneshumanasydesarrolloorganizativo.
g) Voluntariedad:Laintervencindelmediadordebeseraceptadaporlaspartes
del conflicto, puesto que las mediaciones forzosas tienen escasas
probabilidades de concluir con xito. Igualmente la decisin de los
contendientesdeiraunamediacindebeserlibreyvoluntaria.
La figura del Mediador est adquiriendo gran relevancia en nuestros centros
educativos actualmente. Ante la ola de violencia e indisciplina que inunda nuestras
aulas,estafiguramediadoranotieneunpapelfigurativo,sinoqueesnecesariapara
evitar conflictos que se van agravando con el paso de los das y que pueden tener
trgicos desenlaces. Para desempear la labor de mediador hay que tener un alto
gradodepreparacin,talycomosehadescrito.

Bibliografa:

TORREGO,J.C.(2000).Mediacindeconflictoseninstitucioneseducativas.
Manualparalaformacindemediadores.

VIAS,J.(2003).Prevencindelaviolenciayresolucindeconflictos.

www.enfoqueseducativos.es

337

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q

INCIDENCIADELASAGRESIONESPADECIDASPORELPROFESORADO.

A diferencia de lo que acontece con el fenmeno del bullying, pocos son los
estudiosqueanalizanlaincidenciadelasagresionessufridasporlosprofesoresenlos
centros educativos. Se argumenta que los casos de agresin fsica ejercida contra el
profesorado son muy infrecuentesy quela problemtica, por tanto, no reviste tanta
gravedad.
Lociertoesque,aunquelasagresionesverbalesseanlasmanifestacionesms
comunesdelacosoejercidocontralosdocentes,laincidenciadelasmismassobrela
salud de sus vctimas no puede menospreciarse. El sndrome del profesor burnout o
profesor quemado, empieza a convertirse en un problema muy preocupante. Varios
son los factores que influyenen ese sndromede desgaste del profesorado, pero sin
duda alguna, una variable a tener en cuenta es el tener que padecer, en ocasiones,
burlas continuas de los alumnos en un contexto de prdida total del respeto y
autoridad.Esposiblequeenesoscasosnoexistauntemorrealdesufrirunaagresin
fsica, pero esos insultos e incluso, amenazas, pueden llegar a deteriorar las
personalidades ms equilibradas y provocar, en otras ocasiones, cuadros muy
preocupantes de ansiedad, fatiga y sobre todo, una gran frustracin acompaada de
depresinmsomenossevera.
Los docentes desarrollan su actividad laboral en contextos en los que los
factores psicosociales son un referente esencial para la prevencin. En realidad se
trata de un sector en el que se registra una incidencia significativa de determinados
factores de riesgo y que, por tanto, necesita un Plan de Prevencin de Riesgos
Laborales.Aspues,estoscasosdeenfermedadesderivadasdelacosoejercidocontra
losdocentes,debensercatalogadoscomoenfermedadeslaborales.Sinembargo,por
www.enfoqueseducativos.es

338

Nmero 2 noviembre -2007


desgracia, el cumplimiento de las previsiones contempladas en la Ley 31/1995 de
PrevencindeRiesgosLaborales,distamuchodeserunarealidad.
Estas

agresiones

tienen

los

siguientes

determinadores

comunes:

principalmente se trata de agresiones verbales, aunque en ocasiones llegan a ser


fsicas e incluso, sexuales; se dan en mayor porcentaje en aquellos centros donde se
imparte1y2deESO;laviolenciaesejercidamayoritariamenteporalumnosvarones
actuandosolos.Porltimo,lostiposdeviolenciaquetienenmayorriesgodepadecer
los profesores de forma repetitiva son los insultos y las burlas, acompaados por el
entorpecimientodesulaborcomoformadecoaccin.

Bibliografa:
GONZLEZ, R. (2003). Investigacin sobre agresin y violencia en
contextosescolares.
SAVATER,F.(1997).Elvalordeeducar.

www.enfoqueseducativos.es

339

Nmero 2 noviembre -2007

MANUELAJIMNEZROSA26024562Q

FACTORESCAUSALESDELACOSOESCOLAR.

La problemtica del acoso sistemtico que algunos alumnos efectan sobre


otros en el mbito educativo estalcanzandoproporciones enormes actualmente. El
fenmeno bullying est a la orden del da y, son muchos los que han intentado
desentraar las causas subyacentes que conducen hacia este comportamiento. La
figuradelbullyomatndentrodelaclaseescadadamsfrecuente;pero,cmose
llegahastaaqu?
Enprimerlugar,dentrodelmbitofamiliar,setratadeniosquerecibenuna
actitudnegativayderechazoporpartedesuspadres,carentetotalmentedeafecto.
Seapreciaunaltogradodepermisividadenlospadres,loscualesnoponenlmitesala
conductadesushijos.Enlamayoradeloscasos,lospadresrecurrencomomtodode
afirmacindelaautoridadalusodelcastigofsicoymaltratoemocional.Estetipode
mtodos generara ms violencia porque la violencia engendra violencia. Al mismo
tiempo, se trata de nios que sufren o han sufrido periodos de crisis o de
transformacin de su contexto familiar,acontecimientos traumticos,enfermedades,
etc.
Enelmbitopersonal,elbullysecaracterizaporsufaltadecontrol,agresividad
eimpulsividad.Enalgunoscasos,estbajolosefectosdediversassustanciastxicas.
Su conducta violenta la ha aprendido en los primeros aos de su vida. Siente gran
rechazo por lo que lconsidera desviaciones externas de su vctima,es decir, rasgos
que puedan singularizarla y hacerla distinta: obesidad, gafas, estatura, color de piel,
maneradehablar
Los nios acosadores dentro del mbito escolar, han sufrido frecuentes
cambiosdecolegiopordistintascausas:desderazonesobjetivas,comoelcambiode
residencia familiar, a las provocadas por las dificultades de integracin social del
alumnado. Se trata de chicos/as de nuevo ingreso en el centro educativo, que
provienendecontextosescolaresmuydiferentesocuyaintegracinestsiendodifcil.
Hantenidounsistemadisciplinariolaxo,inconsistente,ambiguoo,enelotroextremo,
extremadamentergido.

www.enfoqueseducativos.es

340

Nmero 2 noviembre -2007


Enelmbitosocial,seproduceenfenmenodelcontagiosocial:elmodeloque
acta en un grupo influye en todos los espectadores, pero en especial en los que
carecen o no tienen formado un espritu crtico, son inseguros, dependientes y no
cuentanparaelrestodesuscompaeros.Enestoscasos,porcontagiosocialadoptan
elmodeloobservado.Enelbullysedifuminalaresponsabilidadindividual,porqueal
actuar en grupo o acompaado de otros, reduce el sentimiento de culpa que se
producira en solitario. De igual forma los cambios en la percepcin de la vctima
disminuye la culpabilidad en el agresor: si la vctima acumula insultos o ataques
continuados se le termina percibiendo como a alguien a quien no importa que se le
haganesascosas,ydealgunamaneracomomerecedoradelaagresin.
Talycomosepuedeapreciar,sonmuchaslascausasqueconducenaunnioa
comportarsecomounagresorhaciasuscompaeroseincluso,hacialosprofesores.En
realidad, detrs de cada bully o matn existe una problemtica latente que ha ido
aumentandoconelpasodeltiempo.Nohayunaraznnicaparaexplicaruncasode
bullying,sinounconjuntodecausasyrazonesmuyvariadasyenmuchoscasos,muy
duras.

Bibliografa:
ORTEGA,R.&MORAMERCHN,J.(1997).Agresividadyviolencia.Elproblema
delavictimizacinentreescolares.
OLWEUS,D.(1998).Conductasdeacosoyamenazasentreescolares.

www.enfoqueseducativos.es

341

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoD.N.I:44040721E

ElusodelFlashcards(tarjetasdevocabulario)enEducacinSecundaria.

De acuerdo con el REAL DECRETO 1631/2006, 29 de diciembre, que establece las


enseanzas mnimas correspondientes a la Educacin Secundaria Obligatoria de
acuerdoaloestablecidoenelartculo6.2delaLeyOrgnica2/2006,de3demayo,
deEducacin(L.O.E),eltercerbloquedecontenidosparalenguasextranjeraseselde
conocimiento de la lengua, es decir el conocimiento de la gramtica as como de
otrosaspectosformalescomoelvocabularioocontenidofonticos.

Enestesentido,eluso deflashcardsenEducacinSecundariaesmuytily
ayudaanuestrosalumnosaaprender.Quesunaflashcard?.Esunatarjetaquese
usa normalmente para ensear vocabulario a travs de una fotografa. A veces
incluyenlapalabraescritaenelreverso.
A parte de vocabulario, los profesores pueden ensear gramtica e incluso aspectos
fonticosdelidiomaconestastarjetas.

Los profesores tradicionales solan ensear vocabulario por medio de largas


listasquelosalumnostenanqueaprendersedememoria.Hoyenda,elusodeestas
tarjetasesmsatractivoparaellosqueesaslistas.Estocontribuyeaqueelaprendizaje
seamsfcilynaturalyaqueellosadquierenelvocabulariorelacionandounapalabra
aunaimagenascomolohacenensulenguamaterna.

Adems,lastarjetasayudanaenseargramticaoinclusoredaccionesguiadas.
Por ejemplo, mostrndoles una tarjeta con un adjetivo, ellos pueden practicar la
comparacin de los adjetivos o la formacin de adverbios. Al mismo tiempo, ellos
estn practicando ingls a nivel oral puesto que tienen la oportunidad de hablar y
pronunciarelidioma.

www.enfoqueseducativos.es

342

Nmero 2 noviembre -2007

Aparte de todo esto, se pueden hacer varias actividades y juegos usndolas.


Estopromueveeltrabajoenparejas,pequeosograndesgrupos,locualesbastante
bueno para ensearles valores sociales tales como el respeto hacia las normas, los
turnos,cooperacin

Pararesumir,elusodidcticodelasflashcardshacequenuestrosalumnosse
diviertan en la clase. Esto ayuda a que el aprendizaje sea mas fcil y que nuestros
alumnos tengan ms inters en esta lengua extranjera. El profesor debe usar tantos
recursoscomoseaposibleynecesarioparaquelosalumnosaprendan.

Bibliografa:

LEYORGNICA2/2006,de3demayo,deEducacin.(B.O.E.106,4demayo
del2006)
REAL DECRETO 1631/2006, de 29 de diciembre, por el que se establecen las
enseanzas mnimas correspondientes a la Educacin Secundaria Obligatoria.
(B.O.E5,5deenerode2007)
CARSTAIRSMcCarthy, A. (2002). An Introduction to English Morphology.
EdinburghUniversityPressCtd.
DENNING, K (1995). English Vocabulary Elements. Oxford University Press.
U.S.A.
FABRA,M.LL(1973).Lanuevapedagoga.Ed.Salvat.Barcelona.

www.enfoqueseducativos.es

343

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoD.N.I:44040721E

Qumtododetrabajoesmejorenlaclase,eltrabajoenparejasoindividual?

Ambos, el trabajo en parejas e individual son necesarios e importantes en la


claseyaquelosdosfomentandiferentesvaloresyuntipodeaprendizajedistinto.

La ORDEN de 10 de Agosto de 2007, por la que se desarrolla el currculo


correspondiente a la Educacin Secundaria Obligatoria en Andaluca, se incluyen las
cuatro destrezas bsicas para el rea de Lengua Castellana y Literatura as como
LenguasExtranjeras,losprofesoresdeinglsdebentrabajarenclasecuatrodestrezas
bsicas basadas en saber qu y como escuchar; qu ycomo hablar;qu y como
leeryquycomoescribir.

Porunlado,eltrabajoindividualesrealmenteimportanteyaquelosprofesores
necesitamos evaluar el proceso de aprendizaje de los alumnos de forma
independiente.Pormediodeestetipodetrabajopodemoscomprobarelniveldelos
estudiantes, problemas especficos de aprendizaje (gramtica, audio, escritura),
inters y motivacin e incluso su capacidad para aprender ms rpido o ms lento.
Estetipodetrabajoledaalprofesorlaoportunidaddepromovervalorespersonales
tales como la organizacin, cuidado del material, responsabilidad en general, por
ejemplo, haciendo sus deberes a tiempo. Este mtodo es importante para que los
profesoresconozcanasusalumnos.

Por otro lado, el trabajo en parejas resulta tambin interesante. Es muy


importante que los jvenes adolescentes aprendan a entablar buenas relaciones
personalesconsuscompaeros.Elcentroeselprimerlugarparahacerlo.Estetipode
mtodo ayuda a los profesores a trabajar valores como la cooperacin, el respeto
hacialasopinionesdelosdems,dejarquelosotroshablen,controldelliderazgo

En conclusin, los profesores deben usar tantos tipos de agrupamiento en la


clase como sea posible (en pareja, pequeos grupos, la clase entera, de forma
www.enfoqueseducativos.es

344

Nmero 2 noviembre -2007


individual)porquecadaunoofreceventajasdiferentesynecesariasdesdeelpuntode
vistapedaggico.

Bibliografa:

LEY ORGNICA 2/2006, de 3 de mayo, de Educacin. (B.O.E. 106, 4 de mayo del


2006).
ORDEN de 10 de Agosto de 2007, por la que se desarrolla el currculo
correspondientealaEducacinSecundariaObligatoriaenAndaluca(B.O.J.A 171,30
deagostode2007).
ANTONS,K.(1979):Prcticadeladinmicadegrupos.Herder.Barcelona.
LARSENFREEMAN, D (2000). Techniques and Principles in Language Teaching.
Oxford:OxfordUniversityPress.
RICHARDS,J,&RODGERS,T(2001).ApproachesandMethodsinLanguageTeaching
(2nd,ed).Cambridge:CambridgeUniversityPress.

www.enfoqueseducativos.es

345

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoD.N.I:44040721E

Cualdelascuatrodestrezasbsicasenelreadeinglsplanteamsproblemasa
losalumnos?Cualessonlasrazones?

El REAL DECRETO 1631/2006, 29 de Diciembre, que establece las enseanzas


mnimas correspondientes a la Educacin Secundaria Obligatoria de acuerdo a lo
establecidoenelartculo6.2delaLeyOrgnica2/2006,de3demayo,deEducacin
(L.O.E),enelAnexoI,fijalascompetenciabsicasquedebeconseguirlosalumnosal
final de la etapa de educacin secundaria obligatoria. Una de las competencias que
menciona es la de competencia en comunicacin lingstica. Esta competencia se
trabajaclaramentedesdeelreadelenguasextranjerasysereflejaenlaORDENde10
deAgostode2007,porlaquesedesarrollaelcurrculocorrespondientealaEducacin
Secundaria Obligatoria en Andaluca, se incluyen las cuatro destrezas bsicas para el
rea de Lengua Castellana y Literatura as como Lenguas Extranjeras de la manera
siguiente:
saberquycomoescuchar;quycomohablar;quycomoleeryquycomo
escribir

Parasabercualdeellasplanteamsproblemasalosalumnos,hayquehacer
una distincin entre habilidades receptivas, a travs de las cuales nuestros alumnos
reciben informacin y conocimiento (esta son la lectura y la escucha) de las
habilidades productivas, a travs de las cuales los alumnos reproducen su
conocimientoyproducennuevainformacin(hablaryescribir).

Lasprimerassonmsfcilesparanuestrosalumnosquelassegundas.Conel
fin de poner en prctica cualquierhabilidad, ellos necesitan estarencontacto con la
lengua en situaciones y contextos reales. Sin embargo, ellos no tienen tantas
oportunidades para hablar o escribir. Es ms accesible para ellos escuchar o leer en
inglsyaque,normalmente,ellosescuchancancionesqueellosmismoseligen,cintas
www.enfoqueseducativos.es

346

Nmero 2 noviembre -2007


enlaclaseoasusprofesoreshablandoelidioma.Lomismoocurreconlasocasiones
que ellos tienen para leer en lengua extranjera ya que pueden comprar revistas o
librosdeformabarataencualquierlibrera.
Tambin hay muchos carteles y anuncios en ingls en nuestro pas (en camisetas,
pelculas).Avecesinclusopreguntanporelsignificadodepalabrasquehanvistoen
algunaparte.

Sin embargo, los alumnos tienen ms problemas cuando tienen que


enfrentarseahablaroescribir.Tienenmuypocasoportunidadesparahablaroescribir
inglsensituacionesrealesylaprcticaseconvierteenalgonotanaccesible.

Portanto,nuestralaborpedaggicamsimportantecomoprofesores,estener
encuentaestosfactoreseintentarpromoveractividadesyoportunidadesenclaseen
las que losalumnos puedan trabajar lascuatro habilidades por igual sin decantarnos
msporunasqueporotras.

Bibliografa:

LEY ORGNICA 2/2006, de 3 de mayo, de Educacin. (B.O.E. 106, 4 de mayo del


2006).
REAL DECRETO 1631/2006, de 29 de diciembre, por el que se establecen las
enseanzas mnimas correspondientes a la Educacin Secundaria Obligatoria. (B.O.E
5,5deenerode2007).
ORDEN de 10 de Agosto de 2007, por la que se desarrolla el currculo
correspondientealaEducacinSecundariaObligatoriaenAndaluca(B.O.J.A 171,30
deagostode2007).
CANALE, M (1983). From Communicative Competence to communicative Language
Pedagogy.NewYork:Longman.
FAERCH,C&KASPER,G(1983).StrategiesinInterlanguageCommunication.London:
Longman.
MARNIBAEZyotros(1981):Teoradelaeducacin.Madrid:Anaya.

www.enfoqueseducativos.es

347

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoD.N.I:44040721E

Cmousarlapizarradeformapedaggicaenclase?

Elartculo7delDECRETO231/2007,de31dejulio,porelqueseestablecela
ordenacinylasenseanzascorrespondientesalaeducacinsecundariaobligatoriaen
Andaluca,mencionalasorientacionesmetodolgicasqueelprofesoradodebeseguir
durantelaetapadeeducacinsecundariaobligatoria.Dentrodeestasorientacionesse
hace alusin a una metodologa activa y participativa en la que el profesorado debe
plasmarestrategiasqueayudenalalumnadoaalcanzarlosobjetivosprevistos.
Enestesentido,laadecuadaeleccinyusoderecursosdisponiblesenelcentroyel
aulacontribuyenfavorablementeaestalabor.

Si nos centramos en el uso de la pizarra, utilizarla eficazmente es una labor


importante y que no resulta tan fcil a veces. El adecuado o inadecuado uso de la
mismapuedeafectaralaprendizajedelosalumnos,suinters,motivacin,atenciny
muchas ms cosas de las que se puedan plantear. Teniendo esto en cuenta, los
profesoresdebenactuarenconsecuencia.

Enprimerlugar,unaspectoimportanteeslacaligrafadelosprofesores.Siesta
esilegible,losestudiantestendrnproblemasparaentenderyseguirlasexplicaciones
de forma clara. Esto hace que se pierdan y, como consecuencia, no se interesen en
absoluto en lo que el profesor les dice. Los profesores deben escribir claramente,
usandoletrasmaysculasconlatizaapropiadaydecalidad.

En segundo lugar, el efecto visual en la pizarra tambin es muy importante.


Cuandolosprofesoresutilizantizasdecoloresparadiferentespuntosoaspectos,todo
resultamasclaroparalosalumnos.Lossmbolossontambinmuytiles.Porejemplo,
los profesores pueden usar el color rojo para los puntos clave o ms relevante,
asteriscos en lugar de guiones blancos o lneas amarillas para realizar cuadros o

www.enfoqueseducativos.es

348

Nmero 2 noviembre -2007


esquemas.Laspizarrasdesuperficieblancasonmstilesenestesentidoquelasde
superficieoscura.

Paraterminar,elordenenlapizarraesabsolutamentenecesario.Organizarlos
contenidosynoescribirloqueseaencualquierlugarhacequelosalumnossiganlas
explicacionesdeformamsclara.

Todosestosaspectoshacenquelapizarraseconviertaen
un instrumento imprescindible en nuestra labor educativa. Si los alumnos se sienten
atrados, ellos prestarn ms atencin as que los resultados acadmicos sern
mejores.Didcticamente,estaesnuestraprincipallaborcomoprofesores.

Bibliografa:

LEY ORGNICA 2/2006, de 3 de mayo, de Educacin. (B.O.E. 106, 4 de mayo del


2006).
DECRETO 231/2007, de 31 de julio, por el que se establece la ordenacin y las
enseanzas correspondientes a la educacin secundaria obligatoria en Andaluca.
(B.O.J.A156,8deagosto2007).
CARTER,R(2004).LanguageandCreativity.Routlege.Taylor&FrancisGroup.
HARMER,J.(1983).ThePracticeofEnglishLanguageTeaching.London:Longman.
WOODS,P.(1987):Laescuelapordentro.Barcelona:Paids/M.E.C

www.enfoqueseducativos.es

349

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoD.N.I:44040721E

Puedenlosprofesoresdeinglsusareldichoidiomatodoeltiempoenungrupode
Secundaria?

UnadelascompetenciasbsicasrecogidasenREALDECRETO1631/2006,29de
Diciembre, que establece las enseanzas mnimas correspondientes a la Educacin
SecundariaObligatoriadeacuerdoaloestablecidoenelartculo6.2delaLeyOrgnica
2/2006, de 3 de mayo, de Educacin (L.O.E). es la de desarrollar competencia en
comunicacin lingstica. Para ello, los profesores de ingls han de ser ejemplo
usandoelinglsdentrodelaula.
Pero,esposibleusarelidiomadurantetodaunaleccinengrupodesecundaria?
La verdad es que esto se convierte en una tarea complicada y los profesores se ven
forzadosautilizarelcastellanoenocasiones.

Losalumnosdebenestarencontactoconlalenguadurantetodalaleccinpero
estaesunaideauntantotericayaquelosprofesoresdehoyendanormalmentese
enfrentan a grupos de estudiantes muy heterogneos, procedentes de diversos
sectoressocialesyculturales.Estehechohacequelosprofesoresseencuentrencon
diferentes niveles en un mismo aula as que no es fcil permanecer hablando ingles
durantetodaunaleccinsinencontrarseconproblemasdecomunicacinentretantos
estudiantes ya que se pierden y se sienten frustrados por no entender de lo que se
habla.Estolesllevaaperderintersporlaasignatura.

No obstante, esto no debe influir a los profesores para que dejen de usar el
idiomaenlaclase,aunquesehagadeformacontrolada.Losalumnossoncapacesde
aprenderyponerenprcticaestructurassimples,unadelasmscomunesesPuedo
iralbao?

www.enfoqueseducativos.es

350

Nmero 2 noviembre -2007

Adems, los profesores pueden decir cosas simples, traducirlas al principio y


repetirlas de nuevo en ingls, por ejemplo, el nmero de los ejercicios que deben
hacerylapginaenlaqueseencuentran.Estaesunaformadeintroducirelidioma
paso a paso, y, aunque en principio resulta escaso, es mucho mejor que no utilizar
nuncaelidioma.

Laposturamsdidcticaquelosprofesorespuedentomaresladeusaringles
en clase pero sabindole sacar el mayor partido posible. Es mejor usar el idioma
durante menos tiempo cerciorndose de que los alumnos aprenden lo que oyen en
lugardehablartodoeltiempoeninglsyconseguirquelosalumnossedesmotiveny
desconecten.

Bibliografa:

LEYORGNICA2/2006,de3demayo,deEducacin.(B.O.E.106,4demayo
del2006).
DECRETO231/2007,de31dejulio,porelqueseestablecelaordenacinylas
enseanzas correspondientes a la educacin secundaria obligatoria en
Andaluca.(B.O.J.A156,8deagosto2007).
CARRETERO,M(1981).LateoradePiagetylapsicologatranscultural.Infancia
yaprendizaje.SegundaMonografasobrePiaget187189.
KRASHEN, S. (1982). Principles and practice in Second Language Acquisition.
Oxford:PergamonPress.
PAWLEY, A., & SYDER, F (1983). Two puzzles for Linguisitc theory: Nativelike
selectionandnativelikefluency.InJ.Richards&Schmidt(Eds).Languageand
communication.London:Longman.

www.enfoqueseducativos.es

351

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoD.N.I:44040721E

Como pueden hacer los profesores de ingls que sus alumnos usen el idioma en
clasesinqueestossesientancohibidos?

La vigente ley de educacin LEY ORGNICA, 2/2002 de 3 de Mayo, de


Educacin(L.O.E)insisteenelenfoqueprcticoycomunicativoenlaenseanzade
lenguas extranjeras a lo largo de su currculo y as lo especfica en muchos de los
objetivosdidcticosqueplantea:

objetivos de etapa LEY ORGNICA, 2/2002 de 3 de Mayo, de Educacin


(L.O.E),objetivoj:Entenderyexpresarseenunaovariaslenguasextranjeras
adecuadamente.
objetivosdereaREALDECRETO1631/2006,de29dediciembre,porelquese
establecenlasenseanzasmnimascorrespondientesalaEducacinSecundaria
Obligatoria. (B.O.E 5, 5 de enero de 2007), objetivo 5: Usar elementos
fonticos, lxicos, estructuras bsicas en una lengua extranjera en contextos
realesdecomunicacin.

Losalumnosdebenhacerusooraldelinglsenclaseyatrsquedanolvidados
lostradicionalesmtodosdeenseanzabasadosenelaprendizajesistemticoypoco
comunicativodelagramticayelvocabulario.

Sinembargo,anuestrosalumnosnolesresultatanfcilexpresarseeninglsya
que no tienen muchas oportunidades de hablar en pblico y no lo ven como algo
natural.Losprofesoresdebenserconscientesdeestoparaofrecersoluciones.

La palabra clave para hacer que los alumnos se sientan cmodos y a gusto
cuandohablaneninglesesmotivacinLosprofesoresdebendarlesrefuerzopositivo
encualquiermomentoenelqueellosusenelidiomaaniveloral,aunquecomentan
errores.Estoaumentalaseguridadensmismosylehaceseguirintentndolo.Cuando
los profesores no fomentan este aspecto sino que, en lugar de eso, regaan a los

www.enfoqueseducativos.es

352

Nmero 2 noviembre -2007


alumnosoledandemasiadaimportanciaasuserroresellossesientenavergonzadosy
frustrados.
En este sentido, crearuna ambiente tranquilo y agradable, donde los alumnos no se
sientanasustadosalahoradecometererrores,esimprescindible.

Tambinesrelevantemostrarlesloimportantequeessabercomocomunicarse
en otro idioma, concretamente, en nuestro caso, en ingles. Como ejemplo, los
profesores deben empezar desde el comienzo de sus lecciones a decir oraciones
simplesdesuvidacotidianaparaqueasseacostumbrenpocoapocoausarelidioma
comounhbitonatural.

Estassonalgunasdelasconsideracionesqueelprofesordebetenerencuenta
paraelbuenfuncionamientodesusclasesyconseguirciertosobjetivosdidcticosque
laleypropone.

Bibliografa:

LEYORGNICA2/2006,de3demayo,deEducacin.(B.O.E.106,4demayo
del2006).
REAL DECRETO 1631/2006, de 29 de diciembre, por el que se establecen las
enseanzas mnimas correspondientes a la Educacin Secundaria Obligatoria.
(B.O.E5,5deenerode2007).
KRASHEN, S. (1981). Second Language Acquisition and Learning. Oxford:
PergamonPress.
SPOSKY, B. (1989). Conditions for Second Language Learning. Oxford: Oxford
UniversityPress.
SBANDI,P.(1977):Psicologadegrupos.Ed.Herder.Barcelona.

www.enfoqueseducativos.es

353

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoDNI:44040721E

LaEducacinSecundariaObligatoriahastalos16aos.

Laanteriorleyqueregiaelsistemaeducativo,LEYORGNICA1/1990,de3de
OctubredeOrganizacinGeneraldelSistemaEducativo(L.O.G.S.E)estableciquela
edadmnimaobligatoriadeenseanzaeraladelos16aos.LavigenteLeyOrgnica,
2/2002 de 3 de Mayo, de Educacin (L.O.E) estableced la misma clausula en la
actualidad.Laideasebasaenconseguirquelosalumnosnodejensusestudioscuando
todava no tienen la madurez suficiente como para darles la importancia necesaria y
cuando no son conscientes de lo que supondr para ellos en un futuro dicho
abandono.Enestesentido,diferentespuntosdevistasehansuscitado.

En primer lugar, es cierto que antes de que esta norma fuera llevada a la
prctica,muchosalumnosdecidanabandonarsusestudiosalatempranaedaddelos
13 aos cuando todava no tenan las ideas claras sobre lo que realmente queran
hacer con su futuro. Esto aument las tasas de personas sin la adecuada formacin
acadmicaoprofesionalennuestropas.

Sin embargo, todava hoy en da hay alumnos que no se sienten atrados por
unaformacinacadmicaysesientenobligadosaasistiraclasehastaquecumplenlos
16aosyestoseconvierteenunaobligacincostosaparaellos.Comoreaccin,ellos
dejandecomportarseadecuadamenteenclase,especialmente,sitenemosencuenta
quelaadolescenciaesunaetapacomplicada.Tratarconadolescentesquesesienten
frustradosyempujadosahaceralgoquenolesgustanosestareafcilaunquelaley
(L.O.E) facilita a los profesores de hoy en da una metodologa bastante adaptada a
esta circunstancias, para ello se basa en el principio de Atencin a la Diversidad, es
decir, una metodologa en la que se tendrn en cuenta todo tipo de problemas de
aprendizajeyaseanpormotivossocioeconmicos,culturales,ascomolmitesanivel
sensorialomental.

Estosuponeunaadaptacinmetodolgicapersonalizadaparacadaalumno,lo
cualconcluyequelosprofesoresdebenorganizarunaadecuadaprogramacindesde
www.enfoqueseducativos.es

354

Nmero 2 noviembre -2007


elprincipiodecursoparacontribuiraqueelproyectoleynoseatansolounproyecto
sinounarealidadllevadaacabo.

Bibliografa:

LEY ORGNICA 1/1990, de 3 de Octubre de Organizacin General del Sistema


Educativo(L.O.G.S.E).
LEY ORGNICA 2/2006, de 3 de mayo, de Educacin. (B.O.E. 106, 4 de mayo del
2006).
BEANE,J.A.Integracindelcurrculo.EdicionesMorata,Madrid.
LVAREZ, M. Y BIZQUERRA, R. (1987). Programa de Orientacin de estudios y
vocacionalaltrminodelaescolaridadobligatoria.Barcelona:PPU

www.enfoqueseducativos.es

355

Nmero 2 noviembre -2007


MdelCarmenBautistaMontojoDNI:44040721E

Conclusindidcticaparaquelosprofesoressuperenelstress.

Hoyendaessabidoquelosprofesorespadecenstress,esdecir,excesode
cansancioproducidoporlalabordiariaqueconllevaeducaradecenasdealumnos.A
vecessecaeenlatendenciadepensarenresponsablestalescomoelcambiosocialo
el entorno familiar. Sin embargo, los profesores forman parte de esa sociedad y su
laborenloscentrosdeenseanzapblicasevereflejadaeneseentornodelquetodos
formamosparte.

Contribuir a una mejora social desde los institutos de enseanza secundaria


exige mucho trabajo y una importante responsabilidad que a veces tienen como
consecuenciaelstress.

Sinembargo,losprofesoresdebenevitarcaerenladesmotivacinoenvertan
sololacaramsnegativadelalaboreducativa.Estalaborrequiereesfuerzopero,ala
vez,esunalaborqueseverecompensadaconlaevolucinyelprogresoenelproceso
deaprendizajedemuchosdelosalumnos.Tenerclaraestaideacontribuyealalabor
didcticadiariatomndoladesdeunaperspectivapositivayconstructiva.

Adems,losprofesoresestnapoyadosporunactualsistemaeducativobajola
Ley Orgnica, 2/2002 de 3 de Mayo de Educacin, que propone metodologas muy
dinmicasconobjetivosdidcticosycontenidosbasadosnosoloenideasrelacionadas
con una sola especialidad sino varias, es lo que se conoce como interdisciplinaridad.
Adems no slo se trabajan contenidos referentes a puntos formales de cada
asignatura sino tambin aquellos aspectos socioculturales. Este es concretamente el
cuarto bloque de contenidos recogidos en el REAL DECRETO 1631/2006, de 29 de
diciembre, por el que se establecen las enseanzas mnimas correspondientes a la
EducacinSecundariaObligatoria

Enestesentido,haymuchascosasquelosprofesorespuedenhacerparaque
losalumnossesientanmotivados.Entreotrascosas,podemosprepararactividadesas
www.enfoqueseducativos.es

356

Nmero 2 noviembre -2007


como material original, diferente de los tradicionales ejercicios en el libro. En el
momento en que ellos se sienten interesados se implican ms en las diferente
asignaturasy,comoconsecuencia,aprendenmsymejor.Estohacelatareamsfcil
tantoparaelloscomoparalosprofesores.

Pedaggicamente,laclaveestenencontraropcionesyalternativasparahacer
eltrabajomsasequibleparaambaspartes.Tenerunaaptitudoptimistasetransmite
alosalumnosyestocontribuyefavorablementeensuprocesodeaprendizaje.

Bibliografa:

LEYORGNICA2/2006,de3demayo,deEducacin.(B.O.E.106,4demayo
del2006).
REAL DECRETO 1631/2006, de 29 de diciembre, por el que se establecen las
enseanzas mnimas correspondientes a la Educacin Secundaria Obligatoria.
(B.O.E5,5deenerode2007.
CAMILLERI, A. Initial teacher training: guiding students to produce their own
learningmaterials.ReportonWorkshop13B,Malta:councilofEurope.1996.
PALLARS,M.(1982).Tcnicasdegrupoparaeducadores.ICCE.Madrid.

www.enfoqueseducativos.es

357

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoDNI:44040721E

Sonlosactualeslibrosdetextoeninglsadecuadosparaelcorrectoaprendizajede
losalumnosensecundaria?

Laadecuadaseleccindelibrosdetextoesdesumaimportanciaenelprocesode
aprendizajedenuestrosalumnos.LaOrdende10deAgostodel2007 queestablece
lascompetenciasbsicasparaelreadeLenguaCastellanayLiteraturaascomoelde
lasLenguasExtranjeras.Dichascompetenciasson:

quycmoescuchar?
quycmohablar?
quycmoleer?
quycmoescribir?

En este sentido, los centros, desde el Departamento de Ingls, deben elegir


librosdetextoquerealmentereflejenestarealidad.Hoyenda,losprofesorestienen
a su disposicin libros realmente atractivos y actualizados. Estos contienen ejercicios
para practicar todas las destrezas comunicativas, actividades de diferentes niveles y
quenotienennadaqueverconaquelloslibrosconlosquelosprofesorestuvieronque
aprender.

Sinembargo,muchosprofesoresnecesitanbuscarmaterialextrayprepararsus
propiasactividadesparaasegurarsedequelosalumnosrealmenteaprenden.Estoes
porque,aveces,losactualeslibrosdetextonoincluyensuficientesejerciciosparaque
los alumnos practiquen todos los contenidos propuestos en cada unidad didctica.
Adems,normalmenteloslibrostrabajandichoscontenidosenunidadesaisladasyno
ofrecen material suficiente para el repaso, tan solo cada tres unidades. Todas las
unidades deben tener ejercicios de repaso de las anteriores. Esto forma parte del
procesogradualdeaprendizaje.

www.enfoqueseducativos.es

358

Nmero 2 noviembre -2007


Adems, los libros de texto no siempre se adaptan al nivel de todos los
alumnos.Elmanualdelprofesorsueleincluiractividadesderefuerzoodeampliacin,
sin embargo, el libro que ellos tienen no contienen actividades graduadas sino las
mismas para todos cuando con lo cual no atienden a la diversidad, es decir al
alumnadoconnecesidadespecficadeapoyoeducativoquelaLeyOrgnica,2/2006,
de3deMayo,deEducacin(L.O.E)recogeenelttuloII(Equidadenlaeducacin),
captuloI(Alumnadoconnecesidadespecficadeapoyoeducativo).Porejemplo,
lascancionesqueaparecensondemasiadoinfantilesparaalgunos,sobretodoaquellos
con niveles altos de ingles o muy difciles para aquellos con niveles ms bajos, sin
embargo, la actividad propuesta en el libro es la misma para todos y los profesores
tienenqueadaptarlas.

La mejor opcin para los profesores es la de explotar al mximo los recursos


queofrecenloslibrosdetextoy,almismotiempo,adaptaryprepararmaterialextra
para aquellos alumnos que lo necesiten. Es el profesor quien mejor conoce estas
necesidadesespecficasyloslibrosnopuedenestaradaptadosparacadaunodeellos

Bibliografa:

LEY ORGNICA 2/2006, de 3 de mayo, de Educacin. (B.O.E. 106, 4 de mayo del


2006).
ORDEN de 10 de Agosto de 2007, por la que se desarrolla el currculo
correspondientealaEducacinSecundariaObligatoriaenAndaluca(B.O.J.A 171,30
deagostode2007).
RODGERS,C.(1975)Libertadycreatividadeneducacin.Buenosaires.Paids.
TANNEN, D (1982). Spoken and Written Language: Exploring Orality and Literacy.
Norwood,NJ:Ablex.

www.enfoqueseducativos.es

359

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoDNI:44040721E

Enquetapaeducativadebenlosalumnosempezararedactareningls?

Aprenderaescribiresunadelascuatrodestrezasbsicasqueseestablecenen
elanexoIdelaORDENde10deAgostode2007,porlaquesedesarrollaelcurrculo
correspondiente a la Educacin Secundaria Obligatoria en Andaluca, se incluyen las
cuatrodestrezasbsicasparaelreaLenguasExtranjeras.

Sinembargo,losalumnosdeberanempezaraescribirtextosoredaccionesen
laeducacinprimariayasempezaraaprenderahacerlodeformagraduada.Deeste
modo,alcontinuarsueducacinsecundariapartirandeunabase.

Durantelaeducacinprimarialosalumnosdebenaprenderaescribirpalabras
en ingls. Esto no es a veces tan fcil, especialmente teniendo en cuenta que el
deletreo de una palabra no coincide con su pronunciacin. Hay que ensearles a los
alumnosesteaspectodesdeelprincipioparaque,almenos,sevayanconcienciando,
algo muy importante en su proceso de aprendizaje. Tambin pueden aprender a
escribirfrasessimplesoinclusoexpresionescoloquialesqueellosoiganencanciones.

Partiendodeestabase,cuandolosalumnoscomienzanlaetapadesecundaria,
estn preparados para aumentar y mejorar su nivel escrito. Durante estos cuatro
cursostambinhayquehacerlodeformagraduada:

En el 1er curso de la E.S.O (Educacin Secundaria Obligatoria) as como en


2ndo, los profesores deben hacer a sus alumnos escribir redacciones
facilitndoles entradilla de frases, por ejemplo, o darles frases cortas
desordenadasparaquelasordenen,escribirfrasestambinesescribir,siusan
el adecuado vocabulario sin faltas en el deletreo y ponen correctamente el
ordendesujeto+verbo+complementos,estnaprendiendoaredactar.

www.enfoqueseducativos.es

360

Nmero 2 noviembre -2007


En los siguientes cursos, 3 y 4 de la E.S.O las redacciones que nuestros
alumnos tengan que hacer no deben ser tan guiadas ya que se da por hecho
quelosalumnostienenunniveldegramticasuperiorascomomscapacidad
parapensaryrazonarporsmismos.

Los contenidos de las redacciones tambin deben variar de un curso a otro


siendo ms simples o coloquiales en los dos primeros cursos y algo ms
complicadosapartirde3.

Segn el sistema educativo vigente, los alumnos tendrn que acceder a las
pruebasdeselectividadunavezfinalizadoBachilleratoparaaccederalauniversidad,
aslorecogelaLeyOrgnica,2/2206de3deMayodeEducacin(L.O.E)enelcaptulo
IV sobre las enseanzas de Bachiller y su ordenacin, artculo 38 sobre prueba de
acceso a la universidad. En la prueba de ingls se les exige hacer una redaccin de
algntemaespecficodealrededordeochentaocienpalabras.

A nivel didctico, los profesores deben considerar como una obligacin el


prepararlesparaello,peronoesslolabordelosprofesoresenelsegundocursode
Bachilleratosinodetodoslosprofesoresalolargodetodoelprocesoeducativo.

Bibliografa:

LEYORGNICA2/2006,de3demayo,deEducacin.(B.O.E.106,4demayo
del2006).
ORDEN de 10 de Agosto de 2007, por la que se desarrolla el currculo
correspondiente a la Educacin Secundaria Obligatoria en Andaluca (B.O.J.A
171,30deagostode2007).
GARCA, L.A Y HERNNDEZ, P. Ensear a pensar, un reto para los profesores
notice (normas orientativas para el trabajo intelectual dentro del currculum
escolar).TAFOR.LaLaguna(Tenerife)1997.
HALLIDAY,M.(1989).SpokenandWrittenLanguage.Oxford:OxfordUniversity
Press.
MANN, W & THOMPSON, S (1987). Rhetorical Structure Theory: A theory of
Text Organization. Information Sciences Institute. University of Southern
California.

www.enfoqueseducativos.es

361

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoDNI:44040721E

Lalaborpedaggicadelprofesor.

Lalaborpedaggicadelosprofesoreshoyendayenpocasanterioresesuna
laborcomplejayquerequieredeunacualificadapreparacinpsicolgicayacadmica
Nuestra labor comienza desde una adecuada preparacin universitaria as como
superarlaspruebasdeaccesoquequedanrecogidasenelRealDecreto276/2007de
23 de Febrero por el que se aprueba el sistema de ingreso, acceso y adquisicin de
nuevas especialidades en los cuerpos docentes a los que se refiere la Ley Orgnica
2/2002, de 3 de Mayo, de Educacin. Y adems, el profesor debe adaptarse a los
cambiossocialesyculturalesqueafectanalsistemaeducativo.

Hoy en da, la educacin se ha convertido en una tarea no tan fcil debido a


aspectossocialescomolanodebidaimportanciaqueseledaaestudiarascomose
hacaaosatrs.
Esto dificulta la tarea diaria de los educadores. Adems, ciertos aspectos relevantes
como el respeto, los modales o el saber estar parecen que se difuminan en una
sociedadqueseinclinaporlomaterialenmuchasocasiones,aunquenosiempre.Estos
sonvaloresimportantesynecesariosdentrodelaescuelaparapoderinteractuarcon
losalumnosydarleslaeducacinnecesaria.

Incluso as, no se puede descartar a aquellos alumnos que se convierten en


ejemplos de la otra cara de la educacin. Muchos de ellos son adolescentes muy
responsablesyconlasideasclaras,unfocodeesperanzaparaconstruirunasociedad
mejor. Son alumnos entusiasmados y con la idea de aprender y los profesores se
convierten en un referente para ellos, modelos para adquirir nuevos conocimientos.
Estohacelalaborpedaggicadelprofesormuchomsfcil.

Como conclusin didctica, la preparacin que los profesores reciben sirve


realmente para formar a personas jvenes y esta es una manera de contribuir al
www.enfoqueseducativos.es

362

Nmero 2 noviembre -2007


progreso en la sociedad desde las aulas. Esta es la mejor aportacin que se puede
hacerdesdeelplanodidctico.

BIBLIOGRAFA

RealDecreto276/2007de23deFebreroporelqueseapruebaelsistemade
ingreso,accesoyadquisicindenuevasespecialidadesenloscuerposdocentes
alosqueserefierelaLeyOrgnica2/2002,de3deMayo,deEducacin.(B.O.E
53de2deMarzode2007)
LeyOrgnica2/2002,de3deMayo,deEducacin.
LVAREZ, P Y SANTANA, L. (1998). Orientacin y educacin sociolaboral: una
perspectivacurricular.Madrid:EOS.
ANAYA,D.(1999):Diagnsticoenorientacineintervencinpsicopedaggica:
basesconceptualesymetodolgicas.Madrid:UNED.

www.enfoqueseducativos.es

363

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoD.N.I:44040721E

Quycmoensearinglsaalumnosconnecesidadeseducativasespeciales?

Hoyendalosprofesorestrabajancongruposdealumnosmuyheterogneos
en los que los alumnos tienen diferentes niveles pero tambin, con necesidades de
apoyo educativo y as los denomina la Ley Orgnica, 2/2006, de 3 de Mayo, de
Educacin (L.O.E) en el ttulo II (Equidad en la educacin), captulo I (Alumnado
connecesidadespecficadeapoyoeducativo).
LaL.O.Eensuartculo73establecelosiguiente:
seentiendeporalumnadoquepresentanecesidadeseducativasespeciales,aquelque
requiera, por un periodo de su escolarizacino a lo largo de toda ella, determinados
apoyos y atenciones educativas especficas derivadas de discapacidad o trastornos
gravesdeconducta
Esto conlleva preparar y seguir una metodologa diferente con material
especfico para ellos as como actividades, objetivos, contenidos, criterios de
evaluacin, es decir, debemos hacerles una adaptacin curricular segn sus
necesidadesespecficas.

Los profesores pueden y deben ensear ingls a estos alumnos pero hay que
plantearse la cuestin de qu tipo de ingls. Dependiendo de sus dificultades o
minusvalas deberemos elegir una opcin u otra. Por ejemplo, con alumnos que
padezcansorderahayqueemplearunmtodovisual(asociandoimgenesapalabras
mediantetarjetas),einclusoatravsdelecturasoredacciones,esdecir,aprendern
inglsanivelescritoenlugardeoral.

Los alumnos con Sndrome de Down, entre otros, aprendern de un modo


diferente. Por ejemplo, en estos casos, los profesores deben ensearles ingls
centrndose en vocabulario bsico que aprendern a travs del coloreo de fotos y
dibujosascomoexpresionessimplesurdenesabasederepetrselounayotravez.
www.enfoqueseducativos.es

364

Nmero 2 noviembre -2007


De hecho, este es el modo en que los seres humanos aprendemos nuestra lengua
materna.Ellosnopuedenexpresarsecorrectamentey,aveces,loqueentiendenson
cosasmuysimples.

Losprofesorestienenquetenerencuentaestosrequisitosalahoradedisear
susprogramacionesymetodologasaseguir,espartedesulaborpedaggica.Detectar
estetipodeproblemticaascomoestablecerparmetrosycriteriosaseguirenestos
casosesalgoqueascontemplalaarribacitadaL.O.E.

Bibliografa:

LEY ORGNICA 2/2006, de 3 de mayo, de Educacin. (B.O.E. 106, 4 de mayo del


2006).
ELLIS, R (1986). Understanding Second Language acquisition. Oxford: Oxford
UniversityPress.
FARRE, A. & SOLANS, M. (2000). Estrategias de adaptacin a la diversidad. En
MIANBMRES, A y JOV. G (Coords): La atencin a las necesidades educativas
especiales:delaeducacininfantilalauniversidad.Lleida.UniversidaddeLleida.
HATCH, E (1992). Discourse and Language Education. Cambridge: Cambridge
UniversityPress.

www.enfoqueseducativos.es

365

Nmero 2 noviembre -2007

MdelCarmenBautistaMontojoD.N.I:44040721E

Aplicacin didctica en la clase de ingls basada en la experiencia en un pas


extranjero.

LosprofesoresdeinglssuelentomarcomoreferencialaciudaddeLondresen
muchasdesusactividades.Leshablanasusalumnosdesusestanciasall,lesensean
mapasdelaciudad,delmetro,postalesdelugarestpicosyunidadesenterasgiranen
tornoalacapitaldeInglaterra.
Sin embrago, se pueden usar otros pases y ciudades para trabajar, por ejemplo,
diferentesaspectossocioculturalesyas,trabajarelcuartobloquedecontenidospara
lenguasextranjerasqueestableceelRealDecreto1631/2006,29deDiciembre,que
establece las enseanzas mnimas correspondientes a la Educacin Secundaria
Obligatoriadeacuerdoaloestablecidoenelartculo6.2delaLeyOrgnica2/2006,de
3 de mayo, de Educacin (L.O.E). En este cuarto bloque se cita textualmente:
aspectossocioculturalesyconscienciaintercultural.

UnpascomoNoruegapuederesultarbastanteatractivoparalosalumnos,su
cultura,suidiomaeinclusosulocalizacingeogrficasondesconocidosparaellosen
general.Sinembargo,lageografadeestepas,consusfiordosyglaciaresascomosu
gastronomasonunafuentedematerialparatrabajarenclase.Atravsdelpaisajedel
pas se puede trabajar tanto la interdisciplinaridad, es decir, relacionar la asignatura
deinglsconladegeografaascomounodelostemastransversalescomoeseldel
conocimiento y cuidado del medio ambiente Ambos elementos forman parte del
currculoylosprofesoresdebenincluirlosensusprogramacionesdidcticas.

Loprimerodetodoesmostrarledondeselocalizaestepas,yaquemuchosde
ellos probablemente no lo sepan. Una vez situados, se pueden empezar a hacer
actividadesdeformagraduadayquelessirvaparairaprendiendoyconociendoelpas
pocoapoco.
www.enfoqueseducativos.es

366

Nmero 2 noviembre -2007


Alahoraderealizaractividades,unprofesorquehayavisitadoestepas,puedehacer
unmuralconfotografasrealestomadasall,estodarunmatizderealidadaltemaya
que los alumnos no vern este pas como algo tan lejano. Los estudiantes suelen
prestar atencin ante este tipo de informacin, les gusta hacer comentarios y
compararformasdevida.Esunabuenamaneradeintroducireltema.
Despus el profesor puede explicar lo que son los fiordos, glaciares, cataratas y su
formacin. La explicacin puede acompaarse de un DVD, este tipo de material se
puede adquirir normalmente en el lugar de origen e incluso muchas editoriales
publican colecciones de este tipo. El profesor tendr que adaptar o usar el DVD de
formaadaptadaparasusalumnosyaque,aveces,estosestnhechosparaelpblico
engeneralynoparaserusadospedaggicamente.Porello,elnivellesresultaaltoy
handehacerseactividadesenlasque,porejemplo,enlugardehacerlesrespondera
preguntas basadas en lo que escuchen s hacerles que escriban palabras que oigan,
vocabularioqueyapreviamenteseleshaenseado.LosDVDsonbastantevisualesy,
aunquenoentiendantodoloqueoyen,squealcanzanunaperspectivaintercultural,
es decir, ven el paisaje y la naturaleza de un pas diferente al suyo y lo hacen
escuchandoelinglscomolenguainternacional.

Al terminar, los alumnos pueden dar una explicacin de lo que han visto,
explicarlosfenmenosnaturalesysepuederealizarundebatesobrepequeascosas
quepodemoshaceradiarioparacuidarnuestroplanetayprevenirlanaturalezadeser
destruida.

A nivel didctico, Londres puede dejar de convertirse en un clsico en las


lecciones de ingls. Los profesores deben reciclar y adaptar sus propios materiales
manteniendosiempreelintersymotivacindelalumnado.Estopropiciarsuproceso
deaprendizaje.

Bibliografa:

LEYORGNICA2/2006,de3demayo,deEducacin.(B.O.E.106,4demayo
del2006).
REAL DECRETO 1631/2006, de 29 de diciembre, por el que se establecen las
enseanzas mnimas correspondientes a la Educacin Secundaria Obligatoria.
(B.O.E5,5deenerode2007).

www.enfoqueseducativos.es

367

Nmero 2 noviembre -2007


The European Language Portfolio: a guide for teachers and teacher trainers.
ECML Research and Development series. European Centre for Modern
Languages.
MARN IBAEZ, R (1976): Valores, objetivos y actitudes en educacin.
Valladolid:Min.

MdelCarmenBautistaMontojoD.N.I:44040721E

Lecturas graduadas en ingls para alumnos de enseanza secundaria. Son


realmenteadecuadas?

Losprofesoresquecomponeneldepartamentodeinglsdebenseleccionarel
material adecuado en cuanto a lecturas se refiere. Muchas editoriales ofrecen a los
profesores libros de lectura graduados y adaptados a los referentes niveles de los
alumnos y sus necesidades, sin embargo, a menudo, estas lecturas no funcionan
muchasveces.

Para empezar, estos libros son a veces muy extensos y largos. Contienen
muchaspginassinapenasfotografasllamativas.Adems,lasactividadesqueofrecen
soncomplicadasparaellos.

Apartedeeso,apesardelhechodeestaradaptadasalosdiferentescicloso
inclusoporcursos,noatiendenaladiversidadydanporsupuestoquelaclaseentera
puedetrabajarconelmismolibrocuandolarealidadnoesas.

Sinembargo,lapartemenosadecuadadeestoslibroseselargumento.Estos
no suelen ser suficientemente atractivos para los alumnos ni su edad. Muchas veces
estnbasadosennovelasclsicasquenoresultaninteresantesalosadolescentes.

En lugar, una alternativa para fomentar la lectura en clase, los profesores


pueden usar historias cortas que se encuentran en pginas didcticas de internet.
Estassonhistoriasdealrededordecincooseispginas,algunas,relacionadasconel
www.enfoqueseducativos.es

368

Nmero 2 noviembre -2007


vocabulario visto en clase o con un determinado aspecto gramtico. Los profesores
pueden elegir lecturas o textos en funcin de lo que estn explicando en ese
momento,seleccionandounahistoriacadadosunidades,porejemplo.Estashistorias
sacadas de estas pginas suelen contener fotografas atractivas y actividades muy
divertidasquelosalumnospuedenhacerdeformaindividual,enparejasoinclusoen
formadejuegosformandogrupos.

Didcticamente, este tipo de mtodo hace que el leer se convierta en una


actividad fcil e interesante. Si a ellos les gusta leer y cogen el hbito de hacerlo,
aprendernmuchagramtica,vocabularioyexpresionestilesparasabercomunicarse
en esta lengua. As se consigue que desarrollen una de las destrezas bsicas que
establece la Orden de 10 de Agosto del 2007 en Andaluca para lenguas extranjeras
comoesladesaberquycomoleer.

Bibliografa:

LEYORGNICA2/2006,de3demayo,deEducacin.(B.O.E.106,4demayo
del2006).
ORDEN de 10 de Agosto de 2007, por la que se desarrolla el currculo
correspondiente a la Educacin Secundaria Obligatoria en Andaluca (B.O.J.A
171,30deagostode2007).
COULTHARD, P (1994). Advances in Written Text Analysis. Routledge
Publishers,London.
LORCH, R. (1995). Sources of Coherence in Reading. Lawrence Erlbaum
Associates.
WHEELER,D.K.Eldesarrollodelcurrculumescolar.(4.ed.)Santillana.Madrid.
1993.

www.enfoqueseducativos.es

369

Nmero 2 noviembre -2007


MdelCarmenBautistaMontojoD.N.I:44040721E

Culessonlasventajasdetrabajarenclaseensilencio?

El silencio es imprescindible en el aula. En el anexo I de la Orden de 10 de


Agostode2007,porla quesedesarrollaelcurrculocorrespondientealaEducacin
SecundariaObligatoria en Andaluca, se incluyen lascuatro destrezasbsicas para el
readeLenguaCastellanayLiteraturaascomoLenguasExtranjeras.Unadeellases
quelosalumnosdebenaprenderquycomoescuchar.

Qusignificaestadestrezarealmente?:

Saber escuchar significa atender al profesorado como organizador y gua


pedaggico as como escuchar al alumnado como protagonista de un aprendizaje
prctico.

La principal ventaja de que los alumnos estn en clase en silencio es que


nuestrosalumnospuedenaprendermsymsfcilmentedebidoavariasrazones.

En primer lugar, cuando ellos estn en silencio en clase, ellos se sienten ms


relajadosy,enelmomentoenqueestnmsclamados,prestanmsatencinaloque
el profesor les est explicando o diciendo en ese momento. Esto es bastante
importante en el sentido de que si atienden recibirn mucha ms informacin y
aprendernms.

Escucharasuscompaerosesnecesariocomobasedeldilogoylainteraccin
comunicativa. Tambin les sirve para aprender de los errores de los dems y de sus
opiniones,aveces,muydiferentes,conlocual,aprendenasermstolerantes.

Al mismo tiempo, el silencio ayuda a que nuestros alumnos estn ms


organizados, es decir, si estn callados y prestando atencin tomarn notas, se
www.enfoqueseducativos.es

370

Nmero 2 noviembre -2007


enterarn de los deberes que tienen que hacer en casa, anotarn las fechas de los
exmenes.Todoestolesayudararendirmejorensusestudios.

El silencio es tambin importante para fomentar la concentracin. Cuando


nuestrosalumnosestnhaciendoactividadesoejercicios,seconcentranmejorsinadie
hablayaqueelruidolesdistraedeloquetienenquehacer.

La msica es un buen recurso para mantener el silencio en clase,


especialmente, msica relajada y tranquila. Inconscientemente, ellos se van
tranquilizandoytrabajandomejor.

Lomsimportanteenestesentidodentrodelalaborpedaggicadelprofesor,
essabercrearunadecuadoambientedeestudioyaqueestointervieneenelcorrecto
aprendizajedelosadolescentes.Unambientetranquiloquenolesexaltenileshaga
sentir incmodos es muy importante para evitar conflictos en el aula y as poder
realizarnuestralabor,esdecir,ensearlesyconseguirqueaprendan.

Bibliografa:
-

LEYORGNICA2/2006,de3demayo,deEducacin.(B.O.E.106,4demayo
del2006).
ORDEN de 10 de Agosto de 2007, por la que se desarrolla el currculo
correspondiente a la Educacin Secundaria Obligatoria en Andaluca (B.O.J.A
171,30deagostode2007).
FABRA, M.LL. (1992): La intencin en las aulas de secundaria: incidencia del
gnero, en del silencio a la palabra. Ed. Montserrat Moreno. Instituto de la
Mujer.MinisteriodeAsuntosSociales.Madrid.
HALLIDAY,M.(1987).SpokenandWrittenmodesofMeaning.SanDiego.
KNIGHT, CH.et. alii (2000). The Evolutionary Emergence of Language: Social
FunctionsandtheOriginofLinguisticForm.CambridgeUniversityPress.

www.enfoqueseducativos.es

371

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

ACTIVIDADESQUESEPUEDENHACERENELAULACONALUMNOSSUPERDOTADOS.

Los alumnos altamente cualificados son considerados como alumnos con


necesidades educativas especiales. Este tema debe considerarse no slo desde el
puntodevistadelprofesorsinotambindesdeelpuntodevistadeloscentrosylas
familias.Estosignificaquedebehaberdiagnsticosyestoslosdebenconocertantola
familia,comoelcentroyporsupuestoelprofesor.

Eldiseocurricularbsicoeselmarcogeneral.Laatencinaladiversidadest
establecida en el Decreto 231/2007 del 31 de Julio en su captulo 5. Se
desarrollenlaOrden15/01/2007,elDecreto147/2002,del11deMayoque
trata de las necesidades educativas especiales dividido en estudiantes
superdotadosyestudiantescondificultadesenelaprendizaje.
El proyecto curricular de centro: Responsabilidad de los diferentes equipos
docentes.Sisenecesitaunprogramadediversificacincurricular,seestablece
en el Decreto 231/2007 en su artculo 21 especificado en la Orden de
19/07/2006.
Programacin.
Programacindeunaclase.

Una vez que se conoce la situacin, el departamento de asesoramiento


psicolgicoguiadoporelpsicopedagogopuedencrearladiversificacincurricular
siennecesaria.Sinoloes,elprofesorprepararlaadaptacincurricular.

Lospuntosmsimportantesquetenemosqueconsiderarson:
www.enfoqueseducativos.es

372

Nmero 2 noviembre -2007

Caractersticasdelalumno.
Serrealistasconlasituacin.
Empezarconlosconocimientosprevios.
Crearalgoflexibleyadaptable.

JohnsonyJohnsondeclaraqueelaprendizajecooperativoeslamejorparaadaptar
lasnecesidadeseducativasespeciales.

El artculo 35 del Decreto 147/2002 se preocupa de las medidas especiales a


adaptartalescomo:

Flexibilidad.
Atencinindividualizada.
Programaderefuerzoenclase.
Haytresopcioneseducativas:

Acelerarelaprendizaje
Agrupamientos.
Refuerzo.

Se solicitarn dependiendo de las caractersticas del alumno, pero algunos


ejemplosdeactividadesquepuedenhacerenclaseson:

Escribirundiario
Aprenderfragmentosdememoria.
Hacerresmenesdetextos.
Leerunlibro.Resaltandoinformacinsobreellibroyelautor.
Hacerredacciones.
Preparartrabajoextraparaellos.
EjerciciosOnline.
Describirimgenes.

www.enfoqueseducativos.es

373

Nmero 2 noviembre -2007


Eldiariopuedeserunabuenaestrategia.Lesayudaaincrementarsuvocabulario,a
entender sus errores cuando el profesor los corrige y tambin, aumenta su
imaginacin.

Elprincipalelementoimplicadoenesteprocesoesaprenderaaprender,estoes,
construirunplandeaprendizajeeidentificarcualessonlasestrategiasdeaprendizaje
apropiadas. Implica hacer reflexiones del proceso, de las estrategias, del
comportamiento,delcontenido

Es altamente valioso para el profesor ya que podr centrar su enseanza en el


alumno.

Referencias.

www.coe.unt.edu/gifted/parents/highly.htm
www.ri.net/gifted_talente/character.html
www.geniusdenied.com/Articles/Record.aspx?rid
Arielle Adda & Helene Catroux (2005) Highly gifted children. Teh recociled
intelligence.
Decreto231/2007del31deJulioensucaptulo5
Orden15/01/2007
Decreto147/2002,del11deMayo

www.enfoqueseducativos.es

374

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

COMOENSEARANUESTROSALUMNOSAHABLARENPBLICOSINMIEDO

NuestromarcolegalestbasadoenlaLOE2/2006,del3deMayoyelEstatuto
Autonmico de Andaluca, donde en el art. 52 se dice que Andaluca comparte
responsabilidadeseneducacinconelgobiernocentral.

Los objetivos de la etapa de la ESO establecidos en la LOE y en el Decreto


231/2007 hacen referencia a la comunicacin en Ingls tanto oral como escrita. Se
menciona tambin en el Real Decreto 1631/2006 de 29 de Diciembre, donde se
establecenlashabilidadesocompetenciasbsicas.

Los profesores tienen que idear actividades en la clase para cubrir estos
objetivos. En primer lugar, tienen que considerar que el aula es un marco artificial
dondelasnormasestnmuybiendefinidas.Paramejorarconversacionesrealestienen
queredefinirelespaciooelmarco,lasnormasyelcontexto.

El primer ejercicio con los estudiantes esta dedicado al lenguaje corporal y al


contacto visual. Se pueden plantear actividades de mmica en parejas, ellos eligen
palabrasdelvocabularioaprendidoyslocongestostienenqueexplicarlapalabra.

Unavezquehanrepresentadotrespalabrascadaunodeellos,tienenquedecir
cuantosaciertosycuantasequivocacioneshantenido.Mientrasqueestnjugandono
sonconscientesdeloquerealmenteestnhaciendo,esdecir,utilizarsucuerpopara

www.enfoqueseducativos.es

375

Nmero 2 noviembre -2007


comunicarse delante de alguien. Luego lo harn en grupos donde la audiencia ser
mayor.

Estatcnicapuedesertilporqueellosnoestnhablandoenpblicotodava.
Perolespuedeponerencontactoconelescenario.

Una actividad ms concreta es aprender de memoria un breve fragmento


escritoyrecitarloenclase.

Sisesientenmsseguros,unapresentacinpowerpointpodraserotropaso,
en este caso les ayudan los textos que hayan escrito, las imgenes y los dibujos que
hayanseleccionado

De esta manera poco a poco, podrn hacerse con la situacin y manejar la


ansiedadyelnerviosismo.

Referencias:
o
o
o
o
o
o
o

LOE2/2006de3deMayo
Decreto231/2007,31deJulioparalaEducacinSecundariaObligatoria
RealDecreto1631/2006de29deDiciembre
DaleCarnegie(2002)Elcaminofcilyrpidoparahablareficazmente.
DaleCarnegie(2000)Comohablarenpblico
DianaBooher(1994)Comohablarenpblicosintemor
IvyNaistadt(2005)Speakwithoutfear:Practicalguidetoovercomethefearof
public.

www.enfoqueseducativos.es

376

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

COMOINCULCARLOSHBITOSDELECTURAENNUESTROSALUMNOS

Cuantoselementostecnolgicostienennuestrosjvenes?UnMP3,untelfono
mvil,unagameboy,unordenador,unavideocmara,quizsunaTV,unHIFI,pero
cuantos libros tienen en su habitacin? Normalmente leen aquellos libros que
necesitanenelcolegio,CienciasNaturales,CienciassocialesoLiteratura,entreotros.

Es un asunto de costumbre, es algo que tienen que aprender desde que son
muyjvenes,desuspadresprimeroydespusenelcolegio.

Hay algunos consejos tiles que se pueden hacer tanto en casa como en el
colegio. En primer lugar, debe verse como algo placentero, como un elemento de

www.enfoqueseducativos.es

377

juego

que

pueda

captar

la

Nmero 2 noviembre -2007


atencin
del
nio.

www.enfoqueseducativos.es

378

Nmero 2 noviembre -2007

Algunosconsejossobrelalectura:

Ayudarles a seleccionar sus libros dentro de la seleccin previa de


materialesquesehahechoenclase.
Compartir algn tiempo con un alumno hablando sobre los detalles
favoritosdellibroqueestaleyendo.
Animarlesydarlesalgntipodepremio.
Utilizarlosinformesparainculcarleslalecturaporejemplo:
o Haceruncomicconelfragmentodeunlibro.
o Representaralgunasparteshaciendoundilogo.
o Aprenderdememoriadilogoscortos.

Perolalecturapuedeayudardesdeotrasperspectivas:

www.enfoqueseducativos.es

379

Nmero 2 noviembre -2007


Puedesertilanimarlesahacersuspropiasobras,debemosconsiderar
cualquiertipodeescritura,fragmentossobreellosmismos,fragmentos
de diarios, textos funcionales como las cartas, creativos como los
poemas, incluso juegos para mejorar su imaginacin y fantasa como
sugiereGianniRodariensutrabajo.
Animarles por medio de la expresin oral, juegos de palabras,
adivinanzas,canciones,pequeashistoriasocuentos.
Animarles a utilizar diferentes formas de expresin tales como la
fotografa,obrasdeteatro,pelculasetc.

Referencias:

o http://www.aplicaciones.info/articu2/arti30b.htm
o www.clubdelibros.com/profol19.htm
o www.indexnet.santillana.es/rcs/_archivos/Primaria/Talles/Masrecursos/animal
ect/libro1b5.doc
o Oscar Iglesias, (06022007) El Pais.com Galicia. Campaa de Xerais para
animaralalecturainfantil.
o www.cervantesvirtual.com/cervlet/SirveObras
o EvelineCharmeux(1994)Comofomentarhbitosdelalectura
o JanetGardneryLoraMyers(2000)Lalecturaesdivertida:diezmtodospara
cultivarelhbitodelalectura.

www.enfoqueseducativos.es

380

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

COMOSACARPROVECHOAUNACANCIN

Lascancionesenclasesonunaactividadplacenteratantoparalosprofesores
como para los alumnos. Un ejercicio recomendable podra ser que los alumnos
memoricen la cancin pero lo que normalmente ocurre es que se aprenden el
estribillo. Pero existe un problema, no todas las canciones son apropiadas para
principiantes. La mayora de ellas son demasiado complicadas pero en realidad se
puedenencontraralgunasdefcilentendimiento.

Podemos enfocar nuestra atencin en varios aspectos dependiendo de las


necesidadesdenuestrosestudiantesodelospropsitosquetengamospreparadosen
nuestraprogramacin.

La habilidad ms explotada con este tipo de actividades es la audicin,


hablando de forma genrica. Pero antes de escuchar, podemos predecir algunos
detalles de la cancin dando algunas pistas, por ejemplo: Algunas imgenes para
ilustrarlacancin.Losalumnostendrnquedescribirlaseintentarpredecircualesel
temadelacancin.

Una vez que hemos escuchado la cancin, pedimos a nuestros alumnos que
tomen notas sobre palabras importantes, algn acontecimiento, personajes en la
cancinoellugardondetienelugarlacancin.

www.enfoqueseducativos.es

381

Nmero 2 noviembre -2007

Cuando la escuchamos para obtener ms detalles, podemos darles una copia


delaletraconalgunosespaciosenblancoypedirlesquecuandolaescuchenrellenen
esos espacios en blanco. Dependiendo del nivel de nuestros estudiantes podremos
darles una lista de posibles palabras que puedan estar en esos espacios en blanco o
hacerlodeformalibre.

En un estudio ms detallado de la cancin prepararemos una serie de frases


verdaderasyfalsassobrelaletraylespediremosqueescuchenparaaveriguarsison
ciertasono.

Conunpocomsdepreparacin,podremosconvertirlaletradeunacancin
en un ejercicio de gramtica, por ejemplo si borramos el verbo y escribimos el
infinitivopodemospedirlesqueutiliceneltiempocorrecto.

Tambinpodemostrabajarenpronunciacin,vocabulario,gramtica,reflexin
culturalsiconsideramosquetipodemsicaestamosescuchando,oinclusoescribirun
resumenounapequearepresentacinsobreeltema.Haymuchosejerciciosquese
puedenhacer,consisteenunasuntodeintersporpartedelprofesorydemotivacin
delosalumnoselprepararunaactividaduotra.
Referencias:

o Church,E.B.(2000)TheGreatBigbookofClassroomSongs.Rhymes&Cheers.
Scholastic.
o Murphey,Tim(1992)MusicandSong.OsfordUniversityPress.
o www.teachingenglish.org.uk/download/kids/using_songs.pdf
o http://links.jstor.org/sici?sici

www.enfoqueseducativos.es

382

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

COMOTRABAJANLOSLIBROSSOBREELSEXISMO?

Cuandobuscamoseneldiccionarioladefinicindesexismonosencontramos
conlosiguiente:

o Sexismo:
1. actitudesocomportamientosbasadosenestereotipostradicionalesde
papalessexuales.
2. discriminacin o devaluacin basada en el sexo de una persona, como
enlasoportunidadesdetrabajorestringidas.

Era muy comn encontrarse en hojas de ejercicios de ingls gente haciendo

estas acciones
podamos encontrar chicos que
jugabanalftbolohombresqueestabanarreglandosuscochesomujeresqueestaban
comprandoohaciendolacomida.

Pero no solamente las hojas de trabajo de Ingls mostraban indicaciones


sexistas,alolargo,delahistoriapodemosencontrarmuchosejemplosenloslibrosde
historia,porejemplo:

www.enfoqueseducativos.es

383

Nmero 2 noviembre -2007


Asiria era un territorio montaoso en el Valle del Tigris; sus habitantes, habilidosos
guerrerosycazadores,construyeronunaarmadapoderosa

Enesteprrafoelautorhablaengeneralsobreloshabitantesperoslohace
referencia al sexo masculino o podemos pensar que todos los pobladores eran
cazadoresyguerreros,hombresymujeres.

Haymuchosejemploscomoesteennuestrahistoria,slotenemosquepensar
en ello. Podemos pensar en muchos hombres importantes a lo largo de la historia,
Einstein, Leonardo
daVinci,HenryFord:

Pero en cuantas mujeres podemos pensar, algunas existen, pero quien


debemos ensear a nuestros alumnos, Marie Curie, Hellen Keller, o por que no
Pocahontas cuyo nombre verdadero era Matoaka con esta persona adems podran
aprender cosas sobre los asentamientos Ingleses en Norte
Amrica.

En nuestras clases debe ser distinto porque una de las


caractersticasdenuestraenseanzadeberserlamotivacin.

Lademandadeinformacinestasiemprebasadaenpersonajesquelesgustan,
ellosnoestnpensandosisonhombresomujeres,solamentepiensansilesgustao
noporseruncantantefamoso,unfutbolista,un
actor o una actriz.
Bajolasupervisinyguadelprofesor,cualquier
personaje famoso
serbienvenido.

www.enfoqueseducativos.es

384

Nmero 2 noviembre -2007


As encontraremos en nuestros centros posters de Ronaldinho, Shakira o
LeonardodiCaprio,porejemplo.Realmentenoimportasobrequinhablensiemprey
cuandopractiquenelInglsyaprendanalgosobreellos.

Referente:

o www.edualtes.org/material/dona/lenguaje.html
o www.educastur.princast.es/cpr/aviles/asesoria/socioling/FONDOSDEBIBLIOTEC
AESCOLARYCOEDUCACION%5B1%5D.doc
o Gaby Vallejo Canedo (2001). De toros y rosas. Imgenes del sexismo en los
librosparanios.
o Michel,Andree(1987). Fuerademoldeshaciaunasuperacindelsexismoen
loslibrosinfantiles.

www.enfoqueseducativos.es

385

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

DIVERTIRSEENCLASEMIENTRASAPRENDENINGLS:UNMITO?

Haymuchasconsideracionesquedebentenerseencuentaparacontestaresta
pregunta,enprimerlugar,laspartesinvolucradasenelproceso,larelacinqueambos
mantienenylacompenetracinqueexisteentreellos.

En segundo lugar, el nivel de Ingls es tambin muy importante, aunque


pueden aprender tambin mucho sobre la cultura inglesa, el vocabulario y las
estructuras.Haymuchoejemplosenversoyenprosa,tambinsepuedenencontrar
muchos programas de televisin que explotan estos aspectos. Por ejemplo, hay un
versoescritoporHarryGrahamquedice:

Theresbeenanaccidentetheysaid.

Yourservantscutinhalf,hesdead

IndeedsaidMrJones,andplease

Sendmethehalfthatsgotmykeys

Con esta rima, dependiendo del nivel de los alumnos, podramos jugar con la
fontica, simplemente separando la rima en las cuatro partes hasta que ellos
encontrasenlaformacorrecta.

Buscarpalabrasconlasmismasterminaciones.
Intentarconvertirlarimaenprosa,aslosestudiantesutilizanelestiloindirecto
enlugardeldirecto.
Representarlarima.
www.enfoqueseducativos.es

386

Nmero 2 noviembre -2007


Aprenderladememoria.
Contarunahistoriaquetengaestefinal.
Hacerunpsterconlarima.

Sielprofesorsabecomosacarelmayorpartidoposibledelarimaenclase,ellos
disfrutarnyaprendernIngls.Slosenecesitadactitud.

Referencias:

http://en.wikipedia.org/wiki/Harry_Graham_(poet)
www.ruthlessrhymes.com/facts/photos_of_harry_graham.html

www.enfoqueseducativos.es

387

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

HAYALGNPROBLEMAENDEJARLLEVARVELOENLASAULAS?

Hayalgnproblemaenllevaruncrucifijo?Siestamossolamentehablandode
religin,larespuestadeberaser:No.

Hay muchos artculos y polmicas sobre este tema. Algunas mujeres


musulmanas consideran esta accin como una cuestin de identidad no slo de
religin. Esta es la razn por la que se puede encontrar una divisin en los grupos
Islmicos,algunaspersonasconsideranestocomounasuntodeculturayotrasdanla
bienvenidaalhechoderetirarsuvelo.

Peroencontramosalgunostiposdiferentesdevelos:

Hijab:Cubreelpeloyelcuello.Puedenllevarropasoccidentalesconel.
Chadar:Esunvelolargo.Cubreelpeloelcuelloyvahastalospies.
Niqab:Esunveloquecubretodoexceptolosojos.
Burka:Cubredelacabezaalospiesyslodejaunarejillaparalosojos.

Algunasescuelasestnafavordeprohibirelveloporlassiguientesrazones:

www.enfoqueseducativos.es

388

o
o
o
o
o

Nmero 2 noviembre -2007


Unasuntodeseguridad.
Laimportanciadetenercontactovisualconlosalumnos.
Hacerlacomunicacinmsfcilentreelprofesorylaalumna.
Hacerlacomunicacinmsfcilentrecompaeros.
Si un profesor no puede ver la cara de su alumna, el / ella no sabr con que
entusiasmo,angustiaofaltadeatencinestlaalumna.Nopodemossabersi
estprestandoatencinono,osientiendeloqueelprofesorestdiciendoo
no.

AyshahIsmaelprofesoradeuncolegiodeniasmusulmanasenPrestondijoa
laBBCquellevarelvelopromovalaigualdad.Dijo:setejuzgaporquineresno
porloqueeres,asexistendosargumentosenlacuestindeigualdad

Algunosdelosprincipiosenlosquesebasanuestrosistemaeducativosonelde
nodiscriminacinporunlado,yporotro,elprincipiodenormalizacinparaalcanzarla
integracin de todos nuestros alumnos. Si esto es as, nuestros centros deberan
reconocerelderechoallevarvelo,perosiesunasuntodeeducacin,padresehijas
deberan tambin entender que hay una necesidad en ver el rostro del alumno o
compaero,paraentendercualessonsussentimientosoinclusoqueestdiciendo.

Referencias

http://news.bbc.co.uk/2/hi/uk_news
www.exsoftech.com/akram/hijab.asp
www.faithfreedom.org/Articles/abulkazen/unveilin_islamic_veil.htm
www.muhajabah.com/faceveil.htm
Jan Goodwin (2002) Price of Honor: Muslim women lift the veil of silence on
theislamicworld.
o Deborah Rodriguez and Kristin Ohlson (2007) Dabul Beauty School: An
americanwomangoesbehingtheveil
o
o
o
o
o

www.enfoqueseducativos.es

389

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

VENTAJASYDESVENTAJASDELUSODECANCIONESENLACLASEDEINGLS.

Cuandotrabajamosconunacancinnopodemostrabajarsoloenlaaudiciny
repeticindelacancin,estaestrategiasloayudaacaptarlapronunciacin,peroel
objetivoprincipaldeutilizarcancionesenclaseeslacomunicacin,lascancionesson
unamanerarelajadadeobtenernuestroobjetivo.

DESVENTAJAS

VENTAJAS

Atmsferadetrabajo
Fcilderecordar
Traspasodecultura
Repeticin

Noesunexponenteserio
dellenguaje.

Laprogramacinsequeda
incompleta
Dificiltraduccion
Problemasconel
vocabulario.

Algunas de las actividades que podemos realizar con las canciones, si no


conocenlacancinson:

1. Elprofesorinventacuatrottulosparalacancinydespusdeescucharlalesda
laposibilidaddeelegirentrelascincoposibilidades,lacorrecta.
2. En grupos tienen que elegir el ttulo correcto e intentar dar razones para sus
respuestas.
3. Intentarcontextualizarlacancin,localizndolaeneltiempoyenelespacio.
4. Inventarsupropiottuloparalacancindandosusrazones.

www.enfoqueseducativos.es

390

Nmero 2 noviembre -2007


Estapequeamuestradeactividadesesunejemplofcildecmolacomunicacin
se puede explotar utilizando una cancin como punto de partida. No es necesario
advertirqueelniveldelgrupomarcalacomplejidaddelasactividades.Estosejemplos
seran para alumnos con niveles bsicos. Pero no es slo importante el nivel de los
alumnos, los profesores debe involucrarse en el proceso de aprendizaje tanto como
seaposible,intentandoresolverlosinconvenientesquesepuedaencontrar.

Referencias:

o www.cepgranada.org~jmedina/articulos
o http://bcatrogonzalez.blogspot.com
o Leonor Moreno y Angel Muller (2000) La msica en el aula: globalizacin y
programacin.
o Rock & orff: Beatles Carlos Santana,propuestas para la interpretacin en el
aula.(2003)EditorialGrao.

www.enfoqueseducativos.es

391

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

QUESUNAWEBQUESTYCOMOSEPUEDEUTILIZARENUNACLASEDEINGLS?

Laeducacinsobrelasnuevastecnologasesuncampoespecialquehaestado
presente de alguna manera desde los aos 60s. Los especialistas en ingeniera y
educacin pasaban su tiempo con la idea de ayudar a la gente a aprender de una
maneradiferente.

Laswebquestsaparecen,comootrasinvenciones,sintenerlaintencindeque
fueranas.BernieDodgefueelcreadordelformatoqueconocemoshoyendacomo
Webquest,surgisolamenteporquenotenaunacopiadelosmediosnecesariospara
mostrarlesalgoasusalumnos.Aselorganizlasfuentes,unaspginasparahaceruna
evaluacin del proyecto, unas cuantas pginas web, y una tarea. Y puso a sus
estudiantesatrabajarengrupos.Deestaformaapareciloqueconocemoshoycomo
webquest.Tienenformatodeclaseorientadaconpreguntasenlaquelainformacin
quenecesitanlosalumnosprovienedelaweb.

La idea principal que distingue a una webquest de otras experiencias es que


tienesquehaceralgoconlainformacin.Elpensamientopuedesercreativoocrtico,
e implica resolver un problema, hacer un juicio, un anlisis o sntesis. La tarea tiene
quesermsqueresponderaunaspreguntas,tienequeverconlaresponsabilidad,la
colaboracin,labsquedaindividual,darlesentidoalanuevainformacin,usardatos
quevienendeotroslugaresqueloslibrosdetexto,organizarsusopinionesylasdesus
compaerosparahacerunproducto.

www.enfoqueseducativos.es

392

Nmero 2 noviembre -2007

Las webquests son una posibilidad para los alumnos de aprender ms, de
mejorarsuhabilidaddigitalylacompetenciacomunicativaenunalenguaextranjera.
Estopuedesucedersilosprofesoresestnrealmentepreparados,enprimerlugar,los
profesoresdebensercapacesdecrearunapginaweb.Ensegundolugar,elprofesor
debesaberdondeencontrarlainformacin.Elrestoeslatareadecualquierprofesor.
Pero en este tipo de proyectos es de gran ayuda si el profesor adems tiene
conocimientossobreestrategiasdeaprendizajecooperativo.Dependiendounasdelas
otrassecrearnsituacionesdetrabajo.

Referencias:
o Heidi Schweizer and Ben Kossow (2007) Digital. Webquests: tools for
differentiation.:anarticleform:Giftedchildtoday
o AndrewJ.MilsonandPortiaDowney(2005)Digital.Webquests:UsingInternet
Resourcesforcooperativeinquiry.:Anarticleform:socialeducation.
o Jan Lacina (2007) Digital. Inquirybased learning and tecnology: designing and
exploringWebquests.(Technologyintheclassroom)Anarticleform:Childhood
Education.
o www.eduteka.org/reportaje.php3?ReportID=0011
o www.aula21.net
o www.isabelperez.com/webquest/
o www.auladeletras.net/webquest.html

www.enfoqueseducativos.es

393

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

EL USO DE LOS RECURSOS TECNOLGICOS EN EDUCACIN SECUNDARIA. ES UN


ASUNTOCREIBLEOFACTIBLE?

Nuestroscentrosestnencontrandoalgntipodeproblemasconelmalusode
los TICs, por ejemplo, el uso de los mviles. Es muy comn encontrar en Internet
secuenciasgrabadasobtenidasconuntelfonomvil.Losprofesorespodranutilizar
esteintersensupropiobeneficiocondiferentespropsitos.

Realizar pequeas pelculas de video puede ser una estrategia efectiva para
motivaralosalumnosdesecundariaenlasclases.

Algunas veces los profesores encuentran una aversin a todo lo que significa
escuela,asquetienenquebuscarotrotipodemetas,porejemploelvideo.Enprimer
lugar los alumnos estn menos preocupados por la asignatura porque el lenguaje es
secundario.Luegoselespermitehacerlaeleccin,decidirquetipodepelculaquieren
escribir.Esunaformaextraordinariadecomprobarsuscontradicciones.

Ensegundolugar,cuandoselespermitedecirloquequieren,lesliberasdesus
frustracionesyemocionesreprimidas.Unavezquelesdejashacerloquequierencon
algunas modificaciones y negociaciones, el profesor puede empezar a practicar
estructurasconellos.

Es muy importante aclarar cual esel principalobjetivo en esta tarea. La clase


enteradebesabercualessonlasreglasquedebenseguirencadagrupoycomoclase.
www.enfoqueseducativos.es

394

Nmero 2 noviembre -2007


El tiempo que se le dedique a este proyecto a todos los detalles tiene que estar
decidido.

Mientrasmuchosprofesorespuedequenoconsiderenlatraduccincomouna
buenaopcinatenerencuentaenlasclasesdeIngls,enestasituacinseradegran
ayuda porque uno de los problemas de los estudiantes es el orden diferente de las
oraciones.Deestaforma,sernconscientesdelospequeoscambiosquetienenque
hacerparaproducirmensajesenlenguaInglesa.

Estoscambioshacenalosjvenesalumnosmiraralaprendizajedelalengua
inglesadeunaformadistinta.

Referencias:

o http://chopo.cnice.mecd.es/~fgomez5/video.htm
o http://livedocx.adobe.com/flashlite
o ClaudiodeMouraCastro,AimeeFerdisco(2004)Comomejorarlaeducacin.

www.enfoqueseducativos.es

395

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

CUL ES LA OFERTA DE LA ADMINISTRACIN PARA QUE LOS PROFESORES DE


INGLS MEJOREN? QU CURSOS O PROGRAMAS DE ENTRENAMIENTO ESTAN
ACTUALMENTEDISPONIBLESPARALOSPROFESORESDELENGUASEXTRANJERAS?

Hoyenda,losprofesoresdelenguasmodernasdebentenerunperfilespecial,
sesuponequedebenestarpreparadosparamoversedeunlugaraotrootrabajarcon
personasdediferentespasesintercambiandoinformacin.

ElltimoprogramapuestoenmarchaporlosresponsablesdeEducacinfueel
llamado Programa Scrates. Fue sustituido por el programa Lifelong Learning
Programmequehasidoelltimo.

El programa Scrates se cre en los pases Europeos. Estaba basado en la


AGENDADELISBOAdondeelaprendizajeatravsdetodalavidaestabapresente,esto
es porque el ritmo de cambio es tan vertiginoso que los profesores tendrn que
preparar a los estudiantes para tener flexibilidad y habilidad para adaptarse a las
circunstancias.

LosprincipalesobjetivosdelLifelongLearningProgrammeson:

o
o
o
o

Intercambiodeexperiencias.
Cooperacinentrepasesycentros.
Movilidadentrecentrosypases.
Capacidadparaelaprendizajepermanente.
www.enfoqueseducativos.es

396

Nmero 2 noviembre -2007

Esteprogramaempezel1deEnerode2007ycontinuarhastafinalesde2013.
En este periodo de tiempo, las escuelas primarias (alumnos de 5 a 11 aos) y las
escuelas secundarias sern capaces de mejorar sus programas en Espaa por el
intercambiodeideas,materiales,recursosetc.

El principal objetivo de los profesores de Ingls es hacer que los estudiantes se


sientanmiembrosdelaComunidadEconmicaEuropeayparteactivadelmundo.Con
respecto a esta idea los objetivos especficos de este programa que deben
considerarseson:
o
o
o
o
o

Ciudadanaactiva.
Aprendizajedeidiomas.
Usodelasnuevastecnologas.
Ciudadanaeuropea.
Dilogointercultural.

Losprogramasmsimportantesson:

o ProgramaComenius.Seocupadelosalumnos.Suactividadprincipalesponera
losestudiantesencontactodediferentespases.
o Ayudante Comenius. Se ocupa de los profesores. Todas las escuelas tienen
accesoaestosprogramas.
o ProgramaGruntvig:Essimilarperolaenseanzaestdedicadaalosadultos.

Teniendo estos programas a nuestro alcance, nuestros centros no pueden


quedarseatrsenestetipodecooperacin.

Referencias:

o
o
o
o
o

www.mec.es/programaseuropeos/jsp/plantillasoc.jsp?id=comenius
www.mec.es/programaseuropeos/jsp/plantillasoc.jsp?id=catacomgr
http://.ec.europa.eu/educacion/programmes/llp/comenius/index_en.html
www.profesores.universia.es/becas/pap/grundtvig/index.htm
http://ec.europa.eu/education/programmes/llp/grundtvig/index_en.html

www.enfoqueseducativos.es

397

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

LA FONTICA ES TIL PARA NUESTROS ALUMNOS? PODEMOS ENSEARLES


FONTICA? UTILIZAMOS SIMBOLOS FONTICOS EN LA PIZARRA PARA GUIARLES?
ENTENDERANLOSSMBOLOS?

Cualquiertipodeaprendizajeenlalenguatieneinfluenciasunasdeotras.Esto
involucraalascuatrohabilidades.Latransferenciafonolgicadelalenguamaternaes
unprocesonaturalenelaprendizajedeunsegundoidioma,ylosprofesoresdeberan
responderaestodeunaformaselectiva.EsloquesugiereJenniferJenkins(profesora
desociolingsticayfonticaenelKingsCollagedeLondres).Tambinconsideraque
unaapropiadaproduccindeloselementosautilizarenellenguajeesnecesariapara
unentendimientomutuoentreloshablantes.

Aprenderunlenguajeesunprocesoenelquetenemosquediferenciarentrela
adquisicin y aprendizaje, el primero es natural e inconsciente y el segundo es
consciente y con la necesidad de un gran esfuerzo. Entre estos dos extremos de un
continuoencontramosloquesellamaInterlanguage.

Si hacemos una comparacin entre los elementos fonolgicos de ambos


sistemas,encontramosalgunasconsonantesconlasmismascaractersticas,comolas
oclusivasyalgunasotrasquesontotalmentediferentescomolassemivocalesinglesas
o la nasal palatal espaolas. Las semejanzas pueden hacer que los estudiantes
tomen prestados algunos modelos de pronunciacin de su lengua materna y los
trasladen a la lengua objetivo de aprendizaje. Podemos ayudarles utilizando en la
pizarraalgunossmbolosfonticosparaestablecerunaclaradiferenciaentreambos.

www.enfoqueseducativos.es

398

Nmero 2 noviembre -2007

Noesnecesarioescribirenlapizarratodoslossmbolos,peropocoapocoes
posible. Por ejemplo, si empezamos con un juego intentando diferenciar parejas de
palabrasconsonidossimilarescomo[b]y[v]o[z]y[s].Yasesabequeungrannmero
de pueblos andaluces tiene ciertas peculiaridades en cuanto a su pronunciacin, por
ellopodremosteneralgunosproblemasaadidosconnuestrosalumnos.Esteejercicio
sepodrhacerenparejas,engruposocontodalaclase.

Otra posibilidad es el uso de otros smbolos, diferentes de la fontica, para


determinar el acento que es diferente en ambos idiomas. Podra utilizarse cualquier
figura,omarcandoelacentoconlasletrasdemayortamao.

En cualquier proceso de formacin, es difcil al principio entender el cdigo


nuevo, pero si lo utilizamos lo suficiente tendrn las suficientes posibilidades para
aprenderloyutilizarlodentrodesusposibilidades.

Referencias:

o
o
o
o
o
o

www.teachingenglish.org.uk/think/pron/global_english
http://en.wikipedia.org/wiki/vowel
http://en.wikipedia.org/wiki/consonants
Ashby,M&Maidment,J.(2005)Introducingphoneticscience.Cambridge.
Hancock,M.(2003)Englishpronunciationinuse.Cambridge.
Fraser,H.(2001)Teachingpronunciation:ahandbookforteachersandtrainers.
Canberra.

www.enfoqueseducativos.es

399

Nmero 2 noviembre -2007

JoanaMRustarazoHervs

D.N.I.75068457E

Trabajoenparejasoindividual:Culesmejor?

Alahoradetratarunaactividaddentrodelauladeingls,losprofesoresdeben
considerarlasdiferentesformasdeagruparalosalumnos:demaneraindividual,por
parejas, o trabajo en grupo. Las dos primeras son los puntos a considerar en este
artculo.

En primer lugar, vamos a hablar sobre el trabajo individual. Este, como su


nombre indica, tiene que ver con el hecho de que sea el alumno el que trabaje de
maneraaislada,contandocontodalaayudaqueselepuedaofrecer(esdecir,librosde
referencia gramtica, diccionarios y el profesor, por citar algunos). Este tipo de
actividadesfomentaelaprendizajeautnomo,metaaobtenersegnlasactualesleyes
educativas.

Losprofesorespuedenutilizarestetipodetrabajoconactividadesrelacionadas
con la escritura, la escucha de alguna conversacin, y/o la lectura de algn texto. El
motivoparaelegirestetipodeagrupacinsedebeaqueeselpropioalumnoelque
tienequeentenderydescifrarlainformacintransmitidaolaquequierentransmitir.

Otro motivo para utilizar el trabajo individual es que puede llevar menos
tiempo, ya que normalmente la organizacin de la clase sigue esta disposicin.
Adems, mientras los alumnos trabajan a su ritmo, el profesor puede ayudar a
aquellosalumnosquelorequieran,loquefacilitalaeducacinaladiversidad.

En segundo lugar, el trabajo en parejas se refiere a la agrupacin de dos


personas para desempear cualquier tarea. Esto nos permitir llevar a cabo
actividades relacionadas con propsitos comunicativos, tales como dilogos, puesto
quedosomspersonassonlasquesenecesitanencualquiertipodecomunicacin.
Adems de ensear el respeto y la tolerancia a las opiniones de los dems, ambos
valorestambinmuypresentesenlalegislacinactual.

Una ventaja de este tipo de organizacin es que el profesor puede agrupar


alumnoscondistintascaractersticas,porejemplo,unalumnoaventajadoconotroque
no lo es tanto, a fin de que ambos salgan beneficiados de esta actividad (uno
aprendiendo, y el otro reforzando sus conocimientos sobre ese tema). Al mismo
tiempo, los alumnos pueden sentirse ms abiertos a la hora de utilizar la lengua
extranjerayaquehablansloconunapersona,enlugardedirigirseatodalaclase.Un
punto que no se debe pasar a la ligera es la edad y la etapa evolutiva de nuestros
alumnos,quienessonadolescentes,yaquieneselsentido delridculomuchasveces
lesimpidehaceralgoquerealmentequierenhacer,pormiedoaquesepuedanrerde
ellos.
www.enfoqueseducativos.es

400

Nmero 2 noviembre -2007

Sinembargo,elprimerpuntoquedebemosconsideraralahoradeagrupara
losalumnosporparejaseselcriterioquevamosautilizar.Encasodequenohayamos
pensadoenestepuntodeantemano,nosllevartiempohacerlosobrelamarcha.Otro
aspectoaconsideraresqueladisposicindelaulanopermitaesto,oenelsupuesto
dequeelnmerodealumnosseaimpar.Asimismo,elprofesordebercontrolarque
la tarea se desarrolle de la mejor manera posible y que los alumnos usen el ingls
comoinstrumentodecomunicacin.

Paraconcluir,debemosadmitirelhechodequeelelegiruntipodeagrupacin
uotronoesunproblemadeculesmejoropeordentrodelaclase,sinodeculesel
que se adapta mejor a la propia actividad. No debemos imponer una manera u otra
pormotivosajenosaesaactividad.Aslosbeneficiosobtenidosalahoradeaprender
unanuevalenguasernanmayores.

Bibliografautilizada:

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.

Decreto 231/2007, de 31 de julio, por el que se establece la ordenacin de la


EducacinSecundariaenAndaluca.

Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

DOYLE,
W.
Classroom
Organization
and
Management.
HandbookofResearchonTeaching,1986MacmillanLibraryReference

EVERTSON, C, Ed; WEINSTEIN, C., Ed. (2006) Handbook of Classroom Management:


Research,PracticeandContemporaryIssues.LawrenceErlbaumAssociates.

HARMER,J.(1998)HowtoTeachEnglish.Harlow:Longman.

HARMER,J.(1988)ThePracticeofEnglishLanguageTeaching.NewYork:O.U.P.

www.enfoqueseducativos.es

401

Nmero 2 noviembre -2007

JoanaMRustarazoHervs

D.N.I.75068457E

CCUUNNDDO
ODDEEBBEERRAANNLLO
OSSAALLUUM
MNNO
OSSEEM
MPPEEZZAARRAARREEDDAACCTTAARR

Siemprequetenemosqueescribiralgo,yaseaenlalenguamaternaoenuna
lenguaextranjera,nosenfrentamosaunatareacompleja:sobrequvoyaescribir?
Serrelevante?Gustar?

Siaadimosqueloquevamosaescribirvaestarenunalenguadiferenteala
nuestra, esta actividad puede ser tediosa para nuestros alumnos, pero no por ello
debedejarseaparte.

Porestarazn,losalumnosdebenempezaraescribirloantesposible.Esaqu
candosurgeotranuevacuestin:Cmosepuededesarrollarestadestreza?

Paraempezar,hayqueconsiderartrestiposdeactividadesrelacionadasconla
escritura, a saber, aquellas que estn controladas, las que son guiadas, y las de
escrituralibre.Ahoracontinuaremosconunanlisisdecadaunodeestostipos.

Las actividades controladas son aquellas en las que a los alumnos se les dan
todosloselementosnecesariosparalaescrituradefrases,sinquesetengaquepensar
muchoenesaformacin,sloenaplicarlaregla.Sonactividadesmsautomticaso
mecnicas.Algunosejemplosdondepodemosencontrarestetipodetareasson:

y
Rellenarhuecos
y
Ordenarlaspalabrasafindecrearoracioneslgicas
y
Dictado
y
Escribirrespuestasypreguntasconcretas

Encuantoalasactividadesqueestnguiadas,podemosdecirquesonlasque
siguenciertosindicativos,peroqueademstienenqueaadirinformacinadicional.
En este caso, se les puede ofrecer a los alumnos modelos a seguir o algunos puntos
claveatratar.
Clarosejemplosdeestetipodetareaspuedenser:

y
Empezarunahistoriacuyofinalseconoce
y
Terminarunahistoriatrasconocercmoempieza

Para concluir, las actividades de tipo libre son aquellas ms creativas. El


profesorsugiereuntemaylosalumnostienenquedesarrollarideasrelacionadascon
dichoaspecto.
Actividadesdentrodeestacategorapuedenser,entreotras:

www.enfoqueseducativos.es

402

Nmero 2 noviembre -2007


y
y
y
y

Escribirresmenes
Escribirunartculo
Escribirundiario
Tomarnotas

Trasesteanlisissepuedecomprobarquenoestandifcilelhechodeponerse
aescribirenunalenguaextranjeracomoenunprincipiopuedeparecer.
Bienesciertoquenotodoslosalumnosposeenlasmismascapacidades,yque
habralgunosqueselesdmejorqueaotros.Noesperamoscreargrandesautores
comoCela,Cervantes,oArturoPrezReverte,porsupuesto.Loquessepretendees
quenuestrosalumnosseancreativosysepanusarcorrectamentelalenguaextranjera.

Si se desarrolla esta destreza desde el principio, es decir, desde que los


alumnos empiezan la enseanza de una lengua extranjera, nuestros alumnos sern
capacesdeusarestalenguaparacomunicarideasosentimientos.

Un punto tambin a tener en cuenta es que los temas propuestos para que
nuestrosalumnosescribanseaninteresantesymotivantes.Inclusopodramospensar
enunpblicoconcreto,enunreceptordeesetextoescrito,paraqueveanquetiene
una utilidad aparte de la mera intencin didctica. De esta manera esta actividad se
transforma en un elemento comunicativo y funcional, en algo real, siguiendo as los
principios propuestos en la Ley Orgnica de Educacin, aunque se retrase esta
destrezahastaelsegundociclodelaESOoinclusoBachillerato.

Bibliografa:

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.

Decreto 231/2007, de 31 de julio, por el que se establece la ordenacin de la


EducacinSecundariaenAndaluca.

Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

HARMER,J.(1988)ThePracticeofEnglishLanguageTeaching.NewYork:O.U.P.

KROLL,B.,Ed.(2003)ExploringtheDynamicsofSecondLanguageWriting.Cambridge:
CambridgeAppliedLinguistics

www.enfoqueseducativos.es

403

Nmero 2 noviembre -2007


JoanaMRustarazoHervs

D.N.I.75068457E

AAlluum
mnnoossttm
miiddooss::IIddeeaassppaarraaqquueesseeiinntteeggrreenneennccllaassee

Dentrodeunaclaseesmuyfcildistinguiralosalumnostmidosdelrestode
suscompaeros.Ellosseesconden,inconscientementeono,ytratanfervientemente
denollamarlaatencin.

La pregunta que se trata de responder aqu es la de: cmo puede integrar el


profesor,enestecasodeingls,aestetipode alumnadoafindeque participeyse
integrecompletamenteenclase.

Elprimeraspectoatenerencuentaesqueelprofesordebecrearunambiente
relajadodentrodelaula.Esaqudondedebemosrecordarquenuestroalumnadose
encuentradentrodelacomplejaetapaevolutivadelaadolescencia.Ellosintentanpor
todos los medios ser aceptados y no salirse de las normas impuestas dentro de sus
compaeros, del grupo. Por tanto, algo que evitan por naturaleza es el cometer
errores,seandeltipoquesean,afindequenadiesepuedareroburlardeellos.

El papel del profesor en este punto es de vital importancia, puesto que debe
cortar radicalmente cualquier manifestacin de desaprobacin o ridiculizacin de un
alumno, por poner por caso. A modo de solucin, el profesor puede pedir a los
alumnos o alumno implicados en la crtica de otro compaero que respondan a
algunaspreguntasqueparecenfciles,peroquetienenalgunacomplejidad,paraque
ellos tambin se equivoquen y se den cuenta que equivocarse es de humanos, y de
quenohaynadamaloenello.Loserroressontilesnosloaprendiendounalengua
extranjera, sino tambin en la vida cotidiana, esto entrara dentro de la educacin
integraloeducacinenvalores.

En segundo lugar, nosotros como profesores debemos potenciar la


participacindeestaclasedealumnado.Deestaformaelprofesortendrqueobligar
a los alumnos a colaborar en clase con cualquier intervencin. Con el tiempo, se
acostumbrarnahablarenpblico,ysesentirncmodosanteestassituaciones,por
lo que no ser necesario el hecho de que sean voluntarios forzados. Esto ayuda a la
educacinaladiversidad.

En tercerlugar, podemos tambin hacerles preguntas para introducirles en la


dinmicadelaclase,conocersusgustoseintereses,yusarlosafindequetenganalgo
quedeciryaslohagan.

A modo de conclusin, hay que admitir que el hecho de introducir a los


alumnosquesonmsreservadosotmidosdentrodelaclasellevasutiempo,noes
algo que se consiga de la noche a la maana. Incluso algunas veces los resultados

www.enfoqueseducativos.es

404

Nmero 2 noviembre -2007


obtenidosnosonptimosdebidoporejemploaqueelnmerodealumnosporclase
esalto,aligualqueelnmerodealumnosquemuestranestascaractersticas.

Sin embargo, si los resultados obtenidos son favorables, se logra el objetivo


propuesto de introducirlos en la clase, la sensacin que se manifiesta es realmente
gratificante.

Bibliografa:

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.

Decreto 231/2007, de 31 de julio, por el que se establece la ordenacin de la


EducacinSecundariaenAndaluca.

Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

Ordendel19dejuliode2006,porlaqueseregulandeterminadosaspectossobrela
organizacinyfuncionamientodelosCentrosdeEducacinPermanente.

BROWN, H.D. (1994) Teaching by Principles: An Interactive Approach to Language


Pedagogy.NewYork:Longman

HARMER,J.(1988)ThePracticeofEnglishLanguageTeaching.NewYork:O.U.P.

MADRID,D.;McLAREN,N.(1996)AHandbookforTEFL.Alcoy:Marfil.

RIVERS,W.M.(1981)TeachingForeignLanguageSkills.Chicago:UniversityofChicago
Press.

www.enfoqueseducativos.es

405

Nmero 2 noviembre -2007


JoanaMRustarazoHervs

D.N.I.75068457E

SSeeppuueeddeeuussaarreelliinnggllssttooddooeellttiieem
mppooeennuunnggrruuppooddeeEESSO
O??

Antes de nada, tenemos que dejar claro que estamos en Espaa, es decir, la
lenguaextranjera,enestecaso,ingls,estfueradeuncontextohabitual(seestudia
enelcurrculo,peronoeslohabitualusarlacomoinstrumentodecomunicacinfuera
delcontextoacadmico).Debidoalaimportanciadeestalenguaenlavidareal,ses
posibleencontrarlaporejemploencanciones,seriesopelculas,perolonormalesque
este tipo de material se oiga, no que se escuche. De igual manera, no tenemos la
costumbredesubtitularpelculasoseriescomosepuedeobservarenpasesvecinos.

Esto implica que nosotros, como profesores, debemos facilitar que la lengua
extranjerainglsseoigayseescucheennuestraclase(ejemplosdelusodelingls).
Deestemodo,losalumnosseacostumbrarnalsistemafonolgicoinglsalcontrastar
losdiferentessonidosytambinotrosparmetroscomoelritmoylaentonacin.

Cuandosepiensaenelaprendizajedeunanuevalengua,lomsaconsejablees
usarlalomsposible.Podemosgraduarelinglsempleadoaligualquepodemosusar
diferentes tcnicas a fin de que nuestros alumnos puedan comprender mejor el
mensajequelestransmitimos.Estastcnicaspuedenser,entreotras:

Repeticin
Vocabulariofcil
Parafraseado
Preguntascontinuasparacomprobarlacomprensin
Gestos(lenguajenoverbal)

Cuando nuestros alumnos nos entienden, se sienten realmente motivados, e


intentanexpresarseeninglstambinparacomunicarse.Estaeslaraznporlaquese
deben utilizar todos los recursos que se estimen necesarios a fin de no acudir a la
traduccininmediatadelmensaje,conloquenuestrosalumnosserelajanyesperan
pacientementeaqueseleofrezca,sinpensarellosporsmismos.
www.enfoqueseducativos.es

406

Nmero 2 noviembre -2007

Porotrolado,debemostenerclaroquecuandoseexpliqueunconceptoalgo
ms complejo, el uso de la lengua materna no debe negarse, ya que puede evitar
malentendidos y puede facilitar la comprensin de dicho apartado. Sin embargo, el
restodelasactividadespuedendesarrollarseenlalenguaextranjerasinproblemas.

Para concluir, podemos decir que el ingls como lengua extranjera puede y
debeserutilizadocasitodoeltiemposilascircunstanciaslopermiten,estoes,nohay
problemasgravesdedisciplina,encuyocasosetendrqueajustaralasnecesidades
delosalumnosparaquesepuedallevaracabounaenseanzalomstilposible.Por
medio del uso del ingls, las habilidades comunicativas de nuestros alumnos
mejorarn y se crear una funcin ms realista de la asignatura lengua extranjera,
potenciandolainfluenciadeunalenguaextranjeraenlasociedadpluralistaenlaque
noshayamosinmersos.

Bibliografa:

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.

Decreto 231/ 2007, de 31 de julio, por el que se establece la ordenacin y las


enseanzas correspondientes a la Educacin Secundaria Obligatoria en
Andaluca.

Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

Decreto208/2002,de23dejulio,porelqueseregulaelcurrculoparaBachillerato.

BROWN, H.D. (1994) Teaching by Principles: An Interactive Approach to Language


Pedagogy.NewYork:Longman.

HARMER,J.(1988)ThePracticeofEnglishLanguageTeaching.NewYork:O.U.P.

www.enfoqueseducativos.es

407

Nmero 2 noviembre -2007


MADRID,D.;M.cLAREN,N.(1996)AHandbookforTEFL.Alcoy:Marfil

www.enfoqueseducativos.es

408

Nmero 2 noviembre -2007

JoanaMRustarazoHervs

D.N.I.75068457E

EElluussooddeellaaffoonnttiiccaaeennllaaccllaasseeddeeiinnggllss

Cualquierpersonaquepiensequelafonticanoesunaspectoimportanteenla
enseanza de una lengua extranjera est muy equivocada. Basta slo pensar en dos
casosmuycomunesenlaclasedeingls:butyvowels,yquenormalmentesesuelen
pronunciar incorrectamente de acuerdo con el contexto donde esa palabra aparece.
As podemos encontrarnos [but] en lugar de [bt] o [bt] (formas dbil y fuerte,
respectivamente), o [baulz] (para vowels y bowels, dos palabras completamente
diferentes:vocalesyentraas,respectivamente).

Cuando se habla de pronunciacin, el ingls no es, segn los hispanos


hablantes,unalenguamuylgica.Estosedebealhechodequeencastellanoseleetal
y como se escribe, pero en ingls esto no tiene nada que ver. Podemos encontrar
palabrasqueseescribendemanerasimilar,ycuyapronunciacinescompletamente
opuesta.Unejemplodeestoesbread[bred]/steak[steik].

Porsiestofuerapoco,tambinhayquehablardehomfonos,estoes,palabras
que se escriben de manera distinta, pero que se pronuncian de la misma manera:
sun/son[sn].

Si nuestros alumnos no tienen las claves para diferenciar estas palabras, no


serncapacesdeserentendidos.Adems,sepuedensentirunpocofrustradosalno
sabercmopronunciarunapalabraenconcreto,yalnosaberporquvariaspalabras
se pronuncian igual aunque se escriban de diferente forma, y por qu palabras
similaressepronunciandemaneratotalmentecontraria.

Esta es la razn por la que se debe incluir fontica a la hora de ensear una
lengua extranjera. E incluso, tambin tenemos que tener en cuenta cundo se debe
llevaracabo.Aspues,estararecomendadoempezarconlafonticaalcomienzodel
curso, para que de esta manera puedan desarrollar a lo largo del curso su
pronunciacin.Tambinhayquepensarencmoensearla,esdecir,lametodologaa
emplear.

Aunqueaprimeravistapuedaparecersencillo,noloestanto.Esteprocesose
puedesimplificaratravsdediferentestcnicas.Unadeellaspuedeserunatablacon
todos los smbolos fonticos (tanto de vocales como consonantes). Si esta tabla o
cuadro es visualmente llamativa (por medio de dibujos, por ejemplo), y contiene
palabras comunes y fciles representando cada sonido, los alumnos la mirarn con
frecuencia,oalmenos,unavez.

www.enfoqueseducativos.es

409

Nmero 2 noviembre -2007


Unavezquesehaexpuestoenelaula,ytrasexplicarla,sepuedecolgaresta
tablaeneltablndelaclase,oenunacartulinaquesepuedeprepararparatalefecto.
Estofacilitatambinquesepuedaconsultardemanerasencillasiempreycuandolo
necesiten.

Acto seguido, o durante esa misma explicacin, se puede pedir al alumnado


que d ms ejemplos donde ese sonido en particular aparece. A cada alumno que
proporcione un ejemplo vlido se le dar un punto, y aquellos que obtengan ms
puntos recibirn un estmulo, que puede ser un positivo en su calificacin. De esta
maneraseconsiguequeelalumnoparticipe,seinvolucreenelprocesodeenseanza,
yqueaprendandeunamaneraamena.

Es ahora cuando estos alumnos pueden hacer uso de las transcripciones que
losdiccionariospresentan,loquefavoreceengranmedidaunaprendizajeautnomo
(aspectopotenciadoporlasactualesleyeseducativas),alnotenerquedependerdel
profesorparaentendercmosepronunciaunapalabraenparticular.

Amododeconclusin,sehapodidojustificarenestedocumentolarelevancia
delusodelafonticaenelauladeunalenguaextranjera.

Por otro lado, no debemos esperar que nuestros alumnos sean capaces de
hacertranscripciones.Estodependerengranmedidadelniveldenuestrospupilosy
desushabilidadesconlossonidos.Astendremosquecuantomstrabajenyescuchen
elidiomaextranjero,mejorymsacertadasersupronunciacin,sibienestees un
procesoquerequierebastantetiempo.

Hay que aadir tambin que a la hora de comunicar cualquier mensaje, si el


hablante comete algn error gramatical, el oyente puede entender el mensaje
transmitido,porloquelacomunicacinesefectiva.Sinembargo,enuntextooral,si
hayfallosdepronunciacin,lacomunicacinpuedesertotalmenteinefectivadebidoa
que el oyente ser incapaz de distinguir el tema de la conversacin. Todo esto hace
msimportante,sicabe,elaprendizajedelafonticadeunalengua.

Bibliografa:

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.

Decreto 231/2007, de 31 de julio, por el que se establece la ordenacin y las


enseanzas correspondientes a la Educacin Secundaria Obligatoria en
Andaluca.

www.enfoqueseducativos.es

410

Nmero 2 noviembre -2007


Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

CARTER, R.; NUNAN, D. Eds. (2001) The Cambridge Guide to Teaching English to
SpeakersofOtherLanguages.Cambridge:C.U.P.

HARMER,J.(1988)ThePracticeofEnglishLanguageTeaching.NewYork:O.U.P.

NUNAN, D. (1990) Designing Tasks for the Communicative Classroom. Cambridge:


C.U.P.

www.enfoqueseducativos.es

411

Nmero 2 noviembre -2007

JoanaMRustarazoHervs

D.N.I.75068457E

LLeenngguuaaiinngglleessaappaarraaaalluum
mnnoossccoonnNNeecceessiiddaaddeessEEdduuccaattiivvaassEEssppeecciiaalleess

Actualmente la presencia de alumnos con necesidades educativas especiales


(N.E.E.)esmuycomndentrodelaula.Estetipodealumnadotieneciertosproblemas
alahoradeseguirlasexplicacionesdelprofesor.Esporestoporloqueestndentro
de este grupo. Sin embargo, nosotros, profesores en este caso de ingls, debemos
preocuparnos por su proceso de aprendizaje y adaptarlo segn sus caractersticas
personales, lo que se incluye dentro del marco educativo en la educacin para la
diversidad.

A fin de tener una idea clara y precisa sobre los conocimientos de estos
alumnos, una reunin con el/ la orientadora es lo ms eficaz, al igual que con el
anteriorprofesor/adeinglsdelalumnoencuestin,siesposible;ysiesnecesario,
tambin se puede consultar el expediente acadmico y ficha del alumno en
www.juntadeandalucia.es/educacion/seneca.

Tras este primer contacto, seremos capaces de preparar material de acuerdo


conelconocimientodelestudiante:

Si tienen algunas lagunas en el aprendizaje de la lengua materna,


nuestro objetivo ser facilitarles actividades donde el
vocabulario (fcil y ameno) sea lo principal, y donde las dos
lenguas, materna y extranjera, sean comparadas. Tambin es
til, y altamente necesario, incluir sencillas frmulas
comunicativas para que sean capaces de expresar funciones
bsicas(presentarse,describirse,saludar).
www.enfoqueseducativos.es

412

Nmero 2 noviembre -2007

Si la lengua espaola est ms o menos asimilada, se pueden usar


ejercicios graduados que incluyan las cuatro destrezas (hablar,
escuchar, escribir y leer). De esta forma, sern capaces de
trabajar al mismo ritmo que sus compaeros, si bien con
ejerciciosadaptados.

Algunosdeloscontenidosquesepuedentrabajarpuedenserlossiguientes:

Vocabulario

Familia
Ropa
Colores
Nmeros
Trabajos
Animales

Gramtica
Pronombrespersonales
Presente simple del verbo
tobe
Presente simple del verbo
tohavegot
Pronombresobjeto
Pronombresposesivos

Funciones
Saludos
Presentaciones
CanI?
Whatsyourname?
Wheredoyoulive?
Whatdoyoudo?
Preferencias
Gustos

Estas dos alternativas propuestas se tendrn que desarrollar a lo largo de la


permanenciadelalumnoenlaEducacinSecundariaObligatoriaafindequesepueda
observar un progreso en dicho alumno, tanto por parte del profesorado, como por
partedelalumno.

Otro punto importante es que no debemos olvidar que estos alumnos tienen
que ser constantes si quieren ver una evolucin. Es por este motivo que la
colaboracinconlospadresesrealmenteimportante,yaqueelalumnodebetrabajar
tantoencasacomoenclase.Cuantomstrabajen,mayorsersuprogreso.

A modo de conclusin, tenemos que decir que nosotros como profesores


tenemosquesabermotivaratodoslosalumnos,yconmayornfasis,aaquelloscuyas
caractersticassonespeciales.Aligualquetrataratodoslosalumnosdeigualmanera,
yaqueestosnoquierenresaltarsobreelrestonihacertrabajosdiferentesalosque
realizansuscompaeros.
www.enfoqueseducativos.es

413

Nmero 2 noviembre -2007

Debemos intentar que hagan el trabajo previsto dentro de lo que sus


compaerosestntrabajando.

Bibliografa:

ConsejoEuropeo,Lisboa2000,dondesehabldelaeducacinparaladiversidad.

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.

Real Decreto 806/ 2006, de 30 de junio, por el que se establece el calendario de


aplicacindelanuevaordenacindelsistemaeducativo,establecidapor
laLeyOrgnica2/2006,de3demayo,deEducacin.

Decreto 231/2007, de 31 de julio, por el que se establece la ordenacin de la


EducacinSecundariaenAndaluca.

Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

ABAD,M.yBENITO,ML.,Coord.(2006)Comoensearjunt@saalumnosdiferentes:
Aprendizaje cooperativo. Experiencias de atencin a la diversidad para
unaescuelainclusiva.Zaragoza:GobiernodeAragn.

PUJOLS, P. (2001) Atencin a la diversidad y aprendizaje cooperativo en la ESO.


Archidona(Mlaga):EdicionesAljibe.

PUJOLS, P. (2004) Aprender juntos alumnos diferentes. Los equipos de aprendizaje


cooperativoenelaula.Barcelona:EumoOctaedro.

www.enfoqueseducativos.es

414

Nmero 2 noviembre -2007

JoanaMRustarazoHervs

D.N.I.75068457E

CCm
moouussaarrllaappiizzaarrrraaddeem
maanneerraaeeffeeccttiivvaa

La pizarra es uno de los elementos principales que el profesor utiliza en sus


clasesparaensearcualquieraspectoquenecesiteenunmomentoconcreto(desde
expresionescomunicativasalapronunciacindepalabras/sonidosquepuedencausar
algunadificultad).Esporestemotivoquehayquetenermuyclaro,siemprequenos
encontramos con la pizarra limpia, cul es la mejor manera de usar este recurso
caracterizadoporsufacilidaddemanejoysucomnpresenciadentrodelaula.

Unadelasopcionesmsvlidasseradividirlapizarraendos:


Una seccin en la que se incluira el vocabulario que va a aparecer
durante la clase y que puede causar algn inconveniente al
alumnado.


Otra seccin en la que se apunten aspectos relacionados con la
gramticaofuncionesdellenguaje.

La primera seccin se podra dejar ah, sin borrar, durante toda la clase si es
quesonesosloselementosatratardurantelamisma.

En cuanto a la segunda seccin, se puede borrar siempre que necesitemos


espacioparatratarcualquierotropunto.

Otra idea que se tiene que considerar hablando del uso de la pizarra es el
tamaodelasletrasempleadas.Hayquerecordarquetodoslosalumnostienenque
sercapacesdeleerloescrito,inclusolosdelaltimafila.Esporesoquesetieneque
utilizaruntamaonormalgrande.Tambintenemosquetenerencuentaaaquellos
alumnosconalgntipodediscapacidadvisual,ysiesnecesario,adaptarestatcnicaa
suscaractersticaspersonales.

Tambin relacionado con la letra, tenemos que escribir de manera clara y


legible, y ordenar todos los elementos que estn incluidos, no ir de un lado a otro
mezclandoconceptosloquehacequelosalumnossepierdan.

Para comprobar que los alumnos entienden lo expuesto, es necesario hacer


preguntasdecomprensinconstantemente.
www.enfoqueseducativos.es

415

Nmero 2 noviembre -2007

Por otro lado, a fin de hacer la pizarra ms atractiva visualmente, se pueden


utilizarcolores.Estoesmuyrecomendablesobretodoalahoradecontrastarvarios
conceptos. As, por medio de ayudas visuales, los alumnos pueden entender el
significado de lo que se est explicando ms fcilmente. Al mismo tiempo, estamos
facilitandolaeducacinalosalumnosquetenganunaprendizajemsvisual.

Otro aspecto que debe tenerse en cuenta es la calidad de la pizarra y su


posicin.Enalgunasclaseselusodelapizarrarequierequesebajenlaspersianaspara
evitar el reflejo y que lo escrito se pueda leer. En caso de encontrarnos esta
inconveniencia, sera aconsejable estudiar la distribucin del aula, y la posibilidad de
cambiar la pizarra de sitio a fin de que se pueda leer siempre. En caso contrario, se
debernutilizarlaslucesartificialesparaevitarelreflejo.

Otroproblemaquenospodemosencontraresquelapizarraestmuysuciay
quenoseentiendaloqueseescriba.Parasolucionarlohabrquepedirquelalimpien
demaneraespecial.

Tambin se puede dar el caso de que sea una pizarra de mala calidady haya
zonas donde no se puede escribir. En este caso, lo mejor ser cambiarla por otra
mejor.

Parafinalizar,hayquedecirquesabermanejarlapizarrademaneraefectivaes
un requisito imprescindible a la hora de ensear algo. Es por este motivo que los
puntos tratados en este texto se tengan que tener en cuenta, por muy simples que
puedanparecer,cadavezqueentremosenelaula.

Bibliografa:

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.

Decreto 231/2007, de 31 de julio, por el que se establece la ordenacin y las


enseanzas correspondientes a la Educacin Secundaria Obligatoria en
Andaluca.

Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

MADRID,D.yN.McLAREN(1995)DidacticProceduresforTEFL.Valladolid:LaCalesa.

MATTHEWS, A., M. SPRATT & L. DANGERFIELD (Eds) (1985) At the Chalkface.


Bath:EdwardArnold.

www.enfoqueseducativos.es

416

Nmero 2 noviembre -2007


SOUTHWORTH, H., K. CAKICI, & Y. VOVIDES (2006) Blackboard for Dummies.
Indianapolis,Indiana:WileyPublishing,Inc.

UR,P.(1996)ACourseinLanguageTeaching.Cambridge:C.U.P.

JoanaMRustarazoHervs

D.N.I.75068457E

CCuulleessllaaddeessttrreezzaaqquueeccaauussaam
mssddiiffiiccuullttaaddeessaalloossaalluum
mnnooss

Siestamismapreguntaselaplanteamosanuestrosalumnos,estoes:cules
ladestreza,escuchar,leer,escribirohablar,queosesmscompleja?,lasrespuestas
sernvariadas,esdecir,todasestarnincluidasenlarespuesta,yaquedependiendo
delalumno,serunauotra,einclusovarias.

Enesteartculosevaallevaracabounanlisisdecadaunadelasmismaspara
comprobarculespuedenserestasdificultades,ycmosolventarlas:

y HABLAR. Esta destreza puede causar algunas inconveniencias ya que


pueden no sentirse lo suficientemente seguros para hablar en una
lengua que no es la suya propia, y adems, delante de todos sus
compaeros. Su creencia es que esos mismos compaeros se van a
rerdeellos,asqueparaevitarestomismo,nodicenniunapalabra
enlalenguaextranjera.
Otradesusideasesladequenosepuedenequivocar.Nuestralabor,
como profesores, es la de crear un ambiente relajado donde el
respetoylatoleranciaseanlosvaloresaseguir,talycomopropugnan
lasactualesleyeseducativas.

LEER.Entodaslasocasionesenlasquelosalumnosseencuentranconun
textoescritoenunalenguaextranjeratienenlanecesidaddeconocer
el significado de absolutamente todas las palabras. No se plantean
tcnicas como las de inferencia. Otra desventaja es que muchos de
ellos tampoco poseen un diccionario, por lo que el profesor se hace
ms necesario a la hora de conocer el significado de vocabulario
nuevo.Deberamospromoverdosacciones:

Por medio del contexto se puede deducir el significado de


palabrasdesconocidasparanosotros.

www.enfoqueseducativos.es

417

Nmero 2 noviembre -2007


El fin que se debe buscar es el de saber sobre qu trata un
textodeterminado,ynoesnecesarioconocerelsignificadode
cadaunadelaspalabrasquenosencontramos.

ESCUCHAR. Esta destreza es una de las que se pueden considerar ms


complejas.Losalumnostienenqueescucharvocesquesalendeuna
mquina, y tampoco pueden controlar otros aspectos como la
velocidad o el tono de voz (demasiado alto o demasiado bajo, por
ejemplo). Por aadidura, se encuentran con la misma situacin que
cuando leen algo, es decir, quieren entender exactamente todas las
palabras,loquehacedelaactividadalgomsintensa,yaquealapar
que estn escuchando,intentan traducir todo lo que oyen. Tenemos
quepedirleslomismoquecuandoleen,estoes,queintentensaberla
ideaprincipal.
Parahacerdeestadestrezaalgomenoscomplicada,podemosfacilitar
a los alumnos su propio material para escuchar en casa, a su propio
ritmo,paraquepuedantrabajarconl.Deestamanerasepotenciael
aprendizajeautnomo.

ESCRIBIR.Siseproporcionanlassuficientesclaves,estadestrezanotiene
porqucausardificultad.Ellosconocenlospuntosquedebentratar,y
escribir sobre ellos. Con niveles ms avanzados, la lluvia de ideas o
brainstormingpuedeserunaestrategiamuytilafindeobtenerms
ideas sobre un tema en concreto. Tambin esta tcnica favorece el
respetoylatolerancia,ademsdesaberescucharaloscompaeros.

Paraconcluir,tenemosquedecirquetodaslasdestrezaspuedencausarmayor
o menor dificultad, y ser ms o menos asequibles. Todos (alumnos y profesores)
tenemos que tener unas miras ms abiertas para que el proceso de enseanza
aprendizajeseapositivo,afindeaprenderms,ydellegaraserautnomotambina
lahoradepoderenfrentarseconunalenguaextranjera.

Bibliografa:

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.
www.enfoqueseducativos.es

418

Nmero 2 noviembre -2007

Decreto 231/2007, de 31 de julio, por el que se establece la ordenacin y las


enseanzas correspondientes a la Educacin Secundaria Obligatoria en
Andaluca.

Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

HARMER,J.(1998)HowtoTeachEnglish.Harlow:Longman.

HARMER,J.(1988)ThePracticeofEnglishLanguageTeaching.NewYork:O.U.P.

MADRID,D.;McLAREN,N.(1996)AHandbookforTEFL.Alcoy:Marfil.

RIVERS,W.M.(1981)TeachingForeignLanguageSkills.Chicago:UniversityofChicago
Press.

www.enfoqueseducativos.es

419

Nmero 2 noviembre -2007

JoanaMRustarazoHervs

D.N.I.75068457E

Q
Quueelleeggiirr::LLiibbrrooddeetteexxttoooom
maatteerriiaalleessddeessaarrrroolllaaddoossppoorreellpprrooffeessoorr

Hoyendaloquenosencontramosentodaslasclasesdelenguaextranjera,o
ensumayora,esunlibrodetextoconsucorrespondientecuadernillodeactividades.
Aqusedebe?

Laraznprincipalesqueestetipodematerialproporcionaungrannmerode
instrumentos, por lo que el profesor no tiene que preparar infinidad de hojas de
trabajo,einclusoninguna,sinotieneeltiempoqueesorequiere.

Lasegundaraznquesepodradar,ymsimportante,esquetrabajarconun
libroenlugardefotocopiasesmuchomsatractivoyvisualporelusodecolores.Alos
alumnoslespuedellamarlaatencinciertaspginasllenasdecoloressiemprequeno
seanmuycargadas,loquedaunasensacindealgomsreal,mscercano.Esteesel
motivoprincipalenESO.

Por otro lado, si es el profesor el que se encarga de preparar el material,


normalmentetendrquehacerfotocopiasparaquetodoslosalumnosdispongande
algo, de un material tangible. Eso implica que ese mismo material sea en blanco y
negro,porloquealgunosapartadospuedennoversebien.
www.enfoqueseducativos.es

420

Nmero 2 noviembre -2007

Tambinenestecaso,hayqueestarpendientedeelementosexternos,como
sonlasfotocopiadorasdelcentroenelqueteencuentres,quepuedenromperseelda
quemslasnecesites.

Otromotivoquetenemosquemencionaresqueloslibrosdetextovienenya
consupropiomaterialdeescucha,paraquelosalumnosescuchentantoenclase(el
CDdelprofesor),comoencasa(paraquepuedanhacerloasupropioritmo,repitiendo
cuando sea necesario un fragmento o el texto entero, dndole ms o menos voz, y
probablemente con menos ruido de fondo pueden utilizar cascos con ese fin). Si el
material lo prepara el profesor, tendremos que emplear bastante tiempo en buscar
varios textos y que estos sean asequibles para nuestros alumnos (tanto en calidad
comoencantidad).

Relacionadoconesto,hayquedecirqueelmaterialelaboradoporelprofesor
requiere en general bastante tiempo, al menos la primera vez que se recopila, y no
todoslosprofesoresdisponendeesetiempo.

Paraconcluir,diremosquetodoloaquexpuestonoquieredecirqueellibrode
texto sea mejor que el material elaborado por el profesor. Es lo que actualmente se
tiene ms a mano. No obstante, si nos decidimos por un libro de texto en concreto
tenemos que saber que no hay ningn libro perfecto, y que se puede ajustar lo
expresado all de cualquier otra manera o incluso reforzarlo por algn material
adicionalparaadaptarloalasnecesidadesdenuestroalumnado.

ParacursosdeESOsepuedeconsiderarellibrodetextocomomsidneopara
trabajarconellosdebidoalusodecolor,yporquesegnelprogramadegratuidadde
librosenAndaluca(reflejadoenlaLEALeydeEducacindeAndaluca,elmaterial
escolaresgratis(aunquesloloseaellibrodetextoynoelcuadernillo),peronolas
fotocopias.

Bibliografa:
www.enfoqueseducativos.es

421

Nmero 2 noviembre -2007

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.

Decreto 231/2007, de 31 de julio, por el que se establece la ordenacin y las


enseanzas correspondientes a la Educacin Secundaria Obligatoria en
Andaluca.

Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

BROWN, H.D. (1994) Teaching by Principles: An Interactive Approach to Language


Pedagogy.NewYork:Longman

CELCEMURCIA, M. (Ed.) (1991) Teaching English as a Second or Foreign Language.


Boston:Heinle&HeinlePublishers.

DOFF,A.(1988)TeachEnglish.Cambridge:C.U.P.

HARMER,J.(1998)HowtoTeachEnglish.Harlow:Longman.

www.enfoqueseducativos.es

422

Nmero 2 noviembre -2007


JoanaMRustarazoHervs
D.N.I. 75068457E

EElluussooddeellaalleenngguuaam
maatteerrnnaaeennllaaccllaasseeddeelleenngguuaaeexxttrraannjjeerraa

Aunque nosotros seamos profesores de lengua extranjera, y esta sea el


principalinstrumentodecomunicacin,tenemosquetenermuyclaroquenosepuede
prohibirelusodelalenguamaternadentrodelaula,porqueenesecasoiramosen
contradelaigualdaddeoportunidadesdentrodelamismaclase.

Tenemos que recordar tambin que esta lengua extranjera (en nuestro caso
ingls), no se utiliza de manera natural en nuestro pas (Espaa), por lo que los
profesores son una de las fuentes para conocer el idioma de las que el alumno
dispone.

No obstante, hay situaciones claras en las que el uso de la lengua materna


(castellano)esrecomendable:

&

Cuando se est explicando o preguntando por el significado de una


palabranuevaodesconocida.Hayquedejarelsignificadomuyclaro
a fin de evitar posibles malentendidos. Pongamos por caso que
queremos explicar el significado de la palabra mouse, y decimos
comoejemploquehayunmousemuyfamosoenDisney.Alpedirsu
equivalenteencastellanolarespuestapuedeserMickeyMouseen
lugarderatn,conloqueseproduciraunerror.

&

Enelcasodequeseexpliqueunconceptoqueseacomplejoyqueno
hayanvistoanteriormente.Sepierdemuchomstiempointentando
explicarloenlalenguaextranjeraqueusandolalenguamaterna,por
loquesuusoestmuyaconsejadoaqu.

&

Siempre que haya algunos problemas de comportamiento, y se quiera


dejarclaroqueesonoesttoleradodentrodelaula.Deestamanera
elsignificadoseentenderdemaneramsrpidaysencilla.

www.enfoqueseducativos.es

423

Nmero 2 noviembre -2007

&

Para expresar sentimientos de los propios alumnos sobre algo en


concreto. Pueden empezar utilizando la lengua extranjera pero
automticamentecambiarnparadejarclarolaopininquealgoles
merece,einclusoparacambiarexmenes,porponerunejemplo.

Amododeconclusin,hayquedecirqueelusodelalenguamaternasepuede
reducirconformepasaeltiempo,porloquellegarunmomentoenelquelamayora,
si no la totalidad de la clase, se impartir en la lengua extranjera. Habr tambin
clases, por el contrario, en las que la lengua materna se puede considerar un
instrumento de ayuda, pero slo eso, siendo el vehculo de comunicacin la lengua
extranjera,aunquenoelnico.

Bibliografa:

LeyOrgnicadeEducacinLOE2/2006,publicadael3demayode2006.

Decreto 231/2007, de 31 de julio, por el que se establece la ordenacin y las


enseanzas correspondientes a la Educacin Secundaria Obligatoria en
Andaluca.

Ordendel10deagostode2007porlaquesedesarrollaelcurrculocorrespondientea
laEducacinSecundariaObligatoriaenAndaluca.

BROWN, H.D. (1994) Teaching by Principles: An Interactive Approach to Language


Pedagogy.NewYork:Longman.

HARMER,J.(1988)ThePracticeofEnglishLanguageTeaching.NewYork:O.U.P.
NATION,P.(2003)Theroleofthefirstlanguageinforeignlanguagelearning,inAsian
EFL
Journal
Volume
5.
Issue
2
Article1.
PELLOWE, W.R. (1998) Negotiation, Noticing, and the Role of Selective Crosslingual
Strategies in Foreign Language Classrooms. Birmingham: University of
Birmingham.
www.enfoqueseducativos.es

424

Nmero 2 noviembre -2007

www.enfoqueseducativos.es

425

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

ACTIVIDADESPARALOSALUMNOS;CULESLAMEJOR?

De acuerdo con nuestro currculo, nos debemos regir por el enfoque


comunicativo de este modo nuestras actividades deben ser tan comunicativas como
seaposible.DeacuerdoconD.AntonioBuenoGonzlez,existeunagranvariedadde
actividadespertenecientesadistintosgrupos:
o
o
o
o
o
o
o
o

Actividadesparareconocerelnivel.
Actividadescomunicativasguiadas.
Actividadespararesolverproblemas.
Actividadespararellenarhuecosdeinformacin.
Representaciones:teatro,roleplayetc.
Juegoscomunicativos.
Actividadescomunicativasconsentidodelhumor.
Actividadesbasadasenlacomunicacinescrita.

Estasactividadesaparecenennuestroslibrosdetexto,pero,culdebemoselegir
para cada uno de nuestros alumnos? Para contestar a esta pregunta, tenemos que
consideraralgunosdetallesdenuestrosalumnostalescomo:

o Suniveldeingls.
o Sisonelocuentesoprecisos,sinolesgustaelidioma,sucomportamientoen
clase,sisontmidos,extrovertidos,sociables,insociables.
o Loschicosconnecesidadeseducativasespeciales,porqueseansuperdotadoso
tenganunnivelmsbajoqueelrestodeloscompaeros.

www.enfoqueseducativos.es

426

Nmero 2 noviembre -2007


Aunque sabemos que las cuatro destrezas tienen que estar involucradas en el
proceso de enseanza aprendizaje, la manera en la que el profesor presenta la
actividadesmuyimportante,porejemplo:

Queremoshacerunarevisinennuestraclasedelpresenteyelpasadosimple,
pero sabemos que la gramtica es aburrida y no pretendemos cansar a nuestros
alumnos con muchos ejercicios as que decidimos utilizar una cancin El submarino
amarillo de los Beatles. De esta manera, escuchan y practica la pronunciacin y
disfrutantambinporquenormalmentealosalumnoslesgustacantar.

Como hemos visto en este breve ejemplo los objetivos del profesor y los
intereses de los alumnos pueden ir juntos. La misma situacin se puede encontrar
cuandoseutilizaunaactividadcomunicativa.

Referencias:

o Antonio Bueno Gonzlez. (1993) Teaching functional language Actas IX


Jornadaspedaggicasparalaenseanzadelingls.
o S.F.Hampshire.(1992)Twentytopicsfortiredteachers.
o W.R.Lee.(2002)Languageteachinggamesandcontests.

www.enfoqueseducativos.es

427

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11808189Q

ALGUNASIDEASPARAESCRIBIRBIEN

ErnestHemingwaydijo:Mipropsitoesponerenelpapelloqueveoyloque
sientodelamaneramejorymssimple:

Algunas personas como Hemingway no tienen problemas cuando escriben,


peronotodostienenlamismafacilidadparaescribir.

Los profesores deben ser conscientes de las dificultades que plantea la


redaccin en la lengua materna. Sin embargo existen algunos guiones que podemos
seguirparamejorarnuestraescritura.Enprimerlugar,tenemosqueexpresarnuestros
puntos de vista de forma clara, para tener xito en nuestros escritos debemos
recopilarinformacinsobreloquevamosaescribirovayamosahablar,deestemodo
tendremosquehacerunaseleccindelainformacinmsimportanteparaconseguir
laatencindenuestroslectores.

Una vez que el escritor ha elegido el tema, y ha recopilado la informacin


necesaria,debeplasmarlocorrectamentetantoenlagramticacomoensusintaxis.El
uso de una buena gramtica hace ms fcil la estructuracin del texto y plasmar en
palabraslasideasylassecuencias.Cuandoelescritorutilizabienlasintaxislepermite
asegurarsedequelasfrasesylosprrafosestnorganizadosdemaneraclaraylgica.

Sielescritornoconocebieneltemasutextoseraburrido,elvocabulariono
serelmsapropiadoyquizsparezcademasiadotcnicooacadmico.Elpoderdela
escritura se encuentra en la simplicidad. Grice resumi estas ideas en sus cuatro
mximas:Cantidad,cualidad,importanciayforma.

www.enfoqueseducativos.es

428

Nmero 2 noviembre -2007

The dignity of movement o fan iceber is due to only one ninth of it being
abovewaterErnestHemingway.

Referencias:

o DanielRuizGomez(2004)Comoaprenderaescribirbien.
o Daniel Ruiz Gomez (2004) Como aprender a escribir bien: la ortografa, la
palabra,lafraseyeltexto
o GloriaSanz,(2002)Aprenderaredactarnotas.
o www.es.wikipedia.org/wiki/Ayuda:Cmo_redactar_un_buen_artculo
o www.educandonos.cl/node/399
o www.teacher.org.cn/doc/

www.enfoqueseducativos.es

429

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11.801891Q

QUEDESTREZALECAUSAMSPROBLEMASANUESTROSALUMNOS?

Laenseanzadeidiomashacambiadoenestosltimosaos,nosloeneluso
delosmtodos,sinoenlosobjetivosplanteadosporlosprofesoreshacialosalumnos.
AprincipiosdelsigloXX,unprofesordesegundoidiomapreparabaasusalumnospor
medio de gramtica y traducciones solamente. Basaban su adiestramiento en dos
habilidadessolamente:Lecturayescritura.

Hoyendalasituacinesdistinta,losprofesorestratandeaumentarelusode
las cuatro habilidades cognitivas. Pero debemos considerar la divisin de estas
habilidadesendosgrandesgrupos:Lashabilidadesdeentradadeconocimientosylas
habilidadesdeproduccin.

Lalecturaylasaudicionessonhabilidadesquenosproporcionanconocimiento
Input,ellassonelmedioparaconduciralalumnohaciaelusodellenguajecomouna
herramienta de comunicacin. En esta etapa, los estudiantes leen y escuchan para
comprenderellenguaje.Losalumnosdeberanconfiarmsenestashabilidades,pero
sonaburridas.Nolesgustaescuchar,asquelosprofesoresdebenutilizarmateriales
talescomopelculasocancionesparainvolucrarlos.

Laescrituraylaproduccinhabladasonhabilidadesdeoutput,peroconuna
diferencia, que la primera es una habilidad que se procesa, ellos elaboran un
fragmentoescritoparaqueselescorrijayasconstruirsuentendimientodecmola
nueva lengua funciona. La segunda es la produccin oral, cuando el estudiante se
arriesgayutilizaellenguajeparaunpropsitoprctico.Estasdoshabilidadessonms

www.enfoqueseducativos.es

430

Nmero 2 noviembre -2007


difciles para la mayora de nuestros alumnos porque no estn lo suficientemente
entrenadosporlogeneral,paraproducirunmensajeenlenguaInglesa.

Uno de los objetivos generales que debemos obtener con nuestros


adolescentes es el desarrollo de las habilidades para poder comunicarse de manera
efectiva,enambosmedios,oralyescrito,ensituacionescotidianasatravsdelusode
tareasespecficas.Alredactarestosobjetivoslosprofesoressedebendeencargarde
planificar y organizar las actividades para motivar a los alumnos tanto como sea
posible. Este proceso es el ms importante porque el profesor decide el tema y la
formaenlaquesevaatrabajardentroyfueradelaclase.

Referencias:
o Granada Learner Autonomy Work Group: Elena Barbero Espinosa, Pilar Flores
Martinez,ManuelJimnezRaya,JoseAntonioMartinezLpez,MaribelMoreno
Snchez,ElenaRuizVico.(2001).Greta.RevistaparaprofesoresdeIngls.Vol.9
n1.2001.
o www.pde.stat.pa.us/reading_writing/
o www.aber.ac.uk/
o Jacks C. Richards and Charles Lockhart (1994) Reflective teaching in Second
LanguageClassrooms(CambridgeLanguageEducation)

www.enfoqueseducativos.es

431

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

COMOEXPRESARPOSESIONENINGLS

Desde el principio en la enseanza de la lengua Inglesa, la estructura de la


posesinestmuypresente.Unadelasprimerasfrasesquelosalumnospracticanes
Mynameis..unejemploclarodeposesinutilizandolosadjetivosposesivos.

Unpocomstarde,aprendenaconstruirfrasescomoIhaveabookoIhave
a computer in my house. En esta etapa, cuando se preocupan ms de la gramtica
quedelacomunicacin,algunasveceshayungranproblema.

Ihaveacat
Ivegotacat

Ambassonestructurassinnimas.Peroennegativay

en interrogativa hay una diferencia. Una de las estructuras aade do/does para
negativaseinterrogativas,asencontraremosestructurascomo:

Doyouhaveacat?YesIdo

Haveyougotacat?YesIhave

Ambassonestructurassinnimas,en

significadoperovuelvenaserdistintasenforma.

www.enfoqueseducativos.es

432

Nmero 2 noviembre -2007

Elsiguientepasoenseandolaposesinseralaestructuradelgenitivosajn.
Aunquelosalumnoshanledoyodoestaestructuramuchasveces,lesconfundepor
causa del apstrofe y la s. Relacionan el s con la forma contrada de la tercera
personadesingulardelverboTobeyTohaveenpresentesimple,porejemplo:

Laurasmyfriend.

Juansgotapencilcase.

La siguiente etapa es determinar cuando y como se utiliza el genitivo sajn,


reglasdepronunciacinyestablecerestructurasquesepuedanutilizarcuandoelcaso
genitivonoesposible.Luegoaparecelaconstruccinconlapreposicinofjuntocon
otro tipo de estructuras expresando las caractersticas de los nombres tales como la
cualidad.

Unavezquelosestudianteshanentendidoelsignificadodelaposesineshora
deexplicarleslaasociacinentreelgenitivoyelgneroanimado.

o
o
o
o
o

Nombresdepersonas:Santiaagospupils.
Nombrespersonales:Mysistersdaughter
Animalesgrandes:Thecatscollar
Nombrescolectivos:TheGovernmentsplan
Hacer algn tipo de referencia a nombres geogrficos cuando implican una
colectividad:Chinaspolicy.

Fonticamentenuestrosalumnosdebenserconscientesdequeelgenitivosajn
ylaformacindelpluralsonexactamenteiguales.Perodebemosmostrarlesalgunas
diferenciastalescomo:

o Socratesdoctrines:[sokrati:z]
o Moseslaws:[meuziz]
o Dickensnovels[dikinz][dikinziz].

www.enfoqueseducativos.es

433

Nmero 2 noviembre -2007

Laeleccinentreelcasogenitivoyelusodelaconstruccinofsedetermina
por condiciones estructurales y semnticas. Sin embargo, tenemos que hacer una
eleccindeacuerdoconlasreglasqueyasabemosconrespectoalgenitivosajn.

Enresumen,enelniveldeBachillerato,losalumnostienenquesercapacesde
expresarlaposesinpormediodelgenitivosajn,laconstruccinconof,pormedio
de los posesivos, dividido en determiners e independent tems de acuerdo con
Quirk y utilizando verbos que puedan mostrar el significado de posesin tales como:
belongto,own,haveetc.

Referencias:

o www.en.wikipedia.org/wiki/Genitive_case
o www.polseguera.org/advanced_english_grammar/the_genitive_case
o http://omega.cohums.ohio
state.edu/latin/grammar/genitive_case.htm#Possession
o http://www.learnenglish.de/grammar/casepossgen.htm
o Rosenbach, A. (1992) Genitive Variation in English: Conceptual Factors in
SynchronicandDiachronicStudies.
o JudithOlson,(2001)WritingSkillsSuccess
o Onions, C. (1974). Modern English Syntax. London: Rouledge and Degan Paul
Publishers.

www.enfoqueseducativos.es

434

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

COMO PUEDEN LOS TICs AYUDAR A ATENDER A LA DIVERSIDAD EN NUESTRAS


CLASES.

Hoy en da casi todos tenemos algn que otro aparato informtico, telfonos
mviles,MP3,PDA,unIPODotecnologassimilares.Todosestnconsideradoscomo
elementosTICs.Estosaparatoshancambiadolasociedad,eltrabajo,laeducacin,la
formacinylaformaquetenemosenenviaryrecibirinformacin.

Estos mecanismos sirven para aumentar las capacidades y compensar las


limitaciones, pero para que todos puedan alcanzar beneficios, es necesario hacerlos
accesibles.Ennuestrosdashayunagranvariedaddeaparatosparafacilitarelacceso
talescomo:

ACCESORIOSDEMEJORA

ALTERNATIVASATECLADOSSTANDARD

MOBILIARIO

BLOCKERKEY

PROTECTORESDETECLADO

TECLADOVIRTUAL

RATONESESPECIALES

TECLADOREDUCIDO

JOYSTICK

TECLADOAMPLIADO

PANTALLATCTIL

TECLADOESPECIAL

RECONOCIMIENTODEVOZ

TECLADOPARAUNAMANO

www.enfoqueseducativos.es

435

PROGRAMASESPECIALES

Nmero 2 noviembre -2007


TECLADODECONCEPTOS

Todasestastecnologasadaptativasestnunidasalordenadorparapoderdar
las mismas posibilidades de aprendizaje al nmero ms amplio posible de alumnos,
ofrecindoleslosmediosynuestraayuda.

No solamente se necesitan accesorios especiales, sino que para atender a la


diversidadtambinvamosatenerunagranvariedaddemateriales,porejemplo,para
estudiantes superdotados, para estudiantes con dificultades en el aprendizaje, para
alumnosprovenientesdeotrascivilizacionesoculturasconlenguasdistintas.

Es posible promover la autonoma y la propia evaluacin en un entorno


multimedia. De esta manera, cada estudiante puede trabajar de una manera
individual.Losalumnospuedenseguirsusestudiosasupropiopasoencadaleccinde
Ingls.

Referencias:
o Aguado Diaz, A.L. y Alcedo Rodrguez, M.A. (1995) Las personas con
discapacidadfsica.
o Heward, W.L. (2001). Nios excepcionales: Una introduccin a la Educacin
Especial
o FundacinONCE.http://www.fundaciononce.es
o www.ceapat.org
o http://www3.who.int/ict/icftemplate.cfm

www.enfoqueseducativos.es

436

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11808189Q

CUANDODEBERIANLOSALUMNOSEMPEZARAESCRIBIRTEXTOSOREDACCIONES
ENELPRIMERCICLODELAESO,ENELSEGUNDOCICLOOENBACHILLERATO?

Entodoprocesodeaprendizaje,elentrenamientoesnecesario.Elprimerpaso
a llevar a cabo es la inmersin en el idioma para transformar las percepciones en
conceptos. Aunque los profesores de Ingls en Espaa comienzan en etapas muy
tempranas este adiestramiento, muchos de los alumnos no son capaces de producir
textosconunbuenniveldeIngls.

Cuando pensamos en la produccin escrita debemos considerarla desde dos


perspectivas,comoproductoycomoproceso.Comoproductoporquedependedeuna
habilidad considerada productiva ya que al final tendremos un resultado. Como
proceso en el sentido de que tenemos que hacer continuas elecciones entre
vocabulario,estructuras,gramticaetc.

Nuestros alumnos deben darse cuenta de que el aprendizaje de la lengua


Inglesadeberaversecomolagestinomanejodeunaherramienta.Hayqueintentar
utilizarlo, al hacerlo se cometern errores hasta que se mejore, finalmente llega el
aprendizaje. En este proceso existen varios puntos importantes relacionados con el
procesodeaprendizajequedebenconsiderarse.

Enprimerlugarlaseleccinyelusodematerialesyrecursos,enestepunto,los
profesoresdebenserconscientesdelaimportanciaquetieneparacaptarlaatencin
delosalumnos.Luego,laorganizacinyplanificacindeltrabajoparaelprofesorylos
alumnos. Los profesores no se pueden olvidar de contenidos referentes a actitudes,
valoreshumanos,diferentesculturasydiferentesritmosdetrabajoenelprocesode
aprendizaje. Finalmente, la evaluacin se debe considerar tan importante como
cualquierotroaspectodelproceso.
www.enfoqueseducativos.es

437

Nmero 2 noviembre -2007

Contodoesto,tanprontocomolosestudiantessonconscientesdeunamanera
gradual, del tipo de aprendizaje que necesitan, esto es unaprendizajeautnomo, su
actitudhaciaelidiomayelprocesodeaprendizajecambia.Deestemodo,elpuntode
partidapararealizartextosenInglsdependerdelaaportacinquehayantenidolos
alumnosydelaconcienciaquetengansobreelprocesodeaprendizaje.

Referencias:
o http://mundoculturalhispano.hondurasbiz.com
o ElenaLuchetti(2005)Comoescribirmejor.
o NerioTello(2003)Comoescribir.

www.enfoqueseducativos.es

438

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA D.N.I.:11801891Q

MUCHOSALUMNOSDEJANLAENSEANZASECUNDARIAOBLIGATORIA(DESPUSDE
10 AOS APRENDIENDO INGLS) SIN HABER APRENDIDO EL IDIOMA, SIN SER
CAPACESDEUSARLOENLAPRCTICA:CUALESSONLASRAZONES?

La meta que se plantean hoy los profesores de idiomas eshacer sus clases lo
mscomunicativasposible.Muchosdelosprofesores,terminansiendoprofesoresde
gramtica porque una de las preocupaciones es completar la programacin. Pero
existenmuchasmsrazones.

Si pensamos en los bebs, cuando tienen 57 meses de edad, empiezan a


balbucear,lohacenporqueestnintentandoimitarloqueescuchan.Cuandonuestros
alumnos empiezan a aprender Ingls, desde el principio, deben estar expuestos al
idioma,perorealmentenoloestn.

Lapreocupacinsobreelidiomaesunodelosproblemasqueencontramosen
lassituacionescomunicativasplanteadasenelaula.Larazdeesteproblemasepuede
encontrar en la inseguridad, la falta de autoestima y por supuesto, la capacidad de
cadaalumno.Notodoslosindividuostienenelmismonivel.Unadelasrazonesms
frecuentesporlasquelosalumnossiententemordehablarenclase,eslapercepcin
dequeestnsiendoobservadosyescuchadosyporconsiguientevanaserevaluadosy
comparadosconotroscompaeros.

Esteproblemasugierequecuandolosalumnosestnaprendiendounidioma,
tienen que tener oportunidades para expresarse sin que haya mucha gente a su
alrededor. Esta no es la situacin en Espaa, la enseanza del Ingls tiene lugar en
aulassuperpobladasconloqueesosignificaparalosalumnos.
www.enfoqueseducativos.es

439

Nmero 2 noviembre -2007

Lacomunicacinimplicanosololafacultaddehablarsinotambinlafacultad
de escuchar y entender. Las situaciones en las que se le pide al alumno que se
comuniqueenunalenguaextranjeraestnasociadasconproblemasdecomprensin
quelosalumnostienencuandointentanescucharasusinterlocutores.

Si consideramos estos aspectos, los profesores deben acomodar las


conversacionesalniveldecompetenciadesusalumnos,enotraspalabraspormedio
de simplificaciones lxicas y sintcticas, hablar ms despacio, articular sonidos ms
cuidadosamente estos son procedimientos que no solamente contribuyen a hacer el
lenguajemscomprensibleyaccesible,sinoqueayudaaquelosdiscursosdelprofesor
provoquenmenosansiedadenlosalumnos.

Referencias:
o
o
o
o

http://wzar.unizar.es/servicios
http://www.ugr.es
GloriaCardonaTobon(1996)Unamiradainvestigativaalauladeingls.
IvyNaistadt(2005)Speakwithoutfear:Practicalguidetoovercomthefearof
publicspeaking.

www.enfoqueseducativos.es

440

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

LAMALAREPUTACINDELACOMIDAINGLESA.

Hace algunos aos cuando un estudiante quera viajar a Gran Bretaa, se


quedaba con familias que le proporcionaban alojamiento. Eran vctimas de la
comercializacin de la lengua Inglesa. Estas familias normalmente tenan medios
limitadosypocointersensusestudiosdeidiomas.Muchasquejaseranjustificadas,
perootrassebasabanenlafaltadeentendimientodelaculturadeunpasextranjero.
Estarea,lacultura,eslaqueelprofesortienequeexplotarenelaula.

Los factores meteorolgicos y latitudinales dictaminan un ritmo de vida muy


diferentequeserepresentaenlascomidas.Hagamosunacomparacin:

HORARIO
6:008:00

TIPODECOMIDA
DESAYUNO

10:3011:30

MEDIAMAANA

12:30

MEDIODA

14:30

MEDIODA

18:00

MERIENDA

ESPAOL
INGLES
TAZA DE CAFE O UN DESAYUNO
VASODELECHE
TRADICIONAL INGLS
O
ALGUNAS
TOSTADAS Y UNA
TAZADECAF.
UN PASTEL, UN UNATAZADECAF
BOLLO
O
UN
SANDWICH

ALGO PARA COMER,


UNSANDWICH...
UNA
COMIDA
APROPIADA
ALGUNOS DULCES O ALGO
CON
PATATASFRITAS
SUSTANCIA.
SU

www.enfoqueseducativos.es

441

22:00

Nmero 2 noviembre -2007


COMIDAFUERTE.
UNABUENACENA
UNA
BEBIDA
CALIENTE ANTES DE
ACOSTARSE.

CENA

Como muestra esta tabla, las horas y los tipos de comidas son totalmente
distintos.

Paraencontrarunaraznalttulo,tenemosquereferirnosalahistoriadelpas.
Hace miles de aos, no haba variedad en la comida. Las comidas inglesas estaban
basadas en cereales, pjaros, pequeos animales y algo de fruta durante un periodo
muycortodetiempoenelverano.Estasituacinsedebaalclimayalaislamientode
otrospases.Slolaaristocraciatenaelderechoacomeranimalesgrandesdecaza.

Despusdelaconquista,laaristocraciafrancesacomaestosgrandesanimales
tanto de caza como de corral, aqu est la explicacin de las nomenclaturas de los
animalesvivosylascomidasdeestosanimales.

INGLS
ESPAOL
CERDO
VACA
TERNERA
CORDERO

ANIMAL
PIG
BULL/COW
CALF
SHEEP

CARNE
PORK
BEEF
VEAL
MUTTON

FRANCS
PORC
BOEUF
VEAU
MOUTON

Los visitantes a Gran Bretaa admitan que en tartas, galletas, tortas, pastas
etc.,lavariedadylacualidadsonexcelentes.

www.enfoqueseducativos.es

442

Nmero 2 noviembre -2007

HoyendaesdifcildeciralgoasporqueGranBretaasehaconvertidoenuna
sociedadmulticultural.Losvisitantesnopuedenolvidarsupropiacocinaperotambin
encontrarncosasparadisfrutarenlacomidaBritnica.

Referencias:

o
o
o
o
o
o

DuncanTownson(2004)AbriefHistoryofEngland.
HilaireBelloc(2006)HistoriadeInglaterra.
AnneWilson(1998)CocinaInglesa.
www.sprachcaffe.england.com
www.es.wikipedia.org/wiki/Gastronomia_de_Inglaterra
www.diomedes.com/Inglaterra

DOLORESMARIASANTIAGOPEA

DNI:11.801.891Q

MIRADARETROSPECTIVAALAENSEANZADELARELIGIN

Hasta el siglo XV, la Iglesia Catlica pensaba que la educacin consista en


recibirlasideasqueDiosdijo.

EnelsigloXVI,PedroPoncedeLenyautilizmtodosparalaenseanzade
niossordos,decaquehacindoloas,elpodraacercarlosaDios.

A finales del siglo XVIII, la educacin primaria se hizo obligatoria. Los nios
empezaban a trabajar a edades tempranas ayudando a sus padres y no estudiaban.
JoanAlbertIMartifueunsacerdotemuypreocupadosobrelasalvacindelosnios
sordos.Laspersonasoyentesquerespetabanlaenseanzareligiosapodaniralcielo
www.enfoqueseducativos.es

443

Nmero 2 noviembre -2007


porque cuando haban sido jvenes les haban explicado el catecismo, los diez
mandamientos,etc.Perolosniossordosnopodaniralcieloporquenadieleshaba
explicadoqueDiosexista,onadieleshabaenseadolascosasqueeranpecado.

La ley Moyano aparece en 1857, y estructura el sistema educativo espaol,


queservlidohasta1970,exceptuandolasegundarepblica(19311936).Anteriora
estaley,elestadoadquirideberesconlaIglesiaCatlicaenElConcordatoen1851.

Laenseanzareligiosaprivada,tuvoenlaLeyMoyanonoslountratoespecial,
sino que algunas funciones que correspondan al Estado se le otorgaron, como la de
darlealaiglesiatodaslasatribucionesenlaenseanza.

SunimosestecompromisoespecialquehatenidolaIglesiayelEstadodesdeel
principio, pasando por diferentes puntos de vista polticos en nuestra historia,
encontraremos la razn por la que en nuestra Educacin, religin, sacerdotes y
catecismohanestadosiemprejuntos.

Referencias:

http://es.geocities.com/grupolibrepensamiento/educacion
http://www.educacionenvalores.org/article
Candido Ruiz Rodrigo. (1991) Escuela y religin: El pensamiento conservador y la
educacin(Valencia18741902)

www.enfoqueseducativos.es

444

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

QUEESUNBLOGYCOMOSEPUEDEUTILIZARENLAENSEANZADELINGLS

Lapalabrablogvienedelaunindewebylog.Sedefinecomounlugar
enlawebdondecualquierapuedeaadircomentariossobreloquesehaescrito.Hay
blogs sobre una gran variedad de temas y dependiendo de a lo que enfoquen su
atencintendrnunnombreuotro.Porejemplo:

SUTEMAPRINCIPALES:

SUNOMBREES:

ARTE

ARTBLOG

FOTOGRAFIA

PHOTOBLOG

SKETCHS,VIDEOS

VIDEOBLOG

MUSICA

MP3BLOG

AUDIO

PODCASTING

MECANISMOSMVILES

MOBLOG

CONEXIONES

LINKLOG

SKETCHES.DIBUJOS

SKETCHEBLOG

SHORTERPOSTSANDMIXEDMEDIATYPES TUMBLELOGS
BASADOENLIBROS

BLOOK

COMENTARIOSATIEMPOREAL

LIVEBLOG

www.enfoqueseducativos.es

445

Nmero 2 noviembre -2007

Estos comentarios o entradas que la gente puede aadir, se escriben en un


ordencronolgico.Unblogsepuedediferenciarenlamaneraenlaqueelcontenido
se escribe o a que tipo de gnero pertenece. Si se dedican a un tema particular
podemos encontrar ejemplos tales como: blogs sobre poltica, sobre viajes, sobre
moda,sobreproyectos,sobretemaslegalesetc.

Escribir en blogs ha sido una herramienta para todas aquellas personas que
queranexpresarsusideassintenercontactovisual,normalmenteconsideradoscomo
tmidos. Con este medio pueden recibir una respuesta rpida en un tiempo real y
utilizando la lengua Inglesa en contexto o cualquier otra, desde gente y lugares muy
diferentesymanteniendounarelacinescritamuyespecial.

Estaactividaddeescribirenblogsaumentmuyrpidamenteacomienzosde
estesiglo,porquedesdeaqusepuedecontactarcongranpartedelasociedad,ms
que con cualquier tipo de periodismo. Hoy en da, podemos encontrar comentarios
sobre testimonios que se estn dando en ese momento en televisin, a este tipo de
blogsseles

denominaliveblogging.EstosblogsfueronmuytilesascomoMoblogduranteel
TsunamideDiciembrede2004oelhuracnKatrinaenAgostode2005.

Un blog se puede utilizar en clase bien como una actividad en la que los
alumnos reciban informacin input o bien como una actividad producto output
donde pueden expresar sus ideas, especialmente til para aquellos alumnos que no
estn acostumbrados a hablar en pblico. Puede servirles como un texto real de
lecturaoparaexpresarsuopininquelesresultarmsfcilsilossituamosenparejas
paraquepuedaexistirunacooperacinentreellos.

Referencias:

www.enfoqueseducativos.es

446

Nmero 2 noviembre -2007

o
o
o
o
o

www.es.wikipedia.org/wiki/Blog
www.blogia.com
www.blogger.com
www.euroresidenes.com/Blogs
Simon Collison, Andy Budd, John Oxton and David Powers (2007) Blog Design
Solutions.

DOLORESMARIASANTIAGOPEA

DNI:11.801.891Q

TARJETASDEVOCABULARIOENEDUCACINSECUNDARIA?PARQU?

LaprincipalmetaqueseplanteaunprofesordeInglsesayudarasusalumnos
a obtener un buen nivel de Ingls. Pero una de las ms importantes decisiones que
tienequetomareselmaterialquevanausar.Unodelosrecursospodraserelusode
comics,haciendolasclasesdeestamaneramsdivertidasymotivadoras.

TodoshemosodohablarsobreelhumorIngls,podemosencontrardostipos
decomicsqueson:enversooenprosa.Siutilizamosestosfragmentosdeunaforma
aislada,quizsnuestrosestudiantesnoentiendanelsignificado,perosinosayudamos
dealgunastarjetasdevocabulariootarjetasilustrativas,cuadros,dibujos,fotografas,
elentendimientoseramsfcil.

Haycuatrotiposdeversocmicoenlalenguainglesa:
Poesahumorsticadecincolneasenlaquerimanlasprimerasdosconlaltima:
limericks
Rimasdespiadadasruthlessrimes
Juegosdepalabrasdenominadoseninglspuns
Epitafioseninglsepitaph.Aunquesoninscripcioneshechasentumbas,algunas
deellasestnhechasconhumor.Porejemploelepitafiodeundentista:
Stranger,approachthisspotwithgravity

JohnBrownisfillinghislastcavity.
www.enfoqueseducativos.es

447

Nmero 2 noviembre -2007

Extrao,enfoquemosestepuntogravedad

JohnBrownestllenandosultimacavidad

Debido a la rima y al ritmo, son fciles de memorizar as los estudiantes


adquierennuevovocabularioyexpresionesdelcomic.Sepuedendestacarunnmero
detcnicasparaexplotarlasbromasenclase.

1. Utilizar lminas: cuando hablamos sobre una broma en dos lminas, el


profesor, presenta a los alumnos un nmero de lminas y le pide que una la
primeraparteconlasegunda.
2. Dibujosconsusleyendas:losdibujospuedenayudaraentenderelsignificado.
3. Dibujosconsusleyendas:Sielprofesormezclalasleyendasopiededibujoy
los dibujos, los alumnos tendrn que averiguar donde corresponde cada
fragmento.
4. TraducirchistesEspaolesalInglshaciendoellosmismossuspropiaslminas,
tarjetasodibujos:

Porquelosbuceadoressaltanhaciaatrs?
Porquesilohacenhaciadelantecaendentrodelbarco

Whydodiversjumponbackwards?
Becauseiftheydoonwardstheyjumpontheboat.
Referencias:

o Clements,J.(1976)JokesandRiddles,FortunePaperbacks,London.
o Kilgariff,M.(1987)3001Jokes,GamesandPuzzlesforKids,WardlockLimited,
London.

www.enfoqueseducativos.es

448

Nmero 2 noviembre -2007

DOLORESMARIASANTIAGOPEA

DNI:11801891Q

TRABAJOENPAREJASOINDIVIDUAL

Tellme,andIllforget

Showme,andIllremember

Involveme,andIlllearn

(ChineseProverb)

Segn Shirk (1995) la colaboracin aumenta la motivacin y el aprendizaje


porqueprovienedelaexperienciaderesolverproblemas.Losprofesorestendranque
tener en cuenta las variables que afectan al proceso de aprendizaje tales como: el
tema, los materiales, la motivacin, el entusiasmo Gibbs (1994) plantea que las
variables para medir el nivel de xito dependen de la consistencia del propsito del
proyecto,relacinconlosobjetivosyrequisitosdelcurso.

Los profesores deciden si los alumnos harn su aprendizaje de manera


cooperativaoautnoma.Algunosresultadosindicanunagranvariedaddeventajasen
la colaboracin de los estudiantes a la hora de preparar trabajos escritos, los
resultados son gramaticalmente ms correctos, incluyen menos errores a la hora de
escribir e indican un mayor grado de conciencia gramatical. El trabajo cooperativo
ayudaalosestudiantesaconstruirrelacionesinterpersonalespositivasycrearunalto
niveldeconfianzaysolidaridadenelambienteacadmico.

www.enfoqueseducativos.es

449

Nmero 2 noviembre -2007

Segn Chomsky expone, la competencia es el conocimiento del lenguaje del


hablanteodeloyentemientrasquelaejecucineselusodellenguajeensituaciones
concretas. Los profesores no pueden olvidarse de este dato, porque no siempre los
compaeros tienen el mimo nivel y el problema puede venir cuando estudiantes
inexpertosseescondendetrsdelosmsaventajados.Esteeselmotivoporelqueel
profesor debe utilizar tcnicas de entrevista antes de que el proyecto empiece para
hacerunaevaluacinprevia,otratcnicaefectivaeselusodelcorreoelectrnico.Los
estudiantes tienen la oportunidad de ampliar su nivel de intimidad y son capaces de
comunicarseconmsfrecuenciaporestemedio.

Como conclusin de este anlisis, el trabajo en parejas tiene contribuciones


positivasenamboscampos,elacadmicoyelsocial,enmuchossentidossilasetapas
anteriores se han hecho correctamente. Pero no se puede utilizar para mejorar las
cuatro destrezas, algunos inconvenientes pueden aparecer tales como el uso de la
lenguamaternaoquealgunosalumnosnohagannadayseaprovechendeltrabajode
suscompaeros.
Referenciasbibliogrficasyweb:

o Gibbs, G. (1994) Learning in teams: A student manual. Oxford: Oxford Brooks


University
o Shirk, H:N: (1995). The fallacies of collaboration. Education, training and
research.
Pg,7882http://www.stc.org/confproceed/1995/PDFs/PG7982.PDF
o Olcay Sert. (2005). Journal of Language and Linguistic Studies. Vol. 1, N 2,
October2005.AcomparativeanalysisofPairworkandIndividualAssignments
intwoELTGrammarClasses
o Canale, M. (1983). From Communicative Competence to Communicative
LanguagePedagogy:NewYork:Longman.

www.enfoqueseducativos.es

450

Nmero 2 noviembre -2007


o

AnaMaraJaracesLaserna77347898W

Actividadesextraescolares:Paraqusontiles?

Las actividades extraescolares son una gran fuente de conocimiento para el


alumno,sobretodo,siestndedicadasalavisitadeunmuseo,deunagaleradearteo
unaexposicinfotogrfica.
Mediante este tipo de actividades acercamos a los alumnos al mundo que
verdaderamente les rodea, y se trata de una forma diferente de poner en prctica
aquelloquehanestudiadodemaneratericaenclase.
Por otro lado, tambin nos encontramos aquellas actividades que tienen un
carctermsldicoyquesesuelenrealizarafinaldecursoparadesconectardetoda
larutinadelao,comopuedeserunavisitaaunparquedeatracciones,unmuseode
ceraouncampodeftbol.
Mediantetodasestassalidas,losalumnosserncapacesdedemostrarsugrado
demadurez,puestoquetienenquetenerundeterminadocomportamientoytambin
enalgunoscasos,comohemencionadoanteriormente,elniveldeconocimientoque
hanobtenidoalolargodelcurso.
Se trata de una manera diferente de aprender cosas nuevas puesto que este
tipodeactividadesnosontanfrecuentes.
Aunque tambin presentan algunas desventajas, como por ejemplo, que el
comportamiento de los alumnos no sea el adecuado y esto suponga un verdadero
hndicapparaeldesarrollodelaactividad.

www.enfoqueseducativos.es

451

Nmero 2 noviembre -2007


Por lo tanto es importante hacerle saber a los alumnos que las actividades
extraescolaressonimportantesparasuformacinsiempreycuandoellosrespondan
con el comportamiento adecuado que se requiere cuando se visita un lugar nuevo y
diferente.
Bibliografa:

Doff,A.(1988).TeachEnglish.ATrainingCourseforTeachers.Cambridge:C.U.P

www.enfoqueseducativos.es

452

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

LaexpresindelacategoragramaticalenIngls:Nombre,adjetivoyadverbio.

Enesteartculohablardelaexpresindelacategoragramaticaleninglscon
respectoalnombre,eladjetivoyeladverbio.
Para ello, dar una breve introduccin acerca de la diferencia entre la
morfologaderivativaylamorfologaqueestudialasinflexiones(morfologainflexiva)
La morfologa derivativa estudia los lexemas mientras que la morfologa
inflexiva se centra en las inflexiones de los lexemas. Dichas inflexiones son los afijos
queexpresandiferentescategorasgramaticalesenunapalabra,porejemplo,persona,
nmero, tiempo verbal, grado comparativo o superlativo, etc. Pero todas estas
categoras gramaticales no aparecen en todas las palabras; es decir, hay categoras
gramaticales que son propias de determinadas clases de palabras, por ejemplo, el
grado comparativo y superlativo es propio de los adjetivos, y la voz pasiva y activa,
propiadelverbo.
Ahoraexplicarestascategorasgramaticalesdependiendodeltipodepalabra.

1. Nombre

El nombre es una tipo de palabra abierta y sus principales categoras


gramaticalessonelnmero,elcasoylapersona.
Conrespectoalnmero,tenemosquediferenciarentreelsingularyelplural.
En el singular, no hay ningn elemento que nos indique que la palabra hace
referenciaaunsoloelemento,porejemplo,table(mesa).
www.enfoqueseducativos.es

453

Nmero 2 noviembre -2007


Por el contario, en el plural solemos aadir una s a aquellas palabras que
acaban en vocal (tables) o algunas que acaban en consonante (yearsaos). Pero
existeotrogrupoqueparalacreacindelpluralaadeelalomorfoes,porejemplo,
lapalabrawishes(deseos).

En relacin al caso, tenemos que hablar del genitivo sajn. Se utiliza para
expresarposesin.Secreaaadiendos.Unejemplosera:Peterscar(elcochede
Peter). Adems de esta construccin podemos formar el genitivo aadiendo solo la
apostrofe: Dickens novels (las novelas de Dickens). En este caso, slo nombres que
acabenens.

El gnero es otra categora del nombre. Tenemos el masculino, femenino y


neutro.Peronosoncaractersticaspropiasdelnombreeningls,sinomsbiendelos
pronombresposesivos:(His,herssuyo)ylosadjetivosposesivos:(her,hissu).

2. Adjetivo

Losadjetivossolamentepresentanunacategoragramatical,elgrado.
El grado se expresa en diferentes maneras, todo depende del significado que
queramosexpresar.
Si aadimos er al adjetivo, estamos expresando el grado comparativo: This
classroom is cleaner than the other (esta clase est ms limpia que la otra). Por el
contrario, si aadimos est, el grado es superlativo: This classroom is the cleanest
(estaclaseeslamslimpia).
Pero existen otras formas de crear tanto el grado comparativo como el
superlativo. Tenemos que aadir more and the most respectivamente a aquellos
adjetivosquetenganmsdedosslabas:Thisnovelismoreinterestingthanthatbook
(esta novela es ms interesante que aquel libro); o this novel is themost interesting
(estanovelaeslamsinteresante).
Tambin existen otra clase de adjetivos que para realizar su correspondiente
forma de comparativo y superlativo cambian su forma: good better, best (Bueno,
mejor,elmejor)obadworse,worst.

www.enfoqueseducativos.es

454

Nmero 2 noviembre -2007


3. Adverbio

Estapalabraesparecidaaladjetivoyaquesucategoragramaticalseexpresa
medianteelgrado.
Aaden tambin er or est. Por ejemplo, earlier (some years earlier
algunos aos antes). Tambin se aade more y most para referirse a significados
diferentes.

Para concluir con el artculo, vemos que las categoras gramaticales tanto de
nombres,adjetivosyadverbiossondiferentes.
Conrespectoalosnombres,diferenciamosentrecaso,gneroynmero,ycon
losadjetivosyadverbiotansolodestacarelgrado:comparativoysuperlativo.

Bibliografa:

Greenbaum,S&Quirk,R(1990).AStudentsGrammaroftheEnglishLanguage.
London:Longman
Brown,G&G.Yule(1983).DiscourseAnalysis.CambridgeUniversityPress

www.enfoqueseducativos.es

455

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Dictado:otrasformasderealizarlo

El dictado ha sido siempre considerado una actividad muy aburrida que el


profesorrealizaparahacerquelosalumnospermanezcanensilencio.
El procedimiento ha sido siempre el mismo durante aos. El profesor lee el
texto tres veces. Con la primera lectura, los estudiantes se acostumbran a los
diferentes sonidos del idioma. Con la segunda lectura, empiezan a escribir lo que
estn escuchando y finalmente, con la tercera lectura, los alumnos corrigen los
posibleserroresquehayanpodidocometer.
Perolaconcepcindeestaactividadhacambiado.Actualmente,haydiferentes
tcnicasconlasquerealizarlosdictados.
Por ejemplo, el profesor puede imitar a un mp3 y los estudiantes los usarn
comoquieran;esdecir,siellosquierenqueelprofesorsigaconeldictadodebendecir
play.Porelcontrario,siquierenqueelprofesorpare,debernpronunciarlapalabra
stop.Ysiquierenqueelprofesorrepitaalgunadelaspartesdeberndecirrepeat.
Estetipodeprocedimientoesdivertidoparalosalumnosenelsentidodeque
ellosformanpartedirectadelaactividad.
As que utilizando este mtodo hacemos que los alumnos se integren
activamenteenlarealizacindeldictado.
Otro tipo de dictado sera en el que los alumnos tienen que dibujar lo que el
profesorlesdicte.Conestatcnica,elprofesorpodrcomprobarlacomprensinoral
desusalumnosoloqueeslomismo,sihansituadolosdibujosenellugarcorrecto.

www.enfoqueseducativos.es

456

Nmero 2 noviembre -2007


Para resumir lo anteriormente escrito, podemos decir que hay distintas
manerasderealizarundictadoalosalumnosquepermitelacompletaintegracinde
losalumnosenunaactividaddivertidaydiferenteparaellos.

Bibliografa:

Madrid, D & McLaren, N. (1995). Didactic Procedures for TEFL. Valladolid: La


Calesa.
Ur,P.(1998).GrammarPracticeActivities.Cambridge:C.U.P

www.enfoqueseducativos.es

457

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Estnlosalumnosrealmentemotivadosensuactividadeducativa?

Cuando hablamos de la motivacin de los alumnos, hacemos referencia a


aquellasmetasquelosestudiantesseproponenyporlotantoquierenconseguir.
Pero no todos estn igualmente preparados para afrontar tanto los factores
internos(autoestima,sentimientos,etc.)comoexternos(situacinfamiliar,amistades,
etc.) que en algn momento pueden afectar a la consecucin de los objetivos
propuestos.
Es muy importante que en el centro educativo sean los profesores los que
motivenasusalumnosmedianteactividadesqueseadaptenasusinteresesygustos.
Deestamaneraelprofesorconocermsprofundamenteasusalumnosystosvern
enlaunapersonaquerealmentequierequeaprendanacercndolesaquelloquems
lesllamalaatencin.
Mediantelaproposicindedeterminadosobjetivos,elalumnosevecapazde
realizar todo lo que sea posible para poder avanzar en la ampliacin de su
conocimiento.Gradualmente,irampliandosusganasdeaprenderyporconsiguiente
deformularsenuevasmetas.
Porlotantopodemosconcluirconlaideadequemediantelaproposicinde
metasyobjetivosaconseguir,losalumnosseresponsabilizandirectamentedeaquello
queaprendenenelcentroescolar.Elesquemaseraelsiguiente:

Alumno

www.enfoqueseducativos.es

458

Nmero 2 noviembre -2007

Bibliografa:

Phillips,S.(1993).YoungLearners.Oxford:OxfordUniversityPress
Scott, W & L. Ytreberg. (1990). Teaching English to Children. London:
Longman.

www.enfoqueseducativos.es

459

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Porqusontandesmotivanteslosexmenesoralesenlaasignaturadeingls?

Noesmuydifcildeterminarlaraznporlaquelosestudiantesconsideranque
losexmenesoralesdeinglssontandesmotivantes.
Los alumnos tienden a pensar que no tienen el suficiente nivel para expresar
susideaseningls.
Aparte de esto, tambin se sienten aterrorizados cuando dicen algo mal y el
profesorautomticamentecorrigeelerror
Otro aspecto que es hace sentirse mal es la risa y mofas de sus compaeros.
Normalmente,tiendenahacerbromasconlosfallosquecometen
Porlotanto,estaactitudseconvierteenunhndicapimportanteenlamejora
desuniveloraldelingls.Losestudiantesdebenpensarqueelprofesoresunadelas
opcionesviableparaconseguirunamejoranotableensuniveloral,yaqueelprofesor
sabecmoycundocorregirloserrores.
Hacerexmenesoraleshacequelosalumnossereplanteenlaimportanciade
tenerunbuennivelenlacomunicacinoral.
El profesor puede dar consejos a sus alumnos para que stos practiquen el
ingls mediante la comunicacin oral. Por ejemplo, pueden ver pelculas en versin
original, escuchar msica en ingls o jugar a la videoconsola o al ordenador con los
juegoseningls.
Como conclusin, podemos destacar la idea de que los estudiantes pueden
mejorar notablemente su nivel de ingls si realizan actividades tan sencillas como
escucharmsicaoverpelculasenversinoriginal.

www.enfoqueseducativos.es

460

Nmero 2 noviembre -2007


Bibliografa:

Madrid, D & McLaren, N. (1995). Didactic Procedures for TEFL. Valladolid: La


Calesa.
Matthews , A. et al. (eds) (1985). At the Chalkface. Practical Techniques in
LanguageTeaching.London:EdwardArnold

www.enfoqueseducativos.es

461

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Modelosoracionaleseningls

Primero, definir los tres conceptos ms relevantes de dicho artculo: clause


(oracin),pattern(modelo)yclausepattern(tipodeoracin).
Una clause (oracin) es una de las unidades que forman la escala
comunicativa. Est formada por un sujeto y un verbo. Con ella, podemos crear
oracionesopartesdeunaoracin.
Podemosclasificarlascomofiniteclauses(oracionesfinitas:elverboaparece
conjugado) y como nonfinite clauses (oraciones no finitas: el verbo aparece no
conjugado;esdecir,infinitivoogerundio).Aqutenemosalgunosejemplos:
Finitecl:PeterandMaryhadfoursons.

(PeteryMarytienencuatrohijos)

Nonfinitecl:Wewereluckytowinthelottery.

(Tuvimossuertedequenostocaralalotera)

Un pattern (modelo) hace referencia a los elementos principales que forman


una oracin y a la funcin correspondiente que estos elementos tienen en dicha
oracin,porejemplo,sujeto,predicado,etc.
Todas estas funciones son obligatorias, excepto, los adverbiales, ya que su
funcinnoestanimportantedesdelospuntosdevistagramaticalysemntico.Porlo
tanto,lopodemosomitiryelsignificadodelaoracinnocambia:

www.enfoqueseducativos.es

462

Nmero 2 noviembre -2007


Forthenextthreedays,hewillbethepresident.
(Durantelosprximostresaos,lserpresidente)

Una clause pattern (modelo oracional) hace referencia a aquellos elementos


que son obligatorios y tienen una funcin concreta en la oracin. Dichos elementos
sonlosquesiempreserepitenentodaslasoraciones,tantoenvozactivacomoenvoz
pasiva.

Enlavozactiva,encontramosoracionesqueintegranunpredicadocuyoverbo
aparece conjugado y otras oraciones en las que el predicado contiene un verbo que
apareceobieneninfinitivooengerundio.
Algunasdeestasoracionesson:
1. Sujeto+Predicado:
i. Theyareeatingpizza
ii. Ellosestncomiendopizza
2. Sujeto+Predicado+Atributo:
i. Theyarefriends
ii. Ellossonamigos
3. Sujeto+Predicado+ObjetoDirecto(monotransitiva):
i. Theboyhastwobooks
ii. Elniotienedoslibros
4. Sujeto+Predicado+ComplementoAdverbial:
i. Petermovedfrequentlyfromflattoflat
ii. Petersecambiaconfrecuenciadepiso
5. Sujeto+Predicado+ObjetoPreposicional:
i. Shecaredforherchildren
ii. Ellacuidadelosnios
6. Sujeto+Predicado+ObjetoDirecto+ObjetoIndirecto(ditransitiva):
i. Shegavemethebook
ii. Ellamedioellibro
7. Sujeto+Predicado+ObjetoDirecto+ComplementodelObjeto:
i. Hetoldhimstupid
ii. llellamestpido

Ahora,nombraralgunosejemplosdeoracionescuyoverbonoestconjugado:
1. (Sujeto)+Predicado+ObjetoDirecto(monotransitiva):
Tomakeanexam
(Hacerunexamen)
www.enfoqueseducativos.es

463

Nmero 2 noviembre -2007


2. (Sujeto)+Predicado+ComplementoAdverbial:
Togrowupinanintellectualenvironment
(Crecerenunambienteintelectual)
3. (Sujeto)+Predicado+ObjetoIndirecto+ObjetoDirecto:
Ofgivinghimabook
(darleunlibro)

Enlavozpasivatambinencontramoscasosparecidos:

1. Sujeto+Predicado:
Johnwasrobbed
(LerobaronaJohn)
2. Sujeto+Predicado+ComplementoAdverbial:
HewasborninMadrid
(lnacienMadrid)

Comoconclusin,podemosdecirquelosclausepatternsserepitentantoenla
voz activa como en la voz pasiva y son parecidos o completamente iguales. La idea
principalescompararlosydemostraralgunasdesusdiferenciasosemejanzas.

Bibliografa:

Greenbaum,S&Quirk,R(1990).AStudentsGrammaroftheEnglishLanguage.
London:Longman
Mair, Ch. Et alii. (1990). Infinitival Complement Clauses in English: A Study of
SyntaxinDiscourse.CambridgeUniversityPress.

www.enfoqueseducativos.es

464

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Participanlosalumnosenclase?

La participacin de los alumnos es una de las caractersticas principales que


debendefinirunaclase.
Sueleserescasaentrelosalumnos.Muchosdeellos,bienporqueseantmidos
obienporquenoestnsegurosdesuintervencin,nosalenvoluntariosenactividades
ydemstareasqueserealizanenclase.
Es en este momento en el que el profesor debe fomentar la participacin
espontneadesusalumnos.
Mediante las intervenciones en pblico, los alumnos pueden aprender a ser
mucho ms extrovertidos tanto en su actitud dentro del aula como en su vida
personal.
Adems de demostrar al profesor que son capaces de intervenir en cualquier
momentoestandosegurosdesuaportacin,muestranalosdemscompaerosque
puedenformarparteactivaenlaclase.
Entre las tcnicas que se pueden utilizar para fomentar la participacin, nos
encontramos las actividades grupales en las que se requiera un portavoz, pequeas
representaciones en las que los alumnos encarnen un personaje o simplemente
preguntarlesporaquelloquelesgusteointerese.
Elobjetivoprincipalesconseguirquenuestrosalumnossesientanbiencuando
participenyqueestonolessupongaunhndicapensuactividadeducativa.

Bibliografa:

www.enfoqueseducativos.es

465

Nmero 2 noviembre -2007

Campell, C & H. Kryszewska. (1987). Learner Based Teaching. Oxford: Oxford


UniversityPress.
Stevick,E.(1980).AWayandWays.Heinle&Heinle

www.enfoqueseducativos.es

466

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Podemos hacer ms interesantes nuestras clases con las Presentaciones


PowerPoint?

Con el uso del Microsoft PowerPoint, podemos hacer de nuestras clases, un


ratointeresanteyatractivo.
Gracias a este programa, podemos explotar ciertos recursos, creando juegos
conlosquenuestrosalumnospuedencomprobarsunivelyasentarconocimientos.

Medianteelusodelhipervnculo,podemoscrearjuegosconlosqueevaluara
los estudiantes. En el instante en el que posicionen el ratn sobre las posibles
respuestaspuedencomprobarsisueleccinhasidolacorrectaono.

Otraposibleopcinesutilizarelprogramaparahacerunaexposicinenlaque
losalumnospuedanintervenirenlaexplicacindelprofesordeformaactiva.
Paraquelaspresentacionesseanmsdivertidasyvisuales,sepuedenutilizar
imgenesqueofreceelprogramaobienotrasobtenidasdeinternetuotrasfuentes.
Como conclusin, podemos destacar que este programa ofrece bastantes
posibilidades,nosloparaacercarlasnuevastecnologasalosalumnossinotambin
parallenarnuestrasclasesdeespontaneidadyentretenimientoalavezdeaprendizaje
yconocimiento.

Bibliografa:

Rozas,M.(1999).InternetylasLenguasExtranjeras.Bosco,284:2432
Teeler,D&P.Gray,(2000)HowtoUsetheInternetinELT.Essex:Longman
www.enfoqueseducativos.es

467

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Quventajastieneelaprendizajecooperativo?

Como su propio nombre indica, el aprendizaje cooperativo es aquel que se


producecomoconsecuenciadeltrabajoenequipoeinteraccinentrelosalumnosde
unaclase.
Una de las ventajas al realizar trabajo utilizando grupos es que las metas de
cada uno de los participantes pasarn a ser las metas del resto de miembros. Por lo
queelaprendizajesecentrarenmuchosmsaspectos.
Mediante el trabajo en equipo, los alumnos pasan a tener diferentes roles.
Entre ellos se ayudan a la comprensin de aquellos conceptos que puedan resultar
mscomplejos,semotivanunosaotros,aprendenarespetarlosdiversospuntosde
vista que se planteen o se fomentan las relaciones interpersonales, sobretodo, en
aquellosalumnosquesonmuchomstmidos.
El trabajo cooperativo es otro procedimiento para hacer madurar a los
alumnos, puesto que el esfuerzo que cada participante realice de manera individual
contarcomopositivoonegativoatodoelconjunto,porlotantolaresponsabilidadde
cadaunosermayor.
Estametodologanoessiempreadecuadaparaserdesarrolladaenclase,deah
queelprofesornecesiteprepararconantelacineltipodeactividadesquesepuedan
llevar a cabo utilizando este procedimiento. Entre este tipo de actividades podemos
destacar la grabacin de un video, escribir una revista, realizar una representacin
teatral,etc.

Bibliografa:

www.enfoqueseducativos.es

468

Nmero 2 noviembre -2007


Madrid, D & McLaren, N. (1995). Didactic Procedures for TEFL. Valladolid: La
Calesa.
Willis,J.(1996).AFrameworkforTaskbasedLearning.Essex:Longman.

www.enfoqueseducativos.es

469

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Lavozpasivaeningls

Esmuyimportantediferenciarentrelasconstruccionesdevozpasivayaquellas
queloparecenperonoloson.
Primero,explicarcmoseformalavozpasiva.Utilizamoselverbotobeyel
pasadoparticipiodecual quierverbo.Porejemplo:

ThisfilmwasproducedbyAngLee

Enesteejemplo,lavozpasivasecreadesdelavozactive;esdecir,quetenemos
unsujetopacienteintroducidoporby.Elsujetodelavozpasivaeselobjetodirecto
de la active y el verbo to be en pasado indica que la construccin activa est en
pasadosimple.
El ejemplo de arriba incluye un sujeto paciente introducido por by, pero no
todaslaspasivasloincluyen,yaqueenalgunoscasosnoesnecesario.
Perocomomencionenlaprimerapartedelartculo,notodaslasformasque
parecenpasivalosson.Esteeselcasodelassiguientesoraciones:

Thoseexerciseswereunfinishedandincorrect

Haydiferentesrazonesqueexplicanestaconstruccin:
www.enfoqueseducativos.es

470

Nmero 2 noviembre -2007

1. Podemossustituirwereporelverboseem:

Thoseexercisesseemedunfinishedandincorrect

2. Podemoscambiarelhipotticopasadoparticipioporunadjetivo:

Thoseexerciseswereunfinishedandincorrect

3. Estaoracinnotieneformaactiva:

Somebodyunfinishedthoseexercises

Con esta tercera razn podemos comprobar que la palabra unfinished es un


adjetivoynounverboenpasadoparticipio.

4. Podemosmodificarestasoracionesconadverbios:

Thoseexerciseswerestillunfinishedandincorrect

5. Otraimportanteraznesqueestasoracionesexpresanunestadoynouna
accin.Enestecaso,quelosejerciciosestnsinterminar.

6. Finalmente,estasoracionesnotienencomplementoagente.Nohaysujeto
querealicelaaccin.

Porlotanto,deacuerdocontodasestascaractersticas,podemosdecirquela
oracinthoseexerciseswereunfinishedandincorrectesunaoracinadjetival.

Parahacermsclaraladistincinentrepasivayoracinadjetival,daralgunas
de las caractersticas ms relevantes de la voz pasiva. Para ello, utilizar el ejemplo
Thatmonasterywasbuiltin1300.

www.enfoqueseducativos.es

471

Nmero 2 noviembre -2007


1. Nopodemossustituirelverboporseem:

Thatmonasteryseemedbuiltin1300

2. Nopodemoscoordinarelpasadosparticipioconotrosadjetivos:

Thatmonasterywasbuiltandold

3. Vienedeunaoracinactiva:

Somebodybuiltthemonasteryin1300

4. Noesposiblelamodificacinadverbial:

Themonasterywasverybuilt

5. Enlavozpasiva,elverboexpresaunprocesoenvezdeestado:

Themonasterywasbuiltin1300proceso

6. Estas oraciones suelen tener un agente. En este ejemplo no hay un


complementoagenteclaro,peropodemosusarsomebody:

Somebodybuiltthemonastery

Aunque hemos realizado una dicotoma entre las oraciones adjetivales y las
construccionespasivas,encontramosotrosejemplosenlosqueladiferencianoestan
notable.
Esteeselcasodelasiguienteoracin:

Officiallysignedthecontract

www.enfoqueseducativos.es

472

Nmero 2 noviembre -2007

El ejemplo anterior presenta una forma activa que es no finita sin embargo,
podemosreorganizarlaoracinsincambiarsusignificado:

Thecontractwassignedofficially

Esta nueva organizacin nos muestra que la oracin pasiva se puede realizar
utilizando solamente la forma de pasado participio. Un ejemplo parecido es el que
muestroacontinuacin:

Correctedtheexambytheteacher,theywentout

Inclusoenestecaso,haymselementosquenosindicanqueestaoracines
vozpasiva.Aunquenoincluyeelverbotobe,presentauncomplementoagenteque
laaproximaalgrupodelavozpasiva.

Podemosdenominaraestegruposemipassives.Aunquenoaparezcaelverbo
to be, el significado y la forma de pasado participio acercan esta construccin al
grupodeoracionespasivas.

Comoconclusin,podemosdeterminarquehaydosgruposclarosdeoraciones,
las adjetivales y las pasivas. Y otro grupo ms reducido que denominamos semi
passive ya que presenta algunos de los elementos de la voz pasiva como el
complementoagenteylaformadepasadoparticipio.

Bibliografa:

Brinton, L.J. (1996). Pragmatic Markers in English: Grammaticalization and


DiscourseFunctions.MoutondeGruyter.
Shibatani,M.(2000).PassiveandVoice(TypologicalStudiesinLanguage).John
BenjaminsPublishingCo.
www.enfoqueseducativos.es

473

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

10razonesparaaprenderingls

Cuando aprendemos una nueva lengua tenemos como objetivo poder


comunicarlos con los dems. Pero hay otros factores que tambin se consideran
relevantes.Podemosdestacarlossiguientes:
Podercomunicarnosconpersonasqueseandeotrospases
Dominar la lengua en su expresin escrita para poder producir textos
escritos
Podernavegarporinternetsinnecesidaddeayuda
Poderaccederacualquiertrabajoquerequieraconocimientodelingls
Entenderacualquierpersonaqueseestcomunicandoconnosotros
Poderverpelculasenversinoriginal
Escucharmsicayentenderlaletradelacancin
Sentirnos capaces de aprender un idioma diferente al nuestro en la
mayoradelosaspectos
Conoceryacercarnosaotrasculturasdelmundo
Interesarnosporloquepuedapasarenotrospasesqueestnvinculado
conlalenguaqueestemosaprendiendo

Estas son algunas de las razones ms importantes por las que deberamos
aprenderingls.Muchasdeellasestndirectamenterelacionadasconnuestrapropia
vida y contacto con la sociedad, mientras que otras simplemente se centran en un
aprendizajeconprecisindelidioma.

Bibliografa:

www.enfoqueseducativos.es

474

Nmero 2 noviembre -2007

Willis,D&J.Willis.(2001).TaskbasedLanguageLearning.EnR.Carter
&D.Nunan(eds.)TheCambridgeGuidetoTeachingEnglishtoSpeakers
ofOtherLanguages.Cambridge:CambridgeUniversityPress:173179.
McKay,H&A.Tom.(1999).TeachingAdultSecondLanguageLearners.
Cambridge:CambridgeUniversityPress.

www.enfoqueseducativos.es

475

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

QuentendemosporLearningbyDoing(aprenderhaciendo)?

Esteconceptosecaracterizaporserbastanteamplioypoderserinterpretado
endiferentesmaneras.
Conestametodologa,losalumnostienenunpapelactivoyaqueaprendernel
idiomademaneradinmica.Trabajarnconlanuevalenguademaneradirecta.
Estemtodosepuedeutilizarparahaceractividadesenlasquelosestudiantes
deban recordar conceptos que ya han sido aprendidos y que le facilitarn el
aprendizajedelosnuevos.
Entre las actividades a destacar, podemos mencionar aquellas en las que los
alumnostrabajandemaneradirectaconlalengua,comoeselcasodelosdebatesolas
representaciones. Estas actividades sern llevadas por los alumnos de manera
independienteysinlacontinuasupervisindelprofesor.Porlotanto,ellossernlos
encargadosdeinventarlosdilogos,lasreglasquesedebenseguirolostemasquese
discutirneneldebate.
Otras actividades son las relacionadas con la conversacin en la que los
alumnostenganqueimprovisarloquequierandeciroaquellasenlasquedebancrear
suspropiostrabajosmanualescomomensderestaurantes,noticiasoanuncios.
Deestamanera,losalumnosnosolamenteaprendenlalenguasinoquehacen
actividades que requieren el uso de multitud de materiales como cartulinas, papeles
decolores,etc.

www.enfoqueseducativos.es

476

Nmero 2 noviembre -2007


Para concluir, decir que el concepto de aprender haciendo es un concepto
amplio pero fcilmente aplicable al desarrollo de las clases ya que permite a los
alumnostrabajardirectamenteconelnuevoidiomaalavezqueaprendenconceptos
mediantelacreacindemateriales.

Bibliografa:
Madrid, D & N. McLaren. (1995). Didactic Procedures for TEFL. Valladolid: La
Calesa
Milne, B. (1990). Heinemann Integrated Skills. Intermediate. London:
Heinemann.

www.enfoqueseducativos.es

477

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Diferenciasentreelusodematerialesrealesyrealia

Aunque los materiales reales y realia son metodologas similares, hay


diferenciasnotablesentreellas.
Losmaterialesrealesestnrelacionadosconelusodeelementoscomomens
derestaurantes,cancionesoinformesderadioparaasestudiarvocabularioynuevos
conceptos.
Por el contrario, con realia los alumnos trabajarn con objetos reales que
podrnpalparyobtenerfeedbackdeunamaneradiferente.Podemosdestacarobjetos
comotelfonos,muecas,cajas,manzanas,etc.Conrealia,losalumnostrabajancon
materialesautnticosconlosqueaprendernconceptosnuevosyrepasarnotrosque
hansidoestudiadosconanterioridad.
Porotrolado,losmaterialesrealesestnvinculadosaunusomstericodel
idioma;esdecir,mediantesuusoseaprendenconceptosrelacionadosconestructuras
oracionales,gramtica,etc.
Ademsdeestadiferencia,realiaseutilizaparaleenseanzadedeterminados
procedimientos como la descripcin de personas y objetos. Ofreciendo la posibilidad
derealizarlodediferentesmaneras.Porejemplo,meterprendasderopaenunacaja
quelosalumnosdeberndescribiryasociaraalguienquevistaalgoparecido.

www.enfoqueseducativos.es

478

Nmero 2 noviembre -2007


Otra diferencia relevante es que los materiales reales se suelen utilizar con
niveleseducativosmselevandoyrealiasecentraenaquellosnivelesmsbsicose
intermedios.
Como conclusin, podemos destacar que realia ofrece la posibilidad de
trabajar con objetos que forman parte de la vida cotidiana de nuestros alumnos.
Mientrasqueconlosmaterialesreales,lasclasessedesarrollarndeunamanerams
terica al tratar con otro tipo de elementos como noticias, peridicos o informes
meteorolgicosderadio.

Bibliografa:

Lewis, G & G. Bedson. (1999). Games for Children. Oxford: Oxford University
Press
Lewis,M&J.Hill.(1992).PracticalTechniquesforLanguageTeaching.HoveUK
LanguageTeachingPublications.

www.enfoqueseducativos.es

479

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Elusodeldiccionarioenclase

Unadelasprincipalesherramientasdelasquedisponeunalumnoenlaclase
deinglsesprobablementeeldiccionario.
Setratadeunamaneraeficazparaobtenerelsignificadodeaquellaspalabras
que pueden resultar ms difciles de comprender o cuyo significado no es fcil de
adivinar,inclusoporelcontextocuandoserealizaunalectura.
Peroparasucorrectouso,esmuyimportantequeelalumnosepacmobuscar
laspalabrasynosiempreesas.
Esaqucuandoelprofesordebeensearcmohacerlo,ademsdelasventajas
desuusoincluyendolacorrectamanipulacindelmismo.
El diccionario es una herramienta muy verstil, ya que con l, el alumno se
vuelve ms independiente en su proceso de aprendizaje y el profesor no est
constantementesiendolafuentedeinformacindesusalumnos.
Sisefomentasuusonosloenelcentroeducativo,sinotambinfueradeste,
losalumnospocoapocoirnconcibindolocomounafuentedeinformacinmspara
suaprendizaje.
Por otro lado, hay tambin que mencionar que actualmente podemos
encontrarunagranvariedaddediccionarios,desdelosbilingesalosmonolinges,sin
olvidarlosdiccionariosdeantnimososinnimosolosdiccionariosonline.
Deestamanerapodemosconcluir,queeldiccionarionoesunanicafuentede
obtencin de informacin para la clase de ingls, sino que tambin es un elemento
esencialparaotrasasignaturascomolenguayliteratura.

www.enfoqueseducativos.es

480

Nmero 2 noviembre -2007


Adems de existir una amplia variedad que permite trabajar con ellos en
cualquierrea.

Bibliografa:

Rozas,M.(1999).InternetylasLenguasExtranjeras.Bosco,284:2432
Sheldon, L (ed.). (1987). ELT Textbooks and Materials: Problems in Evaluation
andDevelopment.Oxford:ModernEnglishPublications&TheBritishCouncil

www.enfoqueseducativos.es

481

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

LAFORMACINDEPALABRAS

En ingls, existen diferentes maneras de crear nuevas palabras. Por ejemplo,


podemos aadir sufijos, prefijos o bien unir dos palabras y formar as palabras
compuestas.
En este artculo, me centrar en la adicin de prefijos y sufijos para la
formacindenuevaspalabras.
Primero,harunalistadelossufijosmscomunesqueseutilizanparaformar
nombres a partir de adjetivos, verbos u otros nombres. Tambin tendr en cuenta
aquellaspalabrasquecambiancompletamentesuforma.

1. Formacindenombresapartirdeverbos:

Verbo
Write
Employ
Pollute
Communicate
Refuse
Arrive
Excite
Drive

Sufijo
er
ee
tion
al
ment
ing

Nombre
Writer
Employee
Pollution
Communication
Refusal
Arrival
Exciment
Driving

2. Formacindenombresapartirdeadjetivos:

Adjectivo

Sufijo
www.enfoqueseducativos.es

Nombre
482

Private
Efficient
Happy
Sad
Honest
Different
Important

Nmero 2 noviembre -2007


Privacy
Efficiency
Happiness
Sadness
Honesty
Difference
Importance

cy
ness
(i)ty
ence
ance

3. Formacindenombresapartirdeotrosnombres:

Nombre
Child
Adult
Relation
Friend

Sufijo
hood

Nombre
Childhood
Adulthood
Relationship
Friendship

ship

Ahora,veremosdostablasenlasquepodemosencontraraquellasexcepciones
enlasquelosnombrescambiancompletamente.Sonlasformasirregulares.

Verbo
Fly
Live
Laugh
Die
Please
Behave
Know
Sign
See
Weigh
Choose
Inhabit
Succeed

Nombre
Flight
Life
Laughter
Death
Pleasure
Behavior
Knowledge
Signature
Sight
Weight
Choice
Inhabitant
Success

Adjective
Poor
Beautiful
Long
Young
Wide
Thirsty
Free
Courageous
Deep
High
True
Hungry
Hot
Angry
Warm
Strong
Dead
Wise

www.enfoqueseducativos.es

Noun
Poverty
Beauty
Length
Youth
Width
Thirst
Freedom
Courage
Depth
Height
Truth
Hunger
Heat
Anger
Warmth
Strength
Death
Wisdom
483

Nmero 2 noviembre -2007

Ahora,mecentrarenaquellossufijosyprefijosparalacreacindeadjetivos.

1. Formacindeadjetivosapartirdeverbos:

Verbo
Read
Create
Success
Use
Excite

Sufijo
able/ible
ive
ful
less
ing

Adjectivo
Readable
Creative
Successful
Useless
Exciting

2. Formacindeadjetivosapartirdenombres:

Nombre
Nation
Origin
Danger
Pain
Peace
Politics
Luck
Hair
Child

Sufijo
al
ous
ful
less
ic/ical
y
ish

Adjectivo
National
Original
Dangerous
Painful
Peaceless
Political
Lucky
Hairy
Childish

Tambinexistendiferentesmanerasdeformarverbos.

1. Formacindeverbosapartirdeadjetivos:

Adjectivo
Modern

Sufijo
ise/ize

Short
Strong

en

Verbo
Modernise
Modernize
Shorten
Strengthen

2. Creacindeverbosapartirdenombres:
www.enfoqueseducativos.es

484

Nmero 2 noviembre -2007

Nombre
Electricity

Sufijo
ify

Verbo
Electrify

Todasestastablassonunpequeoresumendelossufijosmsrelevantesenla
formacindenuevaspalabras.
Sin embargo, hay otras posibilidades como es aadir prefijos para cambiar el
significado y por lo tanto crear palabras nuevas. Tambin usar una lista, para
organizarlosdistintosprefijos.

1. Palabrasconsignificadonegativo:

Palabra
Mature
Patient
Responsible
Legal
Comfortable
Similar
Assertive

Prefijo
In/Im
Ir
Il
Un
Dis
Non

Nuevapalabra
Immature
Impatient
Irresponsible
Illegal
Uncomfortable
Dissimilar
Nonassertive

Otrosprefijoscomunessonlossiguientes:

Palabra
Social
Biography
Wife
President
Skirt

Prefijo
Anti
Auto
Ex

Understand

Mis

Micro/mini

Nuevapalabra
Antisocial
Autobiography
Exwife
Expresident
Miniskirt
Microwave
Misunderstand

Todasestastablasnosmuestranlasposiblesformasdecrearnuevaspalabras
en ingls. Por un lado, podemos aadir o bien un prefijo o bien un sufijo y en otros
casostenemosquecambiarlaformacompletamente(formasirregulares).

www.enfoqueseducativos.es

485

Nmero 2 noviembre -2007


Bibliografa:

Greenbaum,S&Quirk,R(1990).AStudentsGrammaroftheEnglishLanguage.
London:Longman
Clark, R. (1991). Getting a Fix on Vocabulary, Using Words in the News: The
SystemofAffixationandCompoundinginEnglish.ProlinguaAssociates

www.enfoqueseducativos.es

486

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Estrelacionadoelniveldelalumnoconsuniveldelectura?

La lectura es uno de los puntos principales en el periodo educativo de los


alumnos. De ah que los profesores hagamos tanto hincapi en el hbito de lectura,
sobretodo,enlalecturacomprensiva.
Algunos alumnos tienen dificultades en su aprendizaje como consecuencia de
unnivelinferiorquedacomoresultadolacomprensinincorrectadeltexto.
Paraintentarsolucionardichoproblema,esimportantefomentarlalecturaen
las aulas adems de hacer un seguimiento del alumno tanto dentro como fuera del
centroeducativo.
Paraello,elprofesordebertenercomoobjetivolalecturadepequeostextos
diariamente para poder as no slo fomentar la lectura sino tambin solucionar los
problemasquepuedansurgircomoconsecuenciadelanocorrectacomprensindeun
texto.
Perocuandohablamosdelectura,abarcamosunampliogrupodetextoscomo
captulosdeunanovela,unartculodeperidico,uncomicounarevista.
Elobjetivoprincipaleshacerquelosalumnosleanyseenterendeaquelloque
leen,peroademstambinsepretendequeelalumnoseintereseyvayaadoptando
unaactitudmspositivahacialalectura.
Por lo tanto, podemos concluir diciendo que cuando hablamos de mejorar el
niveldelecturadenuestrosalumnos,noslohacemosreferenciaalacomprensindel
textosinotambinaldesarrollodeunaactitudpositivahaciasta.

www.enfoqueseducativos.es

487

Nmero 2 noviembre -2007


Bibliografa:

Gee, R.W. (1996). Reading/Writing Workshops for the ESL Classroom. TESOL
Journal,5/3:49
LuqueAgull,G.(2001).NarrandoHistorias.Jan:UniversidaddeJan

www.enfoqueseducativos.es

488

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Librosdetextoomaterialesdesarrollosporlosprofesores?

Ambas fuentes de trabajo son claramente vlidas en la enseanza. Aunque el


usodeloslibrosdetextoestmsextendidoenelcentroeducativo.

Actualmente los libros de texto son muy variados y ofrecen diversas


posibilidades de trabajo, teniendo en cuanta los intereses y gustos de los jvenes
estudiantes.

Sin embargo, la creacin y diseo de materiales educativos por parte de los


profesores ofrece muchas ms posibilidades de adaptacin a las necesidades de los
alumnos.

En el caso de la enseanza de idiomas, la creacin de materiales debe incluir


todo aquello que se considere esencial, como la integracin por igual de las cuatro
habilidades comunicativas (reading, writing, listening y speaking) o aspectos
relacionadosconlagramtica.

En el diseo y creacin de materiales es muy importante ser creativo y


dinmico en aquellas actividades que decidamos plantear a los alumnos, por lo que
debenserdiferentesyatractivasparalosalumnos.
Otro factor a tener en cuenta es los tipos de materiales que vamos a usar:
cartulinas, peridicos, objetos, etc. Algunos pueden ser directamente creados por
nosotrosyotrospuedensermodificadosapartirdeunmodelo.
Es importante tambin, saber adaptar dichos materiales, no slo a los
conceptos que vamos ensear, sino tambin a los diferentes alumnos que
encontramos dentro del aula. Por ejemplo, preparar materiales extras para alumnos

www.enfoqueseducativos.es

489

Nmero 2 noviembre -2007


que trabajen ms deprisa y adaptar los ya creados a aquellos que necesitan ms
tiempoparafinalizarlastareas.
Por lo tanto podemos concluir diciendo que lacreacin de materialessupone
uncambiodiferenteenlaactuacinenclase,ademsdeungiroalastpicasclasesen
lasqueloslibrosdetextosonelcentrodelaprendizajeylaenseanza.

Bibliografa:

Cunningworth, A. (1984). Evaluating and Selecting EFL Teaching Materials.


London:Heinemann
Skierso,A.(1991).TextbookSelectionandEvaluation.EnM.CelceMurcia(ed.)
Teaching English as a Second or Foreign Language. Boston: Heinle &
HeinlePublishers.432453

AnaMaraJaracesLaserna77347898W

Unametodologadinmica:TotalPhysicalResponse

Cuandohablamosdedichoconcepto,nosreferimosaaquellasaccionesquese
llevan a cabo mediante una respuesta fsica. De esta manera los alumnos aprenden
conceptosnuevosmediantelarealizacindemovimientossencillos.
Elusodeestatcnicaimplicalamejoradeaquellashabilidadescomunicativas
quepuedancausarmsproblemasanuestrosalumnos.Comoeselcasodel:listening.
Dicha metodologa est vinculada al hecho de realizar determinados
movimientos que han sido previamente dictados por el profesor. De esta manera se
puedecomprobarelnivelendichahabilidadcomunicativasinuestroalumnorealizao
nocorrectamenteelmovimiento.

www.enfoqueseducativos.es

490

Nmero 2 noviembre -2007


Estas actividades pueden ser muy variadas. Por ejemplo, el profesor puede
nombrar acciones que los alumnos deban realizar de manera escrita, dibujando o
simplemente sealando objetos cercanos. As que, mejorarn con respecto a uno de
los aspectos que los alumnos encuentran ms problemticos cuando aprenden una
lenguaextranjera.
Siguiendoestatcnica,nuestrosalumnosdesconectandelamaneratradicional
dellevaracabolasclases.
Tambin se sienten motivados si hacen correctamente lo que el profesor ha
descrito,asqueaprendenhacienda.
Para concluir, podemos decir que se trata de un medio diferente y eficaz de
hacerquenuestrosalumnosseinteresenporelidiomaademsdemejorarlahabilidad
comunicativaquelescausamsproblemas.

Bibliografa:

Asher, J. (1969). The Total Physical Response Approach to Second Language


Learning.ModernLanguageJournal26:317
Aristotelous,S.(1980).Dippitydoo.London:Longman

www.enfoqueseducativos.es

491

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Ventajasdelsilencioenclase

Uno de los principales objetivos de un profesor en clase es hacer que sus


alumnospermanezcanensilencio.Yestonoessiemprefcil.
Para ello, el profesor debe dejar claro cul es el papel que debern seguir
durantetodoelcurso;esdecir,elprofesordeberactuardeunamaneraylosalumnos
deotra.Teniendosiempreencuentalaideadequeelrolprincipallollevasiempreel
profesor.
Hay diferentes tcnicas que se pueden utilizar para hacer que los alumnos
estnensilencio.Porejemplo,sielprofesoracabadeentrarenlaclase,puedealzar
un poco la voz (nunca gritando) para hacer que los alumno se percaten de su
presencia.
Otradelaposibilidadesespermanecerensilenciohastaqueellosmismosean
consientesdequelaactituddecharlanoeslaapropiadaparadesarrollarunaclase.
Otra opcin es dejar claro desde el primer da cules son las normas de
convivenciayrespetoenlaasignaturadeingls.Entreellaspodemosincluirelestaren
silenciounavezelprofesorseencuentredentrodelaula.
Adems de estas tcnicas, tambin podemos nombrar a un encargado de
silenciaralosdemsestudiantescuandocomienzalaclase.Astambinimplicamosal
alumno de manera directa en las tareas y normas que se deben respetar dentro del
centro educativo. Todas las semanas sera conveniente cambiar a dicho encargado
parafomentarlaempataentreellosmismos;esdecir,quesedencuentadeltrabajo
quesuponeconseguirquetuscompaerosestncalladoscuandoseanecesario.
Otra alternativa puede ser la de realizar juegos cortos con los que hacer que
guardensilenciodemaneraprogresiva.
www.enfoqueseducativos.es

492

Nmero 2 noviembre -2007


Comoconclusin,podemosdecirquehayunaampliavariedaddetcnicasque
sonfcilmenteaplicablesparaconseguirsilencioenelaula,ademsdeserdiferentes
tantoparaelprofesorcomoparaelalumno.

Bibliografa:

Lewis, G & G. Bedson. (1999). Games for Children. Oxford: Oxford University
Press
Ur, P. & Wright, A. (1993). Five Minute Activities. Cambridge: Cambridge
UniversityPress

www.enfoqueseducativos.es

493

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Posiblesventajasdelusodematerialesreales

Hayinfinidaddetcnicasparaleenseanzadelalenguaextranjera.Podemos
utilizarlosmaterialesrealesparaacercarnoslolalenguasinotambinlaculturade
ese determinado pas a nuestros alumnos. Tambin supone el aprendizaje mediante
unamaneramsdinmicayporsupuestodiferentealasclasestericas.
Para centrarnos ms concretamente en lo que entendemos por materiales
reales, podemos mencionar los peridicos, las canciones, las pelculas, posters o
radios.
Algunasdelasventajasdelusodematerialesrealesson:

Losalumnosaprendeninglsdeunamaneramsreal
Losalumnossefamiliarizanconlascostumbresdeotrasculturas
Acercamosalosalumnosasituacionesdelavidareal
Suponeuncambioderutina
Pocoapocolosalumnossesientenmsconfiadoparaexpresarseenla
lenguaextranjera

Conestametodologa,podemosadaptarelniveldeinglsanuestrosalumnos
mediante el material que se utilice en clase. As que podemos concluir diciendo que
estatcnicasepuedellevaracabocontodoslosniveleseducativos.
Con los niveles bsicos, podemos trabajar con mens de restaurantes para
repasarvocabulariorelacionadoconlacomida.Loshorariosescolarestambinsonun
recurso para aprender vocabulario del colegio, como son las asignaturas, los
elementosdelaclase,etc.

www.enfoqueseducativos.es

494

Nmero 2 noviembre -2007


En niveles medios, podemos usar la radio o las pelculas para acercar la
pronunciacin a los alumnos de manera que puedan obtener un feedback directo y
correctodelidioma.
Finalmente,conlosnivelessuperiores,podemosutilizarfolletosparaaprender
vocabulario mucho ms especfico relacionado, por ejemplo, con el mundo de la
publicidad,internet,etc.
El objetivo principal es usar los materiales reales para que los alumnos se
motivenenelaprendizajedeunanuevalenguaademsdesuscostumbres.Ademsde
suponeruncambioparalastpicasclasestericas.

Bibliografa:

Grundy,P.(1994).Newspapers.Oxford:OxfordUniversityPress.
Ur,P.(1999).ACourseinLanguageTeaching:PracticeandTheory.Cambridge
UniversityPress.

www.enfoqueseducativos.es

495

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Qu actividades pueden hacer los alumnos para mantener su nivel de ingls


duranteelverano?

Esnotableelbajoniveldeinglsconelquealgunosalumnoslleganaclasetras
losmesesdevacacionesestivales.
Para la mejora o simplemente el mantenimiento del nivel obtenido durante
todo el curso, sera recomendable por parte del profesor proponer determinadas
actividadesenlasquelosalumnospuedanmantenerdichonivel.
Algunasdelasactividadesquepodemosllevaracaboson:
Escucharmsicaeningls
Verpelculasenversinoriginal
Proveerunalistadepginaswebenlasquerealizarejerciciosdetodo
tipo
DesarrollarunpequeoProjectworksobrelasvacaciones
Visitarotrospases(alumnosdebachillerato)
Atender a actividades organizadas en las que el ingls forme parte de
ellas

As que, lo que se pretende con el fomento del ingls durante los meses de
veranoesquenuestrosalumnosenlamedidadeloposibleseancapacesderecordar
lo que se estudi en el curso anterior y tengan una buena base para el curso que
comienza.Ademsdehacerlesentenderlaimportanciadehablarunsegundoidiomay
las ventajas que conlleva. Puesto que cuando se aprende un idioma no slo es
importante el nivel gramatical o de vocabulario sino tambin el cultural; es decir, lo
quelosalumnosaprendenacercadelaculturaycostumbresdelpasextranjero.

www.enfoqueseducativos.es

496

Nmero 2 noviembre -2007


Porlotanto,desdeelcentroeducativosetienequefomentarelusodelingls
con respecto a la mejora del nivel lingstico y cultural. Y para ello, tenemos que
orientaranuestroseneltipodeactividadesquepuedenrealizarduranteelverano.

Bibliografa:

Stevick,E.(1980).AWayandWays.Heinle&Heinle
Willis, J. (1997). Taskbased Learning: Designing and Using Tasks. Greta, 5/2:
1318

www.enfoqueseducativos.es

497

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

ColegiosBilinges:Unaposibilidadreal

Aligualqueexistenloscentrosdedicadosalastecnologasdelainformaciny
la comunicacin (centros TIC), encontramos los centros bilinges tanto en francs
comoeningls.
Dichos colegios se centran en aspectos vigentes y esenciales de nuestra
sociedadcomohablarunasegundalenguaocmotrabajarconunordenador.
Muchomscomplejoresultalacomprensindelaimportanciadeunasegunda
lengua,deahqueseconcibanloscentrosbilingescomolugaresenlosqueseofrece
la posibilidad de aprender ms all de los conceptos y procedimientos de otras
asignaturas,comoesaprenderloseningls.
Peroparaqueloscentrosbilingesseanconsideradosunaoportunidadreal,el
profesoradoyelmismocentrodebenestarpreparados.
Con respecto a los profesores, decir que deben acudir a academias y cursos
especializados en los que actualizar su nivel de ingls para adecuarlo al grado de los
alumnosyaaquellasasignaturasquetenganqueensear.
Loscentrosdebendisponerdelosmediosnecesariosparapoderhacerposible
la enseanza de otras asignaturas como matemticas o educacin fsica en ingls o
francs. Aqu tenemos destacar recursos materiales como ordenadores, proyectores,
Dvd, casetes, etc. que hagan posible la utilizacin del idioma en el aula de manera
moderna e innovadora. Ya que ese es el objetivo comn y principal en los centros
bilinges.
Concluyendoconelartculo,podemosdecirqueloscentrosbilingesrequieren
unaampliacapacidaddetrabajoyaquedebehabercoordinacinentrelosprofesores,
www.enfoqueseducativos.es

498

Nmero 2 noviembre -2007


ademsdemediosquehaganmssencillolacomprensinyentendimientodelidioma
tantoaprofesorescomoaalumnosquesonlosverdaderosbeneficiariosdeestanueva
concepcindecentroseducativos.
Bibliografa:

Chun, D. (1994). Using Computer Networking to Facilitate the Acquisition of


InteractiveCompetence.System,22:1731
LEA:Ley17/2007de10deDiciembre.Artculo58

www.enfoqueseducativos.es

499

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Cursosonlineparaprofesores

Los cursos online para profesores son bastante tiles ya que con ellos se
aprendenconceptosnuevosquesonimportantesparalarenovacindelconocimiento
delprofesorado.
Porunlado,conellos,obtenemosconocimientoqueservirparapoderadaptar
nuestras metodologas, proponer nuevos tipos de ejercicios, aprender tcnicas para
resolver problemas etc. La formacin que ofrecen es bastante amplia y cubre la
mayora de las necesidades que podamos tener con respecto a nuestra formacin
comodocentes.Podemosdestacar,laresolucindeconflictos,innovacindidcticade
nuestrametodologa,nuevastecnologas,etc.
Adems suelen estar muy bien organizados ya que puedes tener contacto
permanente con los organizadores y dems responsables del curso mediante va
telefnica,email,otutoraspersonalesmedianteforos.
Larealizacindedichoscursostiendeaserbastantediferente,yaquenotodos
se completan de la misma manera. Encontramos cursos en los que se tienen que
rellenar un cuestionario obteniendo las respuestas a partir de un temario en el que
parece dicha informacin. En otros, tienes que realizar trabajos en los que deben
aparecer apartados concretos, o realizar posibles actividades que llevaramos a cabo
ennuestrasaulas.
Ademsdelaformacintanampliaqueofrecen,loscursossontambintiles
parapoderconseguirpuntosnecesariosenelbaremodelosmritospersonalesdelas
oposiciones.Tambinsontilesparalosconcursosdetraslados,etc.

www.enfoqueseducativos.es

500

Nmero 2 noviembre -2007


Por lo tanto, podemos concluir diciendo que obtenemos beneficio doble al
realizar estos cursos, por un lado la ampliacin de nuestro conocimiento y por otro
lado, la obtencin de puntos para nuestro baremo tanto en oposiciones como en
traslados.

Bibliografa:

www.campusdocente.com
www.ced.juntaandalucia.es

www.enfoqueseducativos.es

501

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Porqulosprofesoresnoseimplicanenlasexcursionesdesusalumnos?

La visita a determinados lugares de inters por parte de los alumnos de un


centroeducativoesunarealidadvigentedesdehacemuchsimosaos.
Sinembargo,ladisposicindelosprofesoresparaserlaguaylosencargados
de estos grupos de alumnos no es siempre la misma; es decir, que no todos los
profesoresestndispuestosaacompaarasusalumnosadichasexcursiones.
Entrelasrazonesquepodemosdestacar,nosencontramoslassiguientes:
Laedaddelosalumnos,yaquelosmspequeostiendenaestarms
despistadosyporlotantopodranperderse
Sehacebastantedifcilcontrolaraungrupoampliodealumnos
El lugar que se visite puede suponer tambin un problema ya que en
algunos casos los estudiantes tienen que adoptar ciertas
responsabilidadesquenosiempretienenencuenta
Pero estos no son los nicos motivos por los que algunos profesores no
acompaanasusalumnos.
Tambin hay que destacar la coordinacin y organizacin de la actividad. Por
normageneral,losprofesoressonlosencargadosdecontactarconloslugaresavisitar,
elmediodetransportequesevaautilizarydeterminarelpreciototaldelaactividad.
Yestosuponeunagrandedicacindetiempoquenosiempreseverecompensada,ya
queunavezquetodoestorganizado,elniveldeparticipacindelosalumnosnoes
tanelevadocomoseesperaba.
Por lo tanto, los profesores no estn siempre dispuestos a organizar y,
sobretodo,acoordinarunaexcursinsinohayunnivelelevadodeparticipacinysi
losalumnosnosecomprometenaadoptarresponsabilidadesconrespectoallugarque
sevisite.
www.enfoqueseducativos.es

502

Nmero 2 noviembre -2007


Como conclusin, podemos decir que para la correcta coordinacin y
organizacin de una excursin, tenemos que hacer partcipes a nuestros alumnos
implicndolos en el proceso de organizacin, y por otro lado, hacerles entender la
importanciadeserresponsablescuandosevisitaunlugardiferente.

Bibliografa:

Madrid, D & N. McLaren. (1995). Didactic Procedures for TEFL. Valladolid: La


Calesa.
McKay, H & A. Tom. (1999) Teaching Adult Second Language Learners.
Cambridge:CambridgeUniversityPress.

www.enfoqueseducativos.es

503

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

PreparacindeOposiciones:tcnicasparanoestresarse

La preparacin de las oposiciones conlleva una amplia carga de trabajo. Hay


queestudiar,enelcaso,delaramadeingls,69temasrelacionadoscongramtica,
didctica,cultura,literatura,poltica,etc.
Tenemos que preparar, al igual que en todas las especialidades, una
programacin anual con sus unidades didcticas correspondientes. En la preparacin
de los materiales se dedica la mayor parte de nuestro tiempo, ya que tenemos que
pensarculessonlasactividadesmsatractivas,tenemosquedisearlasyfinalmente
decidirqulugarvanaocupar.
Alavezqueestudiamoslostemasydiseamoslaprogramacintenemosque
realizaralgunoscursosycompletarasnuestrobaremo.
De ah que sea un factor importantsimo estar bien organizado. Para poder
conseguirunabuenaorganizacindebemosseguirlassiguientespautas:

Estudiar todos los das de manera que progresivamente vayamos


asimilandoconceptos
Realizar cursos con facilidades de horario o bien online que permiten
unarealizacinabiertayflexible
Disear la programacin poco a poco para poder incluir cosas nuevas
cambiarotrasquenonosgusten,etc.
Pedirayuda,silonecesitamos,apersonasdenuestroalrededorparala
creacindelosmaterialesdidcticos,porejemplo.
Tenerunaactitudpositivaanteestanuevaetapaenlaqueampliaremos
nuestracapacidaddetrabajo.

www.enfoqueseducativos.es

504

Nmero 2 noviembre -2007


Estas son algunas de las tcnicas que recomiendo a aquellas personas que
como yo, este ao 2008 estn preparando sus oposiciones para poder trabajar en
aquelloquerealmentelesgusta.
Asquedesdeaqumuchonimoyatrabajar!

Bibliografa:

Stevick, E. W. (1990). Humanism in Language Teaching. Oxford: Oxford University


Press

www.enfoqueseducativos.es

505

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Quesmejor:serunbuenprofesorotenerunabuenaprogramacin?

Mi respuesta a esta pregunta sera que ambas son esenciales. Es decir, que
podemostenerunaprogramacinbrillanteynosabertransmitirlaanuestrosalumnos
otenerunaprogramacinmsbsicaygraciasanuestravocacinpoderexplotarlaal
mximoyhacerquenuestrosalumnosaprendandivirtindose.
Con esto quiero decir que aunque en muchos casos podamos tener una
programacinactualizadaoinnovadora,sisomosincapacesdeacercrselaanuestros
alumnos, sta se convertir en un hndicap para nuestras clases. Y por otro lado no
seremos capaces de hacer que nuestros alumnos consigan aquellos objetivos que
previamentehemosplasmadoendichaprogramacin.
Porelcontrario,sisomosprofesoresbrillantes,aunquenuestraprogramacin
pueda ser menos innovadora e incluso aburrida, siempre estaremos a tiempo de
cambiar aquellos aspectos que no nos gusten y adaptarlos a las necesidades e
interesesdenuestrosalumnos.Consiguiendodespertarassuintersenelaprendizaje
delalenguaextranjera.
Pero no siempre falla uno de estos mecanismos, es decir que hay profesores
competentesconprogramacionesbrillantesqueconsiguenunnivelelevadsimoenla
comprensindelidiomagraciasqueseunenestosdoscomponentes.
Por lo tanto podemos concluir diciendo que tenemos que superarnos a
nosotrosmismosconrespectoanuestraformacincomoprofesoresycomono,tener
claroslospuntosprincipalesquedebemosincluirennuestraprogramacinparahacer
de ella una herramienta de uso diario que nos va a permitir sacar todas nuestras
caractersticascomoprofesores.

www.enfoqueseducativos.es

506

Nmero 2 noviembre -2007


Bibliografa:
Revell,J&S.Norman.(1997).InYourHands.London:SaffirePress
Doff,A.(1988).TeachEnglish.ATrainingCourseforTeachers.Cambridge:C.U.P

www.enfoqueseducativos.es

507

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Sugerenciasparamejorarlascondicionesdetrabajodelosprofesores

En este artculo propondr algunas ideas para la mejora de la condiciones de


trabajodelosprofesores.
Continuamentesehabladelacercamientodelasnuevastecnologasanuestros
alumnos,sinembargo,estonoesposibleentodosloscentroseducativosquenosean
centrosTIC.YaquenoessiemprefcilprepararunpresentacinPowerPointsinose
tienenlosmediosnecesariosparapoderensearlaanuestrosalumnos.
Peronosloseencuentranproblemasparaacercarlasnuevastecnologas.En
muchoscasos,esdifcilpoderrealizaractividadesdiferentessinlosmediosadecuados,
comoverunapelculaobuscarinformacinenInternet.
Deahqueenmuchoscasos,losprofesoresrealicenactividadessiempreenla
mismalnea.Esbastantecomplejoserinnovadoressinohayrecursosdiversos.
Comovemos,dondemsdificultadespodemosencontraresenlaintegracin
de las nuevas tecnologas, pero progresivamente y cada vez ms rpido se est
produciendo un cambio notable en dicho campo. Por lo que podremos integrar las
nuevastecnologasenclasesuponiendoestounamejoradelascondicionesdetrabajo
nosolamenteparaelprofesorsinotambinparalosalumnos.
Tambin podemos mencionar las propuestas que aparecen reflejadas en las
LEA, con respecto a los contratos que se pueden obtener mediante el consenso de
profesores,alumnosypadresdealumnos.Medianteestoscontratos,lastrespartesse
comprometen al cumplimiento de diferentes premisas como reuniones continuas
entre padres y profesores o participacin de los padres en la vida educativa de sus
hijos.

www.enfoqueseducativos.es

508

Nmero 2 noviembre -2007


Graciasalafirmadedichoscontratossellegaaunconsensoentrealumnosy
profesores,permitiendounarelacinmsmaduraysosegadaentreambaspartes.
Con esta nueva innovacin se pretende que tanto profesores como alumnos
encuentren en el centro educativo un lugar en el que acerar posiciones. Y de una
maneradiferenteseobtienenmejorasenlavidaeducativa.

Bibliografa:

LOE2/2006de3deMayo
LEA:Ley17/2007de10deDiciembre.CaptuloII:Artculos31y32

www.enfoqueseducativos.es

509

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

SimeofrecieranuntrabajocomoprofesoraenotropasdeEuropa,Loaceptarao
no?

Si me ofrecieran un puesto de trabajo como profesora en el extranjero,


probablemente lo aceptara ya que supondra una ventaja para la ampliacin de mi
conocimiento,nosolamenteconrespetoalnivellingsticosinotambincultural.
Supone un cambio en las costumbres, adaptarse a la nueva cultura del pas y
conocerlosmodosdevidaqueexistenmsalldelnuestro.
Porotrolado,tambinconoceraaalumnosconcaractersticasdiferentesalos
alumnosespaoles.Loquetambinmeharairadaptndomealosdistintostiposde
estudiantesquepodemosencontrarenunaula.
Mefamiliarizaraconotrossistemaseducativos,cmofuncionan,cmosonlas
leyes que regulan dichos sistemas o cmo se trata el tema de la educacin desde la
esferapoltica.
Tambin podra importar metodologas innovadoras para utilizar en clase y
hacermssencilloelaprendizajedeunasegundalenguaalosalumnosenmipasde
origen.
Delmismomodo,tambinpodrainformarmedelosprogramasdeintercambio
existentesparahacerposiblealosalumnosdeambospasesconocerdistintasculturas
eidiomas.
Concluyendodichoartculo,puedodecirquenotendraningninconveniente
en aceptar un trabajo como profesora en el extranjero ya que creo que sera
beneficioso para mi formacin no slo como profesora sino tambin como persona.

www.enfoqueseducativos.es

510

Nmero 2 noviembre -2007


Obtendra una amplia mejora en mi nivel lingstico y cultural adems de conocer
otrospasesqueformanpartedeEuropa.

Bibliografa:
www.netlanguage.com
www.englishnow.co.uk

www.enfoqueseducativos.es

511

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Cmopodemoshacerdelosprogramasdetelevisinunrecursodidctico?

Actualmente en clase podemos usar una gran cantidad de recursos que


permiten el aprendizaje de una segunda lengua rpidamente. Entre ellos, podemos
mencionarpginasweb,Dvds,msica,etc.
Perootrorecursoposibleeslatelevisinynosiemprelastpicaspelculascon
las que los alumnos escriben, entre otras actividades, los posibles dilogos entre
actores.
Podemos explotar el recurso de la televisin mediante los programas,
documentales, noticias, etc. Hay diferentes tipos de actividades que podemos
desarrollarconlosprogramasdetelevisin.Entreellas:
Losalumnospuedeninventarposiblesnoticiasqueluegodoblarncon
unprogramapreviamentegrabado.
Puedenhacerloscomentariosdealgndocumentaldeanimales
Hacer debates sobre algunos de los temas que se tratan en los
programasactuales
Retransmitirunpartidodeftbol
Hacerunprogramadecocina

La televisin como recurso didctico es un elemento muy til, ya que como


vemos, podemos hacer infinidad de actividades. Todas ellas diferentes. Ya que no
solamente se incluyen aquellas relacionadas con el debate de ciertos temas, sino
tambinconlagrabacindeprogramasporpartedelosalumnosparasimularlosque
realmentetelevisan.
Mediante la realizacin de este tipo de actividades desarrollamos no slo un
conocimiento amplio de vocabulario, gramtica y dems en nuestros alumnos, sino
www.enfoqueseducativos.es

512

Nmero 2 noviembre -2007


tambinqueseancrticosconaquelloquevenporlatelevisinyconloquenoestn
deacuerdo.Porlotantonoslosemejoralasegundalengua,sinoquesedespiertala
responsabilidadyactitudcrticaennuestrosalumnos.

Bibliografa:
Doff,A.(1988).TeachEnglish.ATrainingCourseforTeachers.Cambridge:C.U.P
Campell, C & H. Kryszewska. (1987). Learner Based Teaching. Oxford: Oxford
UniversityPress.

www.enfoqueseducativos.es

513

Nmero 2 noviembre -2007

AnaMaraJaracesLaserna77347898W

Ventajadelosejerciciosonline

Haydiferentesrazonesporlasquepodemosdestacarquelosejerciciosonline
tienenmsventajasquelosejerciciosqueserealizandemaneraescrita.Algunasson:
Losalumnosestnbastantefamiliarizadosconelusodelordenador
Existen infinidad de pginas web que se pueden utilizar para buscar la
respuestaalaspreguntas
Losalumnosnotienenqueescribirdelamaneratradicional
Setratadeunamaneradistintadetrabajarenclase
Seacercaelusodelastecnologasdelainformacinylacomunicacina
losalumnos
Losejerciciossepuedenpresentardemaneramsvisualyatractiva
Los alumnos se motivan ms ya que supone una forma diferente de
trabajar

Ademsactualmente,unodelosobjetivoseneducacineshacerquenuestros
alumnosdesarrollenciertacompetenciaenelusodelasnuevastecnologas,porloque
proponerlarealizacindeejerciciosyotrotipodeactividadesestilparaconseguirlo.
Los profesores tienen tambin una gran diversidad de recursos, ya que en
Internetsepuedenencontrarprogramasgratuitosparadescargaryprepararejercicios
innovadoresydivertidosalosalumnos.
Otra posibilidad es la de crear ejercicios mediante los recursos de los que ya
disponemos,comosonlaspresentacionesPowerPointoelusodelMovieMaker.
Podemosconcluirdiciendoquelosejerciciosonlinesuponenuncambioenel
procederennuestrasclases.Ademsdeintroducirdiversinyuncambioderumboen
www.enfoqueseducativos.es

514

Nmero 2 noviembre -2007


comparacin a las tradicionales lecciones en los que los alumnos responden a sus
ejerciciosenelcuaderno.

Bibliografa:
Rozas,M.(1999).InternetyLasLenguasExtranjeras.Bosco,284:2432
LeyOrgnicadeEducacin(LOE)2/2006de3deMayo

www.enfoqueseducativos.es

515

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x
Eldesempeodelaformacindocente

Enelsiguienteartculoanalizarlosimportantescambiosquesehadadoenla
formacindocenteyculessonlascausasqueloshanprovocado.

La sociedad es un ente complejo donde se interrelacionan los diferentes


sistemas(educativo,poltico,jurdico.)loscualesestnsiempreencontinuocambio.
El sistema educativo cambia a la vez que lo hacen el resto de sistemas ya que el
principal objetivo de laeducacin es ofrecer las herramientas necesarias para queel
alumnopuedaenfrentarsealasnecesidadesdelasociedaddondesedesenvuelve.Los
continuos cambios sociales y polticos han provocado que por el sistema educativo
espaol pasen diferentes leyes de educacin (LGE, LOCE, LODE, LOGSE, LOE). Todas
estasleyeshanafectadodemaneradirectaalaformacindelprofesoradoenEspaa.

Laformacindeldocentejuegaunpapelclaveenelprocesoeducativoyaque
dependiendodeltipodeformacinquehayarecibidoeldocentesercapazdedarun
tipodeenseanzauotra.Unadelasdificultadesdetodainnovacineslaformacin
del profesorado. Debemos tener en cuenta que cada profesor posee sus propios
interesesprofesionalesyesosinteresesnotienenporqucoincidirconlosdelagente
quepretendeunarenovacineducativaaunquebienesciertoquetodoslosdocentes
debenaceptarlasreformaseducativasyaplicarlasensuclase.

Conlaintroduccindelaescuelainclusivaenelsistemaeducativoespaol,y
especficamentelaformacindocentehantenidoqueadaptarsealasnecesidadesde
todoslosalumnos,algunosdestosconnecesidadeseducativasespeciales.Portanto
serequiereunaformacinmuchomscompletadelprofesorado.

"Cuando hablamos del profesor nos estamos refiriendo a alguien que se


sumerge en el complejo mundo del aula para comprenderla de forma crtica y vital,
implicndose afectiva y cognitivamente en los intercambios inciertos, analizando los
mensajesyredesdeinteraccin,cuestionandosuspropiascreenciasyplanteamientos
proponiendo y experimentando alternativas y participando en la reconstruccin
permanentedelarealidadescolar".Schn(1992)

Con la llegada de la escuela inclusiva la mayora de los profesores tienen que


recurriraunaformacinmuchomscompletaycualificadaquelatradicionalyaquela
diversidad se est convirtiendo en un fenmeno cotidiando al que los docenetes
debenhacerfrente.Portanto,suformacindebeestarcadavezmsencaminadaal
continuocambioyadaptacin.

Bibliografia
www.enfoqueseducativos.es

516

Nmero 2 noviembre -2007

Angulo Rasco, J.F. Barquin Ruiz J.; Prez Gmez, A.; (1999) Desarrollo
profesionaldeldocentepoltica,investigacinyprctica.Akal,Espaa.(Editores

Ausubel, David; Novak, Joseph y Hanesian, Helen (1983) Psicologa educativa.


Trillas,Mxico

BarrnTirado,Concepcin.(2000)Laeducacinbasadaencompetenciasenel
marco de los procesos de globalizacin en: Mara de los Angeles Valle Flores
(Coord.) Formacin en competencias y certificacin profesional, UNAM,
Mxico.

Berger, Peter L. y Luckmann Thomas. (1998) La construccin social de la


realidad.Amorrortu,1ed.1968,15reimpresin.BuenosAires.
Schn, Donald 1992 La formacin de profesionales reflexivos. Hacia un nuevo
diseodelaenseanzayelaprendizajeenlasprofesiones.Paids.Barcelona.

www.enfoqueseducativos.es

517

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x

Formasparaimplementarlaevaluacin.

Laevaluacinhaestadoconsideradadurantemuchotiempocomolapartems
importante del proceso educativo enseanza aprendizaje. Se consideraba como el
producto final del alumno. Ah se evaluaban principalmente los contenidos que el
alumnohabaadquiridoaunquenoseprestabaatencinalprocesomedianteelcual
los alumnos llegaban a ese producto final. Podramos decir que se trataba de una
evaluacin final donde se consideraba la valoracin del trabajo mediante una cifra
numricaqueoscilabanormalmenteentreel0yel10.Enlaactualidad,elconceptode
evaluacinhacambiadoconsiderablemente.

Enlaactualidadelconceptodeevaluacindebeserconsideradoenunmbito
muchomsamplio.Seconsideracomounadelaspartesqueconfiguranelcurrculum
delosalumnosenlosqueademsdelaevaluacinencontramoscontenidos,objetivos
ymetodologaentreotros.

Elcambiodelaescuelasellevacaboprecisamenteporlallegadamasivade
alumnos con necesidades educativas especiales, donde se consideraba injusto el
procesodeevaluacin.

ConlaintroduccindelaLOGSEylaLOE,laevaluacinseconsolidacomoun
proceso continuo en el cual el profesor mide el progreso del alumno teniendo en
cuentaunaseriedepautasaseguir.Enestenuevomodelodeevaluacinsetienenen
cuenta las caractersticas individuales de nuestros alumnos y se adapta a las
necesidadesdecadauno.

Evaluarsignificavalorarlosresultadosdeunaaccin.Enelcasodelaaccin

www.enfoqueseducativos.es

518

Nmero 2 noviembre -2007


educativa se evala lo que los alumnos han aprendido (resultados del aprendizaje) y
las actividades que se realizan para que aprendan (actividades de enseanza y
aprendizaje).

Evaluar,esportanto"unactodevalorarunarealidad,queformapartedeun
procesocuyosmomentospreviossonlosdefijacindecaractersticasdelarealidada
valorar,yderecogidadeinformacinsobrelasmismas,ycuyasetapasposterioresson
lainformacinylatomadedecisionesenfuncindeljuicioemitido"(PrezyGarca,
1989:23).

Bibliografa

Castillo, Santiago, Notas del Curso: Evaluacin Educativa y Promocin Escolar.


Xalapa,Ver.,mayo1995.
Lafourcade, Pedro D. Evaluacin de los Aprendizajes. Editorial Kapelusz, S.A.
BuenosAires,1973.
Prez Juste, Ramn; Garca Ramos, Jos Manuel. Diagnstico, Evaluacin y
tomadedecisiones.Serie:Tratadodeeducacinpersonalizada.EdicionesRialp,
S.A.,Madrid,1989.

www.enfoqueseducativos.es

519

Nmero 2 noviembre -2007

LuisaSutilAlcala77347423x
Importanciadelasnuevastecnologasenlaprcticadocente

En una sociedad de la informacin y la comunicacin, la prctica totalidad de

los campos profesionales han visto incrementado su potencial de desarrollo con la


incorporacindelasNuevasTecnologasyellohamotivadouncambiosustancialenel
mododeejercersusfuncionesespecficas.Estasituacinllevacomocontrapartidala
demandaimplcitadenuevospapelesparaeldesempeoprofesional.

Enelcasoconcretodelaeducacin,alolargodeestosltimosaossehabla

muchodelnuevoperfildeldocentecomoconsecuenciadelaintegracindelasNuevas
Tecnologasenelmbitoeducativo.

El primero es un papel tcnico, que permite identificar a los docentes como

expertos habilitados para guiar el aprendizaje de los alumnos conforme a


determinadas reglas metdicas de reconocida solvencia. Este papel ha ido
incorporando algunas funciones que desbordan la docencia clsica, como las
relacionadasconlatutora,lagestindidcticaylainnovacin.Suidentidadsedefine
porunatareadeclaromatiztecnolgicosegnlacualelprofesorserauningenierode
lainstruccin.

Elsegundopapelseasociaalosaspectosticosysocializadoresdelaprofesin.

Eldocentehasido,esyser,unagentedeprimerordenenelprocesodesocializacin
metdica de los menores en el tejido social. Los valores, actitudes y otras pautas de
conductaqueexhibeovehiculaconstituyenunmarcodereferencianormativoparalas
personas en formacin. Por otra parte, como juez evaluador, el docente desempea
una funcin fundamental de control social, al legitimar travs del sistema de
exmenes, e influye en las estrategias de reproduccin, movilidad, igualitarismo y
compensacin..
Bibliografa:
www.enfoqueseducativos.es

520

Nmero 2 noviembre -2007


BRUNNER, Jos Joaqun, Globalizacin cultural y posmodernidad. Fondo de
CulturaEconmica,Santiago,1999.

CASTELLS, Manuel, La era de la informacin. Economa, sociedad y cultura.


Volumen1,Lasociedadred.AlianzaEditorial,Madrid,1997,590pp.

GIDDENS, Anthony, Un mundo desbocado. Los efectos de la globalizacin en


nuestrasvidas.Taurus,Barcelona,2000.

www.enfoqueseducativos.es

521

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x
ElactualsistemadeseleccindeprofesoradoenEspaa.

Enesteartculosereflexionasobreelprocesodeseleccindelosprofesores
funcionarios espaoles y la necesidad de su mejora, dada la arbitrariedad que se ha
experimentadoenlosltimosenlasoposicionesaprofesoresfuncionarios.

Elsistemaeducativoespaolsehallaenconstantereformadesdehace25aos

(LOECE primero, luego LODE, LOGSE, LOPEG, LOCE y LOE.). Peridicamente se


cuestionalavalidezdelsistemadeoposicionesalcuerpodedocentesdelasociedad
espaolayaqueseconsideraqueesunsistemauntantoarbitrarioyavecesinjusto.
Consideraremosestesistemacomoinjustoyaqueesunsistemadeseleccinqueno
partedelasmismasbasesparatodoslosopositores.

Por un lado debemos considerar aquellos opositores que se enfrentan a una

oposicinsintenerningunaexperienciadocentepreviayporotrodebemosconsiderar
aquellosquetienenexperienciadocenteyseencuentrandentrodelsistemaeducativo
espaol ejerciendo como docentes aunque no tenga su plaza definitiva No podemos
considerarqueambosgruposseencuentrenantelamismavariedaddeposibilidades.

Sianalizamoselsistemadeoposicin,nosdamoscuentaquelosopositoresque

seencuentrendentrodelsistemaeducativotienenmuchasmsventajasqueaquellos
queseenfrentenalaoposicinporprimeravez,yaquelosopositoresnoseenfrentan
aunsistemadeoposicinsinoaunsistemadeconcursooposicin.

Los nuevos opositores deben hacer frente a la experiencia de estos otros

opositoresenlamedidadeloposibleyaquealtratarsedeconcursooposicinnose
tieneencuentasoloelexamensinoqueademslosmritosobtenidos.Lanicaforma
que los nuevos opositores tienen para conseguir puntuacin extra es mediante la
realizacindecursosonlineylapublicacindeartculosenalgunarevistadigital,ano
www.enfoqueseducativos.es

522

Nmero 2 noviembre -2007


serqueestosnuevosopositoresdispongandeotrasegundatitulacinbaremableenla
escalademritos.

En definitiva, considero el sistema de seleccin de profesorado como un

sistemaarbitrarioquedeberaserreplanteadoconsiderablementeporelMinisteriode
Educacin.
Bibliografa:

LOE2/2006(LeyOrgnicadeEducacin).

CASTELLS, Manuel, La era de la informacin. Economa, sociedad y cultura.


Volumen1,Lasociedadred.AlianzaEditorial,Madrid,1997,590pp.

www.enfoqueseducativos.es

523

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x
Lasventajasdeloscursosonlineconrespectoaloscursospresenciales.

Las ventajas de los cursos a distancia online son mltiples, ya que al


estaronlineestamosencontactoconunsloclickderatn.Unadelasventajas
es que los alumnos pueden elegir libremente los horarios de estudio y los
contenidos de trabajo. Los cursos online pueden ser interrumpidos para
retomarlosdespusenotromomentomsoportuno.

TodaslasventajasdeInternetsesumanaloscursosOnlineadistancia.
Las matrculas estn abiertas todo el ao y ya no se reciben ms noticias
molestasdequenopodemosrealizarelcursoelegidoobienporquesesuprime
al no haber un nmero mnimo de alumnos o que no podemos ser admitidos
porque el grupo est completo. Las clases de estos cursos Online basados en
Internetestimulanlaparticipacinactivadetodos.

Lagranventajadeestoscursosadistanciaonlinenoestsoloenquese
pueden disponer de todos los contenidos Online sino que estos contenidos
tambinestndeformatotalmenteinteractiva.Todoslosexmenesyejercicios
sontotalmenteinteractivosyestndiseadosparaquesirvanmsparaensear
queparaevaluar.

Cuando un alumno hace un ejercicio de los cursos online, el ordenador


encadainstantenosloledicecmoloharealizadosinoqueleproporcionaun
feedbackconstantecomentndoleelporqudesurespuesta.Ademsestetipo
decursosdisponendeunaseriedetutoriales(vdeosguiadosparalosalumnos)
parafacilitarelaprendizaje.

Adems,estoscursosadistanciaonlinesonflexibles,cadaalumnopuedeseguir
el ritmo de trabajo que ms le convenga con la nica limitacin de que ha de tener
completadaslasprcticasenlafechaquesedcomofinaldelcurso.
Bibliografa:

ForodeFormacinyEdiciones,SL:MemoriadecursosAFCAPao2002dela
FSPUGT.www.forodeformacion.net
INAP (Instituto Nacional deAdministracin Pblica): III Acuerdo de Formacin
ContinuaenlasAdministracionesPblicas,20012004.INAP2001Madrid.
Jimnez Villarejo, Carlos: entrevista el 20 de julio de 2003 en El Periodico
Extremadura.Cceres2003.

www.enfoqueseducativos.es

524

Nmero 2 noviembre -2007


MAP(MinisteriodeAdministracionesPblicas):LibroBlancoparalamejorade
losServiciosPblicos:unanuevaAdministracinalserviciodelosciudadanos.
MAP,2edicin.2002,Madrid

LuisaSutilAlcal77347423x
CmopuedenatenderloscentrosTICSaladiversidad?

En el siguiente artculo analizaremos la importancia de los centros TICS en la


actualidad y consideraremos algunas medidas que pueden ser llevadas a cabo para
adaptarsealadiversidadenlasociedadespaola.

La Constitucin Espaola atribuye a todos los espaoles el derecho a la


educacin y encomienda a los poderes pblicos que promuevan las condiciones y
remuevan los obstculos para que este derecho sea disfrutado en condiciones de
igualdadportodoslosciudadanos.Paraqueestederechosearealmenteefectivo,todo
el proceso de enseanza y aprendizaje debe estar adaptado a las caractersticas del
alumnado.

Atender a la diversidad en las capacidades, intereses y motivaciones de los


alumnos/as es, en sentido estricto, la manera ms adecuada de conseguir una
enseanzadecalidadparatodos.Atenderaladiversidadsignifica,asuvez,poneren
marcha y establecer mecanismos y actuaciones concretas que promocionen en los
centroseducativoselrespetoalas diferencias,latolerancia,ladignidaddetodaslas
personasylaigualdaddeoportunidades

Las Tecnologas de la Informacin y Comunicacin adquieren un papel


fundamentalenlarespuestaeducativaaladiversidad.Enloquerespectaalamejora
del proceso de enseanzaaprendizaje, los centros educativos han elaborado un
proyectodeusodelasnuevastecnologas.EstamoshablandodeloscentrosTICS.

LasTICpermitenaloscentroscompartirinformacinyconocimientosatravs
delasfronteraseuropeas.LaeducacinTICpermiteintegrarlaciudadanaeuropeayla
riquezalingsticayculturaldenuestrocontinenteenunaexperienciadeaprendizaje
eficazyagradableparalosjvenes.
Bibliografa

REVERTE,M.P.(2001).ElProyectoPlumier.Educarenel2000,3(pp59).

www.enfoqueseducativos.es

525

Nmero 2 noviembre -2007


SOTO,F.J.(2001):NuevasTecnologasyDiversidad.Educarenel2000,3,(pp.
4349).

WATKINS, A. (2001). Aplicacin de las Nuevas Tecnologas a las Necesidades


Educativas Especiales.Ultimas tendencias en 17 pases europeos. Middelfart:
EuropeanAgencyforDevelopmentinSpecial.

www.enfoqueseducativos.es

526

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x
Importanciadelniveleducativo:funcionessociales.

En el siguiente artculo analizaremos que consecuencias tiene el alumnado al


terminar una licenciatura o diplomatura y que posibles funciones sociales pueden
llegaradesempear

Enfinaldeunalicenciaturaodiplomaturasupone,porlogeneral,unperiodo
deincertidumbreparaelalumnado.Podemoscompararesteperiodocomoelfinalde
una etapa y el comienzo de otra etapa muy diferente. El sistema educativo espaol
establece un sistema organizado en etapas que se suceden entre s a medida que el
alumnadovasuperandolosobjetivospropuestosparacadaetapaeducativa.

Dependiendo del nivel educativo que tengamos, desempearemos unas


funcionessocialesuotras.Entendemosporfuncinsocialelpapelquedesempean
los individuos o grupos en el seno de una sociedad. En toda colectividad existe la
divisin de funciones entre personas o grupos, de modo que cada cual realice una
contribucinespecficaalconjuntodelasociedad.

Eltrminofuncintienedistintossignificados:puedeserutilizadoenelsentido
de estatus, profesin, cargo o empleo, designando el conjunto de deberes y
responsabilidadesdeunapersona;estambinlarelacinqueexisteentredosovarios
elementos, teniendo en cuenta que todo cambio que se introduzca en uno de ellos
provocarmodificacionesenlosdems.

En una sociedad como la espaola, el nivel educativo determina la posicin


social en la que nos vamos a encontrar cundo finalizamos nuestros estudios. Un
licenciadoenderechoocuparunaposicinsocialmuydistintaalaposicinquepuede
ocupar un trabajador mecnico o electricista: ambos desempean funciones sociales
distintasaunquedebemostenerencuentaqueambasfuncionessonnecesariaspara
elbuenfuncionamientodelasociedad.Losquelasdiferenciaaambaseselprestigio
socialquestastienen.Elprestigiosocialseconstruyeconlosvaloressocialesdecada
culturayhavariadomuchoalolargodetiempo.

Puestosasealarlasfuncioneseducativas,sialgopodemostenerclaroeneste
tancomplejoasunto,esquelaeducacinestllamadaainfluirenlasociedad
Bibliografa:

FORM, W. (1976). Ocupaciones, profesiones y carreras. En: Enciclopedia


Internacionalde las Ciencias Sociales, volumen 7, David L. Sills (ed). Madrid:
Aguilar.Pp408416.

www.enfoqueseducativos.es

527

Nmero 2 noviembre -2007


ORICOECHEA,F.(1999).LaprofesionalizacinacadmicaenColombia.Bogot:
TercerMundoEditoresIEPRI.

TORRES, Rosa Mara (2005) Qu rol docente para qu modelo de sociedad?,


en:Revista Colombiana de Educacin N 47, Bogot: Centro de Investigaciones
UniversidadPedaggicaNacional.

www.enfoqueseducativos.es

528

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x
Caractersticasycualidadesquedebereunirunprofesordeingls.

En este artculo analizaremos cuales pueden considerarse como las

caractersticas bsicas de un profesor de lengua extranjera. La docencia es una


profesin que requiere una serie de cualidades por parte de las personas que la
practican.Estamoshablandodelacualificacinquedebentenerelprofesoradoy,en
concreto,losprofesoresdeingles

Ejercerladocenciaesunatareaquerequieremuchadedicacin,yaqueyaque

debemos tener en cuenta que los profesores son los encargados de trasmitir ideas,
conocimientos,estilosdevida.Cuandohablamosdeprofesoresdeidiomastenemos
quehacerreferenciaaqucaractersticasdebenconsiderarsealahoradecalificara
undocentecomobuenprofesor.

Unbuenprofesordeinglstienequereunirunaseriedecaractersticasbsicas

entrelasquedestacamoslassiguientes:

Conocimientoydominiodelalenguaextranjera

Vocacinporlaenseanza

Usodeunametodologaadaptadaalasnecesidadesdelosalumnos

Personalidadflexibleyabierta.

Esfundamentaltenerencuentaqueparaaprenderingls,elcompromisocon

elcurso,loscompaerosdeclaseyelrespectivodocente,tienequeserdelosmejores.
Elaprendizajedelinglscomosegundalenguanoesnadafcil,esporelloquesiempre
debeexistirunaresponsabilidadpreviaparaquealolargodeldesarrollodelcursose
cumplanconcadaunadelasexigencias.

www.enfoqueseducativos.es

529

Nmero 2 noviembre -2007


Bibliografa

Bartlett,L.(1990)TeacherDevelopmentThroughReflectiveTeachingInJackC.
RichardsandD.Nunan(Eds.)(1996)SecondLanguageTeacherEducation(pp.
215226)UAS:CUP.

Fullan,M.&A.Hargreaves(1992)TeacherDevelopment&EducationalChange
London:FalmerPress.

Fullan,M.&A.Hargreaves(1992)TeacherDevelopment&EducationalChange
London:FalmerPress.

www.enfoqueseducativos.es

530

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x
Caractersticasycualidadesquedebereunirunprofesordeingls.

En este artculo analizaremos cuales pueden considerarse como las

caractersticas bsicas de un profesor de lengua extranjera. La docencia es una


profesin que requiere una serie de cualidades por parte de las personas que la
practican.Estamoshablandodelacualificacinquedebentenerelprofesoradoy,en
concreto,losprofesoresdeingles

Ejercerladocenciaesunatareaquerequieremuchadedicacin,yaqueyaque

debemos tener en cuenta que los profesores son los encargados de trasmitir ideas,
conocimientos,estilosdevida.Cuandohablamosdeprofesoresdeidiomastenemos
quehacerreferenciaaqucaractersticasdebenconsiderarsealahoradecalificara
undocentecomobuenprofesor.

Unbuenprofesordeinglstienequereunirunaseriedecaractersticasbsicas

entrelasquedestacamoslassiguientes:

Conocimientoydominiodelalenguaextranjera

Vocacinporlaenseanza

Usodeunametodologaadaptadaalasnecesidadesdelosalumnos

Personalidadflexibleyabierta.

Esfundamentaltenerencuentaqueparaaprenderingls,elcompromisocon

elcurso,loscompaerosdeclaseyelrespectivodocente,tienequeserdelosmejores.
Elaprendizajedelinglscomosegundalenguanoesnadafcil,esporelloquesiempre
debeexistirunaresponsabilidadpreviaparaquealolargodeldesarrollodelcursose
cumplanconcadaunadelasexigencias.

Bibliografa

www.enfoqueseducativos.es

531

Nmero 2 noviembre -2007


Bartlett,L.(1990)TeacherDevelopmentThroughReflectiveTeachingInJackC.
RichardsandD.Nunan(Eds.)(1996)SecondLanguageTeacherEducation(pp.
215226)UAS:CUP.

Fullan,M.&A.Hargreaves(1992)TeacherDevelopment&EducationalChange
London:FalmerPress.

Fullan,M.&A.Hargreaves(1992)TeacherDevelopment&EducationalChange
London:FalmerPress.

www.enfoqueseducativos.es

532

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x
Enqucircunstanciasseconsideraelusodelalenguamaternarecomendable?

En el siguiente artculo analizaremos las circunstancias en las cuales se

recomiendaelusodelaprimeralenguaolenguamaterna.

Ensear una lengua extranjera debe ser una tarea que implique una serie de

circunstancias en las que el alumno se vea inmerso. El contexto natural donde ser
desarrolle una lengua es una de los aspectos ms relevantes que debemos tener en
cuenta ya que no es lo mismo que se desarrolle dentro de un marco en el que esa
lengua tenga un papel como primera lengua o lengua extranjera. Tambin es
importante analizar las estrategias comunicativas utilizadas en la segunda lengua o
lenguaextranjera.

Conlosnuevosenfoqueseducativos,sepretendefomentarelusodelalengua

extranjeraosegundalenguacomoprincipalvehculodecomunicacinenlaclase.Se
pretendequeelalumnoadquieraunaseriedecompetenciasbsicasquelesirvanpara
que ste se considere competente en una lengua determinada. Entre esas
competenciasquedebedominarparaqueseleconsiderecompetenteenunalengua
citamoslassiguientes:

Competenciaoral

Competenciaescrita

Competencialectora

Competenciaauditiva

Pero no podemos olvidar que cuando un alumno aprende una segunda lengua se
tienden a utilizar las estrategias comunicativas que utilizamos en nuestra lengua
materna. Es por eso que se recomienda que nuestros alumnos utilicen su lengua
materna al comienzo del aprendizaje de una segunda lengua. Con la progresiva
adquisicin de esta segunda lengua, nuestros alumnos tendern a utilizar cada vez
menoslasestrategiascomunicativasdelalenguamaterna.Poresodebemospermitir
al principio que utilicen las estrategias comunicativas de la lengua materna con la
www.enfoqueseducativos.es

533

Nmero 2 noviembre -2007


progresivadesaparicindestasamedidaquesealcanzacompetenciaenlasegunda
lengua.

Bibliografa;

Arias,G.YC.deAutores."OrientacionesMetodolgicas,Ajustescurriculares",
EditorialPuebloyEducacin.LaHabana,2005.

Coto, M. " Cartas al Maestro. Hablemos sobre ortografa." Save the Children.
ReinoUnido,2003

Marrero,H."Elaprendizajegrupalenescolaresubicadosenaulasmultigrados
delsectorrural."ProyectodeTesisenOpcinalTtulodeDoctorenCiencias.2
005.

www.enfoqueseducativos.es

534

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x
Elaprendizajedeunasegundalenguaparalosprofesoresdeidiomaextranjero.

Estudiar una segunda lengua extranjera puede ser considerado como una

herramienta muy til para cualquier persona. La lengua es uno de los vehculos de
comunicacin ms importantes para poder comunicarnos con personas de diferente
cultura y origen cuya lengua materna difiera de la nuestra. Cuantas ms lenguas se
dominen mayor ser la informacin que podamos manejar. No podemos olvidar que
vivimosdentrodeunasociedadmulticulturaldondeladiversidadesunhechoquese
presentaadiarioennuestrasaulas.

El sistema educativo ha sufrido un importante cambio ya que un profesor

puedetenerensuaulaalumnosdediferentesnacionalidadescuyalenguamaternasea
muydiferentealalenguaespaola.

Segn las ideas generales de la LOE (Ley General de Educacin), el sistema

educativo debe ofrecer a todos los alumnos una enseanza de calidad, adaptada en
cadacasoalasnecesidadesquelosalumnospresenten.Portanto,eldocentedebera
poseerdominiodevariaslenguasparaaspoderresponderalasnecesidadesdetodo
tipodealumnado.

Otro factor importante a sealar es que aprendiendo una segunda lengua

extranjera, el docente podr apreciar las estrategias que la mayora de sus alumnos
utilizancuandoaprendeningls.Porlotanto,semejorarlacalidaddelaenseanza
porpartedeldocente.

En definitiva, el aprendizaje de lenguas es un reto que los docentes,

especialmenteaquellosrelacionadosdirectamenteconlosidiomasextranjerostienen
queenfrentardebidoalasociedadmulticulturalenlaquenosencontramos.

www.enfoqueseducativos.es

535

Nmero 2 noviembre -2007

Bibliografa

DelValleA.Internet,unaredparasalvaridiomas[enlnea].JuventudRebelde.
Disponible
en:
http://www.jrebelde.cu/secciones/informatica/html/internet.html
[Consultado:5deseptiembredel2004]
Senf GA. The art of language. Journal of Language and Linguistics
2002;1(4):388433.
Swales J. Genre Analysis. English in Academic and Research Settings. 8th Ed.
Cambridge:CUP,2001.p.247.

www.enfoqueseducativos.es

536

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x

Elaceleramientoeducativo.

En el siguiente artculo, analizar las diferentes estrategias que pueden ser


llevadasenlasclasesdeinglsparaadaptaralosalumnosaventajadosenlamateria
delenguaextranjera(ingls).

DeacuerdoconelPrembulodelaLeyOrgnicadeEducacin(LOE)2/2006,la
diversidaddebeserunadelascaractersticasbsicasdelcurrculum.Elcurrculumse
concibe como flexible, abierto a las necesidades de los alumnos e individualizado y
contextualizadodentrodelmarcosocialyculturalenelquesedesenvuelveelalumno.

Frederick B. Tuttle,Jr (1979) analiza los currculos e identifica los 4 principios


que deben ser aplicados a todos los programas educativo y en especial a aquellos
alumnosquepresentenaceleramientoeducativo.Estosalumnossonalumnoscuyo
nivel es superior al de la media de los alumnos y por tanto el currculo debe ser
adaptadoparacubrirsusnecesidades.

Estosprincipiossonlossiguientes:

1. Disearuncurrculumqueseconstruyasobrelascaractersticasdeestetipode
alumnado.Mientrastodoslosalumnosnecesidaddesarrollarlascompetencias
bsicas, los alumnos con aceleramiento educativo pueden obtener algunas
capacidadesmsavanzadas.
2. Principiodecontinuidad.Losdocentesytodopersonaleducativo(directores)
deberanllegaraunconsensoteniendoencuentalosdiferentescomponentes
delprogramaylosprocedimientosparaquestospuedanserllevadosacaboa
cualquiernivel.
3. La seleccin del profesorado adecuado para responder a este tipo de
necesidades.
www.enfoqueseducativos.es

537

Nmero 2 noviembre -2007


4. Laevaluacindelprocesoeducativodebeserdecalidad.

La aplicacin de estos principios deben ser aplicados para el desarrollo del


ingls y de los programas educativos. Como seala Scher , (1986), un programa
educativo aplicado a los alumnos con aceleracin educativa debe dar a los alumnos
unavisincrticadelarealidadquelesrodea.

Bibliografa:

Bragget,E. (1997) Differentiation in Secondary Schools (Hawker Brownlow,


Australia)
Scher, Paula. (2002) Make it Bigger. New York: Princeton Architectural Press
ISBN1568983328
Gross, M., MacLeod, B. and Pretorius, M. (2003) GIFTED STUDENTS in
Secondary Schools Differentiating the Curriculum (Second Edition) (GERRIC,
Sydney).

www.enfoqueseducativos.es

538

Nmero 2 noviembre -2007

LuisaSutilAlcal77347423x

Elcurrculointegrado:unaconcepcinactualdelcurrculum.

Con la entrada en vigor de la Ley Orgnica de Educacin y de la Ley de


EducacinAndaluza(LEA),artculo40CaptuloI,laEducacinPermanentecobraun
sentidodistintoymodificalaestructurayelcurrculodelaeducacin.
Todos los alumnos que conforman un grupo dentro de una institucin
educativa, presentan unas caractersticas determinadas, poseen un potencial que
podramos llamar inteligencia, unas habilidades particulares, un ritmo y estilo de
aprendizaje propios de cada individuo, y al mismo tiempo algunas necesidades
especficas
Lassociedadesactualesconcedengranimportanciaalaeducacinquereciben
sus jvenes, en la conviccin de que de ella dependen tanto el bienestar individual
como el colectivo. Para los individuos, la educacin es el medio ms adecuado para
construirsupersonalidad,desarrollaralmximosuscapacidades,conformarsupropia
identidadpersonalyconfigurarsucomprensindelarealidad.
Laincorporacindelascompetenciasbsicasenelcurrculumobliga,porun
lado,aplantearseculessonlosaprendizajesfundamentalesquedebeadquirirtodo
el alumnado en cada una de las etapas, reas y materias y, por otro, a establecer
prioridadesentreellos.Adems,lainclusindelascompetenciasbsicastiene,entre
otras finalidades, la de integrar los diferentes aprendizajes dentro del mismo
currculum..

Portanto,laeducacinintegradoraoescuelainclusiva,lossistemaseducativos
debenorientarsehacialaigualdadylacohesinsocialparadefinirelmodeloeducativo
talycomodemandalasociedad.Estoimplicadesarrollaruncurrculointegradorque
busque lazos entre las diferentes disciplinas del conocimiento, a base de la
investigacin.

Biblografa:

Guarro,A.(2001):Elcurriculumdemocrtico,Barcelona,Octaedro.
Hayden, C. (1997): Children excluded from primary school. Debates, evidence,
responses,Buckingham,OpenUniversityPressOCDE(2001):Whatschoolsfor
thefuture?Paris,OCDE.
www.enfoqueseducativos.es

539

Nmero 2 noviembre -2007


Cmotrabajarenclaseconalumnossuperdotados?

MARATERESAZAFRABARRIO

26034701N

Hoyenda,ladiversidadesunarealidadennuestrasclases.Nuestroobjetivo,
comoprofesoresesatenderatodoelalumnadosinestablecerdiferenciasentreellos.
Sin embargo, este aspecto no es tan fcil como parece, principalmente porque
tenemosquehacerfrenteadiferentesritmosdeaprendizajeyaunagranvariedadde
estilosdeaprendizaje.

Cuando hablamos de diversidad, hemos de hacer referencia a alumnos con


Sndrome de Down, con discapacidades sensorio motrices, ciegos, sordos, etc. Pero
quocurreconlosalumnossuperdotados?Pertenecentambinaladiversidad?Para
contestaraestapreguntahemosdesealarquediversidadsignificavariedad,por
tanto, podemos hablar de alumnos que difieren de otros que se encuentran en su
mismo grupoclase. Puesto que los alumnos superdotados aprenden a un ritmo ms
rpido que el resto, tambin pueden considerarse dentro de la diversidad. Sin
embargo, no debemos olvidar que todos los alumnos deben ser tratados igual
(siempreteniendoencuentaquealgunosdeellospresentarngrandeslimitaciones,lo
queprovocarqueseanevaluadosdeacuerdoconsuscapacidades).

Uno de los aspectos ms importantes a tener en cuenta es que la


diversificacinnopuedesersinnimodesegregacin,enotraspalabras,estetipode
alumnado no quiere ser considerado como diferente del resto del grupo. Por tanto,
nuestratareacomoprofesoresespromoversuintegracin.

Cmo podemos tratar con el alumnado superdotado en nuestras clases? A


continuacinvamosasugeriralgunasideas:

www.enfoqueseducativos.es

540

Nmero 2 noviembre -2007

Comoestosalumnostiendenaanticiparsealosdems,solicitarnlaayudadel
profesorparainvestigareltemaconmayorprofundidaddeformaautnoma.El
profesor puede satisfacer sus demandas ofrecindoles material motivador e
interactivo.Yaquelasnuevastecnologasnosofrecenunabuenaoportunidad
paraincrementarnuestroconocimiento,podemosproponerleaestosalumnos
trabajar en actividades de webquest o cazatesoros. Adems, es importante
sealar que este tipo de actividades favorece el desarrollo de las habilidades
socialesydetrabajocooperativoennuestrosalumnos.

Tambin es importante tener en cuenta los agrupamientos. Si promovemos


actividades de trabajo en grupo en nuestras clases sera aconsejable mezclar
alumnos con diferentes ritmos y estilos de aprendizaje dentro del mismo
grupo.As,losalumnos conmayorcapacidadayudarnaaquellosquetardan
ms en aprender y, al mismo tiempo, actuarn como profesores o tutores y
esteaspectoesrealmentemotivador.Losalumnoscuyoritmodeaprendizaje
esmslentosesentirnsatisfechosdepoderterminarlaactividadyalcanzar
susobjetivos.

Alosalumnossuperdotadosdisfrutanmuchoconlosejerciciosdetipooral,as
es que, por qu nos les ofrecemos la oportunidad de hablar en clase o de
haceractividadesdedramatizacinoroleplaying?

Comoconclusin,debemosdecirquelosalumnosnodebenseretiquetados,es
decir, deben sentir que forman parte del resto del grupo y que deben de
trabajar colaborando entre todos. As todos los miembros del grupo
aprendern. Por ltimo, un consejo: hay que valorar el esfuerzo de todos los
alumnossinestablecerdistincionesentreellos.

Bibliografa

GARDNER,R.(1985):SocialPsychologyandSecondLanguageLearning.TheRoleof
AttitudesandMotivation.London:Arnold.

VINCENT,S.(1990):Motivatingtheadvancedlearnerindevelopingwritingskills:a
project.ELTJournal44/4:272278.

www.enfoqueseducativos.es

541

Nmero 2 noviembre -2007


ALBERICIO,J.J.(1991):Educarenladiversidad.Madrid:Bruno.

www.enfoqueseducativos.es

542

Nmero 2 noviembre -2007

Divertirseenclasealmismotiempoqueseaprendeingls:unmito?

MARATERESAZAFRABARRIO

26034701N

Aprender ingls no est reido con divertirse en clase. De hecho, nuestros


alumnos aprendern ms, si lo hacen de forma ldica. Con frecuencia, muchos
profesoresdansusleccionespidindoleasusalumnosquememoricenprrafosmuy
extensosylosalumnoslohacensintratardeentenderquestnleyendo.Estosucede
confrecuenciaenlaetapadeeducacinsecundarianoobligatoria.Sinembargo,est
demostradoqueelelementoldicoesesencialparaaprender.Acontinuacin,vamos
averalgunosejemplos:

En primer lugar, debemos sealar que los alumnos aprendern ms y


mostrarn un mayor grado de inters si la diversin est presente en clase. Esto no
quieredecirquepasemostodoeltiemporiendoocontandochistes,sinoqueestamos
haciendoreferenciaaciertasactividadesmotivadorascomo,porejemplo,crucigramas,
adivinanzas, actividades de resolucin de problemas, etctera. Estos ejercicios son
tiles para practicar vocabulario y para hacerles ejercitar su mente a la hora de
resolverlaactividad.

En segundo lugar, los alumnos mostrarn mayor inters en aprender si


participan en actividades por parejas o grupales. Por tanto, podemos plantearles las
siguientesactividades:

Proyecto:eslapresentacintangibledeuntrabajohechoencomn.

www.enfoqueseducativos.es

543

Nmero 2 noviembre -2007


Actividadesdecazatesorosowebquest:medianteestasactividadeslosalumnos
trabajandeformaguiadayresponsable,yaquetienenquebuscarinformacin
enciertosenlacesadeterminadaspginaswebproporcionadasporelprofesor
y, al mismo tiempo, trabajan de forma colaborativa y autnoma. Un aspecto
fundamentalaresearesqueestetipodeactividadesayudanadesarrollarla
competencia digital de nuestros alumnos, uno de los objetivos de la actual
legislacineducativa.

Actividades de dramatizacin o roleplaying: ofrecen a nuestros alumnos la


oportunidad de convertirse en actores y divertirse al mismo tiempo que
practicanlalenguaextranjera.
Debatessobretemasinteresantes:permitenalosalumnosexpresarsusideasy
puntos de vista. El respeto y la tolerancia son fundamentales aqu. Adems,
desarrollansushabilidadessociales.

Entercerlugar,nopodemosolvidarlaimportanciadelusodecancionesenelaula,
yaquenosonslounamaneradepracticarlaescuchadelalenguaextranjerasinoque
tambin los alumnos mostrarn una buena predisposicin a cantar la cancin. Por
tanto,estambinunabuenaformadepracticarlapronunciacindelingls.

Como conclusin, los profesores debemos siempre mantener e incrementar el


inters de nuestros alumnos a la hora de aprender ingls mediante las actividades
mencionadas anteriormente, ya que la diversin estar presente siempre mientras
aprenden.Dehecho,estaformadepresentarnuestrasleccionesnoesinfantilsinoque
esaltamentemotivadora.

Bibliografa

McLAREN,N&MADRID,D.(1995):AHandbookforTEFL.Alcoy:Marfil.
BROWN,H.D.(1987):PrinciplesofLanguageLearningandTeaching.PrenticeHall.
PALLARS, M. (1993): Tcnicas de grupo para educadores. Madrid: Editorial
PublicacionesICCE.

LPEZCABALLERO,A.(1997):Cmodirigirgruposconeficacia?.Madrid.Editorial
CCS.

www.enfoqueseducativos.es

544

Nmero 2 noviembre -2007


WRIGHT, A. et al. (1986): Games for Language Learning. Cambridge: Cambridge
UniversityPress.

RINVOLUCRI,M.(1987):GrammarGames.Cambridge:CambridgeUniversityPress.
PERKINS,D.(1995):Laescuelainteligente.Madrid.Gedisa

www.enfoqueseducativos.es

545

Nmero 2 noviembre -2007

Lasventajasdetenersilencioenclase.

MARATERESAZAFRABARRIO

26034701N

Unadelascondicionesesencialesparaelaprendizajeeselsilencioenclase.De
hecho, los tiempos han cambiado y hoy en da los problemas de disciplina son ms
frecuentes que hace unos aos. Hay algo que est cambiando en la sociedad y la
rebeldadelosadolescentesestpresenteentodaspartes,inclusoenelaula.Estaes
laraznporlaquehacerfrentealosproblemasdedisciplinasehaconvertidoenun
aspectofundamentalalahoradeensear.

Unadelasmejoresformasdeacatarlosproblemasdedisciplinaeshacerque
los alumnos respeten a sus profesores y el silencio es el principal vehculo para
conseguirlo.Estaeslaclaveparaqueelprofesormuestresuautoridad.Algunasdelas
ventajasdetenersilencioenclasepuedenresumirsedelasiguienteforma:

1. El silencio es fundamental para mantener una relacin de respeto entre


alumnosyprofesores.Enefecto,losalumnosdebenescucharalprofesorpara
quelacomunicacinseaefectiva.

2. Es importante que los alumnos estn familiarizados con ciertas rutinas del
discursooralcomorespetarlosturnosdepalabra,pedirlapalabra,etctera.El
hecho de interrumpir aalguien que est hablando denota impaciencia, deseo
de monopolizar la conversacin y falta de inters por escuchar. Las
interrupciones tambin desvirtan el desarrollo normal de la clase. Los
alumnos deben respetar los turnos de palabra a la hora de contribuir
informacin. Mientras tanto, deben permanecer callados escuchando al
compaeroqueesthablando.
www.enfoqueseducativos.es

546

Nmero 2 noviembre -2007

3. Elsilencioproporcionalacreacindeunambienterelajadoycmodoenelaula
paraprofesoresyalumnos.

4. Cuandolosalumnosestnensilenciopuedenconcentrarsemejorenlastareas
queestnrealizando.

5. Cuandohaysilencioenclaseseevitanlasdistracciones.Silosalumnoshablan
mientraselprofesorestexplicandoesposiblequevuelvanahacerlamisma
preguntaunayotravez,yestoessealdequenohanestadoescuchandoal
profesor.

Amododeconclusincabesealarqueesesencialensearanuestrosalumnosel
valordetenersilencioenlaclase.Silohacemos,conseguiremosdarnuestraleccinsin
problemas y los alumnos mostrarn su disposicin a hablar, ya que se sentirn
escuchados por sus compaeros. Adems, un ambiente tranquilo y relajado en clase
favorecelaconcentracin.

Bibliografa

McLAREN,N&MADRID,D.(1995):AHandbookforTEFL.Alcoy:Marfil.
BROWN,H.D.(1987):PrinciplesofLanguageLearningandTeaching.PrenticeHall.
GOLDSTEIN, A.P. (1989): Habilidades sociales y autocontrol en la adolescencia.
Barcelona:MartnezRoca.
GMEZ,M,MIR,V.ySERRATMG.(1990):Propuestasdeintervencinenelaula.
Tcnicasparalograrunclimafavorableenlaclase.Madrid:Narcea.
CORNELOUP,A.(1991):Cmomantenerladisciplina.Barcelona:CEAC.

Cmoorganizarlosturnosdepalabraenclase?

www.enfoqueseducativos.es

547

Nmero 2 noviembre -2007

MARATERESAZAFRABARRIO

26034701N

Lacomunicacinesunodelosprincipalesobjetivosaconseguirenlaclase.En
general, la comunicacin tiene lugar cuando un individuo consigue transmitir su
mensaje con xito. Debe distinguirse entre comunicacin oral y escrita. Ambas se
caracterizan por una serie de factores que las diferencian. La comunicacin escrita
requiere preparacin y reflexin mientras que la comunicacin oral es ms
espontnea. A causa de esta espontaneidad tenemos que tener en cuenta ciertas
rutinasdecomunicacinoral,porejemplo,losturnosdepalabra.

Enprimerlugar,lacomunicacinrequieresilencioporpartedelaaudiencia,de
lo contrario, pueden surgir dificultades. El debate es una de las actividades ms
popularesymotivadorasenclase,yaquepermitealosalumnosexpresarsusideasy
comentardiferentestemasinteresantes.Sinembargo,elvalordeestaactividadpuede
perdersesilosalumnoscomienzanainterrumpirseunosaotros,osialgunosdeellos
hablanalmismotiempo.

Ensegundolugar,hayvariasformasdeorganizarlosturnosdepalabraenel
aula:

Los alumnos deben acostumbrarse a pedir la palabra levantando la mano. Es


entonces el profesor el encargado de determinar la persona que interviene a
continuacin.Otravariacindeestamismaformaconsistiraendarleaunode
los alumnos la oportunidad de ser el moderador, es decir, se encargar de
asignar los diferentes turnos de palabra conforme los dems estudiante
levantanlamano.

Libertad en la distribucin de turnos: los alumnos tienen plena libertad para


contribuirinformacincuandoellosloconsiderenoportuno,esdecir,debern
www.enfoqueseducativos.es

548

Nmero 2 noviembre -2007


hacerlosininterrumpiraotroscompaeros.Tambindebernevitarhablaral
mismotiempoqueotroalumno.

Los alumnos toman la palabra siguiendo un orden previamente determinado.


Porunaparte,estaeslaformamssencilladedistribuirlosturnospero,por
otra,carecedeautenticidadyespontaneidad.

Elprofesorpuedesertambinelquedeterminalosturnosdepalabra.Eneste
caso,elprofesorseleccionaalosalumnosquetienenquehablar.Esunaforma
muy til para evitar el monopolio por parte de algunos alumnos y, por otra
parte, solicita la participacin de alumnos que voluntariamente no lo hacen.
Otro aspecto a tener en cuenta es que el profesor debe nominar al alumno
paraevitarsealarconeldedo,unaprcticarealmentedescorts.

Como conclusin, el turno de palabra es uno de los aspectos esenciales en la


conversacin y el discurso. Si enseamos a nuestros alumnos como mantener
conversaciones en clase teniendo en cuenta ciertas rutinas propias del discurso oral,
desarrollarntambinsushabilidadescomunicativasysocialessinproblemaalgunoen
lavidareal,fueradelasclases.

Bibliografa

McLAREN,N&MADRID,D.(1995):AHandbookforTEFL.Alcoy:Marfil.
BROWN,H.D.(1987):PrinciplesofLanguageLearningandTeaching.PrenticeHall.
GARDNER,R.(1985):SocialPsychologyandSecondLanguageLearning.TheRoleof
AttitudesandMotivation.London:Arnold.
KASPER, G. (ed) (1986): Learning, Teaching and Communication in the Foreign
LanguageClassroom.Aarhus,Denmark:AarhusUniversityPress.
LITTLEWOOD, W. (1992): Teaching Oral Communication: A Methodological
Framework.Oxford:Blackwell.
MADRID, D. & McLAREN, N. (1995): Didactic Procedures for TEFL. Valladolid: La
Calesa.
MALAMAHTHOMAS, A. (1987): Classroom Interaction. Oxford: Oxford University
Press.

www.enfoqueseducativos.es

549

Nmero 2 noviembre -2007

Librosdetextoomaterialeshechosporelprofesor?

MARATERESAZAFRABARRIO

26034701N

Los mtodos tradicionales de enseanza estaban frecuentemente basados en


apuntes, libros, y fotocopias. Desde hace mucho tiempo se ha estado intentando
averiguar cul es el mtodo ms apropiado y los materiales ms adecuados e
interesantesparahacerqueelprocesoenseanzaaprendizajetengaxito.Portanto,
esto ha llevado al planteamiento de diferentes cuestiones: Es mejor utilizar un
determinadolibrodetexto?EncasoafirmativoCulseraelmsrecomendable?.A
continuacinvamosaofreceralgunasideasquearrojarnluzsobreestascuestiones.

En primer lugar, sera conveniente sealar que el mtodo y los materiales


perfectosparacualquiergrupodealumnosnoexisten,enotraspalabras,laeleccinde
los materiales siempre vendr condicionada por ciertos factores como: el nivel del
alumnado, sus intereses y necesidades, su grado de motivacin, el contexto socio
cultural del centro, etc. Por tanto, sern estos aspectos los que determinen dicha
eleccin.Enestesentido,loscentrosdocentesoptanporunmismolibrodetextopara
todos los grupos del centro, eso s, siempre teniendo en cuenta las caractersticas
generalesdelalumnadoqueestudiaall.Luego,serelprofesoradoelquedetermine
losmaterialesqueutilizarconsugrupodependiendodelosfactoresanteriormente
mencionados, en otras palabras, complementar las unidades temticas del libro de
textoconfichasderevisinyampliacinytambinemplearmaterialesyrecursosde
atencinaladiversidad.

Ensegundolugar,cabesealarlasventajasquecaracterizanallibrodetexto:
Guaalprofesoralahoradedeterminarquvaaensear.
Tambinsirvedeguaalosalumnosyfacilitasutrabajo.
www.enfoqueseducativos.es

550

Nmero 2 noviembre -2007


Alseguirunaestructuradeterminada,losalumnoslomanejarnsinproblemas
una vez que conozcan cmo est estructurado. En este sentido, conforme se
vayanfamiliarizandoconellibro,localizarnfcilmentedndeestelglosario,
elresumendegramtica,etc.
Es un elemento motivador, debido a la gran cantidad de ilustraciones a todo
colorquepresenta.
Evitaquelosalumnosextravenmaterial,yaquevieneencuadernado.
Vieneacompaadoderecursosparaelprofesorado,incluyendoactividadesde
refuerzo y ampliacin, actividades de atencin a la diversidad, exmenes con
diferentes niveles de dificultad, consejos sobre cmo explotar ciertas
actividades,etc.
LamayoradeloslibrosdetextoincluyentambinunCDROMmultimediapara
elalumnadoconactividadesinteractivasyjuegos.

Sinembargo,existentambinunaseriededesventajas:
En ocasiones, las actividades son muy repetitivas y puede llegar un momento
enelquelosalumnosdejendeconsiderarelmaterialatractivoymotivador.
Existenlibrosdetextoquenopresentanactividadesdeiniciacinpararevisar
conocimientosprevios.
A veces presentan demasiado material no autntico, lo que dificulta que los
alumnosconozcanelcontextoenelqueseencuadralalenguaextranjera.

Debido a todos estos factores mencionados en el prrafo anterior, muchos


profesoresoptanporelaborarsupropiomaterial.Sinembargo,nosencontramosante
unatareaclaramenteelaboradayquenosllevaramuchotiempo.

Comoconclusinpodemosdecirque,aligualquenoexisteunmtodomgicopara
ensear,tampocoexisteunnicotipodematerialaemplearconelalumnado,yaque
las caractersticas personales, sociales y culturales de sus miembros sern las que
determinen los materiales y recursos que tendr que utilizar el profesor en cada
momento.Ellibrodetextoesunabuenaguaparaprofesoradoyalumnado,perono
debeserelnicomaterialempleado.Portanto,serecomiendatambinlautilizacin
de material adicional o complementario, bien sea en forma de fotocopias, apuntes,
fichasderevisin,materialautntico,etc.

Bibliografa

www.enfoqueseducativos.es

551

Nmero 2 noviembre -2007


McLAREN,N&MADRID,D.(1995):AHandbookforTEFL.Alcoy:Marfil.
BROWN,H.D.(1987):PrinciplesofLanguageLearningandTeaching.PrenticeHall.
MADRID, D. & McLAREN, N. (1995): Didactic Procedures for TEFL. Valladolid: La
Calesa.

www.enfoqueseducativos.es

552

Nmero 2 noviembre -2007

Puedeelinglsusarsedurantetodalahoradeclase?

MARATERESAZAFRABARRIO

26034701N

Aprender una lengua extranjera no es tarea fcil, sobre todo cuando


encontramosalumnosquelavencomoalgomuylejanoaellosydifcildemanejar.Es
ahcuandoelprofesordebemotivarlosymostrarlesquepuedenllegaraaprenderlay
utilizarlaconeltiempo.Paraelloexistenvariosaspectosqueprocedemosacomentar
acontinuacin.

La utilizacin del idioma extranjero siempre debe hacerse desde el primer


momento. En realidad, una lengua se aprende paso a paso, y tenemos que tener en
cuentaquelanicaformadequenuestrosalumnosaprendanunidiomaesmediante
elcontactodiarioconella.Porejemplo,podemosusarlalenguaextranjeraalahorade
entrarenclaseysaludarlos,haciendoreferenciaaexpresionescomunesyfrecuentes
comoabridellibroporlapgina25,podrasleereltexto?,etc.Pocoapoconuestros
alumnos se acostumbrarn a entender expresiones sencillas y ellos mismos podrn
decirlas.

Por otra parte, debemos tener siempre presente que cuanto ms escuchen
hablarlalenguaextranjeramsentendernconformeavanceelcurso.Eslgicoqueal
principiolescuesteunpoquito,yaquetendrnqueacostumbrarsealritmoytonodel
profesor al hablar en ingls. Sin embargo, una vez llegamos a este punto, surge una
pregunta: hasta qu punto podemos usar el ingls en la leccin?, se supone que
debemosestarhablandoeninglsdurantetodalahora?Enestesentidoypuestoque
nodebemosolvidarqueelinglsdebeserelvehculoparalarnuestrasclases,habra
quecontestarafirmativamente.Peroquocurrirasialgunosalumnosnoentendieran
loqueestamosdiciendo,debidoaquetienenunritmodeaprendizajemslentooa
cualquierotrofactor?Enestecaso,notendramuchosentidocontinuarhablandoen
ingls todo el rato, ya que el valor de la comunicacin se rompera porque no
www.enfoqueseducativos.es

553

Nmero 2 noviembre -2007


conseguimos transmitir el mensaje. Cuando esto ocurre es necesario recurrir al
espaolparasolventarlasposiblesdudas.

Unadelastcnicasquemejoresresultadosofreceesladehablareninglsy
repetir luego esa misma frase en espaol. Lgicamente, conforme vaya pasando el
tiempolosalumnosentendernmejorelinglsynoharfaltarecurriralatraduccin
en cada momento. Tambin se acostumbrarn al acento, la entonacin y la
pronunciacin. Por otra parte, esta tcnica ofrece tambin las ventajas sealadas a
continuacin:
Los alumnos tendrn que guardar silencio para poder escuchar al profesor y
concentrarseenloqueestdiciendo.Portanto,lograremosrespetoyatencin.
Evitaremos interrupciones continuas mediante expresiones como qu ha
dicho?,puededecirloenespaol?

En cuanto a las explicaciones gramaticales, debern quedar lo ms claras posible. Es


decir, habr ocasiones en los que el punto gramatical a tratar ser demasiado
complejoparaellosytendremosqueofrecerlaexplicacinencastellano.Sinembargo,
esto siempre depende del nivel del alumnado y del nivel de curso en el que nos
encontremos.

Comoconclusinhemosdesealarqueelmejorvehculodecomunicacines
el uso de la lengua. Si nuestro objetivo es lograr que nuestros alumnos tengan una
buenacompetenciacomunicativaenelusodelingls,serfundamentalemplearloen
nuestras lecciones. Adems, su uso en actividades motivadoras atraer su inters y
aprendernms.Porotraparte,sesentirnmuysatisfechoscuandoseancapacesde
transmitirsusideasenlalenguaextranjera,peronoolvidemosqueestosloocurrir
si les proporcionamos suficiente conocimiento del idioma y oportunidades para
hacerlo.

Bibliografa

McLAREN,N&MADRID,D.(1995):AHandbookforTEFL.Alcoy:Marfil.
BROWN,H.D.(1987):PrinciplesofLanguageLearningandTeaching.PrenticeHall.
www.enfoqueseducativos.es

554

Nmero 2 noviembre -2007


GARDNER,R.(1985):SocialPsychologyandSecondLanguageLearning.TheRoleof
AttitudesandMotivation.London:Arnold.
LITTLEWOOD, W. (1992): Teaching Oral Communication: A Methodological
Framework.Oxford:Blackwell.
BELTRN, J.A. (1993): Procesos, estrategias y tcnicas de aprendizaje. Madrid:
Sntesis.

En qu circunstancias es recomendable el uso de la lengua


maternaporpartedelprofesorenlaclasedeingls?

MARATERESAZAFRABARRIO

26034701N

El aprendizaje de una lengua extranjera se basa en su uso durante toda la


leccin, ya que nuestro objetivo es que nuestros alumnos sean capaces no slo de
entender mensajes orales y escritos sino tambin de producirlos. Sin embargo, hay
ocasiones en las que el valor comunicativo se pierde, debido bien a la escasa
competenciacomunicativaoniveldelalumnadooaotrotipodefactores.Esenestos
casoscuandorecurriralalenguamaternaesfundamentalparaquenuestrosalumnos
nosentiendanypuedarecuperarseelritmodelaclase.

www.enfoqueseducativos.es

555

Nmero 2 noviembre -2007


Noolvidemosqueelaprendizajedeunidiomaconstituyeunprocesocomplejo
yqueconstadevariasetapas.Nopodemospretenderquenuestrosalumnossiempre
seencuentrenenlasmismascondicionesparaentenderoproducirmensajesenotra
lengua.Portanto,podemoscitaralgunassituacionesenlasqueserecomiendaeluso
delalenguamaterna:

En primer lugar, y como hemos comentado anteriormente, siempre que


surjaalgnproblemadecomprensindeberutilizarselalenguaextranjera
para poder solucionarlo. De esta forma, cumplimos el objetivo de utilizar
una metodologa en la que el alumno sea el centro del proceso de
enseanzaaprendizaje, ya que esto es una manera de atender a sus
necesidades.
En segundo lugar, es tambin aconsejable la explicacin de puntos
gramaticalescomplejosenlalenguamaterna.Loquesdebemosteneren
cuenta es el uso de ejemplos claros y sencillos para ilustrar nuestras
explicaciones.Esos,losejemplosdebenserenlalenguaextranjera.
Entercerlugarhayquetenerencuentaelniveldenuestrosalumnos.Habr
casos en los que slo podamos utilizar el idioma extranjero en contadas
ocasiones. Sin embargo, es aqu cuando el profesor debe motivarlos y
mostrarles lo interesante que es poder entender y comunicarse en otro
idioma.
En cuarto lugar tenemos que tener en cuenta si en nuestra clase
encontramosalumnosconalgunaparticularidad.Nosestamosrefiriendoal
alumnado con necesidades educativas especiales. En este caso tendremos
que adaptarnos a lo que requiera este tipo de alumnado, teniendo que
recurrirconmayorfrecuenciaalusodelalenguamaterna.
Seguidamente hay que proceder a comentar un factor que, aunque
aparentementetienepocaimportancia,influyemuchoenlapredisposicin
quemuestrannuestrosalumnosarecibirlaclase:lahoraenlaquesedala
leccin. Por ejemplo, no es lo mismo dar la clase a segunda hora de la
maana que a ltima. En este ltimo caso es bastante probable que los
alumnosestnbastantecansadosytengamosnosloquecambiarelritmo
delaclasecontinuamentesinotambinhacerusodelalenguamaternaen
ocasiones.

Comoconclusinhayquesealarque,aunquenuestroobjetivosersiempreel
usodelidiomaextranjeroenelaula,tendremosqueestarabiertosautilizarlalengua
materna cuando se produzca algn problema de comunicacin. No podemos olvidar
que ante todo nuestra misin es hacer que el proceso de enseanzaaprendizaje se
lleveacaboconxito.

www.enfoqueseducativos.es

556

Nmero 2 noviembre -2007

Bibliografa

McLAREN,N&MADRID,D.(1995):AHandbookforTEFL.Alcoy:Marfil.
BROWN,H.D.(1987):PrinciplesofLanguageLearningandTeaching.PrenticeHall.
GARDNER,R.(1985):SocialPsychologyandSecondLanguageLearning.TheRoleof
AttitudesandMotivation.London:Arnold.
LITTLEWOOD, W. (1992): Teaching Oral Communication: A Methodological
Framework.Oxford:Blackwell.
BELTRN, J.A. (1993): Procesos, estrategias y tcnicas de aprendizaje. Madrid:
Sntesis.

www.enfoqueseducativos.es

557

Nmero 2 noviembre -2007

Animar a nuestros alumnos a que editen un folleto sobre su ciudad


natal.

MARATERESAZAFRABARRIO

26034701N

La motivacin es un factor clave en nuestra tarea como profesores. Tenemos


queconseguirquenuestrosalumnossemuestreninteresadosyquierantrabajar.Para
ello es esencial promover la realizacin de actividades que respondan a sus gustos.
Una manera de conseguirlo es proponindoles un trabajo en grupo que podra
consistir en la edicin de un folleto sobre su ciudad natal. A continuacin vamos a
sealarlosfactoresquejustificanlaimplicacinpedaggicadeunaactividaddeeste
tipo.

1. En primer lugar, el trabajo en grupo favorece el desarrollo de las habilidades


socialesdenuestrosalumnosyaprendenatrabajarcooperativamente.Esuna
oportunidad para que se relacionen, hagan una puesta en comn de ideas,
trabajoypuntosdevista.

2. Ensegundolugar,cuandolespedimosqueelfolletoseasobresuciudadnatalo
pueblo estamos respondiendo a sus gustos e intereses. Incluso podremos
contarconlaparticipacindealumnosquenormalmentemuestranunaactitud
pasivaenclase,bienseaporquenolesgustalaasignaturaoporquenosaben
que decir. Mediante este tipo de actividades hacemos que ellos se sientan
orgullososdepodercontribuirconalgoquerealmenteestnfamiliarizados,ya
quelesgustarmostraraspectosdesuciudadnatal,costumbres,etc.

3. Entercerlugar,losalumnosseconviertenenprotagonistas. Sonelloslos que


realizan el trabajo y el rol del profesor ser el de asesor. En este sentido, el
disearn el proyecto y les corresponder tomar decisiones acerca de ciertos
aspectos como el diseo o formato del proyecto, su ilustracin mediante
fotografasoimgenes,informacinvariada,etc.

www.enfoqueseducativos.es

558

Nmero 2 noviembre -2007


4. Encuartolugar,estaactividadesunaformademostrarycompartiraspectos
culturales relativos a cada uno de los pueblos o ciudades ilustrados en el
folleto.Podrnaprenderunosdeotros.

5. Por ltimo, uno de los aspectos que ms motiva a los alumnos a continuar
haciendoactividadesdeestetipoesdaraconocerelproductounavezqueest
terminado.Elmerohechodecolocarloenlasparedesdelaulalesharsentir
que lo que han hecho ha tenido finalmente una proyeccin aunque
simplementehayasidoaniveldeaula.

Comoconclusinhemosdedecirquelautilidaddeestaactividadsedemuestraen
el logro de haber hecho a nuestros alumnos participar y trabajar cooperativamente.
Este proyecto estimula su creatividad ya que, a la hora de tomar decisiones sobre
aspectos relativos al formato, buscaran el formato ms apropiado para hacerlo
atractivo.Ademselhechodedarleslibertadparailustrarlocomodeseenfavorecesu
autonoma.

Bibliografa

McLAREN,N&MADRID,D.(1995):AHandbookforTEFL.Alcoy:Marfil.
BROWN,H.D.(1987):PrinciplesofLanguageLearningandTeaching.PrenticeHall.
GARDNER,R.(1985):SocialPsychologyandSecondLanguageLearning.TheRoleof
AttitudesandMotivation.London:Arnold.
ALONSO TAPIA, J. (1991): Motivacin y aprendizaje en el aula. Cmo ensear a
pensar.Madrid:Santillana.
PERKINS,D.(1995):Laescuelainteligente.Madrid.Gedisa

www.enfoqueseducativos.es

559

Nmero 2 noviembre -2007

Elcontactovisualenelaula

MARATERESAZAFRABARRIO

26034701N

Una de las mejores formas de comprobar cmo se est desarrollando el


proceso de enseanzaaprendizaje en el aula es mediante el contacto visual.
Constituyeunodeloselementosmsimportantesatenerencuentaparaaveriguarsi
la leccin se est desarrollando bajo las condiciones ms apropiadas y, en el caso
contrario, nos ayudar a cambiar su ritmo. Un error muy frecuente que podra
mostrar el profesor sera el de mirar nicamente a un grupo de alumnos o a una
seccindelaclase,locualpodraprovocarqueotrosalumnossedistraiganohablen
entreellos,yaquenosesientenobservados.

Engeneral,sepuedeutilizarelcontactovisualpara:

Comprobar si los alumnos estn prestando atencin, estn distrados,


cansados,aburridos,etc.Enestecaso,podrmodificarinmediatamenteel
ritmo de la clase, ofreciendo actividades ms motivadoras y amenas. Por
esta razn, la improvisacin del profesor juega un papel realmente
importante.
Invitar a un alumno a participar en clase. En lugar de llamarlos por su
nombre,almirarlosleconcedemoselturnoparahablar.
Comprobarqueestnentendiendolaexplicacin.
Observar el estado de nimo del alumnado. Esto favorecer el
establecimientodeunarelacinmscercanayhumanaentrealumnadoy
profesorado.

Porotraparte,elprofesorsiempredebertenercuidadocuandosegirepara
escribirenlapizarra.Siempleademasiadoratosinestablecercontactovisual,esmuy
posible que los alumnos hablen entre ellos, se distraigan, e incluso interrumpan el
desarrollonormaldelaclase.
www.enfoqueseducativos.es

560

Nmero 2 noviembre -2007

Otroaspectoimportanteasealaresqueelprofesorsiempredebeconsiderar
la informacin visual como una especie de retroalimentacin para evaluar aspectos
relativosalalumnadosinotambinpararegularsulaborcomodocente.

Comoconclusinhemosdesealarqueelcontactovisualesesencialenlaclase
paramostrarqueestamosentodomomentopendientesdeloquesucedeenlaclase.
Adems indica que el profesor est interesado en obtener informacin sobre cmo
desarrollasuprcticadocente.Elcontactovisualtambinfavorecelacreacindeuna
atmsferadeconfianzaenlaclaseyayudaaestablecerunarelacinempticaentreel
profesorysusalumnos.

Bibliografa

McLAREN,N&MADRID,D.(1995):AHandbookforTEFL.Alcoy:Marfil.
BROWN,H.D.(1987):PrinciplesofLanguageLearningandTeaching.PrenticeHall.
HADFIELD,J.(1992):ClassroomDynamics.Oxford:OxfordUniversityPress.
BYRNE,D.(1988):FocusontheClassroom.London:ModernEnglishPublications.
BELTRN, J.A. (1993): Procesos, estrategias y tcnicas de aprendizaje. Madrid:
Sntesis.
GMEZ,M,MIR,V.ySERRATMG.(1990):Propuestasdeintervencinenelaula.
Tcnicasparalograrunclimafavorableenlaclase.Madrid:Narcea.

Elasistentedeconversacin,unagranayudaparaelprofesordeingls.

MARATERESAZAFRABARRIO

26034701N

www.enfoqueseducativos.es

561

Nmero 2 noviembre -2007

Durantelosltimosaoselnfasisenelaspectocomunicativodelalenguaha
provocadounmayorintersenreforzarlasdestrezasorales,esdecir,laescuchayla
produccin oral de mensajes en otro idioma. Sin embargo, la integracin de estas
destrezas con las escritas es fundamental para lograr nuestro objetivo. Una de las
mejoresformasdedesarrollarlasdestrezasoralesesmedianteelcontactodirectocon
el idioma. Pero cmo podemos tener este contacto sin necesidad de viajar al
extranjero?

Graciasalaproliferacindecentrosbilingesennuestropaspodemoscontar
con un recurso humano ms en nuestro centro educativo: el asistente de
conversacin.Su labor fundamental es la de prestar apoyo en clase al profesor de
inglsysepuedehacermedianteunaseriedeactividades:

Lecturadetextos
Actividadesldicascomunicativas:juegos.
Debatesenclase
Discusin de aspectos socioculturales propios del pas dedonde proviene
elasistente.
Actividadesdepronunciacin.
Etc.

Llegado a este punto, cabe sealar que una de las actividades ms


enriquecedoras es la del comentario, por parte del asistente, de costumbres y otros
aspectos culturales sobre el pas extranjero. Esta actividad tendra una duracin
aproximadademediahoraypodradesarrollarsedelasiguienteforma:

1. En primer lugar, el asistente hablara acerca de un tema que interese y


motivealosalumnos,porejemplo,lacelebracindelDadeSanValentn,el
DadeAccindeGracias,laNavidad,etc.Almismotiempoquedesarrollael
discurso sera conveniente que escribiera algunas de las palabras o
expresioneslepreguntaraalosalumnosporsusignificadoparacomprobar
quevansiguiendoeldiscurso.Elusodetarjetas,materialautnticoorealia
puede ser de gran ayuda. Esta parte de la actividad podra durar
aproximadamente1015minutos.

www.enfoqueseducativos.es

562

Nmero 2 noviembre -2007


2. A continuacin, el asistente procedera a hacer a los alumnos algunas
preguntas relativas al tema tratado e incluso podra iniciar un debate con
ellos.Unos1015minutosseralatemporalizacindeestaseccin.

Latemporalizacindelaactividadcomentadaanteriormenteesaproximado.El
profesor podr decidir la frecuencia con la que el asistente entra a clase y las
actividades que desarrollar en el aula. Aparte de esto es conveniente sealar que
debendarselassiguientescondicionesparapoderrealizarestaactividad:
El profesor no interrumpir al asistente, ya que actuar como otro
oyentems.
Los alumnos deben guardar silencio y levantar la mano para pedir la
palabra cuando quieran contestar alguna pregunta o solicitar la
aclaracindealgnaspecto.
Elasistentedebersertratadoconelmximorespeto.

Enresumen,contarconlapresenciadeunasistentedeconversacinserauna
gran ayuda para desarrollar nuestras lecciones, ya que constituye un elemento
motivador.Adems,losalumnosmostrarncuriosidadnosloporconoceraspectos
socioculturalesdelpasextranjerosinoquetambinharnpreguntas.Deestaforma
seconseguiratraersuatencinyfomentarsuparticipacin.

Bibliografa

BROWN,H.D.(1987):PrinciplesofLanguageLearningandTeaching.PrenticeHall.
GARDNER,R.(1985):SocialPsychologyandSecondLanguageLearning.TheRoleof
AttitudesandMotivation.London:Arnold.
MALAMAHTHOMAS, A. (1987): Classroom Interaction. Oxford: Oxford University
Press.
NUNAN, D. (1988): The LearnedCentred Curriculum. Cambridge: Cambridge
UniversityPress.
COLEMAN,J.C.(1985):Psicologadeladolescente.Madrid:Morata.
HOSTIE,R.(1994):Tcnicasdedinmicadegrupos.Madrid:ICCE.

www.enfoqueseducativos.es

563

Nmero 2 noviembre -2007

www.enfoqueseducativos.es

564

Nmero 2 noviembre -2007

MDELCARMENRODRGUEZDELRO
26.493.683Y
ES ACONSEJABLE HABLAR EN INGLS TODO EL TIEMPO EN LOS GRUPOS DE EDUCACIN
SECUNDARIA?
Piensaentulenguamaterna.Laaprendistesinningnesfuerzo,sinquenadietuviera
que estar todo el tiempo pidindote que repitieras o te tuviera que corregir formalmente.
Aprendiste a dominar una habilidad muy difcil, aprendiste a hablar tu propio idioma
simplemente escuchndolo. El aprendizaje de una segunda lengua no es diferente; la mejor
forma de conseguirlo es a travs de la escucha, recibiendo lo que se denomina el input
adecuado,escuchandolalengua.
Evidentemente,novaleescucharcualquiercosa.Necesitascomprenderalgoocuanto
ms, mejor de lo que oyes, es necesario mostrar inters e implicarse. Como he mencionado
con anterioridad, hay que estar expuesto a un input correcto; pero si no te implicas ni te
relajas,eseinputnoseconvertirenpartedetuconocimiento.
Por consiguiente, es aconsejable que se utilice la lengua extranjera, el ingls, tanto
como sea posible en el grupo de Educacin Secundaria. En ocasiones puede suceder que un
alumno no hable mucho, pero que s se implique en el desarrollo de la clase (hace los
ejercicios, atiende, colabora, realiza los trabajos, ). Si los alumnos escuchan con atencin y
participandelprocesodeescucha,desarrollarnsuhabilidaddecomprensinoraly,almismo
tiempo,suniveldelalenguaengeneral.
Pero,qusucedesiunalumnoempleasulenguamaterna?Noesmalaideapermitir
que los alumnos usen su lengua materna en la clase de ingls. Incluso puede ser una buena
estrategiaenciertassituacionescomo,porejemplo,lasquesecitanacontinuacin:
-

Sielalumnonecesitahablardealgunadificultadodudaquetengaconelprofesory
stecompartelamismalenguamaterna,notienesentidoelempearseenhacerla
discusin artificialmente ms compleja al tener lugar en ingls, especialmente, si
queremos asegurarnos de que el alumno comprende la solucin al problema
planteado.

www.enfoqueseducativos.es

565

Nmero 2 noviembre -2007


Si los alumnos estn trabajando en grupos, todos ellos hablan la misma lengua

materna, no es fundamental que todo lo que ellos hablen sea en ingls. Sera
recomendable,peroalmenos,noscercioraremosdequelaactividadestil,dequ
han aprendido, que el resultado del trabajo llevado a cabo en grupo, lo que ellos
exponganantelaclaseysudefensaycomentariosdelorealizado,tienenlugaren
ingls.
Puedequeelalumnodeseehaceralgunacontribucinpersonalaltemaqueseest

tratandoyquenotengaelvocabularioolaseguridadensmismoparahacerloen
ingls. Debe callarse porque no lo puede hacer en ingls? O por el contrario, es
mejor que aporte su opinin en espaol? Evidentemente, la segunda opcin es la
adecuada; bastante difcil es que un alumno exprese sus opiniones o sentimientos
paraqueencimaseloexijamosenotralenguaquenoeslasuya.Endeterminados
contextostendremosquepriorizarququeremosconseguirdenuestrosalumnos.Y
pocoapoco,animarlesyfacilitarleslaformadehaceresascontribucioneseningls.

El hecho de permitir que se hablen las dos lenguas en clase tiene muchas ventajas
(algunosalumnostienenbuenasideas,perocarecendelniveldeinglsparaexpresarlas;otros
alumnos tienen un buen nivel de ingls, pero les faltan ideas). Permitir las dos lenguas en
clase,endeterminadosmomentos,normalmentegarantizaquegranpartedeltrabajopueda
sermsinteresanteyqueseconsigamejorarelniveldeingls.

REFERENCIASBIBLIOGRFICAS:

ATKINSON,D.(1987).Themothertongueintheclassroom:aneglectedresource?ELTJournal
41/3.
BELTRN.J.A.(1993).Procesos,estrategiasytcnicasdeaprendizaje.EditorialSntesis.
BRUMFIT,C.(1980).ProblemsandPrinciplesinEnglishTeaching.PergamonPress.

MDELCARMENRODRGUEZDELRO
26.493.683Y
CMOUTILIZARLAPIZARRADEFORMAEFICIENTE?

www.enfoqueseducativos.es

566

Nmero 2 noviembre -2007

La pizarra es la herramienta visual ms frecuente; y el objetivo principal de las

herramientas es ayudar. Sin embargo, ha sido utilizada tanto en clase y estamos tan
acostumbrados a tenerla ah que algunos profesores suelen olvidarse de su importancia.
Debemosconsiderarvariosaspectos:

a) Laestructuradelapizarra.Esaconsejableseguirunciertoordencuandoutilicemos
la pizarra para ayudar a nuestros alumnos a comprender diferentes conceptos y
secuenciastemporalesyespaciales.Porlotanto,esmuyimportanteborrartodolo
quenoseanecesarioeneseinstante,demaneraquenuestrosalumnoscentrensu
atencinenloqueseestexplicandoohaciendo.Otracosaquetambinhayque
evitar es el utilizar slo una parte del espacio disponible. Puede ayudarnos el
dividirelespaciodelapizarraencuatrozonasopartes(arriba,abajo,izquierday
derecha).

b) Otroelementoquehayquetenerencuentaeslacaligrafa.Cuandoescribamosen
lapizarra,nuestraletradebeserlegibleylosuficientementegrandeparaquelos
alumnos que estn en la parte final de clase puedan ver lo que escribimos, y
tambinsitenemosalgnalumnoconalgunadeficienciavisual.

c)Elempleodetizasdediferentescoloresharquenuestraexposicinsepercibade
formamsatractiva,visualycreativaparalosalumnos,alavez,quetambinpuede
ayudaraquelaestructuradenuestrapresentacinseamsclara.

d)Ademshabrqueprocurarnoobstaculizarlavisindelapizarraparalosalumnos
mientrasescribimosodibujamos,almismotiempoquemantenemoselcontactovisual
o el contacto verbal con nuestros alumnos en clase. Es aconsejable hablar a los
alumnos mientras escribimos para mantener su atencin y establecer la relacin de
significadoocohesinentrelosconceptos,loqueseescribeylapronunciacindelas
palabras y enunciados. Sin embargo, los especialistas de la voz, los logopedas,
recomiendanquenosedebehablarmirandoalapizarrasinoalosalumnosencasode
quetengamosalgnproblemaconlavoz.
www.enfoqueseducativos.es

567

Nmero 2 noviembre -2007

e)Porltimo,nohayqueolvidarquenotenemosqueescribirabsolutamentetodoen
la pizarra, ya que no es prctico y se pierde mucho tiempo, tan valioso para otras
cuestiones. Podemos echar mano de otras herramientas que nos ayuden tales como
fotocopias, flashcards, presentaciones en powerpoint, webquests, proyecciones con
elcandealgnmaterialquehayamospreparadoennuestroordenador,etc.
Debemos procurar optimizar al mximo nuestros recursos didcticos, rentabilizar el
usoquehagamosdelapizarraparaayudaranuestrosalumnos;peroseacualseaelrecurso
que utilicemos y, particularmente la pizarra, siempre hay que preparar de antemano un
buenmaterial.

REFERENCIASBIBLIOGRFICAS:
BUSHMAN,JohnH.(2001).TeachingEnglishCreatively.CharlesC.ThomasPublisherLtd.
MUGGLESTONE,P.(1981).PlanningandUsingtheBlackboard.Heinemann.
STONES,E.yMORRIS,S.(1972).TeachingPractice:ProblemsandPerspectives.Methuen.
UNDERWOOD,M.(1987).EffectiveClassManagement.Longman.

MDELCARMENRODRGUEZDELRO
26.493.683Y
ALUMNOSTMIDOS:CMOCONSEGUIRQUEPARTICIPENACTIVAMENTEENCLASE?

Esciertoquetodosaprendemosmejorcuandonossentimosmentalmenterelajados,

esdecir,abiertosoreceptivosalaexperienciadeaprendizaje.Siunosesientepresionadoo
bajotensin,esmuchomsdificultoso.Losprofesoresdebemosintentargenerarsiempreuna
atmsferarelajada,sugiriendomsqueexigiendoodemandandounarespuesta.

Losalumnosdebensentirseimplicadosenlaclase.Estonoquieredecirqueatodoslos

alumnosselesdebahacerhablaroqueelalumnoquenohablenoestparticipando.

www.enfoqueseducativos.es

568

Nmero 2 noviembre -2007

Nuestros alumnos necesitan muchas oportunidades para hablar en las clases de

idiomas, pero los profesores debemos evitar presionarles o forzarles a hablar. Algunas
personas(adultosyadolescentes)compartensusopinioneseideasdeunaformanatural,sin
que esto les suponga un gran esfuerzo; otras, sin embargo, poseen personalidades ms
reflexivas o introvertidas. Nos corresponde a los profesores el hacer que todo el mundo
participe,perononecesariamentehadeserdelamismamanera.Habralumnosquequieran
participar todo el tiempo sin decir mucho realmente. Esta situacin puede provocar un
sentimientodefrustracinenelprofesor;peroesimportanteserconscientedequenosotros
estamosahparaayudaralalumnoyadaptarlasituacin,nocreandoestrsodificultandoel
aprendizajey,porsupuesto,nocambiandosupersonalidad.

Sisomossensiblesalagentequenosrodea,esfcildistinguirentrelosalumnosque

estn aburridos y los que estn en silencio, pero implicados en el aprendizaje. En el primer
caso,quizsesnecesariocambiarloqueestamoshaciendo;enelsegundocaso,tenemosque
respetarladecisinpersonaldelalumno.

Encualquiercaso,losalumnosestarnmspropensosadisfrutardelaasignaturaya

obtenerbuenosresultadossiseveninvolucradosenelprocesodeaprendizajey,entantoen
cuantoseaposible,tenganunaoportunidaddeinfluirenloquesucedeyencmosucede.

Podra ser una buena idea comenzar averiguando por qu estn aprendiendo ingls,

paraqulespuedeservirelinglsqueestnaprendiendo,susexpectativas,loquelesgustay
loquelesdisgusta.Sepuedehacerestainvestigacin,porejemplo,repartiendounalistaenla
quepedimosalosalumnosquerespondanalaspreguntaspersonalmenteydeformasincera.

Elinglsestilporque:
-

Puedeshablarconmuchsimagentenueva.

Puedesusarelinglscuandoestsviajando.

Puedesentenderpelculasyprogramasdetelevisin.

Puedescomprendercanciones.

Tepuedeayudaraconseguirunbuentrabajo.

LonecesitassiquieresestudiarenlaUniversidad.

Eselidiomaquelagenteempleaparahacernegociosentodoelmundo.

www.enfoqueseducativos.es

569

Nmero 2 noviembre -2007


-

Puedescomprendermscosassobreelmundosileesrevistasyperidicosingleses
oamericanos.

Aadecualquierotromotivo:.

Si logramos conocer a nuestros propios alumnos, entenderemos mejor sus


comportamientos.Conestosalumnostmidos,tenemosquesermspacientesyanimarlesa
participar poco a poco, hacindoles comentarios positivos, sonrindoles cuando hagan
esfuerzospersonalesyproporcionndolesactividadesquesuponganunamayordificultadcada
vez. As, no slo ellos adquirirn un sentimiento de xito, sino tambin nosotros, los
profesores,yaqueademsdequeelniveldeinglsmejorar,anivelpersonallesestaremos
ayudandoasuperarse.

REFERENCIASBIBLIOGRFICAS:
- BRUMFIT,C.(1980).ProblemsandPrinciplesinEnglishTeaching.PergamonPress.
GARDNER,R.yLAMBERT,W.(1972).AttitudesandmotivationinSecondLanguageLearning.
NewburyHouse.
STONES,E.yMORRIS,S.(1972).TeachingPractice:ProblemsandPerspectives.Methuen.
WRIGHT,A.(1987).Rolesofteachersandlearners.OxfordUniversityPress.

www.enfoqueseducativos.es

570

Nmero 2 noviembre -2007

MDELCARMENRODRGUEZDELRO
26.493.683Y
FLASHCARDSENEDUACINSECUNDARIA,CONQUPROPSITO?

Hay herramientas que son tiles slo y exclusivamente si han sido previamente
preparadasporelprofesor.Flashcards(lminasilustrativas),psters,tablas,grficos,juegos,
grabaciones de CDs y DVDs e incluso los mismos libros de texto estn ah para ayudar al
profesorado.Noestndiseadosparaserusadossinmotivo,porques.Notienesentidohacer
undibujosilosalumnosyasabenloquelapalabrasignifica.Losmaterialestienenqueaportar
algonuevoalaleccin.Porejemplo,hayprofesoresqueopinanquelosmediosaudiovisuales
harnsuclasemsinteresante.Esoserciertosilasherramientasestnclaramenteintegradas
en la organizacin global del profesor y contribuye a ese objetivo. Estas herramientas
utilizadassinpreviaplanificacinsuelenconfundirymolestaralosalumnos.

Para elaborar flashcards, podemos utilizar recortes de revistas, peridicos, folletos

publicitarios, Cada conjunto de flashcards deber mostrar conexin con los conceptos
lxicos, funcionales, categoras gramaticales, por ejemplo: comida, rutinas o hbitos,
habilidades, gustos, hobbies, Se pueden usar las flashcards para presentar nuevo
vocabulario,comoactividadpreliminar,parapracticarladestrezaoral,...Podemosorganizara
losalumnosenpequeosgrupos,mezclarlasflashcards,cogerunnmerodeterminadode
lminascadaunoyjugaralgnjuegoparapracticarfuncionescomopedirydarcosas.Tambin
sepuedenponerenlasparedesdelaclaseparaambientaryfamiliarizaralosalumnosconel
temaquesevaatrabajar.

Algunasactividadesquesepuedenllevaracaboconflashcards:
a) Mostrar las lminas: se pueden disear lminas con dibujos o palabras
relacionadas con un tema. El profesor puede repartir diferentes lminas a los
alumnosdelaclase,entonceslescuentaunahistoriaylespidequemuestrenlas
lminascuandolostrminoscorrespondientesseanmencionados.
b) Dilogos en los que tienen que sustituir algn trmino con las palabras de las
lminas;porejemplo:CanIborrowyourpencil/book/ruler?

www.enfoqueseducativos.es

571

Nmero 2 noviembre -2007


c) Cadenas:Ivegotapencil.Ivegotapencilandaruler.Ivegotapencil,arulerand
abook,
d) Clasificarlosdibujos/palabrasmezcladasdedistintostemas.
e) Juegos de flashcard en grupos, tratando de emparejar las palabras con sus
correspondientesimgenes.
f)

DiccionariodedibujosPicturedictionary.

Pararesumir,losprofesorespodemosutilizartodoestematerialtantoconalumnosde
EducacinPrimariacomoconalumnosdeEducacinSecundaria.Porquno,sisepreparana
concienciaysonbienempleados?
REFERENCIASBIBLIOGRFICAS:
ALLWRIGHT,R.(1981).Whatdowewantteachingmaterialsfor?(ELTJournal36/1).
BUSHMAN,JohnH.(2001).TeachingEnglishCreatively.CharlesC.ThomasPublisherLtd.
TOMLINSON.B.(1997).MaterialsDevelopmentforL2Teaching.CambridgeUniversityPress.
WRIGHT,A.(1984).AThousandPicturesforTeacherstoCopy.Collins.

www.enfoqueseducativos.es

572

Nmero 2 noviembre -2007


MDELCARMENRODRGUEZDELRO
26.493.683Y
ESTILENSEARFONTICAANUESTROSALUMNOS?
SELESPUEDEENSEARFONTICA?

Laimportanciadelapronunciacinentrminoscomunicativosestrelacionadaconla

habilidad del alumno para codificar y descodificar mensajes de forma adecuada en una
segundalengua.Latareaesdifcil,yaqueintentamosfamiliarizaranuestrosalumnosconun
sistema fonolgico que no se parece al de su lengua materna en muchos aspectos (por
ejemplo, el sistema voclico del ingls posee doce vocales mientras que el del espaol tiene
cinco, diferentes sonidos consonnticos, acento, formas dbiles, ritmo, ). Podemos mitigar
algunosdeestosproblemascontextualizandolosmensajesoralestantocomonosseaposible
yhaciendounalentaprogresinquefamiliaricealalumnoconestasdistincionesbsicaspoco
a poco. Si nos queremos centrar en la comprensin y expresin oral, debemos ensear la
pronunciacindesdeuna perspectivafuncionalyhacerquelapresentacinoraldelmensaje
precedaasurepresentacinvisualy,posteriormente,presentarsuformaescrita.

Est demostrado que escribir una palabra en la pizarra antes de que los alumnos la

pronuncien puede crear problemas innecesarios. Es mucho mejor seguir el modelo decir y
despus ver / say then see. Si utilizamos la pizarra para practicar la pronunciacin, es
aconsejable emplear smbolos fonticos o quasiphonetics. Si los alumnos conocen los
smbolosfonticos,usmoslos.Sinolosconocen,esmejorrepresentarlossonidosconotros
semifonticos (quasiphonetics). Si empleamos el alfabeto fonmico, ayudaremos a que
seanmsautnomosyseacostumbrarnaellosrpidamente.

El principal objetivo es practicar con la pronunciacin, insistir en su valor, ser

constante, ensear buenos hbitos desde el principio. Si lo hacemos con insistencia y


entusiasmo, se lo tomarn ms en serio; si se trata como un ejercicio sin sentido, nuestros
alumnosreflejarnnuestraactitud.Hayqueempezarconlapronunciacindesdeelprimerda;
por ejemplo, el acento oracional es un buen punto de partida, ya que lo pueden utilizar
inmediatamente.

www.enfoqueseducativos.es

573

Nmero 2 noviembre -2007

Los adolescentes, normalmente, son mejores imitando sonidos que los adultos, pero

lescuestamselacentooracionalylaentonacin(debido,entreotrosfactores,alatimidez,a
la vergenza, etc). As pues, es fundamental tener estos aspectos en cuenta cuando
planificamos actividades que tienen que ver con la pronunciacin. Adems, actividades
relacionadasconpronunciacinsepuedenaplicarenclase,realmente,encualquiermomento
funciones,gramtica,vocabulario,

Con la finalidad de establecer una serie de prioridades cuando nos enfrentemos a la

enseanzadelapronunciacin,enprimerlugardeberemospensarenelnivelalqueestamos
presentandoelmensajeoral.Encualquiercaso,debemosabarcartodotipodeunidadesdesde
el comienzo, simplificando los procedimientos en las primeras fases para ir profundizando
posteriormente. As, desde muy pronto debemos trabajar en la estructura fonolgica del
ingls: elementos segmentales (vocales, consonantes) y los elementos suprasegmentales
(acento, ritmo y acentuacin). Nuestra intencin es proporcionar un sistema interlingstico
adecuadoquepuedaayudaralalumnoaprogresarensuasimilacindelapronunciacindel
ingls.

Paraconcluir,talvez,desdelasprimerasetapasesmssencilloemplearlossmbolos

tradicionales propuestos por la Asociacin Fontica Internacional (AFI /IPA International


PhoneticAssociationparaquelosalumnossevayanacostumbrando,perosindejardeladola
naturalezadelalenguamaterna(loquesedenominaeningls,thenotationsystem.

REFERENCIASBIBLIOGRFICAS:

BAKER,A.(1982).IntroducingEnglishPronunciation:aTeachersGuidetoShiporSheep?And
TreeorThree?CambridgeUniversityPress.
MORLEY, J. (1994). Pronunciation Pedagogy and Theory : New Views, New Directions.
Alexandria,VA:TESOL.
KREIDLER,C.W.(2004).ThePronunciationofEnglish:ACourseBook.BlackwellPublishing.

www.enfoqueseducativos.es

574

Nmero 2 noviembre -2007


MDELCARMENRODRGUEZDELRO
26.493.683Y
ENQUORDENDEBENENSEARSELASCUATRODESTREZASALOSALUMNOS?

No puede haber reglas absolutas en cuanto a cul es el mejor orden en el que se

debe ensear las cuatro destrezas (comprensin oral, comprensin escrita, expresin oral y
expresin escrita). En trminos generales, sin embargo, en el caso del ingls donde la
ortografaesamenudodesconcertante,lasecuenciahear,speak,readandwrite/or,hablar,
leeryescribiresusualmentelamejor.Estasecuencianoeslanicaempleadaenlamayora
de los sistemas escolares, al menos hasta hace poco. Muchos estudiantes empezaban con
textosescritos,hacanejerciciosescritosquepromovansuspropiashabilidadesdeescrituray,
slodespus,escuchabanlalenguanaturaleinclusolahablaban.

Si tenemos en cuenta la forma en la que la gente aprende su lengua materna, es

evidente la primaca de la comprensin oral, de la escucha. La comprensin oral asume una


importanciaparticular,yaque,ademsdeloqueseescucha,muchodeloquesesloseoye
tambininfluyeenelprocesoinconscientedeadquisicin.

Existen algunos experimentos radicales que sugieren que es posible ensear una

lenguaconxitoconpocaprcticadelashabilidadesdeproduccinporpartedelosalumnos
durante las primeras etapas de enseanza. Los efectos se ven posteriormente cuando los
alumnosconsiguenunprogresoinferioraldelamediaenlashabilidadesproductivas.

Talvezlanicadiferenciamsimportanteentreescribiryhablarataealanecesidad

de precisin o exactitud. Incluso los hablantes nativos cometen constantemente fallos


(mistakes)cuandohablan,sinembargo,losfallosalescribirdebenserevitadosatodacosta.
Sededuceque,confrecuencia,haymuchamspresinenprocurarquelosalumnosescriban
bienqueenquelohaganhablando.

Comoexpusealprincipio,noexisteunordennicoparaensearlascuatrodestrezas

comunicativas,perolosprofesoresdebemosprocurarabarcarlastodasentantoencuantonos
sea posible desde el principio; y siempre, evidentemente, adaptando el material y los
contenidosalosnivelesycapacidadesdenuestroalumnado.

www.enfoqueseducativos.es

575

Nmero 2 noviembre -2007

REFERENCIASBIBLIOGRFICAS:
BRUMFIT,C.(1980).ProblemsandPrinciplesinEnglishTeaching.PergamonPress.
STONES,E.yMORRIS,S.(1972).TeachingPractice:ProblemsandPerspectives.Methuen.
WIDDOWSON,H.G.(1988):TeachingLanguageasCommunication.OxfordUniversityPress.
ZAMEL, J. (1993). Writing: The Process of Discovering Meaning. TESOL Quaterly 16/2: 195
210.

www.enfoqueseducativos.es

576

Nmero 2 noviembre -2007

MDELCARMENRODRGUEZDELRO
26.493.683Y
CMOENSEARANUESTROSALUMNOSAHABLARINGLSENPBLICOSINMIEDO?

Hablar puede ser una habilidad difcil en nuestra lengua materna; lo mismo sucede

cuando la lengua en cuestin es una lengua extranjera. Hablar bien no es slo cuestin de
producir la lengua de forma oral, sino que tambin implica el ser capaz de comprender
mensajes orales. Los profesores debemos tener en mente que los alumnos deben ser
provistos,primeramente,conunagrancantidaddeinformacin(input).

La inhibicin de los alumnos puede estar ocasionada por numerosos factores, por

ejemplo,elsentirseexpuestoanteotroscompaeros,faltadeseguridadensmismos,presin
porestaranteunpblico(suscompaerosdeclase),miedoacometerfallos,dudas,eltener
querecurrirasulenguamaterna,dificultadesparaexpresarloquequierendecireninglsola
lengua extranjera, falta de vocabulario, carencia de conocimientos de las estructuras de la
lenguaextranjeray/odefuncionesofaltadeinterseneltemaqueseesttratando.

Nohayunarecetamgicaparamitigarlosefectosdeestoselementos,perounabuena

forma de comenzar es creando situaciones en clase donde los alumnos se sientan lo


suficientemente cmodos y tranquilos como para que se arriesguen a hablar en ingls. La
ansiedadpuedeproducirnoslolaincomodidadquealgunosalumnosexperimentancuando
tienenqueusarlalenguaextranjeraenclasesinotambinfrustracin.Esfundamentalquelos
alumnosasumanqueloserroressonpartedelprocesodeaprendizajeyquesoninevitables.
As, nosotros, los profesores debemos aprovechar cualquier oportunidad y reforzar los
progresosquelosalumnosvanhaciendoenlalenguaoral.

La ansiedad se puede deber a la personalidad y los bajos niveles de destreza en la

lengua,perosuefectoestdirectamentevinculadoalapercepcinqueelalumnotienedelo
quesucedeasualrededor.Enconsecuencia,ladinmicadeclasepuedeayudaramejoraresta
situacin. Una forma de lograrlo es hacer que los alumnos tengan oportunidades para
expresarse sin estar expuestos a una audiencia. As pues, si pedimos a los alumnos que
trabajenjuntosenpequeosgrupos,hablareninglssermenosintimidatorio.Trabajandoen
parejasopequeosgrupos,maximizaremoseltiempodeclasey,adems,prepararemosalos

www.enfoqueseducativos.es

577

Nmero 2 noviembre -2007


alumnosparainteraccionesreales,puestoquepuedenemplearlosmecanismospararesolver
los problemas comunes que surgen cuando intentan comunicarse. Trabajando en pequeos
grupos,crecelaseguridadquetienenonotienenensmismos;asuvez,tambincontribuyea
construir en los alumnos una imagen positiva de ellos mismos como hablantes de la lengua
extranjera,alverquepuedendesenvolverseenlostemaspropuestosparadiscutirenclasey,
consecuentemente,percibenunasensacindeprogresoylogroconelpasodeltiempo.

Tambin es muy importante procurar que lo que se hable tenga relevancia para los

alumnos para que quieran participar. Cmo se logra esto? Tener como punto de partida la
propiaexperienciadelosalumnososusintereseslesofrecelaposibilidaddehacerreferencia
o expresar sus verdaderos sentimientos, actitudes y puntos de vista, y puede significar una
grandiferenciaenlavoluntadquetengandehablar.Algunosmediosparahacerleshablaresel
usodeenunciadosprovocadores,decirlesalgoqueestimulesureaccin;losalumnospueden
sentirquelosestsprovocandoyrespondern.Laresolucindeproblemasesamenudouna
buena fuente de conversacin. Otro recurso efectivo es con information gap (informacin
incompleta)(losdosinterlocutorestienendiferentesbloquesdeinformacinylaconversacin
consisteenelintercambiodedatos).Estaactividadsepuedehacerporparejas.

Otro elemento que contribuye a la seguridad en s mismo del alumno es hacer las

actividades ms sencillas. El temor a cometer fallos se reduce y si le proporcionas bastante


ayuda,laactividadsermuchomsfcil.

Losprofesoresnodebemosolvidarqueesunerrorplanificarunaconversacindentro

de una leccin, puesto que las conversaciones planeadas normalmente generan silencio o
implicansloaunpequeonmerodealumnos.Sieltemaesdemasiadogeneral,puedeser
interesante; si es demasiado especfico, algunos pueden interesarse y otros no. La
conversacin natural fuera del entorno de clase es espontnea y la gente contribuye de
manerasdiversas.Pornaturaleza,algunaspersonassonmuylocuacesyotrasmuycalladas.En
todoloposible,deberamosincorporarlosrasgosdeunaconversacinnaturalalasactividades
declase.Laconversacinenclasesermsefectivasisurgenaturalyespontneamentedeun
texto,unejemplo,uncomentariohechoporunalumnooalgoqueocurredurantelaclase.La
espontaneidadesesencial.

Confianza, motivacin y buena voluntad van juntas cuando se est aprendiendo a

hablar. Cuanta ms prctica acumulen los alumnos, ms positiva ser la imagen que ellos
construyandesmismos.Experimentarnunsentimientodexito.
www.enfoqueseducativos.es

578

Nmero 2 noviembre -2007

Podemosconcluirdiciendoquelosprofesoresnodebemoscesarennuestrosintentos

por conseguir que los alumnos hablen en ingls en pblico. Ser cuestin de hacer que las
actividadesseacoplenconlosinteresesdenuestrosnios,delniveldeinterlenguaqueposean
y de las necesidades. El acto de habla se concentra en la fluidez ms que en la propiedad o
perfeccin,esdecirspeakingconcentratesonfluencyratherthanaccuracy.Deacuerdocon
esta premisa, los profesores no debemos corregir errores de estructura que no sean
importantes y, en caso de tener que corregir, habr que hacerlo cuando la conversacin
finalice, no se debe interrumpir la fluidez. Los profesores debemos aprender a tomar una
posicindeobservador.Merecelapenainvertireltiemponecesarioenclaseendesarrollarla
destrezadehablaextranjeraporpartedelalumnohastaconseguirquetengaxito.Elhablaes
un constituyente necesario en cualquier lengua; no tiene sentido estudiar una lengua
extranjerasinoseescapazdeutilizarlaconpropsitoscomunicativos.
REFERENCIASBIBLIOGRFICAS:
BILBROUGN, NICK (2007). Dialogue Activities: Exploring Spoken Interaction in the Language
Class.CambridgeHandbooksforEnglishTeachers.C.U.P.
GARDNER,R.yLAMBERT,W.(1972).AttitudesandmotivationinSecondLanguageLearning.
NewburyHouse.
UR,P.(1981).Discussionsthatwork.CambridgeUniversityPress.
WATCYNJONES,P.(1987).PairWork:ActivitiesforEffectiveCommunication.Penguin.

www.enfoqueseducativos.es

579

Nmero 2 noviembre -2007


MDELCARMENRODRGUEZDELRO
26.493.683Y
ESELTRABAJOPORPAREJASIMPORTANTEPARALACLASEDEINGLS?

Elprofesordeinglsdebedesarrollarestrategiasparamaximizarlacantidaddetiempo

queelalumnopasehablandoenlalenguaextranjera.Eltrabajoporparejas,bienorganizado,
esunadelasformasmsimportantesparalograrlo.

Paraquelaactividadestbienorganizada,elprofesordebedarinstruccionesclaras

yexplcitasdeloquehayquehacery,mientrasqueeltrabajoenparejasestteniendolugar,
elprofesordebeestardandovueltasporlaclasemonitorizandoy,siesnecesario,guiandoy
corrigiendo lo que cada pareja est haciendo. Es til escribir en la pizarra un esquema, un
esbozoomodelodeloquelasparejasdeberanestarhaciendooapuntaralgunaspalabraso
frasesclave.

Transcurrido un tiempo prudencial de trabajo en parejas, una o dos de ellas sern

invitadas a demostrar o representar lo que han estado haciendo; posteriormente, el


profesor deber aadir comentarios (correcciones, sugerencias, ). Entonces las parejas
volvernarepetirlaactividad,intercambindoselospapeles.

Unadelasprincipalespreocupacionesdealgunosprofesoresesquealgunaparejano

esthaciendolaactividadoqueestnusandolalenguamaterna(encualquiercaso,estono
sucede tambin cuando trabajan individualmente?, por ejemplo, algunos alumnos no hacen
los ejercicios). Pero es importante recordar que la mayora estarn trabajando bien. Los
profesores no debemos dejar de hacer actividades por parejas simplemente porque no
obtengamosexcelentesresultadoscontodoslosalumnosalavez.
Eltrabajoporparejassermsefectivosilosprofesores:
a) Nosotros mismos dividimos el grupo en parejas y nos aseguramos de que todos
losalumnossabenconquintienenquetrabajaryculessupapel.
b) Nos aseguramos de que todo el mundo tiene claro lo que se supone que tienen
quehacer.
c) Nospaseamosporlaclase,escuchandoycomprobandoqueloestnhaciendo.
d) Paramoslaactividadcuandoesevidentequetodoelmundohaterminado.

www.enfoqueseducativos.es

580

Nmero 2 noviembre -2007


e) Hacemos un seguimiento del trabajo con una demostracin o resumen de una o
msparejas. Sinoestbienhecho,secorrigeyse ayuda;despussepidealos
alumnosquerepitanlaactividad.
f)

Hacerdeestaprcticaalgohabitual.

Eltrabajo porparejases uninstrumentoquenossirveparaaumentareltiempoque


pasahablandoeninglselalumnoydebemoshacerusodel,aunquepuedapareceruncaos
(que no lo es si se ha preparado adecuadamente!). No debemos tener miedo del ruido en
clase,lalenguaoralhayquepracticarlay,paraelloelsilencionotienemuchosentido.
A los alumnos les gusta saber lo que se quiere de ellos. Si les pedimos que trabajen
silenciosa, individualmente o por parejas, en cualquier caso hay que indicarles unas
limitacionestemporales.

REFERENCIASBIBLIOGRFICAS:

BILBROUGN, N. (2007). Dialogue Activities: Exploring Spoken Interaction in the Language


Class.CambridgeHandbooksforEnglishTeachers.C.U.P.
HADFIELD,J.(1992).ClassroomDynamics.OxfordUniversityPress.
WATCYNJONES,P.(1987).PairWork:ActivitiesforEffectiveCommunication.Penguin.

www.enfoqueseducativos.es

581

Nmero 2 noviembre -2007


M DEL CARMEN RODRGUEZ DEL RO
26.493.683-Y
QU ES UN BLOG?
CMO PODEMOS UTILIZARLO CON OBJETIVOS EDUCATIVOS?
UnaformaabreviadadeltrminoWebblob,elblogesunaherramientadepublicacin
en lnea online que permite a la gente hacer pblicos sus gustos, pasiones, antipatas,
descubrimientos e ideas. Un blog (tambin denominado blog o bitcora es una pgina web
donde se escriben textos o artculos en orden cronolgico, frecuentemente en orden
cronolgicoinverso.Lapalabrablogtambinsepuedeusarcomoverbo,conelsignificadode
manteneroaadircontenidoaunblog.
Legalmente, un blog puede ser privado, como en la mayora de los casos, o puede
funcionarconobjetivoseconmicos,denegocios.Losblogsqueseutilizaninternamentepara
realzar la comunicacin y cultura de una corporacin, para comercializar o poner marca de
fbrica,sedenominanblogscorporativos.
Todos los blogs comparten algunas caractersticas generales. Comnmente, los
lectores pueden escribir sus propios comentarios en un blog concreto y el autor puede
responderles, de forma que es posibleestablecer una especie de dilogoo debate. Pero
depende del tipo de blog, porque algunas herramientas para disear blogs no permiten a la
gentesucolaboracin.Porlotanto,lacapacidaddequeloslectorespuedandejarcomentarios

en un formato interactivo es una parte importante de muchos blogs.


Numerososblogsofrecencomentariosonoticiasacercadeuntemaenconcreto;otros
funcionancomodiariospersonalesonline.Unblogtpicomezclatextos,imgenes,enlacesa
otrosblogs,pginaswebyotrosmediosrelacionadosconeltemaquetrata.Lamayoradelos
blogssonprincipalmentetextuales,aunquealgunosincluyenfotografas(photoblogs),vdeos
(vlog), msica (MP3 blog), audio o sonido (podcasting), arte (artlog, que es una forma de
compartirypublicararteenunformatoblog,peroconelusopredominanteyelenfoqueen
trabajosdeArtemsqueentexto);todosellossonpartedeunentramadovirtualmsamplio
delosmediossociales.

www.enfoqueseducativos.es

582

Nmero 2 noviembre -2007


El blog moderno evolucion del diario en lnea, donde la gente llevaba una relacin
actualizadadesusvidaspersonales.

Hayvariostiposdeblogsycadaunosediferenciaeneltema,elusoyenlaformaen
losqueeltemasedesarrollaoescribe.Conrespectoaltema,existenblogspersonales,blogs
de viajes, blogs de moda, blogs acerca de proyectos, blogs tecnolgicos, blogs educativos
(edublogs),sobrepoltica,periodismo,negocios,blogsjurdicos,etc.

Internet ofrece un gran instrumento pedaggico para la enseanza del ingls. Por
consiguiente, nosotros, los profesores, no podemos ignorar todas las posibilidades que las
tecnologas de la informacin y la comunicacin nos muestran; debemos explotar todos los
recursosposiblesdelared.
As pues, debemos familiarizarnos con edublogs; un edublog es un blog escrito por
alguienrelacionadoconlaeducacin.Ejemplos:blogsescritosporoparaprofesores,blogscon
elpropsitodeformacinparalaclase,blogsacercadelapolticaeducativa,Lacoleccinde
estosblogsesllamadaedublogosphereporalgunos,teniendoqueverconlagranblogosphere;
sinembargo,notodoelmundoestdeacuerdoconestadenominacin.Otrosserefierenala
comunidadocoleccindeblogsybloggerscomoedusphere.Entreotras,unadelasprincipales
ventajas de la web es su gran capacidad para facilitar el acceso a la informacin; en la
enseanza de idiomas, las barreras geogrficas para obtener textos escritos o materiales
audiovisuales en la lengua extranjera desaparecen. Lo que es ms, los alumnos se motivan
muchocuandoellostrabajanconestosmedios.

Y una de las herramientas ms fascinantes que ha surgido de Internet


recientemente es el blog. Debido a su estructura, los blogs son un instrumento
muy til para ensear. Por qu? Algunas de las razones son las siguientes:

Proporcionaprcticademslecturasparaestudiantes.

Guaalosalumnoshaciarecursosonlineapropiadosparasunivel.

Promueveunsentimientodecomunidad.

Animaalosalumnostmidosaparticipar.

Motivaanuestrosalumnosausarlalenguadeformaautnoma.

www.enfoqueseducativos.es

583

Nmero 2 noviembre -2007

Simuladiscusionesdefueradeclase.

Fomentaunaaproximacinenfocadaenelprocesodeescritura.

Creaunespacioparalosalumnosdondepresentarsusproyectos,exponersus
opiniones,practicarelidioma,informarse,...

Lesproporcionamaterialrealeirreal.

Promuevequelosalumnosusenlatecnologa.

Pero como todo lo relacionado con nuestros alumnos, la seguridad y la privacidad


debensertenidasencuenta.Porlotanto,serecomienda:

Pedirunaautorizacinescritadelospadresdelosalumnos.

Losblogsdebensercontroladosporelprofesor/es.

Queslopuedanaccederaquellaspersonasqueestnregistradasytenganla
claveparaello.

Lainformacinpersonal(direccindeemail,etc)debeserprivada.

Cuandoestamosenseando,podemostrabajar,porejemplo,contrestiposdeblog:

El blog del Tutor: dirigido por el profesor; aqu, los alumnos slo pueden escribir
comentariosacercadeloqueelprofesorhapublicado.

Elblogdelaclaseoblogcompartido:espacioparadebates,unaespeciedeextensin
extracurricular de la clase. Aqu, los alumnos se implican ms y experimentan una
sensacindelibertad.

El blog del alumno: requiere ms esfuerzo y tiempo por parte del profesor, ya que
cadaalumnoposeesupropioblog.Suprincipalventajaesquecadaalumnotienesu
espacioenlaredypuedenenlazarconlosblogsdesuscompaeros.

Parafinalizar,acontinuacinpresentoalgunasplataformasdeedublogquesonbastante
interesantesytiles:

Edublogsgratuitos:edublogmuyutilizadoporprofesores.http://edublogs.org.

Classblogmeister: edublog gratuito muy empleado por alumnos y profesores.

http://www.classblogmeister.com.
www.enfoqueseducativos.es

584

Nmero 2 noviembre -2007

EduSpaces: pgina para educadores, la cual incluye blogs. Anteriormente Elgg.

http://eduspaces.net.

Proyectos de investigacin e intercambios de colaboracin y similares en:

http://www.eslblog.comyhttp://www.eslgo.com/

REFERENCIASBIBLIOGRFICAS:
BROOKSYOUNG,S.(2007).DigitalAgeLiteracyforTeachers:ApplyingTechnologyStandards
toEverydayPractice.IstePublications.
RAY,J.(2006).Studentuseandevaluationofanedublog.ThomsonGale
RICHARDSON, W. (2006). Blogs, Wikis, Podcasts and Other Powerful Web Tools for
Classrooms.CorwinPress.
http://edublogs.org.
http://eduspaces.net.

MDELCARMENRODRGUEZDELRO
26.493.683Y
QUESUNAWEBQUEST?

CMO SE PUEDE USAR CON FINES EDUCATIVOS (TEFL)?


Las Webquests fueron inventadas por Bernie Dodge y Tom March en la Universidad
EstataldeSanDiegoen1995.
UnaWebQuestesunmtododebsquedaorientado,dondelamayoradelasfuentes
procedendelared/web;ademsesunaactividaddeaprendizajeempleadaporeducadoresen

www.enfoqueseducativos.es

585

Nmero 2 noviembre -2007


el aula. Durante dicha actividad, los alumnos leen, analizan y sintetizan informacin usando
internet.
Las Webquests se centran en una orientacin constructivista; una Webquest es una
estrategiainstructivaaltamentevalorada,durantelacuallosalumnosconstruyenactivamente
su propia comprensin crtica de un tema. Durante esta actividad, la cual es atractiva,
motivadora y posible, a menudo se buscan preguntas o problemas y los alumnos pueden
trabajarycooperarparahallarlassoluciones.
Los profesores pueden alterar la rigidez de la actividad animando o exigiendo a los
alumnosconformealosdiferentesnivelesdeabstraccin.Laspreguntaspuedenserdefinidas
porlosObjetivosEducativos.
La relevancia de los materiales instructivos es un factor importante porque puede
proporcionarunamotivacinenaumento.
LaestructuradeunaWebQuest:

Una Webquest est construida sobre una tarea atractiva que hace que el alumno

piense.Ellos tienenquehaceralgoconlainformacin.Puedeseralgocreativoounacrtica,
puedeimplicarlaresolucindeunproblema,resmenes,anlisis,Esmsquesimplemente
responder a preguntas o transcribir lo que aparece en la pantalla. Esta actividad debera
corresponderaloquelosadultoshacenenlavidareal.

LaspartesdeunaWebQuestsonlasqueseexponenacontinuacin:
Introduccin Unenunciadoqueenganchaenprimerlugar,preparaelescenariopara

Tarea

la WebQuest. Incluye la pregunta central o la que gua; la WebQuest


tienequeverconella.

Unadescripcindelresultadofinaldeltrabajodelalumno;elproducto
quedirigetodaslasactividadesdelaleccin.

Proceso

Una descripcin detallada de cmo los alumnos ejecutarn la tarea.


Incluye recursos online (y offline), descripciones y gua de los pasos

www.enfoqueseducativos.es

586

Nmero 2 noviembre -2007


individualesdelproceso.
Evaluacin

Los medios para evaluar la tarea final. Puede incluir exmenes para
medirlascompetenciasologrodelasdestrezas.

Conclusin

Enunciado final; puede incluir reflexiones acerca de la leccin o


extensionesdelcontenidoparaposteriorexploracin.

CmodesarrollarunaWebQuest:

LosalumnospuedentrabajarconWebQuestsengruposcooperativos.Cadaalumno

en el grupo puede tener asignado un papel o un rea especfica en la que investigar. Las
WebQuests pueden adoptar la forma de escenarios de roleplays o representaciones,
dondelosalumnosrepresentanelpapeldeinvestigadoresprofesionalesofigurashistricas.

Actualmente,lasWebQuestssonunagranherramientaparautilizarenclaseporlos

profesoresy,dehecho,cadavezmsseestempleandocomoinstrumentopedaggico.Las
WebQuests dan respuesta al objetivo educativo o competencia bsica de aprender para
saberoensearaaprenderfomentadoporlaUNESCO.PodemosbuscarWebQuestsque
traten un tema concreto o podemos elaborar la nuestra empleando un editor web como
Microsoft FrontPage o Dreamweaver y con un servicio blog. Esta herramienta permite a los
alumnos completar varias tareas empleando otros instrumentos (por ejemplo MS Word,
PowerPoint, Publisher, Access y Excel). Una WebQuest es una gran forma de integrar las
tecnologasennuestraclase.
Finalmente,lasWebQuestsnotienenporqudesarrollarsecomounapginawebde
verdad. Pueden construirse y complementarse usando tecnologas menos exigentes, (por
ejemplo,puedenguardarsecomoundocumentodetextoenunordenadorlocal).
Una referencia interesante es: http://www.vivenciapedagogica.com.br; explica
diversas experiencias utilizando WebQuests, proyectos con esta metodologa, incluyendo las
nuevastecnologasylasherramientascomunicativas.
TiposdeWebQuests:
www.enfoqueseducativos.es

587

Nmero 2 noviembre -2007

WebQuest cortas: para adquirir y organizar la informacin (observacin, anlisis y


sntesis).Duracin:deunaatressesiones.

WebQuest largas: extensin y procesamiento de informacin (deduccin, induccin,


clasificacin,abstraccin,etc).Duracin:deunasemanaaunmes.
Para finalizar: Por qu es interesante utilizar WebQuests en la enseanza de una

lenguaextranjera?Aquhayalgunasrazones,pero,seguramente,cadaprofesorpuedehallar
muchasms:

Esmuymotivadora.

Ayudaadesarrollarlosprocesoscognitivos.

Promuevelainterdisciplinariedad.

Favorecelacolaboracinylacooperacin.

Fomenta la lectura, el aprendizaje y el uso de vocabulario a travs de interacciones


reales,conmaterialesrealesextradosdelared.

Desarrollacompetenciascolaboradorasdeaprendizaje.
EstdemostradoquelasWebQuestssonunaherramientamuytilyuninstrumento

pedaggicoparaprofesores,parasuexplotacinenclase.

REFERENCIASBIBLIOGRFICAS:
BREWER,T.(2004).WebQuests:TheSecrettoGuidedEmpowerment.VisionsTechnologyEd.
BROOKSYOUNG,S.(2007).DigitalAgeLiteracyforTeachers:ApplyingTechnologyStandards
toEverydayPractice.IstePublications.
HOCKERT,M.Integratingtheworldwidewebintoclassroomcurriculumusingwebquests.Ed.
MichaelHockert.
http://www.vivenciapedagogica.com.br

www.enfoqueseducativos.es

588

Nmero 2 noviembre -2007

MDELCARMENRODRGUEZDELRO
26.493.683Y
VENTAJASDELSILENCIOENCLASE

Silencioenlaclase?Enqusentido?Silencioporpartedelosprofesoresodelos

alumnos?Algunosprofesoressuelenhablardemasiado.Esaconsejablereducireltiempoque
el profesor pasa hablando y aumentar el del alumno porque es ste quien necesita tiempo
para practicar. Evidentemente, los alumnos no deben pasar todo el tiempo escuchando al
profesor,sinoqueselesdebeinvolucrarenlaclase.Sinembargo,estonosignificaquehaya
quehacerquetodoslosalumnoshablenenclaseoqueelalumnoquenoesthablandono
est participando. Dependiendo de la materia en la que estemos, exceptuando una clase de
lengua o idiomas, el profesor puede pasar la mayor parte del tiempo en clase hablando,
teniendo en cuenta que puede ser muy aburrido o que los alumnos no participarn. Los
alumnos necesitan muchas oportunidades para hablar en las clases de idiomas, pero los
profesoresdebemosevitarpresionarlosoforzarlosahablar.
Los investigadores lingsticos estn de acuerdo en que la mejor forma de aprender
una segunda lengua, como la lengua materna, es escuchndola. Los alumnos deben
comprenderalgoolamayorpartedeloqueoyen,perotambinnecesitanestarinteresadosy,
por supuesto, participar. Si nuestros alumnos escuchan atentamente y participan en lo que
estnoyendo,desarrollarnsusdestrezasdecomprensinoralytambinsunivelgeneraldel
idioma.

Nosotros, profesores, nos empeamos en hacer que nuestros alumnos hablen y, a

menudo, olvidamos que el silencio tambin juega un papel importante en las clases de
idiomas. Estar hablando constantemente cansa. Los alumnos necesitan tiempo para pensar,
repasarsusideas,tomarapuntes,etc.Elsilencioesespecialmentevalioso:

Cuando los alumnos estn trabajando individualmente (leer un texto o una


explicacin,haciendoactividades,preparandountrabajo,haciendounexamen,).
Sielprofesorhablamientrastanto,interrumpelaconcentracindelosalumnos.

Cuando un alumno duda durante la realizacin de un ejercicio o buscando una


palabra, si el profesor le facilita de inmediato la respuesta, el alumno se volver

www.enfoqueseducativos.es

589

Nmero 2 noviembre -2007


cmodo o perezoso. Esta batalla silenciosa para comprender o pensar forma parte
delprocesonaturaldeaprendizajedeunalengua.

Cuando se est hablando de un tema, o se est hacienda un debate, el alumno


puedequenecesitetiempoparaexpresarunpensamientoysinosotrosledamoslas
ideas constantemente, los alumnos siempre esperarn que sea el profesor quien
hagaeltrabajo.

Enocasiones,elsilencioseproducealcambiardeactividadosimplementeporque
estnpensando.

Elhechodequehayasilencioenclasenosignificaquenoseesthaciendanadaoque
nada est ocurriendo. Lo mejor es mantener un equilibrio entre actividad y momentos de
silencioparareflexionar.Tampocodebemostemerquehayaruido.Noesciertoloquealgunos
opinancuandodicenqueunaclaseensilencioeslamejorclase.Ambos,ruidoysilencioson
doscarascomplementariasdelamismamoneda.

REFERENCIASBIBLIOGRFICAS:

BELTRN.J.A.(1993).Procesos,estrategiasytcnicasdeaprendizaje.EditorialSntesis.
BROUGHTON, Dr. G. (1993). Teaching English as a Foreign Language. Routledge Education
Books.
BRUMFIT,C.(1980).ProblemsandPrinciplesinEnglishTeaching.PergamonPress.
GARDNER,R.yLAMBERT,W.(1972).AttitudesandmotivationinSecondLanguageLearning.
NewburyHouse.

M DEL CARMEN RODRGUEZ DEL RO


26.493.683-Y

LAVOCACINDEDOCENTE

www.enfoqueseducativos.es

590

Nmero 2 noviembre -2007

Responderaestainterroganteimplicavolveramiinfancia:amicontextofamiliarya

misrecuerdosdelcolegio.Comonoesmiintencinaburriranadie,noospreocupis,novoya
contarmividahastaahora;peromegustarasituarosparaquepodiscomprendermidecisin
deserprofesora.
Nac,nohacedemasiadosaos,enunafamiliallenadeprofesores:mipadrehasido
profesor(hastahacepoco,yasehajubilado),mimadreestudiMagisterio,muchosdemistos
ytassonprofesores,einclusoalgunosdemisprimosysusparejas(esposos/esposas).Asque
cuando decid que quera ser profesora, no fui muy original. (Mis hermanos han roto la
tradicin, uno es mdico y el otro ingeniero). Pero desde que era pequea, sola jugar a ser
profesoraymismuecas/hermanos/amigoseranmisalumnos;inclusotenaunapequea
pizarra(laadoraba).
Cuando fui al colegio, algunos profesores me influyeron en el sentido de que me
gustaba cmo nos enseaban, cmo nos trataban y me motivaban a esforzarme, a trabajar
duroparaconseguirloquequera.Tambinrecuerdoamiprimerprofesordeingls,yaque
estaba enamorada platnicamente de l, como la mayora de mis compaeras. En cierto
modo,talvez,ledeboelhechodequererserprofesoradeingls.Sinembargo,tambintengo
algnrecuerdonogratodelcolegio.Recuerdoaunaprofesoraqueeramuysecayruda,arisca,
poco paciente, nada tolerante; pero de ella tambin aprend algunas actitudes hacia los
alumnos,lascualestengoqueevitar.
Enelinstituto,miexperienciafuebastanteinteresante.Noestabamuysegura,tena
mis dudas de qu iba a estudiar en el futuro porque me inclinaba por carreras totalmente
distintas. De nuevo, algunos profesores me ayudaron a darme cuenta de qu era lo que
realmentequeraomegustabamsy,conelapoyodemispadresmefuialaUniversidada
estudiarFilologaInglesa.Unaexperienciadecincoaos,omejordicho,cincoaosllenosde
experiencias;algunasdeellasmuybuenas,otrasnotanbuenasyalgunadecepcionante.Pero
cuando quieres algo y crees que eso te har feliz, luchas y trabajas cuanto puedes para
lograrlo.

Entonces,undatelicenciasyescuandoteenfrentasalavidareal.Elrecorridono

ha finalizado, por supuesto; es el comienzo de un nuevo camino. Y ste es totalmente


diferentealanterior.Tienesqueencontraruntrabajo:Profesora.Porqu?Bueno,megusta

www.enfoqueseducativos.es

591

Nmero 2 noviembre -2007


trabajar con la gente, con adolescentes y con otros profesores. La adolescencia, esa etapa
compleja, llena de cambios, de confusiones, de rebelda, de dinamismo y energa, de
reaccionesinesperadas,decuestionarsetodo,eslaquemellamalaatencin.

Para m, ser profesora no es tan slo ensear ingls, es facilitar a los alumnos los

instrumentos que les servirn para el futuro, es educar, ensear valores, actitudes o
comportamientos,esguiarlesenelprocesodeconvertirseenadultos,eshacerlessentirquete
preocupas por ellos (especialmente si ese alumnoest pasando por una situacin difcil y se
sientesolo),etc.Enmiopinin,dependiendodelaformaenlaquetquierasdesarrollartu
experienciaeducativa,serprofesorimplicaunpocodemuchasotrasprofesiones:tienesque
ensear ingls, educar a los alumnos, ser psiclogo, mediador cuando surja un conflicto,
enfermeraomdicocuandonoseencuentranbien,unjugadordeajedrez(cuandotienesque
elaborar la estrategia de a quin sientas junto a quin y dnde), un organizador de eventos
(excursiones,actividadesparacelebraralgunafestividad,finaldecurso,),Tutor,decorador
(ser lo suficientemente creativo o imaginativo para decorar la clase, preparar juegos o
actividadesentretenidas),entreotrasmuchascosas.
Todoloanteriorhace,param,delaexperienciaeducativaalgointeresante,excitante;
nunca sabes qu te deparar el da, ya que algo que te funcion fenomenalmente un da,
maana no te servir; cada grupo de alumnos, cada alumno, cada momento son diferentes.
Para concluir, personalmente, la enseanza es un trabajo muy vocacional; si lo disfrutas a
pesar de los muchos problemas con los que tienes que tratar, de las buenas experiencias, si
aprendes de esas situaciones y de tus alumnos y compaeros, sers feliz. stas son las
razonesquemehanhechoserprofesora!!

www.enfoqueseducativos.es

592

Nmero 2 noviembre -2007


M DEL CARMEN RODRGUEZ DEL RO
26.493.683-Y
DIVERSINENCLASEMIENTRASAPRENDENINGLS:
FICCINOREALIDAD?

Algunas actividades de aprendizaje de un idioma no son especialmente divertidas. A

muchos alumnos no les gusta tener que memorizar una lista de palabras del vocabulario o
hacer ejercicios largos de rellenar huecos, pero aprender un idioma tiene que ver con
aprendizajesynosiemprepuedeserdivertidooexcitante.Porotrolado,losalumnossuelen
ser reacios a aprender algo a menos que les guste el proceso. Es evidente que no se puede
hablar una lengua extranjera simplemente aprendiendo largas listas de palabras, repitiendo
mecnicamentetrasescucharunCD,etc.Sinembargo,amenudo,ladistincinentreejercicios
tilesydiversinnoestanabismalcomoalgunosprofesorescreen.
La mejor opcin es preparar tantas actividades diferentes como nos sea posible; por
ejemplo,enlugardepreguntarelvocabulario,hacerunjuegodevocabularioosilosalumnos
necesitan prctica por escrito de gramtica, hacer ejercicios entretenidos. Podemos trabajar
con crucigramas, rompecabezas (a los alumnos les gustan incluso en su lengua materna). La
claveesquelaactividadestestructuradaconunpropsitoseriaycuidadosamentedefinido,
perohaciendoqueparezcadivertidooatrayente.

Nuestros alumnos consideran la gramtica como muy poco popular o aburrida. Sin

embargo, nosotros tenemos la oportunidad de cambiar ese concepto. Cmo podemos


conseguir que la gramtica sea divertida? Como he mencionado con anterioridad, a muchos
alumnos les gustan los rompecabezas (crucigramas o buscapalabras) porque cuando los
resuelven, experimentan una sensacin de satisfaccin y si no lo logran, el sentimiento de
fracasonoesmuygrande.Laresolucindeproblemasesunreto,divertido,noesfrustrante,
implica trabajar con gente, comparar, sentido de competicin, Otra manera de ensear
estructuras gramaticales de forma divertida es animar a los alumnos a que exploren y
descubran por s solos las reglas o la actividad en cuestin en lugar de facilitarles desde el
principio toda la informacin. Bajo nuestra supervisin o gua, pueden buscar en internet o
emplearotrosrecursosparaobtenerlasrespuestas.

www.enfoqueseducativos.es

593

Nmero 2 noviembre -2007

En ocasiones, en juegos para practicar el idioma, se repite todo el tiempo la misma

frmula o modelo. Depende del tema o estructura en los que nos queramos centrar. Por
ejemplo,eneljuegollamadoWhoamI?(unalumnohaceelpapeldeunpersonajeyelresto
de los compaeros tienen que adivinar de quin se trata formulando preguntas totales, es
decir,dondeslosepuedaresponderS/No/Yes/No)setrabajanlasinterrogativas;en
otrojuegollamadotheHangman(Elahorcado),sepracticaelabecedario,estructurasdel
tipoIsthereanm?,etc.

Algunos profesores opinan que los juegos deben ser llevados a cabo durante unos

minutos al final de la clase o en la ltima hora del viernes. Pero no debe ser as. Hemos de
recordar que todos los juegos necesitan una cierta preparacin por parte del profesor para
que sean efectivos, dinmicos y divertidos. Es cierto que a la mayora de los alumnos les
apetece ms jugar que hacer ejercicios de gramtica. Aqu, tambin conviene recordar que
todosaprendemosmejorcuandonossentimosrelajadosmentalmenteyabiertosoreceptivos
a la experiencia de aprendizaje. Por lo tanto, si los alumnos estn disfrutando lo que estn
haciendo(teniendounobjetivolingsticoprofundo/superficial),sermsefectivoqueuna
actividadtradicional.

Para trabajar la destreza oral, existe una conocida tcnica que, bien empleada, es

divertida,animada,agilizalaleccin,ayudaalosalumnosarelajarse,permitealosprofesores
crearunaatmsferaagradable,relajadaydinmicaenclase.Estatcnicaeslapronunciacin
coral;significaquetodoslosalumnosdelaclaserepitenalmismotiempo.Estatcnicaestil
en todos los niveles, con todos los alumnos, Se puede aplicar con sonidos individuales o
aislados, palabras, frases, acento, entonacin, rimas, poemas, canciones, trabalenguas
(especialmente divertidos debido a las dificultades para pronunciar ciertos sonidos y por la
velocidadaldecirlos),
Tambinpodemosincorporaralaleccin,enclase,elhumor,esdecir,chistesvisuales,
chistesquedependanenlarelacinquetengamosconnuestrosalumnos,historiasdivertidas,
ysacarleselmximopartido.
Concursos, dramatizaciones, representaciones (role plays), grabar sus actuaciones
(prepararunprogramadetelevisin,porejemplo),usarlastecnologas(internet)ycrearblogs,
o trabajar empleando WebQuests, preparar proyectos en grupos pequeos, usar lminas
(flashcards),realiaomaterialrealyrealizarjuegosinteractivos;todoelloymuchomsson
herramientaseducativasquegarantizanladiversin,siemprequesepreparencorrectamente
www.enfoqueseducativos.es

594

Nmero 2 noviembre -2007


aprioriysinabusardeestosrecursos,porquesinoseconviertenenalgohabitualynocaptala
atencineintersdenuestrosalumnos.
REFERENCIASBIBLIOGRFICAS:
LARCABAL,R.S.(1992).TheRoleofGamesinLanguageAcquisition.Forum30/2.
RIXON, S. (1987). How to Use Games in Language Teaching. (Essential Language Teaching
Series).Macmillan.
SEN,A.L.(1983).TeachingVocabularyThroughRiddles.Forum21/3.
TOMLINSON.B.(1997).MaterialsDevelopmentforL2Teaching.CambridgeUniversityPress.
TURTLEDOVE,Cyndi.(1995).101CommunicativeGamesfortheEnglishClass.Contemporary
PublishingCompany.

MDELCARMENRODRGUEZDELRO.
26.493.683Y

POEMASENLACLASEDEINGLS

El aprendizaje de una lengua extranjera, entre otras muchas cosas, se presta a la

realizacin de: role plays, juegos, canciones, recitacin de nursery rimes, chants, y
muchas ms actividades ldicas. En el presente artculo voy a exponer la experiencia de
aprendizajedeunpoemaeninglsysuposibleexplotacin.

www.enfoqueseducativos.es

595

Nmero 2 noviembre -2007

A muchos nios les gusta aprender y recitar poemas, citas que a veces escriben en

carpetas de compaeros, canciones (poemas con meloda), Partiendo de esta idea, la


siguientepropuestapodrallevarseacabo,porejemplo,en1E.S.O.

Elprimerpasoeslaeleccindelpoema,elcualdebeadecuarsealosinteresesyedad

de los alumnos. He elegido como muestra el siguiente poema que fomenta el valor de la
solidaridadenlafiguradeunvoluntario:
Why be a Volunteer
Its

not

and

for
its

It's

for
lend

to

something

you

not

the

medals

It's

just

for

that

Its

that

reward

the

Of

feeling

buy
worn
feeling

down
that

helping

tithe

cant

others

man.

helping

the

in
youve
far

fame
gain.

fellow
a

give

for

personal

of

to

just

not

any

Its

Its

its

love

just

Thats

money,

not
for

Its
Its

the

hand.
of

self.

with

wealth.

with

pride.

deep

inside.

your

heart.

been

a
and

part.
near.

That makes you a VOLUNTEER.

Antes de recitarles el poema, se puede hacer una lluvia de ideas para ver que

entienden ellos por la figura de un voluntario. A partir de ah, seguimos con la siguiente
organizacin:
Como material necesitaremos rotuladores, papel continuo, folios de colores y lana
paralaelaboracindeunlibro,ocho(cilindrosdecartnderollosdepapelhiginico(tenemos
quereciclaryesunmaterialdefcilacceso),cartulinasdecoloresyrevistas/peridicos.Los
ochocilindrosllevanenunladoundibujoquerepresentalosconceptosqueestnmarcados
encolorrojoenelpoema;enotro,lapalabraescrita.Elnmerodecilindrosdependerdela
cantidaddepalabrasquedeseemosseleccionarenelpoema.
Losalumnossepuedenorganizarsentadosenuncrculoconlafinalidaddeconseguir
un clima ms agradable y relajado. Tras contarles lo que se va a hacer, el profesor recita el
poemamientraslesmuestralosrollosunoauno.Sepuedeacompaarporbodylanguage.

www.enfoqueseducativos.es

596

Nmero 2 noviembre -2007


Sepeganlosochorollosenlapizarra.Despusdehaberrecitadovariasveceselpoema,ocho
voluntariossalen,despeganelrolloytratandedecirsufraseoloquerecuerdendeella.

Paratrabajarlapalabraescritayreforzarelaprendizajedelpoema,sepuedenhacer
otrasactividades:ensearlapartedeldibujoyqueescribanlapalabra,descolocarloscilindros
yquelosordenenporordendeaparicindelaspalabrasenelpoemaomezclarlapartedel
dibujo y de la palabra en los cilindros y que lo ordenen todo a la vez que intentan recitarlo.
Otro ejercicio puede ser que se repartan hojas tamao cuartilla por nio / por parejas; los
alumnosvanaconfeccionarunminilibroconsuportada(paraelttulo,nombredelalumno,
curso,);enlasdemshojas,losalumnoscopiarnunversoodosdelpoemayrealizarnun
dibujoalusivoaeseverso(osidibujanmal,puedenutilizarrecortesderevistas/peridicos).
Cuando est terminado, los laterales de las hojas se perforan y se atan con la lana. Si los
alumnoslodesean,selespuedefacilitarotrospoemascortos/citas/dedicatoriasquepueden
agregarasuminilibroparacuandoquierandedicaralgoenlaagendadelcole.

Bienenpapelcontinuooencartulinasdecoloressepuedepasarelpoemaalimpioy

de forma bonita para que se quede de mural de clase. A los alumnos les gusta este tipo de
actividades porque son diferentes, aprenden vocabulario de forma asequible, y ven un
resultado(susminilibros,elmural,).

Unaformaentremildeacercarnosalaliteraturapopulardeformaldicaenclase.Lo

mejoresirexperimentandoydescubriendoquesloquemejorfuncionaconnuestrogrupo
dealumnos.

REFERENCIASBIBLIOGRFICAS:

APPEL,J.(1990).Survey.:TeachingofLiterature.ELTJournal44/1.
COLLIE,J.ySLATER,S.(1987).LiteratureandLanguageTeaching:AResourceBookofIdeas
andActivitiesforanIntegratedApproachinLanguageTeaching.CambridgeUniversityPress.

www.enfoqueseducativos.es

597

Nmero 2 noviembre -2007


SEN,A.L.(1983).TeachingVocabularyThroughRiddles.Forum21/3.
WRIGHT,A.(1984).AThousandPicturesforTeacherstoCopy.Collins.

www.enfoqueseducativos.es

598

La revista Enfoques Educativos no se hace


responsable de las opiniones y contenidos de los
artculos publicados, dicha responsabilidad recae
en los autores de los mismos.