Está en la página 1de 11

LACTATO DESHIDROGENASA EN PLASMODIUM FALCIPARUM

PLASMODIUM FALCIPARUM: es un protozoo parsito, una de las


especies del gnero Plasmodium que causa malaria en humanos. Es
transmitida por mosquitos Anopheles. Se pueden observar diferentes
fases evolutivas, en el mosquito Anopheles (donde se reproduce el
parsito), en el interior de los hepatocitos y en el interior de los glbulos
rojos del hospedador humano. P. falciparum transmite la forma ms
peligrosa de malaria con los ndices ms altos de complicaciones y
mortalidad, productor del 80% de todas las infecciones de malaria y 90%
de las muertes por la enfermedad. Su prevalencia predomina en el frica
subsahariana, ms que en otras reas del mundo.
LACTATO DESHIDROGENASA: La
lactato deshidrogenasa, una
oxidorreductasa 33 kDa. Es la ltima enzima de la va glucoltica, esencial
para la generacin de ATP y una de las enzimas ms abundante
expresada por P. falciparum. (PLDH) y no persiste en la sangre.
El plasmodium falciparum produce el lactato deshidrogenasa con el fin de
prevenir la intoxicacin y muerte por el radical libre del xido ntrico.[] El
xido ntrico es producido por lisosomas de fagocitos celulares del
sistema inmune animal, incluyendo los humanos. Esta facultad le permite
resistir la inmunidad innata del hospedador y establecer una infeccin
bacteriana.
La produccin de esta protena es un factor indispensable para la
deteccin de la presencia de este parasito en el organismo humano
dando a conocer que existe una infeccin por parte de este (permite
establecer que el organismo est infectado con malaria). (1)

EXTRACCIN DE LACTATO DESHIDROGENASA DEL PLASMODIUM


FALCIPARUM:
Como el lactato deshidrogenasa es una protena citoplasmtica, es decir
presente en el citoplasma celular, es necesario realizar rompimiento de la
membrana plasmtica para que el citoplasma quede expuesto. Para esto
es posible utilizar el siguiente mtodo:
La lisis celular es la rotura de la membrana celular. Todas las clulas
tienen una membrana hecha de fosfolpidos que separan el contenido
celular del ambiente extracelular. Los fosfolpidos son anfipticos y tienen

embebidas las protenas de membrana. La naturaleza de los lpidos y las


protenas vara dependiendo del tipo de clula.
En la clula animal la membrana es la nica barrera, pero en plantas y
bacterias la membrana se encuentra rodeada por una pared celular. La
pared celular bacteriana est compuesta por peptoglicanos. Estos tipos
de barrera extracelular confieren forma y rigidez a las clulas. La tcnica
escogida para la ruptura celular tiene que considerar el origen del tejido
para evaluar su facilidad o dificultad de destruccin. Adems el mtodo
debe ser compatible con la cantidad de material que ser procesado y las
aplicaciones de este.
Tipos de lisis
Existen dos tipos de lisis: la lisis tradicional y la lisis por medio de
detergentes.
Lisis tradicional
Homogeneizacin lquida. Las clulas se rompen al ser forzadas
a pasar por espacios muy pequeos.
Sonificacin. Ondas de alta frecuencia rompen las clulas.
Congelamiento. Ciclos de congelacin continuos rompen la clula
induciendo la formacin de cristales.

Lisis celular por medio de detergentes: es una manera ms suave de


romper la membrana celular. Los detergentes rompen la barrera lipdica
solubilizando las protenas e interrumpiendo la interaccin lpido-lpido,
lpido-protena y protena-protena. Los detergentes, al igual que los
lpidos, se asocian entre ellos y se unen a superficies hidrofbicas. Se
componen de una cabeza polar hidroflica y una cola no polar hidrofbica.
No hay un protocolo estndar disponible. El detergente depender de la
aplicacin que se le quiera dar. Muchos estudios en los que se usa
electroforesis usan tpicamente SDS para desnaturalizar las protenas por
completo. La eleccin del detergente para la lisis celular depender
tambin del tipo de clula. Es importante tomar en cuenta adems los
buffer usados, el pH, la concentracin de sal y la temperatura para la
eleccin del detergente correcto. (2)

ANLISIS EN SOFTWARE
Se realizo el anlisis de esta protena atreves de el software Cn3D, el cual
nos permite observar la estructura tridimensional de cualquier protena
siempre y cuando el archivo que contiene la informacin de la protena
este el formato indicado (NCBI Chemical Data (ASN)). Este formato es
fcil de adquirir atraves de la web de National Center for Biotechnology
Information quien es el fabricante de este programa. (3)
Se hizo una comparacin con otro software, ZMM, el cual es
proporcionado por protein data bank y fabricado por MVM ingeniera de
software S.A, (2) el software permite observar la estructura de la protena
atreves de sus tomos constituyentes, presenta la secuencia de
aminocidos(al igual que el utilizado) en la nomenclatura de una letra. A
diferencia del programa utilizado, este software permite seleccionar
cualquier tipo de tomo y seala el aminocido del cual hace parte. (4)

ANALISIS DE LA PROTEINA LACTATO DESHIDROGENASA


PRESENTE EN EL PLASMODIUM FALCIPARUM

ESTRUCTURA PRIMARIA
El lactato deshidrogenasa presenta una secuencia de 322 residuos de
aminocidos. A continuacin se presenta la secuencia:
mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckvsgsnty
ddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnafiivvtnpvdvmvqllh
qhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklis
daeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlga
ngveqvielqlnseekakfdeaiaetkrmkalahhhhhh

Laminas beta
Giros y bucles

Hlices alfa

A continuacin presentamos una tabla con la cantidad y porcentaje de los


aminocidos presentes en la protena:

aminocido
Metinina
Alanina
Prolina
Lisina
Isoleucina
Valina
Leucina
Lisina
Serina
Treonina
Asparagina
Ac.
Aspartico
Fenilalanin
a
Histidina
Tirosina
Glutamina
Cistena
Ac.
Glutamico
Arginina
Triptfano

cantida
d
10
27
12
27
27
32
31
25
15
15
23

Porcentaje
(%)
3.1
8.36
3.72
8.38
8.38
9.93
9.9
7.76
4.05
4.05
7.14

14

4.34

2.17

16
8
8
6

4.96
2.48
2.48
1.86

15

4.05

3
1

0.93
0.34

ESTRUCTURA SECUNDARIA
1. Alfa hlice:

El lactato deshidrogenasa de plasmodium falciparum presenta nueve alfa


hlice. A continuacin una lista de los aminocidos que estn en estas
estructuras con su ubicacin en la protena:

Secuencia de aminocido
matlivqknlgdvvlfdivk

Ubicacin en la estructura

mphgkaldtsh
lplnnkimieigghikkn
vdvmvqllhqhs
vldtstlkyyisqk
lqefinnk
daeleaifdrtvnt
vapaaaiiemaesylk
eekakfdeaiaetkrnkal

40 48
99 116
129 140
153 167
200 207
211 224
237 252
297 315

14 25

2. Estructuras laminares:

Presenta doce estructuras beta-laminares como lo muestra la siguiente


tabla:

Secuencia de aminocido
akivlvg
gdvvlfd
ckvsgsn
dvvivta
afiivvt
Kiigl
dvnahivga
Knvll
Yitvg
lkkvlicstll
Ifggtpvvlga
gveqvi

Ubicacin en la estructura
5-11
29-35
59-65
74-80
120-126
146-150
173-181
185-189
192-196
253-264
273-283
285-290

3. Giros o bucles:

Esta protena presenta cerca de veintids giros. A continuacin se tabula


las secuencias de aminocidos y su ubicacin:

Secuencia de aminocido
apk
sg
Nl
ivkn
shtnvmaysn
tyddlaga
gftk
nrddl
cpn
np
gvpkn
gg
nvcpr
hgn
kr
gip
lis
aleivnlhaspy
egqyghsd
n
elqln
ahhhhh

Ubicacin en la estructura
2-4
12-13
27-28
36-39
49-59
66-73
81-84
94-98
107-109
127-128
141-145
151-152
168-172
182-184
191-192
197-199
208-210
225-236
265-272
284
291-295
316-321

ESTRUCTURA TERCIARIA
1. Enlaces disulfuro:
La lactato deshidrogenasa del plasmodium falciparum no presenta
enlaces disulfuro aunque en su secuencia estn presentes
aminocidos que tienen en su estructura tomos de azufre (10
metionina y 6 cistena).

2. Interacciones hidrofobicas:

La figura anterior muestra las interacciones hidrofobicas representadas


por las secuencias de aminocidos en color azul siendo de esta manera
hidrofobicas entre s.

La siguiente figura muestra la estructura tridimensional de toda la


protena:

BIBLOGRAFIA
(1) Wikipedia:
enciclopedia
libre.
plasmodium
falciparum.
http://es.wikipedia.org/wiki/Plasmodium_falciparum. consulta hecha
el da 17 de octubre del 2010.
(2) Wikipedia:
enciclopedia
libre.
Lisis.
http://es.wikipedia.org/wiki/Lisis. consulta hecha el da 17 de
octubre del 2010.

(3) National Center for Biotechnology Information


.www.ncbi.nlm.nih.gov. consultada el 12 de octubre del 2010.
(4) Protein data bank. www.rcsb.org/pdb/home/home.do. consultada el
12 de octubre del 2010.

PREDICCION DE PROTEINAS
LACTATE DESHIDROGENASA EN PLASMODIUM
FALCIPARUM

Osnaider Castillo Contreras


Ruber Ledesma Ruiz

Presentado a:
PH.D. Rubn Jaramillo

Universidad de Sucre
Facultad de Educacin y Ciencias
Programa de Biologa
Bioqumica I
2010