Está en la página 1de 540

AVISO

‡6RORYHQGHPRVDGLVWULEXLGRUHVLQWHJUDGRUHVGHELGDPHQWHDXWRUL]DGRV\FHUWLÀFDGRVSDUDSURJUDPDUHLQVWDODUQXHVWURVSURGXFWRV\DTXHQRVRWURVQRORUHDOL]DPRV
‡1XHVWURVGLVWULEXLGRUHVLQWHJUDGRUHVVRQWRWDOPHQWHLQGHSHQGLHQWHV\QRFRPSDUWHQFRQ6<6&20®QLQJ~QWLSRGHLQIRUPDFLyQDFHUFDGHVXVFOLHQWHVRXVXDULRV
‡1RDQDOL]DPRVSURFHVDPRVUHFXSHUDPRVYLGHRVRLQIRUPDFLyQGHGLVFRVGXURV1RJXDUGDPRVQLQJXQDLQIRUPDFLyQGHIUHFXHQFLDVGDWRVRYLGHRVGHQXHVWURVFOLHQWHV
‡1RSURJUDPDPRVQLGHVSURJUDPDPRVQLQJ~QHTXLSR1RWHQHPRVODVOODYHVQLHOVRIWZDUHSDUDOHHUSURJUDPDVIUHFXHQFLDVYLGHRV
‡/HDJUDGHFHPRVTXHQRQRVHQYtHVRIWZDUHVDUFKLYRVRJUDEDFLRQHVDVLPLVPRHYLWHHQYLDUQRVPHPRULDV&'VGLVFRVGXURVHWF
‡$OHQYLDUQRVHTXLSRSDUDUHSDUDFLyQDVHJ~UHVHGHERUUDURHOLPLQDUIUHFXHQFLDVFODYHVYLGHRVGDWRVRFXDOTXLHURWUDLQIRUPDFLyQ\DTXHDOUHSDUDUORVHOHERUUDUiDXWRPiWLFDPHQWH
FXDOTXLHUDUFKLYRTXHSXGLHVHWUDHUODPHPRULDRORVGLVFRV
‡$OUHSDUDUVXHTXLSRXWLOL]DPRVSDUiPHWURVIUHFXHQFLDV\RYLGHRVGHSUXHED

SYSCOM® ESTÁ CERTIFICADO ISO 9001:2008


CALIDAD TOTAL
ENLACES INALÁMBRICOS Y RADIOCOMUNICACIÓN
GUÍA DE SOLUCIONES 2016

Alta Tecnología

Hacia Un Mundo Más Inalámbrico

Ahora usted tiene en sus manos nuestro catálogo 2016, trabajo realizado conjuntamente por las
áreas de Comunicación e Ingeniería, y además con la colaboración de muchísimas personas de otros
departamentos, todos comprometidos en la edición del mejor compendio sobre las comunicaciones
inalámbricas en el mundo.

En SYSCOM, la calidad es nuestra obsesión en todos los sentidos. Trabajamos arduamente para
que nuestros clientes y los clientes de nuestros clientes, reciban productos y sistemas de la mejor
calidad, con un servicio, atención y soporte incomparable. Desde el año 2000 mantenemos nuestro
SERVICIO
VLVWHPD,62FHUWLÀFiQGRQRVVHPHVWUDOPHQWH

Sólo nos proveemos de los mejores fabricantes del mundo, con quienes tenemos una estrecha EXPERIENCIA
e intensa comunicación y relación técnica. Los productos son probados y expuestos a condiciones
H[WUHPDVGHYLGDDFHOHUDGDSDUDDVHJXUDUVXFRQÀDELOLGDGHQODVSHRUHVFRQGLFLRQHVGHWUDEDMR CRECIMIENTO
FXPSOLHQGRFRQODVPiVDOWDVHVSHFLÀFDFLRQHV
CONFIANZA
Capacitación continua, interna y externa, de manera presencial y en línea las 52 semanas del año.
Soporte continuo, sólido y efectivo a nuestros clientes, retroalimentación a nuestros proveedores,
presencia continua en todas las exposiciones, conferencias y convenciones; trabajo extenuante, es ESTABILIDAD
ORTXHQRVFDUDFWHUL]DFRQYLUWLpQGRQRVHQODGLVWULEXLGRUDPiVHÀFLHQWH\FRQÀDEOHHQHOPXQGR
SERIEDAD
Sin duda alguna, tenemos el más grande inventario de productos, partes y refacciones. También
HOPiVJUDQGHFRQÀDEOH\PHMRUFDSDFLWDGRHTXLSRGHLQJHQLHURV\SURIHVLRQDOHVGHODLQGXVWULDD
GARANTÍA
su servicio.

Comercializamos nuestros productos solamente a través de integradores profesionales, a PUNTUALIDAD


TXLHQHVFDSDFLWDPRV\FHUWLÀFDPRVSDUDDVHJXUDUODVDWLVIDFFLyQSOHQDGHOXVXDULRÀQDOGHQXHVWURV
productos. CONSTANCIA

Es Más Grande Quien Mejor Sirve!


Año 2016

CONTENIDO POR SECCIONES A


Abrazaderas Tipo Cincho para Cables Signal Inside™ ...................................209
Radios KENWOOD® 1-35 Accesorios (Sección) .....................................................................83-144
Accesorios Adicionales para:
Series Pro y Revo OTTO® ........................................................................105
Radios ICOM®  STORM y Genesis II OTTO® ...................................................................107
Accesorios de Audio para:
Móviles KENWOOD® ..............................................................................143
Accesorios 83-144 Móviles KENWOOD®/ SYSCOM®/ MIDLAND® .......................................144
Portátiles .........................................................................................103-105
Portátiles ICOM® ....................................................................................104
$PSOLÀFDGRUHV 145-159 Portátiles OTTO® .............................................................................105-114
Portátiles PRYME®...........................................................................134-142
Accesorios de:
Antenas  Fijación a Muro, Piso y Techo CHAROFIL® ..............................................425
Luces de Emergencia FEDERAL SIGNAL® ..............................................483
Cables y Conectores  Torres Arriostradas SYSCOM® .......................................................494-497
Accesorios Opcionales para Radios Móviles:
Amateur TK-90M HF KENWOOD® ..............................................................5
Energía Solar  Digitales NX-700H/ 800H KENWOOD® ....................................................26
Digitales NX-720/ 820HGK KENWOOD® ..................................................25
Digitales NX-900 KENWOOD® .................................................................28
Equipo de Laboratorio  Digitales NX-920 KENWOOD® .................................................................27
TK-790H/ 890H KENWOOD® ....................................................................22
TK-7302H/ 8302H KENWOOD® ...............................................................20
Filtros RF  TK-7360H/ 8360H KENWOOD® ...............................................................21
Accesorios Opcionales para Radios Portátiles Comerciales:
TK-2000/ 3000 KENWOOD® .......................................................................7
Fuentes de Alimentación  TK-2170/ 3170 KENWOOD® .....................................................................11
TK-2180/ 3180 KENWOOD® .....................................................................12
TK-2312/ 3312 KENWOOD® .......................................................................9
Gabinetes  TK-2360/ 3360 KENWOOD® .....................................................................10
TK-2402/ 3402 KENWOOD® .......................................................................8
PKT-03 KENWOOD® ..................................................................................6
GPS  Accesorios Opcionales para Radios Portátiles Digitales:
NX-200G/ 300G KENWOOD® ...................................................................17
NX-220/320 KENWOOD® ....................................................................14,15
Protección Contra Descargas 306-319 NX-240/ 340 KENWOOD® ........................................................................13
NX-410/411 KENWOOD® ........................................................................18
NX-420K3 KENWOOD® ...........................................................................16
Redes Inalámbricas  Accesorios Opcionales para:
Radios Portátiles para Aficionados ICOM® ...............................................50
Receptores Portátiles Serie Endura LOWRANCE® ..................................301
Cableado Estructurado  Sistemas de Sonar / Radar y GPS LOWRANCE® ....................................299
Accesorios para:
Amplificadores de Señal de Celular................................................................. 157
Sistemas de Radios  Amplificadores epcom®/ weboost® Wilson® ..........................................157
Antenas MAXRAD®/ TRAM®/ Pulse® LARSEN®/ HUSTLER® ..................161
ÍNDICE

Barras de Luces FEDERAL SIGNAL® ......................................................483


Repetidores y Radiobases 448-460 Barras de Luces STREET HAWK® ..........................................................483
Cableado Estructurado Linkedpro® .........................................................417
Cinturón de Seguridad SYSCOM®.............................................................99
Señalización Audiovisual 461-491 Consolas Remotas GAI-TRONICS® ........................................................439
Desoldadora y Extractor de Soldadura HAKKO® .....................................253
Gabinetes NEMA txPRO® .......................................................................297
Torres y Tramos  Instalación de Tierras Físicas y Pararrayos TOTAL GROUNDMR .........311-312
Intemperie para Cables ANDREW® .......................................................207
Luces de Emergencia FEDERAL SIGNAL® ..............................................483
SYSCOM 509-516 Mástiles SYSCOM® ...............................................................................498

También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Lă Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016

Mesa de Laboratorio .............................................................................255 Wi-Fi Micro Cobertura ALTAI® ........................................................364-365


Motocicleta FEDERAL SIGNAL® .............................................................472 Wi-Fi Pico Cobertura 802.11b/g/n o 802.11a/n serie C1 ALTAI® .....366,367
Rack EPCOM Industrial® .........................................................................290 Acoplador de Impedancias TOTAL GROUNDMR ..............................................311
Redes Inalámbricas RF CONNECTORS®/ SYSCOM®/ TRANSTECTOR® ...380 Acopladores Direccionales con Dieléctrico de Aire de Bajo PIM ValuDAS .....160
Redes Inalámbricas SYSCOM® ...............................................................381 Acumuladores
Sistema Móvil de Video Digital DTX-SYSTEM FEDERAL SIGNAL® ..........469 De Ciclo Profundo epcom® POWER LINE/ EXIDE® ..................................233
Accesorios para Radios Móviles: Para Aplicaciones Fotovoltaicas SYSCOM®/ epcom® POWER LINE ........233
Aéreo IC-A110 ICOM® .............................................................................38 Para Aplicaciones Sellados SYSCOM®/ epcom® POWER LINE ...............233
Aéreo IC-A210 ICOM® .............................................................................38 Acumuladores y Cargadores SYSCOM® .......................................................233
Aéreo IC-A220 ICOM® .............................................................................38 Adaptador:
Amateur para Radioaficionados KENWOOD® .............................................3 GPS PRYME® para Radios Portátiles KENWOOD® .................................134
Amateurs KENWOOD® ............................................................................4,5 Para Radio KENWOOD®..........................................................................133
Comerciales Digitales NX-740/ 840 KENWOOD® .....................................24 Remoto de CD IDA-1000 GAI-TRONICS® ................................................439
Comerciales ICOM® ............................................................................63,64 Remoto de Tonos ITA-2000 ....................................................................439
Digitales ICOM® .................................................................................74-82 Universal para Analizador de Baterías W&W® ..........................................99
D-STAR para Aficionados ICOM® .............................................................48 USB 2.0 Multifuncional EUB-9603H para Interior EnGenius® ..................347
HF para Aficionados ICOM®......................................................................52 USB 802.11 ac Doble Banda PLANET® ...................................................340
Marinos HF ICOM® ..................................................................................45 VoIP de 4 FXO Grandstream® .................................................................383
Marinos VHF ICOM® ...........................................................................42-45 VoIP de 4 FXS Grandstream®..................................................................383
Para Aficionados HF, VHF y UHF y Accesorios ICOM® .............................53 VoIP Híbrido de 2 Puertos (FXS/FXO) Grandstream® ...............................383
Para Aficionados ICOM® ...........................................................................51 Adaptadores:
Accesorios para Radios Portátiles: “N” RF CONNECTORS®...........................................................................219
Aéreos ICOM® .........................................................................................37 BNC para Radios Portátiles RF CONNECTORS® ......................................218
Amateurs KENWOOD® ...............................................................................2 BNC RF CONNECTORS® .........................................................................218
Comerciales ICOM®.............................................................................56-62 Coaxiales, SMA y DIN RF CONNECTORS® (Kits).....................................251
Comerciales KENWOOD® ......................................................................6-12 De Corriente W&W® para Radios Portátiles KENWOOD® .........................90
Digitales ICOM® .................................................................................66-73 De Polaridad Inversa RF CONNECTORS® ...............................................221
D-STAR para Aficionados ICOM® .............................................................47 DIN 7-16 y FME RF CONNECTORS®........................................................221
Marinos ICOM® ..................................................................................39-41 Para Chasís RF CONNECTORS® ..............................................................218
Motorola® ..............................................................................................102 Para PTT de Pedal con Diadema PRYME® ...............................................134
Accesorios THORSMAN® ..............................................................................421 Para Radios Portátiles Comerciales ICOM®...............................................92
Accesorios y Repuestos para Duplexers WP 629/639/641 EPCOM Industrial®.... 266 Para Radios PRYME® ..............................................................................142
Access Points: Para Radios SERIE PERFORMANCE txPRO® ............................................122
A2 Conectorizado en 2.4 GHz e Integrado en 5 GHz ALTAI® ...................364 Para Vehículo W&W® ...............................................................................99
A2-Ei Integrado en 2.4 GHz e Integrado en 5 GHz ALTAI® ......................365 RF CONNECTORS® .................................................................................219
A2e Conectorizado en 5 GHz e Integrado en 2.4 GHz ALTAI® .................365 SMA RF CONNECTORS® ........................................................................220
airMAX AC 5GHz 802.11ac UBIQUITY® NETWORKS ..............................328 TNC RF CONNECTORS®..........................................................................221
AP/CPE Versión Antena Integrada en 2.4 ó 5 GHz ALTAI® .....................366 UHF/ Mini UHF RF CONNECTORS® .........................................................219
AP/CPE Versión Conectorizado en 2.4 o 5 GHz ALTAI® ..........................367 Adaptadores Universales Unidapt RF CONNECTORS® (Kits) ...................251
Clientes para Exterior e Interior EnGenius® .............................................344 Adaptadores y Gateways de VoIP Grandstream® ..........................................383
Clientes para Exterior EnGenius® .....................................................342-343 Adaptadores, Acondicionadores y Recargadores W&W® ................................99
Clientes para Exterior UBIQUITY® NETWORKS ................. 322,325-331,335 Administrador OTAP (Over The Air Programming) 10 Radios KENWOOD® .....30
Clientes para Interior EnGenius® ......................................................345-347 ae (antena specialists®) .................................................
Clientes para Interior y Exterior UBIQUITY® NETWORKS..................327-332 AEA® -American Earth Anchor- .........................................................508
Con Hotspot de Gran Capacidad para Exterior UBIQUITY® NETWORKS ..331 Agrupadores de Cable THORSMAN® ............................................................422
EAP-300 -Poderoso- para Interior EnGenius® .........................................344 airGateway / airGateway LR para Exterior UBIQUITY® NETWORKS ...............335
EAP-600 WDS y Repetidor Univ. Doble Banda para Interior EnGenius® ..345 airGateway PRO Doble Banda (2.4 y 5 GHz) UBIQUITY® NETWORKS ............335
ENH-202/ ENH-500 de Gran Ancho de Banda para Exterior EnGenius® ..344 airGrid M2 802.11 b/g/n para Intemperie UBIQUITY® NETWORKS ................327
ENH-900EXT de Alta Potencia y Gran Cobertura EnGenius® ..................342 Alarma y Monitoreo por Voz Vía Radio RITRON® ...........................................444
ENS-202 -Poderoso- para Interior EnGenius® .........................................344 ALE: Establecimiento Automático de Enlace ICOM® ....................................5,55
ÍNDICE
ENS202EXT para Exterior EnGenius® .....................................................343 ALTAI®..........................................................................................360-368
ESR-300/ ESR-600 EnShare™ Multimedia para Interior EnGenius® ........345 alvarion®.......................................................................................
ENS-500EXT para Exterior EnGenius® ....................................................343 Amplificador:
ENSTATION-5 / ENSTATION-2 EnGenius® .............................................342 Cuatribanda para Oficina o Casa - Kit AG Pro 4G ....................................152
EWS-210-AP Serie Neutron para Interior EnGenius® .............................346 De Potencia TAIT® ..................................................................................453
EWS-310-AP Serie Neutron para Interior EnGenius® .............................346 De Punta de Torre BIRD® .......................................................................269
Lite Beam para Intemperie UBIQUITY® NETWORKS ...............................326 Lineal para HF IC-PW1 ICOM® ..................................................................53
M5 de Largo Alcance - Power Bridge UBIQUITY® NETWORKS ...............325 Modular TPL® .........................................................................................147
MESH Doble Banda Simultánea para Exterior ENH-710EXT EnGenius®...343 Para Automóvil, Monousuario - Kit Drive 4G-S........................................152
Para Intemperie Versátiles y Multifuncionales UBIQUITY® NETWORKS ..326 Para Automóvil, Multiusuario - Kit Drive 4G-M .......................................152
Pico M2 HP para Exterior UBIQUITY® NETWORKS ..................................331 Para Banda CB MIDLAND® .....................................................................446
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx Lă
Año 2016

Amplificadores - Combinadores - Multiacopladores ......................................269 UHF ANDREW®/ SYSCOM® ...................................................................184


Amplificadores (Sección) ............................................................145-159 UHF con Plano de Tierra / de Dipolos ANDREW®/ SYSCOM® .................184
Amplificadores de: UHF CUSHCFRAFT® ................................................................................186
Ciclo Continuo Crescend®.......................................................................145 UHF de Dipolos TELEWAVE INC.® ...........................................................185
Ciclo Continuo para Estaciones Base y Repetidores TPL® .......................146 UHF Direccionales CUSHCFRAFT® ..........................................................186
Punta de Torre TELEWAVE INC.® ............................................................270 UHF Direccionales MAXRAD®/ ANDREW®/SINCLAIR®/ Laird® ...............185
RF Crescend® .........................................................................................145 UHF Direccionales SYSCOM® .................................................................187
RF TPL® ..................................................................................................146 UHF en Fibra de Vidrio TELEWAVE INC.®/ CUSHCFRAFT®
Señal para Celular y NEXTEL ............................................................148-151 / ANDREW®/ HUSTLER® ........................................................................181
Señal para Celular y NEXTEL epcom® .....................................................158 UHF en Fibra de Vidrio TELEWAVE INC.®/ TRAM®/ MAXRAD®/ HUSTLER® . 182
Señal para Celular y NEXTEL epcom®/ txPRO® .......................................150 UHF Omnidireccionales TRAM®/ CUSHCFRAFT®/ MAXRAD®/ SYSCOM® ... 183
Señal para Celular y NEXTEL weboost® Wilson®.....................................151 UHF SYSCOM® .......................................................................................187
Amplificadores Modulares Serie MAS TPL® ..................................................147 UHF TELEWAVE INC.®/ CUSHCFRAFT®/ ANDREW®/ HUSTLER® ............181
Amplificadores Móviles weboost® Wilson® ...................................................151 UHF TELEWAVE INC.®/ MAXRAD®/ ANDREW®/SINCLAIR®/ Laird® .......185
Amplificadores para: UHF TELEWAVE INC.®/ TRAM®/ MAXRAD®/ HUSTLER® ........................182
Edificio o Residencia (Interiores) epcom® ...............................................149 UHF TRAM®/ CUSHCFRAFT®/ MAXRAD®/ SYSCOM® ............................183
Edificio o Residencia (Interiores) epcom®/ txPRO® .................................150 VHF con Plano de Tierra / de Dipolos SYSCOM®
Edificio o Residencia (Interiores) weboost® Wilson®...............................151 / TELEWAVE INC.®/ ANDREW®/ SINCLAIR®...........................................179
Exterior epcom® .....................................................................................158 VHF CUSHCFRAFT®/ TRAM®/ HUSTLER® ...............................................177
Radios Móviles TPL® ..............................................................................147 VHF Direccionales SYSCOM®/ MAXRAD® ..............................................180
Uso Vehicular en VHF Crescend® ...........................................................145 VHF en Fibra de Vidrio HUSTLER®/ MAXRAD®
Amplificadores, Preselectores y Multiacopladores TELEWAVE INC.® ............270 / TELEWAVE INC.®/ ANDREW® ..............................................................176
Analizador de: VHF HUSTLER®/ MAXRAD®/ Pulse® LARSEN®/ SYSCOM®/ ...................178
Antena Autocontenido MFJ® .................................................................242 VHF HUSTLER®/ MAXRAD®/ TELEWAVE INC.®/ ANDREW® ...................176
Sistemas de Antena de 25-6000 MHz BIRD® .........................................247 VHF Omnidireccionales CUSHCFRAFT®/ TRAM®/ HUSTLER® .................177
Sistemas de Comunicación R8000B FREEDOM® ....................................243 VHF Omnidireccionales HUSTLER®/ MAXRAD®
Analizador Gráfico de Antena AEA® ..............................................................242 / Pulse® LARSEN®/ SYSCOM® ...............................................................178
Analizadores y Reacondicionadores de Baterías W&W® ............................97,98 VHF SYSCOM®/ MAXRAD® ....................................................................180
Anclas: VHF SYSCOM®/ TELEWAVE INC.®/ ANDREW®/ SINCLAIR® ...................179
Para Base de Torres SYSCOM® .............................................................494 Antenas:
Para Retenida (Varilla Redonda Lisa) de Torres SYSCOM® ....................494 De Rejilla / Panel / Parabólicas SYSCOM®/ txPRO®/ CUSHCRAFT®/
Terrestres AEA® -American Earth Anchor- ............................................508 UBIQUITY® NETWORKS/ CAMBIUM NETWORKS™ ...............................391
Terrestres Tipo Punta de Flecha AEA® -American Earth Anchor- ...........508 De Rejilla / Panel / Parabólicas txPRO®/ MAXRAD®/ PCTEL®/ UBIQUITI®/
Terrestres Tipo Tornillo “Penetrator” AEA® -American Earth Anchor- ....508 L-com®/ CUSHCFRAFT® .........................................................................197
ANDREW® ............. De Servicio para Amplificadores de Celular y NEXTEL epcom®/ txPRO® 159
Antena: De Servicio para Interior epcom®/ weboost® Wilson®/ txPRO® ..............156
Direccional Carrier - Class UBIQUITY® NETWORKS ................................329 Direccionales Tipo Plato (5.1 - 5.8 GHz)
Direccional Tipo Plato (5.15 - 5.97 Ghz) ePMP BY CAMBIUM NETWORKS™/ txPRO® .........................................359
ePMP BY CAMBIUM NETWORKS™ .......................................................359 Direccionales y Sectoriales ePMP BY CAMBIUM NETWORKS™ ............359
Direccional Tipo Reflector (5.15 – 5.97 Ghz) Donadoras para Amplificadores de Celular y NEXTEL epcom® ................159
ePMP BY CAMBIUM NETWORKS™ .......................................................359 Donadoras para Exterior epcom®/ weboost® Wilson®/ txPRO® .......154,155
Multibanda Pulse® LARSEN®..................................................................195 Down-Tilted alvarion® .............................................................................372
Omnidireccional de Bajo PIM Pulse® LARSEN® ......................................156 Externas (Donadoras) para Amplificadores Móviles................................... 153
Para Radioaficionados MFJ®, MAXRAD®, CUSHCFRAFT®, TRAM® ..........199 Genéricas SYSCOM® para Radios KENWOOD® ........................................83
Sectorial airMAX AC UBIQUITY® NETWORKS ........................................329 GPS Móviles Pulse® LARSEN®/ SYSCOM® .............................................195
Yagi para Intemperie UBIQUITY® NETWORKS ........................................323 Helicoidales epcom® para Radios Motorola®............................................84
Antenas (Sección)........................................................................ Helicoidales epcom® para Radios Portátiles
Antenas Aéreas MAXRAD®/ SYSCOM®/ SINCLAIR®/ TELEWAVE INC.®/ en 800 MHz KENWOOD® y Motorola® .....................................................84
CELWAVE®....................................................................................................192 Helicoidales y Recortadas para Radios ICOM® .........................................84
Antenas Aéreas para Móvil MAXRAD® ........................................................192 Internas (de Servicio) para Amplificadores Móviles ................................153
ÍNDICE

Antenas Base: Antenas Móviles:


Aéreas SYSCOM®/ SINCLAIR®/ TELEWAVE INC.®/ CELWAVE® .............192 800 / 900 MHz Ajustables en Campo MAXRAD® ...................................173
800 / 900 MHz ANDREW®/ CUSHCFRAFT®/ MAXRAD® ........................188 800 / 900 MHz Banda Ancha Pulse® LARSEN®/ HUSTLER® ...................173
800 / 900 MHz Direccionales ANDREW®/ CUSHCFRAFT®/ MAXRAD®...189 800 / 900 MHz Cristal (On Glass) Pulse® LARSEN®
800 / 900 MHz Direccionales MAXRAD® ...............................................190 / HUSTLER®/ ae (antena specialists®)/ weboost® Wilson® .....................174
800 / 900 MHz Direccionales MAXRAD® MAXRAD®/ SYSCOM® ..........191 800 / 900 MHz MAXRAD®/ Pulse® LARSEN®/ HUSTLER®......................173
800 / 900 MHz Fibra de Vidrio ANDREW®/ CUSHCFRAFT®/ MAXRAD® .188 800 / 900 MHz MAXRAD®/ Pulse® LARSEN®/ HUSTLER®
800 / 900 MHz MAXRAD® .....................................................................190 / ae (antena specialists®)/ weboost® Wilson®........................................174
800 / 900 MHz MAXRAD®/ SYSCOM® ..................................................191 800 / 900 MHz para Tránsito Pesado / Bajo Perfil Pulse® LARSEN® .......174
Marinas HF Shakespeare® ......................................................................193 Para CB (26.960 - 27.400 MHz) HUSTLER® ............................................202
Para CB SYSCOM®/ HUSTLER® ..............................................................201 Para CB con Montaje Magnético TRAM®/ HUSTLER® ...........................201
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Lă Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016

UHF Ajustables en Campo HUSTLER® / ae (antena specialists®) Antenas:


/ Pulse® LARSEN®/ MAXRAD® ...............................................................169 Direccionales Slant 45 UBIQUITY® NETWORKS ......................................330
UHF Ajustables en Campo TRAM®/ MAXRAD® ......................................170 Portátiles para Radios Pulse® LARSEN®/ MFJ® ......................................168
UHF HUSTLER®/ ae (antena specialists®) Sectoriales txPRO®/ MAXRAD®/ PCTEL®/ UBIQUITI®
/ Pulse® LARSEN®/ MAXRAD® ...............................................................169 / L-com®/ CUSHCFRAFT®................................................................................ 196
UHF MAXRAD®/ Pulse® LARSEN®/ SINCLAIR® Sectoriales (4.9 - 5.8 Ghz) ePMP BY CAMBIUM NETWORKS™ .............359
/ ae (antena specialists®) .......................................................................171 Sectoriales (5.1-5.8ghz) ePMP BY CAMBIUM NETWORKS™/ txPRO® ...359
UHF para Banda Ancha MAXRAD® .........................................................171 Sectoriales 120° para Intemperie UBIQUITY® NETWORKS .....................324
UHF para Cristal (On Glass) ae (antena specialists®)/ Pulse® LARSEN® .172 Sectoriales para Intemperie UBIQUITY® NETWORKS..............................324
UHF para Tránsito Pesado con GPS Laird® ..............................................172 Sectoriales Titanium para Intemperie UBIQUITY® NETWORKS ...............324
UHF para Tránsito Pesado Laird® ............................................................172 Sectoriales txPRO®/ PCTEL®/ UBIQUITI® ................................................390
UHF para Tránsito Pesado / Bajo Perfil Pulse® LARSEN® Tipo G5RV MFJ® ....................................................................................175
/ SINCLAIR®/ ae (antena specialists®) ....................................................171 Antenas y Montajes HUSTLER®/ TRAM® ......................................................446
UHF TRAM®/ MAXRAD® ........................................................................170 Antenas y Receptor de GPS SYSCOM® .........................................................195
VHF Ajustables Campo TRAM®/ Pulse® LARSEN® .................................166 Antorchas y Cautín MASTER®/ Weller® ........................................................255
VHF Ajustables en Campo MAXRAD® ....................................................165 Aplicación Multipunto para Redes Inalámbricas ............................................320
VHF Ajustables en Campo MAXRAD®/ Pulse® LARSEN® Aplicación para:
/ HUSTLER®/ as (antenna specialists®) ..................................................164 CCTV IP y Redes de Datos TRANSTECTOR® ...........................................317
VHF Banda Ancha MAXRAD®/ TRAM® ...................................................166 CCTV y Redes de Datos TRANSTECTOR® ..............................................316
VHF Pulse® LARSEN®/ ae (antena specialists®)/ SINCLAIR® ..................167 Corriente Alterna TRANSTECTOR® .........................................................318
VHF MAXRAD®.......................................................................................165 Redes de Datos TRANSTECTOR® ...........................................................318
VHF MAXRAD®/ Pulse® LARSEN®/ HUSTLER® Aplicación Punto a Punto para Redes Inalámbricas .......................................320
/ as (antenna specialists®) .....................................................................164 Aplicaciones en Energía Solar epcom® POWER LINE ....................................225
VHF para Cristal (On Glass) Pulse® LARSEN®/ ae (antena specialists®)..166 Aplicaciones para Redes Inalámbricas ..........................................................320
VHF para Tránsito Pesado / Bajo Perfil Pulse® LARSEN® Aplicaciones por Radio RAR - Radio Audio Recorder - KENWOOD® ...............31
/ ae (antena specialists®)/ SINCLAIR® ....................................................167 Armadura Tipo Tambor para Antena de Plato UBIQUITY® NETWORKS............... 323
VHF TRAM®/ Pulse® LARSEN® ...............................................................166 Arneses SYSCOM® para Radios y Repetidores ICOM®, KENWOOD® y Otros...... 431
Antenas Omnidireccionales: as (antenna specialists®) ....................................................................
alvarion® (Kit) .........................................................................................372 Asesoría SYSCOM® ......................................................................................514
txPRO®/ MAXRAD®/ PCTEL®/ UBIQUITI®/ L-com®/ CUSHCFRAFT® ........196 ASTRON® ............................................................................................
ePMP BY CAMBIUM NETWORKS™/ txPRO® (5.15 – 5.85 Ghz) ............359 Atenuadores Bidireccionales Mini-Circuits®/ BIRD® ......................................248
UBIQUITY® NETWORKS..........................................................................323 Audífono con Tubo Acústico Ajustable al Oído con Conector 3.5 mm PHOX®...... 130
txPRO®/ MAXRAD®/ UBIQUITI®/ ANDREW® ..........................................390 Audífono Inalámbrico Encubierto OTTO® .......................................................111
Antenas Originales para Radios KENWOOD® ..................................................83 Audífono para Radio Portátil Comercial PKT-03 KENWOOD® .............................6
Antenas para: Audífonos Intrínsecamente Seguros Sensear® ..............................................116
Access Points UBIQUITY® NETWORKS...................................................323 Audífonos para Micrófono-Bocina PRYME® ...................................................134
Amplificadores de Celular y NEXTEL epcom®/ txPRO® ...........................159 Auriculares:
Amplificadores de Edificio epcom®/ weboost® Wilson®/ txPRO® ....154,155 De Conducción Ósea con PTT Grande para Ambiente Ruidoso txPRO® ...126
Amplificadores Móviles Pulse® LARSEN®/ weboost® Wilson®/ txPRO® .153 De Diadema de Uso Rudo Sobre la Cabeza con PTT Grande txPRO® ......127
Banda CB TRAM®/ MFJ®/ HUSTLER® ....................................................201
CB HUSTLER®.........................................................................................202

B
Celular txPRO® .......................................................................................198
Embarcaciones / Móviles VHF Shakespeare® .........................................193
Embarcaciones Marinas VHF Shakespeare® ...........................................194
Equipo OPTOELECTRONICS®...................................................................250 Backhaul / Access Points para Exterior..........................................................331
Equipos ePMP ePMP BY CAMBIUM NETWORKS™ ................................359 Backhaul de Alto Rendimiento - airFiber 5 - 5U
Equipos Rocket - Tipo Plato para Intemperie UBIQUITY® NETWORKS.....322 para Intemperie UBIQUITY® NETWORKS ......................................................330
GPS Pulse® LARSEN®/ SYSCOM® ..........................................................195 Backhaul de Alto Rendimiento airFiber 24 GHz
Interior y Exterior CELLMAX -Antena de Bajo PIM- .................................160 para Intemperie UBIQUITY® NETWORKS ...............................................330,331
Radios ICOM® Marinos, Aéreos y Receptores ..........................................84 Backhaul de Alto Rendimiento Conectorizado airFiber X
ÍNDICE
Radios Portátiles .................................................................................83-85 para Intemperie UBIQUITY® NETWORKS ......................................................330
Radios Portátiles KENWOOD® ..................................................................83 Banda Ancha Inalámbrica ePMP BY CAMBIUM NETWORKS™ .....................357
Radios Portátiles Pulse® LARSEN®/ MFJ® ..............................................168 Banda para el Cuello para Radio Portátil Comercial PKT-03 KENWOOD® ...........6
Redes Inalámbricas SYSCOM®/ txPRO®/ CUSHCRAFT®/ UBIQUITY®/ Barras de:
CAMBIUM NETWORKS™/ANDREW® ....................................................391 Luces de Alta Potencia EPCOM Industrial® ..............................................489
Redes Inalámbricas .........................................................................196,390 Luces de Emergencia Ultra Brillante Serie X37 EPCOM Industrial® ..........485
Televisión Shakespeare® ........................................................................194 Luces de Emergencia Valor
Televisión SYSCOM® ..............................................................................200 con Tecnología LED Solaris / ROC FEDERAL SIGNAL® ............................462
Transmisor de TV SYSCOM® ..................................................................447 Luces de Emergencia Vision
Para Transmisión Rural de Televisión ......................................................200 con Tecnología LED Solaris / ROC FEDERAL SIGNAL® ............................462
Luces Heavy Duty FEDERAL SIGNAL® ...................................................473
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx Lă
Año 2016

Luces Heavy Duty TurboBeam Plus Halógeno FEDERAL SIGNAL® ..........473


Luces Integrity con Tecnología LED Solaris/ ROC ...................................463
C
Luces Integrity FEDERAL SIGNAL® ........................................................463
Cable Coaxial:
Luces JetStream Heavy Halógeno FEDERAL SIGNAL® ..........................473
ANDREW® de Malla Trenzada ...............................................................203
Luces JetStream LED .............................................................................473
ANDREW® HELIAX de Cobre Corrugado y Aluminio Liso ........................203
Luces Latitude y Solaris ILS FEDERAL SIGNAL®......................................465
ANDREW® Súper Flexible HELIAX de Cobre Corrugado y Aluminio Liso .203
Luces Legend LPX con Tecnología LED Solaris / ROC FEDERAL SIGNAL® ..... 464
BELDEN® ................................................................................................211
Luces Legend Serie LPX FEDERAL SIGNAL® ...........................................464
BELDEN® ,PSHGDQFLDŸ  .................................................................211
Luces Mini Jet Heavy Duty FEDERAL SIGNAL® ......................................474
BELDEN® ,PSHGDQFLD\Ÿ  ...............................................211
Luces TurboBeam 2000 FEDERAL SIGNAL® ..........................................476
viakon®/ SYSCOM® ...............................................................................212
Luces VISION y VALOR FEDERAL SIGNAL® ............................................462
Cable Coaxial y de Datos BELDEN® ...............................................................212
Unión para Interconexión de Equipo TOTAL GROUNDMR ..........................311
Cable de Cobre NetKey™ Categoría 6 y 5e PANDUIT™ ................................409
Barras Brillantes para Exterior e Interior EPCOM Industrial® ............................485
Cable de Cobre y Cables de Parcheo PANDUIT™ .........................................409
Barras Direccionadoras de Tráfico FEDERAL SIGNAL® ..................................477
Cable para Datos BELDEN® ...........................................................................212
Base de Cálculo para la Determinación de Sistemas a Base de Energía Solar. ..... 238
Cable Programador para Radio Portátil Comercial PKT-03 KENWOOD® .............6
Bases para Antenas HF SYSCOM®/ MFJ®/ HUSTLER® ................................175
Cableado Estructurado (Sección) ................................................
Bases para Múltiples Cargadores de Baterías para Radios Portátiles ..............90
CHAROFIL® ......................................................................................423-427
Bases para Torre SYSCOM® .........................................................................493
Linkedpro®.......................................................................................413-417
Baterías:
PANDUIT™......................................................................................408-412
De Reemplazo W&W®..............................................................................99
PLANET® ........................................................................................392-407
De Súper Alto Rendimiento Tecnología AGM VRLA ................................233
THORSMAN® .................................................................................418-422
Para Radios Portátiles con Cargador Integrado Positive Charge® ..............88
Cables BELDEN® ...........................................................................................211
Para Radios Portátiles Motorola®..............................................................87
Cables de:
PowerProducts® para Radios Portátiles KENWOOD® ...............................85
Accesorios para Radios ICOM® .............................................................257
txPRO® / W&W® para Radios Aéreos ICOM® ...........................................89
Accesorios para Radios KENWOOD®......................................................256
txPRO® / W&W® para Radios Marinos y Amateurs ICOM® ......................89
Corriente para Radios Móviles ................................................................143
txPRO® para Radios Portátiles de Varias Marcas .................................85-89
Parcheo NetKey™ de Cobre, UTP PANDUIT™........................................409
txPRO® para Radios Portátiles ICOM® ......................................................86
Reemplazo para Micrófonos SPM-1100 y 2100 PRYME® .......................142
txPRO® para Radios Portátiles KENWOOD®..............................................85
Cables HELIAX® 2.0 ANDREW® ....................................................................203
W&W® para Radios Portátiles KENWOOD®..............................................85
Cables y Conectores (Sección) ....................................................
Baterías y Cups Inteligentes W&W® ...............................................................96
Cables y Conectores:
Baterías, Cups, Cargadores y Acondicionadores W&W® .................................96
ANDREW® ......................................................................................203-208
BEE® .............................................................................................
para Aplicaciones de Redes Inalámbricas SYSCOM® .............................381
BELDEN® .............................................................................................
RF CONNECTORS® ..........................................................................213-218
BIRD® ......................................................................
Signal Inside™ ......................................................................................209
Bloqueador de Señal Celular y NEXTEL epcom® ............................................148
SYSCOM® ..............................................................................................222
Bocina Compacta XLS100 EPCOM Industrial® ................................................486
Caja de Interfaz para NEXTEL TELEX® ............................................................438
Bocina de Uso Rudo para Sirenas FEDERAL SIGNAL® ...................................467
Caja de Interfaz Telefónica TELEX® ................................................................438
Bocina de Uso Rudo XYD100 y XYD200 EPCOM Industrial®............................486
Cajas de:
Bocinas para Radios Móviles KENWOOD®/ SYSCOM®/ MIDLAND®..............144
Interconexión para Instalaciones Profesionales de CCTV txPRO® ............298
Bocinas, Estrobos y Luces de Advertencia FEDERAL SIGNAL® ......................468
Interconexión y Gabinetes para Exterior txPRO® .....................................298
Bota para Placas Pasamuros para Cables Signal Inside™ .............................209
Montaje Superficial Linkedpro® ..............................................................415
Botas o Gomas Pasamuros ANDREW® ........................................................208
Montaje Superficial NetKey™ PANDUIT™ .............................................411
Botones PTT Remotos OTTO® ......................................................................111
Piso THORSMAN® ..................................................................................421
Brackets SYSCOM®/ ICOM® para Radios Móviles ICOM® .............................144
Cálculos de Sistemas de Energía Solar. .........................................................238
Brackets SYSCOM®/ KENWOOD® para Radios Móviles KENWOOD®............144
Cámaras Profesionales de Seguridad IP UBIQUITY® NETWORKS ..................338
Bravoled® ............................................................................................
Cámara IP Bala Full HD 1080p ................................................................338
Brazos Tipo “F“ ..............................................................................................497
Cámara IP Infraroja UniFi® Video .............................................................338
Bridas para Torres SYSCOM® .......................................................................494
Domo IP UniFi® Video .............................................................................338
Broches de Presión Signal Inside™ ..............................................................210
ÍNDICE

Micro Cámara IP UniFi® Video ................................................................338


Broches Tipo Mariposa Signal Inside™ ........................................................210
CAMBIUM NETWORKS™ .....................................................
Bullets - Titanium para Intemperie UBIQUITY® NETWORKS...........................325
Canaletas THORSMAN® .........................................................................418-420
Burbuja Pulsator LED FEDERAL SIGNAL® ......................................................479
Canalización y Accesorios THORSMAN® ................................................418-422
Burbuja UltraStar LED FEDERAL SIGNAL® ....................................................479
CANOPI™ ............................................................................................356
Burbujas para Emergencia EPCOM Industrial® ................................................490
Capa Plástica para RJ-45 Linkedpro® ............................................................417
Burbujas y Estrobos para Emergencia FEDERAL SIGNAL® ............................479
Cargador USB para Radio Portátil Comercial PKT-03 KENWOOD® .....................6
Cargadores:
De Baterías txPRO®/ KENWOOD®/ PowerProducts® para Radios Portátiles ... 90
De Baterías txPRO®/ PowerProducts®
para Radios Portátiles Comerciales ICOM®...............................................91

También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Lă Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016

Industriales de Baterías samlexamerica® ...............................................233 Heliax Estándar LDF6-50 (1-1/4”, Cobre Corrugado) ANDREW® .............206
Rápidos txPRO® para Radios HYT® ...........................................................94 Heliax Estándar LDF7-50 (1-5/8”, Cobre Corrugado) ANDREW® .............206
txPRO®/ PowerProducts®/ ProStar® / W&W® Heliax Extremeflex FXL-540 (1/2”, Aluminio Liso) ANDREW® .................205
para Radios Portátiles Motorola® y Uniden®. ............................................95 Heliax Extremeflex FXL-780 y AVA5-50FX (7/8”, Alum. Liso
txPRO®/ PowerProducts®/ ProStar® / W&W® y Cobre Corrug.) ANDREW® ...................................................................205
para Radios Portátiles Yaesu® y HYT® ......................................................95 RG-174/U RF CONNECTORS® .................................................................216
txPRO®/ W&W®/ ICOM® RG-316 RF CONNECTORS® ....................................................................216
para Radios Portátiles Motorola®, Uniden®, Yaesu® y HYT® .....................94 RG-58/ RG-142 RF CONNECTORS®.........................................................213
Cargadores y Adaptadores txPRO®/ ICOM® / PowerProducts® RG-59/ RG-6/ U, RG-11/ U (75 Ohms) RF CONNECTORS® ......................215
para Radios Portátiles Comerciales ICOM® .....................................................92 Semirígido de 0.085” y 0.141” de Diámetro RF CONNECTORS® .............215
Cargadores y Adaptadores txPRO®/ W&W®/ PowerProducts® Súper Flexible FSJ1-50A (1/4”, Cobre Corrugado) ANDREW® ................204
para Radios Portátiles Comerciales ICOM® .....................................................93 Súper Flexible FSJ4-50B (1/2”, Cobre Corrugado) ANDREW® ................204
&DUJDV)DQWDVPDGHŸ ............................................................................248 Conectores para Cables:
Cargas Fantasma y Atenuadores ...................................................................248 ANDREW®.......................................................................................204-206
Catálogo de Partes FEDERAL SIGNAL® .........................................................483 BELDEN 7977A, LMR-600, RF-600 ................................................................. 214
Cavidad Pasa-Banda: BELDEN 9913, CNT-400, 7810, 8214, RG8/U-SYS,
UHF TELEWAVE INC.® ............................................................................264 R FLASH-1113 ANDREW® .............................................................................. 214
UHF TX RX SISTEMS INC.®.....................................................................264 BELDEN 9913, CNT-400, 7810, 8214, RG8/U-SYS, R FLASH-1113 RF®..214
VHF TELEWAVE INC.® ............................................................................264 RG-8/U (BELDEN 8237), RG213/U (8267),
VHF TX RX SISTEMS INC.® .....................................................................264 RG214 (8268) RF CONNECTORS® .................................................................. 214
Cavidades Pasa-Banda de Alta Selectividad en VHF y UHF SINCLAIR® .........264 RG-8/X, BELDEN 9258 RF CONNECTORS®..............................................215
Cavidades Pasa-Banda SINCLAIR® ................................................................264 Conectores para:
CELWAVE® .......................................................................................... Chasís de Wattmetros Bird® ..................................................................218
CHAROFIL® ................................................................................... Chasís RF CONNECTORS® ......................................................................217
Charolas CHAROFIL® .....................................................................................424 Heliax Estándar LDF2-50 (3/8”, Cobre Corrugado) ANDREW® ................205
Charolas y Tapas Ciegas para Rack EPCOM Industrial® .................................287 Heliax Estándar LDF4-50A (1/2”, Cobre Corrugado) ANDREW®..............205
Chasís Rackeable para 15 Convertidores de Medios PLANET® ......................403 Módulos Fotovoltaicos SOLARWORLD® .................................................228
Chasís para Alojar Módulos Serie MAS .........................................................147 Conectores RF CONNECTORS® ..............................................................213-218
Cintos de Velcro THORSMAN®.............................................................................. 422 Conectores y Adaptadores RF CONNECTORS®..............................................218
Cliente y Repetidor Universal ERB-300H para Interior EnGenius® ......................... 345 Conmutador IP para 100 Usuarios PLANET®..................................................382
Clip SYSCOM® para Micrófono para Radios Móviles .....................................144 Conmutadores IP-PBX con 2 FXO para 30 Llamadas Simultáneas Grandstream® 386
Clips ICOM®/ SYSCOM®/ BEE® para Radios Portátiles ICOM® .....................101 Conmutadores IP-PBX con 8 FXO para 60 Llamadas Simultáneas Grandstream® 386
Clips KENWOOD®/ W&W® para Radios Portátiles KENWOOD® ....................100 Conmutadores IP-PBX para T1/E1 y 200 Llamadas Simultáneas Grandstream®... 386
Clips para Radios Portátiles Motorola® ..........................................................102 Consola:
Clips y Fundas para Radios Portátiles KENWOOD®/ ICOM® ...................100,101 De Despacho ZETRON® ...................................................................434-436
Clips, Fundas y Accesorios para Radios Portátiles Motorola® ........................102 Remota CD IDR-1000 GAI-TRONICS® .....................................................439
Cluster de Sincronización GPS (CMM) CAMBIUM NETWORKS™ .................356 Remota de Tonos ITR-1000 GAI-TRONICS® ............................................439
Codificadores y Decodificadores de ANI SYSCOM® ......................................429 Remota Local CPI® .................................................................................440
Combinadores para Tx TX RX SISTEMS INC.®/ BIRD® ...................................269 Remota Local ILD-1000 GAI-TRONICS® ..................................................439
Combinadores para UHF dbSpectra®.............................................................269 Remota y Panel Terminal de CD CPI® .....................................................440
Combinadores VHF / UHF / 800 MHz TELEWAVE INC.®.................................271 Remota y Panel Terminal de Tonos CPI®.................................................440
COMET® .............................................................................................. Consolas de Despacho CSI®/ ZETRON®.........................................................434
COMMSCOPE® ....................................................................................160 Consolas de Despacho TELEX®......................................................................437
Compuesto Mineral Mejorador de Tierras TOTAL GROUNDMR........................311 Consolas Remotas GAI-TRONICS® ................................................................439
Comunicación Voz IP en Sistemas Digitales ICOM® ......................................459 Contador de Frecuencia / Decodificador de Tonos OPTOELECTRONICS® .......249
Concreto Mejorador de Conductividad TOTAL GROUNDMR.............................311 Contador de Frecuencia con Funciones Avanzadas OPTOELECTRONICS® ......249
Conector de Cables “UY” Linkedpro® ............................................................417 Contador de Frecuencia de Tamaño Compacto OPTOELECTRONICS®............249
Conector RJ-45 para Cable Par Trenzado (UTP) Control para Repetidor - COR ........................................................................430
con Blindaje UBIQUITY® NETWORKS.............................................................381 Controlador con PoE para Arreglos Solares en 12 y/o 24 Vcd SYSCOM® ......232
Conector RJ-45 para Cable Par Trenzado (UTP) sin Blindaje SYSCOM®.........381 Controlador con PoE SYSCOM®.....................................................................232
ÍNDICE
Conectores: Controlador Configurable Vía Software CSI® .................................................434
Jack UTP y STP Linkedpro® ....................................................................415 Controlador:
Jack y Cajas de Pared Linkedpro® ..........................................................415  'H$FFHVRă*HVWLyQ5HPRWDGH(OHPHQWRVGH5HG$/7$,® ...................368
Conectores para Cable: De Carga SUNGUARD MORNINGSTAR® ................................................230
Andrew CNT-195-FR (4.95 mm, Malla de Cobre Estañada) ANDREW® ..204 De Carga TRISTAR MORNINGSTAR® ......................................................230
Andrew CNT-400 (10.29 mm, Malla de Cobre Estañada) ANDREW® .....204 De Carga y Descarga PROSTAR MORNINGSTAR® ..................................230
Extraflexible Heliax VXL5-50 (7/8”, Cobre Corrugado) ANDREW®...........206 De Carga y Descarga SHS MORNINGSTAR® ..........................................231
Extreme Flex Súper Flexible SFX-500 (1/2”, Aluminio Liso) ANDREW® ..204 De Carga y Descarga SUN SAVER MPPT MORNINGSTAR® ....................231
Heliax AVA5-50 (7/8”, Cobre Corrugado) ANDREW® .............................206 De Carga y Descarga SUNSAVER MORNINGSTAR® ...............................230
Heliax AVA7-50 (1-5/8”, Cobre Corrugado) ANDREW® ..........................206 De Equipos por IP IP-1000C ICOM® .........................................................80
Heliax Estándar LDF1-50 (1/4”, Cobre Corrugado) ANDREW® ................205 LTR y Panel de Tonos CSI® .....................................................................434
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx Lă
Año 2016

Para Repetidor con Capacidad de 2 Tonos ZETRON® ..............................431 Divisores de Potencia TELEWAVE INC.® ........................................................161
Serial para Barras de Luces FEDERAL SIGNAL® ......................................464 Divisores, Transceptores y Convertidores Power over Ethernet PLANET® .....402
Solar PoE para Arreglos Solares en 12 y/o 24 Vcd SYSCOM® ................380 Domos de Reemplazo para TurboBeam 2000 FEDERAL SIGNAL® ................476
Serie Neutron de 8 y 24 Puertos EWS-5912-FP/ EWS-7928-P EnGenius® .... 346 Domos de Reemplazo para TurboBeam FEDERAL SIGNAL® .........................473
Troncal para Sistemas MPT-1327 ZETRON® ...........................................432 DREMEL®.............................................................................................
Controladores: D-STAR ICOM® ..........................................................................................47,48
De Acceso para Servicios (Hotspot) Guest Internet®..............................339 DTX Sistema de Video Digital FEDERAL SIGNAL®..........................................469
De Carga MORNINGSTAR® ....................................................................230 Ductos de ½ Caña THORSMAN® ..................................................................420
De Carga y Descarga SYSCOM®......................................................230,231 Duplexers:
De Repetidor SYSCOM® .........................................................................430 De 6 Cavidades EPCOM Industrial® ........................................................296
MORNINGSTAR®....................................................................................231 De Rechazo de Banda RFS®....................................................................265
Para Repetidores y Arneses....................................................................431 De Rechazo de Banda y Accesorios EPCOM Industrial®..........................266
Para SignalMaster FEDERAL SIGNAL® ...................................................477 Doble Banda COMET® ............................................................................265
Para Sistemas Troncales LTR ZETRON®..................................................432 Pasa - Banda / Rechazo de Banda / VHF / UHF / 800 MHz TELEWAVE INC.® 268
Troncales y Panel de Tonos ZETRON® ....................................................432 Pasa - Banda / Rechazo de Banda / VHF / UHF SYSCOM® ......................267
Controles “COR” EXPRESS para Radios ICOM® y KENWOOD® de SYSCOM® ..... 430 Pasa-Banda / Rechazo de Banda TELEWAVE INC.® ................................268
Convertidor de Medios: Pasa-Banda / Rechazo de Banda UHF FIPLEX® .......................................267
10/100TX a 100FX Multimodo, SC PLANET® ..........................................403 Pasa-Banda / Rechazo de Banda VHF y UHF dbSpectra® ........................267
1000 Mbps UTP / Fibra Óptica hasta 10 km PLANET® ............................402 Pasa-Banda / Rechazo de Banda VHF y UHF SINCLAIR® .........................267
1000 Mbps UTP / Fibra Óptica hasta 550 m PLANET®............................402 Rechazo de Banda VHF / UHF de 6 Cavidades EPCOM Industrial® ..........266
Industrial Gigabit SFP / TP PLANET® .......................................................406 Rechazo de Banda VHF / UHF de 6 Cavidades SYSCOM®.......................266
Convertidores: VHF / UHF / 800 MHz TX RX SISTEMS INC.® ..........................................268
CD con PoE epcom® POWER LINE ..........................................................226 VHF / UHF de 6 Cavidades RFS® .............................................................265
De Medios PLANET® ..............................................................................402 Duplexers y Lámparas de Emergencia EPCOM Industrial® .............................296
Industriales de CD a CD ASTRON®/ samlexamerica®/ SYSCOM®...........278
Industriales de CD a CD MW® -MEAN WELL .........................................279

E
Convertidor, Cable y Montaje UBIQUITY® NETWORKS ..................................336
Corbata para Cables ANDREW® ...................................................................210
Corbatas:
De Acero Inoxidable THORSMAN® .........................................................422 Eco Cargador / Analizador W&W® ..................................................................96
De Nylon THORSMAN® ..........................................................................422 ED® -Electronic Design- ......................................................................431
Para Cables Signal Inside™ ...................................................................209 EdgeMAX - Ruteador Administrable UBIQUITY® NETWORKS ........................334
Cortadora para Fleje THORSMAN® ................................................................422 Elemento Muestreador BIRD® .......................................................................247
CPI® .....................................................................................................440 Elemento Muestreador con Salida Variable BIRD® ........................................248
Crescend® ...........................................................................................145 Elementos Clave del Sistema MaxDispatch...................................................435
CSI® ..................................................................................................... Elementos para Jaula de Faraday TOTAL GROUNDMR ....................................310
Cuellos y Abrazaderas para Torres SYSCOM® ..............................................495 EMA Corp.® .........................................................................................
Curvas Prefabricadas CHAROFIL® ..................................................................427 EMERLIGHT® .......................................................................................
CUSHCFRAFT® ................................................. Energía Solar (Sección) ...............................................................
enfora® ................................................................................................
EnGenius® ....................................................................................

D
Enlace Vía IP y Accesorios ICOM® ..................................................................81
Enlaces Inalámbricos Calidad Carrier - Class (Low Cost) ePMP BY
CAMBIUM NETWORKS™ .............................................................................358
DataShield® ......................................................................................... Enlaces Multipunto CAMBIUM NETWORKS™ ..............................................355
dbSpectra® .......................................................................................... Ensambles para Extensión de Montajes en Pared ROHN®/ EPCOM Industrial® ... 507
DECIBEL PRODUCTS® .........................................................................163 Envío de Imágenes NEXEDGE™ KENWOOD® .................................................30
DELTA® ................................................................................................ EPCOM Industrial® ................................... 
Desoldadora y Extractor de Soldadura HAKKO® ............................................253 
Detector de Señal RF weboost® weboost® Wilson® ......................................148 epcom® ......................................................................
ÍNDICE

Detector RF OPTOELECTRONICS® .................................................................250 epcom® POWER LINE ....................................................


Diadema por Detrás de la Cabeza con Boom Flexible PHOX® ........................132 ePMP BY CAMBIUM NETWORKS™ ............................................
Diadema por Detrás de la Cabeza con Boom Flexible SERIE TITANIUM txPRO® .. 121 Equipo de Laboratorio (Sección)..................................................
Diadema y Micrófono de Garganta PHOX® ....................................................132 Equipo de Localización Vehicular con Antenas Integradas enfora® ................302
Diadema - Auricular con Atenuación de Ruido PRYME® ................................141 Equipo de Localización Vehicular Vía Celular enfora® .....................................302
Diademas Heavy Duty OTTO®........................................................................113 Equipo Remoto para Redes Inalámbricas PLANET® ......................................381
Diademas OTTO® ...................................................................................111-114 Equipos epcom® POWER LINE .....................................................................224
Divisor de Voltaje PoE 802.3af a 5/12 Vcd de 1 Puerto PLANET® ..................402 Equipos Remotos / Clientes PLANET® ...........................................................382
Divisores de Potencia epcom® ......................................................................157 Equipos y Accesorios para Banda CB MIDLAND®..........................................446
Divisores de Potencia Reactiva (Splitters) Estabilizadores para Torres SYSCOM® .........................................................496
de Bajo PIM (Passive Intermodulation) ValuDAS ...........................................160
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Lă Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016

Estación Base: Fuente de:


A8-Eibg Largo Alcance, 802.11b/g ALTAI® ............................................361 Alimentación Ininterrumpible UPS DataShield® ......................................272
ARENA alvarion® ....................................................................................370 Alimentación Ininterrumpible UPS epcom® POWER LINE .......................272
Doble Banda A8 Flexible, 802.11a/b/g ALTAI® .......................................360 Poder Industrial 12 Vcd de 40 W PLANET®.............................................407
Doble Banda A8n Flexible, 802.11a/b/g/n ALTAI® .................................362 Poder Industrial 24 Vcd de 40 W PLANET®.............................................407
Doble Banda A8-Ei Largo Alcance, 802.11a/b/g ALTAI® ........................361 Poder Industrial 48 Vcd de 120 W PLANET®...........................................407
Doble Banda A8in Gran Capacidad, 802.11a/b/g/n ALTAI® ....................363 Poder Industrial 48 Vcd de 240 W PLANET®...........................................407
Doble Banda A8-Ein Largo Alcance, 802.11a/b/g/n ALTAI® ...................363 Fuente Variable TENMA® .............................................................................242
Doble Banda Sectorial Alta Densidad......................................................369 Fuente y Analizadores de Antena TENMA® ...................................................242
 'REOH%DQGD6HFWRULDO$OWD'HQVLGDGă&RQWURODGRU Fuentes:
PLANET® ................................................................................................382 Conmutadas de Alimentación ASTRON®/ samlexamerica®/ SYSCOM® .275
Kit de Antenas MAXRAD®......................................................................161 Conmutadas de Uso Múltiple EPCOM Industrial® ...................................295
Estación de Retrabajo Digital para SMD HAKKO® .........................................253 De Alimentación (Sección) ..............................................................272-279
Estación de Soldar PS900 OKI® .....................................................................253 Industriales de CD con Gabinete MW® -MEAN WELL- ....................276,277
Estaciones Base: Industriales de CD sin Gabinete MW® -MEAN WELL- ............................276
Clásicas Wi-Fi 802.11 a/b/g, Carrier Class, Para CCTV EPCOM Industrial® ................................................................294
Punto a Multipunto alvarion® .................................................................372 Para Radiocomunicación y Plantas de Energía EPCOM Industrial® ..........295
Doble Banda Wi-Fi 802.11 a/b/g/n Doble Banda alvarion® ......................373 Reguladas...............................................................................................274
Macro Cobertura 802.11 a/b/g ALTAI®............................................360,361 Reguladas de Alimentación ASTRON® ............................................273-275
Macro Cobertura 802.11 a/b/g/n ALTAI® .......................................362-363 Reguladas de Alimentación TENMA® .....................................................274
Mixtas, Omni-Sector y Sector-Omni, 802.11 a/b/g/n Serie WBSn Función ALE: Establecimiento Automático de Enlace ICOM® ..........................55
Doble Banda alvarion® ...........................................................................373 Fundas BEE®/ KENWOOD®/ SYSCOM® para Radios Portátiles KENWOOD® .100
Omnidireccionales / Cobertura 360° .......................................................372 Fundas para Radios Portátiles ICOM®............................................................101
Sectoriales / Cobertura 120° alvarion® ...................................................372 Fundas para Radios Portátiles Motorola® ......................................................102
Wi-Fi 802.11 b/g/n SERIE WBSn alvarion® .............................................373
Estaciones Base y Repetidores TAIT® ...........................................................453

G
Estrobo:
FireBolt Plus FEDERAL SIGNAL® ............................................................480
Pulsator FEDERAL SIGNAL® ...................................................................480
Renegade FEDERAL SIGNAL® ................................................................479 Gabinete para PC EPCOM Industrial® ............................................................254
UltraStar FEDERAL SIGNAL® .................................................................480 Gabinete para TV Porteros EPCOM Industrial®...............................................282
Estrobos FEDERAL SIGNAL® .........................................................................480 Gabinetes (Sección) .....................................................................
Estrobos Ocultos para Emergencia FEDERAL SIGNAL®..................................468 Gabinetes:
Extensiones Remotas CPI® ...........................................................................440 Con Soporte Rack EPCOM Industrial® .....................................................283
Extensor 100 m PoE 802.3at de 1 Puerto 10/100/1000 Mbps PLANET® .......398 Con Soporte Rack EPCOM Industrial® ....................................................284
Extensor Inalámbrico PowerLine de 200 Mbps por Red Eléctrica PLANET® ...341 Con Soporte Rack y Multicargadores EPCOM Industrial®........................284
Extensor PoE sobre Coaxial de Largo Alcance PLANET® ................................401 Línea SVR EPCOM Industrial® .................................................................284
NEMA Cubierta Gris txPRO® ...................................................................297
NEMA Cubierta Transparente txPRO® ....................................................297

F
NEMA y Accesorios txPRO® ...................................................................297
Para Batería EPCOM Industrial® ..............................................................236
Para Estaciones Base EPCOM Industrial® ...............................................285
Familia ePMP - Incomparables en Rendimiento, Aplicaciones Súper Robustas Para Exterior SYSCOM®/ FIBOX®/ MICROCOM®.....................................298
ePMP BY CAMBIUM NETWORKS™ ..............................................................358 Para Paneles de Alarma EPCOM Industrial®............................................280
Fanvil® .......................................................................................... Para Rack EPCOM Industrial® .................................................................289
FEDERAL SIGNAL® ................................................................ Para Sirenas de Alarmas EPCOM Industrial® ..........................................280
FIBOX® ................................................................................................ Para Usos Múltiples EPCOM Industrial® .................................................281
Filtros Preselectores para Rx TX RX SISTEMS INC.®/ BIRD®..........................269 Para Usos Múltiples, Trabajo Rudo y TV Porteros EPCOM Industrial® .....282
Filtros RF (Sección)...................................................................... Para Videograbadoras EPCOM Industrial®...............................................280
FIPLEX® ............................................................................................... Para Videograbadoras, Paneles y Sirenas de Alarma EPCOM Industrial® ...... 280
ÍNDICE
Fish Finder MX-F5000 MarineCommander™ ICOM® .......................................46 Plásticos Móviles con Amortiguador SYSCOM® .....................................298
Flasher para Barras de Luces FEDERAL SIGNAL® .........................................482 GAI-TRONICS® ....................................................................................439
Flejes THORSMAN® ......................................................................................422 Generación de la Banda Ancha en Redes Inalámbricas mimosa™ ................348
Focos de Repuesto FEDERAL SIGNAL® ........................................................483 Generador Eólico de 400 W, 12 V, SUNFORCE® ............................................229
Frecuencímetros OPTOELECTRONICS® ..........................................................249 Generadores Eólicos y Montajes para Módulos SUNFORCE® ........................229
FREEDOM® .......................................................................................... GPS (Sección) ..............................................................................
GPSmonitor® .......................................................................................304
Grabador de Metales DREMEL® ....................................................................255

También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx Lă
Año 2016

Grabadora: Interruptores de Control FEDERAL SIGNAL® .................................................472


Con Ambiente Gráfico en Reproducción de Voz LA-8000 TEAC® .................. 442 Introducción y Normativa de Cableado Estructurado .....................................413
De 1 Canal Analógico con Administración en Red TEAC® .......................442 Inversor / Cargador Onda Pura samlexamerica® ............................................237
De Conversaciones Telefónicas y Radio STANCIL SOLUTIONS® .............441 Inversores de Corriente (CD-CA) samlexamerica® .........................................237
De Red TELEX® .......................................................................................437 Inversores de Corriente samlexamerica®.......................................................237
Grabadoras de Voz TEAC® ............................................................................442 Inyector:
Grabadoras Digitales de Voz TEN-4 STANCIL SOLUTIONS®...........................441 High PoE 1 Puerto Gigabit All-In-One PLANET® .......................................399
Grandstream®...............................................................................383-386 High PoE 802.3af/at de 4 Puertos 10/100/1000 Mbps PLANET® ............398
Grapas para Conductores Planos y Redondos THORSMAN® .........................422 High PoE Industrial Gigabit PLANET® ......................................................404
Guest Internet® ...................................................................................339 PoE 802.3af de 1 Puerto 10/100 Mbps PLANET® ...................................397
Guía para Selección de Charola .....................................................................423 PoE 802.3af de 4 Puertos 10/100Mbps PLANET®...................................399
PoE 802.3at de 1 Puerto 10/100/1000 Mbps PLANET® ..........................397
PoE WPOE-56VN alvarion® .....................................................................373

H
Ultra PoE 60 W Gigabit All-In-One PLANET® ...........................................399
Inyectores, Extensores y Divisores Power over Ethernet PLANET® .........397-399
,3&‡&RQWURODGRUGH(TXLSRVSRU,3,&20® ..........................................80
HAKKO® ............................................................................................... ,3)6‡5DGLR9LUWXDOSDUD,3+,&20® ...............................................80
HELIAX® 2.0 ANDREW® (Cables) ..................................................................203 ,3+‡(TXLSRGH5DGLRFRPXQLFDFLyQ$YDQ]DGRSRU,3,&20® ........................ 80
Herrajes y Accesorios para Cables ANDREW® .............................................208 ISO 9001:2008 Certificación de Calidad Internacional ...................................510
Herrajes y Accesorios Signal Inside™ ..........................................................209
Herramienta:

J
Manual y Automatizada para para Preparación de Cables ANDREW® ....207
Para Desforrar Cables RF CONNECTORS®...............................................254
Para Flejar BAND-INOX® .........................................................................229
Para Flejar EPCOM Industrial® ................................................................292 Jumpers Especializados EPCOM Industrial® ..................................................223
RF CONNECTORS® (Kits) ........................................................................251 Jumpers para Entrega Inmediata EPCOM Industrial® ....................................222
Herramientas: Jumpers y Cable de Red para Equipos de Redes Inalámbricas
De Laboratorio ........................................................................................252 RF CONNECTORS® ..............................................................................380
De Laboratorio HAKKO® .........................................................................253
De Laboratorio RF CONNECTORS® .........................................................251

K
De Terminación PANDUIT™ ...................................................................412
Para Cableado Linkedpro® ......................................................................417
Para Instalar Antenas Móviles Pulse® LARSEN®.....................................254
Para Preparación de Cables ANDREW® ..................................................207 KENWOOD® .........................
Para Radios Portátiles KENWOOD® / ICOM® ..........................................252 
Herramientas y Equipo de Laboratorio EPCOM Industrial® .............................254 KESTER® ..............................................................................................
Herramientas y Software para Programación SYSCOM® ...............................255 Kit de:
HighLighter Halógeno FEDERAL SIGNAL® .....................................................475 Alineación para Antenas de 620 mm UBIQUITY® NETWORKS................323
HighLighter LED Tecnología ROC FEDERAL SIGNAL® ....................................475 Antenas Omnidireccionales alvarion® ....................................................372
HIKVISION® ........................................................................................ Componentes para Mástil Completo SYSCOM® ....................................498
HUSTLER® ................ Energía Solar 24 Hrs. de Operación epcom® POWER LINE ....................225
HYT® ............................................................................................ Montaje con Panel Frontal Avanzado para Radios Móviles KENWOOD® ..23
Montaje con Panel Frontal Básico Serie 90
para Radios TK790H/ TK890H KENWOOD® ..............................................23

I
Montaje para Radios Móviles Aéreos / Base IC-A200 / A210 ICOM® ......38
Kit:
Extensor PoE Sobre Coaxial de Largo Alcance de 1 Puerto PLANET® .....401
ICOM® ................................................ Extensor PoE Sobre UTP de Largo Alcance de 1 Puerto PLANET® ..........401
 Para Cargar Baterías con Fuentes de Poder ............................................273
,&5‡5HFHSWRUGH5DGLRFRPXQLFDFLyQ,&20® ..........................................82 Para Convertir Antenas Móviles VHF y UHF ............................................192
ÍNDICE

,&5‡5HFHSWRUGH5DGLRFRPXQLFDFLyQ,&20® ............................................82 Para Estación Base de Antenas MAXRAD® ............................................161


IDAS™ ICOM® ..........................................................................................66-77 Profesional de Solapa de 2 y 3 Cables OTTO® ........................................110
Inserto de Amortiguación para Cables Signal Inside™ .................................209 Repetidor “Esclavo” SYSCOM® para Radios KENWOOD® ......................450
Intercomunicador Inalámbrico RITRON® ........................................................443 Universal a Prueba de Agua para Cables Signal Inside™ .......................209
Interconector Telefónico y Controlador de Repetidor CSI®.............................428 Kits de:
Interconector Telefónico ZETRON® ................................................................428 Adaptadores Coaxiales, SMA y DIN RF CONNECTORS® .........................251
Interconectores y Controladores ZETRON®/ CSI® ..........................................428 Adaptadores Universales Unidapt RF CONNECTORS® ............................251
Interfaces para Programar Radios ICOM® .....................................................257 Amplificadores de Señal para Celular y NEXTEL Evolution ......................152
Interruptor (Encienda/Apague) Vía Radio SYSCOM® .....................................234 Aterrizaje Compacto de Cables ANDREW® ............................................207
Interruptor de Control FEDERAL SIGNAL®......................................................464 Aterrizaje PolyPhaser® ............................................................................315
Interruptor Solar SYSCOM®...........................................................................235 Aterrizaje Signal Inside™ .......................................................................210
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Lă Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016

Aterrizaje Universal de Cables ANDREW® ..............................................207 Giratorias FEDERAL SIGNAL® ................................................................478


Aterrizaje Universal Signal Inside™ .......................................................210 LED para Motocicleta FEDERAL SIGNAL® ..............................................471
Energía Solar para 4 Dispositivos PoE 802.3af/at epcom® POWER LINE ...... 226 Para Control de Tráfico FEDERAL SIGNAL® ............................................477
Energía Solar epcom® POWER LINE .............................................................. 226 Perimetrales 3600 LED FEDERAL SIGNAL® ............................................482
Estaciones Base de (Antena Incluida) alvarion®......................................377 Perimetrales de Emergencia FEDERAL SIGNAL® ....................................481
Herramienta RF CONNECTORS® .............................................................251 Perimetrales LED Solaris QuadraFlare FEDERAL SIGNAL® ......................481
Luces STREET HAWK® ..........................................................................483 STREET HAWK® -Kits- ............................................................................483
Pararrayos TOTAL GROUNDMR.................................................................309 Telescópicas EPCOM Industrial® ..............................................................487
Sistemas de Tierra Física TOTAL GROUNDMR ...................................306,307 Luz de Advertencia Interior de LED Viper S2 FEDERAL SIGNAL® ...................468
Kits para Aterrizar Cables con Llave para Ajustar Cables ANDREW® .............207 Luz de Advertencia Latitude FEDERAL SIGNAL® ............................................465
Kits Solares para Aplicaciones de CCTV y Redes epcom® POWER LINE .......226 Luz de Advertencia para Interior EPCOM Industrial® .......................................487

L M
Laird®............................................................................................ Malla para Sujetar Cable y Llevarlo a La Punta de la Torre
Lámpara de Bajo Perfil Cuello de Cisne Littlite® FEDERAL SIGNAL® .............468 para Cables Signal Inside™ ..........................................................................209
Lámparas: Manual de Modificaciones en Español e Inglés
Altamente Eficientes para Energía Solar a 12 Vcd SYSCOM®.................236 para Radios ICOM®/ KENWOOD® y Otras Marcas ........................................258
De Emergencia EPCOM Industrial®/ SYSCOM® ......................................296 Manuales Técnicos de Servicio para Radios ICOM®/ KENWOOD®
De Obstrucción y Accesorios FEDERAL SIGNAL®/ SYSCOM® .................497 y Otras Marcas .............................................................................................258
Ocultas EPCOM Industrial® ......................................................................487 Marcos Modulares y Placas para Mobiliario NetKey™ PANDUIT™ ...............411
T8 de LED Altamente Eficientes Bravoled® .............................................239 MarineCommander™ (Sistema de Navegación Marina) ICOM® .....................46
LARSEN® ................................................................. MASTER® APPLIANCE ........................................................................
 MasterTrack®......................................................................................304
Lazos de Acoplamiento para WP-639 SYSCOM® ..........................................266 Mástiles Telescópicos SYSCOM® ................................................................498
Lector de Baterías Inteligentes KAS-12 KENWOOD® ......................................35 MAXON® ......................................
L-com® .................................................................................................196 
Licencias de Actualización Multifrecuencia Medidor de:
para Estaciones Base alvarion® ..............................................................376,377 De Intensidad de Campo Autocontenido BIRD® ......................................247
Licencias de Actualización Multifrecuencia para Suscriptores alvarion® ........377 De Potencia (Wattmetro) TELEWAVE INC.® ...........................................246
Licencias de Actualización alvarion® .............................................................379 De Potencia y SWR para Bandas de Radioaficionados VHF MFJ® ..........246
Línea de Vida de Seguridad en Torres SYSCOM® .........................................496 De Potencia y SWR para HF / VHF / UHF MIDLAND® .............................246
Línea Industrial Onda Pura para Sistemas Medidor Digital de Potencia BIRD® ................................................................246
a 12 Vcd 300 W/ 3000 W samlexamerica®...................................................237 meitrack® ............................................................................................303
Linkedpro®.................................................................................... Mercados Verticales y Soluciones ePMP BY CAMBIUM NETWORKS™ .357-359
LinkedproGPS® ....................................................................................304 Mesabanco de Trabajo para Uso Rudo EPCOM Industrial® ...........................282
Lite Beam para Intemperie UBIQUITY® NETWORKS ......................................326 Mesabanco para Laboratorio EPCOM Industrial®...........................................254
Localización Vehicular Vía GPS ICOM® ............................................................79 MFJ® ................................................................
Localización Vía Celular .................................................................................302 Micro Cámara IP UniFi® Video UBIQUITY® NETWORKS .................................338
Localización Vía Celular meitrack® .................................................................303 MICROCOM® .......................................................................................
Localizador: Micrófono:
De Bancos de Peces (Fishfinder) / X4Pro LOWRANCE® ..........................300 De Garganta OTTO®................................................................................109
De Bancos de Peces (Fishfinder) con GPS Integrado / Elite4 LOWRANCE® .. 300 De Garganta SERIE 1500 PRYME® ..........................................................141
De Bancos de Peces (Fishfinder) LOWRANCE® .....................................300 De Solapa – Audífono Discreto PRYME® ................................................137
Para Caja de Trailer Vía Celular epcom® ................................................302 De Solapa con Audífono Ajustable al Oído para Ambiente Ruidoso txPRO®.. 124
Para Motocicletas meitrack® ..................................................................303 De Solapa con Audífono Ajustable al Oído PHOX® ..................................130
Personal Vía Celular meitrack® ...............................................................303 De Solapa con Audífono Ajustable al Oído SERIE TITANIUM txPRO® ......118
Vehicular Vía Celular meitrack® ..............................................................303 De Solapa con Audífono Discreto PRYME® .............................................138
ÍNDICE
Localizadores de Bancos de Peces y GPS LOWRANCE® ................................300 De Solapa con Audífono en Forma de Anillo Abierto PRYME® ...............138
Localize® .............................................................................................305 De Solapa con Audífono en Forma de Anillo PRYME® .............................138
LOWRANCE® ................................................................................ De Solapa con Auriculares de Gancho en Forma de G txPRO®................123
Luces: De Solapa con Estilo de Gancho PRYME® ..............................................137
Auxiliares EPCOM Industrial® ...................................................................488 De Solapa con Gancho de Auricular en Forma de D txPRO® ...................123
De Advertencia Ideales para Ambulancias EPCOM Industrial® .................491 De Solapa con Receptor y Antena de GPS SERIE TITANIUM txPRO® .......117
De Advertencia para Interiores Spectralux ILS De Solapa de 2 Hilos para Ambiente Ruidoso txPRO® ............................128
con Tecnología LED Multicolor / Solaris / ROC FEDERAL SIGNAL®..........465 De Solapa de 2 Hilos PHOX® ..................................................................131
De Emergencia Compactas EMERLIGHT® / S FIRE® ................................240 De Solapa de 2 Hilos SERIE TITANIUM txPRO® ......................................120
De Emergencia y Accesorios FEDERAL SIGNAL® ...................................482 De Solapa de 3 Hilos PHOX® ..................................................................131
De Respaldo para Emergencia SUNPOWER®..........................................240 De Solapa de 3 Hilos SERIE TITANIUM txPRO® ......................................120
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx Lă
Año 2016

De Solapa y Audífono Ajustable al Oído PRYME® ...................................137 Mini Barras de Luces:


Dinámico con Auricular Dual Alcolchonada .............................................127 De 24 LED GEN III EPCOM Industrial® .....................................................490
GPS para Radios Portátiles Comerciales TK-2312/ 3312 KENWOOD® ........9 EPCOM Industrial®..................................................................................489
GPS para Radios Portátiles Comerciales TK-2360/ 3360 KENWOOD® ......10 Luces FEDERAL SIGNAL® ......................................................................476
Liviano de Garganta PHOX® ....................................................................132 Luces Heavy Duty FEDERAL SIGNAL® ...................................................474
Liviano de Garganta SERIE TITANIUM txPRO® ........................................121 Luces HighLighter FEDERAL SIGNAL® ....................................................475
Para Radios Móviles Comerciales Digitales NX-740/ 840 KENWOOD® ....24 Mini Torretas de Estrobo HighLighter FEDERAL SIGNAL® .............................476
Para Radios Móviles Comerciales TK-7302H/ 8302H KENWOOD® ..........20 Mini-Circuits®......................................................................................
Para Radios Móviles Comerciales TK-7360H/ 8360H KENWOOD® ..........21 Módem/Router ADSL Inalámbrico de 4 Puertos de Fácil Configuración
SYSCOM® para Radios Móviles Motorola® ...........................................143 TRENDNET® ........................................................................................341
Uso Rudo de Garganta para Ambiente Ruidoso txPRO® .........................128 Módem de Datos de Última Generación IC-F5122DD/ 6122DD ......................78
Micrófono - Audífono: Módulo Receptor y Excitador Reciter TAIT® ..................................................453
De Alta Tecnología PHOX® .....................................................................130 Módulos:
Interconstruido de Alta Tecnología SERIE TITANIUM txPRO® .................119 Conectores NetKey™, Categoría 6 y 5e PANDUIT™ ..............................410
Interconstruido en Auricular con PTT Grande ..........................................125 De A/V y Herramientas PANDUIT™ ........................................................412
para Ambiente Ruidoso txPRO®..............................................................125 De Audio y Video NetKey™ PANDUIT™.................................................412
OTTO® .............................................................................................108-110 De Reemplazo para Amplificadores epcom® ..........................................158
Micrófono - Bocina: Fotovoltaicos para Todo Tipo de Aplicaciones epcom® POWER LINE .....227
Genesis II OTTO® ...................................................................................107 Fotovoltaicos para Todo Tipo de Aplicaciones SOLARWORLD® ..............228
Con Control Remoto de Volumen para Ambiente Ruidoso txPRO®..........124 Fotovoltaicos SOLARWORLD® .........................................................227-228
De Uso Rudo SERIE 2100 PRYME® .........................................................135 Internos de Reemplazo para TB8100 TAIT® ............................................453
De Uso Rudo SERIE 4200 PRYME® .........................................................136 Opcionales para MarineCommander™ ICOM® .........................................46
Para Exteriores para Ambiente Ruidoso txPRO® .....................................125 Monitor de Servicio de Radiocomunicación Com 3010 ramsey® ..................241
Para Intemperie PHOX® ..........................................................................129 Monitoreo GPS en Tiempo Real para Vehículos, Personas
Para Intemperie SERIE TITANIUM txPRO® ..............................................119 y Mercancías GPSmonitor® ...........................................................................304
Pequeño y Ligero PHOX® ........................................................................129 Monitores de Servicio ramsey® .....................................................................241
Pequeño y Ligero SERIE TITANIUM txPRO® ............................................118 Montaje:
PRYME® .................................................................................................135 Kit con Panel Frontal Avanzado para Radios Móviles KENWOOD® ...........23
Series Pro y Revo OTTO® ........................................................................105 Kit con Panel Frontal Básico Serie 90 para Radios TK790H/ TK890H
STORM OTTO® ......................................................................................106 KENWOOD® .............................................................................................23
Micrófonos - Audífonos para Radios Portátiles PHOX® ..................................130 Kit para Radios Móviles Aéreos / Base IC-A200 / A210 ICOM® ...............38
Micrófonos - Audífonos y Adaptadores PHOX® .............................................133 Pared PWM ROHN®/ EPCOM Industrial® ...............................................507
Micrófonos de: Pared WM212 ROHN®/ EPCOM Industrial® ...........................................507
Solapa para Radios Portátiles .................................................................120 Techo BRM4 (No Penetrante) ROHN®/ EPCOM Industrial® ....................506
Solapa para Radios Portátiles PHOX® ....................................................131 Techo FRM (No Penetrante) ROHN®/ EPCOM Industrial® ......................506
Solapa para Seguridad Privada PRYME® .................................................138 Techo JRM (No Penetrante) ROHN®/ EPCOM Industrial® ......................506
Solapa PRYME® .....................................................................................137 Techo No Penetrante ROHN®/ EPCOM Industrial® .................................506
Micrófonos para: Montaje para:
Micrófonos para Casco SERIE 800 PRYME® ...........................................136 Cámaras, Domos y Luminarias EPCOM Industrial® .................................292
Micrófonos para Radios Móviles ICOM®.................................................143 Energía Solar EPCOM Industrial® .....................................................228,293
Micrófonos para Radios Móviles KENWOOD® ........................................143 Energía Solar y Equipo de Redes EPCOM Industrial® ..............................293
Micrófonos - Audífonos: Equipo de Redes EPCOM Industrial®.......................................................293
Para Radios Portátiles Comerciales TK-2000/ 3000 KENWOOD®................7 Fuente de Poder en Rack SYSCOM® ......................................................275
Para Radios Portátiles Comerciales TK-2312/ 3312 KENWOOD®................9 Gabinetes EPCOM Industrial® .................................................................292
Para Radios Portátiles Comerciales TK-2360/ 3360 KENWOOD®..............10 Gabinetes, Cámaras, Domos y Monitores EPCOM Industrial®.................292
Para Radios Portátiles ICOM® .................................................................104 Poste y Jaula Reforzada EPCOM Industrial® ...........................................236
Para Seguridad Privada PRYME® ............................................................139 Montajes para:
PHOX® ....................................................................................................133 Antenas ..................................................................................................391
SERIE PERFORMANCE txPRO® ...............................................................122 Antenas Base DECIBEL PRODUCTS® ......................................................188
Micrófonos - Bocina para: Antenas Base MAXRAD®/ ANDREW®/ DECIBEL PRODUCTS® ................163
ÍNDICE

Radios Portátiles PHOX®.........................................................................129 Antenas Móviles MAXRAD®/ TRAM®/ Pulse® LARSEN®


Radios Portátiles SERIE TITANIUM txPRO® ............................................118 / HUSTLER®/ SYSCOM®/ as® ......................................................................... 162
MIDLAND® .......................................................................................... Antenas para Redes Inalámbricas ..........................................................197
mimosa™ ............................................................................................348 Energía Solar ..........................................................................................229
Estaciones Base alvarion® ......................................................................371
Instalación de Celdas Solares EPCOM Industrial® ...................................497
Radios Móviles Comerciales TK-790H/ 890H y Accesorios KENWOOD® ..22
Montajes para Radios Móviles KENWOOD® .............................................23

También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Lă Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016

Montajes y Accesorios para: Paneles de:


Antenas ..................................................................................................161 Parcheo Linkedpro® ................................................................................417
Antenas Marinas Shakespeare® .............................................................163 Parcheo NetKey™ PANDUIT™ ...............................................................411
Antenas MAXRAD®/ Shakespeare®/ DECIBEL PRODUCTS®/ ANDREW® 163 Parcheo, Marcos y Cajas Superficiales PANDUIT™ ................................411
Antenas MAXRAD®/ TRAM®/ Pulse® LARSEN® Tonos ZETRON® .....................................................................................433
/ HUSTLER®/ SYSCOM®/ as® .................................................................162 Paquete de Torres Arriostradas con Accesorios SYSCOM® ..........................499
Antenas Móviles HF / CB HUSTLER® ......................................................161 Paquete para Instalación de Mástiles SYSCOM® .........................................498
Antenas para CB.....................................................................................202 Paquetes de Torres Arriostradas SYSCOM® .................................................499
MORNINGSTAR®................................................................... Paquetes para Torre SYSCOM® ....................................................................501
Motorola® ...................................................................... Pararrayos TOTAL GROUNDMR ................................................................309,310
Multiacoplador TX RX SISTEMS INC.®...........................................................269 Partes de Reemplazo para:
Multiacopladores para Rx TX RX SISTEMS INC.®/ BIRD® ..............................269 Auriculares Uso Rudo OTTO® .................................................................113
Multicargadores EPCOM Industrial® ..............................................................284 Equipos de Vigilancia PRYME® ...............................................................142
Multicargadores para Radios Portátiles Comerciales ICOM® ...........................92 Micrófono - Audífono OTTO® .................................................................110
MW® - MEAN WELL..................................................................... Partes para:
ICS-2010-MX12/AS-422/6S FEDERAL SIGNAL® ....................................483
Luces Ámbar FEDERAL SIGNAL® ...........................................................483

N
Motocicleta FEDERAL SIGNAL® .............................................................483
Radios Móviles KENWOOD®............................................................262,263
Radios Portátiles KENWOOD® .........................................................259-261
NanoBeam 802.11ac para Intemperie UBIQUITY® NETWORKS .....................329 Repetidores KENWOOD® .......................................................................263
NanoStation: Torreta ARJENT FEDERAL SIGNAL® ......................................................483
M5- M2 para Intemperie UBIQUITY® NETWORKS ..................................327 Torreta Legend FEDERAL SIGNAL® ........................................................483
Loco M5 - M2 para Intemperie UBIQUITY® NETWORKS.........................327 Torreta Vista FEDERAL SIGNAL® ...........................................................483
Loco M900 para Intemperie UBIQUITY® NETWORKS .............................327 Wattmetro BIRD® ...................................................................................248
Navajas de Repuesto para Herramientas de Corte Automatizado..................207 Pasamuro Sencillo con Bota ANDREW® .......................................................208
Navajas de Repuesto para Herramientas de Corte Manual............................207 Pasamuros de Pared Linkedpro® ...................................................................416
NEXEDGE™ (Software) KENWOOD® ..............................................................30 Patch Cord Linkedpro® ..................................................................................414
NexeTalk Suite - Solución de Despacho, Grabación y Localización IP ..............33 Patch Panel / Conectores Jack Linkedpro® ....................................................416
NOVITGPS® .........................................................................................305 Patch Panel y Organizadores Linkedpro® .......................................................417
Nueva Generación Carrier de Altísima Capacidad CAMBIUM NETWORKS™ 351 PCTEL® ..................................................................................
NVR UniFi® Video UBIQUITY® NETWORKS ....................................................338 Peralte de 33/ 66/ 116/ 166 mm Tramos Rectos de 3 m CHAROFIL®............424
PHOX® ..........................................................................................
Pistola Desoldadora / Extractora HAKKO® ....................................................253

O
Placas:
De Pared NetKey™ PANDUIT™ .............................................................410
De Pared y Módulos Conectores Keystone PANDUIT™ ..........................410
OKI® ..................................................................................................... Igualadoras para Torres SYSCOM® ........................................................495
Omega® ............................................................................................... Pasamuros Múltiples ANDREW® ...........................................................208
Onda Pura para Sistemas a 12 Vcd Línea Industrial Pasamuros Múltiples para Cables Signal Inside™ .................................209
300 W/ 3000 W samlexamerica® ................................................................237 PLANET® ........................................................................
OPTOELECTRONICS® .......................................................................... Plantas de Energía para Emergencias EPCOM Industrial® ......................272, 295
Orden de Requisición de Compra / Pedido SYSCOM® ...................................515 Plataforma de Monitoreo Localize® ..............................................................305
Organismos y Normas del Cableado Estructurado .........................................413 Plataforma de Monitoreo Skycom® ..............................................................305
Organizadores de Cables Horizontal y Vertical Linkedpro® .............................417 Plataformas de Localización Vía Celular .................................................304,305
OTTO® ..................................................................................................105 GPSmonitor® ..........................................................................................304
LinkedproGPS® ......................................................................................304
Localize® ................................................................................................305

P
MasterTrack® .........................................................................................304
NOVIT GPS® ...........................................................................................305
ÍNDICE
Skycom connect®...................................................................................305
PANDUIT™................................................................................... Política de Garantía SYSCOM® ......................................................................512
Panel: PolyPhaser® ..........................................................................
Adaptador IP TELEX® ..............................................................................438 Porteros IP Fanvil® ..................................................................................387-388
Comunitario con Interconector Telefónico ZETRON® ..............................433 Portero IP/SIP para Intemperie - I21T/ I21 Fanvil® ...................................388
Comunitario de Alto Rendimiento ZETRON® ...........................................433 Portero IP/SIP Soporta Tarjetas de RFID - I20T Fanvil® ............................387
Comunitario para 154 Grupos ZETRON® .................................................433 Positive Charge® ...................................................................................88
De Protección Contra Sobretensiones TRANSTECTOR®..........................318 PowerBeam 802.11ac -Nueva Solución
De Tonos Comunitario ED® -Electronic Design-.......................................432 en Estándar 802.11ac- UBIQUITY® NETWORKS ...........................................328
Panel e Interfaces Telefónicos IP TELEX® ......................................................438 PowerProducts® ....................................................................
Preamplificador EMA Corp.® .........................................................................269
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx Lă
Año 2016

Preselectores y Multiacopladores VHF / UHF / 800 MHz TELEWAVE INC.® ..270


Probador de Fase SYSCOM® .........................................................................380
R
Probador para Cables Punto a Punto y Cruzado (Cat5) RF CONNECTORS® ....380
Rack Profesional Abierto EPCOM Industrial® ..........................................286,287
Probador Power over Ethernet Compacto PLANET® ......................................399
Racks Abiertos de Pared EPCOM Industrial® .................................................285
Productos para Energía Solar SYSCOM® .......................................................236
Radar Marino MXR-5000T/MX-5000R MarineCommander™ ICOM® ..............46
Productos y Aplicaciones para Energía Solar SYSCOM®................................235
Radio Banda Civil de 40 y 400 Canales MIDLAND® ......................................446
Programador de EEPROMS ...........................................................................255
Radio Bases (Sección) ........................................................................448
Programador para Radio Portátil Comercial TK-2000/ 3000 KENWOOD® ..........7
Radio Móvil:
Programadores Originales para Radios KENWOOD®......................................256
Aéreo IC-A110 y Accesorios ICOM® ........................................................38
Programadores para Radios ICOM® ..............................................................257
Aéreo IC-A210 y Accesorios ICOM® ........................................................38
Programadores SYSCOM® para Radios KENWOOD®.....................................256
Aéreo IC-A220 y Accesorios ICOM® ........................................................38
ProStar® ................................................................................................95
Amateur para Radioaficionados TS-990S HF / 50 MHz
Protección Contra Descargas (Sección) .....................................306-319
y Accesorios KENWOOD® ..........................................................................3
Protector:
Amateur TK-90M HF y Accesorios KENWOOD® .........................................5
Coaxial Contra Descargas Atmosféricas txPRO® ....................................313
Amateur TM-281AK VHF de Alta Potencia y Accesorios KENWOOD®........4
Contra Descargas UBIQUITY® NETWORKS ............................................337
Amateur TS-2000 HF, VHF, UHF y Accesorios KENWOOD® .......................4
De Corriente Alterna de 1 Fase TRANSTECTOR® ....................................318
Comercial / Profesional HF IC-F8101 ICOM® .............................................55
De Datos Multiprotocolo TRANSTECTOR® ..............................................317
Comercial / Profesional HF ICOM® ............................................................55
De Picos DELTA® ....................................................................................231
Comercial Digital NX-900 y Accesorios KENWOOD® ...............................28
De Video en BNC txPRO® .......................................................................319
Comercial Digital NX-920 y Accesorios KENWOOD® ..............................27
De Video para Cámaras Analógicas de 16 Puertos txPRO®.....................319
Comercial IC-F5013/ 6013 y Accesorios ICOM® .......................................63
De Video para Domos PTZ txPRO®..........................................................319
Comercial IC-F5021/ 6021 y Accesorios ICOM® .......................................64
Ethernet de 12 Vcd a 10/ 100 Mbps TRANSTECTOR® ............................318
Convencional y Trunking LTR/ Passport IC-F621TR y Accesorios ICOM® ..65
Para Cámaras con PTZ (Pan-Tilt-Zoom) TRANSTECTOR® ........................316
De Datos IC-F5122DD/ 6122DD ................................................................78
Para Cámaras IP TRANSTECTOR®...........................................................316
Digital Avanzado IC-F5123D/ 6123D y Accesorios ICOM® ........................74
Power over Ethernet de 24 Vcd a 10/ 100 Mbps TRANSTECTOR® .........318
Digital Avanzado NX-5700/ 5800 y Accesorios KENWOOD® ...................................29
Power over Ethernet Individual 10/ 100 Mbps ........................................317
D-STAR para Aficionados IC-2820H y Accesorios ICOM® .........................48
Power over Ethernet Individual 55 Vcd a 100 Mbps ...............................317
D-STAR para Aficionados ID-880H y Accesorios ICOM®...........................48
Power over Ethernet Individual 55 Vcd a 1000 Mbps .............................317
FM para Aficionados IC-V8000 y Accesorios ICOM® ...............................51
Power over Ethernet para 8 Módulos a 10/ 100 Mbps TRANSTECTOR®.317
HF para Aficionados IC-78 y Accesorios ICOM® .......................................52
Vía Cable Coaxial para Cámaras Analógicas TRANSTECTOR®.................316
Marino HF IC-M700PRO/41 y Accesorios ICOM® ....................................45
Protectores:
Marino HF IC-M802 y Accesorios ICOM® .................................................45
Coaxiales contra Descargas Atmosféricas
Marino VHF IC-M324 y Accesorios ICOM® ..............................................43
(Con Ceja Latera y Frontal) PolyPhaser® ..........................................313-314
Marino VHF IC-M400BB y Accesorios ICOM® ..........................................44
Coaxiales para Amplificadores de Punta de Torre PolyPhaser® ...............315
Marino VHF IC-M412 y Accesorios ICOM® ..............................................42
Contra Descargas Atmosféricas txPRO®/ PolyPhaser® ....................313-314
Marino VHF IC-M424 y Accesorios ICOM® ..............................................42
Contra Descargas PolyPhaser ..........................................................313-315
Marino VHF IC-M506 y Accesorios ICOM® ...............................................43
Contra Descargas PolyPhaser® ...............................................................222
Marino VHF IC-M604 y Accesorios ICOM® ..............................................44
Contra Descargas TRANSTECTOR® ................................................316-318
Marino VHF UM-380 y Accesorios uniden® .............................................45
Contra Descargas txPRO® ......................................................................319
Para Aficionados HF, VHF y UHF y Accesorios ICOM® .............................53
Contra Sobretensiones Eléctricas - Aplicación para CCTV IP y Redes de
Para Aficionados Multimodo Tribanda HF/ VHF/ UHF IC-7100
Datos TRANSTECTOR® ...........................................................................380
y Accesorios ICOM® ................................................................................53
Contra Sobretensiones Eléctricas TRANSTECTOR® .........................316-318
VHF para Aficionados IC-2300H y Accesorios ICOM® ...............................51
De Banda Ancha para Combinadores PolyPhaser® .................................315
Radio para Transmisión de Datos RF CONNECTORS® ....................................443
Ethernet: 100/ 1000 Mbps txPRO®.........................................................319
Radio Portátil:
Para Sistemas de Video Análógico, IP, Datos PTZ y Ethernet txPRO® ....319
Amateur TH-D72A y Accesorios KENWOOD® ............................................2
PoE de 24 Puertos para 10/ 100/ 1000 Mbps txPRO® ............................319
Amateur TH-F6A y Accesorios KENWOOD® ...............................................2
PoE de 8 Puertos para 10/ 100/ 1000 Mbps txPRO® ..............................319
Amateur TH-K20AK y Accesorios KENWOOD® ..........................................2
PoE para 10/ 100/ 1000 Mbps (Interior) txPRO®.....................................319
Comercial IC-F50 y Accesorios ICOM® ....................................................61
PoE: 10/ 100/ 1000 Mbps (Exterior) txPRO®...........................................319
ÍNDICE

Comercial PKT-03 KENWOOD® .................................................................6


Power over Ethernet Individuales TRANSTECTOR® ................................317
Comercial TK-3230 y Accesorios KENWOOD® ...........................................6
Protectores y Jumpers SYSCOM®.................................................................222
Convencional y Trunking LTR/ Passport IC-F43TR y Accesorios ICOM® ....65
PRYME® .......................................................................................
Digital NX-420K3 y Accesorios KENWOOD® ...........................................16
PRYMEGPS™ ......................................................................................134
Digital Wi-Fi IP-100H ICOM® ...................................................................80
Puente Ethernet PowerLine de 500 Mbps por Red Eléctrica PLANET® ..........341
Digital Avanzado NX-5200/ 5300/ 5400 y Accesorios KENWOOD® .........19
Pulse® LARSEN® .....................................................
D-STAR para Aficionados IC-80AD y Accesorios ICOM® ..........................47

D-STAR para Aficionados IC-92AD y Accesorios ICOM® ..........................47
Puntas de Reemplazo para Estación de Soldar PS900 OKI® ..........................253
Marino IC-M73 y Accesorios ICOM® ........................................................39
Puntas Piezoeléctrica para Uso Industrial TOTAL GROUNDMR.........................310
Marino IC-M92D y Accesorios ICOM® ......................................................39
Marino VHF IC-GM1600 y Accesorios ICOM® ..........................................41

También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Lă Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016

Marino VHF IC-M24 y Accesorios ICOM® ................................................40 Digitales IC-F3261/ 4261/ DS/ DT y Accesorios ICOM® ...........................71
Marino VHF IC-M25 y Accesorios ICOM® ................................................40 Digitales IC-F3360/4360/DS/DT y Accesorios ICOM® ..............................72
Marino VHF IC-M36 y Accesorios ICOM® ................................................40 Digitales NX-200G/ 300G y Accesorios KENWOOD® ...............................17
Marino VHF IC-M88 y Accesorios ICOM® ................................................41 Digitales NX-220/320 y Accesorios KENWOOD®.................................14,15
Para Aficionados IC-T70A y Accesorios ICOM® ........................................50 Digitales NX-240/ 340 y Accesorios KENWOOD®.....................................13
Para Aficionados IC-V80 y Accesorios ICOM® ..........................................50 Digitales NX-410/411 y Accesorios KENWOOD® .....................................18
Radio Portero - Interfono Inalámbrico SYSCOM® ...........................................449 Ditigales NX-5200/ 5300/ 5400 y Accesorios KENWOOD® ......................19
Radio Portero DOORCOM RITRON® ...............................................................444 Digitales y Accesorios ICOM® ............................................................66-73
Radio ProTalk XLS TK-3230 y Accesorios KENWOOD®......................................6 Digitales y Accesorios KENWOOD® .....................................................13-18
Radio Switch SYSCOM® ..............................................................................429 D-STAR para Aficionados y Accesorios ICOM® ........................................47
Radio Virtual IP-100H ICOM® ..........................................................................80 Marinos VHF y Accesorios ICOM® ......................................................39-41
Radiobases Fabricadas con Potentes Radios KENWOOD® Serie 90 .................... 448 Para Aficionados y Accesorios ICOM® ......................................................50
Radiobases Potentes ICOM®/ KENWOOD® ..................................................448 Radios y Accesorios ICOM® (Sección) ............................................
Radios Convencionales, Trunking y Accesorios ICOM® ...................................65 Radios y Accesorios KENWOOD® (Sección) .....................................1-33
Radios Móviles: Radioteléfonos de Emergencia SYSCOM® .....................................................447
Aéreos / Base ICOM® ..............................................................................38 Radomos para Antenas Direccionales para Intemperie UBIQUITY® NETWORKS . 323
Amateurs y Accesorios KENWOOD® .......................................................4,5 ramsey®...............................................................................................
Comerciales Digitales NX-700H/ 800H y Accesorios KENWOOD® ...........26 RAR - Radio Audio Recorder KENWOOD® ......................................................31
Comerciales Digitales NX-720/ 820HGK y Accesorios KENWOOD® ........25 Rastreador de Frecuencias OPTOELECTRONICS® .........................................249
Comerciales Digitales NX-740/ 840 y Accesorios KENWOOD® ...................... 24 Receptor:
Comerciales Digitales y Accesorios KENWOOD® ................................24-28 De Comunicación IC-R20 ICOM® ..............................................................82
Comerciales TK-7302H/ 8302H y Accesorios KENWOOD® ......................20 De Comunicación IC-R6 ICOM® ................................................................82
Comerciales TK-7360H/ 8360H y Accesorios KENWOOD® ......................21 De Comunicaciones con Potente Rastreador
Comerciales TK-790H/ 890H y Accesorios KENWOOD® ..........................22 Ultrarrápido OPTOELECTRONICS® ..........................................................250
Comerciales y Accesorios ICOM® .......................................................63,64 GPS MXD-5000 MarineCommander™ ICOM®..........................................46
Comerciales y Accesorios KENWOOD® ..............................................20-23 GPS para Radios Móviles Comerciales Digitales NX-740/ 840
Digitales IC-F5061D/ 6061D y Accesorios ICOM® ....................................76 KENWOOD® ............................................................................................24
Digitales IC-F5360D/ 6360D y Accesorios ICOM® ...................................77 GPS para Radios Móviles Comerciales TK-7302H/ 8302H KENWOOD® ...20
Digitales NX-5700/ 5800 y Accesorios KENWOOD®.................................29 GPS para Radios Móviles Comerciales TK-7360H/ 8360H KENWOOD® ...21
Digitales y Accesorios ICOM® .............................................................74-82 Táctico de Altavoces de Cabeza de Conducción Ósea
D-STAR para Aficionados y Accesorios ICOM® ........................................48 para Ambiente Ruidoso txPRO®..............................................................126
HF para Aficionados y Accesorios ICOM®.................................................52 Receptores Portátiles Serie Endura LOWRANCE® .........................................301
Marinos HF y Accesorios ICOM® .............................................................45 Redes Inalámbricas (Sección) .....................................................
Marinos VHF y Accesorios ICOM® ......................................................42-45 Redes Inalámbricas:
Marinos VHF y HF y Accesorios ICOM® ...................................................45 ALTAI® ...........................................................................................360-368
Para Aficionados y Accesorios ICOM® ......................................................51 alvarion® .........................................................................................369-379
Radios Portátiles: CAMBIUM NETWORKS™ ...............................................................349-359
Aéreos IC-A14/ A14S y Accesorios ICOM® .............................................37 Con Tecnología MIMO TDMA UBIQUITY® NETWORKS ...........................321
Aéreos IC-A24/ A6 y Accesorios ICOM® .................................................37 EnGenius® .......................................................................................342-347
Aéreos y Accesorios ICOM® ....................................................................37 ePMP BY CAMBIUM NETWORKS™ ...............................................357-359
Amateurs y Accesorios KENWOOD® ..........................................................2 mimosa™ ..............................................................................................348
Comerciales IC-F1000/ 2000/ S/T y Accesorios ICOM® ............................58 PLANET® ................................................................................................381
Comerciales IC-F3003/ 4003 y Accesorios ICOM® ..................................56 UBIQUITY® NETWORKS...................................................................321-338
Comerciales IC-F3013/ 4013 y Accesorios ICOM® ...................................57 Reflector Direccional a Control Remoto / Ideal para Vehículos
Comerciales IC-F3021/ 4021/ S/ T y Accesorios ICOM® ..........................59 de Trabajo FEDERAL SIGNAL® ......................................................................478
Comerciales IC-F3031S/ 4031S y Accesorios ICOM® ..............................60 Reguladores y Respaldos de Energía UPS On-Line
Comerciales IC-F50V/ 60V y Accesorios ICOM® ......................................62 de Hasta 3 KVA / 2.4 KW epcom® POWER LINE ...........................................272
Comerciales TK-2000/ 3000 y Accesorios KENWOOD® .............................7 Repetidor / Estación Base FM - TKR-750 / 850 KENWOOD® .........................452
Comerciales TK-2170/ 3170 y Accesorios KENWOOD® ...........................11 Repetidor / Estación Base FM y Digital / NXR-710 / 810 KENWOOD® ...........454
Comerciales TK-2180/ 3180 y Accesorios KENWOOD® ...........................12 Repetidor:
ÍNDICE
Comerciales TK-2312/ 3312 y Accesorios KENWOOD® .............................9 “Esclavo” SYSCOM® para Radios KENWOOD® -Kit - ..............................450
Comerciales TK-2360/ 3360 y Accesorios KENWOOD® ...........................10 Básico para Emergencias SYSCOM® ......................................................449
Comerciales TK-2402/ 3402 y Accesorios KENWOOD® .............................8 Compacto SYSCOM® .............................................................................449
Comerciales y Accesorios ICOM®........................................................56-62 Compacto Totalmente Equipado de Fabricación SYSCOM®
Comerciales y Accesorios KENWOOD® .................................................6-12 para Radios KENWOOD® ........................................................................450
Digitales IC-F1000D/ 2000D y Accesorios ICOM® ...................................67 Convencional IP KTI-3 KENWOOD® ........................................................454
Digitales IC-F3103D/ 4103D y Accesorios ICOM® ...................................66 De 110 Watts Tipo Rack de Fabricación SYSCOM®
Digitales IC-F3161/ 4161/ DS/ DT y Accesorios ICOM® ............................70 para Radios KENWOOD® ........................................................................450
Digitales IC-F3201DEX/4201DEX y Accesorios ICOM® ............................73 De Altas Especificaciones KENWOOD® TKR750/850
Digitales IC-F3210D/ 4210D y Accesorios ICOM® ...................................68 de Fabricación SYSCOM® .......................................................................451
Digitales IC-F3230/ 4230/ DS /DT y Accesorios ICOM® ...........................69 Digital - Trunking NXDN™ Tipo C IDAS ICOM® .......................................460
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx Lă
Año 2016

Digital / Analógico IDAS NXDN™ ICOM® ...............................................458 de Acero Inoxidable para Cables ANDREW® ................................................208
Digital NEXEDGE™ NEXEDGE™ KENWOOD® .........................................456 Separadores:
Doble Zona con Beamforming alvarion® .................................................371 De Plástico para Cableado en Torre para Cables ANDREW® ..................208
Inalámbrico Autónomo SYSCOM® ..........................................................232 Para Cable Signal Inside™ .....................................................................210
Repetidores (Sección)..................................................................448-460 Para Cableado en Torre para Broche Tipo Mariposa para Cables ANDREW® 208
Repetidores: Para Cableado en Torre para Broches de Presión para Cables ANDREW® ... 208
Con Transmisor Serie 90 de 110 W Para Cables ANDREW® .........................................................................208
con Receptor Serie 302 SYSCOM® para Radios KENWOOD®.................451 Serie:
Convencionales KENWOOD® ..................................................................452 Breeze Access VL - Soluciones Punto a Multipunto
Convencionales SYSCOM® .....................................................................450 de Alta Capacidad, Carrier Class alvarion® .............................................376
Convencionales TAIT® ............................................................................453 Breeze Ultra - Solución Punto a Punto de Alta Capacidad Carrier Class ..375
Convencionales y Radio Portero SYSCOM® ............................................449 BreezeNET®B - Punto a Punto Carrier - Class
De Fabricación SYSCOM® ......................................................................451 para Bandas Libres alvarion® ..................................................................378
De Fabricación SYSCOM® para Radios KENWOOD®...............................450 BreezeNET®B - Punto a Punto Carrier - Class
Digitales ICOM® .....................................................................................458 para Bandas Libres alvarion® ..................................................................379
Digitales KENWOOD® .............................................................................456 PERFORMANCE txPRO® .........................................................................122
Digitales y Estaciones Base ICOM® ........................................................459 PMP 400 - Soluciones Punto a Multipunto para Seg. Pública 4.9 GHz
D-STAR ID-RP2000V/ 4000V y Accesorios ICOM® ...................................49 para Intemp. CAMBIUM NETWORKS™..................................................355
Simplexor SYSCOM® ..............................................................................430 PMP 430 - Soluciones Punto a Multipunto para Bandas Libres
SYSCOM® PLUS .....................................................................................451 para Intemperie CAMBIUM NETWORKS™ .............................................355
Resonadores para Antenas HF HUSTLER® ....................................................175 PMP 450 - Soluciones Punto a Multipunto
Respaldo de Energía para Aplicaciones Pequeñas EPCOM Industrial® ...........272 para Intemperie CANOPI™ CAMBIUM NETWORKS™............................356
Retenidas para Torres SYSCOM® .................................................................495 PSE Onda Sinusoidal Modificada Línea Industrial ....................................237
RF CONNECTORS® ........................................... PST Onda Sinusoidal Pura .......................................................................237
RF PARTS® .......................................................................................... PTP 200 - Enlace Punto a Punto (PTP) para Seg. Pública (4.9 GHz)
RFS® .................................................................................................... para Intemperie CAMBIUM NETWORKS™ .............................................349
RITRON® ....................................................................................... PTP 230 - Enlace Punto a Punto (PTP) para Bandas de Uso Libre
Rocket M2, M3, M5 y M9 para Intemperie UBIQUITY® NETWORKS .............322 para Intemperie CAMBIUM NETWORKS™ .............................................349
Rocket M5 y M2 Titanium para Intemperie UBIQUITY® NETWORKS .............322 PTP 250 - Enlace Punto a Punto (PTP) para Bandas de Uso Libre
Rollos de Velcro THORSMAN® ......................................................................421 para Intemperie CAMBIUM NETWORKS™ .............................................350
ROHN® .......................................................................................... PTP 450 - Enlace Punto a Punto (PTP)
RUIZELECTRONICS®............................................................................445 para Bandas de Uso Libre/ Intemp. CAMBIUM NETWORKS™ ..............350
Ruteador: PTP 500 - Enlace Punto a Punto (PTP) para Bandas de Uso Libre
3G Inalámbrico para Interior WNRT-617G PLANET® ...............................340 para Intemperie CAMBIUM NETWORKS™ .............................................351
802.11 a/b/g/n/ac PLANET® ...................................................................382 PTP 600 - Enlace Punto a Punto (PTP) para Bandas Licenciadas
ac/ Doble Banda PLANET®......................................................................340 y Uso Libre / Intemperie CAMBIUM NETWORKS™ ................................352
Inalámbrico de Alta Capacidad ESR-1221N para Interior EnGenius® .......347 PTP 650 - Enlace Punto a Punto (PTP) para Banda Licenciada
Multifuncional ECB-300 para Interior -Poderoso- EnGenius® ..................347 y Uso Libre / Intemperie CAMBIUM NETWORKS™ ................................353
VPN Balanceador de Carga PLANET® .....................................................340 PTP 820 - Soluciones Punto a Punto para Bandas Licenciadas
VPN Gigabit Ethernet Doble Banda EPG-600 EnGenius® .........................346 para Intemperie CAMBIUM NETWORKS™ ............................................354
Ruteadores Carrier - Class UBIQUITY® NETWORKS .......................................334 SAM Onda Sinusoidal Modificada ..........................................................237
Ruteador 5 Puertos PoE Administables Gigabit Ethernet.........................334 TITANIUM txPRO® ..........................................................................117-121
Ruteador 8 Puertos Administables Gigabit Ethernet ...............................334 S FIRE® ................................................................................................
Ruteador Administrable EdgeMAX .........................................................334 Shakespeare® ....................................................
Ruteador Gigabit Ethernet con salida PoE ...............................................334 Signal Inside™ ...................................................................................
Ruteador Versátil con 5 puertos Gigabit Ethernet +1 SFP ......................334 Simplexor ED® -Electronic Design- .....................................................431
Ruteadores Inalámbricos para Interior UBIQUITY® NETWORKS .....................335 Simplexor (Repetidores) SYSCOM® ..............................................................430
SINCLAIR®........................................................
Sintonizador Automático de Antena AH-4 ICOM® ...........................................54

S
Sintonizador de Antena AT-130/ AT-140 y Accesorios ICOM® ........................54
ÍNDICE

Sintonizador Smartuner SG-230 ICOM® ..........................................................54


Sirena:
samlexamerica® .................................................................... Discreta Básica de 100 W FEDERAL SIGNAL® ........................................467
Sensear® .............................................................................................116 Electromécanica Especial para Bomberas FEDERAL SIGNAL® ................467
Sensor de Potencia Direccional Dual con Interfaz USB 2.0 (Tipo B) BIRD® ...247 Electrónica con Control para 6 Luces FEDERAL SIGNAL® .......................467
Sensor de Potencia Direccional y Elementos DPM BIRD® ..............................247 Electrónica Serie XELS EPCOM Industrial® ...............................................486
Señalización Audiovisual (Sección).............................................461-483 Estándar PA-300 FEDERAL SIGNAL® ......................................................466
Señalización Audiovisual FEDERAL SIGNAL® ..........................................461-483 Estándar X100A EPCOM Industrial® .........................................................486
Señalización Audiovisual para Motocicletas FEDERAL SIGNAL® ...................471 Preventiva para Trabajo Pesado FEDERAL SIGNAL® ..............................482
Señalización DTMF SYSCOM® ......................................................................429 SmartSiren FEDERAL SIGNAL® ..............................................................466
Separador de Plástico para Cableado en Torre con Soporte Sirena y Bocina para Motocicleta FEDERAL SIGNAL® ...................................472
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Lă Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016

Sirena y Caja de Interruptores a Control Remoto FEDERAL SIGNAL® ............467 Software DTX-COMMAND FEDERAL SIGNAL® .............................................469
Sirena, Controladores y Accesorios FEDERAL SIGNAL® ................................472 Software e Interfaces de Programación KENWOOD® ....................................256
Sirenas FEDERAL SIGNAL®............................................................................466 6RIWZDUH.3*$3‡$GPLQLVWUDGRU27$3SDUD1(;('*(Œ.(1:22'® .30
Sirenas y Bocinas FEDERAL SIGNAL® ...........................................................467 Software para Despacho IP TELEX® ..............................................................437
Sistema Antiescala para Torres SYSCOM® ..................................................496 Softwares de Programación para Radios KENWOOD® ..................................256
Sistema Autónomo de: Softwares e Interfaces de Programación SYSCOM®/ ICOM® ........................257
Alarma Básico SYSCOM® .......................................................................235 Softwares para Radios ICOM® .....................................................................257
CCTV a Control Remoto SYSCOM®.........................................................235 Solarímetro SYSCOM® ..................................................................................235
Cerca Eléctrica SYSCOM® ......................................................................235 SOLARWORLD® ...................................................................................
Radiocomunicación y Señalización SYSCOM® ........................................235 Soldaduras KESTER® y Omega® ....................................................................255
Repetidores de Datos SYSCOM®............................................................235 Solicitud de Asistencia Rápida RITRON® .......................................................444
Sistema de: Solución Punto a Punto de Alto Desempeño para Intemperie mimosa™ ......348
Alarma por Radio Radio Alert / RUIZELECTRONICS ..........................234,445 Solución Punto a Punto para Backhaul hasta 1 Gigabit
Alumbrado de Emergencia Novedoso EPCOM Industrial®.......................239 de Velocidad B5 mimosa™ ..........................................................................348
Cableado NetKey™ .........................................................................408-412 Solución Punto a Punto para Backhaul hasta 1 Gigabit
Despacho IP / Max Dispatch ZETRON® ...................................................435 de Velocidad B5C mimosa™ ........................................................................348
Navegación Marina MarineCommander™ y Accesorios ICOM® ..............46 Soluciones de Voz por IP (VoIP) PLANET® .....................................................381
Prevención RUMBLER FEDERAL SIGNAL® ..............................................467 Soluciones de Voz por IP (VoIP) Grandstream®.......................................383-386
Radio Sobre IP ZETRON® .......................................................................428 Soluciones en Energía Solar epcom® POWER LINE ...............................224-227
Repetición de Máxima Potencia Serie IAS ICOM® ..................................458 Soluciones Inalámbricas CAMBIUM NETWORKS™................................349-359
Sirena y Caja de Interruptores a Control Remoto FEDERAL SIGNAL® ......466 Soluciones Inalámbricas Punto a Punto y Multipunto Tipo
Videovigilancia Autónomo (Aplicaciones) SYSCOM® ..............................232 Carrier Class CAMBIUM NETWORKS™.........................................................349
Sistema: Soporte SYSCOM® ........................................................................................516
Completo de Combinador / Multiacoplador - Preselector Soportes y Uniones CHAROFIL® ....................................................................425
TX RX SISTEMS INC.®/ BIRD® ................................................................269 STANCIL SOLUTIONS® .......................................................................441
HI-IQ W&W® ............................................................................................96 STREET HAWK® .................................................................................483
Inalámbrico de Voceo RITRON® ..............................................................443 SUNFORCE® ........................................................................................
Móvil de Video Digital DTX FEDERAL SIGNAL® .......................................469 SUNPOWER®.......................................................................................
NEXEDGE™ Trunking Tipo D KENWOOD® ..............................................455 Suscriptores Remotos (Licencias) alvarion® ..................................................377
Troncal Digital KENWOOD® ....................................................................457 Switch:
Sistema Troncal IP Multisitio KENWOOD® ..............................................457 Administrable de 16/24 puertos 10/100/1000T
Sistemas de: + 2 puertos SFP 100/1000X PLANET® ..................................................396
Administración de Controlador de Acceso ALTAI® .................................368 Administrable de 16 puertos 10/100TX PoE+
Alarmas Vía Radio SYSCOM® .................................................................445 y 2 puertos combo TP/SFP Gigabit ..........................................................394
Datos por Radio RITRON®................................................................443.444 Administrable de 24 Puertos 10/100TX PoE+
Despacho IP TELEX® ...............................................................................437 y 2 Puertos Combo TP/SFP Gigabit PLANET® ..........................................394
Distribución de Antenas (DAS) ANDREW®/ COMMSCOPE® ...................160 Administrable L2+ de 24 Puertos 10/100/1000T PLANET® ...................393
Filtros de RF para UHF TX RX SISTEMS INC.®/ BIRD®.............................269 Administrable L2 de 48 Puertos 10/100 Mbps + 2 Puertos Gigabit
Sonar / Radar y GPS LOWRANCE® .........................................................299 Ethernet + 2 Puertos SFP Gigabit PLANET® ...........................................396
Tierra Física TOTAL GROUNDMR .......................................................306-308 Administrable L2+, con 48 Puertos High PoE + 4 Puertos Compartidos
Sistemas de Radio (Sección) ....................................................... TP/SFP/100/1000X (600 W) PLANET® ....................................................394
Sistemas para Telecomunicaciones SYSCOM® .............................................238 Core Capa 3 de 24 Puertos 10/100/1000 Mbps PLANET® ......................392
Sistemas Troncales Digitales NEXEDGE™ KENWOOD® ................................457 Core Capa 3 de 24 Puertos 100/1000X SFP PLANET® ............................392
Sitio Web syscom.mx ...................................................................................509 Fast Ethernet de 8 Puertos 10/100Mbps PLANET®.................................396
Software de: Gigabit de 16 Puertos 10/100/1000Mbps PLANET® ...............................396
Administración de Flotas KAS 2 KENWOOD® ..........................................31 Gigabit de 24 Puertos 10/100/1000 Mbps PLANET® ..............................396
Administración para Enlace de Voz IP Digital ICOM® ..............................459 Industrial 4 Puertos PoE 10/100 + 1 Puerto SFP 100FX PLANET®..........404
Administración alvarion® .......................................................................374 Industrial Administrable de 8 Puertos 1000T + 2 Puertos SFP 1000X
Administración y Localización FLAV 3.0 SYSCOM® .................................32 PLANET® ................................................................................................405
Administración y Localización NexeTalk Suite ..........................................33 Industrial de 4 Puertos 1000T + 2 Puertos SFP 1000X PLANET® ...........405
ÍNDICE
Despacho para Radios Profesionales ICOM® - LANUS ..............................79 Industrial de 4 Puertos High PoE 1000T + 2 Puertos SFP 1000X PLANET® .. 404
Despacho para Radios Profesionales KENWOOD® - LANUS .....................32 Industrial de 5 Puertos 10/100/1000 PLANET® .......................................406
Gestión Remota de Elementos de Red (AWMS) ALTAI® ........................368 Industrial de Pared de 8 puertos Gigabit .................................................406
Monitoreo de Baterías KENWOOD® .........................................................35 Industrial de Pared de 8 puertos Gigabit
Monitoreo GPS de Alto Rendimiento NOVITGPS® ...................................305 con 4 puertos PoE+ 802.3at PLANET® ..................................................406
Monitoreo Remoto para Sistemas Digitales IP NEXEDGE™ KENWOOD® .34 Switch PoE:
Monitoreo y Administración FLAV 3.0 ICOM®...........................................79 Administrable L2 de 16 Puertos High PoE + 2 Puertos Compartidos
Monitoreo y Administración FLAV 3.0 SYSCOM® ....................................32 Gigabit/SFP PLANET® .............................................................................395
Prueba de Cobertura y Rendimiento de Red Inalámbrica alvarion® ........374 De 8 Puertos 10/100 Mbps con 4 Puertos PoE 802.3af PLANET®...........395
Videoconferencia FULL-HD Grandstream® ..............................................383 De 8 Puertos + 1 Puerto de Datos Gigabit Adicional PLANET® ..............395
Software DTX-ADS FEDERAL SIGNAL® ........................................................469 Gigabit Administrables UBIQUITY® NETWORKS .....................................336
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx Lă
Año 2016

Gigabit de 8 Puertos 10/100/1000 Mbps con High PoE 802.3at PLANET® ... 395 Tempocontrolador SUN LIGHT MORNINGSTAR®...........................................231
Sobre Coaxial Administrable de 8 Puertos BNC Tempocontrolador SYSCOM®........................................................................231
+ 2 Gigabit RJ45 + 2 Gigabit SFP PLANET®..........................................400 TENMA® ..............................................................................................
Switches: Tensores para Retenida para Torres SYSCOM® ............................................495
Core de Alto Rendimiento PLANET® .......................................................392 THORSMAN® ...............................................................................
Gigabit Administrables y No Administrables PLANET® ...........................396 Tierras Físicas y Pararrayos TOTAL GROUND® ........................................306-310
PoE Gigabit Administrables TOUGHSwitch™UBIQUITY® NETWORKS .....336 Tiras de Cobre para Aterrizaje PolyPhaser® ...................................................315
Power over Ethernet PLANET® ........................................................394,395 Tornillo Galvanizado THORSMAN® ................................................................421
Stack Administrables PLANET® ..............................................................393 Tornillos de Reemplazo SYSCOM® ...............................................................493
Switches Admnistrables UniFi® UBIQUITY® NETWORKS...............................333 Torres (Sección)...........................................................................
De 24 Puertos, 250 Watts ......................................................................333 Torres Arriostradas:
De 24 Puertos, 500 Watts ......................................................................333 ROHN® ...................................................................................................502
De 48 Puertos, 500 Watts ......................................................................333 Serie 25G ROHN® ...................................................................................502
De 48 Puertos, 750 Watts ......................................................................333 Serie G ROHN® .......................................................................................502
Switches Gigabit Administrables + PoE UBIQUITY® NETWORKS .................. 337 SYSCOM® .............................................................................................493
SYSCOM® .................... Torres Autosoportadas:
 Línea BX ROHN®.....................................................................................503
 Línea RSL ROHN® ...................................................................................504
SYSCOM® en Línea .......................................................................................509 Línea SSV ROHN® ..................................................................................505
SYSCOM® es Garantía de Calidad en sus Envíos ...........................................510 TOTAL GROUNDMR ........................................................................
SYSCOM®, Un Gran Equipo a su Servicio ......................................................511 TOUGHSwitch™ PoE...........................................................................336
TPL® ....................................................................................................146
TRAM® .................................
Tramos de Remate o Copete SYSCOM® ......................................................493

T
Tramos de Torre SYSCOM® ..........................................................................493
Transceptor:
Mini-GBIC SFP 1000 Base-LX para Fibra Monomodo
Tabla de Cables de Interconexión para Duplexers WP639 y WP641 ..............266 hasta 10 Km PLANET® ...........................................................................402
Tabla para Selección de Arneses SYSCOM® para Radios Mini-GBIC SFP 1000 Base-SX para Fibra Multimodo
y Repetidores ICOM®, KENWOOD® y Otros ..................................................431 hasta 550 m PLANET®............................................................................402
TAIT® ...................................................................................................453 SFP Industrial Gigabit Monomodo hasta 10 km PLANET® .......................405
Tapas Automáticas CHAROFIL® ....................................................................426 SFP Industrial Gigabit Multimodo 220/550 m PLANET® ..........................405
Tapas de Pared con Etiqueta Linkedpro® .......................................................415 Transmisor de TV Rural SYSCOM® ................................................................447
Taquetes THORSMAN®.................................................................................421 Transmisores y Antenas de TV SYSCOM®.....................................................447
Tarjeta Radio Switch de 5 Zonas SYSCOM® .................................................429 TRANSTECTOR® ....................................................................
TEAC® .................................................................................................. Tubo de:
Tecnología Beamforming para Aplicaciones Sin Línea de Vista alvarion® ......371 Hule Plástico Termoretráctil (Termofit) para Cables Signal Inside™ .......209
Tecnología airMAX ac UBIQUITY® NETWORKS .....................................328,329 Hule Plástico Termoencogible 3M® ........................................................254
Access Points airMAX AC 5GHz 802.11ac .............................................328 TX RX SISTEMS INC.® ..........................................................
Antena Direccional Carrier - Class para Intemperie .................................329 txPRO® ......................................................... 
Antena Sectorial airMAX AC para Intemperie .........................................329 
Nanobeam 802.11ac para Intemperie ....................................................329
PowerBeam 802.11ac ............................................................................328

U
Tecnología MIMO TDMA ...............................................................................321
Teléfono IP:
Base Inalámbrico Grandstream® .............................................................385
Complementario/ Adicional para Base Grandstream®.............................385 UAP / UAP-LR / UAP - PRO para Interior UBIQUITY® NETWORKS ..................332
Con Pantalla Táctil y Wi-Fi UBIQUITY® NETWORKS ...............................337 UAP - AC para Interior UBIQUITY® NETWORKS .............................................332
Convencional para 1 Línea Grandstream®...............................................384 UAP-OUTDOOR para Intemperie UBIQUITY® NETWORKS..............................331
Convencional para Videoconferencias Grandstream® .............................385 UBIQUITY® NETWORKS ...................................
ÍNDICE

Empresarial para Videoconferencias Grandstream® ................................385 Unidad de Manejo de Potencia TAIT®............................................................453


PoE Empresarial para 3, 4 y 6 Líneas Grandstream® ...............................384 Unidades Base / Remoto, Punto a Punto, Carrier Class
PoE PLANET® .........................................................................................382 y Serie BreezeNET®B alvarion®............................................................................... 378
SMB para 2 Líneas Grandstream® ..........................................................384 Uniden® ..................................................................................
Teléfonos IP Grandstream®.....................................................................384 UniFi® Security Gateway UBIQUITY® NETWORKS ........................................337
Teléfonos IP Inalámbricos Grandstream® ................................................385 UniFi® UBIQUITY® NETWORKS (Switches Admnistrables) ............................333
Teléfonos IP para Videoconferencias Grandstream® ...............................385 Uniones CHAROFIL® ......................................................................................425
X3B Fanvil®.............................................................................................389
TELEWAVE INC.® ............................................ 

TELEX® ................................................................................................
También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Lă Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016

V
Ventas en Línea SYSCOM® ...........................................................................509
9(3*‡(QODFH9HUViWLOGH&RPXQLFDFLyQSRU,3,&20® ..............................81
viakon® ................................................................................................
Videograbadora Digital Móvil con GPS y 3G FEDERAL SIGNAL® ...................470

W
W&W® ................................................................................. 
Wattmetros:
Direccionales Thruline® de Banda Ancha BIRD® .....................................245
Medidores de Potencia RF BIRD® ...........................................................245
Medidores de Potencia RF BIRD®/ MFJ®/ MIDLAND®/ TELEWAVE INC.® .... 246
Wattmetros para Uso Semiprofesional MFJ®/ MIDLAND®............................246
Wattmetros y Analizadores de Antena BIRD® ...............................................247
alvarion®.......................................................................................
weboost® Wilson®...................................................
Weller® ................................................................................................
:LUHOHVV0DQDJHPHQW6\VWHP $:06 ă*HVWLyQ5HPRWDGH(OHPHQWRV
de Red ALTAI® ..............................................................................................368

Y
Yaesu® .........................................................................................

Z
ZETRON® ...............................................................................

3
3M® .....................................................................................................

ÍNDICE

También disponible para usted, nuestra Guía de Soluciones para Seguridad Electrónica 2016
que incluye: CCTV, Sistemas de Intrusión, Automatización e Incendio y Acceso Electrónico.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx Lă
Año 2016

SK
RADIOS
D OS
RADI KENWOOD
NWOOD
EN O

Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 1
Radios Portátiles Amateurs Año 2016

7+'$‡5DGLRGH'REOH%DQGDFRQ*36 7+)$‡5DGLR7UL%DQGD6~SHU&RPSDFWR
5 W | Fabricado en Ambiente ISO 9001:2008 | Cumple Norma IP54
Estándares Militares MIL-STD-810 C/ D/ E/ F y G | 1 Año de Garantía

'REOH%DQGD El TH-F6A tiene capacidad para escuchar 2


144 - 440 MHz frecuencias simultáneamente, y cuenta con un diseño
ultracompacto y poderoso.
„7+'$ă86 5DQJRGH)UHFXHQFLD
,QFOX\H: antena, batería Li-Ion (1800 mAh), cargador de Tx: 144 - 148 / 222 - 225 / 438 - 450 MHz
pared, clip, cable USB para conectar a la PC y software de Rx: 0.1 - 1300 MHz
programación.
'LPHQVLRQHV58 x 121.3 x 33.2 mm.
&DUDFWHUtVWLFDV „7+)$ă86
‡'REOHUHFHSWRU ,QFOX\H: antena, batería Li-Ion (1550 mAh),
‡5HFHSWRU*36LQWHUFRQVWUXLGR cargador de pared y clip.
‡1000 canales de memoria. 'LPHQVLRQHV55.8 x 87 x 30.4 mm.
‡Iluminación en pantalla y teclado. &DUDFWHUtVWLFDV
‡Temporizador de transmisión (TOT). ‡435 canales de memoria.
‡9 modos de Scan. ‡Modos FM / WFM / NFM / AM + USB y LSB / CW.
‡&RGLILFDGRUGHFRGLILFDGRUGHWRQRV&7&66\'&6 ‡Iluminación en pantalla y teclado.
‡92;LQWHUFRQVWUXLGR ‡Temporizador de transmisión (TOT).
‡Amplia pantalla alfanumérica. ‡Antena de ferrita para AM (0.1 - 7 MHz)
‡Listo para TNC 1200 / 9600 bps (no requiere adaptador). ‡20 canales para exploración.
‡Programable por usuario o PC. ‡&RGLILFDGRUGHFRGLILFDGRUGHWRQRV&7&66\'&6
‡10 memorias DTMF. ‡92;LQWHUFRQVWUXLGR
‡Conexión directa a PC a través de cable mini USB incluido. ‡ Listo para TNC 1200 / 9600 bps (no requiere adaptador).
‡Compatible con datos APRS (Automatic Packet Reporting ‡Programable por usuario o PC.
System). ‡10 memorias DTMF.
‡Convierte datos GPS a KML para visualizar en Google Earth. ‡3 niveles de potencia seleccionables.
‡Información meteorológica. ‡Programable por software MCP-F6F7
‡Datos de posicionamiento, dirección y velocidad. (disponible www.syscom.mx).
‡Almacena hasta 5,000 puntos de interés en memoria
interna. $FFHVRULRV
‡Programable por software MCP-4A (incluido en disco).
3%/ă86Batería Li-Ion (1550 mAh).
$FFHVRULRV 6383/86ă86Programador universal de móviles
3%/ă86 y portátiles KENWOOD para puerto USB y RS-232.
Batería Li-Ion (1800 mAh). 6386%ă86Programador universal de móviles y
portátiles KENWOOD para puerto USB

7+.$.‡5DGLRGH&RPXQLFDFLRQHV3RGHURVDV
5.5 W | Fabricado en Ambiente ISO 9001:2008
Estándares Militares MIL-STD-810 C/ D/ E/ F y G | 1 Año de Garantía
5DQJRGH)UHFXHQFLD 2WUDVIXQFLRQHV
Tx: 144 - 148 MHz ‡Mensaje de encendido.
Rx: 136 - 174 MHz ‡Temporizador de transmisión (TOT).
‡Escaneo prioritario, de banda, programado, de llamadas y
„7+.$.ă86 de CTCSS/ DCS,
‡(VSDFLDPLHQWRVGHFDQDO:LGH1DUURZ
,QFOX\H: Batería KNB63L, cargador rápido KSC35S y antena ‡Candado de canal ocupado.
'LPHQVLRQHV 54 x 111.7 x 25.3 mm (con batería) ‡Ahorrador de batería.
‡Conector de antena SMA.
El nuevo radio TH-K20AK es poderoso. A pesar de ser de ‡Ingreso directo de frecuencia desde el teclado.
dimensiones pequeñas como para ajustar perfectamente ‡Autodial de códigos DTMF.
en la palma de su mano, ofrece perfecto desempeño y ‡Indicador de capacidad de la batería (en transmisión).
numerosas características para asegurar su magnífica ‡Número de serie electrónica.
RADIOS KENWOOD

facilidad de operación, y por tener agregadas funciones


aplicadas diariamente en sus 11 teclas preprogramadas con $FFHVRULRV
una tecla adicional programable que puede ser asignada para 60&ă86 Micrófono bocina de 3 teclas.
cualquier otra función. Además su construcción es altamente 60&ă86 Micrófono bocina con control
resistente, suficiente para soportar las peores condiciones de volumen
ambientales. Dentro o fuera, el TH-K20AK está equipado para .1%/ă86 Batería Li-Ion, 1130 mAh.
comunicaciones claras donde sea necesario.
.1%/ă86 Batería Li-Ion, 1520 mAh.
)XQFLRQHVSUHSURJUDPDGDV .+6ă86 Micrófono audífono con clip.
‡Pantalla de LCD y teclado iluminados.
‡9R[LQWHUFRQVWUXLGR
‡Codifica y decodifica tonos CTCSS y DCS.
‡Programable por PC con el software MCP-5A.

Dimensiones: Ancho x Alto x Profundidad.

2 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 5DGLR0yYLO$PDWHXUSDUD5DGLRDÀFLRQDGRV

766‡5DGLR+)0+]SDUD9HUGDGHURV5DGLRDÀFLRQDGRV
200 W (HF, 50 MHz) | 25 W (AM) | Fabricado en Ambiente ISO 9001:2008 | 1 Año de Garantía

„766ă86
'LPHQVLRQHV: 460 x 182 x 449 mm.
3HVR: 24.5 kg.

&DUDFWHUtVWLFDV
‡SURFHVDGRUHVGLJLWDOHV'63GHGLFDGRVSDUDUHFHSWRUSULQFLSDO
VXEUHFHSWRU\DQDOL]DGRUGHEDQGD EDQGVFRSH 
‡Cavidad de rechazo de banda (notch) (Ver fig.1)
‡AGC avanzado, fusionando digital y analógico.
‡Sistema de enfriamiento de alta capacidad.
‡$OWDHVWDELOLGDGRSHUDQGRD:HQWRGDVODVEDQGDV 9HUILJ 
‡Sintonizador de antena interconstruido de alta velocidad de operación (ver fig.3).
‡Monitor Touch Screen (ver fig.4). 3
‡Actualizaciones vía USB.
‡Ecualización del DPS en pantalla, transmisor y receptor. 1
‡Su diseño permite una operación más intuitiva y fácil.
‡Dirección por voz para frecuencias, control de teclas y ajustes.
‡Controle de forma remota su TS990S desde la PC.
‡Diseño del chasís que permite notar la verdadera calidad de audio.

2 4

3DQHO)URQWDO
1. Conector de audífonos 6.3 mm. 8. Conector de unidad: salida de unidad.
2. Llaveador para telegrafía (Paddle Keyer). 9. Tierra.
3. Conectores USB. 10. Terminal externa I/0 tipo BNC: 10 MHz.
4. Conector para micrófono (8 pines). 11. Conector para suministro de voltaje Vca (3 pines).
12. Conector AT de 6 pines para sintonizador de antena externo.
3DQHO3RVWHULRU 13. Jack de conexión 3.5 mm para teclado.
1. Conectores de antena (4 conectores).  3XHUWR&20'%ă56&
2. Conector de Rx IN tipo RCA: terminal de antena sólo recepción. 15. Conector óptico para terminal de entrada EIAJ óptico.
3. Conector Rx Out tipo RCA: terminal de receptor externo. 16. Conector óptico para terminal de salida EIAJ óptico.
4. Jack de conexión de 6.3mm para llavedor (Paddle). 17. Jack de conexión para bocina externa 1 (3.5 mm).
5. Conector de accesorios tipo din de 13 pines. 18. Jack de conexión para bocina externa 2 (3.5 mm).
6. Conector remoto de 7 pines tipo din. 19. Conector USB: control por PC, audio USB, etc.
7. Jack de conexión para medidor: conexión de medidor analógico. 20. Conector de display: display externo.
21. Conector LAN (RJ-45).

3 2 1 9 10 11 12 13 14

RADIOS KENWOOD

2
18
3
17

Frontal Posterior
4 5 6 7 8 15 16 19 20 21
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Móviles Amateurs Año 2016

76‡5DGLR%DVH+)9+)\8+)
100 W (HF 6 y 2 m) | 25 W (AM) | Fabricado en Ambiente ISO 9001:2008 | 1 Año de Garantía

2IUHFHDORSHUDGRUH[LJHQWHGHKR\HVWiQGDUHVGHDOWRUHQGLPLHQWR 5DQJRGH)UHFXHQFLDHQ5[
VLQODVOLPLWDFLRQHVHQFRQWUDGDVHQRWURVHTXLSRV 0.5 - 30 MHz / 50 - 54 MHz
Main 144 - 148 MHz / 430 - 450 MHz
144 - 148 MHz
Sub 438 - 450 MHz

&DUDFWHUtVWLFDV
‡300 canales de memoria.
‡$OWRUHQGLPLHQWRHQHWDSDVGHIUHFXHQFLDLQWHUPHGLDSURFHVDGRU'63HQEDQGD
SULQFLSDO.
‡Incluye conector Doppler, listo para trabajo con satélites.
‡'REOHUHFHSWRU +)\PRFPP\PFP\FP 
‡Repetidor de banda cruzada.
‡Sintonizador automático de antena hasta 6 m.
‡TNC para KSS/DX PACKET CLUSTER.
‡Incorpora RS-232 para control por PC.
‡Incluye TCXO (.5 ppm).
‡Codificador / decodificador de tonos CTCSS / DCS.
‡Manipulador electrónico con memoria.
‡5+1 puertos de antena (2 para HF y 6 m, 1 para 2 m, 1 para 70 cm, 1 para 1.2 GHz).
‡Amplio display LCD color ámbar.
„76ă86 ‡Apagado automático.
‡Temporizador de transmisión (TOT).
,QFOX\H: micrófono con teclado DTMF. ‡Bloqueo de teclas.
'LPHQVLRQHV: 270 x 96 x 317 mm. ‡VOX interno.

$FFHVRULRV
0&$ă86 Micrófono KENWOOD de escritorio para TS-2000.
96ă86 Sintetizador de voz

70$.‡5DGLR0yYLO9+)GH$OWD3RWHQFLD
65 W | Fabricado en Ambiente ISO 9001:2008 | Cumple con Estándares Militares MIL-STD-810 C/ D/ E/ F y G | 1 Año de Garantía

5DQJRGH)UHFXHQFLD
Tx: 144 - 148 MHz
Rx: 136 - 174 MHz

&DUDFWHUtVWLFDV
‡200 canales de memoria.
‡3DQWDOODDOIDQXPpULFDGHGtJLWRV
‡Mensaje de encendido.
‡Múltiples funciones de rastreo.
‡Codificador / decodificador de tonos CTCSS y DCS.
‡Bocina frontal.
‡Candado de canal ocupado.
‡0XOWLPRGR N+] SRUFDQDO
‡Temporizador de transmisión (TOT).
‡Circuito de apagado automático.
‡Control de brillo.
‡Programable por software MCP-1A Ver. 3.0 (disponible en www.syscom.mx)
RADIOS KENWOOD

$FFHVRULRV
0&$ă86 Micrófono de escritorio (requiere MJ88).
.0&ă86 Micrófono estándar para radios móviles.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para
puerto USB y RS-232
6386%ă86 Programador universal de móviles y portátiles KENWOOD para
puerto USB.
.3*80ă86 Cable de programación KENWOOD para puertos USB.
„70$.ă86 63%ă86 %RFLQDPyYLOŸUHVSXHVWDDIUHFXHQFLDD+]
,QFOX\H: micrófono con teclado DTMF.
'LPHQVLRQHV: 160 x 43 x 126 mm.
3HVR: 1.13 kg.

Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Móviles Amateurs

7.0‡5DGLR+)
100 W (PEP) | 300 Canales | Para Uso Rudo | Fabricado en Ambiente ISO 9001:2008 | Cumple Norma IP54
Cumple con Estándares Militares MIL-STD-810 C/ D/ E/ F y G | 3 Años de Garantía

$/( )XQFLyQ$/( 5DQJRGH)UHFXHQFLD


Automatic Link Establishment KPE2M Automáticamente monitorea la óptima frecuencia para comunicación. Tx: 1.8 a 30.0 MHz.
Rx: 0.5 a 30.0 MHz.

„7.0ă86
,QFOX\H: micrófono con teclado DTMF.
'LPHQVLRQHV: 270 x 96 x 271 mm.
3HVR: 5.2 kg.
&DUDFWHUtVWLFDV
‡:SRWHQFLDGHVDOLGD 3(3 HQ
66%&:)6.
.0&. Micrófono liviano ‡:GHSRWHQFLDGHVDOLGDHQ$0
con teclado DTMF opcional ‡FDQDOHVGHPHPRULD
‡Opción de cabezal remoto.
‡6 teclas de función programables.
‡Audio mejorado.
‡TCXO de alta estabilidad.
‡Puerto de datos (serial), conéctelo al KCT39.
‡Pantalla de 12 caracteres alfanuméricos.
‡Llamada selectiva y de estado.
‡Puerto para accesorios opcionales (GPS o encriptor de voz)
o para módem opcional.
3UHSiUHVH ‡Requiere micrófono KMC-30 y software de programación
/RVGHVDVWUHVQDWXUDOHV£QRDYLVDQ KPG-102DK (no incluidos).
La HF es la frecuencia de comunicación que ha salvado más vidas alrededor del mundo en
grandes desastres. Un radio HF y un acumulador son de vital importancia durante una crisis.

£4XHQRORWRPHQSRUVRUSUHVD
¿Requiere de radiocomunicación a grandes distancias? En áreas rurales, cañadas, caminos
entre montañas, zonas boscosas, para guardias forestales, comunicaciones móviles en
carreteras, todo sin necesidad de repetidores, la banda de HF es la solución.

/DPDQHUDPiVVHQFLOODGHRSHUDUXQUDGLR +) 
2SFLyQ´$/(µ $XWRPDWLF/LQN(VWDEOLVKPHQW 
Permite encontrar la frecuencia óptima de operación, logrando comunicaciones seguras y confiables (requiere tarjeta KPE-2M y sintonizador automático KAT-1).

/RJUHFRPXQLFDFLyQHQVHQFLOORVSDVRV
Radios en exploración. Envío de señal ALE. Respuesta de radio remoto. Se establece el enlace.

RADIOS KENWOOD
Nota: Es necesario que todos los radios tengan la opción “ALE” para lograr los enlaces.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.0&ă86 Micrófono liviano de mano .(6ă86 Bocina externa
.0&ă86 Micrófono liviano con teclado DTMF .5.ă86 Kit para montaje remoto (requiere cable KCT22M/M2/M3)
.$7ă86 Sintonizador automático de antena externo .&70ă86 Cable para kit de montaje remoto (2 m)
.3*'.ă86 Software de programación .&70ă86 Cable para kit de montaje remoto (5 m)
.0%ă86 Bracket con seguros .&70ă86 Cable para kit de montaje remoto (7 m)
.3(0ă86 Tablilla, habilita la función ALE (Automatic Link Establishment) 6383/86ă86 Programador universal de móviles y portátiles KENWOOD para
puerto USB y RS-232

Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Comerciales Año 2016

3.7‡8Q*UDQ5DGLRHQ3HTXHxDV'LPHQVLRQHV
1.5 W | 4 Canales Pregrabados | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E/ F y G | 3 Años de Garantía
&DUDFWHUtVWLFDV
‡Control intuitivo con operación guiada por voz. ‡Lámpara interconstruida.
‡Tonos QT / DQT. ‡Audio superior KENWOOD.
‡3 teclas programables. ‡Adaptador Jack de 3.5 mm.
‡Tono de alerta. ‡LED multicolor de estatus (transmisión, nivel de batería,
‡Temporizador de transmisión (TOT). cambio de canal, etc.).
‡Alerta de batería baja. ‡'LVHxRVyOLGRTXHUHVLVWHJROSHVSROYR\DJXD
‡Programación por Windows. &XPSOHFRQ,3
‡&RQHFWRUPLFUR86%SDUDFDUJD\SURJUDPDFLyQ

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
%DQGDSDUDHO&XHOOR &DEOH3URJUDPDGRU &DUJDGRU86% $XGtIRQR

TX-BAND PL-USB PL-USB-2100 V1-EH23R131 / V1-10252

3/86%ă86 Cable programador y cargador USB a microUSB de 1 metro de largo.


3/86%ă86 Cargador USB profesional de 1 puerto (req. PL-USB).
3/86%ă86 Cargador USB de uso rudo de 4 puertos (req. PL-USB por puerto).
7;%$1'ă86 Banda para colgarse el radio en el cuello.
.3*'.ă86 Software de programación.
(+6&ă86 Audífono PRYME con conector 3.5 mm.
„3.7.ă86 (+6&ă86 Audífono PRYME con tubo acústico transparente 3.5 mm.
)UHFXHQFLD440 - 480 MHz. 9(+5ă86 Audífono OTTO en forma de anillo solo para escuchar, cable retráctil y conector angular
,QFOX\H: batería KNB-71L Li-Ion (1,430 mAh) y antena fija de 3.5 mm (cable de 12” de largo, úsese el radio con la banda TXBAND).
'LPHQVLRQHV: 45.7 x 83.8 x 20.3 mm. 9ă86 Audífono OTTO con tubo acústico transparente solo para escuchar y conector recto
3HVR: 99.2 g. de 3.5 mm (cable de 48” de largo).

7.‡9HUViWLOÔWLO\&DUJDGRGH)XQFLRQHV
1.5 W | 16 Canales | FleetSync® | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | 3 Años de Garantía
5DQJRGH)UHFXHQFLD
460 - 470 MHz

5DGLR3UR7DON;/6
„7..ă86
,QFOX\H: batería KNB-46L (Li-Ion, 2000 mAh), antena fija, clip y cargador rápido de escritorio KSC-37.
'LPHQVLRQHV: 52 x 103 x 28.75 mm / 3HVR: 155 g.

&DUDFWHUtVWLFDV
‡Tonos CTCSS y DCS. ‡Candado de teclas.
RADIOS KENWOOD

‡([SORUDFLyQGHFDQDOHV 6FDQ  ‡10 tonos de alerta.


‡Encriptor de voz interconstruido. ‡Cloneo inalámbrico.
‡2SHUDFLyQDPDQRVOLEUHV 92; LQWHUFRQVWUXLGD
‡Temporizador de transmisión (TOT). 6HxDOL]DFLyQ)OHHW6\QF®
‡Conector de accesorios compatible con radios KENWOOD ‡PTT-ID.
comerciales. ‡Identificación en pantalla.
‡Pantalla iluminada con indicador de nivel de batería. ‡Llamada selectiva.
‡Monitor.

$FFHVRULRV,QFOXLGRV
.%+0ă86 Clip de resorte para cinto.
.1%/ă86 Batería Li-Ion, 2000 mAh.
.6&ă86 Cargador rápido
.3*'ă86 Software de programación.

9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

6 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Comerciales

7.‡3RUWiWLO/LJHUR\3UiFWLFR
5 W (VHF) | 4 W (UHF) | 16 Canales | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E/ F y G | Cumple Norma IP54 | 3 Años de Garantía
&DUDFWHUtVWLFDV
‡16 canales.
‡3DVVZRUGGHGDWRVGHHVFULWXUD\VREUHHVFULWXUD
‡377,'FRQ'70)
‡5 Watts en VHF / 4 Watts en UHF.
‡Exploración de canales (Scan) normal y prioritario.
‡92;LQWHUQROLVWRSDUDXVRGHPDQRVOLEUHV
‡Multimodo 12.5 / 25 kHz.
‡Tecla programable.
‡Tonos CTCSS y DCS.
‡Temporizador de transmisión (TOT).
‡Candado de canal ocupado.
‡Alerta de batería baja.
‡Ahorrador de batería.
‡Cloneo (radio a radio con cable).

)UHFXHQFLD &DQDOHV 3RWHQFLD


7..ă 86 144 - 174 MHz 16 5W
7..ă 86 440 - 480 MHz 16 4W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

KRA-26M KRA-27M KNB-65L KSC-35SK

.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Batería Li-Ion, 1130 mAh.
.6&6.ă86 Cargador rápido

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
0LFUyIRQRV$XGtIRQRV 3URJUDPDGRU

/2&
RADIOS KENWOOD
E1-QC2NC133
E1-1W2KA131

TX-EHKA / TX-EHK E1-QC2NC133 / E1-1W2KA131 SPUSB2


Más accesorios LOC, ver pág. 108

7;(+.$ă86 Micrófono-Audífono con tubo acústico para radios KENWOOD.


7;(+.ă86 Micrófono-Audífono para radios KENWOOD.
„7. 7;.1%ă86
(4&1&ă86
Batería TXPRO Li-Ion 1800 mAh.
Audífono en forma de gancho.
'LPHQVLRQHV: 54 x 113 x 24.9 mm. (:.$ă86 Micrófono con PTT intercambiable.
3HVR: 203 g. 6386%ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB y RS-232.
.3*'.ă86 Software de programación y ajuste en Windows.
.3*80ă86 Cable de programación KENWOOD para puertos USB.

9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 7
Radios Portátiles Comerciales Año 2016

7.‡3RWHQWH5REXVWR\GH*UDQ,QWHOLJHQFLD
5 W (VHF / UHF) | 16 Canales | FleetSync® | MDC 1200 | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54 / 55 | 3 Años de Garantía
&210Ð'(03$5$*36 5DGLR&RPSDFWR\(UJRQyPLFRSDUD8VR5XGR 6HxDOL]DFLyQ)OHHW6\QF®
Obtenga la posición del radio en un sistema LAV 9HORFLGDGESV 
(requiere KMC-48GPS) &DUDFWHUtVWLFDV ‡PTT-ID.
‡(QFULSWDFLyQSRULQYHUVLyQGHYR]GHDOWRQLYHO ‡/ODPDGDGHHPHUJHQFLDLQWHOLJHQWH\VHOHFWLYD
‡Volumen mínimo programable. ‡Radio Kill con acuse de recibo.
‡:GHSRWHQFLDGHDXGLR ‡Reportes GPS.
‡Módem para GPS interconstruido (req. sistema LAV y ‡Envío de 2 mensajes pregrabados.
micrófono GPS).
‡3DVVZRUGGHHQFHQGLGR 6HxDOL]DFLyQ'70)
‡3DVVZRUGGHGDWRVOHFWXUD\HVFULWXUD ‡PTT-ID.
‡Encriptor y VOX interconstruidos, programables por canal. ‡Llamada de emergencia inteligente y selectiva.
‡Pausa de PTT-ID: Inhibe el envío del PTT-ID durante un ‡Radio Kill.
tiempo preestablecido.
‡,GHQWLILFDFLyQDXGLWLYDGHFDQDOHQP~OWLSOHVLGLRPDV 6HxDOL]DFLyQ0'&
‡Indica de forma audible si el canal de operación tiene
‡PTT-ID.
activado el encriptor y el VOX.
‡Llamada de emergencia inteligente.
‡)XQFLyQGHRSHUDGRUVROLWDULR /RQH:RUNHU 
‡Radio Check.
‡Operación sin repetidor (Talk Around).
‡Radio Kill.
‡Exploración de canales (Scan) normal y prioritario.
‡Cloneo inalámbrico.
‡Compensador de audio (Compander).
)UHFXHQFLD &DQDOHV 3RWHQFLD
7..ă 86 136 - 174 MHz 16 5W
7..ă 86 450 - 520 MHz 16 5W
7..ă 86 400 - 470 MHz 16 5W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

KRA-26M KRA-27M KNB-45L KSC-35SK

.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Batería Li-Ion, 2000 mAh. Use sólo cargador KSC-35SK.
.6&6.ă86 Cargador rápido

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
0LFUyIRQRV$XGtIRQRV 0LFUyIRQR*36 0LFUyIRQR*36
Localice sus Radios
Portátiles Localice sus Radios
Portátiles
*36
*36
RADIOS KENWOOD

TX-EHKA / TX-EHK TX-7 KMC-48GPS

7;(+.$ă86 Micrófono-Audífono con tubo acústico para radios KENWOOD.


7;(+.ă86 Micrófono-Audífono para radios KENWOOD.
7;ă86 Micrófono IP67 de solapa con receptor y antena de GPS.
.0&*36ă86 Micrófono de solapa con receptor y antena GPS.
7;.1%/ă86 Batería TXPRO Li-Ion 1800 mAh.
6386%ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB.
„7. .3*'.ă86
.3*80ă86
Software de programación y ajuste en Windows.
Cable de programación KENWOOD para puertos USB.
'LPHQVLRQHV: 54 x 122 x 33.7 mm. ,$3&ă86 Interfaz para conexión de radio a internet con PC.
3HVR: 280 g. Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Comerciales

7.‡,GHDOSDUD$GPLQLVWUDFLyQGH)ORWLOODV
5 W (VHF / UHF) | 128 Canales | FleetSync® | MDC 1200 | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54 / 55 | 3 Años de Garantía
&210Ð'(03$5$*36 &DUDFWHUtVWLFDV 6HxDOL]DFLyQ'70)
Obtenga la posición del radio en un sistema LAV ‡(QFULSWDFLyQSRULQYHUVLyQGHYR]GHDOWRQLYHO ‡PTT-ID (ANI).
(requiere KMC-48GPS) ‡3DQWDOODDOIDQXPpULFDGHFDUDFWHUHVLOXPLQDGD ‡'HFRGLILFD377,'HQSDQWDOOD
‡3DVVZRUGGHGDWRVOHFWXUDVREUHHVFULWXUD\GH ‡Llamada de emergencia inteligente y selectiva.
HQFHQGLGR ‡Radio Kill (inhibición vía aire).
‡Cloneo inalámbrico. ‡Acuse de recepción de llamadas.
‡Tono seleccionable por operador.
‡Función de operador solitario (Lone Worker). 6HxDOL]DFLyQ)OHHW6\QF® ESV 
‡Exploración (Scan) con prioridad y multizona. ‡PTT-ID (ANI).
‡Programable por usuario (sin PC). ‡'HFRGLILFD377,'HQSDQWDOOD DOLDV 
‡WHFODVSURJUDPDEOHV ‡Llamada de emergencia inteligente y selectiva.
‡Operación a manos libres (VOX) interconstruida. ‡5HFHSFLyQGHPHQVDMHVDOIDQXPpULFRVGHFDUDFWHUHV
‡FleetSync® o MDC-1200 programable por zona. ‡Capacidad de envío y recepción de mensajes pregrabados
‡Indicador de estado de batería y de intensidad de señal. (16 caracteres).
‡Codificador / decodificador de 2 tonos. ‡Radio Kill (inhibición vía aire).
‡Resistente a lluvia y polvo de acuerdo al estándar europeo
IP54/55. 6HxDOL]DFLyQ0'&
‡Módem para GPS interconstruido (req. sistema LAV y ‡Llamada de emergencia inteligente.
micrófono GPS). ‡'HFRGLILFD377,'HQSDQWDOOD DOLDV 
‡PTT-ID (ANI).
‡Radio Check.
‡Radio Kill (inhibición vía aire).
)UHFXHQFLD &DQDOHV 3RWHQFLD
7..ă 86 136 - 174 MHz 128 5W
7..ă 86 450 - 520 MHz 128 5W
7..ă 86 400 - 470 MHz 128 5W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

KRA-26M KRA-27M KNB-45L KSC-35SK

.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Batería Li-Ion, 2000 mAh. Use sólo cargador KSC-35SK o TXKSC-35.
.6&6.ă86 Cargador rápido

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
0LFUyIRQRV$XGtIRQRV 0LFUyIRQR*36 0LFUyIRQR*36
Localice sus Radios
Portátiles Localice sus Radios
Portátiles
rtátiles
*36 *36
36 RADIOS KENWOOD

TX-EHKA / TX-EHK TX-7 KMC-48GPS

7;(+.$ă86 Micrófono-Audífono con tubo acústico para radios KENWOOD.


7;(+.ă86 Micrófono-Audífono para radios KENWOOD.
7;ă86 Micrófono IP67 de solapa con receptor y antena de GPS.
.0&*36ă86 Micrófono de solapa con receptor y antena GPS.
7;.1%/ă86 Batería TXPRO Li-Ion 1800 mAh.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB y RS-232.
.3*'.ă86 Software de programación y ajuste en Windows.
„7. .3*80ă86 Cable de programación KENWOOD para puertos USB.
'LPHQVLRQHV: 54 x 122 x 33.7 mm. 7;.6&ă86 Cargador rápido para batería KNB45L.
3HVR: 300 g. Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Comerciales Año 2016

7.‡6LHPSUH/LVWRHQ6LWXDFLRQHV&UtWLFDV
5 W (VHF / UHF) | 16 Canales | FleetSync® | MDC 1200 | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Encriptación por Inversión de Voz de Alto Nivel | 5 Años de Garantía
&DUDFWHUtVWLFDV 6HxDOL]DFLyQ'70)
Intrínsecamente Seguro con Batería .1%/&9 ‡(QFULSWDFLyQSRULQYHUVLyQGHYR]GHDOWRQLYHO ‡PTT-ID (ANI).
&HUWLILFDGR,62SFLRQDO ‡3DVVZRUGGHGDWRVOHFWXUD\VREUHHVFULWXUD ‡Llamada de emergencia inteligente y selectiva.
‡Identificación auditiva de canal. ‡Radio Kill (inhibición vía aire).
&210Ð'(03$5$*36 ‡7HFODGHHPHUJHQFLDHQFRORUQDUDQMD ‡Acuse de recepción de llamadas.
Obtenga la posición del radio en un sistema LAV ‡Exploración (Scan) con prioridad. ‡Hasta 8 memorias programables para llamadas
(requiere KMC-48GPS) ‡3 teclas programables. automáticas.
‡Función de operador solitario (Lone Worker).
‡+RPEUHFDtGR RSFLRQDO  6HxDOL]DFLyQ)OHHW6\QF® ESV 
‡Operación a manos libres (VOX) interconstruida. ‡PTT-ID (ANI).
‡Indicador de estado de batería. ‡Llamada selectiva.
‡Cumple con estándares militares MIL-STD-810 C/D/E/F y ‡Capacidad de envío de mensajes pregrabados.
contra lluvia torrencial. ‡Radio Kill (inhibición vía aire, recepción).
‡Resistente a lluvia y polvo de acuerdo al estándar europeo ‡Llamada de emergencia inteligente y selectiva.
IP54/55.
6HxDOL]DFLyQ0'&
‡Módem para GPS interconstruido (req. sistema LAV y
micrófono GPS). ‡PTT-ID (ANI).
‡Llamada de emergencia inteligente.
‡Radio Check.
‡Radio Kill (inhibición vía aire).
Versión Intrínsecamente Seguro )UHFXHQFLD &DQDOHV 3RWHQFLD
avalado por
Societe Generale de Surveillance 7..ă 86 136-174 MHz 16 5W
7..ă 86 450-520 MHz 16 5W
7..ă 86 400-470 MHz 16 5W
7..,6ă 86 136-174 MHz 16 5W
7..,6ă 86 450-520 MHz 16 5W
,QWUtQVHFDPHQWH6HJXUR
$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

KRA-26M KRA-27M KNB-55L / KNB-40LCV KSC-25

.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Li-Ion 1480 mAh.
.1%/&9ă86 Li-Ion 1950 mAh I.S. (batería incluida en versión ,QWUtQVHFDPHQWH6HJXUR).
.6&ă86 Cargador rápido.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
0LFUyIRQRV$XGtIRQRV 0LFUyIRQR*36 0LFUyIRQR*36

Localice sus Radios Localice suss Radios


Portátiles Portátiles
les

*36 *36
6
RADIOS KENWOOD

TX-EHKA / TX-EHK TX-7 KMC-48GPS

7;(+.$ă86 Micrófono-Audífono con tubo acústico para radios KENWOOD.


7;(+.ă86 Micrófono-Audífono para radios KENWOOD.
7;ă86 Micrófono IP67 de solapa con receptor y antena de GPS.
.0&*36ă86 Micrófono de solapa con receptor y antena GPS.
.1%/ă86 Batería Li-Ion, 2000 mAh.
.3*'.ă86 Software de programación y ajuste en Windows.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB y RS-232.
6386%ă86
„7. ,$3&ă86
Programador universal de móviles y portátiles KENWOOD para puerto USB.
Interfaz para conexión de radio a internet con PC.
'LPHQVLRQHV: 56 x 103.7 x 29.1 mm. .3*80ă86 Cable de programación KENWOOD para puertos USB.
3HVR: 260 g con batería KNB-55L. &0ă86 Switch de mercurio para opción hombre caído.
Dimensiones: Ancho x Alto x Profundidad.

10 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Comerciales

7.‡6LHPSUH/LVWRSDUDHO7UDEDMR'XUR
5 W (VHF) | 4 W (UHF) | 128 Canales | FleetSync® | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54 / 55 | 3 Años de Garantía

Intrínsecamente Seguro con Batería .1%/&9 &DUDFWHUtVWLFDV )OHHW6\QF® ESV 


&HUWLILFDGR,62SFLRQDO ‡3DQWDOODDOIDQXPpULFDGHFDUDFWHUHV ‡Identificación en pantalla.
‡Operación a manos libres (VOX) interconstruida. ‡PTT-ID.
&210Ð'(03$5$*36 ‡Encriptación por inversión de voz (scrambler) ‡Radio Kill.
Obtenga la posición del radio en un sistema LAV ‡Llamada de emergencia. ‡Llamada selectiva.
(requiere KMC-48GPS) ‡+RPEUHFDtGR RSFLRQDO  ‡Envío y recepción de mensajes pregrabados
‡Tecla de emergencia en color naranja. (16 caracteres )
‡Puerto de accesorios para tarjetas opcionales. ‡Recepción de mensajes de texto (48 caracteres).
‡Programable por usuario (sin PC). ‡Conexión a PC.
‡3DVVZRUGGHGDWRVOHFWXUDHVFULWXUD\
HQFHQGLGR 6HxDOL]DFLyQ'70)
‡Módem para GPS interconstruido (req. sistema LAV y
micrófono GPS). ‡Codificador / decodificador de DTMF.
‡Llamada selectiva.
Versión Intrínsecamente Seguro ‡Identificación en pantalla.
avalado por 9HUVLyQ/75 7. 
Societe Generale de Surveillance ‡Radio Kill.
* Modo Trunking LTR 250 IDs.
‡Llamada de emergencia inteligente.
,QWUtQVHFDPHQWH6HJXUR
Con cargador rápido
Con cargador rápido Con cargador rápido
KSC-25, batería
KSC-25 y batería KSC-25 y batería
KNB-40LCV y
)UHFXHQFLD &DQDOHV 3RWHQFLD DTMF
KNB-55L KNB-40LCV
CM13700
7..ă 86 86 86 136-174 MHz 128 5W No
7..ă 86 86 86 450-490 MHz 128 4W No
7..ă 86 86 86 400-430 MHz 128 4W No
7..ă 86 86 86 136-174 MHz 128 5W Sí
7..ă 86 86 86 450-490 MHz 128 4W Sí
7..ă 86 86 86 400-430 MHz 128 4W Sí
7..ă 86 86 86 450-490 MHz 250 IDs 4W No
9HUVLyQ7UXQNLQJ/75
Versión con 3DUDYHUVLyQ,QWUtQVHFDPHQWH6HJXURDJUHJDUVXILMR,6DOPRGHORGHOUDGLR
DTMF

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

KRA-26M KRA-27M KNB-55L KSC-25

.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Li-Ion 1480 mAh.
.6&ă86 Cargador rápido. RADIOS KENWOOD
$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.1%/ă86 Batería recargable de Li-Ion, 2000 mAh.
.1%/&9ă86 Batería recargable de Li-Ion, 1950 mAh, intrínsecamente segura.
.3*'.ă86 Software de programación y ajuste en Windows.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB y RS-232.
6386%ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB.
&0ă86 Switch de mercurio para opción hombre caído.
,$3&ă86 Interfaz para conectar de radio a internet con PC.
.3*80ă86 Cable de programación KENWOOD para puertos USB.
.0&*36ă86 Micrófono de solapa con receptor y antena de GPS.
7;ă86 Micrófono IP67 de solapa con receptor y antena de GPS.
„7. 7;(+.ă86
7;(+.$ă86
Micrófono-Audífono para radios KENWOOD.
Micrófono-Audífono con tubo acústico para radios KENWOOD.
'LPHQVLRQHV: 56 x 109 x 31.7 mm.
3HVR: 340 g. 9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 11
Radios Portátiles Comerciales Año 2016

7.‡/D1XHYD*HQHUDFLyQHQ&RPXQLFDFLyQ
5 W | 512 Canales | Compatible con PassPort | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | 5 Años de Garantía

&210Ð'(03$5$*36 3DUD6HJXULGDG3~EOLFD\6HUYLFLR([WUD3HVDGR ‡Envío y recepción de mensajes pregrabados


Obtenga la posición del radio en un sistema LAV 0RGR&RQYHQFLRQDO\7UXQNLQJ/75 (16 caracteres).
(requiere batería KNB-43L y KMC-47GPS) ‡Recepción de mensajes de texto de 48 caracteres.
&DUDFWHUtVWLFDV ‡Puerto de datos para conexión a PC.
‡VOX interconstruido, operación a manos libres (Sólo en ‡Radio Kill, habilitación y deshabilitación vía aire.
modo convencional). ‡Pausa y enmudecimiento de PTT-ID.
‡Encriptación de voz incluido, sólo prográmelo. 6HxDOL]DFLyQ'70)
‡3DQWDOODGHFDUDFWHUHVDOIDQXPpULFRVPDWUL]DGRV\
VXEOtQHDGHFDUDFWHUHV ‡PTT-ID.
‡Llamada de emergencia inteligente. ‡Radio Kill.
‡3DVVZRUGGHOHFWXUDHVFULWXUD\HQFHQGLGR ‡Llamada de alerta.
‡Puerto de accesorios. Opciones para scrambler / grabador
de voz VGS-1. 6HxDOL]DFLyQ0'&
‡Módem para GPS interconstruido (req. sistema LAV y ‡Codifica PTT-ID (ANI).
KMC-48GPS). ‡Decodifica PTT-ID en pantalla.
‡Maneja una lista de identificación para 100 usuarios (alias).
6HxDOL]DFLyQ)OHHW6\QF®ESV ‡Codifica y decodifica llamada de emergencia.
&RQYHQFLRQDO\7URQFDO  ‡Radio Check.
‡Decodifica PTT-ID en pantalla. ‡Radio Kill, habilitación y deshabilitación vía aire.
‡Llamada selectiva. ‡Pausa y enmudecimiento de PTT-ID.
‡Envío de mensaje de encendido y apagado.

9HUVLyQ,6 )UHFXHQFLD &DQDOHV 3RWHQFLD DTMF


7..ă 86 86 136-174 MHz 512 5W No
7..ă 86 86 450-520 MHz 512 5W No
7..ă 86 86 400-470 MHz 512 5W No
7..ă 86 86 136-174 MHz 512 5W Sí
7..ă 86 86 450-520 MHz 512 5W Sí
7..ă 86 86 400-470 MHz 512 5W Sí
3DUDYHUVLyQ,QWUtQVHFDPHQWH6HJXURDJUHJDUVXILMR,6DOPRGHORGHOUDGLR
3UHJXQWHSRUWLHPSRGHHQWUHJD

9HUVLyQ037'LVSRQLEOH7..07..0

‡Modo troncal MPT1327 y convencional. ‡Envío de mensaje al momento de encender y apagar radio.
‡32 canales modo convencional. ‡Cambio automático a modo convencional en ausencia de
‡Puerto MAP27. canal de control y viceversa.
‡32 mensajes de estado de 12 caracteres alfanuméricos. ‡Tonos CTCSS sobre MPT.
‡Envío de posición de LAV. ‡Opción de tarjeta de grabación de voz (VGS-1).
3UHJXQWHSRUGLVSRQLELOLGDG

$FFHVRULRV,QFOXLGRV
.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Batería Li-Ion, 2000 mAh.
.6&ă86 Cargador rápido inteligente de escritorio.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
RADIOS KENWOOD

.3*'ă86 Software de programación y ajuste en Windows.


Versión con 6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto RS-232 / USB.
DTMF 6+.ă86 Cable Interfaz para portátiles KENWOOD serie 80/180/NXDN™ (req. SPUPLUS / SPUSB2).
.5$0ă86 Antena recortada VHF 162-174 MHz.
.5$0ă86 Antena helicoidal UHF 470-512 MHz.
.1%1ă86 Batería de Ni-MH, 2500 mAh, Intrínsecamente Seguro.
.1%/ă86 Batería de polímero de litio, 3300 mAh.
.1%3/ă86 Batería de litio 4500 mAh. No recargable.
.0&*36ă86 Micrófono de solapa con receptor y antena de GPS.
*361; ă86 Adaptador GPS para portátiles KENWOOD.
9*6ă86 Tarjeta para almacenamiento de voz.
„7. &0ă86 Switch de mercurio para opción hombre caído.
.3*80ă86 Cable de programación KENWOOD para puertos USB.
'LPHQVLRQHV: 58 x 136 x 21.5 mm. 3UHJXQWHSRUWLHPSRGHHQWUHJD
3HVR: 260 g.
3UHJXQWHSRUGLVSRQLELOLGDG 9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

12 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Digitales

1;‡7HFQRORJtD'LJLWDO6XSHULRU
5Cumple
W (VHF/UHF) | 32 Canales | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54/55 | 3 Años de Garantía
6yOR.(1:22'SXHGHIDEULFDUXQUDGLRWDQUREXVWRHFRQyPLFR\DODYDQJXDUGLDHQWHFQRORJtD
2SHUDHQPRGRGLJLWDOFRQRVLQUHSHWLGRU
‡,PSUHVLRQDQWHDXGLRIXHUWH\FODUR
&210Ð'(03$5$*36 ‡]RQDVSURJUDPDEOHVHQGLJLWDORDQDOyJLFRFRQFDQDOHVFDGDXQD
Obtenga la posición del radio en un sistema LAV ‡5HVLVWHQWHDJROSHVYLEUDFLyQOOXYLDSROYRIDEULFDGRSDUDRSHUDUSRUPXFKRVDxRVHQDPELHQWHVH[WUHPRV
(requiere KMC-48GPS) ‡(QFULSWDFLyQGHDOWRQLYHO(QGLJLWDOPiVGHFyGLJRVGLIHUHQWHV
&DUDFWHUtVWLFDV*HQHUDOHV 0RGR&RQYHQFLRQDO'LJLWDO
‡LED indicador de transmisión / ocupado / llamada de alerta ‡64 números de acceso de radio (RAN).
/ escaneo / advertencia. ‡Llamada selectiva individual y de grupo.
‡2 teclas programables.
‡3RWHQFLDGHDXGLRGH: 0RGR$QDOyJLFR*HQHUDO
‡Selector de 16 posiciones. ‡Canales de 12.5 y 25 kHz (Versión 2.0).
‡Anunciador auditivo de zona / canal ‡Zonas convencionales.
‡Listo para VOX ‡FleetSync® /II, MDC -1200, DTMF.
‡Llamada de emergencia inteligente. ‡QT/DQT/2 Tonos.
‡Alerta de trabajador solitario por canal (Lone Worker Alert). ‡Encriptación por inversión de voz de alto nivel.
‡Temporizador de transmisión (TOT)
‡Candado de canal ocupado. )OHHW6\QF®,,
‡Indicador de batería baja.
‡Ahorrador de batería. ‡PTT ID digital ANI.
‡Software de programación de Windows KPG-169D ‡Llamada selectiva / grupal.
‡Cloneo inalámbrico ‡Llamada paging.
‡3DVVZRUGGHHQFHQGLGROHFWXUD\HVFULWXUD ‡Estatus de emergencia.
‡Cumple con MIL-STD-810 C/D/E/F/G ‡Reporte de datos GPS.
‡Cumple con IP54/55 agua e intrusión de polvo.
0'&
&DUDFWHUtVWLFDV'LJLWDOHV ‡PTT ID ANI / Caller ID.
‡,QWHUID]GLJLWDO1;'1Œ ‡Emergencia.
‡Canales en 6.25 y 12.5 kHz (Versión 2.0). ‡Monitoreo remoto.
‡Envío de alias al aire (sólo Tx). ‡Radio Kill.
‡Llamada paging.
‡Llamada de emergencia.
‡Mensajes de estatus.
‡Desactivación de radio vía aire Stun/Kill
(mediante software de despacho).
‡(QFULSWDFLyQ1;'1Œ
Frecuencia Canales Potencia
1;.ă 86 136 - 174 MHz 32 5W
1;.ă 86 450 - 520 MHz 32 5W
1;.ă 86 400 - 470 MHz 32 5W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

KRA-26M KRA-27M KNB-45L KSC-35SK

.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Batería Li-Ion, 2000 mAh. Use sólo cargador KSC-35SK.
.6&6.ă86 Cargador rápido RADIOS KENWOOD
.%+ă86 Clip de resorte con fijación de tornillos.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.0&*36ă86 Micrófono de solapa con receptor y antena de GPS.
7;ă86 Micrófono IP67 de solapa con receptor y antena de GPS.
7;(+.$ă86 Micrófono-Audífono con tubo acústico para radios KENWOOD.
7;(+.ă86 Micrófono-Audífono para radios KENWOOD.
.0&ă86 Micrófono-Bocina de uso rudo con control de volumen (IS).
.(3ă86 Auricular
.+6$ă86 Diadema ligera.
.+6ă86 Micrófono miniatura con clip y audífono.
.3*'.ă86 Software de programación y ajuste en Windows.
„1; 6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB y RS-232.
6386%ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB.
'LPHQVLRQHV: 54 x 122 x 33.7 mm. 7;.1%/ă86 Batería TXPRO Li-Ion 1800 mAh.
3HVR: 281 g. .3*80ă86 Cable de programación KENWOOD para puertos USB. Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Digitales Año 2016

1;‡$OWR'HVHPSHxRHQ$PELHQWHV'XURVGH7UDEDMR
5 W (VHF / UHF) | 64 Canales | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54 / 55 | 5 Años de Garantía
&DUDFWHUtVWLFDV*HQHUDOHV 0RGR)0$QDOyJLFR
02'20,;72ăCambio de Digital a Analógico
Automáticamente (Sólo Prográmelo) ‡Tonos de alerta programables. ‡Canales de 12.5 y 25 kHz.
‡Scan sencillo/multizona y con doble prioridad. ‡FleetSync® I/II.
2SHUDHQPRGRGLJLWDOFRQRVLQUHSHWLGRU ‡Módem para GPS interconstruido (req. sistema LAV y ‡Codificación y decodificación de tonos DTMF.
micrófono GPS). ‡Compensación de audio.
‡Encriptación por inversión de voz de alto nivel.
Intrínsecamente Seguro con Batería .1%/&9
'LJLWDO*HQHUDO
(&HUWLILFDGR,62SFLRQDO) )00RGR7URQFDO/75
‡NXDN™ interfaz digital.
&210Ð'(03$5$*36 ‡Vocoder AMBE+2. ‡Características KENWOOD LTR.
Obtenga la posición del radio en un sistema LAV ‡Canales de 12.5 y 6.25 kHz.
‡3URJUDPDFLyQYtDDLUH27$3 UHTXLHUH.3*$3  )OHHW6\QF®,,, 6yOR)0$QDOyJLFR 
(requiere KMC-48GPS)
‡Llamada de búsqueda y emergencia. ‡PTT-ID digital ANI.
‡+RPEUHFDtGRLQWHUFRQVWUXLGR ‡Llamada selectiva y de emergencia.
‡Trabajador solitario. ‡Mensajes de estatus.
‡(QFULSWDFLyQ1;'1ŒFyGLJRVGLIHUHQWHV ‡Hombre caído interconstruido.
‡Desactivación de radio vía aire (desde el software de ‡Trabajador solitario.
despacho). ‡Mensajes de estatus, encendido / apagado.
‡Reporte GPS con mensajes de estatus, PTT-ID y ‡Reportes GPS con PTT-ID y emergencia.
emergencia. ‡Reporte GPS con mensajes de estatus.
Versión Intrínsecamente Seguro
‡Reporte GPS con mensajes de estatus.
avalado por ‡(QYtRGHDOLDVDODLUH 6HxDOL]DFLyQ0'&
Societe Generale de Surveillance
0RGR'LJLWDO&RQYHQFLRQDO ‡Codifica PTT-ID (ANI).
‡Llamada de emergencia.
‡63 números de acceso de radio a repetidor (RAN). ‡Hombre caído interconstruido.
‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRGLJLWDO ‡Trabajador solitario.
‡5RDPLQJHQPLQLVLWLRV,3 ‡Radio Check.
‡Radio Kill, habilitación y deshabilitación vía aire.
0RGR'LJLWDO7URQFDO
‡ID de monitor prioritario 1 y 2.
‡Entrada tardía (late entry).
‡Llamada general (Broadcast).
‡Capacidad de 30 canales por sitio.
‡Operación en modo mixto de FM analógico / troncal digital.
‡Compatible con sistemas multisitio.
‡Reagrupamiento dinámico.
‡ Compatible con Trunking ICOM (req. firmware KWDNXD20K).

)UHFXHQFLD &DQDOHV 3RWHQFLD


1;.ă 86 136 - 174 MHz 64 5W
1;.ă 86 450 - 520 MHz 64 5W
1;.ă 86 400 - 470 MHz 64 5W
3DUDYHUVLyQ,QWUtQVHFDPHQWH6HJXURDJUHJDUVXILMR,6DOPRGHORGHOUDGLR

$FFHVRULRV,QFOXLGRV
.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Batería Li-Ion, 2000 mAh.
.1%/&9 ă86 Batería Li-Ion, 1950 mAh, ,QWUtQVHFDPHQWH6HJXUR
.6&ă86 Cargador rápido inteligente de escritorio.
%DWHUtDLQFOXLGDFRQHOUDGLRYHUVLyQ,6

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
RADIOS KENWOOD

.3*'.ă86 Software de programación y ajuste en Windows.


6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto RS-232 / USB.
.0&*36ă86 Micrófono de solapa con receptor y antena de GPS.
7;ă86 Micrófono IP67 de solapa con receptor y antena de GPS.
7;(+.ă86 Micrófono-Audífono para radios KENWOOD.
7;(+.$ă86 Micrófono-Audífono con tubo acústico para radios KENWOOD.
.1%/ă86 Batería Li-Ion, 1480 mAh.
.1%1ă86 Batería Ni-MH, 1400 mAh.
.5$ă86 Antena recortada VHF (148-162 MHz).
.5$ă86 Antena recortada UHF (450-490 MHz).
.5$0ă86 Antena recortada VHF (162-174 MHz).
„1; .5$0ă86
.3*80ă86
Antena helicoidal UHF (470-512 MHz).
Cable de programación KENWOOD para puertos USB.
'LPHQVLRQHV: 56 x 114 x 30.1 mm.
3HVR: 350 g. 9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Digitales

1;‡$OWDV(VSHFLÀFDFLRQHV)XQFLRQDPLHQWR'LJLWDO([FHSFLRQDO
5 W (VHF / UHF) | 260 Canales | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54 / 55 | 5 Años de Garantía
&DUDFWHUtVWLFDV*HQHUDOHV ‡Reagrupamiento dinámico.
MODO MIXTOăCambio de Digital a Analógico ‡ Compatible con Trunking ICOM (req. firmware KWDNXD20K).
Automáticamente (Sólo Prográmelo) ‡3DQWDOODGHFDUDFWHUHV
‡Íconos de funciones y estatus en pantalla. 0RGR)0$QDOyJLFR
2SHUDHQPRGRGLJLWDOFRQRVLQUHSHWLGRU ‡Tonos de alerta programables.
‡Scan sencillo/multizona y con doble prioridad. ‡Canales de 12.5 y 25 kHz.
Intrínsecamente Seguro con Batería .1%/&9 ‡Módem para GPS interconstruido ‡FleetSync® I/II.
(&HUWLILFDGR,62SFLRQDO) (req. sistema LAV y Micrófono GPS). ‡Codificación y decodificación de tonos DTMF.
- Envío de PTT-ID.
'LJLWDO*HQHUDO - Llamada selectiva.
&210Ð'(03$5$*36 - Stun.
Obtenga la posición del radio en un sistema LAV ‡NXDN™ interfaz digital. ‡Compensación de audio.
(requiere KMC-48GPS) ‡Vocoder AMBE+2. ‡Encriptación por inversión de voz de alto nivel.
‡Canales de 6.25 y 12.5 kHz.
‡3URJUDPDFLyQYtDDLUH27$3 UHT.3*$3  )00RGR7URQFDO/75
‡Llamada de búsqueda y de emergencia. ‡Características KENWOOD LTR.
‡+RPEUHFDtGRLQWHUFRQVWUXLGR
‡Trabajador solitario. )OHHW6\QF®,,, 6yOR)0$QDOyJLFR 
‡(QFULSWDFLyQ1;'1ŒFyGLJRVGLIHUHQWHV
‡Envío y recepción de mensajes pregrabados. ‡PTT-ID digital ANI.
‡Desactivación de radio vía aire (desde el software de ‡Llamada selectiva y de emergencia.
despacho). ‡Mensajes de estatus.
‡(QYtR\UHFHSFLyQGHPHQVDMHVGHWH[WR ‡Trabajador solitario.
FDUDFWHUHVHGLWDEOHV ‡Decodifica PTT-ID en pantalla.
Versión Intrínsecamente Seguro
‡Reportes GPS con PTT-ID y emergencia y mensajes de ‡Mensajes de texto cortos y de estatus
avalado por estatus. encendido / apagado.
Societe Generale de Surveillance ‡Envío de alias al aire. ‡Función de enviar y desplegar GPS en pantalla.
‡Reporte GPS con mensajes de estatus, PTT-ID y
0RGR'LJLWDO&RQYHQFLRQDO emergencia.
‡Reporte GPS con mensajes de estatus.
‡63 Números de acceso de radio a repetidor (RAN).
‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRGLJLWDO 6HxDOL]DFLyQ0'&
‡5RDPLQJHQPXOWLVLWLRV,3
‡Codifica PTT-ID (ANI).
0RGR'LJLWDO7URQFDO ‡Decodifica PTT-ID en pantalla (alias).
‡Llamada de emergencia.
‡ID de monitor prioritario 1 y 2. ‡Hombre caído interconstruido.
‡Entrada tardía (Late entry). ‡Trabajador solitario.
‡Llamada general (Broadcast). ‡Radio Check.
‡Capacidad de 30 canales por sitio. ‡Radio Kill, habilitación y deshabilitación vía aire (recepción).
‡Operación en modo mixto de FM analógico / troncal digital.
Versión DTMF ‡Compatible con sistemas multisitio.
)UHFXHQFLD &DQDOHV DTMF 3RWHQFLD
1;.ă 86 136 - 174 MHz 260 No 5W
1;.ă 86 450 - 520 MHz 260 No 5W
1;.ă 86 400 - 470 MHz 260 No 5W
1;.ă 86 136 - 174 MHz 260 Sí 5W
1;.ă 86 450 - 520 MHz 260 Sí 5W
1;.ă 86 400 - 470 MHz 260 Sí 5W
3DUDYHUVLyQ,QWUtQVHFDPHQWH6HJXURDJUHJDUVXILMR,6DOPRGHORGHOUDGLR

$FFHVRULRV,QFOXLGRV
.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Batería Li-Ion, 2000 mAh.
.1%/&9 ă86 Batería Li-Ion, 1950 mAh, ,QWUtQVHFDPHQWH6HJXUR
.6&ă86 Cargador rápido inteligente de escritorio.
%DWHUtDLQFOXLGDFRQHOUDGLRYHUVLyQ,6
RADIOS KENWOOD
$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.3*'.ă86 Software de programación y ajuste en Windows.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto RS-232 / USB.
.0&*36ă86 Micrófono de solapa con receptor y antena de GPS.
7;ă86 Micrófono IP67 de solapa con receptor y antena de GPS.
7;(+.ă86 Micrófono-Audífono para radios KENWOOD.
7;(+.$ă86 Micrófono-Audífono con tubo acústico para radios KENWOOD.
.1%/ă86 Batería Li-Ion, 1480 mAh.
.1%1ă86 Batería Ni-MH, 1400 mAh.
.5$ă86 Antena recortada VHF (148-162 MHz).
.5$ă86 Antena recortada UHF (450-490 MHz).
„1; .5$0ă86
.5$0ă86
Antena recortada VHF (162-174 MHz).
Antena helicoidal UHF (470-512 MHz).
'LPHQVLRQHV: 56 x 114 x 30.1 mm. .3*80ă86 Cable de programación KENWOOD para puertos USB.
3HVR: 350 g. 9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Digitales Año 2016

1;.‡/R0HMRUSDUD6LVWHPDV7URQFDOHVHQ0+]
3 W | 260 Canales | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54 / 55 | 5 Años de Garantía
MODO MIXTOăCambio de Digital a Analógico &DUDFWHUtVWLFDV*HQHUDOHV 0RGR'LJLWDO7URQFDO
Automáticamente (Sólo Prográmelo) ‡3 Watts (806-870 MHz). ‡Llamada individual.
‡WHFODVIURQWDOHVSURJUDPDEOHVWHFODGR'70) ‡Llamadas de grupo y de Broadcast (llamada de difusión).
Intrínsecamente Seguro con Batería .1%/&9 WHFODV ‡2SHUDFLyQHQVLVWHPDVFRQFRQH[LyQWHOHIyQLFD
(&HUWLILFDGR,62SFLRQDO) ‡3DQWDOODGHFDUDFWHUHV ‡Transmisión de modo trunking.
‡Iluminación en teclado y pantalla. ‡Mensajería en sistema trunking.
&210Ð'(03$5$*36 ‡Indicadores de estatus y funciones en pantalla. ‡Llamada en espera con distintas prioridades.
Obtenga la posición del radio en un sistema LAV ‡ Transmisión/ ocupado/ llamada de alerta / indicados por LED. ‡(QWUDGDWDUGtDDOODPDGD ODWHHQWU\ 
(requiere KMC-48GPS) ‡Selector de canal de 16 posiciones. ‡Reagrupación dinámica.
‡3 teclas laterales programables. ‡0RGR)DLOVRIW
‡Tecla de emergencia o auxiliar programable.
‡Sensor de movimiento interconstruido. 0RGR'LJLWDO0XOWLVLWLR
‡500 mW en la bocina. ‡Capacidad de 60,000 IDs de grupo y de unidad.
‡Anunciador de canal y zona. ‡/ODPDGDVGHiUHDH[WHQGLGDDWUDYpVGH,3
‡Memoria flash para actualizaciones. ‡5HJLVWURGH5RDPLQJDXWRPiWLFR
‡Módem para GPS interconstruido (req. sistema LAV y ‡Registro de grupo.
micrófono GPS).
'LJLWDO&RQYHQFLRQDO 0RGR$QDOyJLFR
‡Transmisión digital al aire NXDN™. ‡Espaciamiento de 12.5 y 25 kHz.
‡Vocoder AMBE+2. ‡Operación en zonas convencionales y LTR analógicas.
‡Espaciamiento de canal 6.25 kHz reales y 12.5 kHz. ‡Señalizaciones FleetSync®, MDC-1200 y DTMF.
‡27$3 SURJUDPDFLyQYtDUHPRWD UHTXLHUH ‡Tonos QT/DQT para zonas convencionales.
.3*$3 ‡Scrambler interconstruido (programable por canal).
‡Llamada Paging. ‡Scaneo de zona/ multizona/ lista de Scan.
‡Llamada de emergencia inteligente.
‡Llamada general de grupos.
Versión Intrínsecamente Seguro ‡Mensajes de estatus.
avalado por
Societe Generale de Surveillance ‡Stun y Kill remotos (requiere software de despacho).
‡Revisión remota del estado del radio (Remote Check).
‡Mensajes personalizados (radio a radio y software a radio).
‡Localización GPS.
‡(QFULSWDFLyQGLJLWDO1;'1ŒLQWHUFRQVWUXLGD
‡63 códigos RAN.
‡Llamadas individuales y de grupo.
‡0RGRPH]FODGR FRPXQLFDFLyQFRQ)0\GLJLWDOHQ
HOPLVPRFDQDO 
‡Operación en sistemas convencionales a través de IP.
‡)XQFLyQGHURDPLQJ

)UHFXHQFLD &DQDOHV DTMF 3RWHQFLD


1;.ă 86 806 - 870 MHz 260 Sí 3W
3DUDYHUVLyQ,QWUtQVHFDPHQWH6HJXURDJUHJDUHOVXILMR,6DOPRGHORGHOUDGLR

$FFHVRULRV,QFOXLGRV
.5$0ă86 Antena helicoidal UHF 800 MHz.
.1%/ă86 Batería Li-Ion, 2000 mAh.
.1%/&9 ă86 Batería Li-Ion, 1950 mAh, LQWUtQVHFDPHQWHVHJXUD
.6&ă86 Cargador rápido inteligente de escritorio.
%DWHUtDLQFOXLGDFRQHOUDGLRYHUVLyQ,6
RADIOS KENWOOD

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.3*'.ă86 Software de programación y ajuste en Windows.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto RS-232 / USB.
.0&*36ă86 Micrófono de solapa con receptor y antena de GPS.
7;ă86 Micrófono IP67 de solapa con receptor y antena de GPS.
7;(+.ă86 Micrófono-Audífono para radios KENWOOD.
7;(+.$ă86 Micrófono-Audífono con tubo acústico para radios KENWOOD.
.1%/ă86 Batería Li-Ion, 1480 mAh.
.1%1ă86 Batería Ni-MH, 1400 mAh.
.3*80ă86 Cable de programación KENWOOD para puertos USB.
„1;.
'LPHQVLRQHV: 56 x 110.5 x 36.9 mm.
3HVR: 210 g. 9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

16 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Digitales

1;**‡7HFQRORJtD'LJLWDO3URIHVLRQDO\GH*UDQ&DSDFLGDG
5 W (VHF / UHF) | 512 Canales | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | GPS
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54 / 55 | 5 Años de Garantía
MODO MIXTOăCambio de Digital a Analógico &DUDFWHUtVWLFDV*HQHUDOHV ‡Compatible con sistemas multisitio.
‡FDUDFWHUHVDOIDQXPpULFRVHQSDQWDOOD ‡Reagrupamiento dinámico.
Automáticamente (Sólo Prográmelo) ‡Íconos de funciones y estatus en pantalla. ‡Compatible con múltiples sistemas.
‡Tonos de alerta programables.
2SHUDHQPRGRGLJLWDOFRQRVLQUHSHWLGRU ‡Memoria flash. 0RGR)0$QDOyJLFR
‡2SFLyQSDUDWDUMHWD9*6JUDEDFLyQGHYR] ‡Canales de 12.5 y 25 kHz.
9HUVLyQ,6'LVSRQLEOH ‡Scan sencillo/multizona y con doble prioridad. ‡FleetSync® I/II.
‡GPS interconstruido (req. sistema LAV). ‡Codificación y decodificación de tonos DTMF.
‡Menú editable. - Envío de PTT-ID.
- Llamada selectiva.
'LJLWDO*HQHUDO - Stun.
9HUVLyQ,3 ‡NXDN™ interfaz digital. ‡Compensación de audio.
Disponible ‡Vocoder AMBE+2. ‡Encriptación por inversión de voz.
‡Canales de 6.25 y 12.5 kHz. ‡Puerto plug-in para tarjeta ANI o encriptación.
‡3URJUDPDFLyQYtDDLUH27$3 UHT.3*$3 
‡Llamada de búsqueda y de emergencia. )00RGR7URQFDO/75
‡Hombre caído (opcional) ‡Características KENWOOD LTR.
‡Trabajador solitario.
‡(QFULSWDFLyQ1;'1ŒFyGLJRVGLIHUHQWHV )OHHW6\QF®,,, 6yOR)0$QDOyJLFR 
‡Envío y recepción de mensajes pregrabados. ‡PTT-ID digital ANI.
‡Desactivación de radio vía aire (desde el software de ‡Llamada selectiva y de emergencia.
despacho). ‡Mensajes de estatus.
‡(QYtR\UHFHSFLyQGHPHQVDMHVGHWH[WR ‡Hombre caído (opcional).
FDUDFWHUHVHGLWDEOHV ‡Trabajador solitario.
‡Reportes GPS con PTT-ID y emergencia y con mensajes ‡Decodifica PTT-ID en pantalla.
de estatus. ‡Mensajes de texto cortos y de estatus encendido /
‡(QYtRGHDOLDVDODLUH apagado.
‡Función de enviar y desplegar GPS en pantalla.
0RGR'LJLWDO&RQYHQFLRQDO ‡Reportes GPS con PTT-ID y emergencia y con
‡63 números de acceso de radio a repetidor (RAN). mensajes de estatus.
‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRGLJLWDO
‡5RDPLQJSDUDPXOWLVLWLR,3 6HxDOL]DFLyQ0'&
‡Codifica PTT-ID (ANI).
0RGR'LJLWDO7URQFDO ‡Decodifica PTT-ID en pantalla (alias).
Versión DTMF ‡ID de monitor prioritario 1 y 2. ‡Llamada de emergencia.
‡Entrada tardía (late entry). ‡Hombre caído (opcional).
‡Llamada general (Broadcast). ‡Trabajador solitario.
‡Capacidad de 30 canales por sitio. ‡Radio Check.
‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRWURQFDO ‡Radio Kill, habilitación y deshabilitación vía aire.
GLJLWDO
)UHFXHQFLD &DQDOHV 3RWHQFLD DTMF
1;*.ă 86 136 - 174 MHz 512 5W No
1;*.ă 86 450 - 520 MHz 512 5W No
1;*.ă 86 400 - 470 MHz 512 5W No
1;*.ă 86 136 - 174 MHz 512 5W Sí
1;*.ă 86 450 - 520 MHz 512 5W Sí
1;*.ă 86 400 - 470 MHz 512 5W Sí

$FFHVRULRV,QFOXLGRV
.5$*0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$*0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/ă86 Batería Li-Ion, 1950 mAh.
.6&ă86 Cargador rápido inteligente de escritorio

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.3*'.ă86 Software de programación y ajuste en Windows. RADIOS KENWOOD
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto RS-232 / USB.
6+.ă86 Cable interfaz para portátiles KENWOOD serie 80/180/NXDN™ (Req. SPUPLUS/ SPUSB2).
.:''(.ă86 Tarjeta de encriptación avanzada, 56 bits, tipo DES.
.3*$(ă86 Software para encriptación avanzada.
9*6ă86 Tarjeta para almacenamiento de voz.
.1%/ă86 Batería Li-Ion, 2550 mAh.
.5$ă86 Antena recortada VHF (148-162 MHz).
&21*36,17(5&216758,'2 .5$ă86 Antena recortada UHF (450-490 MHz).
.5$0ă86 Antena recortada VHF (162-174 MHz).
„1; .5$0ă86
.5$*0ă86
Antena helicoidal UHF (470-512 MHz).
Antena VHF (146-162 MHz y GPS).
'LPHQVLRQHV: 58 x 127.5 x 41.3 mm. .5$*0ă86 Antena UHF (440-490 MHz y GPS).
3HVR: 375 g. &0ă86 Switch de mercurio para opción hombre caído.
.3*80ă86 Cable de programación KENWOOD para puertos USB.
&RPXQtTXHVHFRQVX(MHFXWLYRGH9HQWDV 9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 17
Radios Portátiles Digitales Año 2016

1;‡/R0HMRUGHOD7HFQRORJtD'LJLWDO
3W / 2.5 W | 512 Canales | 800 / 900 MHz | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54 / 55 | 5 Años de Garantía
MODO MIXTOăCambio de Digital a Analógico &DUDFWHUtVWLFDV*HQHUDOHV 0RGR)0$QDOyJLFR
Automáticamente (Sólo Prográmelo)
‡512 canales/128 zonas. ‡Canales de 12.5 y 25 kHz.
2SHUDHQPRGRGLJLWDOFRQRVLQUHSHWLGRU ‡Íconos de funciones y estatus en pantalla. ‡Canales NPSPAC
‡Tonos de alerta programables. ‡FleetSync® I/II.
‡Scan sencillo/multizona y con doble prioridad. ‡Codificación y decodificación de tonos DTMF.
Intrínsecamente Seguro con Batería .1%1 ‡Módem para GPS interconstruido (req. sistema LAV y ‡Compensación de audio.
(&HUWLILFDGR,62SFLRQDO) KMC-47GPS). ‡Encriptación por inversión de voz de alto nivel.
‡WHFODVSURJUDPDEOHVPDVWHFODGR'70) ‡Puerto plug-in para tarjeta ANI o encriptación.
&210Ð'(03$5$*36
Obtenga la posición del radio en un sistema LAV 'LJLWDO*HQHUDO )00RGR7URQFDO/75
(requiere batería KNB-41N y KMC-47GPS)
‡NXDN™ interfaz digital. ‡Características KENWOOD LTR.
‡Vocoder AMBE+2.
‡Canales de 6.25 y 12.5 kHz. )OHHW6\QF®,,, 6yOR)0$QDOyJLFR 
‡Programación vía aire OTAP (req. KPG 150AP). ‡PTT-ID digital ANI.
‡Llamada de búsqueda y de emergencia. ‡Llamada selectiva.
‡Hombre caído (opcional). ‡Mensajes de estatus.
‡Trabajador solitario. ‡Llamada de emergencia.
‡(QFULSWDFLyQ1;'1ŒFyGLJRVGLIHUHQWHV ‡Hombre caído (opcional).
‡(QYtR\UHFHSFLyQGHPHQVDMHVSUHJUDEDGRV ‡Trabajador solitario.
‡Desactivación de radio vía aire (desde el software de ‡Decodifica PTT-ID en pantalla.
despacho). ‡Mensajes de texto cortos y de estatus encendido /
‡(QYtR\UHFHSFLyQGHPHQVDMHVGHWH[WR apagado.
FDUDFWHUHVHGLWDEOHV ‡Función de enviar y desplegar GPS en pantalla.
‡Reportes GPS con PTT-ID, emergencia y con mensajes de ‡Reportes GPS con PTT-ID y emergencia y con mensajes
estatus. de estatus.
‡Envío de alias al aire.
*VERSIÓN INTRÍNSECAMENTE 6HxDOL]DFLyQ0'&
0RGR'LJLWDO&RQYHQFLRQDO
SEGURA DISPONIBLE. ‡Codifica PTT-ID (ANI).
APROBADO POR FACTORY MUTUAL. ‡63 números de acceso de radio a repetidor (RAN). ‡Decodifica PTT-ID en pantalla (alias).
‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRGLJLWDO ‡Llamada de emergencia.
‡5RDPLQJHQPXOWLVLWLRV,3 ‡Hombre caído (opcional).
‡Trabajador solitario.
0RGR'LJLWDO7URQFDO ‡Radio Check.
‡ID de monitor prioritario 1 y 2. ‡Radio Kill, habilitación y deshabilitación vía aire.
‡Entrada tardía (late entry).
‡Llamada general “Broadcast”.
‡Capacidad de 30 canales por sitio.
‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRWURQFDO
GLJLWDO
‡Compatible con sistemas multisitio.
‡Reagrupamiento dinámico.

)UHFXHQFLD &DQDOHV 3RWHQFLD


1;.ă 86 806 - 870 MHz 512 3W
1;. ă 86 900 MHz 512 2.5 W
3DUDYHUVLyQ,QWUtQVHFDPHQWH6HJXURDJUHJDUVXILMR,6DOPRGHORGHOUDGLR
3UHJXQWHSRUGLVSRQLELOLGDG\WLHPSRGHHQWUHJD

$FFHVRULRV,QFOXLGRV
7ă86 Antena helicoidal para 800 MHz.
.5$0ă86 Antena helicoidal para 800 MHz
.1%/ă86 Batería Li-Ion, 2000 mAh.
.6&ă86 Cargador rápido inteligente de escritorio.
RADIOS KENWOOD

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.3*'.ă86 Software de programación y ajuste en Windows.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto RS-232 / USB.
6+.ă86 Cable interfaz para portátiles KENWOOD seríe 80/180/NXDN™( Req. SPUPLUS/SPUSB2).
*361;ă86 Adaptador GPS para portátiles KENWOOD.
.0&*36ă86 Micrófono de solapa con receptor y antena de GPS.
9*6ă86 Tarjeta para almacenamiento de voz.
.1%/ă86 Batería Po-Li, 3300 mAh, extra ligera.
.1%1ă86 Batería de Ni-NH, 2500 mAh, ,QWUtQVHFDPHQWH6HJXUR.
&0ă86 Switch de mercurio para opción hombre caído.
„1; .3*80ă86 Cable de programación KENWOOD para puertos USB.
'LPHQVLRQHV: 58 x 138.8 x 34.2 mm.
3HVR: 395 g. 9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Digitales

1;‡&RPXQLFDFLyQ'LJLWDOGH$OWDV(VSHFLÀFDFLRQHV
5 W de Potencia | 3 W (800 MHz) | 1024 Canales (4000 Opcional) | Analógico, NXDN™, P25 Fase 1 y Fase 2
Fabricado en Ambiente ISO 9001:2008 Aprobado por la FCC | Cumple Normas IP67/68 | Bluetooth | Micro SD | MIL-STD-810 C/D/E/F/G

&DUDFWHUtVWLFDV*HQHUDOHV ‡Baterías de alta capacidad.


‡Multidigital + operación FM analógica. ‡Monitoreo de la vida útil de las baterías desde software.
‡NXDN™ convencional. ‡Anunciador de voz en 8 idiomas.
CO L t S U PPO ‡Ranura para tarjeta Micro SD (opcional).
TO ‡Trunking NXDN™ tipo C.
RT
t M U LT I -PR O

P25 ‡P25 fase 1 convencional / trunking. ‡Bluetooth interconstruido.


RA D

‡P25 fase 2 trunking. ‡Módulo para tarjeta AES (opcional).


NXDN
IO

‡Analógico FM convencional / trunking. ‡Un solo software para programación P25, NXDN™
t

FM y FM analógico.
G

‡Modo mezclado.
LO
P2

5/ A
NX N ‡Display TFT a color de 1.74” (240 x 180 pixeles).
D N /FM A
‡Interfaz de color ajustable y display de texto multilínea. 6HJXULGDG0HMRUDGD
0XOWLSURWRFROR ‡1000 mW de potencia de audio en la bocina. ‡Activación del software de programación,
‡Control central de 4 direcciones y palanca de dos vía autenticación en servidor.
posiciones para control y operación intuitiva. ‡Nuevo metodo de ID de instalación.
‡6 teclas frontales y 2 laterales programables. ‡Anticracking: archivos encriptados.
‡Modelos con DTMF de 12 teclas disponibles. ‡Encriptación en sesión P2P (lectura y escritura).
‡Tecla de emergencia/ Aux.
‡MDC-1200. &DUDFWHUtVWLFDV'LJLWDO3
‡FleetSync®. ‡P25 convencional / trunking (phase 1 y 2).
‡Capacidad máxima de 4000 canales, 512 canales por zona, ‡Vocoder Ambe+2 mejorado.
128 zonas. ‡Listo para llamadas de grupo e individuales.
‡Batería inteligente. ‡Identificación en pantalla.
‡GPS interconstruido. ‡Monitoreo remoto.
‡Encriptación tipo DES interconstruida 56 bits. ‡Inhibición remota.
‡Ajuste automático del brillo en el LCD. ‡Llaves de encriptación Zeroize y retenida.
DTMF Sencillo

‡Audio KENWOOD renovado con doble micrófono y ‡Localización GPS P25


cancelación de ruido. ‡OTAP (Over the Air Programming).
‡Detección de 3 modos de emergencia, man-down, ‡P25 Voting (roaming).
estacionario o movimiento (interconstruido). ‡Mensajes de texto.

)UHFXHQFLD DTMF 3RWHQFLD


1;.ă 86 136 - 174 MHz Sencillo 5W
1;.ă 86 136 - 174 MHz 12 Teclas 5W
1;.ă 86 450 - 520 MHz Sencillo 5W
1;.ă 86 450 - 520 MHz 12 Teclas 5W
1;.ă 86 380 - 470 MHz Sencillo 5W
1;.ă 86 380 - 470 MHz 12 Teclas 5W
Rx: 763 - 776, 851 - 870 MHz
1;.ă 86 Tx: 763 - 776, 793 - 806,
Sencillo 3W
1;.ă 86 806 - 825, 851 - 870 MHz 12 Teclas 3W
0RGR3)DVH\RSFLRQDO

$FFHVRULRV,QFOXLGRV
.5$0ă86 Antena helicoidal VHF, 146-162 MHz (se incluye una antena dependiendo de la banda del radio).
.5$0ă86 Antena helicoidal UHF, 440-490 MHz (se incluye una antena dependiendo de la banda del radio).
.1%/0ă86 Batería inteligente de Li-Ion de alta capacidad 2600 mAh.
.6&<.ă86 Cargador inteligente para baterías KNB-L1, L2, L3.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
RADIOS KENWOOD

.5$ă86 Antena UHF (800 MHz)


.1%/0ă86 Batería inteligente de Li-Ion 2000 mAh.
.1%/0ă86 Batería inteligente de Li-Ion 3400 mAh.
.%+ă86 Clip de plástico con fijación de tornillos
9ă86 Diadema sumergible con cancelación de ruido (requiere cable modular, consulte pág. 114).
.6&ă86 Cargador rápido inteligente de escritorio.
.0&:'0ă86 Micrófono de solapa con cancelación de ruido IP65/67 polvo y agua
18(925$',2',*,7$/ .$6.ă86 Software de lectura, acondicionamiento y vida útil para baterías inteligentes.
.3*$3ă/OiPHQRV Software de programación remota.
„1; .3*80ă86
.3*'.ă86
Cable de programación KENWOOD para puertos USB.
Software de programación.
'LPHQVLRQHV: 58 x 139 x 38.8 mm.
3HVR: 440 g.
9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Móviles Comerciales Año 2016

7.++‡,GHDOSDUDHO7UDEDMR3HVDGR
50 W (VHF) | 45 W (UHF) | 16 Canales | FleetSync ®
| MDC 1200 | Encriptación por Inversión de Voz de Alto Nivel | Cumple Norma IP54
Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | 3 Años de Garantía
&DUDFWHUtVWLFDV
&210Ð'(03$5$*36ăObtenga la posición de la unidad en un sistema LAV ‡Módem para GPS incluido. Puede ser utilizado como unidad
con sólo conectar un receptor de GPS (GU-158-DB15) GPS remota (req. receptor GU-158-DB15).
‡3DVVZRUGGHHQFHQGLGROHFWXUD\HVFULWXUD
‡(QFULSWDFLyQSRULQYHUVLyQGHYR]GHDOWRQLYHO
‡Pausa de PTT-ID: Inhibe el envío de PTT-ID durante un
tiempo preestablecido.
‡Identificación auditiva de canal.
‡Exploración (Scan) con prioridad y multizona.
‡Función de operador solitario (Lone Worker).
‡Identifica de forma audible si el canal de operación tiene
activado el encriptor.
‡Tonos de alerta para llamada selectiva por 2 tonos, DTMF
y FleetSync®.
‡&RQHFWRUGHDFFHVRULRVFRQSXHUWR'68%GHDOWD
GHQVLGDG
‡9 teclas programables iluminadas.

6HxDOL]DFLyQ'70)
‡377,' $1, 
‡Llamada selectiva y de emergencia inteligente.
‡Radio Kill (inhibición vía aire).
‡Acuse de recepción de llamadas.

)OHHW6\QF® ESV 
‡377,' $1, 
‡Llamada selectiva y de emergencia inteligente.
‡Radio Kill (inhibición vía aire).
‡2 mensajes de estatus pregrabados.
‡Capacidad de operación GPS (sólo remoto), requiere
antena receptora GU-158-DB15.
)UHFXHQFLD &DQDOHV 3RWHQFLD ‡Cambio automático de canal al enviar los datos de GPS.
‡Entrada / salida para relevador (no incluido).
7.+.ă 86 136-174 MHz 16 50 W
7.+.ă 86 450-520 MHz 16 45 W 6HxDOL]DFLyQ0'&
7.+.ă 86 400-470 MHz 16 45 W ‡377,' $1, 
‡Llamada de emergencia inteligente.
,QFOX\H cable de corriente, micrófono KMC-30, bracket y ‡Radio Kill (inhibición vía aire).
accesorios de instalación. ‡Radio Check (verifica que el radio esté encendido).
'LPHQVLRQHV: 160 x 43 x 137 mm.
3HVR: 1.18 kg.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
5HFHSWRU*36
S 0LFUyIRQR *8'%ă86 Receptor GPS con antena para radio móvil KENWOOD
TK-7302H / 8302H.
.0&ă86 Micrófono estándar con teclado DTMF.
.3*'.ă86 Software de programación y ajuste en Windows.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD
para puerto USB y RS-232
RADIOS KENWOOD

.3*80ă86 Cable de programación KENWOOD para puertos USB.


6+'.ă86 Arnés SYSCOM para adaptar diademas de portátiles
KENWOOD (excepto serie 80/ 140/ 180/ NX-200)

GU-158-DB15 KMC-36

Dimensiones: Ancho x Alto x Profundidad.

20 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Móviles Comerciales

7.++‡/D0HMRU6ROXFLyQHQ&RQGLFLRQHV&UtWLFDV
50 W (VHF) | 45 W (UHF) | 128 Canales | FleetSync ®
| MDC 1200 | Encriptación por Inversión de Voz de Alto Nivel | Aprobado por la FCC
Cumple Norma IP54 | Fabricado en Ambiente ISO 9001:2008 | Cumple con Estándares Militares MIL-STD-810 C/ D/ E/ F y G | 3 Años de Garantía
$KRUDFRQ&DSDFLGDG7URQFDO/75 &DUDFWHUtVWLFDV
‡3DQWDOODDOIDQXPpULFDGHFDUDFWHUHV
Puede ser utilizado como radio base GPS al conectarse vía puerto serie ‡Password de encendido, lectura y escritura.
a una computadora (req. SKRR-360PC y modificación) ‡(QFULSWDFLyQSRULQYHUVLyQGHYR]GHDOWRQLYHO
&210Ð'(03$5$*36ăObtenga la posición de la unidad en un sistema LAV ‡Pausa de PTT-ID: Inhibe el envío de PTT-ID durante un
con sólo conectar un receptor de GPS (GU-158-DB15) req. modificación tiempo preestablecido.
‡Exploración (Scan) con prioridad y multizona.
‡Función de operador solitario (Lone Worker).
‡Conector de accesorios con puerto D-SUB 15 de alta
densidad.
‡WHFODVSURJUDPDEOHVLOXPLQDGDV
‡Módem para GPS incluido
- Puede ser utilizado como unidad GPS remota
(req. receptor GU-158-DB15).
- Puede ser utilizado como radiobase GPS (ambas opciones
req. modificación).

6HxDOL]DFLyQ'70)
‡Envía PTT-ID (ANI).
‡'HFRGLILFD377,'HQSDQWDOOD
‡Codifica y decodifica llamada de emergencia.
‡Llamada selectiva.
‡Radio Kill, habilitación y deshabilitación vía aire.
‡Acuse de recepción de llamadas.

6HxDOL]DFLyQ0'&
‡Envía PTT-ID (ANI).
‡'HFRGLILFD377,'HQSDQWDOOD
‡Codifica y decodifica llamada de emergencia.
‡Radio Check.
‡Radio Kill, habilitación y deshabilitación vía aire.

'(6(03(f2<&$5$&7(5Ì67,&$6-$0É69,67$6(18162/202'(/2 6HxDOL]DFLyQ)OHHW6\QF®&RQYHQFLRQDO\/75 ESV 


‡Envía PTT-ID (ANI).
‡'HFRGLILFD377,'HQSDQWDOOD
)UHFXHQFLD &DQDOHV 3RWHQFLD ‡Codifica y decodifica llamada de emergencia.
‡Llamada selectiva.
7.+.ă 86 136 - 174 MHz 128 50 W ‡Envío y recepción de mensajes pregrabados
(16 caracteres).
7.+.ă 86 450 - 520 MHz 128 45 W ‡Recepción de mensajes cortos de texto (48 caracteres).
‡Radio Kill, habilitación y deshabilitación vía aire.
7.+.ă 86 400 - 470 MHz 128 45 W ‡&DSDFLGDGGHFRQH[LyQD3&FRPREDVHGH*36
UHTXLHUH6.553&\PRGLILFDFLyQ 
,QFOX\Hcable de corriente, micrófono KMC-30, bracket y accesorios de montaje. ‡Reportes GPS automático, por petición y al transmitir.
'LPHQVLRQHV: 160 x 43 x 137 mm.
3HVR: 1.18 kg. )00RGR7URQFDO/75 UHTXLHUHYHUVLyQR
SRVWHULRU.3*'. 
$JUHJXHODRSFLyQGHPRGLILFDFLyQ02'*36ă86DVXUDGLRSDUDDSOLFDFLRQHVFRQ*36 ‡128 IDs de grupo / 128 zonas LTR.
RFRQVXOWHFRQ,QJHQLHUtD ‡Protocolo troncal LTR.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
5HFHSWRU*36
S 0LFUyIRQR *8'%ă86 Receptor GPS con antena para radio móvil KENWOOD RADIOS KENWOOD
TK-7302H / 8302H.
.0&ă86 Micrófono estándar con teclado DTMF
.3*'.ă86 Software de programación y ajuste en Windows
6383/86ă86 Programador universal de móviles y portátiles KENWOOD
para puerto USB y RS-232.
6.553&ă86 Arnés SYSCOM con conector DB15 macho a RS-232 o serial
para conexión de TK-7360/ 8360 y NX-720/820.
.3*80ă86 Cable de programación KENWOOD para puertos USB

GU-158-DB15 KMC-36

Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 21
Radios Móviles Comerciales Año 2016

7.++‡5DGLR0yYLOGH$OWDV(VSHFLÀFDFLRQHV
110 W (VHF) | 100 W (UHF) | 160 Canales | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | 5 Años de Garantía
&XDQGRODPLVLyQHVFUtWLFDVXHTXLSRGHFRPXQLFDFLyQGHEHHVWDUVLHPSUHDO &DUDFWHUtVWLFDV*HQHUDOHV
La Serie 90 es simplemente lo mejor en términos de desempeño, facilidad de uso y durabilidad. ‡Scan (exploración) con doble prioridad y canal de regreso.
‡Memoria flash.
‡2SFLyQSDUDGREOHFDEH]DOUHPRWR
‡Función de repetidor en banda cruzada en configuración
doble banda/un cabezal.
‡Sensor de ignición.
‡conector de accesorios opcionales DB-25, para consolas
de despacho, consolas remotas, módems para datos, etc.

'70)
‡(QYtD377,'
‡Llamada selectiva.
‡Acuse de recepción de llamadas.
‡Hasta 9 memorias programables para llamadas
automáticas.
Cabezal remoto 6HxDOL]DFLyQ)OHHW6\QF®ESV
(requiere kit de montaje)
‡377,'
‡Estado de emergencia.

%DQGD 3RWHQFLD )UHFXHQFLD 'LPHQVLRQHV 3HVR


7.+%.ă 86 VHF 110 W 148 - 174 MHz 178 x 60 x 360 mm 3.6 kg
7.+%.ă 86 UHF 110 W 450 - 490 MHz 178 x 60 x 360 mm 3.6 kg
Los modelos siguientes muestran solamente el precio del radio,
por lo que QRLQFOX\HQFDEH]DOIURQWDOPLFUyIRQRDFFHVRULRVGHPRQWDMH (ver tabla de montajes).

0RQWDMHV
7,326'(&$%(=$/(6$(6&2*(5
Usted necesitará un kit de montaje (a seleccionar), para cualquiera de los radios.
9HUGHWDOOHGHORVNLWVHQODSiJLQDVLJXLHQWH &$%(=$/%É6,&2 &$%(=$/$9$1=$'2

7LSR .LWVGH0RQWDMH
%+'ă 86 Cabezal frontal básico Montaje en tablero
%+6+ă 86 Cabezal frontal básico Montaje remoto
)+'ă 86 Cabezal frontal avanzado Montaje en tablero
)+6+ă 86 Cabezal frontal avanzado Montaje remoto

- Pantalla alfanumérica de - Pantalla alfanumérica de


RADIOS KENWOOD

8 caracteres segmentados. 14 caracteres matrizados.


- 7 teclas programables. - 9 teclas programables.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
6.3*0ă86 Interfaz de programación para radios móviles TK690/ 790/ 890.
.3*'ă86 Software de programación en Windows para radios móviles TK790/ 890.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB y RS-232 compatible con Windows (para serie 90 requiere SHK-90).
6386%ă86 Programador universal de móviles y portátiles KENWOOD para puerto USB compatible con Windows (para serie 90 requiere SHK-90).
6+.ă86 Cable de interfaz para SPUPLUS para móviles KENWOOD serie 30/ 90.
.5.'%ă86 Kit doble banda para control de 1 radio en VHF,1 radio UHF con un sólo cabezal remoto.

Dimensiones: Ancho x Alto x Profundidad.

22 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Montajes para Radios Móviles

6HULH‡.LWGH0RQWDMHFRQ3DQHO)URQWDO%iVLFR
.,73$5$0217$-((17$%/(52 &RQÀJXUHVX7.+\7.+
KMC-27
KCT-23M2 KMB-9
.LWSDUD0RQWDMHHQ7DEOHUR
„%+'ă86
,QFOX\H
.&+ă86 Panel de control básico con bocina interna.
.&70ă86 Cable para corriente directa, (modelos de 100/110 W).
.0%ă86 Bracket de montaje con llave (modelos de 100/110 W).
.0&ă86 Micrófono estándar robusto con cancelación de ruido, cumple
con especificaciones MIL-STD.

KCH-10

.,73$5$0217$-(5(0272
KMC-27 .LWSDUD0RQWDMH5HPRWR
KCT-23M2 KMB-9
„%+6+ă86
,QFOX\H
.&+ă86 Panel de control básico con bocina interna.
.5.ă86 Kit de montaje remoto de cabezal sencillo de control.
.&70ă86 Cable para kit de montaje remoto 5 m.
.&70ă86 Cable para corriente directa (modelos de 100/110 W).
.0%ă86 Bracket de montaje con llave (modelos de 100/110 W).
.0&ă86 Micrófono estándar robusto con cancelación de ruido, cumple
con especificaciones MIL-STD
KCH-10
KCT-22M2

.LWGH0RQWDMHFRQ3DQHO)URQWDO$YDQ]DGR
.,73$5$0217$-((17$%/(52
.LWSDUD0RQWDMHHQ7DEOHUR
KES-5
„)+'ă86
,QFOX\H
.&+ă86 Panel frontal completo.
.&70ă86 Cable para corriente directa, (modelos de 100/110 W).
KCT-23M2
.0%ă86 Bracket de montaje con llave (modelos de 100/110 W).
.0&ă86 Micrófono estándar robusto con cancelación de ruido, cumple
con especificaciones MIL-STD.
KMC-27 .(6ă86 %RFLQDH[WHUQDŸ:

KCH-11

.,73$5$0217$-(5(0272
.LWSDUD0RQWDMH5HPRWR
RADIOS KENWOOD
KES-5
„)+6+ă86
,QFOX\H
.&+ă86 Panel frontal completo.
.5.ă86 Kit de montaje remoto de cabezal sencillo de control.
KCH-11 .&70ă86 Cable para kit de montaje remoto 5 m.
.&70ă86 Cable para corriente directa, (modelos de 100/110 W).
.0%ă86 Bracket de montaje con llave (modelos de 100/110 W).
.0&ă86 Micrófono estándar robusto con cancelación de ruido, cumple
con especificaciones MIL-STD
.(6ă86 %RFLQDH[WHUQDŸ:

KMC-27

KMB-9
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Móviles Comerciales Digitales Año 2016

1;‡5DGLR'LJLWDOGHOD0iV$OWD7HFQRORJtD
50 W (VHF) | 45 W (UHF) | 32 Canales | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | Cumple Norma IP54 | 3 Años de Garantía

=21$6ăAnalógico / Digital &DUDFWHUtVWLFDV*HQHUDOHV


‡2 zonas convencionales.
',*,7$/(6ăNo requieren repetidor para operar en modo digital ‡LED display de 2 dígitos.
‡LED indicadores de función y estatus.
‡Iluminación de teclas.
‡LED indicador de transmisión/ ocupado/ llamada de alerta.
‡9 teclas programables.
‡Emergencia inteligente / tecla auxiliar configurable.
‡:GHSRWHQFLDHQODERFLQDIURQWDO
‡Anunciador de canal por voz.
‡&RQHFWRUGHDFFHVRULRV'%
‡8 puertos programables como entrada o salida.
‡MIL-STD-810 C/ D/ E/ F.
‡)XQFLRQHVGH*36GLVSRQLEOHV
&DUDFWHUtVWLFDV'LJLWDOHV
‡Interfaz digital al aire NXDN™.
‡Canales con espaciamiento de 6.25 y 12.5 kHz (Versión 2.0).
‡(QYtRGHDOLDVDODLUH HQ7[ 
‡Llamadas paging.
‡Llamada de emergencia.
‡Llamada a todos los grupos.
‡Mensajes de estatus configurables (2 sólo en Tx).
‡Stun y Kill remotos (req. software de despacho).
‡Localización GPS con PTT.
‡(QFULSWDFLyQGLJLWDO1;'1Œ
‡Modo convencional digital.
‡1-63 códigos RAN disponibles (Radio Access Number).
‡Llamadas selectivas de grupo o individuales.
‡Funcionamiento en sitios convencionales IP.
‡)XQFLyQURDPLQJ
‡Scan.
‡Scan sencillo de zona.
)UHFXHQFLD &DQDOHV 3RWHQFLD ‡Scan prioritario por zona.
1;+.ă 86 136 - 174 MHz 32 (2 zonas) 50 W &DUDFWHUtVWLFDV*HQHUDOHV$QDOyJLFDV
1;+.ă 86 450 - 520 MHz 32 (2 zonas) 45 W ‡(VSDFLDPLHQWRGHFDQDON+] 1DUURZ \N+]
1;+.ă 86 400 - 470 MHz 32 (2 zonas) 45 W 9HUVLyQ 
‡Zonas convencionales programables.
,QFOX\H cable de corriente, micrófono KMC-30, bracket y accesorios de montaje. ‡Señalización DTMF, FleetSync® y MDC-1200.
'LPHQVLRQHV: 160 x 43 x 122.6 mm. ‡Tonos seleccionables QT/DQT.
3HVR: 1.10 kg. ‡16 códigos de inversión de voz (Scrambler).
‡FleetSync®.
$JUHJXHODRSFLyQGHPRGLILFDFLyQ02'*36ă86DVXUDGLRSDUDDSOLFDFLRQHVFRQ*36 ‡Identificación ANI por PTT.
RFRQVXOWHFRQ,QJHQLHUtD ‡Llamadas selectivas de grupo o individuales.
‡Llamada de emergencia inteligente.
‡Localización GPS.
6HxDOL]DFLyQ0'&
‡PTT-ID (ANI).
‡Emergencia, Radio Check e inhibición del radio.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
RADIOS KENWOOD

5HFHSWRU*36
S 0LFUyIRQR 6383/86ă86 Programador universal de móviles y portátiles
KENWOOD para puerto USB.
6386%ă86 Programador universal de móviles y portátiles
KENWOOD para puerto USB.
.0&ă86 Micrófono de mano.
.0&ă86 Micrófono con DTMF.
.(6ă86 %RFLQDH[WHUQDŸ:
.&7ă86 Cable para sensor de ignición.
*8'%ă86 Receptor GPS con antena para radios moviles KENWOOD.
.3*'.ă86 Software de programación y ajuste en Windows.
.3*ă86 Cable de programación KENWOOD para puertos USB.
GU-158-DB15 KMC-36

Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Móviles Comerciales Digitales

1;+*.‡$OWR'HVHPSHxRHQ&RQGLFLRQHV$GYHUVDV
50 W (VHF) | 45 W (UHF) | 260 Canales | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple Norma IP54 | 5 Años de Garantía
0RGR&RQYHQFLRQDO )0 
02'20,;72ăCambio de Digital a Analógico Automáticamente (Sólo Prográmelo) ‡Codificación y decodificación de tonos DTMF.
- Envío de PTT-ID.
',*,7$/(6ăNo requieren repetidor para operar en modo digital - Llamada selectiva.
&210Ð'(03$5$*36ăObtenga la posición de la unidad en un sistema LAV - Stun.
con sólo conectar un receptor de GPS. Requiere antena KRA-40GM. ‡MDC-1200.
‡FleetSync® I/II.
‡Canales de 25 y 12.5 kHz.
‡Tonos CTCSS / DCS.
‡Tabla de tonos seleccionable.
‡Compensación de audio.
‡Encriptación por inversión de voz.
‡Compatible con zonas LTR.
)OHHW6\QF®,,, 6yOR0RGR&RQYHQFLRQDO)0 :
‡PTT-ID ANI.
‡Llamada selectiva.
‡Mensajes de estado.
‡Llamada de emergencia.
‡Identificación en pantalla.
‡Mensajes de texto cortos.
‡Mensajes de encendido / apagado.
‡Despliega posición GPS en pantalla.
‡Reportes GPS con PTT-ID y emergencia.
‡Reporte GPS con mensajes de estatus.
‡Desactivación de radio vía aire (Radio Kill).

0'&
‡PTT-ID ANI
‡Identificación en pantalla.
)UHFXHQFLD &DQDOHV 3RWHQFLD ‡Supervisión remota.
‡Desactivación de radio vía aire (Radio Kill).
1;+*.ă 86 136 - 174 MHz 260 50 W
&DUDFWHUtVWLFDV'LJLWDOHV
1;+*.ă 86 450 - 520 MHz 260 45 W ‡Canales de 6.25 y 12.5 kHz.
1;+*.ă 86 400 - 470 MHz 260 45 W ‡NXDN™ Interfaz digital.
‡Vocoder AMBE+2.
,QFOX\H cable de corriente, micrófono KMC-35, bracket y accesorios de montaje. ‡3URJUDPDFLyQYtDDLUH27$3 UHT.3*$3 
'LPHQVLRQHV: 160 x 43 x 136 mm. ‡Identificación en pantalla.
3HVR: 1.2 kg. ‡Llamada selectiva.
‡Llamada de emergencia.
&DUDFWHUtVWLFDV ‡(QFULSWDFLyQ1;'1ŒGHFyGLJRVGLIHUHQWHV
‡3DQWDOODDOIDQXPpULFDGHFDUDFWHUHV ‡Envío y recepción de mensajes de texto pregrabados.
‡260 CH-GID / 128 zonas ‡Desactivación de radio vía aire y radio espía (desde el software de despacho).
‡Íconos de funciones y estado en pantalla. ‡Envío y recepción de mensajes cortos de 100 caracteres editables por teclado.
‡Tonos de alerta programables. ‡Reportes GPS con PTT-ID y emergencia.
‡&RQHFWRUGHDFFHVRULRV'% FRQH[LyQD3&  ‡Reporte GPS con mensajes de estado.
‡Sensor de ignición. ‡(QYtRGHDOLDVDODLUH
‡Programable por software KPG-141D.
‡Memoria flash para actualizaciones futuras. 0RGR'LJLWDO&RQYHQFLRQDO
‡Exploración sencilla/ multizona y canal prioritario. ‡63 números de acceso de radio a repetidor (RAN).
‡6 puertos auxiliares programables. ‡2SHUDFLyQHQPRGRPL[WRGHGLJLWDO)0DQDOyJLFR
‡Función del puerto modo transparente. ‡Funcionamiento en zonas convencionales multisitio por IP.
‡Resistencia a polvo y agua cumpliendo con la norma IP54. ‡5RDPLQJHQPXOWLVLWLRV,3
‡Tecla auxiliar o de emergencia.
‡4W de potencia en bocina frontal. 0RGR'LJLWDO7URQFDO
‡6 teclas frontales programables. ‡Llamada individual o de grupo
‡ Módem para GPS incluido ‡Entrada tardía (late entry).
- Puede ser utilizado como unidad GPS remota (req. receptor KRA-40GM). ‡Llamada general (Broadcast).
‡Capacidad de 30 canales por sitio.
- Puede ser utilizado como radiobase GPS (req. modificación).
RADIOS KENWOOD
‡Reagrupamiento dinámico.
‡Funcionamiento en zonas trunking multisitio por IP.
‡Roaming.
$JUHJXHODRSFLyQGHPRGLILFDFLyQ02'*36ă86DVXUDGLRSDUD ‡Llamada en espera.
DSOLFDFLRQHVFRQ*36 VHUHTXLHUHVyORFRPRUDGLREDVH RFRQVXOWHFRQ,QJHQLHUtD
)00RGR7URFDO/75
‡Características KENWOOD LTR.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.3*'.ă86 Software de programación y ajuste en Windows. .0&ă86 Micrófono con DTMF.
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para .(6ă86 %RFLQDH[WHUQDŸ:
puerto USB y RS-232. .&7ă86 Cable para sensor de ignición.
6386%ă86 Programador universal de móviles y portátiles KENWOOD para $17;ă86 Antena GPS SYSCOM con conector SMA macho.
puerto USB. .5$*0ă86 Antena GPS KENWOOD con conector SMA macho.
.0&ă86 Micrófono de mano. .3*80ă86 Cable de programación KENWOOD para puertos USB.
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Móviles Comerciales Digitales Año 2016

1;++‡7HFQRORJtD6HJXULGDG\5HVLVWHQFLD
50 W (VHF) | 45 W (UHF) | 512 Canales | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple Norma IP54 / 55 | 5 Años de Garantía
0RGR'LJLWDO*HQHUDO
02'20,;72ăCambio de Digital a Analógico Automáticamente (Sólo Prográmelo) ‡NXDN™ interfaz digital.
',*,7$/(6ăNo requieren repetidor para operar en modo digital ‡Vocoder AMBE+2.
‡Canales de 6.25 y 12.5 kHz.
&210Ð'(03$5$*36ăObtenga la posición de la unidad en un sistema LAV ‡(QYtRGHDOLDVDODLUH.
con sólo conectar un receptor de GPS. Requiere antena GU-158-DB25 y modificación. ‡3URJUDPDFLyQYtDDLUH27$3 UHTXLHUH.3*$3 
‡Llamada de búsqueda y de emergencia.
‡(QFULSWDFLyQ1;'1ŒFyGLJRVGLIHUHQWHV
‡Envío y recepción de mensajes pregrabados (16 caracteres).
‡Desactivación de radio vía aire (desde el software de despacho).
‡Envío y recepción de mensajes escritos (100 caracteres).
‡Reportes GPS con PTT-ID y emergencia y con mensajes de estatus.
‡0HQVDMHVGHYR]FRQWDUMHWD9*6.

0RGR'LJLWDO&RQYHQFLRQDO
‡63 Números de acceso de radio a repetidor (RAN).
Cabezal remoto
‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRGLJLWDO
(requiere kit de montaje)
‡5RDPLQJHQPXOWLVLWLRV,3

0RGR'LJLWDO7URQFDO
‡ID de monitor prioritario 1 y 2.
‡Entrada tardía (Late Entry).
‡Llamada general (Broadcast).
‡Capacidad de 30 canales por sitio.
‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRWURQFDOGLJLWDO
‡Compatible con sistemas multisitio.
‡Reagrupamiento dinámico.

0RGR*HQHUDO)0 $QDOyJLFR 
‡Canales de 12.5 y 25 kHz.
‡FleetSync® I/II.
‡Codificación y decodificación DTMF.
)UHFXHQFLD &DQDOHV 3RWHQFLD ‡Compensación de audio.
1;.ă 86 136 - 174 MHz 512 30 W ‡Encriptación de inversión de voz.
‡Puerto plug-in para tarjeta ANI o encriptación.
1;.ă 86 450 - 520 MHz 512 30 W
)00RGR7URQFDO/75
1;.ă 86 400 - 470 MHz 512 30 W
‡Características KENWOOD LTR.
1;+.ă 86 136 - 174 MHz 512 50 W
1;+.ă 86 450 - 520 MHz 512 45 W )OHHW6\QF®,,, 6yOR)0$QDOyJLFR 
‡PTT-ID digital ANI.
1;+.ă 86 400 - 470 MHz 512 45 W ‡Llamada selectiva.
‡Mensajes de estatus.
,QFOX\HFDEOHGHFRUULHQWHPLFUyIRQR.0&EUDFNHW\DFFHVRULRVGHPRQWDMH
‡Estado de emergencia.
'LPHQVLRQHV: 160 x 45 x 157 mm / 3HVR: 1.38 kg.
&DUDFWHUtVWLFDV*HQHUDOHV ‡Decodifica PTT-ID en pantalla.
‡Mensajes de texto cortos, de estatus encendido/ apagado y de entradas/salidas.
‡3DQWDOODGHFDUDFWHUHVDOIDQXPpULFRV ‡Función de enviar y desplegar GPS en pantalla.
‡Íconos de funciones y estatus en pantalla. ‡Reportes GPS con PTT-ID y emergencia, con mensajes de estatus y con sensor de ignición.
‡Tecla de emergencia auxiliar.
‡Tonos de alerta programables. 6HxDOL]DFLyQ0'&
‡&RQHFWRUGHDFFHVRULRV'% FRQH[LyQD3& 
‡Sensor de ignición. ‡Codifica PTT-ID (ANI).
‡Voceo público (opcional). ‡Decodifica PTT-ID en pantalla (alias).
‡Memoria flash. ‡Codifica y decodifica llamada de emergencia.
‡2SFLyQSDUDFRQH[LyQGHUHFHSWRU*36SDUDWDUMHWD9*6JUDEDFLyQGHYR] ‡Radio Check.
‡Scan sencillo/multizona y con doble prioridad. ‡Radio Kill, habilitación y deshabilitación vía aire.
‡Módem para GPS incluido: $JUHJXHODRSFLyQGHPRGLILFDFLyQ02'*36ă86DVXUDGLRSDUD
RADIOS KENWOOD

- Puede ser utilizado como unidad GPS remota (req. receptor GU-158-DB25). DSOLFDFLRQHVFRQ*36RFRQVXOWHFRQ,QJHQLHUtD
- Puede ser utilizado como radiobase GPS.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.3*'.ă86 Software de programación y ajuste en Windows. *8'%ă86 Receptor GPS con antena para radio móvil KENWOOD Serie
6383/86ă86 Programador universal de móviles y portátiles KENWOOD 180 y NXDN™.
para puerto USB y RS-232. .3*80ă86 Cable de programación KENWOOD para puertos USB.
6386%ă86 Programador universal de móviles y portátiles KENWOOD
para puerto USB .LWGH0RQWDMH5HPRWR
.0&ă86 Micrófono de mano. .5.ă86 Kit de montaje remoto.
.0&ă86 Micrófono con DTMF. .&70ă86 Cable de corriente directa (3.048 m) para radios KENWOOD
.(6ă86 %RFLQDH[WHUQDŸ: Serie 90.
.$3ă86 Tarjeta para voceo público. .&70ă86 Cable de corriente directa (7 m).
.&7ă86 Cable para sensor de ignición. .5.ă86 Montaje remoto con doble cabezal.
9*6ă86 Tarjeta para almacenamiento de voz. 6+'.1;ă86 Arnés SYSCOM para adaptar diademas de portátiles
KENWOOD (excepto serie 80/ 140/ 180/ NX-200).
Dimensiones: Ancho x Alto x Profundidad.

26 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Móviles Comerciales Digitales

1;‡&RPXQLFDFLyQ(ÀFD]\6HJXUDHQ7RGR0RPHQWR
15 W | 260 Canales | 800 MHz | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple Norma IP54 | 5 Años de Garantía
02'20,;72ăCambio de Digital a Analógico Automáticamente (Sólo Prográmelo) ‡Encriptación NXDN™.
‡Mensajes de estatus.
',*,7$/(6ăNo requieren repetidor para operar en modo digital ‡Desactivación de radio vía aire (Stun/ Kill, desde software de despacho).
‡Radio Check.
&210Ð'(03$5$*36ăObtenga la posición de la unidad en un sistema LAV ‡Mensajes de datos.
con sólo conectar un receptor de GPS. Requiere antena KRA-40GM. ‡Localización GPS con voz.
0RGR'LJLWDO&RQYHQFLRQDO
‡64 números de acceso de radio al repetidor (RAN).
‡Llamada selectiva individual y de grupo.
‡Operación en zonas convenciones por IP.
‡5RDPLQJHQPXOWLVLWLRV,3
0RGR'LJLWDO7URQFDO
‡Llamada individual.
‡Llamadas de grupo y/o generales (Broadcast).
‡Interconexión telefónica.
‡Modo de trasmisión troncal.
‡Mensajes.
‡Llamada en espera con prioridad.
‡Entrada tardía (Late Entry).
‡Operación de monitoreo prioritario de 4 IDs.
‡Modo Failsoft.
&RPSDWLELOLGDGGH5HGHV0XOWLVLWLRSRU,3
‡60,000 GIDs/ UIDs.
‡Llamadas de grupo.
‡5RDPLQJ
‡Registro de grupos.
)UHFXHQFLD &DQDOHV 3RWHQFLD
&RPSDWLELOLGDGHQ0XOWLVLVWHPDV
1;*.ă 86 806 - 870 MHz 260 (128 zonas) 15 W ‡8 redes troncalizadas.
‡Lista de UID para cada red.
,QFOX\H cable de corriente, micrófono KMC-35, bracket y accesorios de montaje.
'LPHQVLRQHV: 160 x 43 x 136 mm. (VFDQHR
3HVR: 1.3 kg. ‡Zona simple/ multizona/ lista de escaneo.
&DUDFWHUtVWLFDV*HQHUDOHV ‡Escaneo prioritario (convencional).
‡15W (806-870 MHz). 0RGR)0*HQHUDO
‡Pantalla alfanumérica de 10 caracteres. ‡Canales de 25 y 12.5 kHz.
‡Luz de pantalla y teclas. ‡Canales NPSPAC (National Public Safety Panning Advisory Committee).
‡Íconos de funciones y estado en pantalla. ‡Zona convencional y LTR® o MPT.
‡LCD de transmisión/ ocupado y alarma. ‡FleetSync®/II, MDC-1200, DTMF.
‡0RGRVGHRSHUDFLyQPH]FODGR)0GLJLWDO ‡QT/DQT (sólo zonas convencionales).
‡LED de estatus. ‡Encriptación por inversión de voz de alto nivel.
‡4 selectores arriba/ abajo.
‡6 teclas programables frontales. )OHHW6\QF®,, )0 
‡Tecla de emergencia/ auxiliar.
‡Bocina de audio de 4W. ‡PTT ID ANI.
‡Anunciación por voz del número de zona/ canal. ‡Llamada selectiva/ grupo.
‡&RQHFWRUGHDFFHVRULRV'% ‡Mensajes de texto, emergencia y estatus.
‡6 puertos auxiliares programables. 0'&
‡Software de programación de Windows KPG-141D.
‡Memoria flash para actualización de firmware. ‡PTT ID ANI.
‡Cumple con normas MIL-STD-810 C/ D/ E/ F/ G. ‡Emergencia, radio check e inhibición.
‡Cumple con IP-54 resistiendo intrusión de agua y polvo.
‡Interfase serial PC.
‡Mensajes de texto personalizados (SDM).
‡Función de puerto modo transparente.
RADIOS KENWOOD
‡Receptor GPS interconstruido (sólo requiere antena). $FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
‡Conexión a PC. 6383/86ă86 Programador universal de móviles y portátiles KENWOOD para
‡Conector SMA hembra para antenas GPS. puerto USB y RS-232.
'LJLWDO*HQHUDO 6386%ă86 Programador universal de móviles y portátiles KENWOOD para
puerto USB.
‡Interfaz digital NXDN™.
‡Vocoder AMBE+2™. .0&ă86 Micrófono de mano.
‡Canales de 6.25 y 12.5 kHz. .0&ă86 Micrófono con DTMF.
‡(QYtRGHDOLDVDODLUH .(6ă86 %RFLQDH[WHUQDŸ:
‡Programación vía aire OTAP (req. KPG150AP). .&7ă86 Cable para sensor de ignición.
‡Llamadas Paging. .5$*0ă86 Antena GPS KENWOOD con conector SMA.
‡Llamada de emergencia. .3*'.ă86 Software de programación.
‡Llamadas de grupo. $17;ă86 Antena para GPS SYSCOM con conector SMA.
.3*80ă86 Cable de programación KENWOOD para puertos USB.
$JUHJXHODRSFLyQGHPRGLILFDFLyQ02'*36ă86DVXUDGLRSDUD
DSOLFDFLRQHVFRQ*36 VHUHTXLHUHVyORFRPRUDGLREDVH RFRQVXOWHFRQ,QJHQLHUtD
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 27
Radios Móviles Comerciales Digitales Año 2016

1;‡6XSHULRULGDGHQ7HFQRORJtDGH9DQJXDUGLD
15 W | 512 Canales | 800 MHz | NXDN™ | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple Norma IP54 / 55 | 5 Años de Garantía
0RGR'LJLWDO*HQHUDO
02'20,;72ăCambio de Digital a Analógico Automáticamente (Sólo Prográmelo)
‡NXDN™ interfaz digital.
',*,7$/(6ăNo requieren repetidor para operar en modo digital ‡Vocoder AMBE+2.
‡Canales de 6.25 y 12.5 kHz.
&210Ð'(03$5$*36ăObtenga la posición de la unidad en un sistema LAV ‡(QYtRGHDOLDVDODLUH
con sólo conectar un receptor de GPS. Requiere antena GU-158-DB25 y modificación. ‡3URJUDPDFLyQYtDDLUH27$3 UHTXLHUH.3*$3 
‡Llamada de búsqueda y de emergencia.
‡(QFULSWDFLyQ1;'1ŒFyGLJRVGLIHUHQWHV
‡Envío y recepción de mensajes pregrabados (16 caracteres).
‡Desactivación de radio vía aire (desde el software de despacho).
‡Envío y recepción de mensajes escritos (100 caracteres).
‡Reportes GPS con PTT-ID, emergencia y con mensajes de estatus.
‡0HQVDMHVGHYR]FRQWDUMHWD9*6

0RGR'LJLWDO&RQYHQFLRQDO
Cabezal remoto ‡63 números de acceso de radio a repetidor (RAN).
(requiere kit de montaje) ‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRGLJLWDO
‡5RDPLQJPXOWLVLWLRSRU,3

0RGR'LJLWDO7URQFDO
‡ID de monitor prioritario 1 y 2.
‡Entrada tardía (Late Entry).
‡Llamada general (Broadcast).
‡Capacidad de 30 canales por sitio.
‡2SHUDFLyQHQPRGRPL[WRGH)0DQDOyJLFRWURQFDOGLJLWDO
‡Compatible con sistemas multisitio.
‡Reagrupamiento dinámico.

0RGR*HQHUDO)0 $QDOyJLFR 
‡Canales de 12 y 25 kHz.
‡Canales NPSPAC.
Frecuencia Canales Potencia ‡FleetSync® I/II.
1;.ă 86 806 - 870 MHz 512 15 W ‡Codificación y decodificación DTMF.
‡Compensación de audio.
,QFOX\H cable de corriente, micrófono KMC-35, bracket y accesorios de montaje. ‡Encriptación de inversión de voz.
'LPHQVLRQHV: 160 x 45 x 157 mm. ‡Puerto plug-in para tarjeta ANI o encriptación.
3HVR: 1.5 kg.
&DUDFWHUtVWLFDV*HQHUDOHV )00RGR7URQFDO/75
‡3DQWDOODGHFDUDFWHUHVDOIDQXPpULFRV ‡Características KENWOOD LTR.
‡Íconos de funciones y estatus en pantalla.
‡Tecla de emergencia auxiliar. )OHHW6\QF®,,, 6yOR)0$QDOyJLFR 
‡Tonos de alerta programables. ‡PTT-ID digital ANI.
‡&RQHFWRUGHDFFHVRULRV'% FRQH[LyQD3&  ‡Llamada selectiva.
‡Sensor de ignición. ‡Mensajes de estatus.
‡Voceo público (opcional) ‡Estado de emergencia.
‡Memoria flash. ‡Decodifica PTT-ID en pantalla.
‡2SFLyQSDUDFRQH[LyQGHUHFHSWRU*36\SDUDWDUMHWD9*6JUDEDFLyQGHYR] ‡Mensajes de texto cortos, de estatus encendido / apagado y de entradas / salidas.
‡Scan sencillo/multizona y con doble prioridad. ‡Función de enviar y desplegar GPS en pantalla.
‡Módem para GPS incluido ‡Reportes GPS con PTT-ID y emergencia, con mensajes de estatus y con sensor de ignición.
- Puede ser utilizado como unidad GPS remota (req. receptor GU-158-DB25
y modificación). 6HxDOL]DFLyQ0'&
- Puede ser utilizado como radiobase GPS. ‡Codifica PTT-ID (ANI).
‡Decodifica PTT-ID en pantalla (alias).
$JUHJXHODRSFLyQGHPRGLILFDFLyQ02'*36ă86DVXUDGLRSDUD ‡Codifica y decodifica llamada de emergencia.
DSOLFDFLRQHVFRQ*36RFRQVXOWHFRQ,QJHQLHUtD ‡Radio Check.
RADIOS KENWOOD

‡Radio Kill, habilitación y deshabilitación vía aire.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
.3*'.ă86 Software de programación y ajuste en Windows. *8'%ă86 Receptor GPS con antena para radio móvil KENWOOD Serie
6383/86ă86 Programador universal de móviles y portátiles KENWOOD para 180 y NXDN™.
puerto USB y RS-232. .3*80ă86 Cable de programación KENWOOD para puertos USB.
6386%ă86 Programador universal de móviles y portátiles KENWOOD para .0&ă86 Micrófono estándar con teclado DTMF.
puerto USB.
.0&ă86 Micrófono de mano .LWGH0RQWDMH5HPRWR
.0&ă86 Micrófono con DTMF. .5.ă86 Kit de montaje remoto.
.(6ă86 %RFLQDH[WHUQDŸ: .&70ă86 Cable de corriente directa (3.048 m). para radios KENWOOD
.$3ă86 Tarjeta para voceo público. serie 90
.&7ă86 Cable para sensor de ignición. .&70ă86 Cable de corriente directa (7 m).
9*6ă86 Tarjeta para almacenamiento de voz. .5.ă86 Cabezal remoto doble.
Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Móviles Digitales

1;‡&RPXQLFDFLyQ'LJLWDOGH$OWDV(VSHFLÀFDFLRQHV
45/50 W de Potencia | 1024 Canales (4000 Opcional) | Analógico, NXDN™, P25 Fase 1 y Fase 2 | Fabricado en Ambiente ISO 9001:2008
Aprobado por la FCC | Cumple Normas IP54/55 | Bluetooth | Micro SD | MIL-STD-810 C/D/E/F/G

‡6 teclas frontales y 4 teclas arriba / abajo.


‡Tecla de emergencia/ Aux.
t S U PPO ‡MDC-1200.
CO L
TO ‡FleetSync®.
RT
t M U LT I -PR O

P25 ‡Capacidad máxima de 4000 canales, 512 canales por zona, 128 zonas.
RA D

‡GPS.
NXDN
IO

‡(QFULSWDFLyQWLSR'(6LQWHUFRQVWUXLGDELWV
t

FM
G

‡Ajuste automático del brillo en el LCD.


LO
P2

5/ A
NX N ‡Audio KENWOOD con cancelación de ruido.
D N /FM A
,GHQWLILFDFLyQ ‡Botón de emergencia.
0XOWLSURWRFROR $XWRPiWLFDGH ‡Anunciador de voz en 8 idiomas.
/ODPDGD ‡Ranura para tarjeta Micro SD (opcional).
‡%OXHWRRWKLQWHUFRQVWUXLGR
‡Un solo software para programación P25, NXDN™ y FM analógico.
‡Opción cabezal remoto.

6HJXULGDG0HMRUDGD
‡$FWLYDFLyQGHOVRIWZDUHGHSURJUDPDFLyQYtDDXWHQWLFDFLyQHQVHUYLGRU
‡1XHYRPpWRGRGH,'GHLQVWDODFLyQ
‡Anticracking: archivos encriptados.
‡Encriptación en sesión P2P (lectura y escritura).

&DUDFWHUtVWLFDV'LJLWDO3
‡P25 convencional / trunking (fase 1 y 2).
‡Vocoder Ambe+2 mejorado.
‡Listo para llamadas de grupo e individuales.
‡Identificación en pantalla.
18(92 ‡Monitoreo remoto.
‡Inhibición remota.
)UHFXHQFLD &DQDOHV* 3RWHQFLD ‡Llaves de encriptación Zeroize y retenida.
1;.ă 86 136 - 174 MHz 1024 50 W ‡Localización GPS P25
1;.ă 86 450 - 520 MHz 1024 45 W ‡OTAP (Over the Air Programming).
‡P25 Voting (roaming).
1;.ă 86 380 - 470 MHz 1024 45 W
‡Mensajes de texto.
0RGR3)DVH\2SFLRQDO *Máximo 4000 canales
'LJLWDO1;'1Œ
,QFOX\H cable de corriente, bracket y micrófono KMC-35.
'LPHQVLRQHV: 170 x 48 x 190 mm. ‡Interfaz digital NXDN™.
3HVR: 2.1 kg. ‡Vocoder AMBE+2.
‡Ancho de canal 6.25 y 12.5 kHz.
‡Envío de alias al aire.
‡Encripción NXDN™.
&DUDFWHUtVWLFDV*HQHUDOHV ‡Modo trunking y trunking IP multisitio.
‡Multidigital + operación FM analógica. ‡Modo convencional y convencional IP multisitio.
‡NXDN™ convencional. ‡Roaming.
‡Trunking NXDN™ tipo C. ‡GPS.
‡3IDVHFRQYHQFLRQDOWUXQNLQJ ‡Mensajería.
‡3IDVHWUXQNLQJ ‡Scan.
‡Analógico FM convencional / trunking.
‡Modo mezclado.
‡Display TFT a color de 2.55” (154 x 422 pixeles).
‡Interfaz de color ajustable y display de texto multilínea.
‡4 W de potencia de audio en la bocina.

$FFHVRULRV
RADIOS KENWOOD

0LFUyIRQR 0LFUyIRQR'70) $FFHVRULRV,QFOXLGRV


.0&ă86 Micrófono de mano.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV 
.3*80ă86 Cable de programación KENWOOD para puertos USB.
.0&ă86 Micrófono estándar con teclado DTMF.
.&+5ă/OiPHQRV Cabezal remoto.
.5.+ă/OiPHQRV Kit para cabezal remoto.
.&7ă/OiPHQRV Cable para cabezal remoto.
KMC-35 KMC-36 .3*'.ă86 Software de programación.

Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Software para NEXEDGE™ Año 2016

.3*$3‡$GPLQLVWUDGRU27$3
5HFRQÀJXUHGH)RUPD5HPRWD &DUDFWHUtVWLFDV3ULQFLSDOHV
‡&DSDFLGDG GH PXOWLVLVWHPDV Maneja información de diferentes tipos de sistemas
El sistema OTAP de KENWOOD permite al usuario reconfigurar sus unidades portátiles y móviles (convencionales, trunking y multisitio), puede operar en cualquier puerto serial y en diferentes
NEXEDGE™ vía aire de una forma rápida y eficiente mediante una aplicación en Windows. bandas.
El software KPG-150AP OTAP (Over The Air Programming) simplifica la capacidad de editar o ‡(ILFLHQFLDHQWUDQVIHUHQFLDGHGDWRVEl sistema OTAP comprime y envía únicamente la
cambiar características de operación: información con los cambios. Cada radio tarda de 15 a 80 segundos en tomar la información
dependiendo del tamaño del archivo de programación (data file).
‡Lista de IDs, envío de alias al aire (Over the Air Alias), canales, sitios, parámetros de roaming, ‡8QVRORDUFKLYRGHSURJUDPDFLyQ GDWDILOH SDUDIORWLOODVUna flotilla de radios puede
características opcionales, código de encriptación, Scan, etc. compartir el mismo archivo de programación y el administrador OTAP puede enviar este
‡Sólo opera de manera digital. archivo a cada unidad utilizando su número de unidad (Unit-ID) no necesita hacer un archivo
por radio.
‡6HVLRQHVDXWRPiWLFDVAlgunas sesiones de OTAP pueden ser calendarizadas para iniciar
inmediatamente o por tiempos programados para evitar las horas picos del sistema. OTAP
puede correr automáticamente en cada sesión y se le pueden programar los reintentos por
radio en caso de que se interrumpa el envío de la información.
‡3URFHVR27$3OLEUHGHHUURULa corrección de envío de datos asegura que el 100% de la
información enviada sea recibida. Los radios retienen la información original y la información
recibida (OTAP) separadas en la memoria hasta que el proceso de OTAP sea completado.
‡6HVLRQHV27$3JXDUGDGDVLas sesiones OTAP son guardas con los estatus de éxito o fallo
Estación Base /
Sitio de Administración Directo Archivo de
Programación
para ser verificadas y reprogramar su envío si es necesario.
Cable
NEXEDGE®
2WURV3XQWRV'HVWDFDGRV
Software KPG-150AP Radio Base
Repetidor
Sistema Trunking
‡Cambia total o parcialmente la programación de los radios.
KPG-150AP OTAP

Archivo de
Programación
‡Administra hasta 100,000 unidades.
‡Espacios de canal 6.25 kHz o 12.5 kHz en NXDN™.
Archivo de
Programación
‡Redes IP trunking NEXEDGE™.
‡Redes IP convencionales NEXEDGE™.
‡Modo directo NEXEDGE™.
‡Todos los modelos de radios NEXEDGE™ (excepto serie digital 40).
‡Gráficas en ambiente Windows.

Diagrama de Operación (VSHFLILFDFLRQHV3ULQFLSDOHVSDUD3&


$GPLQLVWUDGRU27$3 2YHU7KH$LU3URJUDPPLQJ 5DGLRV Sistema Operativo Microsoft® Windows® XP SP3 o posterior / Windows
Vista® / Windows® 7 (32/64-bit)
„.3*$3ă86 CPU Intel® Pentium® III 3.1GHz o mayor
2SFLRQHVSDUDSURJUDPDFLyQGHUDGLRVVLPXOWiQHDPHQWH RAM 256 MB o más
.:'$3 . Uno por radio de 10 y hasta 99 radios. Espacio Libre en Disco Duro 40 MB o más
.:'$3 . Uno por radio de 100 y hasta 249. Lector de CD-ROM Necesaria para la instalación del software
.:'$3 . Uno por radio de 250 y hasta 499. Puerto COM Un puerto serial (9600 bps)
.:'$3 . Uno por radio para pedidos de más de 500 radios. Pantalla XGA (1024 x 768) o mayor resolución
SDUDSUHFLRVOOiPHQRV Otros Microsoft® .NET Framework 2.0 o posterior

(QYtRGH,PiJHQHV1(;('*(Π8Q VHQFLOOR \ HIHFWLYR FDPLQR SDUD WHQHU XQ VLVWHPD GH PRQLWRUHR HQ FXDOTXLHU
ORFDFLyQXWLOL]DQGR1(;('*(ŒDSURYHFKDQGRODFREHUWXUDGHORVVLVWHPDVGHUDGLR

&RPSRQHQWHVGHO6LVWHPD
(VWDFLyQGH0RQLWRUHR.- Se compone de radio móvil digital (1;+.), codificador de
imagen (KVT-11) y cámara o domo fijo.
(VWDFLyQ %DVH.- Se compone de radio móvil digital (1; +.), software para
Codificador de Imágenes monitoreo de imágenes (KAS-11) y PC.
KVT-11
2SHUDFLyQGHO6LVWHPD
(VWDFLyQ GH 0RQLWRUHR.- Recibe los comandos vía radio para enviar la imagen capturada
o almacenada en su memoria (8M) a la estación base, la estación de monitoreo se puede
encontrar en cualquier lugar incluso en otro estado gracias a las coberturas que ofrecen los
sistemas multisitio IP de NEXEDGE™.
RADIOS KENWOOD

(VWDFLyQ %DVH.- Equipada con una PC y software KAS-11, manda comandos para recibir
imágenes de una o varias estaciones de monitoreo, tiene la capacidad de almacenamiento
Radio Móvil Digital de imágenes.
NX-700/800
Software Visor de Fotografías KAS-11 „.97ă86
„.$6ă86
Estación de Monitoreo 7LHPSRGH7UDQVIHUHQFLDGH,PDJHQ 6HJXQGRV
Estación de control &DOLGDGGH,PDJHQ
$QJRVWR N+] 0X\$QJRVWR N+]
Premium (18 KB) 46 seg. 95 seg.
Súper fina (12 KB) 32 seg. 59 seg.
Muy fina (6 KB) 20 seg. 35 seg.
KVT-11 NX700/800
Fina (3 KB) 12 seg. 20 seg.
KAS-11
Estándar (1.5 KB) 9 seg. 13 seg.
Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Aplicaciones por Radio

5$55DGLR$XGLR5HFRUGHU

5DGLR$XGLR5HFRUGHU
„5$5ă86
Este nuevo software permite la grabación de transmisiones
analógicas (FleetSync®) y digitales (NXDN™) de una forma
sencilla y organizada, alojando toda la información en su
computadora y permitiendo el acceso o búsqueda por medio
de fecha, ID de origen de la llamada, ID de destino de la
llamada, nombre de usuario, etc.

Al guardar sus conversaciones en carpetas alojadas en


internet usted podrá consultar sus grabaciones desde su
dispositivo móvil sin ningún problema. Todas las grabaciones
son formato .wma que permiten una manipulación sencilla
para grabaciones de respaldo.

Aproveche al máximo su infraestructura de radiocomunicación


y convierta su PC en una poderosa herramienta de grabación
con una inversión verdaderamente baja.

5HTXLHUHUDGLREDVHFRQHFWDGDDOD3&7.
7.1;1;

6RIWZDUHGH$GPLQLVWUDFLyQGH)ORWDV

„.$6ă86
.$6HVXQDVROXFLyQSURIHVLRQDOGHGHVSDFKR
FRPELQDGDFRQKHUUDPLHQWDVLPSRUWDQWHVFRPR
‡Mensajería
‡Llamadas individuales y de grupo
‡Stun/Revive remotos
‡Radio Espía
‡Alertas
‡Salidas de relevador
‡Historial de transmisiones
‡Alta y baja de unidades
‡Señalizaciones FleetSync® y NXDN™
‡No requiere licencias.

5HTXLHUHUDGLREDVHFRQHFWDGDDOD3&
Compatible con radios bases TK-7360/8360, TK-7180/8180,
NX-700/800/900, NX-720/820/920. Con modelos TK-7360/8360
y NX-720/820/920; requiere modificación y arnés KSRR-360PC.

El SKRR-360PC es un adaptador de DB15 a puerto serial


(DB9) y puede requerir un adaptador de USB a serial según
la PC. RADIOS KENWOOD
En modelo TK-7180/8180 y NX-700/800/900, requiere arnés
DB25 a puerto serial (DB9) y puede requerir un adaptador
USB a serial según la PC.

$FFHVRULRVQRLQFOXLGRV
6.553&ă86.
Arnés SYSCOM con conectores DB15 macho y RS-232
(serial) hembra.

Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Software de Administración y Localización Año 2016

6RIWZDUHGH0RQLWRUHR\$GPLQLVWUDFLyQ)/$9
‡Manejo de historiales y recorridos
‡Módulo de emergencia
‡Puntos de interés
‡Geocercas
‡Alertas por exceso de velocidad y por entrada/salida de geocercas.
‡Activación de salidas de relevador (3)
‡Bitácora de eventos y gráfica de localizaciones
‡Vista a nivel de calle
‡Manejo de cuentas de usuario
5HTXHULPLHQWRV
‡Compatible con Windows XP y 7.
‡Sólo sistemas operativos de 32 bits.
‡2 GB de memoria RAM.
‡JAVA.
‡MYSQL como motor de base de datos.
‡Apache Tomcat.
‡Mozilla Firefox.
‡Conexión permanente a internet de banda ancha.
„)/$9ă86 ‡Contratación de IP pública fija.
6HxDOL]DFLRQHV
Esta nueva versión de software para localización y despacho cubre las necesidades que
demanda el mercado actual, no limita el alcance de cobertura para envío de mensajes ‡FleetSync® (KENWOOD).
aprovechando la infraestructura de tecnologías existentes y complementándolas a los equipos ‡NXDN™ (ICOM y KENWOOD).
de radio analógicos (FleetSync®) y digitales (NXDN™) KENWOOD. 5DGLRV&RPSDWLEOHV.(1:22'
‡5DGLREDVH
&DUDFWHUtVWLFDV - TK-7360/ 8360, TK-7180/ 8180, NX-700/ 800, NX-720/ 820, NX-900, NX-920,
Versión web haciendo uso de la plataforma de google maps para mostrar las localizaciones NX-5700/ NX-5800.
‡5DGLRV5HPRWRV
‡Diferentes tipos de vizualización: - Portátiles con micrófono KMC-48GPS: TK-2402/ 3402, TK-2312/ 3312, TK-2360/ 3360,
- Mapa. TK-2170/ 3170, NX-240/ 340, NX-220/ 320
- Satélite. - GPS interconstruido: NX-200/ 300G, NX-5200/ 5300/ 5400.
‡3 tipos de localizaciones diferentes: - Móviles con antena GU158-DB15: TK-7302/ 8302, TK-7360/ 8360, NX-740/ 840.
- Vía PTT (1). - Móviles con antena GU158-DB25: NX-700/ 800.
- Específica. - Móviles con antena KRA-40GM y ANTX20: NX-720/ 820, NX-5700/ 5800.
- Automática (2). (1) Opcional según el radio remoto.
‡Módulo de administración con características de: (2) Las especificaciones del módulo de administración varían según características de
- Llamada selectiva. radio remoto.
- Mensaje de status. (3) El software activa/desactiva una salida de 5 V a la cual hay que acoplar el módulo de
- Mensaje personalizado. relevadores (no incluido).
- Radio Kill.
- Radio Espía. 3DUDPD\RULQIRUPDFLyQFRPXQtTXHVHDO'HSDUWDPHQWRGH,QJHQLHUtD

6RIWZDUHGH'HVSDFKRSDUD5DGLRV3URIHVLRQDOHV.(1:22'/$186

LANUS le permite tener una interacción con sus radios de diferentes maneras como son:

‡Llamada selectiva.
‡Mensaje de estatus.
‡Mensaje personalizado.
‡Radio Kill.
‡Radio Espía (NXDN™).

&DUDFWHULVWtFDV\)XQFLRQHV
RADIOS KENWOOD

‡Manejo de historiales.
„/$186ă86 ‡Módulo de emergencia.
‡Puntos de interés.
/$1865(&25'(5 cuenta con una grabadora de audio integrado que le permite almacenar ‡Geocercas.
todas las llamadas que ocurren en su sistema de radio, el software le permite agregar ‡Alertas por exceso de velocidad.
información de la persona que utiliza el radio como fotografía y nombre. Cuenta además con ‡Activación de salidas de relevador.
RSFLyQGHÀOWUDGRTXHOHSHUPLWHHQOLVWDUGHPDQHUDVHQFLOODODVJUDEDFLRQHVHQXQUDQJRGH ‡Vista a nivel de calle.
fechas, por radio que genera la llamada, así como quien la recibe, además de dar información ‡Alertas enviadas por correo o SMS (1).
de cuando ocurrió y su duración. ‡Bitácora gráfica de localizaciones y de eventos.
‡Alertas por entrada o salida de geocercas.
/$186*36 le permite conocer la ubicación de sus dispositivos de radio que cuenten con ‡Requiere radiobase conectada a PC.
antena GPS y que utilicen señalización NXDN™ y FleetSync®.
Cuenta con la opción de vista a nivel de calle, así como 4 diferentes tipos de mapa e íconos
para mostrar sus unidades.
3RGUiFRQRFHUUHFRUULGRVHQXQUDQJRGHIHFKDVDGHPiVGHFRQÀJXUDUDOHUWDVSRUH[FHVRGH
velocidad, botón de pánico y entrada o salida de geocercas.
Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Software de Administración y Localización

1H[H7DON6XLWH6ROXFLyQGH'HVSDFKR*UDEDFLyQ\/RFDOL]DFLyQ,3
1H[H7DON6XLWHHVXQDVROXFLyQGHGHVSDFKRJUDEDFLyQ\ORFDOL]DFLyQ
GLVHxDGDSDUDUHGHV.(1:22'1(;('*(ŒWUXQNLQJ\FRQYHQFLRQDOHV
$UTXLWHFWXUDGHO6LVWHPD

'HVFULSFLyQ
‡6RSRUWDUHGHVGHFXDOTXLHUWDPDxRFRPHQ]DQGR Kit NexeTalk 1 Licencia de despacho, 1 licencia de repetidor, 15 licencias de radios
GHXQVLWLR\FUHFLHQGRKDVWDUHGHVQDFLRQDOHV
1767.& ă86
PXOWLVLWLR 17695& ă86 Servidor NexeTalk para sistema digital convencional
‡%DVDGRYHUGDGHUDPHQWHVREUH,3 Licencia NexeTalk 1 repetidor
- No requiere llave para Vocoder. 176,7(& ă86
- No requiere de una radio base. 17'63& ă86 Licencia para despacho NexeTalk modo convencional, 1 PC
- Alta seguridad.
‡6RSRUWDGLVSRVLWLYRVWRXFK NT-SVRT ă86 Aplicación NexeTalk server para sistemas trunking
‡'HVDUUROORGHVRIWZDUHSHUVRQDOL]DGR NT-1 ă86 Interconexión telefónica NexeTalk
‡&RQH[LyQ,3DOUHSHWLGRUHQPRGRFRQYHQFLRQDOR
WUXQNLQJ NT-SITET ă86 Licencia NexeTalk para sitio trunking
17'637 ă86 Licencia para despacho NexeTalk modo trunking, 1 PC
NT-R1 ă86 Licencia NexeTalk por radio (despacho, grabación y GPS)
NT-R2 ă86 Licencia NexeTalk por radio (despacho y GPS)
175 ă86 Licencia NexeTalk por radio (grabación)

&RQVRODGH'HVSDFKR *UDEDFLyQGH9R] $GPLQLVWUDFLyQGH)ORWLOODV


‡Calidad de audio AMBE+2™. ‡Grabación de llamadas de grupo. ‡Permite a los operadores SMR el arrendamiento de la
‡Llamadas privadas. ‡Grabación de llamadas privadas despacho-radio. infraestructura para distintos clientes.
‡Llamadas de grupo. ‡Grabación de llamadas radio-radio. ‡Soporta múltiples flotas compartiendo el sistema.
‡Llamadas a múltiples grupos. ‡Interfaz de reproducción instantánea. ‡Múltiples grupos de trabajo dentro de la misma flotilla.
‡Llamadas de emergencia. ‡Interfaz de búsqueda de grabaciones incluida. ‡Privacidad: Flotiilas de radios y datos no pueden ser
‡Mensajes de texto. ‡Las grabaciones pueden ser grabadas como archivos .wav. accesados por otras flotillas.
‡Opciones bloqueo de audio. ‡Almacenamiento: base de datos o carpeta (local, ‡La cantidad de consolas de despacho con cada flotilla es
‡Control de nivel de audio para cada canal. compartido o NAS). ilimitada.
‡Monitoreo remoto o radio espía.
‡Reagrupamiento remoto. *36 *DWHZD\GH,QWHUFRQH[LyQ7HOHIyQLFD
RADIOS KENWOOD
‡Soporta conexión de dispositivos externos para ‡Posicionamiento GPS en tiempo real. ‡Soporta sistemas trunking y convencionales.
PTT USB/COM. ‡StreetMap abierto, mapas Bing. ‡Permite comunicaciones entre teléfono y radios.
‡Roles de despachador / distintos privilegios. ‡Soporta Google earth. ‡Compatible con PBXs SIP 2.0.
‡Recuadro de PTT configurable. ‡Intervalo de reporte GPS automático configurable. ‡Radio-a-teléfono, teléfono-a-radio, teléfono-a-grupos de
‡Radio status check (ON/OFF). ‡Historial de GPS. trabajo.
‡Stun / Revive remotos. ‡Reproducción de recorridos. ‡Números telefónicos ilimitados.
‡Soporta status. ‡GPS en PTT. ‡Grabación de voz (opcional).
‡Default / personalizables. ‡Disponible como aplicación independiente.
‡Atajos.
‡Seleccionar / deseleccionar canales.
‡NexeTalk trabajador solitario.
‡Manager de alertas.
‡Reportes.
‡Registro de ID/ alias.
‡Hasta 65,000 IDs.
‡Historial de llamadas.
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Software de Monitoreo Remoto Año 2016

6RIWZDUHGH0RQLWRUHR5HPRWRSDUD6LVWHPDV'LJLWDOHV,3

IP Network

6RIWZDUHGHPRQLWRUHRUHPRWRSDUDVLVWHPDVGLJLWDOHV,3
„.3*50ă86
.3*50.-Software de monitoreo remoto para sistemas de conexión IP convencionales, 0RQLWRUHR 1;5 1;5
troncales, monositio y multisitio.
El KPG-149RM permite el monitoreo remoto de todos los repetidores en un sistema NXDN™ Consumo de corriente (LNA) 1 N/A
IP. Este software informa a los supervisores o personal técnico de problemas en el sistema o Recepción
Detección de PLL
fallas en cualquiera de los repetidores en cualquiera de los sitios. Además puede establecer un
tono de alarma en la PC del administrador y enviar múltiples e-mail o mensajes de texto SMS al Detección de PLL
recibir dicha alarma. Todos los eventos son almacenados en una bitácora. Consumo de corriente (OCXO) N/A
El monitoreo remoto ayuda a prevenir que ocurran fallas serias en el sistema y así asegurar que Transmisión Nivel de potencia N/A
las comunicaciones críticas permanezcan ininterrumpidas. Detección de baja potencia N/A
Consumo de corriente (HPA) N/A
&DUDFWHUtVWLFDVSULQFLSDOHV Temperatura Tx PCB
Temperatura
3DUiPHWURVGHPRQLWRUHR El personal técnico tiene acceso a información detallada sobre los Temperatura Rx PCB N/A
estatus de alguno de los repetidores, esto gracias al monitoreo individual de la alimentación, Ventilador Consumo de corriente (FAN) 2 N/A
temperatura y las condiciones del ventilador. Los intervalos de monitoreo son ajustables.
Alimentación
Estatus de voltaje de alimentación N/A
5HJLVWURGHDFFHVRDOVRIWZDUH Una vez ejecutado el software se crea un archivo de registro de Voltaje
con formato CSV en una carpeta específica. Un nuevo registro es creado para cada sesión. Conexión
RADIOS KENWOOD

1
Función no disponible para NXR-900.
$ODUPD Opcionalmente, cuando una condición de alerta es detectada, un tono en la PC es 2
Hardware de tipo K únicamente.
activado. El tono puede ser personalizado utilizando un archivo de audio de tipo WAV.

(PDLO \ DOHUWDV GH PHQVDMH 606 Provisto con acceso a un servidor de correos SMTP
(protocolo simple de transferencia de correo), el software puede alertar a una o más personas 5HTXHULPHQWRV0tQLPRV
a través de un e-mail o un mensaje de texto. .3*50
6LVWHPD2SHUDWLYR Microsoft® Windows® XP (32-bit) / Windows Vista® / Windows® 7
,QWHUID]GHXVXDULR La pantalla principal ofrece una organización sencilla utilizando múltiples
pestañas para un fácil cambio entre monitoreo y registros. La configuración de pantallas &38 Intel® Pentium® III 1 GHz o mayor
separadas facilita el registro de nuevos repetidores, bandejas de correo, etc. RAM 256 MB o más
(VSDFLRHQ'LVFR'XUR 40 MB o más (no incluye almacenamiento de registros)
&RQH[LyQ/$1 10 Base-T o más
0RQLWRU XGA (1024 x 768), más de 256 colores

Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Software de Monitoreo de Baterías

/HFWRUGH%DWHUtDV,QWHOLJHQWHV.$6.
6RIWZDUHGH0RQLWRUHRGH%DWHUtDV 9LVXDOL]DFLyQGHYDULRVGDWRV
„.$6.ă86 El lector de baterías KAS-12K lee automáticamente varios datos de baterías recargables
incluidos en un cargador de baterías o una batería recargable. Se muestran como números o
El lector de baterías KAS-12K es un software que supervisa el estado de cargadores de baterías gráficos las diferentes informaciones del cargador o la batería, tales como temperatura, número
o baterías recargables leyendo diferentes informaciones de los cargadores de baterías y las de cargas y descargas y la duración de la batería.
baterías recargables conectadas a un PC. Se puede conectar un máximo de 30 cargadores
de baterías mediante un concentrador USB para supervisar el estado de cada cargador de (VFULWXUDGHGDWRVGHXVXDULR
baterías y cada batería recargable montada en el cargador de baterías. Gracias a la lectura de Se puede escribir texto, como por ejemplo el nombre de los usuarios y la fecha del primer uso,
varias informaciones, tales como el número de cargas y descargas de una batería recargable en un cargador de baterías o una batería recargable.
y la supervisión del estado de la batería recargable, se pueden gestionar correctamente las
baterías recargables. &RQILJXUDFLyQGHGLIHUHQWHVQLYHOHVGHDGYHUWHQFLD
Se pueden configurar niveles de advertencia para el número de días de uso de la batería
recargable, el número acumulado de cargas y descargas y la duración de la batería.

3URWHFFLyQGHODMXVWHGHGDWRVFRQXQDFODYH
Con una clave se puede proteger la configuración del cargador de baterías

(OOHFWRUGHEDWHUtDV.$6.HVFRPSDWLEOH
FRQODVVLJXLHQWHVEDWHUtDVUHFDUJDEOHV
%DWHUtD &DSDFLGDG
Se utiliza un cable USB para conectar un cargador de baterías (cargador rápido KSC-Y32) a KNB-L1 (Li-Ion) 2000 mAh
un PC, y se puede utilizar el lector de baterías KAS-12K para supervisar desde el PC el estado KNB-L2 (Li-Ion) 2600 mAh
del cargador de baterías y el estado de las baterías recargables montadas en el cargador de KNB-L3 (Li-Ion) 3400 mAh
baterías.

5HTXLVLWRVGHOVLVWHPD
Ordenador - CPU: Recomendada por el SO o más rápida.
- 2 GB (64 bits) o 850 MB (32 bits) de espacio libre en
el dispositivo de almacenamiento interno.
- RAM: Recomendada por el SO o más.
- Unidad de CD-ROM.
- Pantalla WXGA (1280 x 768 o mayor).
- Compatible con IBM PC/AT.
SO Windows 8.1, Windows 8, Windows 7
Software Microsoft .NET Framework 4.5
Puerto USB Una PC debe contar con un puerto USB 2.0 para comunicación con el
cargador rápido KSC-Y32.
Cable de conexión Para conectar el cargador rápido KSC-Y32 se necesita un cable USB
Mediante un concentrador USB se puede conectar a una sola PC un máximo de 30 cargadores (Micro USB-B a USB-A).
(cargador rápido KSC-Y32). Se recomienda utilizar una concentrador USB hasta una conexión
de nivel 2. Como se pueden producir desviaciones de tensión y retardos, no se recomienda una
conexión de nivel 3 o superior.

/DSDQWDOODGHOOHFWRUGHEDWHUtDV.$6.VHFRQILJXUDGHODVLJXLHQWHPDQHUD

RADIOS KENWOOD

Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Año 2016 Radios Portátiles Aéreos

,&$$6‡&RQVWUXFFLyQ5REXVWD\GH)iFLO0DQHMR
5 W PEP | Salida de Audio 700 mW | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía

'LVHxR5REXVWRFRQ$PSOLILFDGRU%7/ 5DQJRGH2SHUDFLyQ
%ULGJH7LHG/RDG TXH0HMRUDOD&DOLGDGGH$XGLR ,&$ Tx: 118.000 - 136.975 MHz
Rx: 108.000 - 136.975 MHz
,&$6 Tx/ Rx: 118.000 - 136.975 MHz

&DUDFWHUtVWLFDV*HQHUDOHV
„,&$ă86 ‡5 W PEP (Potencia Envolvente de Pico).
‡200 memorias con alias alfanuméricos distribuidas en
200 canales alfanuméricos, teclado, canales de navegación 10 bancos (,&$6VyORPHPRULDV).
VOR. Incluye batería BP-232H (Li-Ion, 2300 mAh), cargador ‡Pantalla de 8 caracteres con indicador de nivel de batería.
estándar BC-179, adaptador de corriente BC174, clip MB94 ‡Botón para acceso rápido a canal de emergencia
y antena FAB02AR. (121.5 MHz).
‡/LPLWDGRUGHUXLGR$1/ $XGLR1RLVH/LPLWHU 
„,&$6 ă86 ‡Alerta auditiva de batería baja.
‡Canales de pronóstico del clima (VyOR,&$).
100 canales alfanuméricos, incluye batería BP-232H (Li-Ion, ‡3URJUDPDEOHSRU3&FRQFDEOH23&8\VRIWZDUH
2300 mAh), cargador lento BC-179, adaptador de corriente &6$
BC-174, clip MB-94 y antena FAB-02AR. ‡Cumple con norma IPX4 contra ambientes húmedos y lluvia
ligera.
'LPHQVLRQHV: 53 x 120 x 36.39 mm. ‡Cumple estándares militares MIL-STD-810.
3HVR: 350 g.
$FFHVRULRV
+DVWDDJRWDUH[LVWHQFLDV 23&8ă86Cable programador USB.
+0ă86Micrófono-Bocina.
9ă86Diadema Lightweight.

,&$$‡5REXVWRVFRQ([FHOHQWH&DOLGDGGH$XGLR
5 W PEP | Salida de Audio 500 mW | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía

5DQJRGH)UHFXHQFLD 5DQJRGH)UHFXHQFLD
&REHUWXUD Tx: 118.000 - 136.975 MHz &REHUWXUD Tx / Rx: 118.000 - 136.975 MHz
1DYHJDFLyQ925 Rx: 108.000 - 136.975 MHz &DQDO0HWHRUROyJLFR 161.650 - 163.275 MHz
&DQDO0HWHRUROyJLFR 161.650 - 163.275 MHz
„,&$ ă86
„,&$ă86 Igual al IC-A24 pero sin funciones de navegación (VOR).
Operación versátil. Cuenta con acceso a los últimos
10 canales mediante un par de teclas. ,QFOX\HIXQFLRQHVGH &DUDFWHUtVWLFDV
QDYHJDFLyQ925 las cuales muestran la desviación y el radial ‡5 W PEP (Potencia Envolvente de Pico).
del faro. ‡200 canales de memoria.
‡Botones y pantalla de gran tamaño.
&DUDFWHUtVWLFDV ‡6HOHFFLyQLQPHGLDWDGHFDQDOGHHPHUJHQFLD
‡5 W PEP (Potencia Envolvente de Pico). 0+]
‡200 canales de memoria. ‡Búsqueda de frecuencias y de memorias.
‡Resistente al agua (Norma IPX4). ‡,OXPLQDFLyQSDUDXVRQRFWXUQR
‡7HFODGHHPHUJHQFLD 0+]  ‡Robusto diseño resistente a la intemperie.
‡Explorador de canales. ‡3URJUDPDEOHSRUVRIWZDUH&6$
‡,OXPLQDFLyQSDUDXVRQRFWXUQR
‡Alerta de batería baja. ,QFOX\H: batería de alta capacidad BP-210N (Ni-MH,
‡3URJUDPDEOHSRUVRIWZDUH&6$ 1650 mAh), clip para cinturón MB-103, cargador estándar de 5$',26,&20
,QFOX\H: batería de alta capacidad BP-210N (Ni-MH, pared BC-110A y antena FA-B02AR.
1650 mAh), clip para cinturón MB-103, cargador estándar de
pared BC-110A y antena FA-B02AR, funda LC-159 y adaptador 'LPHQVLRQHV: 53 x 129.3 x 35.5 mm / 3HVR: 430 g.
para diadema OPC-499.
'LPHQVLRQHV: 54 x 129.3 x 35.5 mm / 3HVR: 430 g. 3UHJXQWHSRUGLVSRQLELOLGDG

$FFHVRULRV
)$%$5ă86 Antena ICOM para IC-A22 / 23 / 3 / 14 / 14S / 24 / 6. $'ă86 Adaptador Cup para batería BP232N para cargador BC119N01.
%3/ă86 Batería ICOM, Ni-Cd, 760 mAh para IC-A23/5. 9ă86 Diadema lightweight para IC-A14, IC-A14S, IC-A6 e IC-A24.
%&ă86 Cargador estándar de escritorio para IC-A14/S (req. BC-174). %&1ă86 Cargador de escritorio para IC-A6.
&3ă86 Adaptador vehicular para IC-A24 / A6. +0ă86 Micrófono-Bocina para IC-A24/ IC-A6.
&3ă86 Adaptador vehicular para IC-A14 / IC-A14S (req. BC-179). 9ă86 Diadema heavy- duty para IC-A14, IC-A6 e IC-A24.
23&ă86 Adaptador para diadema de audición para IC-A24 / A6. 9+1&9ă86 Diadema hurricane para IC-A14, IC-A6 e IC-A24.
%3+ă86 Batería Li-Ion 2300 mAh, para IC-A14/14S.
FCC (Federal Communications Commission Approved) Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Móviles Aéreos / Base Año 2016

,&$‡/R0HMRUHQ(TXLSR$pUHR 5DQJRGH)UHFXHQFLD
Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía Tx / Rx: 118.000 - 136.975 MHz

„,&$ă86 ‡Temporizador de transmisión (TOT).


‡)XQFLyQGHLQWHUFRPXQLFDGRU
Versión compatible en espacimiento de 25 kHz HQWUHHOSLORWR\HOFRSLORWR
y 8.33 kHz. UHTXLHUHGLDGHPDRSFLRQDO 
‡&DSDFLGDGGHFRQHFWDUDUHFHSWRUGH*36
&DUDFWHUtVWLFDV RSFLRQDO 
‡1XHYDSDQWDOOD2/('(Organic Light- Emitting ‡8 W portadora continua.
Diode) que permite una mejor visión de los ‡Alimentación: 12 ó 24 Vcd.
caracteres.
‡:3(3 3RWHQFLD(QYROYHQWHGH3LFR  $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
‡FDQDOHVGHPHPRULDUHJXODUHV
‡FDQDOHVGHPHPRULDGLYLGLGRVHQ0%ă86Kit de montaje para
JUXSRVGH IC-A200 / A210, incluye: bocina de 5 W (SP-5),
‡Scan de canales meteorológicos. micrófono HM-176, bracket de montaje y arnés.
‡Botón para acceso a canal de emergencia 636 ă86Kit para estación base.
(121.5 MHz). Incluye fuente de poder, gabinete (G051), micrófono
y bocina (QRLQFOX\HUDGLR).
18(92 'LPHQVLRQHV: 160 x 34 x 271 mm / 3HVR: 1 kg.
3UHJXQWHSRUGLVSRQLELOLGDG

,&$‡/LVWRSDUD$SOLFDFLRQHVGH$OWR1LYHO 5DQJRGH)UHFXHQFLD
25 W PEP | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía Tx / Rx: 118.000 - 136.975 MHz

„,&$ă86 „Incluye
,&$% ă86
Versión compatible en espacimiento de 25 kHz y fuente de poder PS80 para uso como
8.33 kHz. estación base. 3UHJXQWHSRUGLVSRQLELOLGDG
&DUDFWHUtVWLFDV ‡&DSDFLGDGGHFRQHFWDUDUHFHSWRUGH*36
IC-A210/25B ‡25 W PEP (Potencia Envolvente de Pico). RSFLRQDO 
‡8 W portadora continua. ‡Cumple normas militares MIL-STD-810.
‡FDQDOHVHQPHPRULD (distribuidos en 20 ‡Alimentación: 12 ó 24 Vcd.
bancos de 10 canales). ‡3URJUDPDEOHSRUVRIWZDUH&6$
‡3DQWDOODFRQPD\RUEULOORDOWDUHVROXFLyQ\
DMXVWHDXWRPiWLFRGHLQWHQVLGDG $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
‡Botón para acceso a canal de emergencia 0%ă86Kit de montaje para
(121.5 MHz). IC-A200 / A210, incluye: bocina de 5 W (SP-5),
‡Temporizador de transmisión (TOT). micrófono HM-176, bracket de montaje y arnés.
‡Función de intercomunicador entre el piloto y el
copiloto (requiere diadema opcional). 636 ă86Kit para estación base.
‡Explorador de canales (Scan). Incluye fuente de poder, gabinete (G051), micrófono
IC-A210/25 y bocina (QRLQFOX\HUDGLR).
'LPHQVLRQHV: 160 x 34 x 271 mm / 3HVR: 1 kg. 3UHJXQWHSRUGLVSRQLELOLGDG

,&$‡6~SHU&RPSDFWR\GH$OWD3RWHQFLD
5DQJRGH)UHFXHQFLD
36 W PEP | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía Tx / Rx: 118.000 - 136.975 MHz

„,&$ă86 „Incluye
,&$% ă86
,QFOX\H micrófono de mano HM-161, accesorios fuente de poder y gabinete para uso como
para instalar en unidad móvil, cable de alimentación estación base. 3UHJXQWHSRUGLVSRQLELOLGDG
y manual del usuario.

IC-A110/25 &DUDFWHUtVWLFDV
‡36 W PEP (Potencia Envolvente de Pico). ‡%RFLQDGH:PRQWDGDDOIUHQWH
‡9 W portadora continua. ‡3DQWDOOD/&'GHFODUDYLVXDOL]DFLyQHQ
IC-A110/25B FRQGLFLRQHVGHWHPSHUDWXUDH[WUHPD
‡20 canales de memoria programables.
‡Exploración de canales con doble prioridad. ‡Cumple con normas militares MIL-STD-810.
‡3DQWDOODDOIDQXPpULFDGHFDUDFWHUHVH ‡Alimentación: 12 ó 24 Vcd.
LOXPLQDFLyQDMXVWDEOH ‡3URJUDPDEOHSRUVRIWZDUH&6$
5$',26,&20

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
'LPHQVLRQHV: 150 x 50 x 180 mm / 3HVR: 1.5 kg. +0ă86Micrófono de mano.

.LWGH0RQWDMHSDUD,&$$
0%ă86Kit de montaje para IC-A200 / A210, incluye: bocina de 5 W (SP-5),
MB-53
micrófono HM-176, bracket de montaje y arnés
$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV  HM-176
+0ă86 Micrófono ICOM para IC-A200/A210 (req. SPS-80)
6(0 ă86 Micrófono SYSCOM para IC-A200 (No incluye radio)
6%5$ă86 Montaje SYSCOM para IC-A200/210
636 ă86 Kit para estación base. Incluye fuente de poder, gabinete (G051), SPS-80
micrófono y bocina (QRLQFOX\HUDGLR) SBRA-200 .LWGHHVWDFLyQEDVH
FCC (Federal Communications Commission Approved) 3UHJXQWHSRUGLVSRQLELOLGDG Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Marinos VHF

,&0'‡(O3ULPHU(TXLSR3RUWiWLOFRQ&DQFHODFLyQGH5XLGR\02%
5 W | Flota al Caer al Agua | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3;

5DQJRGH)UHFXHQFLD
&DUDFWHUtVWLFDV
Tx: 156.025 - 157.425 MHz ‡1XHYDWHFODGRGHRSHUDFLyQ
Rx: 156.050 - 163.275 MHz
‡*36LQWHUFRQVWUXLGR
‡PHPRULDVGHSXQWRGHUHIHUHQFLD
02% (hombre al agua). Esta función permite al equipo ‡Función de hombre al agua (0DQ2YHU%RDUG).
almacenar las coordenadas donde el equipo cayó al agua. ‡Función cancelación de ruido (Active Noise) elimina el ruido
del ambiente en un 90%.
‡Capacidad de llamada selectiva digital (DSC).
(QYtHVXSRVLFLyQH[DFWDHQ
*36 VLWXDFLyQGHHPHUJHQFLD
‡2SHUDFLyQ)ORDWQ)ODVK IORWDHPLWHOX]SRUPHGLR
GHXQ/('DOPRPHQWRGHFDHUDODJXD\XQVRQLGR
SHUPDQHQWH .
‡700 mW de potencia de audio.
„,&0' ă86 ‡Sumergible 1 m x 30 min (IPX7).
‡Función $TXD4XDNH que elimina residuos de agua de la
®

,QFOX\H batería BP-275, antena FA-SC59V, cargador bocina.


rápido BC-204, adaptador de corriente BC-147SA, cable de ‡3URJUDPDEOHSRUVRIWZDUH&60
encendedor CP-25, clip MB-109 y correa de mano.

'LPHQVLRQHV: 61.2 x 141.4 x 43.2 mm. $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 


3HVR: 318 g.
+0ă86Micrófono-Bocina sumergible
3UHJXQWHSRUGLVSRQLELOLGDG (Grado IPX7).
%3 ă86Batería Li-Ion de 1500 mAh.
%& ă86Cargador rápido.
)$6&9ă86Antena para banda marina.
3UHJXQWHSRUGLVSRQLELOLGDG

18(92

,&0‡3UiFWLFR\FRQ1XHYR'LVHxR3URIHVLRQDO
6 W | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3;

5DQJRGH)UHFXHQFLD
Tx: 156.025 - 157.425 MHz
Rx: 156.050 - 163.275 MHz

„,&0ă86 &DUDFWHUtVWLFDV
‡P:GHSRWHQFLDGHDXGLR
,QFOX\H batería BP-245N, antena FA-S64V, clip MB-103, ‡:GHSRWHQFLD
cargador rápido BC-210, cable de encendedor CP-25H y ‡Sumergible 1.5 m x 30 min (IPX8).
correa de mano. ‡Función de $TXD4XDNH  ®

‡Función de doble o triple monitoreo del canal 16


„,&0ă86 ‡Indicador de batería de 4 niveles.
‡)XQFLyQGHJUDEDGRUGHYR] JUDEDOD~OWLPDOODPDGD
,QFOX\H batería BP-245N, antena FA-S64V, clip MB-103, SRUPLQDXWRPiWLFD\RPDQXDOPHQWH 
cargador rápido BC-210, cable de encendedor CP-25H y ‡Función de cancelación de ruido.
correa de mano, FRQIXQFLyQGHFDQFHODFLyQGHUXLGR\ ‡3URJUDPDEOHSRUVRIWZDUH&60
JUDEDFLyQGHYR] 5$',26,&20
$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
'LPHQVLRQHV: 52.5 x 125 x 30 mm. +0ă86Micrófono-Bocina sumergible
3HVR: 320 g. (Grado IPX7).
%31ă86Batería Li-Ion de 1900 mAh.
%& ă86Cargador rápido para batería
BP-254N.
)$669ă86Antena para banda marina.

18(92

FCC (Federal Communications Commission Approved)


IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Marinos VHF Año 2016

,&0‡8Q%XHQ5DGLROH6DOYDOD9LGD ,&0‡/D0HMRU+HUUDPLHQWDHQHO0DU
5 W | Flota y Destella al Caer al Agua | Aprobado por la FCC 5 W | Flota y Destella al Caer al Agua | Aprobado por la FCC
Fabricado en Ambiente ISO 9001:2008 | 3 Años de Garantía Fabricado en Ambiente ISO 9001:2008 | 3 Años de Garantía
680(5*,%/(,3; 680(5*,%/(,3;
&DUDFWHUtVWLFDV &DUDFWHUtVWLFDV
‡$FFHVRDOFDQDOSRUXQDWHFOD ‡3RWHQFLDGHVDOLGDGHDXGLRGHP:
5DQJRGH)UHFXHQFLD ‡)XQFLyQ $TXD4XDNH . (OLPLQDUHVLGXRV
® 5DQJRGH)UHFXHQFLD ‡Sumergible IPX7 (1 m por 30 min).
Tx: 156.025 - 157.425 MHz GHDJXDGHODERFLQD Tx: 156.025 - 157.425 MHz ‡Indicador de 4 niveles para batería.
Rx: 156.050 - 163.275 MHz ‡Indicador de nivel de batería en 4 niveles. Rx: 156.050 - 163.275 MHz ‡Cambio al canal 16 de forma instantánea.
‡Función de autoescaneo. ‡Cuenta con función de monitor abierto.
‡Sumergible 1 m x 30 min (IPX7). 18(92 ‡Función de autoescaneo.
‡3URJUDPDEOHSRUVRIWZDUH&60 ‡Luz para display de forma automática.
UHT23&8\23&  ‡1XHYRFDUJDGRUSRUPHGLRGH86%
‡*UDQSDQWDOODGH/&' ‡Cuenta con un indicador LED rojo que destella al
momento de caer al agua.
$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV  ‡3DQWDOOD/&'GHPiVJUDQGHGHORQRUPDO
23&8ă86 Cable programador USB. ‡%DWHUtDGH/L,RQGHP$KSDUDXQD
23&ă86 Interfaz para OPC-478U. RSHUDFLyQGHKRUDV .
%3ă86 Batería Li-Ion
1500 mAh. $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
%&ă86 Multicargador para 6 %3ă86 Batería Li-Ion 1500 mAh.
baterías (req. AD-123 %&ă86 Multicargador para 6
para BP-266) baterías (req. AD-123 para
$'ă86 Cup para batería BP-266 BP-266)
)$6&9ă86 Antena para IC-M24/ $'ă86 Cup para batería BP-266
M34 )$6&9ă86 Antena para IC-M25
+0ă86 Micrófono sumergible para
(O,&0 ahora con su innovadora luz de IC-M25
LED roja destellante es fácil localizarlo si cae
al agua, de día o de noche ya que destella aun
estando apagado el radio. „,&0 ă86Gris metálico
„,&0 ă86Perla
„,&0ă86 „,&0 ă86Azul marino
,QFOX\H: batería (BP-266, Li-Ion, 1500 mAh),
,QFOX\H: batería (BP-266, Li-Ion, 1500 mAh), cargador de pared BC-217SA, antena FA-SC59V,
cargador de pared BC-199S, antena FA-SC58V clip MB-133 y correa de mano.
y clip MB-124. 'LPHQVLRQHV: 56.6 x 134.2 x 30.5 mm
'LPHQVLRQHV: 58.5 x 128.5 x 34.5 mm 3HVR: 220 g.
3HVR: 260 g.
FRORUHVGLIHUHQWHV 3UHJXQWHSRUGLVSRQLELOLGDG

,&0‡*UDQ&DOLGDGGH$XGLR
6 W | Flota al Caer al Agua | Fabricado en Ambiente ISO 9001:2008
Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3
5DQJRGH)UHFXHQFLD &DUDFWHUtVWLFDV
Tx: 156.025 - 157.425 MHz ‡0LFUyIRQRFRQFDQFHODFLyQGHUXLGR
Rx: 156.050 - 163.275 MHz ‡Bajo consumo de batería.
‡Indicador de nivel de batería en 4 niveles.
‡3URJUDPDEOHSRUVRIWZDUH&60 UHTFDEOH23&8\23& 
„,&0ă86 ‡Ahorrador de batería.
‡Función de monitoreo dual/tri.
,QFOX\H: batería BP-252 (Li-Ion, 980 mAh), ‡6XPHUJLEOHP[PLQ ,3 
‡Función automática de exploración.
5$',26,&20

cargador estándar BC-173, antena


FA-SC58V y clip MB-109. ‡$FFHVRLQVWDQWiQHRDOFDQDOy
'LPHQVLRQHV: 62 x 139.5 x 43 mm
3HVR: 295 g. $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
+0ă86 Micrófono-Bocina sumergible (Grado IPX7) para IC-M36.
23&8ă86 Cable programador USB.
23&ă86 Interfaz para OPC-478U.
)$6&9ă86 Antena para IC-M24/ M34

(O,&0 detecta y corrige la distorsión del audio, brindando una recepción óptima;
en ambientes ruidosos incrementa el nivel de volumen automáticamente.

FCC (Federal Communications Commission Approved)


IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Marinos VHF

,&0‡(O5DGLR0DULQR0iV3HTXHxR
5 W | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3;
5DQJRGH)UHFXHQFLD
Tx: 156.025 - 157.425 MHz
Rx: 156.050 - 163.275 MHz
%DQGD&RPHUFLDO
Tx / Rx: 146 -174 MHz
,175Ì16(&$0(17(6(*8529(56,Ð1',6321,%/(

„,&0 ă869HUVLyQ,QWUtQVHFDPHQWH6HJXUR
,QFOX\H: batería BP-227 (Li-Ion, 1700 mAh), cargador estándar de escritorio
BC-152, adaptador BC-147A, antena FA-S59V y clip MB-98.
'LPHQVLRQHV: 62 x 97 x 39 mm.
3HVR: 280 g.

&DUDFWHUtVWLFDV
‡2SHUDFLyQVLPSOH[\VHPLG~SOH[
‡Todos los canales marinos internacionales y acceso instantáneo al canal de emergencia.
‡FDQDOHVHQEDQGDFRPHUFLDOFRQWRQRV&7&66\'&6HQEDQGD0+]
‡3URJUDPDEOHSRUVRIWZDUH&60 UHT23& 
‡9HUVLyQLQWUtQVHFDPHQWHVHJXUR

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
+0ă86 Micrófono-Bocina sumergible.
23&ă86 Cable programador (compatibles con radio F50/60).
$'ă86 Cup para batería BP-227
%&ă86 Multicargador para 6 baterías (req. AD-123 para BP-266)

3UHJXQWHSRUGLVSRQLELOLGDG

,&*0‡,GHDOSDUD(PHUJHQFLD\5HVFDWH
2 W | Cumple GMDSS Global Maritime Distress Safety Sistem | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
3 Años de Garantía | 680(5*,%/(,3;

5DQJRGH)UHFXHQFLD
Tx / Rx: 156.300 - 156.875 MHz

„,&*0ă86
,QFOX\H: antena FA-S61V, batería BP-224 (Ni-Cd, 750 mAh), batería BP-234 (litio, 3,300 mAh, no recargable),
cargador estándar de escritorio BC-158, adaptador BC-147A y clip para cinto MB-103Y.
'LPHQVLRQHV: 65 x 145 x 44 mm.
3HVR: 385 g.

&XPSOHFRQUHJXODFLRQHV*0'66SDUDHPHUJHQFLDVHQHPEDUFDFLRQHV
,QFOX\HEDWHUtDGHHPHUJHQFLDGHOLWLRP$KQRUHFDUJDEOH

&DUDFWHUtVWLFDV 5$',26,&20
‡5HVLVWHQWHDFDPELRVEUXVFRVGHWHPSHUDWXUDYLEUDFLRQHV\FDtGDV
‡&DQDOHVPDULQRVGH9+)UHTXHULGRVSRU*0'66
‡Cambio al canal 16 con el toque de un botón.
‡Incluye 2 baterías.
‡100 canales en modo simplex sin tonos CTCSS y DCS .
‡3URJUDPDEOHSRUVRIWZDUH&6*0 UHT23&8\23& 

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
+0ă86 Micrófono bocina sumergible (Grado IPX7) para IC-GM1600.
23&8ă86 Cable programador USB.
23&ă86 Interfaz para OPC-478U.
%3ă86 Batería de Ni-Cd de 750 mAh.
%3ă86 Batería Li-Ion de 3,300 mAh (no recargable).
)$69ă86 Antena para IC-GM1600
FCC (Federal Communications Commission Approved)
IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Móviles Marinos VHF Año 2016

,&0‡5DGLR&RPSDFWRFRQ$PSOLD3DQWDOOD
25 W | Compatible con GPS | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3;
(Excepto cables)

(QYtHVXSRVLFLyQH[DFWDHQ 5DQJRGH)UHFXHQFLD
*36 VLWXDFLyQGHHPHUJHQFLD Tx: 156.025 - 157.425 MHz
Rx: 156.050 - 163.275 MHz

&DUDFWHUtVWLFDV
‡6HQVLELOLGDGVXSHULRUHQUHFHSFLyQ
‡&DUDFWHUtVWLFD)RUFH$XGLREULQGDH[FHOHQWHQLYHOGHDXGLRHOLPLQDHOUXLGRGH
IRQGRHQ7[\5[
‡Opción $TXD4XDNH . Elimina residuos de agua de la bocina.
®

‡&DSDFLGDGGHOODPDGDVHOHFWLYDGLJLWDO '6& LQWHUFRQVWUXLGDSDUDGLUHFFLRQHV


‡Rastreo de canal simple; agregue o borre canales con un solo botón.
‡Fácil selección de canales con teclas arriba/abajo.
‡Función de observación doble y triple para mejor monitoreo del canal 16 mientras se está
operando en otro.
‡Micrófono inteligente que permite realizar el cambio de potencia y canales.
‡ 22 canales en modo simplex y sin tono CTCSS y DCS.
‡3URJUDPDEOHSRUVRIWZDUH&60

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
*0'%ă86 Receptor / Antena GPS con 5 m de cable.
*8'%ă86 Receptor / Antena GPS con 5 m de cable.
+0%ă86 Micrófono negro
+06: ă86 Micrófono blanco.

3UHJXQWHSRUGLVSRQLELOLGDG
„Disponible
,&0;; ă86
en color blanco o negro, sufijo de acuerdo al color: 11 12

,QFOX\Hmicrófono HM-164B y cable de corriente OPC-891A y montaje.


'LPHQVLRQHV164 x 78 x 139.5 mm.
3HVR 1.06 kg.

,&0*‡)iFLOGH8VDU\0iV)iFLOGH(VFXFKDU
25 W | Compatible con GPS | DSC Clase D | Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3;
(Excepto cables)
(QYtHVXSRVLFLyQH[DFWDHQ 5DQJRGH)UHFXHQFLD
*36 VLWXDFLyQGHHPHUJHQFLD Tx: 156.025 - 157.425 MHz
Rx: 156.050 - 163.275 MHz

&RORU *36,QWHUFRQVWUXLGR
„ ,&0 ă86 Negro No
„ ,&0 ă86 Blanco No
„ ,&0* ă86 Negro Sí
IC-M424G „ ,&0* ă86 Blanco Sí
&DUDFWHUtVWLFDV
‡6DOLGDGHSRWHQFLDGH: ERFLQDH[WHUQD 
‡2SFLyQGH$TXD4XDNH HOLPLQDUHVLGXRVGHDJXDGHODERFLQD
®

‡Capacidad de llamada selectiva digital (DSC).


IC-M424 ‡Función de cancelación de ruido (reduce 90% de radio del ambiente).
‡&XPSOH1RUPD,3; PSRUPLQ
5$',26,&20

‡Función de vigilancia doble/triple para mejor monitoreo del canal 16.


‡,QWHUID]10($SDUDFRQH[LyQGHDQWHQD*36
‡1XHYDLQWHUID]GHFRQWUROSDUDIXQFLRQHV
‡3URJUDPDEOHSRUVRIWZDUH&60\FDEOH23&
„„,&0
,QFOX\H micrófono HM-196B/SW, cable OPC-891A y montaje
‡GPS interconstruido, envie su posición exacta (sólo modelo IC-M424G).
‡Pantalla de LCD de gran tamaño en color blanco (sólo modelo IC-M424G).
‡Incluye micrófono HM-205, cable de alimentación (sólo modelo IC-M424G).
„,&0*
„,QFOX\H micrófono HM-205B/SW, cable OPC-891A y montaje $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
'LPHQVLRQHV180 x 82 x 119.9 mm. +0% ă86 Micrófono Command MIC en color negro.
3HVR 1.2 kg. +06: ă86 Micrófono Command MIC en color blanco.
+0%ă86 Micrófono estándar en color negro para IC-M424/01.
+06:ă86 Micrófono estándar en color blanco para IC-M424/02.
+0%ă86 Micrófono estándar en color negro para IC-M424G.
FCC (Federal Communications Commission Approved) 3UHJXQWHSRUGLVSRQLELOLGDG
IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Móviles Marinos VHF

,&0*‡5DGLR0DULQRGH0i[LPR5HQGLPLHQWR
25 W | Compatible con GPS | Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3;
(Excepto cables)

(QYtHVXSRVLFLyQH[DFWDHQ
*36 VLWXDFLyQGHHPHUJHQFLD
5DQJRGH)UHFXHQFLD
Tx: 156.025 - 157.425 MHz
Rx: 156.050 - 163.275 MHz
&DUDFWHUtVWLFDV
‡*36LQWHUFRQVWUXLGR HQYtHVXSRVLFLyQH[DFWD
‡Nueva interfaz para administración de funciones.
‡Nuevo display de alta definición.
‡&XHQWDFRQLQWHUID]10($
‡Función AquaQuake®, elimina residuos de agua de la bocina.
‡Compatible con el sistema MarineComander™.
‡)XQFLyQGXDOWULZDWFKGHOFDQDORGHOODPDGD
‡3URJUDPDEOHSRUVRIWZDUH&60\FDEOH23&
&RORU *36,QWHUFRQVWUXLGR
„,&0ă86 Negro No
„,&0ă86 Blanco No
„,&0* ă86 Negro Sí
„,&0* ă86 Blanco Sí

18(92 $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 


+0%ă86 Micrófono para IC-M324/324G color negro.
,QFOX\H Cable de alimentación, micrófono de mano +06:ă86 Micrófono para IC-M324/324G color blanco.
HM-200B/SW, y bracket para montaje. 23&ă86 Interfaz para programación con adaptador USB.
'LPHQVLRQHV 180 x 80 x 119.9 mm
3HVR 1.2 kg.

,&0‡(O5DGLR0DULQR0iV&RPSOHWR
25 W | Compatible con GPS | DSC Clase D | Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3;
(Excepto cables)

(QYtHVXSRVLFLyQH[DFWDHQ
*36 VLWXDFLyQGHHPHUJHQFLD
5DQJRGH)UHFXHQFLD
Tx: 156.025 - 157.425 MHz
Rx: 156.050 - 163.275 MHz
&DUDFWHUtVWLFDV
‡Integra un receptor AIS.
‡)XQFLyQGHFDQFHODFLyQGHUXLGR UHGXFHXQGHUXLGRGHODPELHQWH 
‡Nuevo teclado intuitivo de mejor acceso.
‡)XQFLyQGHJUDEDGRUGHYR]GHPLQXWRV ~OWLPDOODPDGD 
‡Función de altavoz externo automático o manual.
‡/ODPDGDVVHOHFWLYDV'6&SDUDKDVWDGLUHFFLRQHV
‡Sumergible IPX8 (1.5 m por 30 min).
‡Incluye los canales de USA, Canadá, internacionales y meteorológicos.
‡Cuenta con la opción de llamadas privadas mediante tarjeta de encriptación UT-112.
‡Compatible con el sistema MarineCommander™.
‡)XQFLyQGHGUHQDMHGHDJXD $TXD4XDNH® 
‡3DQWDOODJUDQGHGH/&'GHPDWUL]GHSXQWRV
‡3URJUDPDEOHSRUVRIWZDUH&60FDEOH23&\23&

0LFUyIRQR NMEA2000 5HFHSWRU$,6 5$',26,&20


„ ,&0ă86 Frontal No incluido No integrado
„ ,&0ă86 Frontal Incluido No integrado

18(92 „ ,&0ă86 Frontal Incluido Integrado


„ ,&0ă86 Posterior Incluido No integrado
,QFOX\H micrófono HM-205B, cable de alimentación y bracket de montaje.
'LPHQVLRQHV 178.9 x 113.9 x 113.8 mm.
„ ,&0ă86 Posterior Incluido Integrado

3HVR 1.4 kg. $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 


+0% ă86 Micrófono Command MIl en color negro.
+06: ă86 Micrófono Command MIl en color blanco.
87 ă86 Tarjeta de encriptación opcional de 32 códigos.
23&ă86 Extensión de cable de 6 m para HM162.
23&ă86 Interfaz para programación con adaptador USB.
23&ă86 Interfaz para programación.
3UHJXQWHSRUGLVSRQLELOLGDG
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Móviles Marinos VHF Año 2016

,&0$‡5DGLR0DULQRGH$OWDV(VSHFLÀFDFLRQHV
25 W | Compatible con GPS | DSC Clase D | Fabricado en Ambiente ISO 9001:2008
Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3;
(Excepto cables)
(QYtHVXSRVLFLyQH[DFWDHQ
*36 VLWXDFLyQGHHPHUJHQFLD

5DQJRGH)UHFXHQFLD
Tx: 156.025 - 157.425 MHz
Rx: 156.050 - 163.275 MHz

&DUDFWHUtVWLFDV
‡(QFULSWRUGHYR]RSFLRQDO WDUMHWD87RSFLRQDO 
‡Doble y triple monitoreo de canal 16.
‡Memoria para 100 direcciones DSC.
‡ 70 canales en modo simplex y sin tono CTCSS y DCS.
‡3URJUDPDEOHSRUVRIWZDUH&60$ UHT23&8\23& .
‡Incluye todos los canales marinos internacionales.
‡*UDQSDQWDOODGHPDWUL]GHSXQWRVFRQQLYHOHVGHDMXVWH
‡Incluye amplificador de 30 W para conexión de altavoz externo (no incluido).
‡)XQFLyQ$TXD4XDNH SDUDHOLPLQDUUHVLGXRVGHDJXDGHODERFLQD
®

‡Monitoreo automático de canal 70.


Micrófono ‡Conexión frontal y trasera para conectar micrófono opcional (hasta 2 micrófonos
HM-162B COMMAND MICIII).
‡Cuenta con puerto para tarjeta UT-112 de 32 códigos de encriptación.
‡Puerto NMEA.

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV
5DGLR*DODUGRQDGRSRUOD10($
(National Marine Electronics Association) Micrófono opcional con capacidad de operar a distancia todas las funciones del IC-M504,
pantalla LCD de matriz de puntos, bocina mejorada para una mejor calidad de audio.
+0% ă86 Micrófono en color negro.
„,&0$ ă86 +06: ă86 Micrófono en color blanco.
+06:ă86 Micrófono color blanco IC-M604, IC-M504.
,QFOX\H: micrófono HM-126B, cable de corriente (OPC-1174) y montaje. +05%ă86 Micrófono bocina color negro.
'LPHQVLRQHV220 x 110 x 109 mm. 23&ă86 Cable de extensión de 6 m para HM-162.
3HVR: 1.41 kg. 87ă86 Tarjeta de encriptación opcional para IC-M604.
*0'%ă86 Receptor / Antena GPS con 5 m de cable.
3UHJXQWHSRUGLVSRQLELOLGDG *8'%ă86 Receptor / Antena GPS con 5 m de cable.
23&8ă86 Cable programador USB.
23&ă86 Interfaz para OPC-478U.

,&0%%‡5DGLR9+)&RPSDFWRGH*UDQ&DOLGDG
25 W | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía | 680(5*,%/(,3;
(Excepto cables)

5DQJRGH)UHFXHQFLD
Tx: 156.025 - 157.425 MHz
Rx: 156.050 - 163.275 MHz

&DUDFWHUtVWLFDV
‡Tecnología de reducción del ruido.
‡3RWHQFLDGHVDOLGDGHDXGLRGH:
‡Llamada de emergencia por (DSC).
‡,QWHUID]FRP~Q10($ SDUDFRQH[LyQ*36 
5$',26,&20

‡Llamada AIS con el MA-500TR.


‡&RPSDWLEOHFRQ0DULQH&RPPDQGHUŒ
‡Función de drenaje de agua $TXD4XDNH . ®

‡6XPHUJLEOH,3; P[PLQ 
‡Monitoreo de canales dual/tri-watch 16 y/o canal de llamada.
‡Escaneo normal y prioritario.

„,&0%% ă86 $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 


,QFOX\H: HM195B y cable de alimentación. 23&ă86 Cable de extensión de 6 m para HM-162.
'LPHQVLRQHVGHOUDGLR216 x 79 x 125 mm. 3HVR: 830 g. +0% ă86 Micrófono Command MIC en color negro.
'LPHQVLRQHVGHOPLFUyIRQR67.5 x 144.5 x 37 mm. 3HVR: 400 g. +06: ă86 Micrófono Command MIC en color blanco.

3UHJXQWHSRUGLVSRQLELOLGDG

FCC (Federal Communications Commission Approved)


IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Móviles Marinos VHF y HF

80‡5DGLR0yYLO0DULQR9+)
25 W | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 3 Años de Garantía
5DQJRGH)UHFXHQFLD
Tx: 156.025 - 157.425 MHz
Rx: 156.050 - 163.275 MHz

„Radio
80ă86
móvil marino VHF, color blanco

„Radio móvil marino VHF, color negro


80%.ă86

'LPHQVLRQHV66 x 162 x 128 mm / 3HVR1 kg.


&DUDFWHUtVWLFDV
‡3DQWDOOD/&'\ERWRQHVJUDQGHV
‡Función de observación triple para mejorar el monitoreo de canal.
3UHJXQWHSRUGLVSRQLELOLGDG ‡&RPSDWLEOHFRQ*36
‡DSC Clase D .

,&0‡5DGLR+)&RPSDFWRGH*UDQ&DOLGDG
150 W | 1355 Canales | Fabricado en Ambiente ISO 9001:2008 | 2 Años de Garantía
5DQJRGH)UHFXHQFLD

HF 5[
0.5 - 29.999 MHz 1.6 - 2.9999 MHz
7[
4.0 - 4.9999 MHz 6.0 - 6.9999 MHz
8.0 - 8.9999 MHz 12.0 - 13.9999 MHz 16.0 - 17.9999 MHz
18.0 - 19.9999 MHz 22.0 - 22.9999 MHz 25.0 - 27.5000 MHz
‡0RGRVGHRSHUDFLyQ66%$0 VyOR5[ &:)6.$)6.577\
‡1355 canales ITU (160 programables por usuario).
‡Cabezal remoto de dimensiones estándar 4 x 8” (10.16 x 20.32 cm).
‡Construido en chasís de aluminio fundido y con ventilador de gran tamaño.
‡*UDQSDQWDOOD/&'DOIDQXPpULFDGHIiFLOOHFWXUDFRQQLYHOHVGHLOXPLQDFLyQ
‡Puerto para aplicaciones de GPS (NMEA 0183).
(/0(-255$',20$5,12+)
‡Llamadas DSC (ITU Clase “E”).
&21/2Ô/7,02(17(&12/2*Ì$'63<'6&
‡3URJUDPDEOHSRUVRIWZDUH&60\FDEOH23&
18(92
$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
23&1ă86 Cable de extensión de 10 m para AT-140.
„,&0ă86 $7ă86 Sintonizador automático de antena con cable de control
integrado. Cobertura 1.6-30 MHz.
,QFOX\H: cable remoto OPC-1106, control remoto RC-25 micrófono HM-135,
bocina externa SP-24, montaje y cable de alimentación OPC-1107A. $7ă86 Sintonizador automático de antena. Cobertura 1.6 - 30 MHz.
'LPHQVLRQHVGHOUDGLR: 240 x 94 x 238.4 mm / 3HVR: 4.7 kg. +0 ă86 Micrófono de mano para IC-M802.
'LPHQVLRQHVGHOFDEH]DO: 220 x 110 x 84.4 mm / 3HVR: 570 g. $+ ă86 Antena base tipo dipolo HF 1.9 - 30 MHz
23&$ă86 Cable de alimentación para IC-M802.
3UHJXQWHSRUGLVSRQLELOLGDG

,&0352‡&RPXQLFDFLyQD/DUJD'LVWDQFLDGH)RUPD6HQFLOOD
150 W PEP en 1.6 - 2.9999 MHz, 60 W PEP en 24.0 - 27.5000 MHz | 150 Canales | Fabricado en Ambiente ISO 9001:2008 | 2 Años de Garantía
5DQJRGH)UHFXHQFLD
HF 5[ 7[
0.5 - 29.999 MHz 1.6 - 2.9999 MHz 4.0 - 4.9999 MHz 18.0 6.0 - 6.9999 MHz
8.0 - 8.9999 MHz 12.0 - 13.9999 MHz 16.0 - 17.9999 MHz
18.0 - 19.9999 MHz 22.0 - 22.9999 MHz 25.0 - 27.5000 MHz 5$',26,&20
‡0RGRVGHRSHUDFLyQ86%$0 VyOR5[ &:)6.$)6..
‡150 canales (3 grupos de 50 canales cada uno).
‡Cabezal remoto de dimensiones estándar 4 x 8” (10.16 x 20.32 cm).
‡ :3(3 3RWHQFLD(QYROYHQWHGH3LFRLQIHULRUD0+] \: VXSHULRUD0+]).
‡Cobertura general de recepción de banda ancha: 0.5 a 29.9999 MHz
‡Pantalla grande y de fácil lectura
‡Potente escaneo de memoria
18(92 ‡3HULOODGHFDQDOIUHFXHQFLDTXHSHUPLWHDOXVXDULRVLQWRQL]DUIUHFXHQFLDV
HVSHFtILFDVDOUHGHGRUGHOFDQDOGHPHPRULD
„,&0352 ă86 $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
,QFOX\H: micrófono de mano HM-180, gancho para micrófono, cable de $7ă86 Sintonizador automático de antena con cable de control integrado.
alimentación OPC-568 y fusibles. Cobertura 1.6-30 MHz.
'LPHQVLRQHVGHOUDGLR: 291.4 x 116.4 x 315 mm. 3HVR: 7.9 kg. $7ă86 Sintonizador automático de antena. Cobertura 1.6 - 30 MHz.
$+ ă86 Antena base dipolo ICOM P/HF1.9-30 MHz.
FCC (Federal Communications Commission Approved) +0ă86 Micrófono resitente a la lluvia y humedad (IP-X7).
IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. 3UHJXQWHSRUGLVSRQLELOLGDG Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Sistema de Navegación Marina Año 2016

0DULQH&RPPDQGHUŒ
El MarineCommander™ es un sistema de navegación marina de ICOM que puede integrar
diferentes módulos marinos como fish finder, radar, AIS (Sistema Automático de Identificación),
GPS y radio VHF en la pantalla.

Este sistema ofrece una interfaz gráfica de usuario sencilla e intuitiva con botones de operación
mínimos y mando rotatorio. La disposición de la pantalla puede ser dividida hasta en 4 pantallas
y personalizar fácilmente la disposición con una simple operación.

El MarineCommander™ tiene la capacidad de ser conectado a un radio ICOM marino VHF y


generar varios tipos de llamadas DSC, incluyendo solicitud individual, grupal, todo barco y la
posición de GPS; todo esto se puede iniciar desde este sistema de navegación. Los mensajes
recibidos DSC e información de posición GPS se pueden mostrar en la pantalla. Al conectar
2 MarineCommander™ a través de un cable de datos, permite utilizar hasta 4 pantallas para
compartir diferente información y además, permite la conexión de hasta 4 cámaras de video
para monitoreo de la misma embarcación.

0;3 Módulo MarineCommander™ (req. MXD-5000/01).


0;' Pantalla multifuncional para MXP-5000/01.
MXP-5000 3URGXFWRVREUHSHGLGR
MXD-5000

0yGXORV2SFLRQDOHVSDUD0DULQH&RPPDQGHUŒ
5DGDUPDULQR0;570;5
MXR-5000T El radar MXR-5000R / T marino proporciona la discriminación objetivo claro. Waypoint (coordenadas para ubicar puntos de referencia) y AIS (Sistema
Automático de Identificación) pueden ser superpuestos en la pantalla del radar.

El radar marino ayuda a evitar colisiones y aumenta su seguridad en el mar. Las imágenes de radar pueden ser superpuestos en la pantalla del trazador
MXR-5000R
en la misma escala y ayuda a detectar objetos peligrosos, cuenta con una función la cual le permite dibujar hasta 10 blancos y el radar continúa el
seguimiento de los blancos de forma automática.

0;57  Radar marino tipo matriz abierta de 4 kW y alcance de 48 NM


0;55  Radar marino tipo domo de 4 kW y alcance de 36 NM.

)LVK)LQGHU0;)
Cuando un módulo buscador de peces está conectado, el sistema MarineCommander™ puede tener una función de frecuencia de sonda dual.
EX-3193
Usando el modo de 50 kHz/200 kHz de doble frecuencia, el MarineCommander™ mejora la separación y ayuda en la detección de los peces. Cuando se
utiliza con el módulo de sonda de pesca, el MarineCommander™ memoriza la información del waypoint (coordenadas para ubicar puntos de referencia)
EX-3194 con la profundidad y la temperatura.
MXF-5000

0;) Fish Finder (req. transductor).


EX-3195
(; Transductor tipo popa de 600 kW, incorporado en barco con sensores de temperatura.
(; Transductor tipo casco de 600 kW, incorporado en barco con sensores de temperatura.
(; Transductor tipo casco de 1 kW, incorporado en los sensores de temperatura.
5$',26,&20

$,60$750;$
AIS (Sistema Automático de Identificación) recibe información en tiempo real del tráfico marítimo emitido por embarcaciones AIS equipadas con
equipo similar. Si utiliza el MA-500TR o MXA 5000, los datos AIS pueden ser superpuestos en la pantalla del radar.

0$75.,7 Radio AIS. Incluye MA-500TR y MXG-5000/02.


MA-500TR MXA-5000 0;$ Receptor AIS (Sistema Automático de Identificación).

GPS: MXG-5000
5HFHSWRU*360;*
El MXG-5000 es un receptor GPS de 12 canales con WAAS, (Wide Area Augmentation System) EGNOS (European Geostationary Navigation Overlay
Service) y MSAS (Multi-functional Satellite Augmentation System).
Ofrece información sobre la posición exacta y cumple con IPX6 resistencia de alta presión de chorro de agua.
0;* Receptor GPS.

3URGXFWRVREUHSHGLGR Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 5DGLRV3RUWiWLOHV'67$5SDUD$ÀFLRQDGRV

,&$'‡5DGLR3RUWiWLO'REOH%DQGD
5 W | 1052 Canales | Fabricado en Ambiente ISO 9001:2008 | 2 Años de Garantía

5DQJRGH)UHFXHQFLD
D-STAR
D-STA 5[ 7[
144-148 MHz
0.495 - 999.999 MHz
430-440 MHz

„,&$' ă86
,QFOX\H: batería BP-217, cargador de pared BC-167, antena FA-S270C y clip MB-107.
'LPHQVLRQHV58.4 x 103 x 34.2 mm.
3HVR: 290 g.
&DUDFWHUtVWLFDV
‡'REOHEDQGDFRQPXWDEOH9+)8+)
‡Receptor de banda ancha (0.495-999.99 MHz).
‡)XQFLyQGHHVFDQHRP~OWLSOH
‡Codificador y decodificador CTCSS/DCS.
‡*36RSFLRQDOFRQPLFUyIRQR+0*36
‡Teclado de navegación.
‡Función de monitor.
‡Permite escuchar una señal débil.
‡Recepción de canal meteorológico.
‡4 niveles de potencia (5 W, 2.5 W, 0.5 W, 0.1 W).
‡Construcción resistente, equivalente IPX4.

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
+0ă86 Micrófono.
+0*36 ă86 Micrófono.
)$6&ă86 Antena VHF/UHF
%3ă86 Batería Li-Ion 7.4 V 1500 mAh.
3UHJXQWHSRUGLVSRQLELOLGDG

,&$'‡5DGLRGH&RQVWUXFFLyQ5HVLVWHQWH\6XPHUJLEOH
5 W | 1304 Canales | Fabricado en Ambiente ISO 9001:2008 | 2 Años de Garantía | 680(5*,%/(,3;
5DQJRGH)UHFXHQFLD
D-STAR
D-STA
-STA 5[
VFO A: 0.495 - 999.990 MHz
7[
Tx: 144-148 MHz, 420-450 MHz
VFO B: 118-174 MHz, 350-470 MHz

„,&$' ă86
,QFOX\H: batería BP-256, cargador de pared BC-167, antena FA-S270C y clip MB-111.
'LPHQVLRQHV59 x 112 x 34.2 mm.
3HVR: 325 g.
&DUDFWHUtVWLFDV
‡3URWHFFLyQUHIRU]DGDVXPHUJLEOHHTXLYDOHQWH,3;
‡*36FRQPLFUyIRQR+0*36
‡Receptor de banda ancha.
‡,QGLFDGRUGHEDQGDVLPSOH
‡Función de grabador de voz. 5$',26,&20
‡Gran pantalla de matriz de puntos.
‡Navegación con el teclado.
‡10 canales de memoria DTMF (16 dígitos)
‡Codificador y decodificador de tonos.
‡EDQFRVGHPHPRULDFRQHVFDQHRGHEDQFRV
‡Atenuador incorporado de 10 dB.
‡Canal meteorológico.

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
+0*36 ă86 Micrófono/GPS.
+6 ă86 Diadema.
/& ă86 Funda para transporte.
%3 ă86 Batería Li-Ion, 1620 mAh.
23& ă86 Cable adaptador para diademas HS-94, HS-95 y HS-97.
3UHJXQWHSRUGLVSRQLELOLGDG
IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
5DGLRV0yYLOHV'67$5SDUD$ÀFLRQDGRV Año 2016

,'+‡(O0HMRU&RPSDxHUR0yYLO'REOH%DQGD
50 W | 1052 Canales | Fabricado en Ambiente ISO 9001:2008 | 2 Años de Garantía

5DQJRGH)UHFXHQFLD
D-STAR 5[
118-173.995 MHz
7[
144-148 MHz
230-549.995 MHz 430-450 MHz
810 - 999.990 MHz
&DUDFWHUtVWLFDV
‡'REOHEDQGDFRQPXWDEOH9+)8+)
‡Receptor de banda ancha (118- 999.99 MHz).
‡)XQFLyQGHHVFDQHRP~OWLSOH
‡ Codificador y decodificador CTCSS/DCS incorporado.
‡FDQDOHVGHPHPRULD'70)
‡Teclado de navegación.
‡Función de monitor.
‡Permite escuchar una señal débil.
‡6RIWZDUHGHSURJUDPDFLyQ&6\FDEOH23&
‡Construcción resistente, equivalente IPX4.
Producto sobre pedido
$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
„,'+ă86 23&ă86 Cable de programación.
23& ă86 Cable de alimentación.
,QFOX\H: micrófono HM-133, cable separador OPC-1154A,
cable de corriente OPC-1132, bracket. 63ă86 Altavoz externo
'LPHQVLRQHV150 x 40 x 199.2 mm. +0 ă86 Micrófono de mano.
3HVR: 1.3 kg. 23& ă86 Cable de extensión para altavoz.
+0ă86 Micrófono con teclado DTMF.

3UHJXQWHSRUGLVSRQLELOLGDG

,&+‡5HFHSWRUGH%DQGD$QFKDGH*UDQ&DSDFLGDG
50 W | 522 Canales | Fabricado en Ambiente ISO 9001:2008 | 2 Años de Garantía

5DQJRGH)UHFXHQFLD
D-STAR 5[
L: 118 - 549.995 MHz
7[
144 - 148 MHz
R:118 - 173.995 MHz 430 - 450 MHz
R: 375 - 549.995 MHz
R: 810 - 999.99 MHz
L: Recepción del lado izquierdo.
R: Recepción del lado derecho.

&DUDFWHUtVWLFDV
‡&XHQWDFRQUHFHSWRUGHGREOHUHFHSFLyQORTXHOHSHUPLWHUHFLELUEDQGDV
VLPXOWiQHDPHQWH
‡Indicador de banda en display.
‡Color de fondo de pantalla variable de verde a ámbar.
‡Capacidad de escaneo de alta velocidad máximo 45 canales / seg.
Producto sobre pedido ‡$WHQXDGRUDXWRPiWLFR
‡Función de silencio automático en la sub-banda.
‡16 canales de memoria DTMF (24 dígitos).
5$',26,&20

„,&+ ă86 ‡Apagado automático.


‡Capacidad de localización vía GPS (requiere tarjeta UT-123).
,QFOX\H: micrófono HM-133, cable OPC-1132A, fusible de repuesto, ‡*UDEDGRUGHYR]LQFRUSRUDGRKDVWDVHJ
cable OPC-1712, bracket.
$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
'LPHQVLRQHV150 x 40 x 187.7 mm.
3HVR: 1.5 kg. 87ă86 Unidad digital / GPS.
23&ă86 Cable para clonación.
3UHJXQWHSRUGLVSRQLELOLGDG 63ă86 Altavoz externo
+0 ă86 Micrófono de mano.
23&$ă86 Cable de alimentación.
3UHJXQWHSRUGLVSRQLELOLGDG

Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Repetidores D-STAR

,'5399 D-STAR
D-STAR (Tecnologías Digitales Inteligentes para Radios Amateurs) | Fabricado en Ambiente ISO 9001:2008 | 2 Años de Garantía

)UHFXHQFLDV 3RWHQFLD
,'539 ă86 144-148 MHz 23W (alta) 2W (baja)
,'539 ă86 440-450 MHz 30W (alta) 3W (baja)
'LPHQVLRQHV: 483 x 88 x 428 mm.
3HVR: 7.5 kg.

3URGXFWRVREUHSHGLGR

/DWHFQRORJtD'67$5HVWiHQFDPLQDGDSDUDUDGLRDILFLRQDGRV\SHUPLWHODVVLJXLHQWHVDSOLFDFLRQHV

,'539 9+)
Este repetidor de voz digital VHF abre el camino para utilizar el sistema repetidor D-STAR en la „ *+] 'DWRV
,'53' ă86
popular banda de 2 m con el ID-800H, IC-91AD y otros radios compatibles con D-STAR. Además
ofrece operación en banda cruzada con las bandas de 144/440/1200 MHz.

,'539 8+) Una de las funciones más poderosas de D-STAR es la capacidad de mover datos.
El RP4000V es un repetidor de voz digital de UHF que utiliza un sistema repetidor D-STAR en El ID-RP2D ofrece un punto de acceso con una velocidad de datos de 128 kbps.
bandas de 70 cm. Además ofrece operaciones de banda cruzada con bandas de Dependiendo de la configuración del sistema, los 128 kbps son perfectos para configurar un
144/440/1200 MHz. correo electrónico y/o servidor de archivos para soporte de EmComm (comunicaciones de
emergencia). Es perfecto para conectarse a la internet y ejecutar aplicaciones o soporte web. 5$',26,&20

„,'53& ă86 Ya sea que utilice los 128 kbps para correo electrónico o para servidores de archivos, conectarse
a una fuente de internet a través de un enrutador le dará la capacidad de verificar el radar del
Servicio Meteorológico Nacional o del Centro Nacional de Huracanes.

Con la capacidad de manejar hasta 4 módulos de RF, el controlador de repetidores ID-RP2C es „ *+] 9R]
,'539 ă86
la piedra fundamental del sistema repetidor D-STAR.

Esto incluye operación básica en la banda, así como operación en banda cruzada entre
cualquiera de los 4 módulos de voz digital de RF. Además del control básico de los módulos de
RF, el RP2C también ofrece capacidades de enlace a través de internet y los futuros productos ¡Finalmente ya está disponible comercialmente un repetidor de banda cruzada legal! con
de red troncal de 10 GHz. adecuada programación de distintivo de llamada en cualquier móvil o portátil compatible con
D-STAR, los repetidores D-STAR de ICOM enrutarán automáticamente su señal hacia cualquier
3URGXFWRVREUHSHGLGR otro módulo de RF conectado a un RP2 común. Con sencillos comandos de repetidor, usted
puede dirigir sus comunicaciones a través de cualquiera de los módulos de RF.
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
5DGLRV3RUWiWLOHVSDUD$ÀFLRQDGRV Año 2016

,&9‡5DGLR9+)GH&RQVWUXFFLyQ5REXVWD ,&7$‡5DGLR)0'REOH%DQGD
5.5 W | Fabricado en Ambiente ISO 9001:2008 | 1 Año de Garantía 5 W | Fabricado en Ambiente ISO 9001:2008 | 1 Año de Garantía
5DQJRGH)UHFXHQFLD 5DQJRGH)UHFXHQFLD
Tx: 144-148 MHz Tx: 144-148 MHz Tx: 420-450 MHz
Rx: 136-174 MHz Rx: 136-174 MHz Rx: 400-479 MHz

„,&9ă86 „,&7$ă86
,QFOX\H: antena FA-B2E, batería (BP-264, Ni-MH, 1400 mAh), cargador estándar ,QFOX\H: batería BP-264 (1400 mAh, Ni-MH), cargador de pared BC-123SA,
de escritorio (BC-192), eliminador (BC-147S) y clip (MB-124) antena FA-S270C y clip MB-124
'LPHQVLRQHV58 x 122 x 30 mm 'LPHQVLRQHV58 x 111 x 30 mm
3HVR: 360 g con batería BP-264 y antena. 3HVR: 380 g con batería BP-264 y antena.

&DUDFWHUtVWLFDV &DUDFWHUtVWLFDV
‡&RQVWUXFFLyQUREXVWDSDQHOIURQWDOGHSROLFDUERQDWR\FKDVtVGHDOXPLQLR ‡302 canales de memoria.
WURTXHODGR ‡92; UHT23&\+6\R+6 
‡92; UHT23&\+6+6\+6  ‡P:GHDXGLR
‡Teclado de 16 botones con una gran cantidad de funciones de fácil acceso. ‡Codificación y decodificación de tonos CTCSS y DCS.
‡3DQWDOODDOIDQXPpULFDGHFDUDFWHUHVFRQLOXPLQDFLyQ ‡Exploración de canales (Scan).
‡FDQDOHVGHPHPRULD ‡Temporizador de transmisión (TOT).
‡Codificación y decodificación de tonos CTCSS y DCS. ‡Candado de canal ocupado.
‡5DVWUHDGRU 6FDQ GHDOWDYHORFLGDG ‡PHPRULDV'70)
‡Excelente sensibilidad (0.14 μV a 12 dB SINAD). ‡Teclado de 16 botones.
‡Candado de canal ocupado.
‡Temporizador de transmisión (TOT).

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
5$',26,&20

+0ă86 Micrófono-Bocina para IC-T70A


%3ă86 Batería ICOM, Li-Ion, 1900 mAh, para IC-V80/ T70A
:%3ă86 Batería W&W, Ni-Cd, 1200 mAh para IC-T2H
%&ă86 Cargador rápido para BP-264. Incluye BC-123SA
%&ă86 Cargador estándar para BP-264. Incluye BC-147S
%&ă86 Cargador rápido de escritorio para batería BP-265
+6ă86 Micrófono-Audífono
+6ă86 Diadema - Micrófono-Audífono
+6ă86 Micrófono de garganta.
%&ă86 Cargador para IC-T90A
BC-145 BC-193 %&6$ă86 Cargador estándar de pared para IC-T70A/F3/F3S/F4/F4S
BP-265
%3ă86 Batería ICOM para IC-T70A / IC-V80
623&30ă86 Cable de programación SYSCOM para IC-T2H
23&ă86 Adaptador para accesorios HS-94 y HS-95
Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 5DGLRV0yYLOHVSDUD$ÀFLRQDGRV

,&9‡5DGLR)0GH$OWD3RWHQFLD
75 W - El Más Poderoso en su Clase | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 1 Año de Garantía
5DQJRGH)UHFXHQFLD
Tx: 144-148 MHz
Rx: 136-174 MHz

&DUDFWHUtVWLFDV
‡Fácil de usar: pantalla de 6 caracteres alfanuméricos que ofrece una referencia rápida de
canal activo.
‡%RFLQDIURQWDOTXHSURYHHXQDXGLRPX\FODUR
‡3DQWDOODGHGREOHFRORU
‡Tonos CTCSS y DCS.
‡Construcción robusta y durable de una sola pieza, con chasís de aluminio y ventilador
integrado que ayudan a disipar el calor.
‡PHPRULDVDOIDQXPpULFDV
‡3URJUDPDEOHSRUVRIWZDUH&69 UHT23&8 
‡([SORUDGRU 6FDQ GLQiPLFRGHPHPRULDV

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
23&8ă86 Cable programador USB.
23&ă86 Cable programador entre radios.
„ ,&9 ă86 23&$ă86 Cable de alimentación.
,QFOX\H: micrófono de mano (HM-133V), cable de corriente (OPC-346) y bracket para montaje. +0ă86 Micrófono de mano.
'LPHQVLRQHV150 x 50 x 150 mm.
3HVR: 1.09 kg.

3UHJXQWHSRUGLVSRQLELOLGDG

,&+‡3RWHQWH5DGLR9+)
65 W | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 1 Año de Garantía

5DQJRGH)UHFXHQFLD
Tx: 144-148 MHz
Rx: 136-174 MHz

&DUDFWHUtVWLFDV
‡4.5 W de potencia de audio.
‡Función de apagado automático.
‡Pantalla con iluminaciónWW de color verde o ámbar, seleccionable.
‡'HFRGLILFDWRQRV&7&66\'&6
‡207 memorias.
‡3URJUDPDEOHSRUVRIWZDUH&6+ UHT23& 
‡Cuenta con especificaciones MIL-STD810.
‡Función de DTMF autodial.
‡Scan de funciones múltiples (permite escanear bancos de memoria seleccionados).

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
23&8ă86 Cable programador USB.
23&ă86 Cable programador entre radios.
23&$ă86 Cable de alimentación. 5$',26,&20
+0ă86 Micrófono de mano.
18(92

„,&+ă86
,QFOX\H: micrófono (HM-133V), cable de alimentación (OPC-1132) y montaje.
'LPHQVLRQHV140 x 40 x 162 mm.
3HVR: 1.1 kg.

FCC (Federal Communications Commission Approved) Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
5DGLRV0yYLOHV+)SDUD$ÀFLRQDGRV Año 2016

,&‡5DGLR3RWHQWH5REXVWR\&RQÀDEOH
100 W (SSB, CW, RTTY) | 40 W (AM) | 99 Canales | 1 Año de Garantía

5DQJRGH)UHFXHQFLD Para usos comerciales e industriales, diseñado en forma compacta, fabricado en aluminio
troquelado con un gran disipador de calor para amplios ciclos de trabajo. Además puede ser
Tx: 1.600 - 29.999999 MHz instalado en cualquier vehículo para operación móvil.
Rx: 0.030 - 29.999999 MHz Operación simple y con una gran pantalla (8 caracteres) que permite leerlo fácilmente, incluso
mientras conduce.

HF 0RGRVGHRSHUDFLyQ86%/6%&:577\ )6. $0

&DUDFWHUtVWLFDV
‡$ODUPDGHWRQRVLQWHUFRQVWUXLGD
‡Fácil acceso a canales a través del teclado de 10 botones.
‡Bocina al frente del operador.
‡6FDQSDUDE~VTXHGDVHFXHQFLDOGHFDQDOHVSURJUDPDGRV
‡Eliminador de ruido que reduce la interferencia pulsante, como la ignición de los vehículos.
‡&RPSUHVRULQWHJUDGRTXHDXPHQWDODSRWHQFLDSURPHGLRDOWUDQVPLWLU
‡Alimentación de 13.8 Vcd.

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
$7ă86 Sintonizador automático de antena. Cobertura 1.6-30 MHz.
$7ă86 Sintonizador automático de antena con cable de control
integrado. Cobertura 1.6-30 MHz
$+ă86 Sintonizador automático de antena HF + 50 MHz.
$+ ă86 Antena base dipolo ICOM P/HF1.9-30 MHz.
23&1ă86 Cable de extensión para AT-140 (10 m).
23&$ă86 Cable de alimentación para IC-78.
63 ă86 %RFLQDH[WHUQDŸ:
„,&ă86 +0 ă86
60%ă86
Micrófono de mano para IC-78.
Bracket para IC-78.
,QFOX\H: micrófono HM-36 y cable de corriente OPC-025A. 3UHJXQWHSRUGLVSRQLELOLGDG
'LPHQVLRQHV240 x 95 x 239 mm.
3HVR: 3.8 kg.

$QWHQDV+)
5$',26,&20

5-BTV ABLU-58 390 393 AH-710

%79ă86 Antena (Hustler) HF, con conector UHF Hembra, bandas 80, 75, 40, 20, 15, 10, potencia 1000 W.
$%/8ă86 Antena (SYSCOM) HF, con conector UHF Macho, rango de frecuencia 2-30 MHz (cortada a la frecuencia solicitada, potencia 300W).
ă86 Antena (Shakespeare) HF, rango de frecuencia 2-30 MHz, potencia 1000 W (req. sintonizador o acoplador de antena).
ă86 Antena (Shakespeare) HF, rango de frecuencia 2-30 MHz, potencia 1000 W (req. sintonizador o acoplador de antena).
$+ă86 Antena base dipolo ICOM P/HF1.9-30 MHz.

Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 5DGLR0yYLOSDUD$ÀFLRQDGR+)9+)\8+)

,&‡5DGLR0yYLO0XOWLPRGR7ULEDQGD+)9+)8+)
505 Canales | 1 Año de Garantía
5DQJRGH)UHFXHQFLD
Rx: 0.030 - 199.999 MHz
400.00 - 470.000 MHz
Tx: 1.800 - 1.900 MHz 24.890 - 24.990 MHz
3.500 - 3.900 MHz 28.000 - 29.700 MHz
10.100 - 10.150 MHz 50.000 - 54.000 MHz
14.000 - 14.350 MHz 144.000 - 148.000 MHz
18.068 - 18.168 MHz 430.000 - 450.000 MHz
21.000 - 21.450 MHz

TOUCH
D-STAR ready SCREEN
18(92
„,& ă86
,QFOX\H: microfono HM-198, cable de alimentación, cable de separación OPC-2253, +)0+] 0+] 0+]
cable USB, cable de accesorios de 13 pin y fusibles
66%&:557\)0 2 - 100 W 2 - 50 W 2 - 35 W
'LPHQVLRQHVGHXQLGDGGH5)167 x 58 x 255 mm.
&RQWURODGRU: 165 x 64 x 78.5 mm. AM 1 - 30 W
3HVRGHXQLGDGGH5): 2.3 kg. $FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
&RQWURODGRU: 0.5 kg.
$+ă86 Sintonizador automático de antena HF + 50 MHz.
0RGRVGHRSHUDFLyQ86%/6%&:577\$0'9)0\:)0 VyOR5[  $7ă86 Sintonizador automatico de antena( necesario utilizar cable
coaxial de 50 Ÿ).
&DUDFWHUtVWLFDV 63ă86 %RFLQDFRPSDFWDH[WHUQD:Ÿ
‡3DQWDOODWRXFKVFUHHQ 0%)ă86 Base con ventosa para tablero.
‡/LVWRSDUD'67$5 0%$ă86 Base para montaje de tablero.
‡(VWDELOLGDGGHIUHFXHQFLDGH“SSP 0%ă86 Bracket para montaje móvil.
‡Programable por software CS-7100
‡Pantalla grafica SWR 56%$ă86 Software de control remoto para PC.
‡Función de grabador de voz y reproductor 5&ă86 Controlador a diatancia para software RS-BA1.
‡Ranura para tarjeta SD para almacenamiento de archivos de voz y datos. 60ă86 Micrófono de escritorio.
‡Demodulador y decodificador RTTY. ,&3: ă86 Amplificador de 1000 W con sintonizador incluido.
‡Pantalla grafica de SWR 3UHJXQWHSRUGLVSRQLELOLGDG
‡Permite administración desde una PC por medio del software RS-BA1

,&3:‡$PSOLÀFDGRU/LQHDOSDUD+)
100 W | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC | 1 Año de Garantía

„,&3: ă86
,QFOX\H: sintonizador, fuente de poder y controlador. 5$',26,&20
'LPHQVLRQHV350 x 269 x 378 mm.
3HVR: 25 kg.
&DUDFWHUtVWLFDV:
‡&XEULPLHQWRFRPSOHWRHQODVEDQGDVGHDILFLRQDGRGHVGHKDVWD0+]DXQ
HQODVPiVGHPDQGDQWHVFRQGLFLRQHV
Controlador Desmontable
‡ÔVHORFRQFXDOTXLHUPDUFDGHUDGLRV QRVyORHVFRPSDWLEOHFRQUDGLRV,&20 
‡100% ciclo continuo.
‡Controlador desmontable para flexibilidad en su instalación.
‡Sintonizador de antena, seleccionador de alimentación y cambio de banda automáticos.
‡3RWHQFLDPi[LPD:

3URGXFWRVREUHSHGLGR $OLPHQWDFLyQ 180-264 Vca 90-132 Vca


&RUULHQWHGHDOLPHQWDFLyQ 15 A 20 A
0iVFRQILDELOLGDG\FRQVLVWHQFLDHQVXVFRPXQLFDFLRQHV 3RWHQFLDGHVDOLGD &:577\ 1 kW 500 W
3RWHQFLDGHVDOLGD 66% 1 kW PEP 500 W PEP
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Accesorios para Radios HF Año 2016

$7$7‡6LQWRQL]DGRUGH$QWHQD
503 Canales | 1 Año de Garantía
5DQJRGH)UHFXHQFLD
Tx / Rx: 1.6 a 30 MHz

„$7ă86 Sintonizador automático de antena. Cobertura 1.6 - 30 MHz (no incluye cable de control).
„$7ă86 Sintonizador automático de antena con cable de control integrado.

‡Memoria para 45 canales


‡)iFLOLQVWDODFLyQVLQQHFHVLGDGGHDMXVWHV
‡Construcción a prueba de rigurosas condiciones ambientales de temperatura, vibración y humedad.
‡Sintonización automática a mínimo SWR en menos de 3 segundos.
‡'LVHxDGRSDUDRSHUDUFRQUDGLRV,&20\DQWHQDVGHORQJLWXGPD\RUDP
$FFHVRULR
23&1ă86Cable de extensión de 10 m para AT-140.
'LPHQVLRQHV: 230 x 80 x 340 mm / 3HVR: 2.5 kg.

$+‡6LQWRQL]DGRU$XWRPiWLFRGH$QWHQD
120 W | De 3.5 a 30 MHz y 50 MHz | 1 Año de Garantía

„$+ă86
'LPHQVLRQHV172 x 69.5 x 230 mm.
3HVR: 1.2 kg.
No incluye cable de control.

&DUDFWHUtVWLFDV
‡0HPRULDSDUDFDQDOHV
‡Fácil instalación. Sin necesidad de ajustes.
‡Construcción a prueba de rigurosas condiciones ambientales de temperatura, vibración y
humedad.
‡Sintonización automática a mínimo SWR en menos de 3 segundos.
‡'LVHxDGRSDUDRSHUDUFRQUDGLRV,&20\DQWHQDVGHORQJLWXGPD\RUDP

£3DUD%DQGDVGH5DGLRDILFLRQDGRV 23&ă86 Cable de control para AH-4.

6*‡6LQWRQL]DGRU6PDUWXQHU
Controlador por Microprocesador | Opera con Cualquier Equipo de HF | 1 Año de Garantía

„6*ă86
Sintonizador automático de antena, de 1.6 a 30 MHz, de 3 a 200 W PEP. Opera con 13.6 Vcd.
(QWUDGDGHŸPHPRULDVQRYROiWLOHV2SHUDFRQFXDOTXLHUDQWHQDHQWUH\P
No requiere ajuste previo ni cable de controlIncluye 2.75 m de cable coaxial.
5$',26,&20

'LPHQVLRQHV410 x 310 x 80 mm.


3HVR: 4 kg.

3URGXFWRVREUHSHGLGR

FCC (Federal Communications Commission Approved) Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radio Móvil Comercial / Profesional HF

,&)‡/D6ROXFLyQDODV1HFHVLGDGHVGH&RPXQLFDFLyQ+)HQXQ6ROR5DGLR
:_$/($XWRPDWLF/LQN(VWDEOLVKPHQW_&XPSOHFRQ(VWiQGDU0LOLWDU0,/67'_,3_$xRGH*DUDQWtD
)XQFLyQ$/( 5DQJRGH)UHFXHQFLD
Automáticamente monitorea la óptima frecuencia para comunicación Tx: 1.6 - 29.999 MHz
Rx: 0.5-29.999 MHz

$OFRQHFWDUXQUHFHSWRUGH*36H[WHUQRSXHGHHQYLDUORV
GDWRVGH*36DFWXDOHV\PRVWUDUORVHQSDQWDOOD

&DUDFWHUtVWLFDV
‡$/((Establecimiento Automático de Enlace).
‡Llamada selectiva.
‡Conexión para GPS.
‡Resistente y compacto.
‡Tipos de emisión J3E, A3E, A1A, F1B y J2B.
‡FDQDOHVGHPHPRULD
ౠ0.3 ppm de estabilidad de frecuencias.
‡Comunicación de datos (req. AD-119).
‡Procesador de Señal Digital (DSP).
Versión 1 ‡IXQFLRQHVGHPHGLGRUGHOUHFHSWRU DXWRPiWLFDOyJLFD\SRUUHFHSWRU 
3URGXFWRVREUHSHGLGR ‡IXQFLRQHVGHPXWH VTXHOFK 
- 1. silenciador de llamada.
- 2. silenciador de nivel.
- 3. silenciador de voz.
‡)XQFLyQGHDXGLRFODUR FOHDUWDON HOLPLQDQGRHOUXLGRSRUPHGLRGHXQERWyQ

$FFHVRULRVRSFLRQDOHV QRLQFOXLGRV 
63ă86 Bocina externa.
$7ă86 Sintonizador automático de antena. Cobertura 1.6-30 MHz.
Versión 2 Versión 3 $7ă86 Sintonizador automático de antena con cable de control
3UHJXQWHSRUGLVSRQLELOLGDG 3UHJXQWHSRUGLVSRQLELOLGDG integrado. Cobertura 1.6-30 MHz
23&1ă86 Cable de extensión de datos para IC-F8100.
50.ă86 Kit para separación de cabezal para IC-F8101.
„Versión
,&) ă86
1
23& ă86 Cable de conexión de IC-F8101 a AT-140.
23& ă86 Cable de conexión de IC-F8101 para GPS y módem.
,QFOX\H: micrófono de mano (HM-193), 23&ă86 Cable de separacion para cabezal (3 m).
bocina SP-35L, cable de alimentación y fusibles. 23&ă86 Cable de separacion para cabezal (8 m).
'LPHQVLRQHV174 x 62 x 259 mm. 23&ă86 Cable de separacion para cabezal (1.9 m).
3HVR: 3.9 kg.
3UHJXQWHSRUGLVSRQLELOLGDG

$/((VWDEOHFLPLHQWR$XWRPiWLFRGH(QODFH $XWRPDWLF/LQN(VWDEOLVKPHQW 
El sistema de comunicación ALE tiene la función de determinar automáticamente la frecuencia para realizar un enlace entre 2 puntos o más con base en la propagación de la señal utilizando los
sintonizadores automáticos $7 o $7. La banda HF consta de 2 métodos de propagación: onda terrestre y onda ionosférica. La onda terrestre se propaga a través de la superficie de la
tierra y se utiliza para enlaces cortos, y la onda ionosférica se propaga por un rebote en la ionósfera y es utilizada para enviar la señal a larga distancia.

(VTXHPDGHFRPXQLFDFLyQHQWUHHVWDFLRQHV$/(
1 2 3 4 5 6
ALE Scan Rx Tx VOZ ENLACE
5$',26,&20
ENLACE

ALE LLAMADA Tx Rx MENSAJE ENLACE

1. Estaciones con sistema $/(. 4. La HVWDFLyQ% responde con un $&., espera respuesta por parte de la
2. La HVWDFLyQ$ genera una llamada a la HVWDFLyQ% por un canal de la HVWDFLyQ$.
red $/(. 5. Ambas estaciones determinan que existe un vínculo entre A y %, y están
3. La señal es enviada y espera una respuesta o verificación por parte de la listas para enviar voz o mensajes.
HVWDFLyQ% $&. . 6. Las HVWDFLRQHV$ y % están enlazadas .

Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Comerciales Año 2016

,&)‡/D6ROXFLyQ3HUIHFWDSDUD3HTXHxRV\*UDQGHV1HJRFLRV
5 W (VHF) | 4 W (UHF) | 16 Canales | MDC-1200 | Fabricado en Ambiente ISO 9001:2008
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | IP54 | 3 Años de Garantía
&DUDFWHUtVWLFDV 6HxDOL]DFLyQ7RQRV
‡&DQGDGRFRQWUDOHFWXUD ‡PTT-ID.
‡Password de lectura y sobreescritura. ‡Llamada selectiva (Rx).
‡Función de operador solitario (Lone Worker). ‡Llamada de grupo (Rx).
‡Explorador de canales (normal y de prioridad). ‡$XWRWUDQVPLVLyQUHPRWD 5DGLR(VStD5[ 
‡Número de serie electrónico (ESN). ‡Llamada de emergencia.
‡92;LQWHUFRQVWUXLGR UHTDGDSWDGRU23&\ ‡Supervisión remota de radio (Radio Check/ Rx).
PLFUyIRQRGLDGHPD+6+6\+6  ‡5DGLR.LOO 5[ 
‡2 teclas programables. ‡Desactivación y activación vía aire (Stun, Revive/ Rx).
‡Diseño compacto y ergonómico.
‡P:GHSRWHQFLDGHDXGLR 6HxDOL]DFLyQ'70)
‡3URJUDPDEOHSRUVRIWZDUH&6) ‡PTT-ID.
‡Llamada de emergencia.
6HxDOL]DFLyQ0'&
‡PTT-ID.
‡Llamada de emergencia.
5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD
,&)ă 86 136 - 174 MHz 16 5W
,&)ă 86 400 - 470 MHz 16 4W
,&)ă 86 450 - 512 MHz 16 4W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-265 BC-193


Incluye clip de resorte (MB-124).
)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3ă86 Batería Li-Ion, 1900 mAh.
%&ă86 Cargador rápido de escritorio para batería BP-265.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
0LFUyIRQRV$XGtIRQRV 3URJUDPDGRU

TXEHI / TXEHIA SPUPLUS / SPUSB2


5$',26,&20

7;(+,ă86 Micrófono-Audífono para radios ICOM.


7;(+,$ă86 Micrófono-Audífono con tubo acústico para radios ICOM.
6383/86ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB y RS-232.
6386%ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB.
23&ă86 Adaptador VOX para IC-F3003/ 4003.
„,&) 36%&ă86
%&ă86
Cargador rápido genérico de escritorio para batería PSBP264.
Cargador rápido de escritorio para batería BP-264.
'LPHQVLRQHV58 x 111 x 35.5 mm. %3ă86 Batería Ni-MH, 1400 mAh para IC-F3003/4003.
3HVR: 270 g. 6%&ă86 Cargador rápido de escritorio marca EPCOM para batería BP-264.
7;%3ă86 Batería Li-lon, 1900 mAh para V80/T70A, F3003/4003.
9(50É6$&&(625,26Págs. 83 - 144 7;%&ă86 Cargador rápido para batería BP-265.
%&ă86 Multicargador para batería BP-264 incluye Cup.
%&ă86 Multicargador para batería BP-265 incluye Cup.
1&)ă86 Funda de nylon con clip.

Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Comerciales

,&)‡5DGLRSDUD6ROXFLRQHV&RPHUFLDOHVRGH6HJXULGDG3ULYDGD
5 W (VHF) | 4 W (UHF) | 16 Canales | MDC-1200 | Fabricado en Ambiente ISO 9001:2008 | IP-54
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | 3 Años de Garantía
&DUDFWHUtVWLFDV 6HxDOL]DFLyQ7RQRV
‡Explorador de canales mejorado (normal y prioritario). ‡PTT-ID
‡Número de serie electrónico (ESN). ‡Llamada selectiva (Rx).
‡&DQGDGRFRQWUDOHFWXUD ‡Llamada de grupo (Rx).
‡Operación VOX (req. accesorio opcional). ‡Llamada de emergencia.
‡2 teclas programables. ‡Supervisión remota de radio (Radio Check/ Rx).
‡%DWHUtDGH/L,RQGHP$K ‡Radio Kill (Rx).
‡3URJUDPDEOHSRUVRIWZDUH&6)
6HxDOL]DFLyQ'70)
6HxDOL]DFLyQ0'& ‡PTT-ID
‡PTT-ID ‡Llamada de emergencia.
‡Llamada de emergencia.

5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD


,&)ă 86 136 - 174 MHz 16 5W
,&)ă 86 400 - 470 MHz 16 4W
,&)ă 86 450 - 512 MHz 16 4W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-232H BC-160-11


Incluye clip de resorte (MB-94).
)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3+ă86 Batería Li-Ion, 2300 mAh.
%&ă86 Cargador rápido de escritorio. Incluye adaptador de corriente (BC-145SA).

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
0LFUyIRQRV$XGtIRQRV 3URJUDPDGRU 0XOWLFDUJDGRU
J

5$',26,&20
TXEHI / TXEHIA SPUPLUS / SPUSB2 BC-197/22

7;(+,ă86 Micrófono-Audífono para radios ICOM.


7;(+,$ă86 Micrófono-Audífono con tubo acústico para radios ICOM.
6383/86ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB y RS-232.
6386%ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB.
18(92 %&ă86 Multicargador rápido para batería BP-232N, H y WP (req. Cup AD-106).
$'ă86 Cup para batería BP-232/ N/ H.
„,&) %&ă86
7;%3ă86
Cargador estándar de escritorio.
Batería Li-Ion de 2000 mAh.
'LPHQVLRQHV53 x 120 x 38 mm. 7;%&ă86 Cargador para batería BP-232/N/H y TX-BP232.
3HVR: 300 g con batería BP-232H. 1&)&/,3ă86 Funda de nylon con clip para IC-F3013/4013.

9(50É6$&&(625,26Págs. 83 - 144
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Comerciales Año 2016

,&)67‡&RPSDFWR6XPHUJLEOH\GH*UDQGHV&DUDFWHUtVWLFDV
5 W VHF | 4 W UHF | MDC-1200 | Fabricado en Ambiente ISO 9001:2008 | 3 Años de Garantía | 680(5*,%/(,3

&DUDFWHUtVWLFDV 6HxDOL]DFLyQ'70)
‡&XPSOH1RUPD,3VXPHUJLEOH P[PLQ  ‡PTT-ID.
‡800 mW de potencia de audio. ‡Llamada de emergencia.
‡Anunciador de canales.
‡,QFOX\HLQYHUVRUGHYR]GHFyGLJRV 6HxDOL]DFLyQ0'&
VHOHFFLRQDEOHV ‡PTT-ID.
‡%RWRQHVSURJUDPDEOHVFRQGREOHIXQFLyQ ‡Envío de emergencia.
‡8 códigos de auto dial de DTMF . ‡Radio Check(Rx).
‡0DQ'RZQ\/RQH:RUNHUSURJUDPDEOHV ‡Stun y Revive (Rx).
‡Cuenta con señalización 2 y 5 tonos. ‡Identificación hasta 100 alias (sólo modelo con display).
‡,QFRUSRUDXQVHQVRUGHPRYLPLHQWRSDUDRSHUDUHQ
FDVRGHHPHUJHQFLD 6HxDOL]DFLyQWRQRV
‡Password de encendido. ‡PTT-ID.
‡Password de lectura y escritura. ‡Llamada selectiva (Rx/ Tx, sólo versión con display).
‡Candado contralectura. ‡Llamada de grupo (Rx/ Tx, sólo versión con display).
‡Vox interconstruido (req. VS-4LA y HS-95) ‡Llamada de emergencia.
‡Opera en espaciamiento de 12.5 kHz (N) y 25 kHz (W). ‡Stun y Revive (Rx/ Tx, sólo versión con display).
‡3URJUDPDEOHSRUVRIWZDUH&6) ‡Radio Kill (Rx/ Tx, sólo versión con display).
‡Autotransmisión remota (Rx/ Tx, sólo versión con display).
‡Identificación en pantalla (sólo radios con display).

5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD DTMF


,&)ă 86 16 No
Versión DTMF
,&)6ă 86 136 - 174 MHz
128
5W No
,&)7ă 86 Sí
,&)ă 86 16 No
,&)6ă 86 400 - 470 MHz
128
4W No
,&)7ă 86 Sí

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-279 BC-213


Incluye clip de resorte (MB-133).
)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
5$',26,&20

)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).


%3ă86 Batería Li-Ion, 1485 mAh.
%&ă86 Cargador rápido de escritorio.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
18(92 6383/86ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB y RS-232.
%&ă86 Multicargador para 6 baterías BP-279 incluye Cup.
„,&)67 +0/$ă86
+0/$ă86
Micrófono-Audífono inserto de oído.
Micrófono-Bocina
'LPHQVLRQHV52.2 x 111.5 x 24.5 mm. +0/$ ă86 Micrófono-Audífono para IC-F1000/ 2000
3HVR: 240 g con batería BP-279.
3UHJXQWHSRUGLVSRQLELOLGDG
9(50É6$&&(625,26Págs. 83 - 144
3DUDPiVLQIRUPDFLyQFRPXQLFDUVHDOGHSDUWDPHQWRGHLQJHQLHUtD
IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Comerciales

,&)67‡0XFKR0iVTXHXQ5DGLR%iVLFR
5 W (VHF) | 4 W (UHF) | 128 Canales | MDC-1200 | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | IP54 | 3 Años de Garantía
3URJUDPDEOHSRU8VXDULR &DUDFWHUtVWLFDV 6HxDOL]DFLyQ7RQRV
6yORYHUVLyQFRQWHFODGR'70) ‡Pantalla de 8 caracteres alfanuméricos. ‡PTT-ID.
‡Nuevo explorador de canales mejorado (normal y ‡,GHQWLILFDFLyQHQSDQWDOOD $1, 
prioritario). ‡Llamada selectiva.
‡1~PHURGHVHULHHOHFWUyQLFR (61  ‡Llamada de grupo.
‡Nivel de voltaje de batería en pantalla. ‡Llamada de emergencia.
‡&DQGDGRFRQWUDOHFWXUD ‡Supervisión remota de radio (Radio Check).
‡3DVVZRUGGHHQFHQGLGR ‡Radio Kill.
‡Operación VOX (req.accesorio opcional). ‡Desactivación y activación vía aire (Stun, Revive).
‡8 botones programables. ‡Autotransmisión remota.
‡/ODPDGDGHHPHUJHQFLDLQWHOLJHQWH
‡Batería de Li-Ion de 2300 mAh. 6HxDOL]DFLyQ'70)
‡Puerto para tarjetas opcionales (encriptores). ‡PTT-ID.
‡3URJUDPDEOHSRUVRIWZDUH&6) ‡,GHQWLILFDFLyQHQSDQWDOOD $1, 5HT875
‡Llamada de emergencia.
6HxDOL]DFLyQ0'&
‡PTT-ID.
‡,GHQWLILFDFLyQHQSDQWDOOD $1, 
‡Supervisión remota de radio (Radio Check, Rx).
‡Desactivación y activación vía aire (Stun, Revive).
‡Llamada de emergencia.(Tx / Rx).

5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD DTMF


,&)60 ă 86 136 - 174 MHz 128 5W No
,&)70 ă 86 136 - 174 MHz 128 5W Sí
,&)70 ă 86 400 - 470 MHz 128 4W Sí
,&)70 ă 86 450 - 512 MHz 128 4W Sí

Versión DTMF
$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-232H BC-160-11


Incluye clip de resorte (MB-94).

)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).


)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3+ă86 Batería Li-Ion, 2300 mAh.
%&ă86 Cargador rápido de escritorio. Incluye adaptador de corriente (BC-145SA).

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
0LFUyIRQRV$XGtIRQRV 3URJUDPDGRU

5$',26,&20

TXEHI / TXEHIA SPUPLUS / SPUSB2

7;(+,ă86 Micrófono-Audífono para radios ICOM.


„,&)67 7;(+,$ă86 Micrófono-Audífono con tubo acústico para radios ICOM.
'LPHQVLRQHV53 x 120 x 36.9 mm. 6383/86ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB y RS-232.
3HVR: 296 g con batería BP-232H. 6386%ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB.
%&ă86 Multicargador rápido para batería BP-232N, H y WP.
%&ă86 Cargador estándar de escritorio.
3UHJXQWHSRUGLVSRQLELOLGDG
875ă86 Tarjeta decodificadora DTMF.
7;%3ă86 Batería Li-Ion de 2000 mAh.
9(50É6$&&(625,26Págs. 83 - 144 7;%&ă86 Cargador para batería BP-232/N/H y TX-BP232.

FCC (Federal Communications Commission Approved) Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Comerciales Año 2016

,&)66‡5DGLR6XSHULRUFRQ1RUPD,36XPHUJLEOH
5 W (VHF) | 4 W (UHF) | 128 Canales | MDC-1200 | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C/ D/ E y F | 3 Años de Garantía | 680(5*,%/(,3
con batería BP-232WP

&DUDFWHUtVWLFDV 6HxDOL]DFLyQ0'&
‡&XPSOHFRQ1RUPD,3 VXPHUJLEOHPSRUPLQ  ‡PTT-ID.
‡Pantalla de 8 caracteres alfanuméricos. ‡,GHQWLILFDFLyQHQSDQWDOOD $1, 
‡Nuevo explorador de canales mejorado ‡Supervisión remota de radio (Radio Check/Rx)
(normal y prioritario). ‡Desactivación y activación vía aire (Stun, Revive).
‡1~PHURGHVHULHHOHFWUyQLFR (61  ‡Llamada de emergencia (Tx / Rx).
‡Indicador de batería baja en pantalla.
‡&DQGDGRFRQWUDOHFWXUD 6HxDOL]DFLyQ7RQRV
‡3DVVZRUGGHOHFWXUD\HVFULWXUD
‡Password de encendido. ‡PTT-ID.
‡Operación VOX (req.accesorio opcional). ‡,GHQWLILFDFLyQHQSDQWDOOD $1, 
‡8 botones programables. ‡Llamada selectiva.
‡/ODPDGDGHHPHUJHQFLDLQWHOLJHQWH ‡Llamada de grupo.
‡Puerto para tarjetas opcionales (encriptores). ‡Llamada de emergencia.
‡%DWHUtDGH/L,RQGHP$K ‡Supervisión remota de radio (Radio Check).
‡3URJUDPDEOHSRUVRIWZDUH&6) ‡Desactivación y activación vía aire (Stun, Revive)
‡Autotransmisión remota (Radio Espía).
6HxDOL]DFLyQ'70) ‡Radio Kill.
‡PTT-ID.
‡Llamada de emergencia.
5DQJRGH)UHFXHQFLD &DQDOHV DTMF 3RWHQFLD
,&)6 ă 86 136 - 174 MHz 128 No 5W
,&)7 ă 86 136 - 174 MHz 128 Sí 5W
,&)6 ă 86 400 - 470 MHz 128 No 4W
,&)6 ă 86 450 - 512 MHz 128 No 4W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-232WP BC-160-11


Incluye clip de resorte (MB-94).
)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3:3ă86 Batería Li-Ion, 2300 mAh. Cumple con norma IP67 (Sumergible).
%&ă86 Cargador rápido de escritorio. Incluye adaptador de corriente (BC-145SA).

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
3URJUDPDGRU 0XOWLFDUJDGRU
J
5$',26,&20

„,&)66 SPUPLUS / SPUSB2 BC-197/22

'LPHQVLRQHV53 x 120 x 37 mm. 6383/86ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB y RS-232.
3HVR: 310 g con batería BP-232WP. 6386%ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB.
%&ă86 Multicargador rápido para batería BP-232N, H y WP.
3UHJXQWHSRUGLVSRQLELOLGDG
%&ă86 Cargador estándar de escritorio.
875ă86 Tarjeta decodificadora DTMF.
9(50É6$&&(625,26Págs. 83 - 144 87ă86 Tarjeta de scrambler de código.
875ă86 Tarjeta scrambler de código rodante.
FCC (Federal Communications Commission Approved)
IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

60 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Comerciales

,&)‡,GHDOSDUD'HSDUWDPHQWRVGH3URWHFFLyQ&LYLOR%RPEHURV
5 W (VHF) | 128 Canales | MDC-1200 | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
5 Años de Garantía | 680(5*,%/(,3;
,175Ì16(&$0(17(6(*852 &DUDFWHUtVWLFDV 6HxDOL]DFLyQ0'&
‡Pantalla de 8 caracteres alfanuméricos. ‡PTT-ID.
‡Indicador de señal recibida. ‡Identificación en pantalla (ANI).
‡Explorador de canales (normal y prioritario). ‡Llamada selectiva.
‡Número de serie electrónico (ESN). ‡Llamada de grupo.
‡Nivel de voltaje de batería en pantalla. ‡Llamada de alerta.
‡&DQGDGRFRQWUDOHFWXUD\SDVVZRUGGHHQFHQGLGR ‡Mensajes de estatus (mensaje de encendido y apagado).
‡(QFULSWDFLyQGHYR]LQFOXLGRQLYHOHVGHVHJXULGDG ‡Supervisión remota de radio (Radio Check).
GLVSRQLEOH EiVLFRRFyGLJRURGDQWH  ‡Llamada de emergencia inteligente.
‡Llamada de emergencia inteligente.
‡Compensador de audio (Compander). 6HxDOL]DFLyQ7RQRV
‡3URJUDPDEOHSRUVRIWZDUH&6)0'& ‡PTT-ID.
‡Identificación en pantalla (ANI).
6HxDOL]DFLyQ'70) ‡Llamada selectiva.
‡PTT-ID. ‡Llamada de grupo.
‡Llamada de emergencia. ‡$XWRWUDQVPLVLyQUHPRWD
‡Llamada de emergencia.
‡Supervisión remota de radio (Radio Check).
‡Radio Kill.
‡Desactivación y activación vía aire (Stun, Revive).
5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD
,&) ă 86 136 - 174 MHz 128 5W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-S59V BP-227FM BC-119-N01 / AD-100 / BC-119-N51

Incluye clip de resorte (MB-98).

)$69ă86 Antena helicoidal, 150-174 MHz.


%3)0ă86 Batería Li-Ion, 1700 mAh, intrínsecamente segura.
%&1ă86 Cargador rápido de escritorio (requiere AD-100).
$'ă86 Cup para cargador BC-119N01.
%&1ă86 Incluye cargador BC-119-N01 y Cup AD-100.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
0LFUyIRQRV$XGtIRQRV 3URJUDPDGRU

5$',26,&20
HM-138 OPC-966

+0ă86 Micrófono-Bocina sumergible.


23&ă86 Interfaz de programación para F50/ 60/ V/ IC-F3161/ 4161/ DS/ DT.
)$69ă86 Antena helicoidal, 136-150 MHz.
„,&) )$696ă86
)$696ă86
Antena recortada, 150-162 MHz.
Antena recortada, 160-174 MHz.
'LPHQVLRQHV56 x 97 x 36.4 mm. %&ă86 Cargador estándar.
3HVR: 280 g con batería BP-227. )$686ă86 Antena recortada, 450-490 MHz.
623&ă86 Interfaz para programación de radios F50/60/V, F3161/4161/DS/DT.
3UHJXQWHSRUGLVSRQLELOLGDG %3ă86 Batería Li-Ion 1700 mAh.
$'ă86 Cup para cargador BC-119N01/ BC-121.
9(50É6$&&(625,26Págs. 83 - 144 %&ă86 Multicargador para 6 baterías (req. AD-123 para BP-266)
FCC (Federal Communications Commission Approved)
IPX7: Sumergible 1 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 61
Radios Portátiles Comerciales Año 2016

,&)99‡(O5DGLR3HUIHFWRSDUD6LWXDFLRQHVGH(PHUJHQFLD
5 W (VHF) | 4 W (UHF) | 128 Canales | MDC-1200 | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
5 Años de Garantía | 680(5*,%/(,3
&DUDFWHUtVWLFDV 6HxDOL]DFLyQ0'&
$/(57$9,%5$725,$
‡Pantalla de 8 caracteres alfanuméricos. ‡PTT-ID.
*5$%$'25'(92= ‡Llamada de emergencia inteligente. ‡Identificación en pantalla (ANI).
‡9LEUDGRUSDUDOODPDGDVGHDOHUWD ‡Llamada selectiva.
‡*UDEDFLyQGHPHQVDMHGHYR]PLQXWRV ‡Llamada de grupo.
‡Explorador de canales mejorado normal y prioritario). ‡Supervisión remota de radio (Radio Check).
‡Compensador de audio (compander). ‡Llamada de alerta.
‡Número de serie electrónico (ESN). ‡Llamada de emergencia inteligente.
‡Nivel de voltaje de batería en pantalla.
‡&DQGDGRFRQWUDOHFWXUD\SDVVZRUGGHHQFHQGLGR 6HxDOL]DFLyQ7RQRV
‡Gran amplificador de audio de salida BTL, hasta P: ‡PTT-ID.
GHSRWHQFLDGHDXGLR (versión sin vibrador ni grabador ‡Identificación en pantalla (ANI).
de voz). ‡Llamada selectiva.
‡,QYHUVRUGHYR]LQFOXLGR ‡Llamada de grupo.
‡3URJUDPDEOHSRUVRIWZDUH&6)9 ‡Supervisión remota (Radio Check).
‡Llamada de alerta.
6HxDOL]DFLyQ'70) ‡Radio Kill.
‡PTT-ID. ‡Desactivación y activación vía aire (Stun, Revive)
‡Llamada de emergencia. ‡Autotransmisión remota.
‡Llamada de emergencia.
5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD
,&)9ă 86 136 - 174 MHz 128 5W
,&)9 ă 86 136 - 174 MHz 128 5W
,&)9ă 86 400 - 470 MHz 128 4W
,&)9 ă 86 400 - 470 MHz 128 4W
,&)9 ă 86 450 - 512 MHz 128 4W
,&)9ă 86 450 - 512 MHz 128 4W
,QFOX\Hamplificador BTL (no cuenta con vibrador, ni grabación de voz)

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-S59V / FA-S27U / FA-S56U BP-227 BC-119-N01 / AD-100 / BC-119-N51


Incluye clip de resorte (MB-98).
)$69ă86 Antena VHF (se incluye la antena dependiendo de la banda del radio).
)$68ă86 Antena UHF (se incluye la antena dependiendo de la banda del radio).
%3ă86 Batería Li-Ion, 1700 mAh.
%&1ă86 Cargador rápido de escritorio (requiere AD-100).
$'ă86 Cup para cargador BC-119N01 y BC-121.
%&1ă86 Incluye cargador BC-119-N01 y Cup AD-100.
%&ă86 Multicargador para 6 baterías (req. AD-123 para BP-266)

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
0LFUyIRQRV$XGtIRQRV 3URJUDPDGRU
5$',26,&20

HM-138 OPC-966

„,&)99 +0ă86
23&ă86
Micrófono-Bocina sumergible.
Interfaz de programación para F50/ 60/ V/ IC-F3161/ 4161/ DS/ DT.
'LPHQVLRQHV56 x 97 x 36.4 mm. )$69ă86 Antena helicoidal, 150-174 MHz.
3HVR: 280 g con batería BP-227. %&ă86 Cargador estándar.
)$696ă86 Antena recortada, 150-162 MHz.
9(50É6$&&(625,26Págs. 83 - 144 )$696ă86 Antena recortada, 160-174 MHz.
623&ă86 Interfaz para programación de radios F50/60/V, F3161/4161/DS/DT.
FCC (Federal Communications Commission Approved)
IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

62 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Móviles Comerciales

,&)‡2SHUDFLyQ6HQFLOODSDUD&RPXQLFDFLyQ,QVWDQWiQHD
50 W (VHF) | 45 W (UHF) | 8 Canales | MDC-1200 | Fabricado en Ambiente ISO 9001:2008
Cumple con Estándares Militares MIL-STD-810 C, D, E y F | 3 Años de Garantía

„,&)
'LPHQVLRQHV150 x 40 x 167.5 mm.
3HVR: 1.1 kg.
&DUDFWHUtVWLFDV
‡Bocina de 4 W montada al frente.
‡(QFULSWDFLyQGHYR] UHT875875 
‡Autodial por DTMF.
‡Explorador de canales mejorado (Scan).
‡&DQGDGRFRQWUDOHFWXUD
‡Password de encendido.
‡Nivel de volumen mínimo programable.
‡4 botones programables.
‡Conector de accesorios para interconexiones.
‡3URJUDPDEOHSRUVRIWZDUH&6)

6HxDOL]DFLyQ0'&
‡PTT-ID (ANI).
‡Stun (Rx).
‡Revive (Rx).
‡Llamada de emergencia.
‡Supervisión remota de radio (Radio Check).

6HxDOL]DFLyQ7RQRV
‡PTT-ID (ANI).
‡Llamada selectiva (Rx).
‡Llamada de grupo (Rx).
18(92 ‡5DGLR(VStD 5[ 
‡Llamada de emergencia.
5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD ‡Supervisión remota de radio (Radio Check/ Rx).
‡Radio Kill (Rx).
,&)ă 86 136-174 MHz 8 50 W ‡Desactivación y activación vía aire (Stun, Revive/ Rx).
,&)ă 86 400-470 MHz 8 45 W
6HxDOL]DFLyQ'70)
,&)ă 86 450-512 MHz 8 45 W ‡PTT-ID (ANI).
,QFOX\Hmicrófono HM-152, cable de corriente OPC-1132A y bracket F121MMB. ‡Llamada de emergencia.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
+07ă86 Micrófono de mano con DTMF.
60ă86 Micrófono de escritorio.
6383/86ă86 Programador universal para radios ICOM / KENWOOD,
móviles y portátiles para puerto USB y RS-232.
6386%ă86 Programador universal de móviles y portátiles ICOM /
KENWOOD para puerto USB.
23&ă86 Interfaz para puerto de accesorios DB-15.
23&$ă86 Cable de alimentación.
23&ă86 Interfaz para puerto de accesorios DB-25. 5$',26,&20
HM-152T SM-26 UT-109R 623&ă86 Interfaz SYSCOM para puerto de accesorios DB-25.
875ă86 Tarjeta de inversión de voz básica de 32 códigos.
875ă86 Tarjeta de inversión de voz código rodante de 1024 códigos.
ă86 Cable repuesto para micrófono HM-152.
)00%ă86 Bracket para montaje en vehiculo.
63ă86 %RFLQDFRPSDFWDH[WHUQD:Ÿ

UT-110R SPUSB2

Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Móviles Comerciales Año 2016

,&)‡/DV0HMRUHV)XQFLRQHVHQXQ6ROR(TXLSR
50 W (VHF) | 45 W (UHF) | 128 Canales | MDC-1200 | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C, D, E y F | 3 Años de Garantía

„,&)
'LPHQVLRQHV150 x 40 x 167.5 mm.
3HVR: 1.1 kg.
&DUDFWHUtVWLFDV
‡6 botones programables.
‡Pantalla de 8 caracteres alfanuméricos.
‡Explorador de canales normal y prioritario.
‡&DQGDGRFRQWUDOHFWXUD
‡Password de encendido, lectura y escritura.
‡Capacidad de enviar emergencia con botón de pánico.
‡Nivel de volumen mínimo programable.
‡3XHUWRSDUDWDUMHWDVRSFLRQDOHV HQFULSWRUHV 
‡Puerto de accesorios para conexión de repetidores u otra
aplicación (req. OPC-2078 y/o OPC-1939).
‡3URJUDPDEOHSRUVRIWZDUH&6)

6HxDOL]DFLyQ0'&
‡PTT-ID.
‡,GHQWLILFDFLyQHQSDQWDOOD DOLDV 
‡Desactivación y activación de radio vía aire (Rx).
‡Supervisión remota de radio (Rx).
‡Llamada de emergencia inteligente.

6HxDOL]DFLyQ7RQRV
‡PTT-ID.
‡,GHQWLILFDFLyQHQSDQWDOOD $1, 
‡Llamada selectiva.
5DQJRGH)UHFXHQFLD $QFKRGH%DQGD &DQDOHV 3RWHQFLD ‡Llamada de grupo.
‡Autotransmisión remota.
,&)ă 86 136-174 MHz 25 / 12.5 kHz 128 50 W ‡Llamada de emergencia.
‡Supervisión remota de radio (Radio Check).
,&)ă 86 400-470 MHz 12.5 kHz 128 45 W
‡Radio Kill.
,&)ă 86 450-512 MHz 12.5 kHz 128 45 W ‡Desactivación y activación vía aire (Stun, Revive).
,QFOX\H cable de alimentación OPC-1132A, micrófono (HM-152) y montaje.
6HxDOL]DFLyQ'70)
‡PTT-ID.
‡,GHQWLILFDFLyQHQSDQWDOOD $1, UHT875
‡Llamada de emergencia.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
+07ă86 Micrófono de mano con DTMF.
60ă86 Micrófono de escritorio.
875ă86 Tarjeta decodificadora DTMF.
+0ă86 Micrófono de uso rudo.
6383/86ă86 Programador universal de móviles y portátiles ICOM /
KENWOOD para puerto USB y RS-232.
6386%ă86 Programador universal de móviles y portátiles ICOM /
KENWOOD para puerto USB.
)00%ă86 Bracket para montaje.
23&ă86 Interfaz para puerto de accesorios DB-15.
5$',26,&20

HM-148T SM-26 UT-108R


23&$ă86 Cable de alimentación.
23&ă86 Interfaz para puerto de accesorios DB-25.
623&ă86 Interfaz para puerto de accesorios DB-25.
ă86 Cable repuesto para micrófono HM-152.
875ă86 Tarjeta de inversión de voz básica de 32 códigos.
875ă86 Tarjeta scrambler de código rodante.
63ă86 %RFLQDFRPSDFWDH[WHUQD:Ÿ

HM-148G SPUSB2

FCC (Federal Communications Commission Approved) Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 5DGLRV&RQYHQFLRQDOHV\7UXQNLQJ

,&)75‡5DGLR3RUWiWLO&RQYHQFLRQDO\7UXQNLQJ/753DVV3RUW
4 W (UHF) | 256 Canales | MDC-1200 | Fabricado en Ambiente ISO 9001:2008 | Aprobado por la FCC
Cumple con Estándares Militares MIL-STD-810 C, D, E y F | 3 Años de Garantía
&DUDFWHUtVWLFDV
‡Trunking LTR / PassPort (50 sistemas, 250 grupos). ‡Explorador de canales (normal y prioritario).
‡2SHUDFLyQFRQYHQFLRQDO ‡&DQGDGRFRQWUDOHFWXUD\SDVVZRUGGHHQFHQGLGR
‡Pantalla de 8 caracteres alfanuméricos. ‡Capacidad de enviar emergencia.
‡Inversor de voz. ‡Puerto para tarjetas opcionales (encriptores).
‡3URJUDPDEOHSRUVRIWZDUH&6)75

5DQJRGH)UHFXHQFLD 3RWHQFLD DTMF


,&)75 ă 86 400-470 MHz 4W No

$FFHVRULRV,QFOXLGRV
$QWHQD8+) %DWHUtD &DUJDGRU

FA-SC57U BP-232H BC-160-11


Incluye clip de resorte (MB-94).
)$6&8ă86 Se incluye una antena UHF.
%3+ă86 Batería Li-Ion, 2300 mAh.
%&ă86 Cargador rápido de escritorio. Incluye adaptador de corriente (BC-145).

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
„,&)75 %&ă86 Cargador estándar de escritorio.
'LPHQVLRQHV53 x 120 x 32.5 mm. 6383/86ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB y RS-232.
3HVR: 320 g. 6386%ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB.
3UHJXQWHSRUGLVSRQLELOLGDG

,&)75‡5DGLR0yYLO&RQYHQFLRQDO\7UXQNLQJ/753DVV3RUW
45 W (UHF) | 250 Canales | Fabricado en Ambiente ISO 9001:2008
Cumple con Estándares Militares MIL-STD-810 C, D, E y F | 5 Años de Garantía
&DUDFWHUtVWLFDV 6HxDOL]DFLyQ'70)
‡Pantalla de 10 caracteres. ‡PTT-ID.
‡Explorador de canales (normal y prioritario). ‡Identificación en pantalla (ANI), con accesorio adicional
‡&DQGDGRFRQWUDOHFWXUD\SDVVZRUGGHHQFHQGLGR UT-108.
‡Capacidad de enviar emergencia con botón de pánico ‡Llamada de emergencia.
(req. accesorio adicional).
‡Nivel de volumen mínimo programable.
‡Puerto para tarjetas opcionales (encriptores ICOM, Midian
o Transcrypt).
‡Puerto de accesorios para conexión de repetidores u otra
aplicación.
‡9HUVLyQWUXQNLQJ/753DVV3RUW 5$',26,&20
‡3URJUDPDEOHSRUVRIWZDUH&6)

5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD


,&)75 ă 86 440 - 490 MHz /753DVV3RUW 45 W
,QFOX\H micrófono HM-152, cable de alimentación OPC-1132A y bracket.
„,&)75
'LPHQVLRQHV140 x 40 x 170 mm.
3HVR: 1.2 kg.
$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
3UHJXQWHSRUGLVSRQLELOLGDG +0ă86 Micrófono de mano.
23&ă86 Cable de alimentación.
6383/86ă86 Programador universal para radios ICOM / KENWOOD, móviles y portátiles para puerto USB y RS-232
6386%ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB.
)00%ă86 Bracket para montaje.
ă86 Cable repuesto para micrófono HM-152.
FCC (Federal Communications Commission Approved) Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Digitales Año 2016

,&)''‡7RGRORTXH8VWHG(VSHUDGHXQ5DGLR'LJLWDO
: 9+) _: 8+) _&DQDOHV_0'&_7UXQNLQJ'LJLWDO,'$6ŒN+]_'LJLWDO1;'1ŒN+]
Fabricado en Ambiente ISO 9001:2008 | IP54 | 3 Años de Garantía
/LVWRSDUD*36 &DUDFWHUtVWLFDV 6HxDOL]DFLyQ7RQRV
Req. HM-171GP ‡&DQGDGRFRQWUDOHFWXUD ‡PTT-ID.
‡3DVVZRUGGHOHFWXUD\VREUHHVFULWXUD ‡Llamada selectiva.
‡Función de operador solitario (Lone Worker). ‡Llamada de grupo.
‡Explorador de canales (normal y de prioridad). ‡5DGLR(VStD
‡Número de serie electrónico (ESN). ‡Llamada de emergencia.
‡2 teclas programables. ‡Supervisión remota de radio (Radio Check).
‡Diseño compacto y ergonómico. ‡Radio Kill.
‡P:GHSRWHQFLDGHDXGLR ‡Desactivación y activación vía aire (Stun, Revive)
‡6RIWZDUHGHSURJUDPDFLyQ&6)')'
6HxDOL]DFLyQ0'&
&DUDFWHUtVWLFDVHQ'LJLWDO1;'1ŒN+] ‡PTT-ID (Tx/Rx).
‡2SHUDFLyQGLJLWDODQDOyJLFRRPH]FODGR ‡Llamada de emergencia (Rx).
‡Operación trunking digital (30 canales, 2000 ID). ‡Supervisión remota de radio (Radio Check)
‡PTT-ID en NXDN™. ‡Desactivación y activación vía aire (Stun, Revive).
‡Llamada selectiva y de grupo y alerta.
‡Llamada de emergencia inteligente 6HxDOL]DFLyQ'70)
‡(QFULSWDFLyQGLJLWDO1;'1Œ FyGLJRV  ‡PTT-ID.
‡Supervisión remota de radio vía aire. ‡Llamada de emergencia.
‡ 'HVDFWLYDFLyQ\DFWLYDFLyQYtDDLUH 6WXQ5HYLYH 
‡*36 HQWUDQVPLVLyQVyORFRQ+0*3 
‡Envío de mensajes de texto (mensaje de encendido y
apagado).
‡63 códigos de acceso RAN.
‡$XWRWUDQVPLVLyQUHPRWD 5DGLR(VStD 
‡5DGLR.LOO

5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD


,&)'ă 86 136 - 174 MHz 16 5W
,&)'ă 86 400 - 470 MHz 16 4W
,&)'ă 86 450 - 512 MHz 16 4W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-265 BC-193


Incluye clip de resorte (MB-124)

)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).


)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3ă86 Batería Li-Ion, 1900 mAh.
%&ă86
5$',26,&20

Cargador rápido de escritorio para batería BP-265.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
+0*3ă86 Micrófono de solapa con receptor GPS.
6383/86ă86 Programador universal para radios ICOM / KENWOOD, móviles y portátiles para puerto USB y RS-232.
„,&)'' %&ă86
7;%3ă86
Multicargador rápido para batería BP-265.
Batería Li-lon, 1900 mAh para F3003/4003, F3103D/ 4103D, F3210D/4210D.
'LPHQVLRQHV58 x 111.5 x 36.4 mm. 7;%&ă86 Cargador rápido para batería BP-265, TX-BP265.
3HVR: 310 g con batería BP-265. 1&)ă86 Funda de nylon con clip .

9(50É6$&&(625,26Págs. 83 - 144

Dimensiones: Ancho x Alto x Profundidad.

66 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Digitales

,&)''‡&RPSDFWR6XPHUJLEOH\$GHPiVHV'LJLWDO
5 W VHF | 4 W UHF | MDC-1200 | Fabricado en Ambiente ISO 9001:2008 | 3 Años de Garantía | 680(5*,%/(,3
&DUDFWHUtVWLFDV ‡Desactivación de radio vía aire (Stun/ Revive/ Rx).
‡Envío y recepción de mensajes de texto (mensaje de
‡800 mW de potencia de audio. encendido y apagado).
‡Anunciador de canales. ‡Función Voting Scan.
‡Explorador de canales (normal y de prioridad). ‡63 códigos de acceso RAN.
‡Password de lectura y escritura.
‡Candado antilectura. 6HxDOL]DFLyQ0'&
‡Número de serie electrónico (ESN).
‡Sumergible IP-67 (1 m por 30 min). ‡PTT-ID.
‡Opción de manos libres (vox interconstruido, req. ‡Llamada de emergencia.
accesorios de audio). ‡Supervisión remota de radio (Radio Check/ Rx).
‡Opera en espaciamiento de 12.5 kHz. ‡Desactivación de radio vía aire (Stun/ Revive/ Rx)
‡Diseño compacto y ergonómico.
‡Man Down y Lone Worker programables. 6HxDOL]DFLyQ7RQRV
‡Programable por software CS-F2000D.
‡PTT-ID.
‡16 canales.
‡Llamada selectiva (Rx).
‡Llamada de grupo (Rx).
&DUDFWHUtVWLFDVHQ'LJLWDO1;'1ŒN+]
‡Radio espía (Rx).
‡Operación digital / analógico o mezclado. ‡Llamada de emergencia (Tx).
‡Operación trunking digital (30 canales, 2000 ID). ‡Supervisión remota de radio (Radio Check/ Rx).
‡PTT-ID en NXDN™. ‡Desactivación de radio vía aire (Radio Kill/ Rx).
‡Llamada selectiva, de grupo y alerta. (Rx). ‡Desactivación de radio vía aire (Stun/ Revive/ Rx).
‡Llamada de emergencia inteligente (Tx).
6HxDOL]DFLyQ'70)
‡Encripción digital NXDN™(32,726 códigos).
‡Supervisión remota de radio (Radio Check/ Rx). ‡PTT-ID.
‡Radio Kill (Rx). ‡Llamada de emergencia.

5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD


,&)'ă 86 136 - 174 MHz 16 5W
,&)'ă 86 400 - 470 MHz 16 4W
,&)'ă 86 450 - 512 MHz 16 4W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-280 BC-213


Incluye clip de resorte (MB-133).
)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3ă86 Batería Li-Ion, 2400 mAh.
5$',26,&20
%&ă86 Cargador rápido de escritorio.
%&6$ă86 Adaptador de corriente para cargador BC-213

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
18(92 6383/86ă86 Programador universal de móviles y portátiles ICOM / KENWOOD para puerto USB y RS-232.
%&ă86 Multicargador para 6 baterías BP-279 incluye Cup.
„,&)'' +0/$ă86
+0/$ă86
Micrófono-Audífono inserto de oído.
Micrófono-Bocina
'LPHQVLRQHV52.2 x111.8 x 30.3 mm. +0/$ ă86 Micrófono-Audífono para IC-F1000/2000
3HVR: 260 g con batería BP-279.
3UHJXQWHSRUGLVSRQLELOLGDG
3DUDPiVLQIRUPDFLyQFRPXQLFDUVHDOGHSDUWDPHQWRGHLQJHQLHUtD
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 67
Radios Portátiles Digitales Año 2016

,&)''‡,QWHJUDQGROD0iV$OWD&DOLGDGFRQODV0HMRUHV(VSHFLÀFDFLRQHV
: 9+) _: 8+) _&DQDOHV_0'&_'LJLWDO1;'1ŒN+]
Fabricado en Ambiente ISO 9001:2008 | IP54 | 3 Años de Garantía
&DUDFWHUtVWLFDV &DUDFWHUtVWLFDVHQ'LJLWDO1;'1ŒN+]
/LVWRSDUD*36
Req. HM-171GP ‡&DQGDGRFRQWUDOHFWXUD ‡2SHUDFLyQGLJLWDO\DQDOyJLFR QRPH]FODGR 
‡3DVVZRUGGHOHFWXUD\VREUHHVFULWXUD ‡2SHUDHQVLVWHPDVPXOWLVLWLRWUXQNLQJ\PXOWLWUXQN
‡Función de operador solitario (Lone Worker). ‡PTT-ID en NXDN™.
‡Explorador de canales (normal y de prioridad). ‡Llamada selectiva, de grupo y alerta.
‡Número de serie electrónico (ESN). ‡Llamada de emergencia inteligente
‡2 teclas programables. ‡(QFULSWDFLyQGLJLWDO1;'1Œ FyGLJRV 
‡2SHUDHQPRGRDQDOyJLFR   ‡Supervisión remota de radio vía aire (Radio Check).
VyORIUHFXHQFLD\WRQR  ‡ 'HVDFWLYDFLyQ\DFWLYDFLyQYtDDLUH 6WXQ5HYLYH 
‡Función de penalización por tiempo (TOT) ‡*36 HQWUDQVPLVLyQVyORFRQ+0*3 
‡Diseño compacto y ergonómico. ‡Envío de mensajes de texto (mensaje de encendido y
‡P:GHSRWHQFLDGHDXGLR apagado).
‡3URJUDPDEOHSRUVRIWZDUH&6)')')' ‡63 códigos de acceso RAN.
‡)XQFLyQ9RWLQJ6FDQ ‡$XWRWUDQVPLVLyQUHPRWD 5DGLR(VStD 
‡5DGLR.LOO

5DQJRGH)UHFXHQFLD &DQDOHV 3RWHQFLD


,&)'ă 86 136 - 174 MHz 16 5W
,&)'ă 86 400 - 470 MHz 16 4W
,&)'ă 86 450 - 520 MHz 16 4W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-265 BC-193

Incluye clip de resorte (MB-124).


)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3ă86 Batería Li-Ion, 1900 mAh.
%&ă86 Cargador rápido de escritorio para batería BP-265.

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
+0*3ă86 Micrófono de solapa con receptor GPS.
6383/86ă86 Programador universal para radios ICOM / KENWOOD, móviles y portátiles para puerto USB y RS-232.
%&ă86 Multicargador rápido para batería BP-265 incluye Cup.
7;%3ă86 Batería Li-lon, 1900 mAh para V80/T70A, F3003/4003.
7;%&ă86 Cargador rápido para batería BP-265.
1&)ă86 Funda de nylon con clip.

2SHUDHQ5HG0XOWLVLWLR&RQYHQFLRQDO,37UXQNLQJ0RQRVLWLR\0XOWLWUXQN
5$',26,&20

RED MULTISITIO SISTEMA TRUNKING


CONVENCIONAL IP
IC-FR5000/6000
con UC-FR5000

18(92

„,&)''
'LPHQVLRQHV58 x 111.5 x 36.4 mm.
3HVR: 310 g con batería BP-265.
RC-FS10 para Radio/PC
IC-F3210D Despachador Virtual IC-F3210D IC-F3210D
9(50É6$&&(625,26Págs. 83 - 144
Dimensiones: Ancho x Alto x Profundidad.

 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Digitales

,&)'6'7‡([WHQGLHQGRHO$OFDQFHGHODV&RPXQLFDFLRQHV
: 9+) _: 8+) _&DQDOHV_'LJLWDO1;'1ŒN+]_)DEULFDGRHQ$PELHQWH,62
Voting Scan | 3 Años de Garantía | 680(5*,%/(,3
&DUDFWHUtVWLFDV &DUDFWHUtVWLFDVHQ'LJLWDO1;'1ŒN+]
‡&DQGDGRFRQWUDOHFWXUD ‡Operación digital y analógico (no mezclado).
‡3DVVZRUGGHOHFWXUD\VREUHHVFULWXUD ‡2SHUDFLyQPXOWLVLWLRWUXQNLQJ\PXOWLWUXQN
‡3DVVZRUGGHHQFHQGLGR ‡)XQFLyQ9RWLQJ6FDQ
‡Función de operador solitario (Lone Worker). ‡PTT-ID en NXDN™.
‡Explorador de canales (normal y de prioridad). ‡Llamada selectiva y de grupo y alerta.
‡Número de serie electrónico (ESN). ‡Llamada de emergencia inteligente
‡8 teclas programables. ‡(QFULSWDFLyQGLJLWDO1;'1Œ FyGLJRV 
‡Diseño compacto y ergonómico. ‡Supervisión remota de radio vía aire (Radio Check) Rx.
‡:GHSRWHQFLDGHDXGLR ‡ 'HVDFWLYDFLyQ\DFWLYDFLyQYtDDLUH 6WXQ5HYLYH 5[
‡3URJUDPDEOHSRUVRIWZDUH&6)')')' ‡Envío de mensajes preprogramados.
‡Envío de mensajes de estatus (mensaje de encendido
y apagado).
‡Identificación en pantalla de hasta 500 alias y 500
grupos.

5DQJRGH)UHFXHQFLD DTMF &DQDOHV 3RWHQFLD


,&)'6ă 86 136 - 174 MHz No 128 5W
,&)'7 ă 86 136 - 174 MHz Sí 128 5W
,&)'6ă 86 400 - 470 MHz No 128 4W
,&)'6ă 86 450 - 512 MHz No 128 4W
,&)'7 ă 86 400 - 470 MHz Sí 128 4W
,&)'7 ă 86 450 - 512 MHz Sí 128 4W
3UHJXQWHSRUGLVSRQLELOLGDG

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-232WP BC-160-11


Incluye clip de resorte MB-94R
)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3:3ă86 Batería Li-Ion, 2300 mAh sumergible.
%&ă86 Cargador rápido de escritorio para batería BP-232WP. 5$',26,&20

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
6383/86ă86 Programador universal para radios ICOM / KENWOOD, móviles y portátiles para puerto USB y RS-232.
%&ă86 Multicargador rápido para batería BP-265.
18(92 +0/$ă86 Micrófono-Bocina.
„,&)'6'7 %&ă86
7;%&ă86
Cargador estándar de escritorio.
Cargador rápido para batería BP-232, N, H y WP.
'LPHQVLRQHV53 x 120 x 37 mm. 7;%3ă86 Batería Li-Ion, 2000 mAh (no sumergible).
3HVR: 340 g con batería BP-232WP. (:&6ă86 Accesorio de audio (ver pág. 108).
1&)6 ă86 Funda de nylon con clip.
3UHJXQWHSRUGLVSRQLELOLGDG 1&)7 ă86 Funda de nylon con clip para radio con DTMF.
+0+':3ă86 Micrófono bocina sumergible para IC-F3230/4230
9(50É6$&&(625,26Págs. 83 - 144
Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 
Radios Portátiles Digitales Año 2016

,&)'6'7‡(O0HMRU(TXLSRSDUD0~OWLSOHV6LVWHPDV
: 9+)8+) _&DQDOHV_0'&HQ0RGR$QDOyJLFR_7UXQNLQJ'LJLWDO,'$6ŒN+]_'LJLWDO1;'1ŒN+]
Voting Scan | Fabricado en Ambiente ISO 9001:2008 | IP55 | 5 Años de Garantía
,175Ì16(&$0(17(6(*852 &DUDFWHUtVWLFDV ‡GPS (en transmisión sólo con HM-170GP).
9(56,Ð1',6321,%/(&21%$7(5Ì$%3)0 ‡Troncal LTR / convencional. ‡$XWRWUDQVPLVLyQUHPRWD 5DGLR(VStD 
‡3DQWDOODGHFDUDFWHUHVDOIDQXPpULFRV ‡5DGLR.LOO
/LVWRSDUD*36con HM-170GP ‡Gran amplificador de audio BTL (Bridge Tied Load).
‡Número de serie electrónico (ESN). Señalización MDC-1200:
‡3DVVZRUGGHHQFHQGLGROHFWXUD\HVFULWXUD ‡PTT-ID.
‡&DQGDGRFRQWUDOHFWXUD ‡,GHQWLILFDFLyQHQSDQWDOOD $1, 
‡Llamada de emergencia inteligente. ‡Llamada selectiva, de grupo y alerta (Tx/Rx).
‡Inversor de voz básico incluido. ‡Supervisión remota de radio vía aire (Radio Check/ Tx/Rx).
‡Batería de Li-Ion de 2300 mAh. ‡Desactivación y activación vía aire (Stun, Revive/ Tx/Rx).
‡Cuenta con puertos para tarjetas opcionales (encriptores ‡Llamada de emergencia inteligente (Tx/Rx).
ICOM, Midian o Transcrypt). ‡Mensajes de estatus (Tx/Rx).
‡6RIWZDUHGHSURJUDPDFLyQ&6))
‡)XQFLyQ9RWLQJ6FDQ 6HxDOL]DFLyQ7RQRV
‡PTT-ID.
&DUDFWHUtVWLFDVHQ'LJLWDO1;'1ŒN+] ‡,GHQWLILFDFLyQHQSDQWDOOD $1, 
‡2SHUDFLyQGLJLWDODQDOyJLFRRPH]FODGR ‡Llamada selectiva y de grupo (Tx/Rx).
‡Operación trunking digital (30 canales, 2000 ID). ‡Autotransmisión remota (Radio Espía/ Tx/Rx).
‡PTT-ID en NXDN™. ‡Llamada de emergencia (Tx/Rx).
‡Llamada selectiva, de grupo y alerta. ‡Supervisión remota de radio (Radio Check/ Tx/Rx).
‡Llamada de emergencia inteligente ‡Radio Kill (Tx/Rx).
‡(QFULSWDFLyQGLJLWDO1;'1Œ FyGLJRV  ‡Desactivación y activación vía aire (Stun, Revive/ Tx/Rx).
‡Supervisión remota de radio vía aire.
‡Desactivación y activación vía aire (Stun, Revive). 6HxDOL]DFLyQ'70)
‡Envío y recepción de mensajes de texto (mensaje de ‡PTT-ID.
encendido y apagado). ‡,GHQWLILFDFLyQHQSDQWDOOD $1, 
‡63 códigos de acceso RAN. ‡Llamada de emergencia.

2SHUDHQ6LVWHPDV0XOWLVLWLR&RQYHQFLRQDO,37UXQNLQJ0RQRVLWLR\0XOWLWUXQN
)UHFXHQFLD &DQDOHV 3RWHQFLD DTMF
Versión DTMF ,&)'6   ă 86 136-174 MHz 512 5W No
Disponible
,&)'7  ă 86 136-174 MHz 512 5W Sí
,&)'6   ă 86 400-470 MHz 512 5W No
,&)'7   ă 86 400-470 MHz 512 5W Sí
,&)'6   ă 86 450-512 MHz 512 5W No
,&)'7   ă 86 450-512 MHz 512 5W Sí
3UHJXQWHSRUGLVSRQLELOLGDG
9HUVLyQ,6 ,QWUtQVHFDPHQWH6HJXUR )UHFXHQFLD &DQDOHV 3RWHQFLD DTMF
,&)'6 ă 86 136-174 MHz 512 5W No
,&)'7 ă 86 136-174 MHz 512 5W Sí
,&)'6 ă 86 400-470 MHz 512 5W No
,&)'7 ă 86 400-470 MHz 512 5W Sí
,&)'6 ă 86 450-512 MHz 512 5W No
,&)'7 ă 86 450-512 MHz 512 5W Sí
3URGXFWRVREUHSHGLGR

$FFHVRULRV,QFOXLGRV
)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3+ă86 Batería Li-Ion, 2300 mAh.
5$',26,&20

%3FM ă86 Batería Li-Ion, 2000 mAh (versión ,QWUtQVHFDPHQWH6HJXUR).


%&ă86 Cargador rápido de escritorio. Incluye adaptador de corriente (BC-145S).
0%ă86 Clip deslizable para 43TR/ 3013/ 4013/ 3021/ 4021/ 3031/ 4031/ 3230/ 4230.
(QODFRPSUDGHUDGLRYHUVLyQ,6LQFOX\HEDWHUtD%3)0

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
66%&ă86 Cargador vehicular para IC-F3161/ 4161/ 3261/ 4261/ DS/ DT con batería BP232H,WP.
%&ă86 Cargador estándar de escritorio.
6+,ă86 Interfaz de programación para F50/ 60/ V/ IC-F3161/ 4161/ DS/ DT.
6386%ă86 Programador universal de móviles y portátiles ICOM/KENWOOD para puerto USB (req. SHI-966).
„,&)'6'7 23&ă86
+0*3ă86
Interfaz de programación para F50/ 60/ V/ IC-F3161/ 4161/ DS/ DT.
Micrófono de solapa GPS.
'LPHQVLRQHV53 x 136 x 38.9 mm. %&ă86 Multicargador para batería BP-232N, H y WP.
3HVR: 338 g con batería BP-232H.
+0ă86 Micrófono de solapa uso rudo.
9(50É6$&&(625,26Págs. 83 - 144 Dimensiones: Ancho x Alto x Profundidad.

70 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Digitales

,&)'6'7‡5DGLR'LJLWDO6XPHUJLEOHFRQ*36,QWHUFRQVWUXLGR
: 9+)8+) _&DQDOHV_0'&HQ0RGR$QDOyJLFR_7UXQNLQJ'LJLWDO,'$6ŒN+]_'LJLWDO1;'1ŒN+]
Voting Scan | Fabricado en Ambiente ISO 9001:2008 | 5 Años de Garantía | 680(5*,%/(,3
&DUDFWHUtVWLFDV 6HxDOL]DFLyQ0'&
*36,17(5&216758,'2 ‡Cumple Norma IP67 sumergible (1 m x 30 min). ‡PTT-ID (Tx/Rx).
‡800 mW de potencia de audio. ‡,GHQWLILFDFLyQHQSDQWDOOD $1,5[ 
‡*36LQWHUFRQVWUXLGR ‡Llamada selectiva, de grupo y alerta(Tx/Rx).
‡Troncal LTR / convencional. ‡Supervisión remota de radio vía aire (Radio Check/ Tx/Rx).
‡3DQWDOODGHFDUDFWHUHVDOIDQXPpULFRV ‡Llamada de emergencia inteligente(Tx/Rx).
‡Número de serie electrónico (ESN). ‡Mensajes de estatus(Tx/Rx).
‡3DVVZRUGGHHQFHQGLGROHFWXUD\HVFULWXUD
‡&DQGDGRFRQWUDOHFWXUD 6HxDOL]DFLyQ7RQRV
‡Llamada de emergencia inteligente. ‡PTT-ID(Tx/Rx).
‡Inversor de voz básico incluido. ‡,GHQWLILFDFLyQHQSDQWDOOD $1,5[ 
‡Batería de Li-Ion de 2300 mAh. ‡Llamada selectiva y de grupo (Tx/Rx).
‡6RIWZDUHGHSURJUDPDFLyQ&6)) ‡Autotransmisión remota (Tx/Rx).
‡Llamada de emergencia (Tx/Rx).
&DUDFWHUtVWLFDVHQ'LJLWDO1;'1ŒN+] ‡Supervisión remota de radio (Radio Check/ Tx/Rx).
‡2SHUDFLyQGLJLWDODQDOyJLFRRPH]FODGR ‡Radio Kill (Tx/Rx).
‡ Operación trunking digital (30 canales, 2000 ID). ‡Desactivación y activación vía aire (Stun, Revive/ Tx/Rx).
‡PTT-ID en NXDN™.
‡Llamada selectiva, de grupo y alerta. 6HxDOL]DFLyQ'70)
‡Llamada de emergencia inteligente ‡PTT-ID.
‡(QFULSWDFLyQGLJLWDO1;'1Œ FyGLJRV  ‡,GHQWLILFDFLyQHQSDQWDOOD $1, 
‡Supervisión remota de radio vía aire. ‡Llamada de emergencia.
‡5DGLR.LOO
‡'HVDFWLYDFLyQ\DFWLYDFLyQYtDDLUH 6WXQ5HYLYH 
‡Envío y recepción de mensajes de texto (mensaje de
encendido y apagado).
‡63 códigos de acceso RAN.
‡Autotransmisión remota (Radio Espía).
2SHUDHQ6LVWHPDV0XOWLVLWLR&RQYHQFLRQDO,37UXQNLQJ0RQRVLWLR\0XOWLWUXQN
*36 )UHFXHQFLD &DQDOHV 3RWHQFLD
,&)'6ă 86 No 136-174 MHz 512 5W
,&)'6ă 86 Sí 136-174 MHz 512 5W
,&)'6ă 86 No 400-470 MHz 512 5W
,&)'6ă 86 Sí 400-470 MHz 512 5W
,&)'6ă 86 No 450-512 MHz 512 5W
,&)'6ă 86 Sí 450-512 MHz 512 5W
9HUVLyQFRQ7HFODGR'70)
,&)'7ă 86 No 136-174 MHz 512 5W
,&)'7ă 86 Sí 136-174 MHz 512 5W
,&)'7ă 86 No 400-470 MHz 512 5W
,&)'7ă 86 Sí 400-470 MHz 512 5W
,&)'7ă 86 No 450-512 MHz 512 5W
,&)'7ă 86 Sí 450-512 MHz 512 5W

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

5$',26,&20
FA-SC55V FA-SC57U/ FA-SC72U BP-232WP BC-160-11
Incluye clip de resorte (MB-94R).
)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3:3ă86 Batería Li-Ion, 2300 mAh. Cumple con norma IP67 (sumergible).
%&ă86 Cargador rápido de escritorio. Incluye adaptador de corriente (BC-145S).
18(92
„ ,&)'6'7 $FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
%&ă86 Multicargador para batería BP-232N, H y WP.
'LPHQVLRQHV53.5 x 142.7 x 39.5 mm.
3HVR: 370 g con batería BP-232WP. 23&ă86 Interfaz de programación para IC-F3261/4261/DS.
66%&ă86 Cargador vehicular para IC-F3161/ 4161/ 3261/ 4261/ DS/ DT con batería BP232H,WP.
9(50É6$&&(625,26Págs. 83 - 144 1&)6ă86 Funda de nylon con clip para IC-F3261/4261.
1&)7ă86 Funda de nylon con clip para IC-F3261/4261.
IPX7: Sumergible 1 m x 30 min. | IPX8: Sumergible 1.5 m x 30 min. Dimensiones: Ancho x Alto x Profundidad.

Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx 71
Radios Portátiles Digitales Año 2016

,&)'6'7‡/D0HMRU7HFQRORJtDHQOD3DOPDGHVX0DQR
:9+)\8+)_&DQDOHV_0'&_'LJLWDO1;'1ŒN+]_7UXQNLQJ7LSR&
Fabricado en Ambiente ISO 9001:2008 | 5 Años de Garantía | 680(5*,%/(,3

&DUDFWHUtVWLFDV
‡&RPSDWLEOHHQVLVWHPDVWUXQNLQJGH.(1:22' ‡800 mW de potencia de audio.
1(;('*(Œ  ‡Encriptación de 32.767 códigos de15 bits.
‡2SHUDHQPRGRFRQYHQFLRQDOWUXQNLQJWLSR&\ ‡512 canales / 128 zonas de operación.
PXOWLWUXQNWLSR& ‡Opera en 12.5 y 6.25 kHz.
‡&XHQWDFRQUHFHSWRUGH*36LQWHUFRQVWUXLGR ‡5 W de potencia en VHF y UHF.
‡(QYtRGHDOLDVDODLUH 2YHUWKH$LU$OLDV  ‡Permite llamadas individuales de grupo y generales
‡,QGLFDGRUGH*36HQSDQWDOOD ‡Envío de mensajes de texto.
‡Cuenta con sensor de movimiento en caso de emergencia. ‡Llamadas de emergencia.
‡Sumergible IP67 (1 m por 30 min). ‡Stun/ Revive (Rx).

*36 )UHFXHQFLD &DQDOHV 3RWHQFLD


,&)'6 ă 86 Sí 136-174 MHz 512 5W
,&)'6 ă 86 Sí 400-470 MHz 512 5W
,&)'7 ă 86 Sí 400-470 MHz 512 5W
3UHJXQWHSRUGLVSRQLELOLGDG

$FFHVRULRV,QFOXLGRV
$QWHQD9+)8+) %DWHUtD &DUJDGRU

FA-SC55V FA-SC57U/ FA-SC72U BP-232WP BC-160-11


Incluye clip de resorte (MB-94R).
)$6&9ă86 Antena VHF (incluida en el modelo de la banda de 136 - 174 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 400 - 470 MHz).
)$6&8ă86 Antena UHF (incluida en el modelo de la banda de 450 - 512 MHz).
%3:3ă86 Batería Li-Ion, 2300 mAh. Cumple con norma IP67 (sumergible).
%&ă86 Cargador rápido de escritorio. Incluye adaptador de corriente (BC-145S).

$FFHVRULRV2SFLRQDOHV 1R,QFOXLGRV
%&ă86 Multicargador para batería BP-232N, H y WP.
23&ă86 Interfaz de programación para IC-F3261/4261/DS.
66%&ă86 Cargador vehicular para IC-F3161/ 4161/ 3261/ 4261/ DS/ DT con batería BP232H,WP.
1&)6ă86 Funda de nylon con clip para IC-F3261/4261/S.
1&)7ă86 Funda de nylon con clip para IC-F3261/4261/T.

6,67(0$7581.,1*7,32&
5$',26,&20

2SHUDHQ6LVWHPD7UXQNLQJ7LSR&
El sistema trunking tipo C es el que para
su operación utiliza un canal de control
permitiendo un acceso rápido al sistema y mejor
administración de los canales.
18(92
„,&)'6'7
'LPHQVLRQHV53.5 x 142.7 x 39.5 mm.
3HVR: 400 g.

9(50É6$&&(625,26Págs. 83 - 144

3DUDPiVLQIRUPDFLyQFRPXQLFDUVHDOGHSDUWDPHQWRGHLQJHQLHUtD
Dimensiones: Ancho x Alto x Profundidad.

72 Enlaces Inalámbricos y Radiocomunicación - Guía de Soluciones 2016 ‡ Consulte el tipo de cambio del día en: www.syscom.mx
Año 2016 Radios Portátiles Digitales

,&)'(;'(;‡5DGLR'LJLWDO)DEULFDGR(VSHFLDOPHQWHSDUD$PELHQWHV([SORVLYRV
:9+)8+)_&DQDOHV_'LJLWDO1;'1ŒN+]_)DEULFDGRHQ$PELHQWH,62
Voting Scan | 5 Años de Garantía | 680(5*,%/(,3
&DUDFWHUtVWLFDV
‡&XHQWDFRQFHUWLILFDGR,(&([$7(;
‡6XPHUJLEOH,3 PSRUPLQ 
‡Opera en modo multisitio y trunking tipo D.
‡Encripción de 32,767 códigos.
‡)XQFLyQGH0DQ'RZQ\/RQH:RUNHUSURJUDPDEOHV
‡16 canales de memoria con anunciador de canal.
‡Compatible con 5 tonos y MDC-1200.
‡3 botones programables vía software.
‡)XQFLyQGH9RWLQJ6FDQ

&DUDFWHUtVWLFDV1;'1Œ
‡PTT ID en NXDN™.
‡Radio Check (Rx).
‡Radio monitor (Rx).
‡Envío de estatus de encendido y apagado (Tx).
‡Stun/ Kill/ Revive (Rx).
‡Envío de emergencia (Tx).
‡Llamada de alerta (Rx).

La directiva ATEX surge en Europa, se encarga de regular los