Está en la página 1de 258

2

11,12y13deMarzode2013

ISBN: 978 - 84 - 9031 - 861 - 4


IIFORODEINVESTIGADORESNOVELES
FACULTADDEPSICOLOGA.UNED

PresidentedeHonor:
Dr.D.MiguelAngelSantedGermn

Comitorganizador
Presidenta:
Dra.DMCarmenPrezLlantada

DirectorTcnico:
Dr.D.AndrsLpezdelaLlave

Secretario:
D.JavierIbiasMartn

Vocales:
Dr.D.AntonioCrespoLen
Dra.D.LauraMndezZaballos
Dr.D.JuanAntonioMorianoLen
Dra.D.AnaMaraLisbonaBauelos
Dra.D.CarmenDazMardomingo
Dra.D.PilarQuirsExpsito
Dr.D.JosMaraMerinoMerino
Dra.D.FaniaIziarHerreroGonzlez
ComitCientfico
Presidente:
Dr.D.EmilioAmbrosioFlores

Miembros:
RepresentantesdelacomisindeinvestigacindelosDepartamentosdelaFacultad.

2013Diseoymaquetacin:JavierbiasMartnyAndrsLpezdelaLlave

NDICE:

PRESENTACIN:..
PROGRAMA:Resumendelassesiones.

Lunes11deMarzode2013
15,30h
SIMPOSIO:PSICOLOGASOCIALYDELASORGANIZACIONES
Coordinadora:Dra.AmparoOscaSegovia...
17,00h
SIMPOSIO:PSICOBIOLOGA
Coordinadora:Dra.MCarmenGarcaLecumberri.
18,00h
SIMPOSIO:PSICOLOGABSICAII
Coordinadora:Dra.MDoloresMartnDaz.

Martes12deMarzode2013
16,00h
SIMPOSIO:PERSONALIDAD,EVALUACINYTRATAMIENTOS
PSICOLGICOSCoordinadora:Dra.AnaMPrezGarca..
17,30h
SIMPOSIO:PSICOLOGABSICAI
Coordinador:Dr.JorgeCastroTejerina..

Mircoles13deMarzode2013
15,30h
SIMPOSIO:PSICOLOGAEVOLUTIVAYDELAEDUCACIN
Coordinador:Dra.ManuelRodrguezGonzlez...
16,30h
SIMPOSIO:METODOLOGADELASCIENCIASDELCOMPORTAMIENTO
Coordinador:Dr.AndrsLpezdelaLlave..
Martes12deMarzode2013;15,30h
SESINDEPSTER:
Coordinadora:Dra.MCarmenPrezLlantada.

TRABAJOSCOMPLETOS.

7
9

11

25

35

43

55

67

75

79
97

PRESENTACIN

Esteesunlibroderesmenesuntantoespecial;yesasporquerecogelasaportaciones
demuchosdelosinvestigadoresnovelesnodoctoresvinculadosanuestraFacultada
travs de los estudios correspondientes al DEA, de los trabajos fin de Mster, de
proyectos de investigacin Tesis doctorales y de Trabajos del Practicum de
Investigacin.
TodosellosfueronconvocadosalIIForodeInvestigadoresNovelesdelaFacultadde
Psicologa de la UNED (marzo de 2013) siendo, para muchos, la primera vez que se
enfrentabanalprocesodeelaboracinypresentacindeunainvestigacinenunforo
cientfico.
Adems de promover dicho reto, la convocatoria pretende facilitar un contexto en el
queestosinvestigadorespuedanponerencomnsusexperienciasydebatirlostemas
actualesenlosqueestninmersos.
La UNED nos proporciona un marco de trabajo en el que las presentaciones pueden
realizarsedemodopresencialoatravsdeentornos(aulas)virtuales,demodoquelos
estudiantesyprofesores,tantodenuestropascomodeotrospasesquenoasistanal
Foropuedanparticiparigualmente.
Endefinitiva,elFororecogeuntotalde50comunicacionesorales(41presencialesy9
online),yuntotalde16posters(9presencialesy7online).
Seanmispalabrasfinalesparaalentar,atodoslosinvestigadoresqueconcurrenaeste
encuentro, a no perder de vista la necesidad del estudio concienzudo, la prctica del
rigor y la honestidad cientficas, as como la bsqueda de la relevancia y la funcin
socialdenuestroquehacercientfico.

Madrid,febrerode2013
MiguelA.SantedDecanodelaFacultaddePsicologa,UNED

RESUMENDELASSESIONES

SIMPOSIO:

PSICOLOGASOCIALYDELASORGANIZACIONES

Coordinadora:Dra.AmparoOscaSegovia

12

PSICOLOGA SOCIAL Y DE LAS ORGANIZACIONES

TESTDEASOCIACINIMPLCITAYCOMPORTAMIENTO
ESTEREOTPICAMENTEASOCIADOCONLOSGRUPOSDEEDAD

Carvajal,J.;Bustillos,A.

Elpresenteestudiosecentraendelimitarlasrelacionesentredistintasmedidasautomticasy
controladas en torno a la frecuencia de comportamiento que estereotpicamente se asocia con
losgruposdeedad.Paraesefin,untotalde597estudiantesdepsicologa(79%mujeres),con
una media de edad de 31,16 aos (DT =9,69) completaron los cuestionarios relativos a la
identificacin con grupo de edad, uso del tiempo y un test de asociacin implcita, relativo a
una preferencia automtica por jvenes y mayores. Los resultados mostraron que la
identificacin con edades mayores se relaciona con una mayor preferencia automtica por el
grupodemayores,peronoporeldejvenes.Asimismo,unamayorpreferenciaautomticapor
el grupo de mayores se encuentra positivamente relacionada con el comportamiento
estereotpicamente asociado a los adultos mayores; pero, no con el comportamiento
estereotpicamenteasociadoconlosjvenes.Finalmente,seconsideraelpapelmediadordela
identificacinconelgrupodeadultosmayorescomovariablemediadoraenelaumentodela
frecuenciadeconductasestereotpicamenteasociadasalosadultosmayores.

javivi.cg@gmail.com

13

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

ESTRESORESORGANIZACIONALESYBURNOUTENUNAMUESTRADE
AGENTESDEPOLICA

Adn,A.J.;Moriano,J.A.

El objetivo del estudio consisti en la identificacin y medicin de los factores de riesgo


psicosocialmtododelINSHT,ydelosnivelesde/burnout/medianteelMBIdeMaslachy
Jackson(1986),entre89agentesdelC.N.P.enlasOficinasdeDenunciaenMadrid.Asimismo,
secompararondiversosmodeloscausalesmediantelatcnicaPLSconSmartPLS.
Losfactoresderiesgopsicosocialquemostraronnivelesnocivos,segnelINSHT,fueron:Carga
Mental,SupervisinParticipacinyRelacionesPersonales.
Lamedicinde/burnout/indicqueun46,10%delosagentes(frenteaun53,90%)satisfacan
loscriteriosdediagnstico(GilMonteyPeir2000).
Finalmente, el modelo causal final consider las existencia de relaciones directas entre dos
variableslatentesexgenas,una,FactoresdeRiesgoformadaporDefinicindeRol,Relaciones
Personales y SupervisinParticipacin; y Antigedad en el Puesto, y tres variables latentes
exgenas (las dimensiones de /burnout/): Cansancio Emocional, Despersonalizacin y
RealizacinPersonal.

jadan@infonegocio.com

14

PSICOLOGA SOCIAL Y DE LAS ORGANIZACIONES

CONFLICTOTRABAJOFAMILIA,AUTOEFICACIAPROFESIONALYBURNOUT
ENMILITARES:UNESTUDIOLONGITUDINAL

Rubio,J.C.;Osca,A.

Los objetivos de este trabajo son analizar las relaciones entre el estrs derivado del conflicto
trabajofamilia(CTF)yelburnout,ascomoidentificarelpapeldelaautoeficaciaprofesionalen
estarelacin.Setratadeunestudiolongitudinalcondosrecogidasdedatosrealizadoconuna
muestrademilitaresespaoles(n=242).
SepartedelosmodelosOccupationalStressIndicator(1988)yDemandasyRecursosLaborales
(2008),enlosquesepostulaquelainfluenciadelestrssobrelasaludpuedeestarreguladapor
variables personales. Los resultados confirman la hiptesis de que el estrs influye
negativamente en el burnout y que la autoeficacia profesional se relaciona directa y
negativamenteconelburnout,comoseesperaba.
AdemsseconstataunarelacinmoduladaentrelaautoeficaciayelagotamientoenT2.Una
aportacinimportantedelestudioeslarelacinlongitudinalybidireccionalentreelestrsyel
burnout,queevidenciaunprocesodedesarrollocclicoestrs>burnout>estrs.Asimismo,se
contribuyeaesclarecerelpapelmoduladordelaautoeficaciaenlarelacinestrsburnout.

candido.rubio@ideojet.com

15

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

RELACIONESENTRELACOMPLEJIDADDELAUTOCONCEPTOYLA
IDENTIFICACINSOCIALDELOSINMIGRANTESCONLACULTURADE
DESTINO

Toledo,A.;Morales,J.F.

Enesteestudioseanalizalarelacinqueexisteentrelaidentificacinsocialquelosinmigrantes
elaboran con la cultura de destino y otras variables como la complejidad del autoconcepto, el
tiempodeestanciaenelpasdedestino,elpoyosocialpercibido,lasdificultadesdeadaptacin
sufridas y los sntomas de malestar fsicos percibidos por los sujetos inmigrantes. La muestra
estuvo compuesta por sujetos de nacionalidad espaola y boliviana, y los resultados indican
quelacomplejidaddelautoconceptoinfluye,endiferentesgrados,enesaidentificacin,perono
aseltiempodeestancia.Tambin,queesaidentificacinactacomofactorsobreelgradode
sintomatologafsicapercibidaysobrelapropiaadaptacinsocialdelcolectivoinmigrante.

andrestoledo2@yahoo.es

16

PSICOLOGA SOCIAL Y DE LAS ORGANIZACIONES

ELEFECTODELAAMENAZADELESTEREOTIPOENELRENDIMIENTODE
LASMUJERESENTAREASMATEMTICAS

Prez,D.;Bustillos,A.;Molero,F.

Con objeto de comprobar si el efecto de la amenaza del estereotipo en tareas matemticas se


reproducaenlasuniversitariasespaolasysielhechoderevelarlaexistenciadedichoefectoa
las participantes las protega contra el descenso en su rendimiento, realizamos una
investigacin con 110 estudiantes (49 mujeres) de la facultad de Ciencias Econmicas de la
UCM en la que tuvieron que responder a una escala matemtica, bien bajo la condicin de
amenaza o bien bajo la condicin de amenaza revelada. Nuestros resultados indican un
descensoentrelanotadeselectividadylanotaobtenidaenlaescalatantoenhombrecomoen
mujeres, pero mayor en stas. El mayor descenso (tres puntos) se encuentra en el grupo de
mujeres asignadas a la condicin de amenaza, y est moderado por su nivel de ansiedad
matemtica. La ansiedad matemtica afecta slo al rendimiento de las mujeres de esta
condicin.

dapgarin@gmail.com

17

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

SITUACINLABORALENPROFESIONALESSANITARIOS,EFECTOR
MEDIADORDELAPOYOEIDENTIFICACINGRUPALSEGNELTIPODE
ORGANIZACIN

Herriz,V.;Topa,G.

Lostrabajadoresdesectorsanitariopresentanelevadosriesgospsicosociales.
Elobjetivodeesteestudioesvalorarelgradodeestrslaboralentrabajadoresdelasaludyla
influencia del apoyo e identificacin grupal dentro del modelo ERIDER (Effort Reward
Imbalance).
Materialymtodo
Estudio transversal, descriptivo sobre una muestra de profesionales de la salud espaoles.
(N=104). Se administr cuestionario con las escalas: ERI, apoyo grupal, identificacin grupal,
NAQyescaladejusticiaorganizacional.Resultados.
La muestra presenta un nivel de acoso laboral por debajo de la media esperable. Por el
contrario el apoyo e identificacin grupal presentan valores superiores. No encontramos
diferencias por sexos.. En organizaciones privadas perciben significativamente menor
recompensaascomotendenciaalasignificacinenlaescaladeapoyogrupal.
Conclusiones
La identificacin y apoyo grupal pueden ser elementos protectores ante los riesgos
psicosocialesenprofesionalessanitarios.Lostrabajadoresdeorganizacionesprivadaspueden
presentarmayoresriesgospsicosociales.

veroherraiz73@gmail.com

18

PSICOLOGA SOCIAL Y DE LAS ORGANIZACIONES

LIDERAZGOAUTNTICOYSUEFECTOENLOSCOMPORTAMIENTOSDE
CIUDADANAORGANIZACIONALDELOSEMPLEADOS(OCB)

Ed,S.;Moriano,J.A.;Molero,F.;Topa,G.

Los estudios que han probado asociacin positiva del Liderazgo Autntico con los OCB han
empleadomedidasglobalesdeambosconstructos.Estetrabajopretendeprofundizarmsenel
efectodelLiderazgoAutnticosobrelosOCB,concentrndoseenanalizarlarelacinespecfica
de sus cuatro componentes con las dimensiones individual y organizacional de los OCB. Los
participantes de este estudio cuasi experimental fueron 220 empleados espaoles (30,9%
hombres y 69,1% mujeres) que respondieron a un cuestionario compuesto por las variables a
estudiar: Liderazgo Autntico, Comportamientos de Ciudadana Organizacional y variables
sociobiogrficas. Los resultados obtenidos mediante anlisis de regresin mltiple stepwise
indican que dos componentes del liderazgo autntico perspectiva moral y transparencia
relacionalserelacionansignificativamenteconlosOCB.
Adicionalmente,elliderazgoautnticoesmejorpredictordelosOCBdelosseguidorescuando
estos comportamientos son impersonales y estn dirigidos a la organizacin en s misma que
cuando estn dirigidos a personas. Estos resultados tienen implicaciones prcticas para la
gestin de los recursos humanos en las organizaciones, especialmente en los procesos de
seleccinyformacindedirectivos.

sergio.eduvalsania@gmail.com

19

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

LIDERAZGOTRANSFORMACIONAL:IDENTIFICACINORGANIZACIONAL,
RELACIONESINTERGRUPALESYSATISFACCINLABORAL

Morgades,C.I.;Molero,F.J.

Elobjetivodelestudioesanalizarlasposiblesrelacionesentreelliderazgotransformacionaly
algunas variables relevantes: importancia otorgada por los empleados al liderazgo,
identificacindeltrabajadorconlaorganizacin,relacionesentrecompaerosysatisfaccinen
elmbitolaboral.Participarontrecegruposdetrabajadores,cadaunodirigidoporunlder,de
los cuales, siete pertenecen a administraciones pblicas y seis a empresas privadas. Los
participantes cumplimentaron un cuestionario dedicado a medir las variables estudiadas. A
mayor liderazgo transformacional, seran previsibles mejores relaciones entre compaeros y
mayoridentificacinysatisfaccin.
Lahiptesisseconfirma,aunquenoenelmismogradoparatodaslasvariables.Sehallamayor
relacindirectaentreelestilotransformacionaldeliderazgoylasatisfaccindeltrabajadorenel
mbitolaboral.Seencuentraquequienespertenecenaunaorganizacinprivadaseidentifican
constaenungradosignificativamentemayorquequienespertenecenaunaempresapblica.

clara_zgz88@hotmail.com

20

PSICOLOGA SOCIAL Y DE LAS ORGANIZACIONES

LAINDUCCINDEEMPATA,UNMTODOPOCOEFICAZENLA
REDUCCINDELPREJUICIOPATERNALISTA

Abascal,L.;Bustillos,A.

Los objetivos de este estudio se centran comprobar cmo la induccin en empata (Stephan y
Finlay, 1998) puede no ser una intervencin eficaz en la reduccin del prejuicio. Nuestra
hiptesis es que para aquellos grupos a los que se aplica un prejuicio paternalista o protector
(Fiskeycols.2002),porejemploadultosmayores,estetipodetratamientosconllevanunefecto
paradjicodeaumentodelprejuicio.Nuestroprimerexperimento(N=106),confirmanuestra
hiptesis: la manipulacin de toma de perspectiva incide en un aumento del prejuicio
paternalista para el adulto mayor que se comporta de forma estereotpica. Nuestro segundo
experimento(N=60)sereplicanlosresultadosdelestudioprevio,encontrndoseenundiseo
intrasujetoquelainduccinempticaimplicaunaumentodelpaternalismodirigidoaladulto
mayorquesecomportadeformaestereotpica,peronoseaplicaaladultomayorquemuestra
otrotipodecomportamientos.

laura_abascal@hotmail.com

21

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

LIDERAZGOAUTNTICOEINTENCINDEABANDONO.ELPAPEL
MEDIADORDELAIDENTIFICACINCONELGRUPODETRABAJOYEL
ENGAGEMENT

Azanza,G.;Moriano,J.A.;Molero,F.;LvyMangin,J.P.

En este estudio se examina la relacin entre la percepcin de liderazgo autntico de los


trabajadoresysuintencindeabandono,mediadaporlaidentificacinconelgrupodetrabajo
yelengagement.SeutilizelModeladodeEcuacionesEstructuralesparaanalizarlosdatosde
623trabajadoresespaoles.Losresultadosobtenidosmuestranqueelliderazgoautnticotiene
unefectonegativosobrelaintencindeabandonoyefectospositivossobreelengagementyla
identificacin con el grupo de trabajo. La identificacin tiene un fuerte impacto en el
engagement, que a su vez afecta negativamente a la intencin de abandono. Una de las
principales consecuencias que se pueden extraer de este estudio es que los lderes autnticos
pueden influir en la intencin de abandono de los trabajadores promoviendo su engagement.
As, el estudio identifica el autntico liderazgo como un elemento clave para retener a los
empleadosvaliososatravsdelfomentodelengagementdelosmismos.

garazi.azanza@deusto.es

22

PSICOLOGA SOCIAL Y DE LAS ORGANIZACIONES

LIDERAZGOAUTNTICO:EFECTOSSOBRELOSEMPLEADOSDEPYMES
ESPAOLAS

Gonzlez,A.;Moriano,J.A.

La presente investigacin analiza la influencia del estilo de liderazgo autntico de los


emprendedoreseneldesarrollodelcapitalpsicolgicodesusempleadosyelworkengagement
queestosmanifiestan.PartiendodelmodelotericopropuestoporAvolioyGardner(2005),se
profundiza en la relacin directa entre el liderazgo autntico y el work engagement as como
medida por las siguientes dimensiones que componen el capital psicolgico: orientacin
positiva, resilencia, autoeficacia y afecto positivo. Los 165 participantes, empleados de 23
pequeas PYMEs espaolas, han cumplimentado un cuestionario elaborado especficamente
paralainvestigacin.
Losresultadosapoyanelmodelopropuesto,aunquelosanlisisderegresinlinealrealizados
reflejaneldistintopesodecadaunadelasdimensionesdelcapitalpsicolgicoporloqueseha
utilizado tambin la tcnica de mnimos cuadrados parciales (PLS). Estos resultados tienen
implicaciones prcticas en el diseo de programas de formacin en la empresa para
emprendedores.

ag.laguia@gmail.com

23

SIMPOSIO:

PSICOBIOLOGA

Coordinadora:Dra.MCarmenGarcaLecumberri

PSICOBIOLOGA

EVALUACINDELESTRESENADOLESCENTES. RELACINENTRELOS
NIVELESDECORTISOL,VARIABLESDECONDUCTAALIMENTARIAY
DISTINTOSPARMETROSDELAPERSONALIDAD

PerezC.;Venero,C.;Juregui,I.

Elobjetivoprincipaldeestetrabajodeinvestigacinfueevaluarelestrsenadolescentesde15
16aosdeedadycomprobarlarelacinentrelosnivelesdecortisolencontradosensalivacon
variables deconductaalimentaria (tendencia a la delgadez, bulimia,insatisfaccin corporal) y
varios parmetros de personalidad (autoestima, resolucin de problemas, autocrtica, apoyo
social,reestructuracincognitiva,expresinemocional,pensamientodesiderativo,evitacinde
problemas y retirada social), comparando los datos obtenidos en dos periodos acadmicos
distintos: despus y antes de la realizacin de exmenes. La poblacin inicial fue de 103
alumnos y particip en todo el proyecto, medidas, anlisis y test un total de 45 alumnos. Los
resultadosobtenidoshansidoreferidosauntotalde42alumnos:
20desexomasculinoy22desexofemenino,yaque3individuosfuerondescartados.

carolinapl@terra.es

27

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

ESTUDIODELAEXPRESINGNICADELOSPPTIDOSPROENCEFALINAY
PROOPIOMELANOCORTINAENLOSSISTEMASNERVIOSOCENTRALE
INMUNETRASLACONDUCTADEAUTOADMINISTRACIN,EXTINCINY
READQUISICINDECOCANA

SantosToscano,R.;Assis,M.A.;HigueraMatas,A.;RouraMartnez,D.;Ucha,M.;Coria,S.
M.;Selvas,A.;Miguns,M.(2);Ambrosio,E.

Losefectosdelacocanaestnmediadosporelsistemaopioideendgeno,loscualestambin
son sintetizados por las clulas inmunes por lo que es posible que la cocana pueda afectar a
dichosistema,ademsdelsistemanerviosocentral.
El objetivo de este trabajo fue estudiar, mediante la reaccin en cadena de la polimerasa
cuantitativa, cambios en la expresin gnica de los pptidos opioides proencefalina y
proopiomelanocortina,traslasconductasdeautoadministracin,extincinyreadquisicinde
cocanaenratasdelacepaLewis.
Los resultados revelaron que tras la autoadministracin de cocana hubo un aumento de la
expresingnicadelaproencefalinaeneltimoyundescensoenelbazo.Traslaextincin,los
nivelesdisminuyeronsignificativamenteeneltimo,yenelbazosemantuvierondisminuidos.
En la recada, no se afectaron los niveles de este pptido en los rganos inmunes pero se
encontraron reducidos en el ncleo accumbens. El estudio de la proopiomelanocortina no
revel diferencias en ninguna de las reas cerebrales y rganos inmunes. Estos resultados
sugieren que, tras el consumo y la abstinencia de cocana, pueden producirse cambios
diferentes en los niveles de opioides expresados en ciertas clulas inmunes y nerviosas que
puedentenersufuncinenladependenciadecocana.
DepartamentosdePsicobiologayPsicologaBsicaI(2)delaUNED.InvestigacinfinanciadaconayudasdelMinisteriode
EconomayCompetitividad(PSI201020355);MinisteriodeSanidad,ServiciosSocialeseIgualdad(RD12/0028/0020,Redde
TrastornosAdictivosdelInstitutodeSaludCarlosIIIyPlanNacionalsobreDrogas20122015);DireccinGeneralde
InvestigacindelaComunidaddeMadrid(S2011/BMD2308;ConsorcioI+DCANNABCM);ylaUNED(PlandePromocinde
laInvestigacin)

raquelsantos@psi.uned.es

28

PSICOBIOLOGA

ELAISLAMIENTOSOCIALALARGOPLAZOENHEMBRASOCTODON
DEGUSPRODUCEDFICITENELCONDICIONAMIENTODELMIEDOAL
CONTEXTO,ATROFIADELREACA1HIPOCAMPALYPRDIDASINPTICA
DEPSANCAM

PeredaPrez,I.1;Popovi,N.3;BeatrizBao,B.3,Popovi,M.2;
Madrid,J.A.3;Rol,M.A.3;Venero,C.1

El aislamiento social en la edad adulta se considera un factor de estrs psicosocial que se ha


asociado con alteraciones endocrinas y de comportamiento en diferentes especies. En el
presente trabajo, hemos investigado, en hembras adultas de Octodon degus, los efectos del
aislamientosocialdelargaduracin(5meses)sobreelcondicionamientodelmiedocontextual,
una prueba que depende del hipocampo. Adems, hemos estudiado el volumen de distintas
reasdelhipocampo,ascomolosnivelessinpticoshipocampalesdelamolculadeadhesin
celular neural (NCAM) y su forma polisializada (PSANCAM), dos molculas que juegan un
papelmuyimportanteenprocesosdeaprendizajeymemoria.Nuestroshallazgosindicanque
elaislamientosocialprovocaundficitenlamemoriadelmiedocontextual,disminucinenlos
nivelessinpticosdePSANCAMyatrofiaenelvolumendelreaCA1delhipocampo.
(1)DepartamentodePsicobiologa,UniversidadNacionaldeEducacinaDistancia,Madrid.
(2)DepartamentodeAnatomaHumanayPsicobiologa,FacultaddeMedicina,UniversidaddeMurcia,Murcia.
(3)DepartamentodeFisiologa,FacultaddeBiologa,UniversidaddeMurcia,Murcia.

inmapereda@bec.uned.es

29

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

DIFERENCIASGENTICASTRASLAAUTOADMINISTRACINDECOCANA
ENLAMORFOLOGADELASNEURONASDELHIPOCAMPO

Selvas,A.;Coria,S.M.;Kastanauskaite,A.;BallesterosYez,I.;DeFelipe,J.;
Miguns,M.(2);Ambrosio,E.

La exposicin crnica a la cocana induce cambios persistentes tanto en el comportamiento


como en la morfologa neuronal de distintas regiones cerebrales implicadas en la adiccin.
Aunque el hipocampo no se considera como un rea esencial para los trastornos adictivos,
algunasevidenciasapuntanasuposibleimplicacinenlaadiccinalacocana.
Enelpresenteestudio,hemosutilizadolatcnicadeinyeccionesintracelularescombinadacon
microscopia confocal y procedimientos avanzados de anlisis de imagen en 3D para evaluar
posiblesalteracionesenlasneuronaspiramidalesdelCA1delhipocampoendoscepasderatas
(Lewis y Fischer 344) que han sido ampliamente utilizadas como modelo de estudio en la
predisposicin gentica a la adiccin a las drogas. Especficamente, hemos examinado los
efectostras20dasdeautoadministracindecocanaenvariosparmetrosmorfolgicosdelas
espinas en las colaterales de las dendritas apicales del CA1 del hipocampo. Los resultados
mostraron que la autoadministracin de cocana afecta diferencialmente a la densidad y
morfologadelasespinasdendrticasenfuncindelacepaestudiada.
Nuestroestudiosugierequelaadiccinalacocanapodraprovocarcambiosmorfolgicosen
elhipocampodependientesdelagenticadelosindividuos.
DepartamentosdePsicobiologayPsicologaBsicaI(2)delaUNED.InvestigacinfinanciadaconayudasdelMinisteriode
EconomayCompetitividad(PSI201020355);MinisteriodeSanidad,ServiciosSocialeseIgualdad(RD12/0028/0020,Redde
TrastornosAdictivosdelInstitutodeSaludCarlosIIIyPlanNacionalsobreDrogas20122015);DireccinGeneralde
InvestigacindelaComunidaddeMadrid(S2011/BMD2308;ConsorcioI+DCANNABCM);ylaUNED(PlandePromocinde
laInvestigacin)

bramwald@gmail.com

30

PSICOBIOLOGA

EXPRESINDELSISTEMAENDOCANNABINOIDEENCEPASDERATACON
DIFERENTEVULNERABILIDADFRENTEADROGASDEABUSO

RouraMartnez,D.;HigueraMatas,A.;Ucha,M.;Coria,S.M.;SantosToscano,R;,Assis,
M.A;,Selvas,A.;Miguns,M.(2);Ambrosio,E.

LascepasderataLewisyFischer344(F344)sonunmodeloanimaldevulnerabilidaddedrogas
de abuso debido a que siendo histocompatibles presentan comportamientos diferentes en
respuestaalasmismas.Seconocendiferenciasensussistemasdeneurotransmisin(glutamato,
GABA). Como el sistema endocannabinoide (eCB) est ntimamente relacionado con stos,
nuestro propsito fue estudiar sus diferencias entre ambas cepas. Se cuantificaron, mediante
RTqPCR, los niveles de expresin de ARNm de receptores (CB1, GPR55) y enzimas (FAAH,
NAPEPLD, MAGL, DAGL ) en corteza prefrontal y ncleo accumbens. Tambin se realiz
autorradiografa con el ligando [3H]CP 55.940 para medir unin a receptores. Los resultados
indicaronque,encomparacinconlasratasLewis,lasF344tienenmenoresnivelesdeFAAH,
MAGL, CB1 y mayor ratio NAPEPLD/FAAH en corteza prefrontal, as como mayor unin a
receptores en globo plido lateral. Estos resultados podran explicar parte de las diferencias
conductualespresentadasporambascepas.
DepartamentosdePsicobiologayPsicologaBsicaI(2)delaUNED.InvestigacinfinanciadaconayudasdelMinisteriode
EconomayCompetitividad(PSI201020355);MinisteriodeSanidad,ServiciosSocialeseIgualdad(RD12/0028/0020,Redde
TrastornosAdictivosdelInstitutodeSaludCarlosIIIyPlanNacionalsobreDrogas20122015);DireccinGeneralde
InvestigacindelaComunidaddeMadrid(S2011/BMD2308;ConsorcioI+DCANNABCM);ylaUNED(PlandePromocinde
laInvestigacin)

puck_imidazol@hotmail.com

31

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

ESTUDIODELSISTEMAINMUNITARIODERATASDELARAZALEWISCON
DISTINTOSNIVELESDEIMPULSIVIDAD

Ucha,M.;HigueraMatas,A.;Assis,M.A.;RouraMartnez,D.;Coria,S.M.;
Selvas,A.;Miguns,M.(2);Ambrosio,E.

La impulsividad es un rasgo de la personalidad que ha sido implicado en varias patologas


comoelTrastornodeDficitdeAtencinconHiperactividad(TDAH),eltrastornobipolaroel
abuso de sustancias. En este estudio piloto, se evalu la impulsividad de las ratas de la raza
Lewis por medio del paradigma de descuento por demora y se analizaron los niveles
sanguneos de diferentes poblaciones de clulas inmunes y la expresin en ellas de los
receptores D5 dopaminrgico y CB2 cannabinoide. Los resultados apuntaron a una relacin
entre impulsividad y expresin del receptor D5 en monocitos y granulocitos. Ms
concretamente, se evidenci una correlacin negativa entre el parmetro de impulsividad
medido y el porcentaje de las citadas clulas que expresaron el receptor D5. Sin embargo, los
nivelesdeexpresindelreceptorenlosgranulocitoscorrelacionaronpositivamenteconelrasgo
impulsividad en estos animales. En cuanto al receptor CB2, no se observ ningn efecto
significativo. Estos datos sugieren que debe considerarse tambin la posibilidad de una
inmunomodulacindopaminrgicaenlaaparicindeciertostiposdeimpulsividad.
DepartamentosdePsicobiologayPsicologaBsicaI(2)delaUNED.InvestigacinfinanciadaconayudasdelMinisteriode
EconomayCompetitividad(PSI201020355);MinisteriodeSanidad,ServiciosSocialeseIgualdad(RD12/0028/0020,Redde
TrastornosAdictivosdelInstitutodeSaludCarlosIIIyPlanNacionalsobreDrogas20122015);DireccinGeneralde
InvestigacindelaComunidaddeMadrid(S2011/BMD2308;ConsorcioI+DCANNABCM);ylaUNED(PlandePromocinde
laInvestigacin)

marketo@gmail.com

32

PSICOBIOLOGA

EFECTODELAAUTOADMINISTRACINDEMORFINAENRATASLEWISY
FISCHER344SOBRELASPOBLACIONESLEUCOCITARIASYLAEXPRESIN
DELRECEPTORDEENDOCANNABINOIDESCB2

Coria,S.M.;Ucha,M.;Assis,M.A.;HigueraMatas,A.;RouraMartnez,D.;SantosSanchez
Toscano,R.;Selvas,A.;Miguns,M.(2);Ambrosio,E.

Existe amplia evidencia cientfica de la interrelacin entre Sistema Nervioso y el Sistema


Inmune,ascomodelaqueexisteenlaneurotransmisinentreelsistemaopioideendgenoyel
endocannabinoide. En este estudio, hemos utilizado machos de dos cepas de rata, Lewis y
Fischer344, que difieren en la susceptibilidad a autoadministrarse sustancias con potencial
adictivo,alasquesometimosaunprogramadeautoadministracindemorfinadurante19das
y15dasdeextincin,paraestudiarporcitometradeflujolainfluenciadeesaconductasobre
distintaspoblacionesleucocitariasysobrelaexpresindelreceptordeendocannabinoidesdel
subtipo CB2, muy presente en el sistema inmune. Encontramos diferencias estadsticamente
significativasenlaspoblacionesbasalesdelinfocitosByTentreambascepasque,sinembargo,
no se modificaron por las conductas de autoadministracin y extincin. No obstante, tras 15
dasdeextincinseprodujounaumentoenambascepasdelaexpresinleucocitariatotaldel
receptorCB2ydelaexpresindeestereceptorenlosmonocitossibienenestasltimasclulas
inmunes slo aument en la cepa Lewis. Estos resultados apuntan a que la abstinencia de
opiceos puede conllevar cambios en los niveles de expresin del receptor CB2 en clulas
inmunes y que puede haber influencias genticas en la expresin diferencial de ese receptor
endocannabinoide.
DepartamentosdePsicobiologayPsicologaBsicaI(2)delaUNED.InvestigacinfinanciadaconayudasdelMinisteriode
EconomayCompetitividad(PSI201020355);MinisteriodeSanidad,ServiciosSocialeseIgualdad(RD12/0028/0020,Redde
TrastornosAdictivosdelInstitutodeSaludCarlosIIIyPlanNacionalsobreDrogas20122015);DireccinGeneralde
InvestigacindelaComunidaddeMadrid(S2011/BMD2308;ConsorcioI+DCANNABCM);ylaUNED(PlandePromocinde
laInvestigacin)

2focas@gmail.com

33

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

EFECTODELCONTENIDOSEXUALDELASPALABRASENELPARPADEO
ATENCIONALEMOCIONAL

Sebastin,R.;Ambrosio,E.;Ruiz,J.M.

El parpadeo atencional (PA) es un efecto observable cuando, en una presentacin rpida de


seriesvisuales(PRSV),enlaqueexistendosobjetivosaserdetectados,ladeteccindelprimero
(O1)reducelaprobabilidaddedeteccindelsegundo(O2).
Dichoefectohasidoutilizadoparaestudiarlaformaenquelosestmulosconcargaemocional
capturanlaatencin.Paraelpresenteestudiosedisearonsecuenciasdeestmulosdondetanto
elO1comoelO2podanserdenaturalezasexualoneutrademaneraequiprobableyeltiempo
de separacin entre ambos estmulos entre 100 ms. y 800 ms. generando un bloque de 128
ensayosaleatorizados.Trasadministrarloaunamuestrade70sujetosuniversitariosseobtiene
quelaspalabrasconcontenidosexualpuedenmodularelPA,obtenindoseefectosdisparesen
funcindelaseparacinentrelosestmulos.Estosresultadossonenmarcadosenelcontextode
losmodelosendosetapas.

rsgsebas@gmail.com

34

SIMPOSIO:

PSICOLOGABSICAII

Coordinadora:Dra.MDoloresMartnDaz

PSICOLOGA BSICA II

ELEXCESODECONTENIDOSENLASPGINASWEB

Mariscal,M.;Cabestrero,R.

El presente trabajo de investigacin se centra en el estudio de la incidencia del exceso de


contenidos(textos,imgenes,iconos,colores)delaspginaswebdeinicio(homepages)enlas
repuestasemocionalesdelosusuariosdeInternet.
SuanlisisseubicadentrodelmarcodelateoratridimensionaldelaemocindelModelode
Lang,atravsdelastresdimensionesemocionalesvalencia,activacinydominancia;haciendo
uso de la herramienta de valoracin SAM (Self Assessment Manikin) como mtodo de
evaluacindelaspginaswebquelosusuariosvisualizaron.
Lahiptesisdepartidaestablecaqueelexcesodecontenidosenlashomepagespodaprovocar
elrechazodelosinternautas.Losresultadosconfirmarontalhiptesisnulaatravsdelanlisis
de los valores de las tres dimensiones afectivas de Lang y de las preferencias de los
participantes;obteniendomejoresvaloracioneslaspginassimples(menoscontenidos)frentea
lascomplejas(mscontenidos).

macarena_mc@yahoo.es

37

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

ALTERACIONESNEUROPSICOLGICASDELPACIENTECONDEPRESIN
UNIPOLAR:UNESTUDIOPILOTODELASALTERACIONESENATENCIN,
MEMORIAYFUNCIONESEJECUTIVAS

Lago,M.T.;Ros,M.

Seprevqueenelao2020ladepresinsealacuartacausamscomndediscapacidadanivel
mundial. El objetivo de esta investigacin consisti en estudiar la presencia de dificultades
cognitivasenpacientescondepresinunipolarleveolevemoderada,encomparacinconun
grupodecontrol,mediantelaevaluacindelaatencin,lamemoriaylasfuncionesejecutivas.
Losresultadosmostraronquepacientesycontrolesnodiferanenelrendimientodelamemoria
inmediata o la inhibicin de la interferencia. Sin embargo, el grupo de pacientes mostr un
rendimiento significativamente peor en los procesos de evocacin libre y consolidacin de la
memoriadiferida,ylaalteracindelosprocesosejecutivosdeatencinalternante,accesoala
memoria semntica y fluidez verbal. En conclusin, los resultados obtenidos difieren
ligeramentedelodescritoenlaliteratura.Sesugierelaseveridaddeltrastornodepresivocomo
variableacontrolarenfuturosestudios.

tlago84@hotmail.com

38

PSICOLOGA BSICA II

EFECTODELENTRENAMIENTOCONVIDEOJUEGOSENLASFUNCIONES
COGNITIVASDELOSMAYORES:UNESTUDIOMETAANALTICO

Toril,P.; Reales,J.M.;Ballesteros,S.

Se realiz un metaanlisis para poner a prueba la hiptesis de que el entrenamiento con


videojuegospodramejorarlasfuncionescognitivasdelosmayores.Doceestudiospublicados
entre 1986 y 2012 se incluyeron en el anlisis. Los resultados mostraron que este tipo de
intervencinconvideojuegostieneefectospositivosenlasfuncionescognitivasdelosmayores.
Lamagnituddeesteefectoestuvomarcadaporvariablesmetodolgicasypersonales,entrelas
que podemos incluir la edad de las personas entrenadas, la complejidad del videojuego y el
tiempodeentrenamiento.

pilartoril@psi.uned.es

39

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

APLICACIONESTERAPUTICASDELMINDFULNESSENPSICOLOGA:
REVISINBIBLIOGRFICA

Espejo,J.F.;Conde,M.

El Mindfulness tambin conocido como Atencin Plena, tiene su origen en las culturas
orientalesyconstituyelaesenciadelasprcticasbudistas.
Desdehaceunasdcadasestempezandoaintegrarseenlaculturaoccidentalysehaaplicado
conxitodesdelapsicologaendiversostrastornoscomoansiedad,estrs,depresin,etc.
Los estudios realizados hasta el momento, han demostrado que aprendiendo a manejar esta
tcnica es posible reducir los niveles de estrs, hace que sea ms sencillo soportar el dolor,
reduce la depresin y facilita el autoconocimiento, aumentando la autoaceptacin y la
autoestima. Esta tcnica ayuda a conocer nuestras propias reacciones desde fuera, con mayor
claridad y perspectiva, pero muy especialmente, ayuda a controlar la mente y todo lo que
sucedeenella.
Es una tcnica que permite reducir el estrs de una forma diferente y por regla general ms
eficazqueotrastcnicasmstradicionales.

paesza@gmail.com

40

EFECTOSDELCOACHINGGRUPALSOBRELOSNIVELESDERESILIENCIAY
DEBIENESTARPERCIBIDOENADULTOS

Ingls,M.T.,Garca,E.

ExisteanpocainvestigacinacercadelimpactoquepuedatenerelCoachingsobrelosniveles
de resiliencia de las personas y sobre su bienestar psicolgico autopercibido. El presente
estudioexaminalosefectosenestasvariablesdeunaintervencindeCoachinggrupal,dirigida
al entrenamiento de habilidades de comunicacin, gestin de conflictos y autogestin de
emociones,enfocadoaunaposibleaplicacintantoprofesionalcomopersonal.

Se realiz un estudio exploratorio. El ANOVA mostr disminuciones significativas en los


nivelesdeafectonegativodelgrupoexperimental,ascomomejorespuntuacionessignificativas
en tres factores protectores de resiliencia (Percepcin de uno mismo, Estructura personal y
Apoyo social) y en el total de la escala. El grupo control mejor significativamente slo en
ApoyoSocialcomofactorprotectorderesiliencia.
Nohubomejoraenbienestarautopercibidoparaningunodelosdosgrupos.

ingles@acem.infonegocio.com

41

SIMPOSIO:

PERSONALIDAD,EVALUACINY
TRATAMIENTOSPSICOLGICOS

Coordinadora:Dra.AnaMPrezGarca

43

PERSONALIDAD EVALUACIN Y TRATAMIENTOS PSICOLGICOS

EVALUACINDESIGNIFICADOSPERSONALESENPSICOTERAPIAA
TRAVSDELATCNICADELAREJILLA

Martn,M.J.

Segn La Teora de los Constructos Personales (TCP) el pensamiento esquizofrnico est


caracterizadoporunasasociacioneslaxasydesorganizadas.Elobjetivoprincipaldeesteestudio
esobservarlascaractersticasdelasrejillasenlaesquizofreniacrnicagraveycompararlascon
un grupo control, as como relacionar los ndices con variables clnicas. Se elicitan los
constructosmedianteunarejillasemiestructurada.Incluimos60sujetos,30encadagrupo.
Laestructuradelarejillamuestraintensidadtotalsimilarenambosgrupos,yenlospacientes
mayor polaridad total y un primer factor que explica un porcentaje cercano al 50% de la
varianza,sealandohaciaunaestructuracognitivargidayunidimensional.Enlaesquizofrenia
lacorrelacinyoactualotrosesprcticamentenula,siendosuperiorenyoactualyoidealyyo
idealotros. En los controles estas correlaciones son positivas y entre el yo actualotros es
significativamentemayorqueenlospacientes.

mjmv66@gmail.com

45

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

POSITIVIDAD,BALANCEAFECTIVOYCONDUCTASDESALUDEN
ADOLESCENTES

Lara,M.D.;Bermdez,J.;PrezGarcaA.M.

La investigacin ha puesto de manifiesto la relacin entre un adecuado balance afectivo (alto


afectopositivoybajoafectonegativo)yunamejorsaludfsicaypsicolgica.Elpresenteestudio
analiz,enunamuestrade106adolescentes(54chicasy52chicos;1217aos)lacontribucina
la relacin entre balance afectivo y conducta saludable del constructo de Positividad. Esta
caractersticadediferenciacinindividualseconceptualizacomolapredisposicindeconducta
relativamenteestableygeneralizablequesubyacealaautoestima,eloptimismoylasatisfaccin
vital,explicandomayorporcentajedevarianzaenconductaqueelatribuidoaestasexpectativas
individual o conjuntamente consideradas. Los resultados mostraron que la relacin entre
balanceafectivoyconductasaludableestabatotalmentemediadaporlaPositividad,deforma
queunaafectividadadecuadafavorecaunamayorPositividadque,alapostre,seasociabacon
mayorfrecuenciadeconductassaludablesdesarrolladasenlamuestradeedadanalizada.

marilolara@telefonica.net

46

PERSONALIDAD EVALUACIN Y TRATAMIENTOS PSICOLGICOS

ESELEMBARAZOUNADULCEESPERA?ESTUDIODESINTOMATOLOGA
ANSIOSA,DEPRESIVAYDERELACINDEPAREJADURANTELA
GESTACIN.

Arnal,B.;Moreno,C.;Ramrez,I.

Elestudioanalizasiexistendiferenciasensintomatologaansiosaydepresivayderelacinde
pareja entre hombres y mujeres en su tercer trimestre de embarazo (grupo de estudio) y
hombres y mujeres con y sin hijos que no esperan ningn beb (grupos control). La muestra
totalesde156participantes.Laansiedad,depresinyrelacindeparejafueronevaluadascon
el STAI, el BDI y la subescala de relaciones con la pareja del EBP, respectivamente. Los
resultadosmuestranausenciadediferenciassignificativasenansiedad/estadoparalosgruposy
el sexo. Los hombres y mujeres del grupo no embarazo sin hijos obtienen puntuaciones ms
altas en ansiedad/rasgo que el resto de los grupos. El grupo de estudio presenta menores
puntuaciones en relacin de pareja y mayores niveles de depresin, siendo las mujeres
embarazadasquienesobtienenpuntuacionessignificativamentemsaltasqueloshombres.

barnalremon@hotmail.com

47

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PERSONALIDAD,AFRONTAMIENTOYCALIDADDEVIDAENENFERMOS
CARDIOVASCULARES

Valls,E.

Este estudio investig la asociacin de la personalidad con el estilo de afrontamiento y la


calidaddevida(CV)en107pacientescardiovasculares(ECV)ysucontribucinconrespectoa
laCV.
Los resultados indicaron que la Estabilidad Emocional predeca un menor uso del
afrontamientocentradoenlaemocin,yunmayorniveldeaceptacindelaenfermedadyde
CV,laAfabilidadseasociconelapoyosocial,ylaExtraversinlohizoconelusodelhumor,
eldesenganchementalylasatisfaccin.
La reevaluacin positiva contribuy a explicar positivamente la satisfaccin; mientras que la
culpa,eldesenganchementalyelusodesustanciaspredijeronunamenorCV.Larelacindela
aceptacinalaenfermedadconlaCVnofuesignificativa.
Estosresultadossugierenlaimportanciadelapersonalidadyelafrontamientoqueutilizanen
elmanejodesuenfermedad,conelfindepromoverlaCV.

evalls@salud.aragon.es

48

PERSONALIDAD EVALUACIN Y TRATAMIENTOS PSICOLGICOS

PERFILESDEPERSONALIDADENTRASTORNOSDELACONDUCTA
ALIMENTARIA

Barajas,B.; Santed,M.A.

Diferentes investigaciones han estudiado la relacin entre los Trastornos de la Conducta


Alimentaria con los Trastornos de Personalidad en adultos, pero existe poca bibliografa en
poblacin adolescente. Los objetivos del presente estudio fueron explorar los perfiles de
personalidad ms frecuentes asociados a la Anorexia Nerviosa (AN) y a la Bulimia Nerviosa
(BN) en adolescentes. Se estudi una muestra de 104 pacientes y se administr el Inventario
ClnicoparaAdolescentesdeMillon.
Encontramos que los prototipos de personalidad ms frecuentes en AN son el conformista
(33,33%),elegocntrico(22,72%)yelhistrinico(18,18%).MientrasqueenBNhemoshallado
que los ms prevalentes son el rebelde (18,42%), el sumiso (18,42%) y el lmite (15,78%), as
como una alta prevalencia de impulsividad (21,05%). Por otro lado, las variables que
diferencian significativamente a ambos grupos son las escalas de sumisin, egocentrismo,
rebelda,rudeza,conformismo,oposicionismo,autopunicin,tendencialmiteypropensinala
impulsividad.

belenbarajas@hotmail.com

49

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PERSONALIDAD,RESILIENCIAYBIENESTARSUBJETIVOENPERSONAL
SANITARIOYNOSANITARIO

Arrogante,O.PrezGarca,A.M.

Esta investigacin est dirigida a analizar los cinco grandes factores de la personalidad, la
resilienciayelbienestarsubjetivo(satisfaccinconlavidamsbalanceafectivo)endosgrupos:
unoformadoporprofesionalessanitariosyotroportrabajadoresnosanitarios.Losanlisisde
regresinmostraronqueelbienestarsubjetivoestuvoasociadoconunamayorresilienciayun
menorneuroticismoenelgrupodepersonalsanitario.Laextraversinyeltesn(relacionados
positivamente) y el neurocitismo (negativamente relacionado) fueron los predictores
significativosdelbienestarsubjetivoenelgrupodetrabajadoresnosanitarios.Finalmente,los
anlisisrevelaronquelaresilienciamedilarelacionesentrelaextraversin(mediacintotal)y
elneuroticismo(mediacinparcial)yelbienestarsubjetivosolamenteenelpersonalsanitario.
Ladiscusindelosresultadossubrayalaimportanciadelaresilienciaalahoradehacerfrentea
unentornolaboraladverso,elcualesmscaractersticoenambienteshospitalarios.

oscar.arrogante@salud.madrid.org

50

PERSONALIDAD EVALUACIN Y TRATAMIENTOS PSICOLGICOS

SENSIBILIDADALASCOYSNTOMASDETOCENADOLESCENTES

PinedaSanchez,D.;Valiente,R.M.;Chorot,P.;SanchezArribas,C.;
Sandn, B.

Los modelos tradicionales han sugerido que el asco es una emocin bsica con componentes
cognitivos,fisiolgicosyconductualesdistintivos,queactaparaprevenirlacontaminaciny
laenfermedad.
Sepretendeexaminarsilasensibilidadalascopuedetenerrelacinconsntomasdeltrastorno
obsesivocompulsivo(TOC)enadolescentes.
La muestra estuvo compuesta por adolescentes, de forma colectiva se aplicaron la Disgust
ScaleRevised (DSR) y Symptoms Assessment45 (SA45). La DSR permite obtener
puntuacionesparatresdimensionesdelasco(ascoesencial,recuerdoanimal,ycontaminacin).
ElSA45evalalosprincipalesgruposdesntomaspsicopatolgicos,entreelloselTOC.
Basndonos en los anlisis estadsticos, constatamos asociaciones significativas entre la
sensibilidad al asco y los sntomas del TOC. Las principales correlaciones se mantenan tras
controlarelefectodelsexo.
Se discuten los resultados y el papel del asco como posible factor de vulnerabilidad para el
TOC.

dpineda@bec.uned.es

51

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

DILEMASIMPLICATIVOSYOTROSCONFLICTOSCOGNITIVOS:ESTUDIO
EXPLORATORIOENUNAMUESTRANOCLNICA

LpezGonzlez,M.A.;Sal,L.A.;RubioGaray,F.;DomnguezSimn,M.J.;
Feixas,G.

LaTcnicadelaRejillahapermitidollevaracaboelestudiodeuntipodeconflictocognitivo
denominado Dilema Implicativo y su papel en el campo de la salud, fundamentalmente en
muestras clnicas. Sin embargo, el objetivo de este trabajo fue estudiar la construccin del s
mismo, la estructura cognitiva y el malestar psicolgico en una muestra comunitaria de 115
personas (56,5% mujeres) con y sin dilemas implicativos. Para ello, los participantes fueron
evaluados mediante la tcnica de la rejilla y cumplimentaron las versiones en espaol de los
autoinformesSymptomCheckList90R(SCL90R)yClinicalOutcomeinRoutineEvaluation
(COREOM). Los resultados ms reseables mostraron que las personas sin dilemas
presentabanunamayorsintonaconsigomismasyconlosdemsquelaspersonascondilemas.
Asimismo, los participantes con dilemas implicativos presentaron puntuaciones superiores en
escalasdedepresinyansiedaddelSCL90,yenlasmedidasglobalesdelCOREOM.

malopez@acoruna.uned.es

52

PERSONALIDAD EVALUACIN Y TRATAMIENTOS PSICOLGICOS

EVALUACIN PRELIMINAR DE ANAIS, UN PROGRAMA EDUCATIVO PARA


PERSONASCONDIABETESTIPO1:PERCEPCINDEPACIENTE

Alvarado,D.;Lpez,Y.;Snchez,R.M.;Jimnez,A.;Rodrguez,J.;Carrillo,A.;
Nvoa,J.;Wgner,A.M.

Introduccinyobjetivos:ANAISesunprogramaeducativoestructuradoquefomentaunadieta
flexible.Sepretendeevaluarsuimpactoenlacalidaddevidayotrasvariablesasociadas.
Mtodos:Ensayoclnicoaleatorizadodegruposparalelos.Edad>18aos,HbA1c712%,>2
aosdeevolucin.Losparticipantessonaleatorizadosaparticiparenuncursogrupalde5das.
Se evala calidad de vida (EsDQOL), satisfaccin (DTSQ), miedo hipoglucemias (MH15),
ansiedad (STAI), depresin (BDI), flexibilidad dieta (pregunta abierta). Participaron 63
pacientes,46%hombres,edad34,9(DE11,8)aos,duracindeladiabetes13aos(rango347),
HbA1c8,42%(0,98)yseguimientode7,4[012]meses.
Resultados: El grupo de intervencin mejor su calidad de vida y redujo el impacto de la
diabetesalos3yalos6meses.Aumentlasatisfaccinconeltratamientoalos3y6mesesy
tendieronadisminuirelmiedoalashipoglucemiasylossntomasdepresivosydeansiedad.En
elgrupocontroltambinmejoraronlasatisfaccingeneralyelimpactoalos6meses.
Conclusiones:ElprogramaANAISmejoralapercepcindelacalidaddevidayreduceelmiedo
alashipoglucemiasylossntomasansiososydepresivos.
S.deEndocrinologayNutricin.ComplejoHospitalarioUniversitarioInsularMaternoInfantil(CHUIMI)deGranCanariaEste
trabajofuepremiadoconlaIAyudaGuidoRuffinodelaSED.

dalvarado12@alumno.uned.es

53

SIMPOSIO:

PSICOLOGABSICAI

Coordinador:Dr.JorgeCastroTejerina

PSICOLOGA BSICA I

ELPROCESODECONSTRUCCINIDENTITARIAHBRIDAENLA
NARRACINAUTOBIOGRFICADEMSICOSESPAOLES

BernalM.J.

El objetivo consiste en analizar el proceso de construccin identitaria hbrida en msicos


espaoles que incorporan a sus vidas, a sus narraciones, la tradicin cultural afroamericana,
concretamentelamsicabluesyjazz.Partimosdeunmarcotericogeneralconstituidoporla
Psicologa Cultural, representada por psiclogos como Michael Cole o Jaan Valsiner, que
recogenlatradicinclsicadelaescuelaculturalhistricarusadeLevVygotskyoMijalBajtn,
entre otros. Tanto la msica como las narraciones autobiogrficas derivadas de ella, son
entendidas como artefactos culturales de tipo tico y esttico que median nuestra experiencia
vital y la dotan de sentido. La metodologa cualitativa empleada estar compuesta de
entrevistas a diversos msicos espaoles de entre 30 y 70 aos. Los datos recogidos sern
sometidos a anlisis del discurso, donde intentaremos identificar el tipo de mediadores
simblicos y materiales que conforman el contexto especfico de la construccin identitaria
hbridadenuestrossujetos.

marco.marcopeland00@gmail.com

57

EFECTODELAORIENTACINESPACIALENLOSJUICIOSESTTICOSDE
PINTURANOFIGURATIVA

Gonzlez,I.C.;Montoro,P.R.

Elpintortomaunadecisindeorientacincannicadesulienzo,segnsujuicioesttico.
Esmenorelimpactoestticodeunaobrasisecolocaenunaorientacindistintaaladispuesta
porelautor?
EltrabajodeMather(2011)examinelefectodelaorientacinespacialenlosjuiciosestticosde
pinturas abstractas. Sin embargo, este estudio no control adecuadamente el efecto de
familiaridaddealgunosdeloscuadrosseleccionados.
Nuestro trabajo replica el procedimiento de Mather pero seleccionado obras de autores
reconocidos que no incluyeran ningn elemento figurativo y carentes de toda significacin.
Adems, se realizaron dos evaluaciones de las mismas obras, separadas en el tiempo, para
evaluar la consistencia de los juicios estticos. Tambin se evalu el grado de familiaridad,
significacinycalificacinestticadelaspinturas.
Nuestrosresultadossugierenquelosjuiciosestticosenpinturanofigurativasonarbitrarios,al
menos,respectoalaorientacinespacial.

aquie.ic@gmail.com

PSICOLOGA BSICA I

PRIMINGEMOCIONAL

Hurtado,M.D.;Montoro,P.R.;Moreno,F.J.

ElparadigmadeprimingemocionalfueinvestigadoporprimeravezporFazioenelao1986,
pretenda evaluar la congruencia emocional entre prime y target, a travs de una tarea de
decisin lxica. El experimento que presento est formado por 441 ensayos con cierta carga
emocional (positiva, negativa y neutra), distribuidos en 7 bloques experimentales. Las
instrucciones administradas a los sujetos, son que tienen que discriminar entre palabra y
pseudopalabra en el menor tiempo posible e intentando no cometer errores. En ste caso se
pasaaunamuestrade11estudiantesdelaUnedenelDepartamentodePsicologaBsicadela
Percepcin. Se realiza un anlisis de la precisin de la respuesta (proporcin de aciertos) y
tiempodereaccinatravsdeunANOVAdemedidasrepetidas,3X3obtenindoseenambos
unefectosignificativo.Elobjetivodemiinvestigacin,versielprimeinfluyesobreelprobe,y
sobretodolainfluenciadelprimingemocionalenlosprocesoscognitivos.

lolihurtadomontiel@hotmail.com

59

INFLUENCIADELCOLORYTESTDEDENOMINACINNOMBELA.UN
ESTUDIOLONGITUDINALENPACIENTESCONENFERMEDADDE
ALZHEIMER

Rodrguez,I.C.;MorenoMartnez,F.J.

Introduccin.Grannmerodeestudiosevidencianlainfluenciapositivadelcoloralahorade
denominar objetos. No obstante, existe cierta controversia sobre la ventaja que el color pueda
aportar a los pacientes con Enfermedad de Alzheimer (EA). Participantes y mtodo. Once
pacientes con posible EA fueron evaluados dos veces (EA1EA2), con un intervalo de tiempo
aproximadodedosaos.Asimismo,veintitrsancianossanosparticiparoncomogrupocontrol;
stos fueron evaluados una sola vez. Se utilizaron 98 estmulos pertenecientes al Test de
Denominacin Nombela, 49 del dominio de los Seres vivos y 49 del dominio de los Seres no
vivos, con dos formatos diferentes: fotografas en color y en blanco y negro. Los estmulos
fueron equiparados en todas las variables psicolingsticas conocidas, potencialmente
contaminantes.Objetivos.Determinarsilaadicindecolorinfluyeenladenominacindelos
objetos.Resultados.LoscontrolessanosrealizanmejorlatareaquelosEA1ylosEA2yasuvez,
losEA1,lohacenmejorquelosEA2.EstoindicaqueconformeevolucionalaEA,elrendimiento
en la tarea se va deteriorando. Tambin se observa que los estmulos en color se denominan
mejor que en blanco y negro, aunque slo los tems de los SV se benefician de este aporte de
color.Encuantoalosgrupos,todossebeneficianporigualdelapresenciadecolor.

inmaculada_07@hotmail.com

PSICOLOGA BSICA I

DETERMINANTESATENCIONALESDELPROCESAMIENTODEESTMULOS
VISUALESJERRQUICOS:EFECTOSDELTIPODETAREA,ELTAMAO
ABSOLUTOYLACONGRUENCIAESTIMULAR

Prieto,A.;Montoro,P.R.

Estudios previos sobre el procesamiento visual de patrones jerrquicos, muestran que la


respuesta ante objetivos presentados en cualquiera de sus niveles (global/local) es ms rpida
cuando en el ensayo anterior el objetivo se present en ese mismo nivel (efecto de priming
secuencial).Enelpresentetrabajo,seutilizaunparadigmadeprimingatencional,paraexplorar
laexistenciadeesteefectosecuencialdentrodecadaensayoenlugardeendiferentesensayos.
Paraelloserealizarondosexperimentosenlosquesemanipuleltipodeatencin(selectivavs
dividida),lacongruenciadelosestmulosyeltamaoabsolutodelosmismos.
Losresultadosindicanqueelefectodeprimingsecuencialsedebealniveljerrquicoatendido,
conindependenciadeltamaoabsolutodelosestmulos,tantoentareasdeatencinselectiva
(Experimento 1) como de atencin dividida (Experimento 2) y que este efecto solo aparece
cuandolosestmulospresentadossonincongruentes.

antonioprieto@psi.uned.es

61

REFORZAMIENTODEBEBIDAINDUCIDAPORPROGRAMAENRATAS
MEDIANTEELACORTAMIENTODELINTERVALODEPRESENTACINDELA
COMIDACONTINGENTEALACONDUCTADEBEBER

lvarez,B.;bias,J.;Pelln,R.

Lapolidipsiainducidaporprograma(PIP)hasidounacuestindeinterstericodesdequefue
descrita por primera vez (Falk, 1961). Aunque ha sido clasificada como conducta adjuntiva,
varios autores defienden que es un tipo de conducta operante, controlada por sus
consecuencias. En este experimento se puso a prueba esta hiptesis. En una primera fase, se
presentaba un pellet a intervalos regulares de 90 segundos, pudiendo ser, dichos intervalos,
acortadosmediantelaconductadebeber.
Seestablecieronvariosgradosdecontingencia(100%,50%y0%)entrelaconductadebeberyel
acortamiento de los intervalos para los distintos grupos. Los resultados muestran que los
grupos que podan acortar el intervalo (contingencias 100 y 50%) desarrollaron PIP, en
comparacincon aquellosque no podan (0%). En una segunda fase, todos los grupos fueron
expuestosaunacontingenciadel100%,loqueresultenaltosnivelesdebebidainducidapor
programaentodoslossujetos.

alvarezbeatriz@hotmail.com

PSICOLOGA BSICA I

PERFILESCONDUCTUALESYSURELACINCONIMPULSIVIDADYLA
ADQUISICINYMANTENIMIENTODEPOLIDIPSIAINDUCIDAPOR
PROGRAMAENRATASDELABORATORIO

bias,J.;PellnR.

Se investig en tres cepas de rata diferentes (8 SHR (Espontneamente Hipertensas), 8 WKY


(WistarKyoto)y15ratasWistar)laadquisicindepolidipsiainducidaporprograma(PIP).Se
utilizarondiferentesvaloresdeTiempoFijo(TF)de15,30,60y120segundosdeduracin.Tras
losprocedimientosconductualesseclasificalosanimalesenfuncindesusresultadosprevios
en impulsividad tomados mediante un procedimiento de descuento por demora con valores
para la obtencin de la recompensa demorada de 3, 6, 12 y 24 segundos. Los resultados del
anlisismostrarondiferentesperfilesconductualesquerelacionabanimpulsividadprevia,PIPe
impulsividadposterior.LasratasWistarpreviamentemsimpulsivasadquirieronmenosPIP.
Las ratas Wistar inicialmente menos impulsivas adquirieron ms PIP y mostraron ms
impulsividaddurantelasegundaevaluacin,esteperfilcoincidiconelmostradoporlasratas
WKY.Porltimo,elperfildelasratasSHRsedistinguidelosdemsconnivelessimilaresde
impulsividaddurantelasdosevaluacionesytasaselevadasdePIPentodoslosprogramasde
TF, especialmente en los programas con intervalos ms largos, de 60 y 120 segundos, a
diferenciadelasratasWistarmsbebedorasquemostrabansumximoenTF15segundos.
Estosresultadospermitendiscutirelefectodiferencialdelaimpulsividadenlaadquisicinde
PIPytambinelefectoqueproduceestaconductaendichosnivelesdeimpulsividad.

j.ibias.martin@gmail.com

63

ADQUISICINYEXTINCINDELCONTROLDISCRIMINATIVOEN
FUNCINDELAVARIEDADDELACONSECUENCIASEALADAEN
PALOMAS

Poln,E.;Carrero,C.;Garca,E.;bias,J.;Moreno,T.;Vicente,M.S.;Prez,V.

El presente estudio tena como objetivo comparar la velocidad de adquisicin as como la


resistenciaalaextincindelaconductadepicoteoenpalomasdependiendodesielestmulo
discriminativohabaadquiridosufuncinmediantelacontingenciaconelrefuerzoatravsde
unsoloestmuloreforzadorodevarios.Elestudiosellevacaboconcuatropalomashembra,
experimentalmente ingenuas que fueron entrenadas en una discriminacin simple en cuatro
cajasdeSkinnerconpantallastctilesacopladas.Losresultadosapoyanlahiptesisdepartida,
mostrandodiferenciassignificativasentrelosgruposexperimentalycontrol.

labo.edu@gmail.com

PSICOLOGA BSICA I

AUTOCONTROLCONCASTIGONEGATIVO

Vicente,M.S.;Carrero,C.;Moreno,T.;Poln,E.;Prez,V.

Nuestro estudio comprueba la eleccin de los sujetos en un procedimiento en el que se


manipula tanto la duracin del reforzador como la duracin del ITI. Se ha encontrado escasa
sensibilidadalademoraposreforzamientocomovariabledecontroldelaconductadeeleccin
cuandoseenfrentaalademoraprereforzamiento.Siendoambasvariablespocodeterminantes
en la eleccin (comparndolas con otras como la frecuencia de reforzamiento o la demora
prereforzamiento),nuestrahiptesiseraqueseobservaraunamayorsensibilidadaladuracin
de la demora posreforzamiento (ITI) que la informada en la literatura. El procedimiento:
palomascomosujetos,Fase0:Automoldeamiento,FaseIIV:Entrenamiento(Programasimple,
A), Fase IIV: Evaluacin (Programa concurrente, B). Los resultados obtenidos: Indiferencia
entre3y5detiempodeaccesoalcomedero.Coherenteconlabajasensibilidadaladuracin
cuando se manipulan otras variables. Insensibilidad a la longitud del intervalo entre ensayos.
Acorde con la poca importancia relativa que la demora posreforzamiento ha demostrado
cuandocompetaconladeprereforzamiento.

m.solvicente@hotmail.com

65

SIMPOSIO:

PSICOLOGAEVOLUTIVAYDELAEDUCACIN

Coordinador:Dr.ManuelRodrguezGonzlez

PSICOLOGA EVOLUTIVA Y DE LA EDUCACIN

PUEDELAEVALUACINCRITERIALSERUNPROCEDIMIENTOFIABLEDE
DIAGNSTICOYDETECCIONDELASDIFICULTADESDEAPRENDIZAJEDEL
CLCULO?

Coronado,A.

Paraladeteccinyevaluacindelasdificultadesespecficasdeaprendizaje,elusoexclusivode
testsnorepresentalaopininmsrepresentadaenlasinvestigacionesactualessobrelacuestin
(Ortiz Gonzlez, 2004). Esta deteccin se justifica mejor en estilos de evaluacin variados que
contemplen pruebas de diagnstico criterial, pruebas basadas en contenidos curriculares,
anlisis de los errores mediante observacin sistematizada y procedimientos alternativos de
identificacin criterial, contrastados y validados en los resultados de la investigacin (OSERS,
2006).
Esteestudiodefiendeyjustificaexperimentalmentelametodologaobservacionalsistematizada
(Anguera,1988)comoprocedimientofiableparalaevaluacindelasdificultadesdeaprendizaje
enelclculo,mostrandolosresultadospositivosdefiabilidadencontradosenlaaplicacinde
unarbricadeanlisisolistadecontrol.

acoronado@sevilla.uned.es

69

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

ESTIMULACINDEHABILIDADESPRAGMTICASENAULASEDUCACIN
INFANTIL

Junquera,C.

En este trabajo se expone la intervencin llevada a cabo en un centro de Educacin Infantil


durante el curso 201112. El objetivo del trabajo era elaborar e implementar un programa de
estimulacin de las habilidades pragmticas para sujetos de 35 aos. Para el diseo del
programa se recogi informacin de observacin directa, anlisis de programas existentes y
revisin bibliogrfica. Se seleccionaron contenidos de intervencin relativos a las habilidades
conversacionales, organizacin de discursos y comprensin/expresin de diversos tipos de
actosdehabla.
Elprogramasedesarrolldurante7semanasenlasaulasdeuncentroeducativo.Serecogieron
medidasdelacompetenciapragmticasantesydespusdelaintervencinde13participantes
enelprograma.Paraelloserecurrialusodepruebasestandarizadasquesecomplementaron
conotrasmedidasdelenguajesugerido.
Los resultados muestran una mejora en la competencia pragmtica, as como en otros
componentesdellenguaje.

PalabrasClave:pragmtica,lenguaje,estimulacin,educacininfantil.

cristinajunquera@usal.es

70

PSICOLOGA EVOLUTIVA Y DE LA EDUCACIN

MEDIDADELDESARROLLOLEXICOYGRAMATICALTEMPRANOENNIOS
HABLANTESDEESPAOL:UNESTUDIODEVALIDEZSOBRELOS
INVENTARIOSMACARTHUR

CorreaC.;Mariscal,S.

EsteestudioanalizalavalidezconcurrentedelaadaptacinespaoladelInventarioMacArthur
IIapartirdeunamuestrade26niosparticipantes,de24a30mesesdeedad.Seanalizaronlas
relaciones entre las puntuaciones obtenidas en el Inventario II, los datos procedentes de una
muestra de lenguaje espontneo y una escala estandarizada de comprensin verbal. As, las
medidas de gramtica y vocabulario del Inventario II se compararon con dos medidas
conductuales de vocabulario expresivo (nmero de palabras diferentes de una muestra de
lenguaje y el nmero de objetos nombrados en una tarea de elicitacin lxica), una medida
conductual de vocabulario comprensivo (Escala Reynell) y una medida conductual de
conocimiento gramatical (longitud media de las emisiones producidas espontneamente). Los
resultadosmuestranunconsiderablegradodeasociacintantoenlasmedidasdevocabulario
comoenlasgramaticales.Estosuponeunaaportacinmsparaconsiderarlainformacinde
losinventariosparentalescomomedidafiableyvlidadeldesarrollolingsticoinfantil.

carolsic0@hotmail.com

71

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

LASDIMENSIONESDELOSESTILOSEDUCATIVOSCOMOFACTORESDE
PROTECCINDELCOMPORTAMIENTOAGRESIVOENTRELAINFANCIAY
LAADOLESCENCIA

Garca,A.T.;Snchez,I.;Gomez,I.

En este trabajo se analizan las relaciones existentes entre determinadas dimensiones de los
estilos educativos paterno y materno con la manifestacin de conductas agresivas durante la
preadolescenciayadolescenciainicial.Hanparticipado271alumnos/asconedadesentrelos10
y14aosprocedentesdedistintoscentroseducativosdeJancumplimentandoelcuestionario
de agresin de Buss y Perry (1992) y la escala de estilos educativos de Oliva, Parra, Snchez
Queija y LpezGavio (2007). Los resultados obtenidos muestran que el control conductual
paterno y materno es la dimensin de los estilos educativos que ms correlaciona con las
medidasdeagresividadsibientambinelafectoylarevelacintantopaternoscomomaternos
correlacionan con varias medidas de agresividad. Los datos se discuten analizando la
importancia del contexto familiar como factor de proteccin de las conductas agresivas y la
diferenteinfluenciapaternaymaternaenlaconductaagresivadesudescendencia

.
anateresagmoral@gmail.com

72

PSICOLOGA EVOLUTIVA Y DE LA EDUCACIN

UNAREVISINSOBREELDESARROLLODELATEORADELAMENTEEN
NIOSCONDISCAPACIDADAUDITIVA

Sarmento,R.;JimnezDas,M.;Martinez,P

Laprdidadeaudicinnoslotieneconsecuenciaspermanenteseneldesarrollodellenguaje
oralsinoque,porsupapelfundamentalenprocesoscognitivosmscomplejos,puedealterarel
desarrollo intelectual, emocional y social del nio. El presente trabajo tiene como objetivo
revisar las investigaciones sobre el desarrollo de la teora de la mente en los nios con
discapacidad auditiva. La teora de la mente como capacidad para explicar y predecir el
comportamiento es uno de los elementos que determina el desarrollo sociocognitivo y
emocionalposterior.Nuestroobjetivoesconocercmosedesarrollalateoradelamenteenla
poblacin con discapacidad auditiva, qu factores tienen ms peso en este desarrollo y qu
muestralaevidenciacientficasobreelposibleretrasoy/odesarrolloatpicoquesufren,eneste
reaconcreta,losnioscondiscapacidadauditiva.

rsarmento1@alumno.uned.es

73

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

LOSRASGOSDEPERSONALIDADDELOSDOCENTESINNOVADORES:UN
ESTUDIOTERICO

Monge,C.

Estetextosepresentacomounestudiotericoacercadeunadelasdiversascontribucionesde
la Psicologa a la Educacin. En concreto, se procura hipotetizar la relacin existente entre
personalidad e innovacin educativa: qu rasgos de personalidad poseen los docentes
innovadores en comparacin con los menos innovadores. Y para ello, en primer lugar, se
revisan algunas de las teoras ms importantes sobre Psicologa de la personalidad.
Posteriormente,trassealarvariasdefinicionesdeinnovacineducativa,seproponeunanueva.
Y, finalmente, se estudian tericamente las caractersticas de personalidad de los docentes
innovadores. As, dependiendo de la perspectiva de los diversos autores sobre rasgos de
personalidadseadoptanvariassolucionesalacuestinplanteada.Conello,esposibleconcluir
quelaPsicologadelapersonalidadpuedecontribuirsignificativamenteafacilitarlosprocesos
decambioeinnovacinenloscentroseducativosconelobjetivodemejorarlos.

carlos.monge@edu.uah.es

74

SIMPOSIO:

METODOLOGADELASCIENCIASDELCOMPORTAMIENTO

Coordinador:Dr.AndrsLpezdelaLlave

METODOLOGA Y CIENCIAS DEL COMPORTAMIENTO

LAADAPTACINDEUNAESCALAAUNAPOBLACIN,LENGUAY
CULTURADISTINTAS:ELCASODEL*MOBILEPHONEPROBLEMUSESCALE
FORADOLESCENTS*

Lpez,O.(1)

En esta comunicacin describe el proceso de adaptacin de la escala *Mobile Phone Problem


Use Scale for Adolescents (MPPUSA) *a poblacin adolescente espaola. Originalmente este
instrumentopsicomtricofueel primero diseado y validado para medirla problemticaque
presentabanadultosaustralianosenrelacinalusodeltelfonomvil(Bianchi&Phillips,2005).
Elobjetivodeesteestudiofueaplicarunprocesodetraduccinretrotraduccin(propuestopor
SnchezMorenoetal.,2005)queimplicardiversasfases,expertos(enlenguayenlatemtica
deinvestigacin),ascomootrosusuarios(profesoradodesecundariadelenguasyadolescentes
bilinges) para garantizar su adecuacin. Se realizaron los anlisis psicomtricos bsicos para
detectar la fiabilidad y validez del mismo, a pesar de la dificultad de extraer puntos de corte
parapoderdeterminarunaclasificacindeusuariosproblemticos.
(1)Departamentodelaunedasociadoaltrabajo:MetodologadelasCiencias
delComportamiento,UniversidaddeBarcelona

olatzlopez@ub.edu

77

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PROPIEDADESPSICOMTRICASYANLISISDELDIFDELAESCALA
SKUASAPLICADAAUNIVERSITARIOSYPROFESIONALESDELA
ENFERMERA

Lpez,M.D.;SurezJ.C.;LubnP.

La ansiedad es uno de los problemas psicolgicos con mayor prevalencia. Entre los
instrumentosparamedirlaseencuentralaKUAS,TheKuwaitUniversityAnxietyScale(Abdel
Khalek, 2000). El propsito de la investigacin ha sido: (1) estimar las propiedades
psicomtricas y estructura factorial del SKUAS (AbdelKhalek, 2004), en una muestra de
estudiantesuniversitarios,y(2)analizarelposiblefuncionamientodiferencialdelostems(DIF)
del cuestionario. El anlisis del DIF ha sido realizado, considerando las variables gnero y
estudios,aplicandodostcnicasdedeteccindelDIF:AnlisisDiscriminanteLogstico(ADL)y
estadsticodeMantelHaenszel(MH),juntoconelprocesodepurificacinbietpico,paraeste
ltimo. Los resultados evidenciaron una fiabilidad y estructura factorial equivalentes a la
versinoriginalyalaversinespaola.RespectoalFuncionamientoDiferencialdelostems,el
acuerdo entre procedimientos fue alto, detectando de 4 a 6 tems que favorecen a un grupo
frenteaotro.

marilo.lopez@gmail.com

78

SESINDEPSTER

Coordinadora:Dra.MCarmenPrezLlantada

SESIN DE PSTER

PSICOBIOLOGA

RELACINENTREESTRSPERCIBIDO,CORTISOLLIBREYESTADO
COGNITIVOENUNAMUESTRADEPERSONASMAYORES

Utrera,L.;Venero,C.;Daz,M.C.;Peraita,H.

LospacientesdiagnosticadosconDeterioroCognitivoLigero(DCL)presentanunmayorriesgo
de evolucionar a algn tipo de demencia, como la demencia tipo Alzheimer. No obstante, el
pronsticodeDCLesvariabley,mientrasunoscasosmejoranconeltiempo,otrossemantienen
estables durante aos pudiendo, posteriormente, desarrollar un nuevo proceso. Desde una
perspectivapreventiva,ladeteccinprecozdelDCLyelhallazgodemarcadorespsicolgicosy
biolgicosfacilitaranlaintervencinypodranayudararetrasarlaaparicindelademencia.
Dado que la percepcin de estrs puede afectar al funcionamiento cognitivo y que durante el
envejecimiento tiene lugar un incremento de los niveles endgenos de cortisol (hormona
liberada en situaciones de estrs), en este trabajo se han estudiado estas dos variables en una
muestra de personas mayores para determinar si el estrs percibido y el patrn de secrecin
diariodecortisolresultanpredictoresdelestadocognitivodelindividuo.

Lutrerapsi@Hotmail.com

81

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PSICOBIOLOGIA

ESTUDIODESCRIPTIVODELOSEFECTOSDELESTRSYLAPRESENCIADE
TRASTORNODEPRESIVOENDIABETESTIPO2

Snchez,M.C.;Gmez,A.;Venero,C.;Paniagua,J.A.

Elobjetivodelestudiofuevalorarlaprevalenciadesntomasdeestrsydepresinenpacientes
ambulatorios con diabetes tipo 2 y como estos problemas afectan al autocuidado y a la
evolucin de la enfermedad. Los sntomas de estrs fueron evaluados con una entrevista
basadaenlaescalaPAIDyladepresinconlaescalaHANDSy.Trasunanlisisdescriptivode
datos demogrficos, clnicos y bioqumicos, se calcularon correlaciones entre los sntomas de
estrs y depresin, y los niveles de hemoglobina glucosilada, indicador de la evolucin de la
enfermedad. Los resultados indican diferencias entre hombres y mujeres. Los trastornos
emocionales, ms prevalentes en mujeres, se reflejan en niveles altos de hemoglobina; sin
embargo los hombres tienen niveles de hemoglobina glucosilada elevados, atribuibles a una
faltadeautocuidadoynoalmalestaremocional.Paramejorarelpronsticodelaenfermedad
serannecesariasintervencionespsicolgicasdiferenciadasparahombresymujeres.

moror16@hotmail.com

82

SESIN DE PSTER

PSICOLOGABSICAII

INTERVENCINESTRUCTURADAENELTRATAMIENTODELACOSO
LABORAL

Rosique,T.;Sanz,T.;Menndez,J.

Sepresentanlosresultadosdeuntratamientoestructuradoparavctimasdeacosolaboral.La
muestra se compone de diez pacientes de un CSM en situacin de baja laboral con sntomas
ansiosodepresivos. Como medida prepost se cumplimentaron los cuestionarios BDI y ASSQ
obteniendo puntuaciones iniciales indicativas dedepresin moderada y gravey unos niveles
elevadosdeansiedaddisfuncional.

Se desarroll un programa estructurado con formato entrevista individual durante dos meses
(1sesin/semana/60minutos).Laintervencinconstabadeseismdulos:
Anlisis del problema, Identificacintrabajo de distorsiones cognitivasfalsas creencias,
Desactivacin/distanciamiento emocional, Anlisis de estrategias empleadas, Bsqueda de
nuevasestrategias,Recuperacinimagenpreviaalconflictoexternalizandoelproblema.).Los
resultados mostraron una mejora significativa en la sintomatologa a travs del BDI, ASSQ y
sensaciones subjetivas de mejora. Nueve pacientes se incorporaron al trabajo al finalizar la
intervencin,elrestanteunmesdespus.

mayte_1987@hotmail.com

83

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PSICOLOGABSICAII

ANLISISDELAEFICACIADEUNPROGRAMADEESTIMULACIN
COGNITIVAPARAANCIANOSCONDETERIOROCOGNITIVOLEVE

Rosique,T.;Sanz,T.;Menndez,J.

SemuestranlosdatosobtenidosenunprogramadeEstimulacinCognitivaaplicadodurante
dosmeses,tresvecesporsemanadurantehoraymedia.Lamuestralacomponendiezancianos
diagnosticadosdedemenciacondeteriorocognitivoleve.
Mientras que en el grupo experimental se aplica la intervencin, el grupo control permanece
ochomesessinformarpartedelprograma,sibienposteriormenteselesincluyeenunanueva
edicin.Seevalualosdosgrupos(antesdelprograma,unavezfinalizadoytranscurridosseis
meses)conelMEC(MiniExamenCognoscitivo,Loboetal.,1999),queproporcionauncribado
sobre el estado global de las funciones superiores. Se obtuvieron diferencias estadsticamente
significativas entre ambos grupos una vez aplicado el programa, dichas diferencias se
mantuvieronseismesesdespus.

mayte_1987@hotmail.com

84

SESIN DE PSTER

PSICOLOGABSICAII

ENTRENAMIENTOCOGNITIVOCONVIDEOJUEGOSENPERSONAS
MAYORESSANOS

Pita,C.;Prieto,A.;Toril,P.;Mayas,J.;PoncedeLen,L.;Reales,J.M.;
Ballesteros,S.

Ungrupode17mayoressanosconedadescomprendidasentre63y80aos(Media:69.8,DT:
5.41), se sometieron a 20 sesiones de entrenamiento en 10 videojuegos de una hora de
duracin, extrados del paquete comercial Lumosity, disponible a travs de Internet. Los
videojuegos estaban dirigidos a mejorar la atencin, velocidad de procesamiento, solucin de
problemas y memoria. Cada juego era completado dos veces antes de pasar al siguiente. El
anlisis de los datos correspondientes al entrenamiento en cada videojuego se analiz
calculando coeficientes de regresin y un ANOVA de medidas repetidas. Los resultados
mostraron aumentos significativos en las puntuaciones y un descenso significativo en los
tiempos de reaccin en todos los videojuegos a travs de las sesiones de entrenamiento. En
conclusin, podemos afirmar que el entrenamiento es efectivo para predecir la mejora en la
ejecucindevideojuegosenpersonasmayores.

carmenpitag@psi.uned.es

85

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PERSONALIDAD,EVALUACINYTRATAMIENTOPSICOLGICOS

RELACINDELAPERSONALIDADTIPODYELAGOTAMIENTOVITALCON
LASEMOCIONESNEGATIVASYELAJUSTEPSICOLGICOALA
ENFERMEDADCARDIACA

Montero,P.;Rueda,B.;Bermudez,J.

Investigacin sobre dos factores de riesgo emergentes dentro de la enfermedad cardiaca: la


personalidad tipo D y el agotamiento vital (AV). Se analizaron las diferencias de sexo con
respectoaltipoDyelAV,lasemocionesnegativas(iradentro,irafuera,ansiedadydepresin)
y el ajuste psicolgico (competencia percibida, autoestima, satisfaccin y apoyo social); y se
determinlacapacidadpredictivadeltipoDyelAVenrelacincontodosestoscriterios.
La muestra se compuso de 164 pacientes cardiacos (40,24% mujeres; 59,76% hombres; edad
media=56,30aos;DT=12,88).
LosresultadosmostraronquelasmujerespuntuabansignificativamentemsaltoentipoD,AV,
ansiedadydepresin,ypresentabanunaautoestimamsbaja.EltipoDyelAVseasociaron
conmsansiedadypeorajustepsicolgico.EltipoDpredijotambinmsiradentro,yelAV
fuepredictordeunapoyosocialmsbajoydemayordepresin.

pilarmonterom@telefonica.net

86

SESIN DE PSTER

PERSONALIDAD,EVALUACINYTRATAMIENTOPSICOLGICOS

REACCINAESTMULOSVISUALESENPSICOSIS:LAATRIBUCINDE
SALIENCIAABERRANTE

Gonzlez,A.R.

La saliencia aberrante parece estar relacionada con disfunciones presentes en pacientes con
psicosis: problemas en el procesamiento emocional; la propia ideacin delirante, dficits en
cognicinsocialyproblemasdefuncionamientopsicosocial.
Elmodelodesalienciaaberranteproponequelossntomasemergerancuandolatransmisin
catica de dopamina conduceauna atribucin derelevancia a estmulosque normalmentese
consideraran irrelevantes. El objetivo de este estudio es revisar la literatura sobre saliencia
aberrante en los pacientes con psicosis. Se realiz una bsqueda bibliogrfica en Medline a
travsdePubmedconlostrminosdebsquedaPSICHO*ySALIENC*unidosporelbooleano
AND.Losresultadosmuestranunarespuestadiferencialdelaspersonasconesquizofreniaalos
estmulosvisualesencomparacinconsujetossinpatologapsiquitricayconotraspatologas.
Estas diferencias se aprecian, tanto en respuesta subjetiva a imgenes visuales como en los
resultadosdeneuroimagen.

anarosagonzalezbarroso@gmail.com

87

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PERSONALIDAD,EVALUACINYTRATAMIENTOPSICOLGICOS

EMOCIONES,HIPERTENSINESENCIALYADHERENCIAALTRATAMIENTO

Alemn,J.F.; Rueda, B.

Se estudiaron en 219 hipertensos las diferencias, en funcin del sexo y duracin de la


hipertensin (HTA), respecto a determinadas emociones y al incumplimiento del tratamiento.
Se determin tambin la capacidad predictiva que tenan estas variables con respecto al
incumplimientodeltratamiento.
Losresultadosmostraronquelasmujerespresentabanmayoralexitimia,malestaremocionaly
afecto negativo. Conforme mayor era la duracin de la HTA ms altaera laalexitimia, yms
bajalairainteriorizadayexteriorizada.
Asimismoelserhombre,lairainteriorizadayunamenorduracindelaenfermedadpredijeron
unmayorincumplimiento,mientrasquelaalexitimiaylaambivalenciapositivaserelacionaron
conunincumplimientomsbajo.
Estosdatosponendemanifiestolanecesidaddeconsiderarenconsultaelpapelquetienenla
cronificacindelahipertensinyelsexodelpaciente,sobresusemociones,ylainfluenciade
todosestosfactoressobrelaadherenciaaltratamiento.

juanfraale@orange.es

88

SESIN DE PSTER

PERSONALIDAD,EVALUACINYTRATAMIENTOPSICOLGICOS

EXPRESINCONDUCTUALYDIRECCIONALIDADDELASAGRESIONESEN
LASRELACIONESDENOVIAZGO

RubioGaray,F.;LpezGonzlez,M.A.;Sal,L.A.;SnchezElvira,A.

La violencia en el noviazgo suele comenzar en las primeras relaciones adolescentes, presenta


frecuentementeuncarcterbidireccionalyconstituyeunfactorderiesgoparaagresionesms
graves cuando la pareja comienza a convivir. En este trabajo se investiga la expresin
conductualyladireccionalidaddelaviolenciaperpetradaysufridadentrodelasrelacionesde
noviazgo. La muestra estuvo compuesta por 69 estudiantes con edades entre los 16 y los 27
aos. Los resultados ms destacables mostraron un patrn recproco muy frecuente en la
agresinpsicolgicay,enmenormedida,enlaviolenciafsicagrave(e.g.,golpesopalizas).El
sexo de los participantes no predijo la direccionalidad de la violencia. Adems, la violencia
psicolgicafuelamodalidadagresivamsperpetradaymssufridaporlasvctimas.
Laprincipalimplicacinprcticadeestetrabajoeshacervisibleungraveproblemasocialcomo
eslaviolenciaenlasrelacionesdenoviazgo.

frubiogaray@cop.es

89

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PERSONALIDAD,EVALUACINYTRATAMIENTOPSICOLGICOS

AUTODEFINICINYDIFERENCIACINDELSMISMOMEDIDASATRAVS
DELATCNICADELAREJILLA

LpezGonzlez,M.A.;Sal,L.A.;RubioGaray,F.;GonzlezBrignardello,M.P.

En este trabajo se ha exploradola construccin del s mismo mediante la Tcnica de laRejilla


(Kelly,1955)enunamuestradepacientescontrastornosdepresivos(n=30)frenteaunamuestra
comunitaria (n= 30). Previamente al estudio de la posicin que las personas otorgan a los
elementos yo actual y yo ideal y al anlisis de la diferenciacin del s mismo, los
constructospersonaleselicitadossecategorizaronenfuncindelasvirtudesylasfortalezasdel
carcterdescritasporPetersonySeligman(2004).Losresultadosmostraronmsconstructosen
las categoras autocontrol y autorregulacin e inteligencia emocional, personal y social en el
grupo clnico. Adems, se encontraron diferencias significativas entre ambos grupos en la
posicin del yo actual con respecto al yo ideal. Asimismo, el nmero de constructos
discrepantes, congruentes y dilemticos fue significativamente diferente en ambos grupos en
varias de las virtudes analizadas. Finalmente, los pacientes con depresin presentaron baja
autoestima,unaconstruccinnegativadelyoyunapercepcindiferentedesuentornosocial.

malopez@acoruna.uned.es

90

SESIN DE PSTER

PSICOLOGABSICAI

BUSCANDOAUNNIOLLAMADOJAK

DelRincn;M.R.

Elobjetivodeestetrabajoes,utilizandocomovnculoeldibujoidentitarioconniosnacidosen
Espaaprovenientesdefamiliadeorigenmagreb,explorarlassemejanzasydiferenciasquese
observan entre un modelo de nio ideal de su edad dibujado por ellos mismos, las
modificacionesendichomodeloparaadaptarloalaimagenqueellosmismostienendeunnio
defamiliadeorigenmagrebylaimagenquetienendeunniodefamiliadeorigenespaol.
Los resultados muestran que se aprecian cambios significativos principalmente en aspectos
fsicos como son pelo, piel y dientes, no aprecindose apenas diferencias en vestimenta o
accesorios.

rosidelrincon@gmail.com

91

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PSICOLOGABSICAI

LARESTRICCINDEPOLIDIPSIAINDUCIDAPORPROGRAMAALFINALDE
UNINTERVALODE120SEGUNDOSFACILITALAEJECUCINPOSTERIOR
COMOFENMENOPOSTPELLET

lvarezA.;bias,J.;PellnR.

SeinvestiglaadquisicindepolidipsiainducidaporprogramaPIPendoslugaresdiferentes
de un intervalo entre bolitas de comida de 120 segundos. Se utilizaron 14 ratas Wistar. A la
mitad de los animales se les permiti obtener agua al efectuar lametones durante los 30
primeros segundos del intervalo, la otra mitad tan solo obtuvo agua durante los ltimos 30
segundos. Tras 15 sesiones se compararon los niveles de adquisicin. A continuacin se
realizaron5sesionesmsinvirtiendolascondicionesexperimentales.Enambasfasesunaluz
indicaba la disponibilidad de la bebida durante cada subintervalo de 30 segundos y los
lametonesreforzadosconaguasemarcaronconunclic.Seregistraronloslametonesefectuados
durantetodalasesinylosmililitrosdeaguaconsumidos.
Los resultados mostraron un retraso en la adquisicin de PIP en el grupo que obtena agua
durante los ltimos 30 segundos del intervalo, durante la primera fase, estos animales
mostraron tasas de bebida menores que aumentaban ms lentamente segn discurrieron las
sesiones. El cambio de programa mantuvo los niveles de bebida en las ratas que durante la
adquisicin bebieron en los 30 primeros segundos del intervalo. Respecto a los animales que
haban adquirido PIP en la primera fase durante los 30 ltimos segundos del intervalo
igualaron los mismos niveles de adquisicin del otro grupo durante la segunda fase. Los
resultadosmuestranevidenciadequelaejecucindePIPsevefacilitadacomofenmenopost
pellet,pero,tambinindicanquelaadquisicindeestaconductanoserestringeaesemomento.
mareavk@gmail.com

92

SESIN DE PSTER

PSICOLOGABSICAI

CEGUERAALCAMBIO

Andrs,D.;Montoro,P.R.;Moreno,F.J.

Lacegueraalcambioocurrecuandoelobservadornovecambiosgrandesqueseproducende
forma rpida en alguna regin de la imagen que se le presenta, pero que una vez que presta
atencin,loscambiossonclaramentevisibles.Tantolacegueraporinatencin(incapacidadque
tenemos para detectar ciertos cambios en un objeto o en una escena a los que no atendemos)
como la ceguera a cambios graduales (incapacidad de detectar cambios en una imagen que
ocurrenmuylentamente)sonlasvariantesdeestefenmenoqueseinvestigaron.

Parasuestudioexperimentalserecurrialarealizacindedostrabajosaudiovisualescapaces
dereproducirenelsujetoexperimentaldichosfenmenos.Enconcretounvideomorphingyun
videoenelquelaatencinsecentrasobredospersonajes.Yadoscuestionariosparamedirsus
resultados.Elanlisisposteriordelosdatosconfirmanlasteorasdesarrolladasalrespecto.

ese_ctgales@hotmail.com

93

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

PSICOLOGAEVOLUTIVAYDELAEDUCACIN

EVALUACINDELARELACINMADREHIJODURANTELOSPRIMEROS6
MESES

Jaez,M.;Rodrguez,C.

Desde que el beb es concebido, se da una predisposicin a compartir entre madre e hijo,
siemprequelaaccinquelosuna,permitaqueseafectenmutuamente(Kaye,1982).Estonoes
as, cuando el nio presenta problemas o en situaciones* donde el beb no es deseado y el
ambientenoestpreparado.

Con este estudio piloto, realizamos un seguimiento de madres menores de 18 aos (muestra
datada como prototipo de esta dificultad* cuando el embarazo no es controlado). Tomamos
datosfilmadosyatravsdeinstrumentosdeobservacin(M.A.IyELLAN)estudiamoscmo
sevagestandoelencuentroentremadreehijo.
Valoramos la sensibilidad con que esta responde al nio y cmo afecta a su respuesta
emocional.

Encontradeloesperado,seevidenciunaproporcinaltaderespuestassensiblesyestadode
bienestarpositivoenelbeb.
Dados los resultados, creemos importante revisar la idoneidad del criterio de la edad en la
comparacindeexperiencias.

mariajanez@hotmail.com

94

SESIN DE PSTER

METODOLOGAYCIENCIASDELCOMPORTAMIENTO

VIOLENCIAHACIALAMUJERENLAADOLESCENCIA:IMPORTANCIADELA
VARIABLESEXISMOYDELASCARACTERSTICASINDIVIDUALESDE
AGRESORESYVCTIMAS

Molina,M.

Enestetrabajoseestudialafrecuenciaconlaqueseproducendiferentessituacionesdemaltrato
hacialamujerenunamuestradeadolescentesescolarizadosenelsegundociclodeESO,tanto
desdeelpuntodevistadelagresorcomodelavctima.Asmismo,seanalizalaimportanciade
las actitudes sexistas y ciertas caractersticas individuales, como agresin en los chicos y
asercin en las chicas, en la explicacin de la violencia hacia la mujer que se produce en las
relaciones de pareja en la adolescencia. Por ltimo, se analizan las relaciones entre actitudes
sexistas y agresin, en el caso de los chicos, y entre actitudes sexistas y asercin, en el de las
chicas.Losresultadosindicanquelaviolenciahacialamujeryaesunproblemapreocupanteen
la adolescencia, y que en su explicacin juega un papel fundamental factores de ndole
sociocultural, como las actitudes sexistas de los agresores y de las vctimas. En cuanto a la
importanciadelascaractersticasindividualessupapelobienresultairrelevanteparaexplicar
la violencia hacia la mujer, como es el caso de la variable asercin en las chicas, o bien su
impacto se produce a travs de su interaccin con la variable sexismo, como es el caso de la
variable agresin en los chicos. Tambin se observa una relacin entre actitudes sexistas y
conductas agresivas en los chicos, relacin que no se observa entre actitudes sexistas y
conductasasertivasenlaschicas.

mmolina2mil@hotmail.es

95

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

METODOLOGAYCIENCIASDELCOMPORTAMIENTO

USODEALGUNASTCNICASDEMETAANLISISENLAREVISIN
BIBLIOGRFICADEARTCULOSCIENTFICOSDECUALQUIERREADE
CONOCIMIENTO(DEPRESINENRATASDELABORATORIO)

bias,J.;SanLus,C.;PrezLlantada,M.C.

Se realiz una bsqueda bibliogrfica de publicaciones en revistas cientficas sobre modelos


animalesconratasdelaboratoriocentradaentrastornosrelacionadosconelcomportamientoy
lasalud.
Primeroseevaluaronlashiptesisprincipalesdecadainvestigacinapartirdelosresultados
de los estadsticos de contraste empleados. A continuacin se distribuyeron los resultados en
funcindelosprocedimientosempleadosylasmedidasrecogidas.Encadacasoseestimaronel
tamao del efecto estudiado y la potencia del contraste realizado. Se ampli esta informacin
con las referencias de tamao muestral ideal enunestudio paraobtener unapotencia ptima
(0,8). Esto ltimo permiti comprobar hasta que punto coincidan las estimaciones realizadas
conlosdatosdereferencia.
Se ofrece este mtodo como una ayuda en el contexto de la revisin bibliogrfica que forma
parte de la planificacin de una investigacin. Permite obtener una interseccin de las
reflexionestericasdelosdiferentesautoresmedianteestetipoderesultadosderivadosdelas
tcnicasmetaanalticas.

j.ibias.martin@gmail.com

96

TRABAJOSCOMPLETOS

TRABAJOS COMPLETOS

RELACIONESENTRELACOMPLEJIDADDELAUTOCONCEPTOYLA
IDENTIFICACINSOCIALDELOSINMIGRANTESCONLACULTURADE
DESTINO.

AndrsToledoCotillasyJosFranciscoMoralesDomnguez
FacultaddePsicologa,UNED
RESUMEN
En este estudio se analiza la relacin que existe entre la identificacin social que los
inmigrantes elaboranconlacultura de destinoyotras variables como la complejidad
delautoconcepto,eltiempodeestanciaenelpasdedestino,elapoyosocialpercibido,
lasdificultadesdeadaptacinsufridasylossntomasdemalestarfsicospercibidospor
los sujetos inmigrantes. La muestra estuvo compuesta por sujetos de nacionalidad
espaola y boliviana, y los resultados indican que la complejidad del autoconcepto
influye, en diferentes grados, en esa identificacin, pero no as el tiempo de estancia.
Tambin, que esa identificacin acta como factor sobre el grado de sintomatologa
fsicapercibidaysobrelapropiaadaptacinsocialdelcolectivoinmigrante.
PALABRASCLAVE
Identidad social, complejidad del autoconcepto, inmigracin, cultura, dificultades de
adaptacin
INTRODUCCIN
Labasetericasobrelaquesesustentaesteestudiotienedosmarcosdiferenciados.Por
unlado,layaclsicaTeoradelaIdentidadSocialylaTeoradelaCategorizacindel
Yo(odelaAutocategorizacin),desarrolladasporTurner(1981)yTajfel(1982)ycuyos
principales corolarios indican que las personas nos categorizamos en grupos para
adquirirdistintividadpositivamedianteunprocesodeidentificacinsocial.
Unas de las principales identidades que se adquieren es la que tiene que ver con la
nacionalidadolaidentificacinconlaculturadeorigen.Cabepensarque,cuandoun
individuo cambia de pas, la adaptacin cultural conllevar un proceso de
identificacin con la cultura o pas de destino, que facilitar la comprensin de las
conductasquesonadecuadasyexitosasenesenuevocontextosocial(yquepuedenno
serloenelotro),ycabepensarqueestaadaptacinalaculturadedestinoafectarasu
bienestarpsicolgico.
ElSndromedeUlisesesunejemplodelasconsecuenciasdeunamalaadaptacindel
sujetoinmigrante,ysecaracterizaporuncuadrodesntomasdemalestartalescomo
estrs,ansiedad,depresin,etctera(TopayLisbona,2003).
Elotromarcodereferenciaestrelacionadoconlacomplejidaddelautoconceptoycon
los aspectos del yo. El autoconcepto se compone de diferentes aspectos del yo: son
ideasquesirvenparadefinirnos,ycuyacantidadycalidadafectanacmonosvemosa

99

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

nosotrosmismosendeterminadassituacionessociales(Linville,1985).Comosabemos,
la identificacin social contribuye a la elaboracin de un autoconcepto positivo, pero
este autoconcepto puede tener un mayor o menor grado de complejidad que puede
dificultar o facilitar la adaptacin de los individuos al contexto en el que estn
inmersos(GrinbergyGrinberg,1984;Huici,1999).
MTODO
Participantes
Para comprobar las posibles relaciones entre estas variables se tom una muestra
compuestapor59sujetosdenacionalidadespaola,deentre22y66aos,y49sujetos
denacionalidadboliviana,deentre14y67aos.
Instrumentosyprocedimiento
Los participantes rellenaron un cuestionario en situacin de evaluacin en el que se
recogieron datos sociodemogrficos (como la edad, el sexo, el nivel de estudios y el
nivel de ingresos), la nacionalidad y el tiempo de estancia en nuestro pas; los
participantes tambin rellenaban una escala de complejidad del autoconcepto que
meda la cantidad de aspectos del yo de los sujetos adaptada de Kashima y Hardie
(2000),unaescaladeapoyosocialpercibido(Bermdez,PrezGarcaySnchezElvira,
1990), otra de sintomatologa fsica percibida (Lafferty et al., 1982), una escala de
identificacin social con la cultura espaola (Leach et al., 2008) y, en el caso de los
sujetos inmigrantes, se solicitaba que cumplimentaran tambin una escala de
identificacinconlaculturadeorigen(b.:Leachetal.)yunaescaladedificultadesde
adaptacin(Basab,ZlobinayPez,2004;FernndezyMorales,2008).
RESULTADOS
Losanlisisestadsticosrealizadosarrojanresultadossignificativosquesondeinters
enalgunosaspectos.Porejemplo,loscontrastesdemediasindicanquelossujetosde
origen boliviano que residen en Espaa perciben mayor sintomatologa fsica que los
sujetosespaoles(Media:1,96;SD:,22;Vs.Media:1,74;SD:,35;t=3,694,p<,001).Estos
resultadossoncoherentesconelmencionadoSndromedeUlises.
Ensegundolugar,encontramosquelosinmigrantespuntanmsaltoenlaescalade
identificacin con la cultura espaola que los propios sujetos espaoles (Media: 5,39;
SD: ,39; Vs. Media: 4,86; SD: 1,37; t=2,64, p=,01). En principio puede parecer una
incoherencia,peroesnaturalpensarqueparalosespaoleslaidentidadnacionalnoes
algosalienteensuvidacotidiana,mientrasqueparaelsujetoinmigrante,queviveen
nuestro pas y que necesita adaptarse a nuestra cultura, esta identificacin se hace
salienteensudaada.
Entercerlugar,observamosquelosinmigrantespercibenmayorapoyosocialquelos
espaoles(Media:4,07;SD:,23;Vs.Media:3,71;SD:,33;t=6,526,p<,001).Unaposible

100

TRABAJOS COMPLETOS

explicacinaestefenmenoesque,engeneral,losinmigranteshacenmsusodelos
lazos sociales para adaptarse a la cultura de destino, mientras que los espaoles no
percibenunaltogradodeapoyosocialsencillamenteporquenolonecesitanparaesta
adaptacin.
Respectoalacomplejidaddelautoconcepto,noseobservarondiferenciassignificativas
entrelaspuntuacionesdeambosgrupos,esdecir,tantoespaolescomobolivianosson
similares en sus niveles de complejidad del autoconcepto (Media: 4,14; SD: ,40; Vs.
Media:4,09;SD:,25;t=,83;NS).
Unavezrealizadosloscontrastesdemedias,secomprobsialgunasvariablespodan
darexplicacincausalaotras,mediantelosanlisisderegresinlineal.
Se obtuvo que, en la muestra de sujetos espaoles, el apoyo social pronosticaba el
grado de sintomatologa fsica percibida, de modo que a mayor apoyo social, menor
sintomatologa(=,480;t=4,331);locualescoherenteconlamayoradelasteorasdel
apoyosocial.
Adems,enestemismogrupo,seobserv queunamayoridentificacinsocialconla
culturaespaolapronosticabaunmayorgradodesintomatologafsicapercibida(=
,264;t=2,380),locualpuededeberseaquelosespaolesquemsseidentificanconsu
nacionalidadtambinsehallanmspreocupadosporlosproblemasqueacosanalpas
comogruposocialalqueperteneceny,portantosesientenmsafectadosfsicamente.
Respecto a la muestra de sujetos bolivianos, se hall que la complejidad del
autoconcepto es una causa de las dificultades de adaptacin, de manera que cuanto
mscomplejoeselautoconceptodelsujetoinmigrante,msfcilleresultaadaptarsea
la cultura de destino (=,320; t=2,397). Esto se debe a que una mayor complejidad
significa que el sujeto tiene mayores tendencias a configurar sus aspectos del yo de
formanicaeirrepetible,manteniendoportantosuidentidadindividual.
De esta forma, no le resulta tan difcil desapegarse de su identidad con la cultura de
origenyelaborarunanuevaidentidadconlaculturadedestino,puesestmsabierto
al cambio y tambin soporta mejor las dificultades de adaptacin que encuentra a su
llegadaanuestropas.
Porltimo,eltiempodeestanciaennuestropasafectapositivamentealasfacilidades
de adaptacin de los sujetos bolivianos. En efecto, cuanto ms tiempo llevan los
inmigrantes en nuestro pas, mayor ser su conocimiento del contexto social y de las
conductasqueresultanadecuadasenlassituacionessociales,yportanto,mayorser
sufacilidaddeadaptacin(=,284;t=2,122).
DISCUSIN
Una vez expuestos los anlisis de datos, cabe realizar una breve reflexin terica.
Existen modelos tericos que han intentado dar explicacin al modo en que la

101

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

complejidad del autoconcepto se relaciona con la identificacin social, mediante los


mencionados aspectos del yo. El modelo SAMI (Modelo de Identidad de los Aspecto
delYo)deSimon(2004)indicaquelosaspectosdelyocobranespecialrelevanciaenla
formacindelaidentidadsocial.Cuandounapersonahacesalienteunsoloaspectodel
yo,amododefigurafondo,seproduceunaidentificacincontodasaquellaspersonas
que se autointerpretan bajo el mismo atributo, surgiendo de este modo lo que las
teoras clsicas definen como identidad social o colectiva. En cambio, cuando
varios aspectos del yo resultan salientes el sujeto elabora una configuracin nica e
irrepetible de aspectos del yo, no encontrando a nadie que coincida con ese perfil y
construyendoportantounaidentidadindividual.
El modelo, aunque potente, est poco desarrollado, ya que como sabemos existen
numerosas variables psicosociales que afectan a la identidad, y este modelo permite
incardinarunaspectodelapersonalidadcomoeselautoconceptoenlaexplicacinde
laformacindelaidentidadsocial,peronodebemosolvidarnumerososaspectosdel
contextoydelascondicionesambientalesqueinfluyendemaneramuysignificativaen
elprocesodeidentificacin.
Por ltimo, sealaremos las limitaciones del estudio y las propuestas para prximas
investigacionesrelacionadasconeltema.Enprimerlugar,cabemencionarquenuestra
muestra es reducida y que, por tanto, los resultados podran verse reforzados con
muestrasmsamplias.Dehecho,nosepudodesarrollarconxitounanlisisfactorial
delasescalasdeidentificacinporestemotivo.
Otra cuestin sera comprobar si lo que es cierto para nuestra muestra de sujetos
bolivianos es tambin cierto para individuos de otras nacionalidades, si existen otras
variables no estudiadas (como por ejemplo el idioma u otras variables psicosociales)
queserelacionanconlaadaptacinyconlaidentificacin,lainfluenciasobreaspectos
delasaludendiferentesgrupossocialesyendiferentespatologas,ytambinpodra
hacerseusodemetodologaexperimentalenlugardemediantecuestionarios.
Todo ello contribuira a dilucidar con mayor precisin y nitidez las relaciones
existentes entre el autoconcepto y su complejidad y la identificacin social de los
inmigrantesconlaculturadedestino,losfactoresqueinfluyenensuadaptacinsocial
ylosposiblesefectossobrelasaluddelosindividuos.

REFERENCIAS
Basab,N.,Zlobina,A.,yPez,D.(2004).Integracinsocioculturalyadaptacinpsicolgicade
losinmigrantesextranjerosenelPasVasco.CuadernosSociolgicos,15,1141.
Bermdez, J., PrezGarca, A. M., y Snchez, M. A. (1990). Type A behavior pattern and
attentionalperformance.PersonalityandIndividualDifferences,11,1318.

102

TRABAJOS COMPLETOS

Fernndez, I. y Morales, J. F. (2008). Una aproximacin a la relacin entre inmigracin y


exclusin.EnJ.F.Morales,C.Huici,E.GaviriayA.Gmez(coords.):Mtodo,Teorae
InvestigacinenPsicologaSocial(591602).Madrid:Pearson.
Grinberg, L. y Grinberg, R. (1984). Psicoanlisis de la migracin y del exilio. Madrid: Alianza
Editorial.
Huici,C.(1999).Lasrelacionesentregrupos.EnJ.F.MoralesyC.Huici(Eds.),PsicologaSocial
(209234).Madrid:McGrawHill.
Kashima,E.S.,&Hardie,E.A.(2000).DevelopmentandvalidationoftheRelational,Individual
andCollectiveaspects(RIC)scale.AsianJournalofSocialPsychology,3,1948.
Lafferty,J.C.,Cooke,R.A.,Coletti,L.,Fisher,D.J.,Miller,W.C.,&Webber,T.(1982).Stress
ProcessingReport.FormII.Plymouth,MI:HumanSynergistics.
Leach, C. W., van Zomeren, M., Zebel, S., Vliek, M. L. W., Pennekamp, S. F., Doosje, B.,
Ouwerkerk,J.W.;Spears,R.(2008).Grouplevelselfdefinitionandselfinvestment:A
hierarchical (multicomponent) model of ingroupidentification. Journal of Personality
andSocialPsychology,95(1),144165.
Linville, P. W. (1985). Selfcomplexity and affective extremity: Dont put all your eggs in one
cognitivebasket.SocialCognition,3,94120.
Simon, B. (2004). Identity in modern society: A social psychological perspective. Oxford:
Blackwell.
Tajfel, H. (Ed). (1982). Social Identity and Intergroup Relations. Cambridge: Cambridge
UniversityPress.
Topa,G.yLisbona,A.(2003).Losinmigrantesfrentealmercadolaboral.EnF.J.PalacyJ.A.
Moriano (coord.), El nuevo mercado laboral: Estrategias de insercin y desarrollo
profesional(205227).Madrid:CuadernosdelaUNED.
Turner,J.C.(1981).Theexperimentalsocialpsychologyofintergroupbehavior.InTurner,J.C.
&Giles,H.(Eds),IntergroupBehaviour(66101).Oxford:Blackwell.

103

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

108

TRABAJOS COMPLETOS

LIDERAZGOTRANSFORMACIONAL:
IDENTIFICACINORGANIZACIONAL,RELACIONESINTRAGRUPALESY
SATISFACCINLABORAL

ClaraIsabelMorgadesBambayFernandoMoleroAlonso
FacultaddePsicologa,UNED

RESUMEN
El objetivo del estudio es analizar las posibles relaciones entre el liderazgo
transformacionalyalgunasvariablesrelevantes.stasson,laimportanciaotorgadapor
los empleados a la calidad del liderazgo, la identificacin del trabajador con la
organizacinalaquepertenece,lasrelacionesentrecompaerosylasatisfaccinenel
mbitolaboral.Paraelloseseleccionantrecegruposdetrabajadores,cadaunodirigido
porunlder.Sietedeellospertenecenaadministracionespblicasylosseisrestantes
formanpartedeempresasprivadas.Losparticipantesevaluarontantoasusuperioren
liderazgo transformacional, como las dems variables. A mayor liderazgo
transformacional, seran previsibles mejores relaciones entre compaeros y mayor
identificacin y satisfaccin. Los resultados apoyan esta hiptesis, aunque existen
diferencias entre las variables estudiadas. Se pone de manifiesto una considerable
relacindirectaentreelestilotransformacionaldeliderazgoylasatisfaccinlaboral.

PALABRASCLAVE
Liderazgo transformacional, satisfaccin laboral, identificacin organizacional,
relacionesintragrupales,sectorpblico/privado

INTRODUCCIN
Alolargodelosaos,laPsicologaSocial,laPsicologadeGruposylaPsicologade
lasOrganizacioneshaabordadoelestudiodelliderazgo,unfenmenoqueseproduce
en todos los grupos humanos consistente en un proceso de influencia entre lder y
seguidores que tiene como fin alcanzar las metas de un grupo, organizacin o
sociedad.Sehanestudiadovariosestilosdeliderazgo.Eldenominadotransaccional,se
basa en transacciones entre lderes y seguidores, intercambios de recompensas o
refuerzos. Este liderazgo produce efectos positivos en el rendimiento y en la
satisfaccindelosempleadoscuandoescorrectamenteaplicado.Sinembargo,nobasta
para explicar que ciertos lderes sean capaces de cambiar de manera radical las
creencias,valoresyactitudesdesusseguidores.Paraexplicardichosefectos,B.M.Bass

105

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

(1985)reconocilaexistenciadeotrotipodeliderazgo,cuyoestudiohemosabordado
enestainvestigacin,elliderazgotransformacional.Elldertransformacionalconsigue
concienciar a sus subordinados de la importancia del trabajo a realizar, es capaz de
hacerlestrascenderdesupropiointersenbeneficiodelgrupoydealterarsujerarqua
de necesidades. No slo es capaz de cambiar a sus seguidores (actitudes, creencias,
valores)sinotambindeconseguirunincrementoexcepcionaldesurendimiento.Por
otra parte, el lder transformacional promueve la maduracin como persona del
trabajador y apoya el desarrollo de las habilidades creativas y estratgicas de sus
seguidores.Elliderazgotransformacionalestcompuestoporcuatrofactores:
1.Carisma:Eselfactormsimportanteyserelacionaconunavinculacinpersonale
identificacinqueestelderconsiguedespertarensusseguidores.
2. Inspiracin: Hace alusin a la capacidad del lder para ilusionar y motivar a sus
seguidoresparaalcanzarlasmetaspropuestas.Setratadequestosseidentifiquen,no
conelldercomoapuntaelfactoranterior,sinoconlavisinylosproyectosqueste
propone.
3. Estimulacin Intelectual: Se refiere a la capacidad del lder para promover en sus
seguidoreslautilizacindesupropiainteligenciaypensamientocreativoalahorade
solucionarlosproblemasquesepresentan.
4.Consideracinindividualizada:Hacereferenciaalacapacidaddellderparatratar,
orientar y apoyar a sus seguidores individualizadamente, segn sus distintas
caractersticas,experiencias,expectativas,potencialidadesylimitacionespersonales
Losdosprimerosfactorescorrespondendemaneraaisladaalliderazgocarismtico,el
cual puede tener efectos muy perjudiciales en los seguidores (por ejemplo, en las
sectas).Escuandoestosfactoressecomplementanconlosdossiguientes,cuandotiene
lugarelliderazgotransformacional,ylosefectossiempresonpositivos.
En estudios realizados en Espaa sobre este tipo de liderazgo se han encontrado
resultados muy positivos. Se han encontrado altas correlaciones entre el liderazgo
transformacional y variables organizacionales tan importantes como la eficacia, la
satisfaccin y el esfuerzo extra de los trabajadores (Molero, 1995). Tambin se han
puesto de manifiesto altas correlaciones positivas entre este estilo de liderazgo y la
satisfaccin laboral, la claridad del rol, el grado de autonoma percibido por los
seguidoresylacalidaddelasrelacionesinterpersonales(Molero,2004;Morales,Navas
yMolero,1996).
La hiptesis de este estudio es que existirn relaciones positivas entre el liderazgo
transformacional y el resto de variables estudiadas. Es decir, cuanto ms
transformacionalseaellder,mayoressernlaidentificacindesussubordinadoscon
la organizacin, la satisfaccin de stos en el mbito laboral y la calidad de las

106

TRABAJOS COMPLETOS

relaciones interpersonales en el grupo. Se controlan variables posiblemente


mediadoras, como el sexo de los trabajadores y del lder, el tiempo durante el cual
llevantrabajandojuntosyelcarcterpblicooprivadodelaorganizacin.
MTODO
Muestra
Participan en el estudio 71 personas (hombres: 35,2 % hombres, mujeres: 64,8%). Los
participantespertenecena13gruposdetrabajodiferentes,deloscuales,7integranla
plantilla de distintos centros pblicos de salud espaoles, y 6 pertenecen a
organizaciones privadas de diversas reas (comercio, seguros, construccin, belleza).
La edad media de los participantes es de 45 aos. La mitad de participantes son
tituladosuniversitariosylaotramitadhacursadoestudiosdeEGB,FPoBachillerato.
Eltiempomedioquellevantrabajandoenelgrupoesde12,73aosyeltiempomedio
bajo la supervisin del lder evaluado, 8,7 aos. Siete de los lderes evaluados son
hombres,mientrasqueenseisgruposellderesunamujer.
Instrumentos
Seadministralosparticipantesuncuestionariodivididoencincobloquesdetallados
acontinuacin,correspondendocadaunoaunavariabledelasestudiadas.Enprimer
lugar, se presenta la Seccin A, en la que se utiliza el cuestionario MLQ (Multifactor
LeadershipQuestionnaire)conobjetodemedirlavariableliderazgotransformacional.
Acontinuacin,enlaSeccinBseutilizalaescalaRLS(RomanceofLeadershipScale),
que mide la importancia atribuida al liderazgo en general por las personas. En la
Seccin C se mide la identificacin organizacional, haciendo uso del cuestionario OI
(OrganizationalIdentificationQuestionnaire).EnlaSeccinDsemidelacalidaddela
relacin existente con los compaeros de su grupo de trabajo. Se utiliza la versin
reducidadelaescalaECRS(ExperiencesinCloseRelationshipScaleShortForm). La
variable medida en esta seccin recibir el nombre relaciones interpersonales. Por
ltimo,enlaSeccinEsemidelasatisfaccinlaboral,divididaensatisfaccinconlos
compaeros (en adelante, E1) y satisfaccin con los mtodos de liderazgo empleados
(en adelante E2). Finalmente, se preguntaron algunos datos biogrficos y personales
(sexo, edad, estudios, provincia y profesin), as como las principales caractersticas
organizacionales y grupales (sector, carcter pblico/privado, tamao organizacional,
tamaogrupalysexodellderevaluado).Tambinselespidiinformacinreferenteal
tiempoquellevabantrabajandoenelmismogrupodetrabajoybajolasupervisindel
mismolder.
Procedimiento
Se seleccionaron 13 grupos de trabajo pertenecientes a organizaciones tanto privadas
como pblicas y supervisados por un lder (hombre o mujer). stos accedieron

107

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

voluntariamente a participar en el estudio. Los 71 participantes cumplimentaron los


cuestionarios de manera individual, tras recibir una breve orientacin sobre los
objetivosdelestudioylanecesidadderespondercontotalsinceridad.Segarantizla
total confidencialidad de las respuestas y datos proporcionados. La media de tiempo
quenecesitaronlostrabajadorespararellenarelcuestionariofuede45minutos.
RESULTADOS
Los grupos que obtuvieron las puntuaciones medias ms altas en A: Liderazgo
Transformacional,sonlosquemayorespuntuacionesmediasobtienenenlasvariables
E1: Satisfaccin con los compaeros de trabajo y E2: Satisfaccin con los mtodos de
liderazgo empleados. De la misma manera, los grupos con puntuaciones bajas en A,
tambinobtienenbajaspuntuacionesenE1yE2.
En la Tabla 1 se muestran las correlaciones obtenidas entre la variable Liderazgo
Transformacionalylasdemsestudiadas.Comopodemosapreciarenella,elndicede
correlacin de Pearson obtenido entre las variables A y E1 es de 0,489, lo que indica
relacindirectaentreellas.Esdecir,cuandounaaumentaodisminuye,laotratambin
lohace.
LasvariablesAyE2muestranunndicedecorrelacinde0,664,locualtambinindica
una asociacin ms fuerte. Es decir, cuando vare A, E2 tambin variar en la misma
direccinqueella,peroenmayormedidadeloqueloharE1.

ndice correlacin con Liderazgo Transformacional


Importancia atribuida al Liderazgo

0,167

Identificacin Organizacional

0,422

Relaciones Interpersonales

0,265

Satisfaccin Compaeros

0,489

Satisfaccin Mtodos Liderazgo

0,664

Tabla 1. Coeficiente de correlacin de Pearson entre la variable Liderazgo Transformacional y las dems variables

Cuando el estilo del lder es ms transformacional, los trabajadores informan de una


mayor satisfaccin con el trato entre compaeros y con los mtodos de liderazgo
empleados por su superior. Parece que resulta ms satisfactorio para el trabajador
contar con un lder transformacional. En cuanto a las dems variables, tambin
muestran relacin directa con el liderazgo transformacional, siendo sta ms
significativa en el caso de la Identificacin organizacional. El grupo que evala a su

108

TRABAJOS COMPLETOS

lder como menos transformacional es el que ms identificado se siente con su


organizacin (seguido por grupos altos en liderazgo transformacional) y esto podra
deberse a que el lder ejerciera un estilo de liderazgo carismtico, pero no
transformacional.Comovemos,seponedemanifiestolarelacindirecta(enestecaso
ms moderada) entre el estilo transformacional de liderazgo y la calidad de las
relaciones interpersonales. Por ltimo, se observa dbil relacin directa entre el
liderazgo transformacional y la importancia otorgada al lder. En cuanto al carcter
pblico o privado de la organizacin, se presentan diferencias significativas en todas
lasvariables,siendosiempremayoreslaspuntuacionesobtenidasporlasempresasde
carcterprivado.LadiferenciamsacusadaseobservaenlaImportanciaatribuidaal
liderazgo.Noexistendiferenciassignificativasenningunavariableenfuncindelsexo
dellder.
DISCUSIN
Seponedemanifiestolaexistenciadeunarelacindirectasignificativaentreelestilo
de liderazgo transformacional y la satisfaccin general de los trabajadores, como
tambinhanmostradootrosestudiosrecientes(Nielsen,Yarker,RandallyMunir,2009;
Bodla, 2010; Yang, Wu, Chang y Chien, 2011). Parece que los trabajadores se sienten
ms satisfechos en su mbito laboral cuando son considerados como personas
individuales (teniendo en cuenta sus potencialidades y limitaciones personales) y no
slo como un miembro ms del grupo, cuando se les ofrece una visin optimista de
futuroycuandoselestransmiteentusiasmoyvalorespositivos.Nopodemosolvidar
queunodeloselementosclavedeesteestilodeliderazgoeslacapacidaddegenerar
entusiasmo.Esfcilsuponerqueamayorsatisfaccin,mayorentusiasmo,yviceversa.
Es probable que si el lder y sus seguidores comparten valores, se identifican como
grupoytienenverdaderoentusiasmoenllevaracabodemaneracorrectasutarea,este
entusiasmo aumente todava ms. Un grupo entusiasta siempre funcionar mejor
debido a que, seguramente, aumentarn su autoeficacia percibida y su deseo de
autorrealizacin (tanto individual como grupal). Todo ello, favorecer tambin la
identificacindelempleadoconlaorganizacinyconlatareaquellevaacabo,puesto
quelostrabajadorestienenvaloreseilusionesencomnconlaempresaycomparten
tambin sus visiones de futuro. La calidad de las relaciones interpersonales puede
verseafectadaporesteestilodeliderazgoyaqueellderesunmodeloatravsdelcual
el trabajador aprendey en elque se basaparallevara cabofuturasacciones.Deesta
manera,elsubordinadotratarconsuscompaerosdemaneraparecidaacomoellder
trataconl,establecindoseunclimaequilibradoenlasrelacionesdelgrupo.Ellder
transformacional consigue cambiar la cultura de grupo y homogeneizar valores y
creencias,creandoasrelacionesbasadasenlacomunicacinyenlacomprensindel

109

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

puntodevistadelotro.Siunapersonaseinvolucraensutrabajo,intentacrecercomo
persona mientras lo lleva a cabo y desea realizarlo lo mejor posible por propia
satisfaccin personal, se dice que trabaja bajo motivacin intrnseca. Los lderes
transaccionales suelen olvidarse de sta al atender demasiado a la motivacin
extrnseca(compensacioneseconmicas,beneficiosdentrodelaempresa,etc.).Porotro
lado, el lder transformacional es capaz de estimular intelectualmente a sus
subordinados, mostrndoles la importancia de ser creativo e innovador, ofreciendo
distintos puntos de vista sobre un mismo asunto y diferentes soluciones a un solo
problema. Cuando los integrantes de un grupo piensan por s mismos intentando
desarrollartodassushabilidadesalmximo(creatividad,intelecto,eficacia...)elgrupo,
rinde por encima de lo que lo hara si nicamente se limitaran a cumplir sus tareas.
Debemos aclarar que el lder transformacional debe tener un trato continuo con su
grupo (como es el caso de los lderes estudiados). El lder transformacional conoce a
sus subordinados, para as poder orientarles hacia el desarrollo de su madurez y
autorrealizacinpersonal,almismotiempoquelosmotivahaciaelcorrectodesarrollo
de su proyecto en comn. Un estilo de liderazgo transformacional resulta claramente
beneficiosoparalostrabajadoresyparaeldesempeogrupal,locualseverreflejado
enlaeficaciayresultadosdelaorganizacin.Dadalaacusadacrisiseconmicaactual,
sera muy conveniente que los lderes recibieran formacin especfica para ejercer su
poder de la manera ms eficaz y lo ms satisfactoriamente posible. Tanto las
administraciones pblicas como las privadas necesitan, ahora ms que nunca,
optimizaralmximosusrecursos(econmicos,tecnolgicos,humanos)ysosteneruna
visin optimista de futuro. Se hace cada vez ms necesaria una divergencia de
perspectivas y mtodos, un fomento de la innovacin de procedimientos y una
implantacin de nuevas actitudes. En cuanto a las diferencias encontradas segn el
carcter pblico o privado, cabe plantearse si desde el mbito privado se est
otorgando mayor importancia al rol del lder, lo que establece hiptesis para
posterioresinvestigaciones.

REFERENCIAS
Bass,B.M.(1985).Leadership:Good,Better,Best.OrganizationalDynamics,13(3),2640.
Bodla,M.yNawaz,M.(2010).Transformationalleadershipstyleanditsrelationshipwith
satisfaction.InterdisciplinaryJournalOfContemporaryResearchInBusiness,2(1),370
381.
Molero,F.(2004):Elliderazgo.EnC.HuiciCasalyJ.F.MoralesDomnguez(Directores),
PsicologadeGruposI,Estructurayprocesos(pp.141167)Madrid:UNED.
Molero,F.(1995):Elestudiodelcarismaydelliderazgocarismticoenlascienciassociales:Una
aproximacindesdelaPsicologaSocial.RevistadePsicologaSocial,10,1,4360
Morales,J.F.,Navas,M.S.yMolero,F.(1996):Estructuradegrupoyliderazgo.EnAyestarn,
S.(Ed.),Elgrupocomoconstruccinsocial(pp.79102).Rub:PluralEdiciones

110

TRABAJOS COMPLETOS

Nielsen,K.,Yarker,J.,Randall,R.yMunir,F.(2009).Themediatingeffectsofteamandself
efficacyontherelationshipbetweentransformationalleadership,andjobsatisfaction
andpsychologicalwellbeinginhealthcareprofessionals:Acrosssectional
questionnairesurvey.InternationalJournalOfNursingStudies,46(9),12361244.
doi:10.1016/j.ijnurstu.2009.03.001
Yang,F.,Wu,M.,Chang,C.yChien,Y.(2011).Elucidatingtherelationshipsamong
transformationalleadership,jobsatisfaction,commitmentfociandcommitmentbases
inthepublicsector.PublicPersonnelManagement,40(3),265278.

111

TRABAJOS COMPLETOS

LIDERAZGOAUTNTICOEINTENCINDEABANDONO.ELPAPEL
MEDIADORDELAIDENTIFICACINCONELGRUPODETRABAJOYEL
ENGAGEMENT

GaraziAzanzaMartnezdeLuco1;JuanAntonioMorianoLen1;FernandoMoleroAlonso1;
JeanPierreLvyMangin2
FacultaddePsicologa,UNED;2UniversitduQubecenOutaouais

RESUMEN
Enesteestudioseexaminalarelacinentrelapercepcindeliderazgoautnticodelos
trabajadoresysuintencindeabandono,mediadaporlaidentificacinconelgrupode
trabajo y el engagement. Se utiliz el Modelado de Ecuaciones Estructurales para
analizar los datos de 623 trabajadores espaoles. Los resultados obtenidos muestran
que el liderazgo autntico tiene un efecto negativo sobre la intencin de abandono y
efectos positivos sobre el engagement y la identificacin con el grupo de trabajo. La
identificacin tiene un fuerte impacto sobre el engagement, que a su vez afecta
negativamentealaintencindeabandono.Unadelasprincipalesconsecuenciasquese
pueden extraer de este estudio es que los lderes autnticos pueden influir en la
intencin de abandono de los trabajadores promoviendo su engagement. As, el
estudio identifica el autntico liderazgo como un elemento clave para retener a los
empleadosvaliososatravsdelfomentodelengagementdelosmismos.

PALABRASCLAVE
Liderazgo autntico, intencin de abandono, identificacin con el grupo de trabajo,
engagement.

INTRODUCCIN
El liderazgo autntico se define como un patrn de comportamiento del lder que
utiliza y promueve tanto las capacidades psicolgicas positivas como un clima
positivo, para fomentar una mayor conciencia de s mismo, un punto de vista moral
interiorizado, un procesamiento equilibrado de la informacin y una transparencia
relacional por parte de los lderes que trabajan con los seguidores, fomentando el
desarrollo positivo de los lderes y de los seguidores (Walumbwa, Avolio, Gardner,
Wernsing,yPeterson,2008).

113

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Estudios recientes llevados a cabo en varios pases (China, EE.UU., Kenia, Nueva
Zelanda y Espaa) han examinado la relacin entre el liderazgo autntico y diversas
variablespsicosocialesydeorganizacin,hallandoqueestrelacionadopositivamente
conlasatisfaccindelosseguidoresyeldesempeolaboral(Walumbwaetal.,2008),
el capital psicolgico colectivo, la confianza y el desempeo grupal (Walumbwa,
Luthans, Avey y Oke, 2009), el crecimiento de ventas (ClappSmith, Vogelgesang y
Avey, 2009), el comportamiento de ciudadana organizacional (Walumbwa, Wang,
Wang,SchaubroeckyAvolio,2010),elesfuerzoextradelosseguidores,lasatisfaccin
con el lder y la eficacia de liderazgo percibida (Moriano, Molero, y Lvy Mangin,
2011).
Elobjetivoprincipaldeesteestudioesexaminarlarelacinentreelliderazgoautntico
percibidoporlostrabajadoresysuintencindeabandono,ylosprocesossubyacentes
por los cuales los lderes autnticos ejercen su influencia sobre la intencin de
abandonomedianteelanlisisdelpapelmediadordelaidentificacinconelgrupode
trabajo y el engagement. Se propone que la intencin de abandono ser una
consecuencia directa de dos variables clave: el engagement y la identificacin con el
grupo de trabajo. Estas dos variables ejercern una influencia negativa sobre la
intencin de abandono. De la misma manera, se propone que el liderazgo autntico
percibidoporlostrabajadorespuedeaumentarsuengagementylaidentificacincon
el grupo de trabajo, y que el liderazgo autntico tendr un efecto indirecto sobre la
intencin de abandono a travs del engagement y la identificacin con el grupo de
trabajo.
MTODO
Muestra
La muestra estuvo conformada por 623 empleados, el 43,4% eran hombres, la edad
media fue de 38,17 aos (DT = 9,80) La mayora de los participantes tenan la
universidad (55,1%) o un ttulo de formacin profesional (14,9%) y slo el 24,4%
trabajaban en puestos de direccin. Los participantes pertenecan a 120 empresas
espaolaspblicas(55,9%)yprivadas(44,1%).
Procedimiento
Lasvariablessemidieronusandouncuestionario.Seinformalostrabajadoresdeque
suparticipacineravoluntariaytodalainformacinseraestrictamenteconfidencialy
utilizadanicamenteparafinesdeinvestigacin.
Instrumento
LiderazgoAutntico.ParaevaluarestavariableseutilizelCuestionariodeLiderazgo
Autntico(ALQ), originalmentedesarrolladoporWalumbwa etal. (2008),y validada
enEspaaporMorianoetal.(2011).

114

TRABAJOS COMPLETOS

Identificacin con el grupo de trabajo. Fue evaluada con la versin espaola de la


escalade6temsdeMaelydeAshforth(1992).
Workengagement.SeevaluconlaadaptacinespaoladelaEscaladeEngagement
UWES9(Schaufeli,Bakker,ySalanova,2006).
Intencin de abandono: Se midi a travs de los siguientes 3 tems: Con qu
frecuencia sientes que quieres dejar tu trabajo en esta organizacin?, Cul es la
probabilidad de que dejes tu organizacin en el prximo ao?, y Cal es la
probabilidaddequedejestuorganizacinen5aos?
RESULTADOS
SeutilizelModeladodeEcuacionesEstructuralesparacontrastarlashiptesisdeeste
trabajo.Paraello,seevaluelajustedelmodelo,primeronicamenteelefectodirecto
deautnticoliderazgoenlaintencindeabandono.Enelsegundomodeloseincluy
la identificacin con el grupo de trabajo como mediadora. Por ltimo, se aadi al
modeloelengagementcomomediadordelasrelaciones.Losndicesdeajusteparalos
tresmodelosalternativossepresentanenlaTabla1.Elmodelofinal(efectosmediados
por la identificacin con el grupo de trabajo y el engagement) supera a los modelos
anteriores. Los resultados para el modelo final indican un RMSEA inferior y una
mayorvarianzaexplicadadelaintencindeabandonoqueelmodeloinicial(sololos
efectos directos del liderazgo autntico) y el modelo de efectos mediados solamente
porlaidentificacinconelgrupodetrabajo.

Modelo

2(gl)

RMSEA

GFI

CFI

M1: Efectos directos del liderazgo

92.23 (13)

< .001

.09

.96

.96

305.16 (86)

< .001

.06

.93

.95

766.76 (242)

< .001

.05

.91

.95

autntico (sin mediacin)

M2: Efectos mediados por la


identificacin con el grupo de trabajo

M3: Efectos mediados por la


identificacin con el grupo de trabajo y el
engagement

Tabla 1. ndices de ajuste de los modelos contrastados

115

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

LosresultadosmuestranqueelLiderazgoautnticoinfluyedemanerasignificativaen
el engagement ( = .40, p < .01) y explic el 48% de su varianza, por lo que, cuanto
mayor es la percepcin de liderazgo autntico, ms engagement muestran los
seguidores.Elliderazgoautnticotambinestuvorelacionadoconlaidentificacincon
el grupo de trabajo ( = .33, p < .01), explicando el 11% de su varianza. A su vez, el
engagement( =.28;p<.01)ylaidentificacinconelgrupodetrabajo( =.16;p<
.01) influyeron significativamente en la intencin de abandono. En este sentido, el
engagement medi completamente los efectos del liderazgo autntico en la intencin
deabandonoanalizadosenelModelo1( =.28;p<.01)yelModelo2( =.44;p<
.01), que yanoeransignificativoseneltercermodelo ( =.08; p = n.s.).Adems,los
efectos de la identificacin con el grupo de trabajo sobre la intencin de abandono
tampoco fueron significativas en el Modelo 3 ( = .06; p = n.s.), indicando que la
relacin entre la identificacin con el grupo de trabajo y la intencin de abandono
tambinestuvomediadaporelengagement.
DISCUSIN
Unadelasprincipalesconsecuenciasquesepuedenextraerdeesteestudioesquelos
lderes autnticos pueden influir en las intenciones de abandono de los empleados
fomentando su engagement. Con el fin de promover el engagement y evitar el
abandono, los lderes deben ser conscientes de que su comportamiento hacia sus
trabajadoresinfluyeenelengagementdelosempleados,yqueesteprocesoconstituye
un instrumento eficaz para reducir la intencin de abandono de empleados valiosos.
Porlotanto,tendrasentidoseleccionaroformaralderesautnticosqueseancapaces
de crear sentimientos de identificacin y engagement entre los trabajadores y retener
recursoshumanosvaliosos,fomentandoaseldesempeoorganizacional.
Enconclusin,elpresenteestudiohadadounpasohacialacomprensindelosefectos
positivosdelliderazgoautnticoenlostrabajadoresylasorganizaciones,destacandoel
autntico liderazgo como un elemento clave para retener a los empleados valiosos a
travsdelapromocindelengagementydelaidentificacindelostrabajadores.

REFERENCIAS
ClappSmith, R., Vogelgesang, G. R. & Avey, J. B. (2009). Authentic Leadership and Positive
Psychological Capital: The Mediating Role of Trust at the Group Level of Analysis.
Journal of Leadership and Organizational Studies, 15(3), 227240. doi:
10.1177/1548051808326596
Mael, F. & Ashforth, B. E. (1992). Alumni and their alma mater: A partial test of the
reformulatedmodeloforganizationalidentification.JournaloforganizationalBehavior,
13(2),103123.doi:10.1002/job.4030130202
Moriano, J.A., Molero, F. & Lvy Mangin, J.P. (2011). Authentic Leadership: Liderazgo
autntico.Conceptoyvalidacindelcuestionarioenespaa.Psicothema,23(2),336341.

116

TRABAJOS COMPLETOS

Schaufeli, W., Bakker, A. B. & Salanova, M. (2006). The Measurement of Work Engagement
With a Short Questionnaire: A CrossNational Study. Educational and Psychological
Measurement.66(4),701716.doi:10.1177/0013164405282471
Walumbwa, F. O., Avolio, B. J., Gardner, W. L., Wernsing, T. S. & Peterson, S. J. (2008).
Authentic Leadership: Development and Validation of a TheoryBased Measure.
JournalofManagement,34(1),89126.doi:10.1177/0149206307308913
Walumbwa,F.O.,Luthans,F.,Avey,J.B.&Oke,A.(2009).Authenticallyleadinggroups:The
mediating role of collective psychological capital & trust. Journal of Organizational
Behavior,32(1),424.doi:10.1002/job.653
Walumbwa, F.O., Wang, P., Wang, H., Schaubroeck, J. & Avolio, B.J. (2010). Psychological
processeslinkingauthenticleadershiptofollowerbehaviors.TheLeadershipQuarterly,
21(5),901914.doi:10.1016/j.leaqua.2010.07.015

117

118

TRABAJOS COMPLETOS

LIDERAZGOAUTNTICO:EFECTOSSOBRELOSEMPLEADOSDE
PYMESESPAOLAS

AnaGonzlezLaguayJuanA.Moriano
FacultaddePsicologa,UNED.

RESUMEN
Lapresenteinvestigacinanalizalainfluenciadelestilodeliderazgoautnticodelos
emprendedores en el desarrollo del capital psicolgico de sus empleados y el work
engagementqueestosmanifiestan.PartiendodelmodelotericopropuestoporAvolio
yGardner(2005),seprofundizaenlarelacindirectaentreelliderazgoautnticoyel
workengagementascomomediadaporlassiguientesdimensionesrelacionadascon
el capital psicolgico: orientacin positiva, resiliencia, autoeficacia y afecto positivo.
Los 165 participantes, empleados de 23 pequeas PYMEs espaolas, han
cumplimentado un cuestionario elaborado especficamente para la investigacin. Los
resultados, utilizando la tcnica de mnimos cuadrados parciales (PLS), apoyan
parcialmente el modelo propuesto ya que de las variables mediadoras nicamente
resultasignificativoelefectoindirectoparalavariableafectopositivo.

PALABRASCLAVE
Liderazgoautntico,capitalpsicolgicopositivo,workengagement.

INTRODUCCIN
ElconceptodeliderazgoautnticosurgeenelmarcodelaPsicologapositiva,conun
nuevo inters por los aspectos del liderazgo relacionados con la autorrealizacin del
lder, pero tambin con el desarrollo de las personas con las que trabaja (Avolio y
Gardner, 2005). El lder autntico es seguro, tiene esperanza, es optimista, resiliente,
transparente,moral/tico,orientadoalfuturoydaprioridadaldesarrollodelpotencial
desussubordinados.
Estudios realizados en diferentes pases han permitido concluir que este estilo de
liderazgoseasocia amayorsatisfaccin,compromiso organizacional yfelicidadenel
trabajo(JensenyLuthans,2006),motivacinyrendimientodelosseguidores(Avolioy
Gardner, 2005; Avolio, Gardner, Walumbwa, Luthans y May, 2004), as como mayor
capitalpsicolgico(Walumbwa,ChristensenyHailey,2011)yconductasdeciudadana
organizacional (Ed, Moriano, Molero y Topa, 2012). En algunos de estos estudios se
contemplan variables mediadoras entre el liderazgo autntico y las variables

119

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

organizacionales como la identificacin organizacional de los empleados, sus


sentimientos de empoderamiento (autonoma en el trabajo) o el capital psicolgico (o
algunas de las dimensiones relacionadas con este constructo, como la esperanza, el
afectopositivooeloptimismo).
El liderazgo autntico tambin se ha relacionado positivamente con el work
engagement (Avolio y Gardner, 2005; Walumbwa, Wang, Wang, Schaubroeck y
Avolio, 2010). A su vez, el work engagement se relaciona positivamente con el
desempeo de los trabajadores (Salanova, Agut y Peir, 2005; Xanthopoulou et al.,
2008),eldesempeoenlastareasacadmicasdelosestudiantes(Parra,2010;Salanova,
Bres y Schaufeli, 2005), la conducta proactiva, iniciativa personal, compromiso,
niveles de salud y calidad de vida (Salanova y Schaufeli, 2004) y el rendimiento
econmico (Xanthopoulou, Bakker, Demerouti y Schaufeli, 2009). Esta relacin work
engagementrendimiento se ha investigado desde diferentes perspectivas (Bakker,
2009): los trabajadores engaged experimentan ms emociones positivas, mejor salud,
creansuspropiosrecursoslaboralesypersonalesypuedentransferirsuengagementa
otraspersonas.Sehaencontradoquecaractersticascomoeloptimismo,laautoeficacia
ylaresilienciaestnrelacionadasconelworkengagement(BakkeryDemerouti,2008;
Salanova,BresySchaufeli,2005;Xanthopoulou,Bakker,DemeroutiySchaufeli,2007).
Por su parte, el capital psicolgico hace referencia a un estado positivo de desarrollo
quesecaracterizaportenerconfianzaparaacometerytenerxitoentareasretadoras
(eficacia),hacerunaatribucinpositivasobreelxitoahorayenelfuturo(optimismo);
serperseverantehacialasmetasyredirigirencasonecesariolasvasparaalcanzaresas
metas (esperanza) y, ante los problemas, mantenerse y recuperarse (resiliencia)
(Luthans, Youssef y Avolio,2006). Investigaciones recientes encuentranqueel capital
psicolgico del lder est positivamente relacionado con el capital psicolgico de los
empleados, el cual, a su vez, se relaciona con el rendimiento organizacional
(Walumbwa,ChristensenyHailey,2011).
El objetivo de la presente investigacin es analizar la relacin entre el estilo de
liderazgo autntico de una muestra de emprendedores espaoles y el work
engagementdesusempleados,tantodeformadirectacomoconsiderandounaseriede
dimensiones relacionadas con el capital psicolgico (orientacin positiva, resiliencia,
autoeficaciayafectopositivo).Seestablecencomohiptesis:
Hiptesis 1. El liderazgo autntico de los emprendedores (percibido por los
empleados)serelacionarpositivamenteconelworkengagementdesusempleados.
Hiptesis 2. El liderazgo autntico se relacionar positivamente con la orientacin
positiva (H2a), resiliencia (H2b), autoeficacia (H2c) y afecto positivo (H2d) de sus
empleados.

120

TRABAJOS COMPLETOS

Hiptesis3.Larelacinentreelliderazgoautnticoyelworkengagementestarmedia
porlaorientacinpositiva(H3a),resiliencia(H3b),autoeficacia(H3c)yafectopositivo
(H3d)desusempleados.
MTODO
Muestra
Lamuestraestabaformadapor165trabajadoresde23pequeasymedianasempresas
espaolasdeentre5y50empleadosyconunaantigedadmediade13.9aos(entre2
y32aos).Decadaempresacumplimentaronelcuestionarioentre3y12empleados,
siendo la media 7.17 empleados. Los participantes, 60.9% hombres y 38.5% mujeres,
con edades establecidas entre 21 y 56 aos (M=35.39, DT=8.2), llevaban en media
trabajando en esa empresa 5.48 aos (DT=5.47). Los sectores de actividad de las
empresas fueron: servicios y comercio (52.17%), produccin/fabricacin (17.39%),
construccin(13.04%)yotros(17.39%).
Medidas
Liderazgo autntico. Versin espaola (Moriano, Molero y Lvy Mangin, 2011) del
ALQ(Walumbwa,Avolio,Gardner,WernsingyPeterson,2008).Escalacompuestade
16 tems que miden la frecuencia con que percibe el empleado cada afirmacin de 0
(nada) a 4 (siempre o casi siempre) sobre el estilo de liderazgo del jefe o supervisor
(lder).
Escala de orientacin positiva (Caprara, 2012), formada por 8 tems con formato de
respuesta tipo Likert de 5 puntos (1 Totalmente en desacuerdo a 5 Totalmente de
acuerdo).tem4invertido.
Escaladeresiliencia(Stephens,Heaphy,Carmeli,SpreitzeryDutton,2013),de5tems
con formato de respuesta tipo Likert de 7 puntos (1 Nada acertado a 7 Totalmente
acertado).
Escala de autoeficacia (adaptada de Schwarzer y Jerusalem, 1999). Se compone de 10
temsrelacionadosconeltrabajo,conformatoderespuestatipoLikertde4puntos(1
Nadaacertadoa4Totalmenteacertado).
Escala de afecto relacionado con el trabajo (Warr, 1990). Consiste en un listado de12
adjetivos, que el participante debe evaluar en cuanto a la frecuencia en la que
experimenta dichos sentimientos o estados afectivos (1Nunca a 6Siempre). Incluye
dossubescalas:afectopositivoyafectonegativo.
Escaladeworkengagement(UWES,Schaufeli,BakkerySalanova,2006),queestudia9
tiposdesentimientosdelaspersonaseneltrabajo.Elparticipantedebeseleccionarla
frecuenciaenlaqueloshaexperimentado(0Nuncaa6Siempre).
Anlisisdedatos

121

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

El anlisis de los datos se realiz con el programa SmartPLS (Ringle, Wende y Will,
2005)querealizalasestimacionesdecoeficientesderegresinestandarizadosparalas
rutas del modelo, los cuales pueden ser utilizados para medir las relaciones entre las
variables latentes. De esta manera, se generan resultados acerca de las propiedades
psicomtricas de los constructos presentes en las hiptesis del estudio (modelo de
medida) y permite analizar simultneamente relaciones de prediccin entre distintas
variables latentes (modelo estructural), y puede emplearse tanto en estudios
exploratorios como confirmatorios, aunque se adapta mejor a las aplicaciones
predictivas y de desarrollo de la teora.Se optporlatcnica de mnimos cuadrados
parciales(partialleastsquares,PLS)debidoaltamaoreducidodelamuestrayaque
las variables no necesariamente cumplen los supuestos exigidos en otros mtodos
(ChinyNewsted,1999).Lasignificacindelasrelacionesenelmodeloestructuralfue
valorada a travs del bootstrapping de 500 muestras de 148 casos (se eliminaron 17
participantesporfaltadealgndatoperdido), loquellevaaunvalor crticodet de
1.96paraunap<.05.
RESULTADOS
Esteanlisisserealizendosetapas,enprimerlugar,seanalizlafiabilidadyvalidez
convergente y discriminante del modelo de medida y, a continuacin, se valor el
modeloestructural,esdecir,enqumedidaelliderazgoautnticopermitapredecirel
workengagement,tantodeformadirectacomoconsiderandolasvariablesorientacin
positiva,resiliencia,autoeficaciayafectopositivocomomediadoras.
Modelodemedida
Se comprob la fiabilidad individual a travs de la significacin estadstica de las
cargasfactorialesestandarizadas()delosindicadoresdecadaconstructolatente.Para
elloserecodificaronaquellostemsqueestabanformuladosensentidoopuestoalresto
de tems de cada escala y se eliminaron aquellos tems que no superaron el nivel
recomendado de .60 (Hair, Black, Babin, Anderson y Tatham, 2006). Para evaluar la
fiabilidad de las medidas se calcul el alfa de Cronbach (vase Tabla 1). Todos los
valoressuperaronel.70(Nunnally,1978)porloqueseconsideraronadecuados.
La validez convergente se midi a travs de la varianza media extrada (Average
VarianceExtracted,AVE)quereflejalacantidadtotaldelavarianzadelosindicadores
recogida por la variable latente. El valor mnimo recomendado es .50 (Bagozzi y Yi,
1988; Hair et al., 2006), es decir, que ms del 50% de la varianza del constructo sea
explicada por sus indicadores. Para determinar la validez discriminante entre
constructos, es necesario que la raz cuadrada del AVE sea superior a la correlacin
entre constructos y que las correlaciones entre los distintos factores no supere .80

122

TRABAJOS COMPLETOS

(Chin, 1998; Fornell y Larcker, 1981). En este estudio, todas las variables latentes
cumplieronlosrequisitosdevalidezconvergenteydiscrimintante(vaseTabla1).

Modeloestructural
En este modelo se incluyeron las relaciones del liderazgo autntico con el work
engagement, tanto de forma directa como considerando las variables orientacin
positiva,resiliencia,autoeficaciayafectopositivocomomediadoras.Estaaproximacin
requierelaestimacindedostiposdemodelospresentadosconjuntamenteenlaFigura
1.

En primer lugar, el efecto directo del liderazgo autntico sobre la variable resultado
resultsignificativoyenelsentidoesperadosegnseestablecaenlahiptesisH1.El

123

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

liderazgoautnticopermitiraexplicarsegnestemodeloun27.2%delavarianzadel
workengagement.Enelsegundomodeloseintrodujeronlasvariablesmediadoras.La
relacin del liderazgo autntico con cada una de las variables mediadoras result
significativa(H2a,b,c,d),ascomolarelacindelasvariablesmediadorasconelwork
engagement (H2 b,c,d), a excepcin de la orientacin positiva (H2a). No obstante,
nicamente la variable afecto positivo super el valor requerido de R2 superior a .10
(FalkyMiller,1992).EltestdeSobel(Sobel,1982)paracadavariablemediadoramostr
que el estadstico z fue nicamente significativo para esta variable (afecto positivo,
H3d:z=3.61,p<.001),porloquelosresultadosnoapoyaronlahiptesisdelamediacin
para las otras tres variables (orientacin positiva, H3a: z=.32, ns; resiliencia, H3b:
z=1.89,ns;autoeficacia,H3c:z=1.83,ns).
Lamediacinfueparcialdadoquelainfluenciadelliderazgoautnticosobreelwork
engagement, aunque se redujo, result significativa. El nuevo modelo permiti
incrementarelR2delworkengagemental66.5%.Elvalordeltamaodelefectof2(.54)
eselevado,loqueindicaunainfluenciasustancialdelavariablelatenteexgenasobre
lavariablelatenteendgena(Chin,1998).
DISCUSIN
Los resultados apoyaron parcialmente el modelo propuesto. El liderazgo autntico
presentunarelacinpositivaconelworkengagementyconlasvariablesorientacin
positiva, resiliencia, autoeficacia y afecto positivo. Sin embargo, nicamente el afecto
positivo result ser una potente variable mediadora entre el liderazgo autntico y el
workengagement,aunqueestamediacinseasloparcial.Estosresultadosconfirman
la relacin positiva entre el liderazgo autntico y el work engagement encontrada en
otrasinvestigaciones(Walumbwaetal.,2010),aunqueesprecisoseguirexplorandola
influencia de las dimensiones relacionadas con el capital psicolgico, tanto del
emprendedorcomodelosempleados.
Parafuturasinvestigacionesserecomiendaemplear,cuandoestvalidadoenEspaa,
el cuestionario especfico de capital psicolgico PCQ (Psychological capital PsyCap
questionnaire)deLuthans,YoussefyAvolio(2006),queestformadopor24temsy4
factores: eficacia, optimismo, esperanza y resiliencia, ya que el constructo capital
psicolgicotienemayorpotencialdeexplicacindelasconductasorganizacionalesque
sus cuatro componentes por separado (Delgado y Castaeda, 2011). El desarrollo del
capital psicolgico positivo es sealado como una de las intervenciones con mayores
implicaciones prcticas probadas en el mbito organizacional (Youssef y Luthans,
2012).
Dadoquesetratabadeunprimerestudioexploratorionosecontrolaronlasvariables
demogrficas y las caractersticas de las organizaciones, por lo que se sugiere su

124

TRABAJOS COMPLETOS

inclusin en futuras investigaciones, as como el estudio multinivel conjunto de las


variables de emprendedores y de sus empleados (Jensen y Luthans, 2006) y la
consideracindefactorescontextuales,entrelosqueseincluyenelpoderylaspolticas
organizacionales,laestructura,culturayclimaorganizacional(Avolioetal.,2004).
Por ltimo, se debe tener en cuenta que tanto el liderazgo autntico como la relacin
mediada por el afecto positivo se asocian positivamente con el work engagement, y
aunquenosepuededescartarlainfluenciadeotrasvariables,parecerazonablesugerir
que tanto los emprendedores como los gerentes y directivos podran potencialmente
incrementarelworkengagementdelosempleados,conlasconsecuenciasbeneficiosas
que esto conlleva en otras variables de rendimiento organizacional, por lo que se
recomienda prestar atencin a estos aspectos en los programas de formacin en la
empresayparaemprendedores.EstoesespecialmenterelevanteenelcasodeEspaa
ya que el 99.3% de las empresas tienen menos de 50empleados(DGIPYME,2013), al
igualquelamuestradeempresasdeestainvestigacin.

REFERENCIAS
Avolio, B.J. y Gardner, W.L. (2005). Authentic leadership development: Getting to the root of
positiveformsofleadership.LeadershipQuarterly,16,31538.
Avolio,B.J.,Gardner,W.L.,Walumbwa,F.O.,Luthans,F.yMay,D.R.(2004).Unlockingthe
mask: A look at the process by whichauthenticleadersimpactfollower attitudesand
behaviors.LeadershipQuarterly,15(6),801823.
Bagozzi, R.P. y Yi, Y. (1988). On the Evaluation of Structural Equation Models. Journal of the
AcademyofMarketingScience,16(1),7494.
Bakker,A.B.(2009).Buildingengagementintheworkplace.EnR.J.BurkeyC.L.Cooper(Eds.),
Thepeakperformingorganization(pp.5072).Oxon,UK:Routledge.
Bakker, A.B. y Demerouti, E. (2008). Towards a model of work engagement. Career
DevelopmentInternational,13(3),209223.
Chin, W.W. (1998). The Partial Least Squares Approach for Structural Equation Modeling. En
G.A.Marcoulides(Ed.),Modernmethodsforbusinessresearch(pp.295336).Hillsdale:
LawrenceErlbaumAssociates.
Chin, W. y Newsted, P.R. (1999). Structural equation modeling analysis with small samples
using partial least squares. En R. Hoyle (Ed.), Statistical strategies for small sample
research(pp.307341).ThousandOaks:Sage.
Delgado Abella, L.E. y Castaeda Zapata, D.I. (2011). Relationship between Psychological
Capital and Knowledge Sharing Behavior in the Context of Organizational Learning.
ActaColombianadePsicologa,14(1),6170.
DGIPYME,DireccinGeneraldeIndustriaydelaPequeayMedianaEmpresa(2013).Retrato
delasPYME2013.
EdValsania,S.,MorianoLen,J.A.,MoleroAlonso,F.yTopaCantisano,G.(2012).Authentic
leadership and its effect on employees organizational. Psicothema, Vol. 24, n 4, pp.
561566.
Fornell, C. y Larcker, D. F. (1981). Evaluating Structural Equation Models with Unobservable
Variables and Measurement Error: Algebra and Statistics. Journal of Marketing
Research,18(3),3950.

125

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Hair, J.F., Black, W.C., Babin, B.J., Anderson, R.E. y Tatham, R.L. (2006). Multivariate Data
Analysis(6ed.).NewJersey:Pearson.
Jensen, S.M. y Luthans, F. (2006). Entrepreneurs as authentic leaders: impact on employees
attitudes.Leadership&OrganizationDevelopmentJournal,27(8),646666.
Luthans, F., Youssef, C. y Avolio, B.J. (2006). Psychological capital: Developing the human
competitiveedge.Oxford,UK:OxfordUniversityPress.
Moriano,J.A.,Molero,F.yLvyMangin,J.P.(2011).Liderazgoautntico.Conceptoyvalidacin
delcuestionarioALQenEspaa.Psicothema,23(2),336341.
Nunnally,J.C.(1978).PsychometricTheory.NewYork:McGrawHill.
Parra, P. (2010). Relacin entre el nivel de engagement y el rendimiento acadmico
terico/prctico.RevEducCiencSalud7(1),5763.
Ringle, C.M.,Wende, S. y Will, S. (2005). SmartPLS 2.0 (M3) Beta, Hamburg 2005,
http://www.smartpls.de
Salanova, M., Agut, S. y Peir, J.M. (2005). Linking organizational resources and work
engagementtoemployeeperformanceandcustomerloyalty:Themediationofservice
climeate.JournalofAppliedPsychology,90,12171227.
Salanova, M., Bres, E. y Schaufeli, W.B. (2005). Hacia un modelo espiral de las creencias de
eficaciaenelestudiodelburnoutydelengagement.AnsiedadyEstrs,11(23),215231.
Salanova, M. y Schaufeli, W.B. (2004). Engagement: un reto emergente para la direccin de
recursoshumanos.Estudiosfinancierosn.261(62/4),109138.
Schaufeli,W.B.,Bakker,A.B.ySalanova,M.(2006).Themeasurementofworkengagementwith
ashortquestionnaire.EducationalandpsychologicalMeasurement,66(4),701716.
Sobel M.E. (1982). Asymptotic intervals for indirect effects in structural equation models.
SociologicalMethodology,13,290312.
Stephens, J.P., Heaphy, E.D., Carmeli, A., Spreitzer, G.M. y Dutton, J.E. (2013). Relationship
QualityandVirtuousness Emotional Carrying Capacity asa Source of Individual and
TeamResilience.TheJournalofAppliedBehavioralScience,49(1),1341.
Walumbwa,F.O.,Avolio,B.J.,Gardner,W.L.,Wernsing,T.S.yPeterson,S.J.(2008).Authentic
leadership: Development and validation of a theorybased measure. Journal of
Management,34(1),89126.
Walumbwa,F.O.,Christensen,A.L.yHailey,F.(2011).Authenticleadershipandtheknowledge
economy:Sustaining motivationand trustamongknowledge workers. Organizational
Dynamics40,110118.
Walumbwa, F. O., Wang, P., Wang, H., Schaubroeck, J. y Avolio, B. J. (2010). Psychological
processeslinkingauthenticleadershiptofollowerbehaviors.TheLeadershipQuarterly,
21(5),901914.
Warr,P.(1990).Themeasurementofwellbeingandotheraspectsofmentalhealth.Journalof
OccupationalPsychology,63,193210.
Xanthopoulou, D., Bakker, A.B., Demerouti, E. y Schaufeli, W.B. (2007). The role of personal
resources in the job demandsresources model. International Journal of Stress
Management,14,121141.
Xanthopoulou,D.,Bakker,A.B.,Demerouti,E.ySchaufeli,W.B.(2009).Workengagementand
financial returns: A diary study on the role of job and personal resources. Journal of
OrganizationalandOccupationalPsychology,82,183200.
Xanthopoulou,D.,Bakker,A.B.,Heuven,E.,Demerouti,E.ySchaufeli,W.B.(2008).Workingin
the sky: A diary study on work engagement among cabin attendants. Journal of
OccupationalHealthPsychology,345356.
Youssef,C.M.yLuthans,F.(2012).Positivegloballeadership.JournalofWorldBusiness,47(4),
539547.

126

TRABAJOS COMPLETOS

ESTUDIODESCRIPTIVODELOSEFECTOSDELESTRSYLAPRESENCIADE
TRASTORNODEPRESIVOENLADIABETESTIPO2

MdelCarmenSnchezUrbano;JuanAntonioPaniaguaGonzlez;CsarVeneroNez.
FacultaddePsicologa,UNED.

RESUMEN

Elpropsitodenuestroestudiofueanalizarlosefectosquelossntomasdeestrsylos
sntomas o trastorno depresivo tienen en el autocuidado y control metablico de la
DiabetesTipo2.Elgrupoexperimentalestuvoformadopor70pacientes(33hombresy
37 mujeres), seleccionados aleatoriamente del rea hospitalaria de Reina Sofa
(Crdoba) y un grupo control (n=35). Los sntomas de estrs fueron evaluados
mediante una entrevista basada en la escala PAID y el trastorno depresivo fue
evaluado con la escala HANDS. Las puntuaciones de estos instrumentos fueron
correlacionadas con niveles de glucosa y HbA1C de los pacientes. Los resultados
indicanquelasmujerespresentanmsprevalenciadesntomasdeestrsydepresin
que los hombres, mostrando correlaciones significativas entre sntomas de estrs y
nivelesdeHbA1c7%.Enconclusin,lasmujerestienenmsproblemasemocionales
peroloshombresmsdificultadesconelautocuidadodelaenfermedad.

PALABRASCLAVE:DiabetesTipo2,estrs,trastornodepresivo,autocuidado,HbA1c.

INTRODUCCIN
Desde la propuesta del modelo biopsicosocial de Engel en 1977, que establece la
influenciadefactorespsicolgicosysocialesenlosprocesosfisiolgicos,lamayorade
los autores coinciden en atribuir una etiologa multifactorial a las enfermedades
crnicas; y en esta influencia es muy importante la respuesta fisiolgica de estrs. El
objetivo de este proyecto de investigacin fue estudiar el papel de los procesos de
estrs y la presencia de un trastorno depresivo en la evolucin y autocuidado de la
Diabetes Tipo 2 (DM2). La DM2 es un trastorno metablico que causa un importante
deterioroenlacalidaddevidaybienestarpsicolgico.Ysutratamientodemandauna
fuerteimplicacinconductual,cognitivayemocionalporpartedelospacientes.
Algunos estudios indican queel estrsest fuertementerelacionado coneldesarrollo
dediabetesyconsusvariablesbiolgicas(Fisheretal.,2009).Enconcreto,lapresencia
de diabetes supone una situacin estresante crnica que provoca la activacin del eje
hipotlamohipfisisadrenal (HHA) (Lloyd C. et al, 2005); as como sentimientos de

127

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

indefensin y tristeza que dan lugar a la aparicin de sntomas depresivos o de un


trastorno depresivo propiamente dicho (Katon et al., 2005), que tienen un efecto
integral sobre la persona, a nivel fisiolgico, cognitivo, comportamental y emocional.
Laprincipalestrategiafuncionaldeadaptacinesaceptareldiagnsticoparaintegrar
las demandas de autocuidado y aprender a afrontar las potenciales complicaciones
(Delahantyetal.,2007).
Porlotanto,lacalidaddevidaespecficaesunimportantembitoenelmanejodela
DM2 y, por tanto, el estrs emocional y los trastornos depresivos son relevantes
(Bogneretal.,2007).Dehecho,lavaloracinnecesariadelosdesrdenesafectivosenla
DM2fueestablecidaenlosestndaresdecuidadomdicodelaAsociacinAmericana
deDiabetes(ADA).
Un marcador bien establecido del control metablico es el nivel de la hemoglobina
glucosilada (HbA1C). Y tanto el control del estrs emocional como una mejora de la
depresin,conllevanunareduccindeestosniveles(Surwitetal.,2002)(Katonetal.,
2004)yacercarlosavaloresadecuados,<7%.
MTODO
Participantes
El grupo experimental estaba formado por 70 pacientes diagnosticados de DM2 (33
hombresy37mujeres).Yelgrupocontrolformadopor35personassindiagnsticode
DM2(14hombresy21mujeres).
Aparatos
Se emple una entrevista de anamnesis general, una entrevista de sntomas de estrs
relacionados con la DM2, basada en la escala Problem Areas in Diabetes (PAID) y la
escala HANDS, para evaluar la depresin. Estos tres instrumentos fueron
cumplimentados para todos los sujetos de la muestra. Adems en el grupo
experimentalserealizunregistrodelosdatosbioqumicos,deglucosaydeHbA1C.
ParaelanlisisestadsticoseuselprogramaSSPS.
Procedimiento
El trabajo es un estudio descriptivo de corte transversal. Para el cual, se elabor una
muestraaleatorizadadepacientesconDM2delreadelHospitalUniversitarioReina
Sofa (Crdoba), utilizando la base de datos informatizada del programa asistencial
DIRAYA.Conlossujetosseleccionadosserealizuncontactotelefnicoparasolicitar
su colaboracin y confirmar los requisitos para participar. Posteriormente, se
cumplimentaron las entrevistas, la escala HANDS y se registraron los datos
bioqumicos.Traselregistrodelainformacinsecalcularonestadsticosdescriptivos;
en variables cuantitativas, media y desviacin estndar y en cualitativas, frecuencia
relativa de las opcionesy su porcentaje.Finalmente se ha calculadoun coeficiente de

128

TRABAJOS COMPLETOS

correlacinlinealentrelosnivelesdeHbA1cylossntomasdeestrsydepresin,de
lossujetosdelgrupoexperimental,enhombresymujeresporseparado.
RESULTADOS
Los resultados de la anamnesis y de los sntomas emocionales se recogen en la
siguientetabla:

LapuntuacindelasmujeresenHANDSessuperioraladeloshombres,enelgrupo
experimental y en el grupo control. Los pacientes con DM2, tanto hombres como
mujeres, presentan ms sntomas de estrs que el grupo control. Y por su parte, las
mujeres puntan ms alto en todos los sntomas de estrs, tanto en el grupo
experimental como en el grupo control, salvo en la percepcin de falta de apoyo
familiar en el grupo experimental. Los hombres presentan ms consumo de alcohol
quelasmujeres,tantoenelgrupoexperimentalcomoenelgrupocontrol.
Losanlisisdecorrelacinindicanqueenelgrupoexperimentalexisteunacorrelacin
positivasignificativaentrelasexpectativasnegativasrelacionadasconlaenfermedady
losnivelesdeHbA1c7%(R=0.333**).Enloshombres,noexistaningunacorrelacin
positivaentresntomasdeestrsynivelesdeHbA1c.Shabaunacorrelacinnegativa
entreelagotamientoemocionalylamotivacindiaria,ylosnivelesdeHbA1c7%.En
las mujeres, las correlaciones positivas ms significativas aparecan entre el
agotamientoemocionalylasexpectativasnegativasrelacionadasconlaenfermedad,y
los niveles de HbA1c 7%(R=0.346* y R=0.432** respectivamente). En cuanto a la
correlacin entre las puntuaciones de la escala HANDS y los niveles de HbA1c no
existen ninguna correlacin significativa. No obstante, en mujeres, la correlacin fue
mselevada.

129

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

DISCUSIN
Losresultadosdeesteestudiopreliminarindicanqueexisteunarelacinentreelsexo,
losnivelesdelaHbA1c,lossntomasdeestrsylapuntuacinenlaescalaHANDS.La
DM2esunapatologacrnicaqueconllevaunprocesodeadaptacincostoso(Clousey
Lustman, 2001), dependiendo el impacto estresante de los factores psicolgicos y
socialesdelosindividuos(Lloydetal.,2005).Aligualqueenlapoblacingeneral,las
mujeres presentan una mayor prevalencia de estrs y/o depresin, al ser ms
vulnerablesadesarrollarestosproblemas(ArenasyPuigcerver,2009).Lamaneraenla
que los sntomas emocionales afectan a los individuos difiere entre los sujetos del
grupo experimental y del grupo control y entre hombres y mujeres con DM2. En
concreto,losresultadosindicanquelossujetosconDM2nodifierensignificativamente
encuantoalaspuntuacionesHANDS o agotamiento emocional,en relacin al grupo
control, pero muestran mayores niveles de insatisfaccin con la atencin mdica que
recibenymenosmotivacindiaria.Porsuparte,cuandohayundiagnsticodeDM2,
las mujeres tienen mayor probabilidad de experimentar sntomas de estrs y/o
desarrollar un trastorno depresivo, en comparacin con los hombres, que
aparentemente no presentan sntomas depresivos significativos. Los hombres y
mujeres con DM2 tienen niveles similares de HbA1C, pero el sexo femenino obtiene
puntuacionesmselevadasenlaescalaHANDS,porloquetienenmsprevalenciade
sntomasy/otrastornodepresivo.Enconclusin,existeunarelacindiferencialentrela
presencia de sntomas emocionales de depresin y estrs, el sexo y los niveles
bioqumicosdeHbA1C,entendidosstoscomomarcadordecontroldelaenfermedad.
As las mujeres manifiestan mayores niveles de estrs que se correlacionan con
mayoresnivelesdeglucosaydeHbA1C.Sinembargo,loshombrespresentanmenores
nivelesdeestrsverbalizados,peroelvalordelosnivelesdeHbA1Csonindicativosde
un mal control de la enfermedad, as muestran mayor consumo de alcohol y tabaco,
menor seguimiento de la dieta. Estos resultados evidencian la necesidad de
intervencionespsicolgicasdiferenciadasparahombresymujeresdecaraamejorarlos
nivelesdeHbA1Cyportanto,elpronsticodelaenfermedad.

REFERENCIAS
Arenas M.C., Puigcerver A. (2009). Diferencias entre hombres y mujeres en trastornos de
ansiedad:Unaaproximacinpsicobiolgica.EscritosdePsicologa.Vol.3,n1:2029.
Bogner H.R., Morales K.H., Post E.D., Bruce M.L. (2007). Diabetes, Depression and Death.
DiabetesCare30:30053010,2007.
ClouseR.,LustmanP.(2001).Theprevalenceofcomorbiddepressioninadultswithdiabetes:a
metaanalysis.DiabetesCare:24:10691078.

130

TRABAJOS COMPLETOS

Delahanty LM, Grant RW, Wittenberg E, Bosch JL, Wexler DJ, Cagliero E. Meigs JB (2007).
Association of diabetesrelated emotional distress with diabetes treatment in primary
carepatientswithType2diabetes.DiabeticMedicine,24:4854.
Fisher L, Mullan J.T., Skaff M.M., Glasgowt R.E., Areant P. and Hessler D. (2009). Predicting
DiabetesDistressinPatientsWithType2Diabetes:ALongitudinalStudy.DiabetMed.
June26(6):622627.
KatonW.,VonKorffM.,CiechanowskyP.,RussoJ.,LinE.,SimonG.,LudmanE.,WalkerE.,
BushP.,YoungB.(2004).BehavioralandClinicalFactorsAssociatedWithDepression
AmongIndividualsWithDiabetes.DiabetesCare27:914920.
Lloyd C., Smith J., Weinger K. (2005). Stress and Diabetes: A review of the Links. Diabetes
Spectrum18(2):121127.
SurwitR.S.,VanTilburgM.,ZuckerN.,McCaskillC.C.,ParekhP.,FeinglosM.N.,Edwards
C.L. , Williams P., Lane J.D. (2002). Stress Management Improves LongTerm Gly
+9cemicControlinType2Diabetes.DiabetesCare25:3034.

131

TRABAJOS COMPLETOS

SITUACINLABORALENPROFESIONALESSANITARIOS,EFECTOR
MEDIADORDELAPOYOEIDENTIFICACINGRUPALSEGNELTIPODE
ORGANIZACIN.

VernicaHerrizLila**;GabrielaTopaCantisano*
FacultaddePsicologa,UNED**;FundacinOftalmolgicadelMediterrneo

RESUMEN
Los riesgos psicosociales de los profesionales de la salud han sido ampliamente
sealados. En el presente estudio analizamos la prevalencia de estrs laboral en una
muestra de trabajadores de instituciones sanitarias espaolas y su relacin con la
identificacin grupal y el apoyo grupal percibido, para ello administramos un
cuestionario con las subescalas Desequilibrio esfuerzorecompensa, apoyo grupal,
identificacingrupalyescaladejusticiaorganizacional.Prestamosespecialatencina
las diferencias segn tipo de organizacin, encontrando diferencia significativa en
cuantoalarecompensapercibidaenlasanidadprivada.

PALABRASCLAVE
Desequilibrioesfuerzorecompensa(DERERI),sanidad,apoyoeidentificacingrupal,
tipodeorganizacin.

INTRODUCCIN.
La estrategia de Lisboa para 2020 en temas laborales indica la necesidad de mas y
mejorempleoparaaseguraruncrecimientointeligente,sostenibleeinclusivo,paralo
cualesindispensableasegurarlacalidaddeltrabajo.(Eurofund,2012).
Un 20% de trabajadores europeos tienen problemas en lograr una vida laboral
satisfactoria. En este sentido la OMS indica los factores psicosociales del ambiente
laboralysuinfluenciaenlasaludyrendimientoslaborales(Gmez,2008).
El acoso psicolgico en el trabajo es una realidad con importantes alteraciones en la
vidapersonalylaboraldelosempleados.(Sanz,2008).Sesealaunaprevalenciams
elevada en los trabajadores pblicos y especialmente en el rea sanitaria. El modelo
desequilibrioesfuerzorecompensa(DER)(Siegrist,2004)(Macias,2003)encuentraalto
desbalance entre empleados en cuyo trabajo la interaccin con personas es parte
fundamentaldesuactividadlaboral,entreellostrabajadoressanitarios(Canepa,2008).
Elobjetivo de esteestudioes valorarelgrado de estrslaboralentrabajadoresde la
salud y la influencia del apoyo e identificacin grupal dentro del modelo ERIDER
(Effort Reward Imbalance) y su posible relacin con la pertenencia a instituciones
pblicasoprivadas.
MATERIALYMTODO

133

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Estudio transversal, descriptivo sobre una muestra de profesionales de la salud


espaoles.(N=104).
Seadministrcuestionarioconlasescalas:
ERI,(Fernndez,2006).
apoyogrupal,versinbrevedeEisengergycols(Topa,2007).
Identificacingrupal
ShortNegativeActQuestionairem(NAQ)(Gonzalez,2009).
Escaladejusticiaorganizacional.
El anlisis univariante se realiz mediante el estudio descriptivo de las variables
sociolaboralesdelcuestionario.Secalcularonlosvaloresmediosdetodaslasescalasy
susdesviacionesestndar(DE).
Paravalorarlavalidezdiscriminantedelcuestionarioovalidezrelacionadacongrupos
se investigaron diferencias por sexos, edad, y pertenencia a diferente tipo de
organizacinmedianteelestadsticotparagruposindependientes
RESULTADOS
La muestra estudiada presenta un nivel de acoso laboral por debajo de la media
esperada. Por el contrario el apoyo grupal e identificacin grupal presentan valores
superioresalamedia.RespectoalaescalaERI,lasmediadasdeesfuerzoextrnsecoy
recompensa se encuentran prximas a la media, superndola en la escala de
sobreimplicacin.

Figura 1:promedio en diferentes subescalas

No encontramos diferencias por sexos en ninguna de las variables analizadas. El


diferencial por tipo de formacin recoge un pico de apoyo grupal en los sujetos con
estudios primarios que se reduce paulatinamente al aumentar el nivel de formacin.
Por el contrario el esfuerzo extrnseco y la recompensa aumentan con el nivel de
estudios.
Destaca la alta percepcin de recompensa e identificacin grupal del colectivo
tcnicos, que contrasta con la baja percepcin de recompensa del colectivo
mdicos. Encontramos puntuaciones elevadas las escalas de apoyo e identificacin

134

TRABAJOS COMPLETOS

grupal en todos los estamentos. Por el contrario las puntuaciones en estrs laboral
(NAQ)yjusticiaorganizacionalseencuentranpordebajodeloesperable.
En organizaciones privadas perciben significativamente menor recompensa as como
tendenciaalasignificacinenlaescaladeapoyogrupal.

Esfuerzo Extrnseco
Recompensa
Sobreimplicacin
Apoyo Grupal
Identificacin Grupal
NAQ
Justicia Organizacional

Hombres

Mujeres

DT

DT

1,75
1,91
2,63
3,06
3,58
1,59
2,07

0,84
1,08
0,70
0,86
0,71
0,61
0,57

2,03
2,06
2,76
3,28
3,69
1,53
1,93

1,01
1,09
0,72
0,90
0,75
0,46
0,56

0,15
0,50
0,37
0,22
0,47
0,54
0,24

Pblico

Privado

DT

DT

2,01
2,16
2,65
3,11
3,61
1,58
1,98

0,87
0,96
0,73
0,82
0,76
0,55
0,57

1,74
1,62
2,85
3,41
3,74
1,48
1,99

1,13
1,27
0,67
1,02
0,68
0,44
0,55

0,19
0,01*
0,18
0,08
0,34
0,34
0,90

Tabla 1: Comparativa Hombre/mujer, pblico/privado

DISCUSIN
Los sectores ms vulnerables a padecer mobbing son los del sector pblico,
especficamente trabajadores del sector salud, ya que en el mismo se encuentra una
marcada asimetra de roles que desempea cada trabajador, donde existe a su vez
jerarquaperfectamentedelimitadas.(Acosta,2009)
Enlamuestraestudiadaencontramosunaltondicedeidentificacinyapoyogrupala
pesar de tratarse de trabajadores de grupos, ambientes e instituciones diferentes
(Pulido,2008).Laidentificacinyelapoyogrupalseharelacionadonegativamentecon
bajos niveles de estrs y acoso laboral. En nuestro caso encontramos niveles de
identificacin y apoyo grupales superiores a lo esperado, as como un bajo nivel de
estrslaboral.Seranecesarioanlisismsprofundoparapoderestablecerlaexistencia
decorrelacinentrelasvariables.
Por el contrario no hemos encontrado, como otros investigadores, diferencias en el
esfuerzo realizado por los diferentes sexos, ni en ninguna de las otras variables
observadasrespectoaestavariable.Debemostenerpresentequeeltamaomuestralde
mujeresessuperioraldehombresyquelasmuestrasnosonequivalentesencuantoa
nivel educativo y puesto desempeado. A pesar de la incursin de la mujer en el
mbito laboral y especialmente en ambientes sanitarios, el rol desempeado por
hombresymujeresdistamuchodeserigualitario,pudiendoestadiferenciadeestatus
influir en las percepciones de ambos colectivos en cuestiones relacionadas con el
trabajo. De hecho, Piuel y Oate indican en sus investigaciones un 47,2% de acoso
verticaldescendentefrenteaun20,9%deacosohorizontal(Piuel,2006).
Hemosanalizadolasrespuestasalasdiferentessubescalasteniendoencuentaelnivel
de formacin y la cualificacin profesional de los trabajadores, no encontrando
diferenciasenningunadeellas.Existentrabajosquehanexaminadolaimportanciadel
apoyo e identificacin grupal en la muestra de enfermera, pero no en muestras
sanitariasheterogneas.(Topa,2009).Dadaladiferenciaenjerarqua,responsabilidady

135

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

autonoma de los distintos tipos de profesionales del campo de la salud sera


convenienteanalizarlasdiferentespercepcionesdecadaunodeestosestamentosysu
implicacinenelestrslaboral.
El segundo objetivo de nuestro estudio consista en investigar la semejanza o
desigualdad de los trabajadores sanitarios segn el tipo de organizacin en que
trabajan,yaseapblicaoprivada.Hastahacepocoserpropietariodeunaplazafijaen
una organizacin sanitaria pblica era el gold estndar de muchos de estos
profesionales. Con la entrada en el mercado sanitario de empresas privadas,
fundaciones y el paulatino proceso de privatizacin de la gestin de los servicios de
saludqueestteniendolugarenmuchoslugares,posiblementeestasdiferenciasenla
percepcindelacalidadlaboralsufrancambios.
En nuestra muestra encontramos una percepcin de recompensa significativamente
mayorenelgrupodesanidadpblicaytendenciaalasignificacinenapoyogrupale
identificacinenelcasodelasanidadprivada.Ambasmuestraspresentansimilituden
cuanto a las conductas de acoso y la percepcin de justicia organizacional. Sera
interesanteinvestigarsiestasdiferenciassemantienenovaranconloscambiosenel
escenariolaboral.
Hemos encontrado limitaciones en el desarrollo de este estudio al no tener
documentadoeltamaodelaorganizacin,eltipodecontratodelosencuestadosyel
hechodepartirdeunamuestranohomogneaenalgunasdelasvariablesobservadas.
Sin embargo puede constituir un buen estudio piloto para construir una prueba con
objetivosmsespecificados.
CONCLUSION
La identificacin y apoyo grupal pueden ser elementos protectores ante los riesgos
psicosociales en profesionales sanitarios. Los trabajadoresde organizaciones privadas
puedenpresentarmayoresriesgospsicosociales.

REFERENCIAS
Eurofund(2012).CambioenlascondicionesdetrabajoenlosltimosaosresultadosdelaV
Encuesta Europea de Trabajo Recuperado el 20 de Febrero de 2012 en:
www.eurofound.europa.eu/surveys/index.htm(Eurofund,2012)
GmezOrtizV.(2008).FactoresPsicosocialesdelTrabajoysuRelacinconlaSaludPercibiday
laTensinArterial:UnEstudioconMaestrosEscolaresenBogot,Colombia.Cienciay
Trabajo,N30.
SanzA.I,RodrguezA.(2008).ElefectodelAcosoPsicolgicoenelTrabajosobrelaSalud:El
Papel Mediador del Conflicto TrabajoFamilia. Revista de psicologa del Trabajo y de
lasOrganizaciones.011,Vol.27,N,Pg.93102.(Sanz,2008)
MacasMD,FernndezJA,HernndezRetcols..(Macias,2003).Evaluacindelestrslaboral
en trabajadores de un hospital pblico espaol. Estudio de las propiedades
psicomtricas de la versin espaola del modelo Desequilibrio Esfuerzo
Recompensa.MedicinaClnica,2003;120(17):6527.
AcostaM,AguileraMA,PozosB.(2009)RelacinentreelAcosoMoralenelTrabajoyelEstilo
InterpersonalenelManejodeConflictos.CienciayTrabajo.N31.(Acosta,2009)
CanepaC,BrionesJl,PrezC,VeraAJurezA.(2008)DesequilibrioEsfuerzoRecompensay
Estado de Malestar Mental en Trabajadores de Servicios de Salud en Chile. Ciencia y
Trabajo;Octubre/Diciembre2008,N30.

136

TRABAJOS COMPLETOS

Topa G, Moriano JA, Morales JF. (2009) Acoso laboral entre profesionales de enfermera: el
papelprotectordelaidentidadsocialeneltrabajo.AnalesdePsicologaa.,vol25,266
276.
SiegristJ,StarkeD,ChandolaT,GodinI,MarmotMetat.(2004)ThemeasurementofEffort
RewardImbalanceatwork:EuropeanComparison.SocialandScienceMedicine,58,8,
14831499.
Fernndez JA, Martn R, Fernndez M, Rdel. (2006) Anlisis Factorial confirmatorio de la
versin espaola del cuestionario EffortReward Imbalance, de medida del estrs
laboral.AtencinPrimaria,38(8):465466.
TopaG,MoralesJF.(2007)Burnouteidentificacinconelgrupo:elpapeldelapoyosocialen
un modelo de ecuaciones estructurales. International Journal of Clinical and Health
Psychology,vol7,num.2,2007,pp.337348.
GonzlezD,GraaJL.(2009)Elacosopsicolgicoenellugardetrabajo:prevalenciayanlisis
descriptivoenunamuestramultiocupacional.Psicothema,2009.Vol21,n2:288293.
Pulido M, Montalbn M, Palomo A, Luque P. ( 2008)Acoso psicolgico, organizacin e
identidad:anlisisdesdeunforovirtual.Atheneadigital.Nm.13:133152
Piuel I, Oate A. (2006) La evaluacin y diagnstico del mobbing o acoso psicolgico en la
organizacin: El barmetro Cisneros. Revista de psicologa del Trabajo y de las
Organizaciones.22(3),309332.(Piuel,2006)

137

138

TRABAJOS COMPLETOS

EVALUACINDELESTRSENADOLESCENTES.RELACINENTRELOS
NIVELESDECORTISOL,VARIABLESDECONDUCTAALIMENTARIAY
DISTINTOSPARMETROSDELAPERSONALIDAD

CarolinaPrezLancho
FacultaddePsicologa,UNED

RESUMEN
Se determin el cortisol salival (maana y noche) de 42 estudiantes de educacin
secundaria obligatoria, al inicio de curso y en el momento previo a los exmenes
finales.
Adems se evalu su relacin con variables de conducta alimentaria (tendencia a la
delgadez, bulimia, insatisfaccin corporal) y varios parmetros de personalidad
(autoestima, resolucin de problemas, autocrtica, apoyo social, reestructuracin
cognitiva, expresin emocional, pensamiento desiderativo, evitacin de problemas y
retiradasocial).Losresultadosmuestranqueelcortisolmatinalinicialfuemenorque
el de maana final (p < 0,05), con niveles ms elevados en las chicas (p < 0,05). En la
determinacinfinal,elcortisolmatinaltambinresultmselevadoenlaschicas(p<
0,01).

PALABRASCLAVE
Estrs,cortisol,adolescencia,personalidad,ingesta.

INTRODUCCIN
En la adolescencia, los cambios de ciclo pueden tener un impacto negativo y ser una
importante fuente de estrs, observndose incluso influencia directa sobre el
rendimientoacadmicodelosalumnos,especialmenteenlosvarones(Chung,Elias&
Schneider, 1998; Isakson & Jarvis, 1999). Por otro lado,la percepcin de la situacin
estresante es individual, dado que tiene que ver con los rasgos de personalidad del
individuoy,larespuestafisiolgicapredominanteeslaactivacindelejehipotlamo
hipfisisadrenal, cuyo resultado final se traduce en un aumento de los niveles de
cortisol(DeKloet,1990;DeKloet,Vreugdenhil,Oitzl&Joels,1998;DeKloet,Oitzl&
Jels,1999;Garca,Marti,Valles,DalZotto&Armario,2000;Torres&Nowson,2007).
MTODO
Sujetos
La muestra inicial estaba formada por 103 alumnos y alumnas de edades
comprendidasentrelos15y16aos.Traselprocesodeseleccin,elgrupofinalqued
constituido por un total de 45 alumnos (23 chicas y 22 chicos) y los resultados estn
referidosa42alumnos,yaque3tuvieronqueserdesestimados.
InstrumentosyMedidas

139

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Cuestionario de estrs percibido (Perceived Stress Questionnaire, PSQ); Escala de


autoestimadeRosenberg(EAR);InventariodeEstrategiasdeAfrontamiento(Coping
Strategies Inventory,CSI); Inventario de trastornos de la conducta alimentaria (Eating
Disorders Inventory, EDI2); Cuestionario de frecuencia de consumo de alimentos;
ndicedeMasaCorporal(IMC);Anlisishormonal:determinacindecortisolensaliva,
TestELISA(DRGSalivaryCortisolELISAKit);Entrevistapersonal
LosanlisisestadsticosserealizaronconelpaqueteestadsticoSPSSv.16.0Eneltexto
ylastablassemuestranlasmediasyelerrortpicodelamedia( +errortpicodela
media). Se utiliz la prueba no paramtrica de MannWhitney, el coeficiente de
correlacin de Spearman y la prueba de 2. El nivel de confianza estadstico se
estableciaunniveldep<0,05.
Procedimiento
De103alumnosiniciales,fueron45losalumnosyalumnasquecompletarontodoel
estudio. Cada cuestionario fue administrado de manera aleatoria en grupos de 5
alumnos hasta completar la totalidad de los mismos. La toma de muestra de saliva
inicial(paramedidadecortisolnocturnoydiurno),serealizunasemanadespusde
haberconcluidounperiodocompletodeexmenesyevaluaciones.Loscuestionarios
con el mismo procedimiento ya indicado, y la toma de muestra de saliva final, se
realiz dos semanas antes de comenzar los exmenes y evaluaciones finales de este
curso y que coincide con el final de la etapa de educacin obligatoria. Se concluy el
estudioconunaentrevistapersonalizada.
RESULTADOS
Todoslosresultadosdelestudiocompletosernreferidosauntotalde42alumnos:20
desexomasculinoy22desexofemenino.
Evaluacindelestrspercibido,PSQactualyhabitual.Sindiferenciassignificativas,ni
encuantoagneroniporelmomentodelestudio.
Evaluacindelosnivelesdecortisoldependientesdelmomentoacadmico.Elcortisol
matinal aumenta de forma significativa en el periodo previo a los exmenes,
independientemente del gnero estudiado, existiendo diferencias significativas (p <
0,05) en los valores medios de cortisol matinal, en el muestreo inicial (momento
acadmicoenausenciadeexmenes)yfinal(adossemanasdelosexmenesfinales).
En el estudio inicial (curva de regresin Abs frente a Log, con coeficiente de
correlacin0,0997),losvaloresdecortisolmatinalfueronde10,15 1,00ng/ml.Enel
estudio final (curva de regresin Abs frente a Log, con coeficiente de correlacin
0,0998),losvaloresdecortisolmatinalfueron17,33 1,44ng/ml.Nivelesdecortisol
dependientesdegnero.Existendiferenciassignificativasenelcortisolmatinalsegn
gnero, encontrndose siempre valores ms elevados en la poblacin femenina,
independientemente del momento acadmico valorado. Los valores encontrados de
cortisolinicialmatinalfueronde7,93 0,73ng/ml(chicos)y12,17 1,70ng/ml(chicas),
existiendodiferenciassignificativas(p<0,05)entreelgnerofemeninoyelmasculino.
Losvaloresdecortisolmatinal,enelestudiofinalfueron13,99 1,45ng/mly21,31
2,09 ng/ml para los chicos y chicas, respectivamente, encontrndose de nuevo
diferenciassignificativasdegnero(p<0,01).

140

TRABAJOS COMPLETOS

*p < 0,05 vs valor cortisol matinal inicial grupo de los chicos. **p < 0,01 vs valor cortisol matinal final grupo
de los chicos.

Variaciones circadianas de los niveles de cortisol. Los datos recogidos en el estudio,


confirmanlashabitualesvariacionescircadianasenlasecrecindecortisol.
Correlacinentreelestrspercibido(PSQ)ylamedidabiolgicadelestrs(cortisolen
saliva). En el presente trabajo no se ha encontrado correlacin significativa entre el
estrs percibido (PSQ) y el estrs biolgico (cortisol en saliva) para las edades
estudiadas(1516aos).
Estrs y autoestima. Existen diferencias significativas chicos/chicas (p < 0,01), en el
estudiofinal:laautoestimaesmayorenchicas19,41 0,93queenchicos14,95 1,07.
Estrs y estrategias de afrontamiento. En el estudio final, la estrategia de
reestructuracincognitivafuemayorenloschicos,12,70 1,12queenlaschicas6,18
1,00;(p<0,001).Laestrategiaderetiradasocial,enelestudioinicial,fuemayorenlas
chicas, 6,32 1,04 que en los chicos, 3,30 0,81; (p < 0,05), no existiendo diferencias
significativasenelestudiofinal.
Estrsyvariablesdeconductaalimentaria.LasubescaladeTendenciauObsesinpor
laDelgadezsiempreesmayorenlapoblacinfemenina,mientrasquelasubescalade
InsatisfaccinCorporalpresentavaloressuperioresenlapoblacinmasculina..Existe
unaumentodeingestaprevioalosexmenes,independientedelgneroestudiado.
DISCUSIN
Traselestudiodelosdatosobtenidosyanalizandolapoblacinobjetodeestudiode
diferentes trabajos publicados (Andreou, Alexopoulus, Lionis, Varvogli, Gnardellis,
Chrousos & Darviri, 2011; Bell, & Lee, 2002; Fliege, Rose, Arck, Walter, Kocalevent,
Weber,&Klapp,2005;Kocalevent,Levenstein,Fliege,Schmid,Hinz,Brhler&Klapp,
2007; Levenstein, Prantera, Varvo, Scribano, Berto, Luzi, & Andreoli, 1993;Sanz
Carrillo, GarcaCampayo, Rubio, Santed & Montoro, 2002) se puede concluir que no
existen en la actualidad referencias suficientes que aborden el estrs percibido en la
edadpoblacionalenlaqueseharealizadoelpresentetrabajoporloqueseranecesario
realizar nuevos estudios con mayor nmero de alumnos y alumnas de esta edad,
siendoprecisoreconsiderarlafiabilidadrealdeesteinstrumentodetrabajo(PSQ)en
clnicaenlaedadobjetodeestudio,yaquelosdatosindicanquenohaycorrelacinde
estostestconlosnivelesdecortisol.

141

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Las observaciones halladas en el presente estudio sobre los niveles de cortisol,


corroboraran las aportadas por las investigaciones que sugieren la existencia de un
incremento en los niveles basales de cortisol entre la adolescencia media y tarda
(Tornhage, 2002; Walker, Walder & Reynolds, 2001), adems de estar apoyadas por
otros estudios que indican que, si bien en la edad prepuberal no existen diferencias
significativas en los niveles de cortisol matinal por cuestin de gnero (Marsman,
Swinkels, Rosmalen, Oldehinkel, Ormel & Buitelaar,2008; Netherton, Goodyer,
Tamplin&Herbert,2004),enlapubertad,losnivelesdecortisolmatinalpuedanllegar
aserentreun20yun30%superioresenlapoblacinfemenina(Nethertonetal.,2004),
existiendo una respuesta de cortisol al despertar ms pronunciado en mujeres
(Pruessner, Wolf, Hellhammer, BuskeKirschbaum, von Auer, Jobst, Kaspers., &
Kirschbaum, 1997). Esta mayor respuesta se ha relacionado con factores genticos
(Wst, Federenko, Hellhammer & Kirschbaum, 2000), con niveles de cortisol
matutinos siempre inferiores en la poblacin masculina de 1517 aos (Bouma, Riese,
Ormel,Verhulst & Oldehinkel, 2009), diferencia que se revierte en etapas anteriores y
posteriores,connivelessuperioresdecortisolenelcasodelgneromasculinocuando
las edades estudiadas son de 7 a 10 aos (Kertes & Gunnar, 2004) o de 17 a 23 aos
(Stroud,Salovey&Epel,2002.

REFERENCIAS
Bouma, E.M.C., Riese, H., Ormel, J., Verhulst, F.C. & Oldehinkel, A.J. (2009). Adolescents
cortisol responses to awakening and social stress; Effects of gender, menstrual phase
andoralcontraceptives.TheTRAILSstudy.Psychoneuroendocrinology,34,884893.
CanoGarca, F.J., Rodrguez, L. & Garca, J. (2007). Spanish version of the Coping Strategies
Inventory.ActasEspaolasdePsiquiatra,35(1),2939.
Garner, D.M. (1998). EDI2: Inventario de trastornos de la conducta alimentaria . Madrid: Tea
Ediciones,SA.
Marsman,R.,Swinkels,S.,Rosmalen,J.G.M.,Oldehinkel,A.J.,Ormel,J.&Buitelaar,J.K.(2008).
HPAaxis activity and externalizing behavior problems in early adolescents from the
general population: The role of comorbility and gender The TRAILS study.
Psychoneuroendocrinology,33,789798.
SanzCarrilloC.,GarcaCampayoJ.,RubioA.,SantedM.A.&MontoroM.(2002).Validationof
the Spanish version of the Perceived Stress Questionnaire. Journal of Psychososmatic
Research,52,167172.
Vazquez, A.J., Jimnez, R. & VzquezMorejon, R. (2004). Escala de autoestima de Rosenberg:
fiabilidadyvalidezenlapoblacinclnicaespaola.ApuntesdePsicologa,22(2),247
255.

142

TRABAJOS COMPLETOS

ELEXCESODECONTENIDOSENLASPGINASWEB

MacarenaMariscalCampos
FacultaddePsicologa,UNED.

RESUMEN
Elpresentetrabajodeinvestigacinsecentraenelestudiodelaincidenciadelexceso
de contenidos (textos, imgenes, iconos, colores) de las pginas web de inicio
(homepages) en las repuestas emocionales de los usuarios de Internet. Su anlisis se
ubicadentrodelmarcodelateoratridimensionaldelaemocindelModelodeLang
(1995),atravsdelastresdimensionesemocionalesvalencia,activacinydominancia;
haciendo uso de la herramienta de valoracin SAM (Self Assessment Manikin) como
mtododeevaluacindelaspginaswebquelosusuariosvisualizan.
Lahiptesisdepartidaestablecaqueelexcesodecontenidosenlashomepagespoda
provocarelrechazodelosinternautas.Losresultadosconfirmarontalhiptesisnulaa
travs del anlisis de los valores de las tres dimensiones afectivas de Lang y de las
preferenciasdelosparticipantes;obteniendomejoresvaloracioneslaspginassimples
(menoscontenidos)frentealascomplejas(mscontenidos).

PALABRASCLAVE:Emocin,Web,SAM,Complejidad,Contenidos

INTRODUCCIN
El permanente desarrollo de pginas web en la actualidad ha generado el estudio de
las cualidades significativas para el xito de stas. Entre las caractersticas especficas
de este medio se halla la posibilidad de mostrar una gran cantidad de informacin a
travs de una diversidad de elementos grficos como textos, colores, imgenes e
iconos.Estoselementosconfiguranlaatmsferadelwebsiteysuefectosobrelaactitud,
la satisfaccin y el comportamiento de acercamiento o rechazo de los consumidores
aparenta ser el resultado de las emociones experimentadas por el comprador (Eroglu
etal.,2003);deloquesededuceque,enlaevaluacinemocionaldelaspginasweb,
resultarelevantelacantidaddecontenidosquestasexponenensupginadeinicio.
MTODO
Participantes
Sesometieronalexperimento36participantes(14hombresy22mujeres),conedades
comprendidas entre 23 y 47 aos, la mayor parte de ellos con estudios superiores
(79,9%)yconmsdecincoaosdeexperienciaenelusodeInternet(86,1%).

143

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Estmulos
Seis pginas web de dos mbitos del comercio electrnico: restauracin y decoracin
deinteriores.stasmostrabandiferentesgradosdecantidaddecontenidosexpuestos
en su homepage, en base al anlisis realizado por un grupo de expertos en diseo
grficoatravsdeunsistemadepuntos(cortesimples/complejas:210puntos).

Figura 1: Homepages de las pginas web seleccionadas para el experimento

Aparatos
LasdiapositivasseproyectaronenunordenadorMacintoshOSXversin10.5.8(iMac
8.1)conpantallade19pulgadas,aunadistanciade50cmdelapantalla.
Tareayprocedimiento
Sesionesindividuales,enlamismasalayconlasmismascondicionesdeiluminacin.
Cuestionarioenpapelen3fases:1)datosdeperfilyhbitosdeconsumoeInternet,2)
exposicin de diapositivas (30) y SAM de cada homepage, 3) preferencias de los
participantesconrespectoalaspginaswebeintencindenavegacinycompra.
RESULTADOS
Conelfindeanalizarsielgradodecomplejidadenlaspginasweberasignificativoen
la evaluacin emocional, se llev a cabo un MANOVA con las tres dimensiones
afectivas como VD y el factor intrasujetos con MR complejidad como VI, con dos
niveles: alta complejidad y baja complejidad [complejidad: promedio de las
puntuacionesdelasvariablesemocionalesdelosparticipantesenlaspginaswebde
cada grupo para cada dimensin emocional]. Los resultados del anlisis mostraron

144

TRABAJOS COMPLETOS

diferencias significativas para el factor complejidad [ de Wilks = 0,343, F(3, 33) =


21,072,p<0,05, 2p=0,657].
Los posteriores ANOVAs univariados revelaron un efecto significativo para las tres
dimensiones: valencia [F(1, 35) = 64,149, p<0,05, 2p = 0,647], activacin [F(1, 35) =
6,497, p<0,05, 2p = 0,157] y dominancia F(1, 35) = 45,473, p<0,05, 2p = 0,565]. El
anlisisdelascomparacionesporpares,aplicandolacorreccindeBonferroni,revel
quelamediadelavalenciaylaactivacinerasignificativamentemsaltaenelnivelde
bajacomplejidad,ylamediadeladominancia,porelcontrario,erasignificativamente
msbajaenesamismacategora.
Alobjetodecomprobarsilasvaloracionesafectivasdiferanentrehombresymujeres,
se realiz un MANCOVA con las tres dimensiones afectivas como VD, el factor
complejidadcomoVIylavariableintersujetossexocomocovariable.Elresultadodel
anlisis revel diferencias significativas para el factor complejidad con la covariable
sexo[ deWilks=0,743,F(3,32)=3,698,p<0,05, 2p=0,257].
Los posteriores ANCOVAs univariados mostraron el efecto significativo de la
interaccin complejidad*sexo en las tres dimensiones afectivas: valencia
[F(1,34)=7,714,p<0,05, 2p=0,185],activacin[F(1,34)=6,054,p<0,05, 2p=0,151]y
dominancia[F(1,34)=6,012,p<0,05, 2p=0,150].Losresultadosdelascomparaciones
por pares (Bonferroni) mostraron diferencias significativas positivas entre mujeres y
hombres en la valencia, la activacin y la dominancia nicamente en el nivel de baja
complejidad. Tambin mostraron diferencias significativas positivas en la valencia de
mujeres y hombres entre el nivel de baja complejidad y el de alta complejidad, as
como diferencias negativas en dominancia tambin en ambos sexos entre dichos
nivelesdecomplejidad.Porltimo,seregistrarondiferenciassignificativaspositivasen
activacin entre el nivel de baja complejidad y el de alta complejidad en las mujeres,
peronoenloshombres.
En cuanto al orden de preferencia, los usuarios mostraron clara preferencia por las
pginassimplesfrentealascomplejas,talycomoquedareflejadoenlatabla1.

Tabla 1: Frecuencias en % participantes de los valores del orden de preferencia

Las correlaciones de Pearson entre cada dimensin afectiva y el orden de preferencia


delasseispginasestablecidoporlossujetos,mostraronunatendenciageneralizada:a
mayorpreferencia,mayorniveldevalenciaymenorniveldedominancia.

145

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Por su parte, el anlisis de las caractersticas de la pgina web favorita (orden 1),
mostr que las cualidades ms valoradas por los usuarios eran: apariencia esttica
(94%); colorido (42%), buena estructuracin (25%), sencillez (19%), claridad de
contenidos(14%)yparecefcildenavegar(14%).
Encuantoalaintencindenavegar,alrededordel70%delosusuariosdemediahabra
navegado en al menos una web simple, mientras que no alcanza el 19% la media de
usuariosquelohubierahechoenalmenosunapginawebcompleja.
Porltimo,el97%delossujetosmanifestaronqueestarandispuestosaadquiriralgn
productodelaspginaswebexpuestas;enalgunadelaspginassimplesenel69%de
loscasos,yenalgunadelascomplejasenel31%restante.
CONCLUSIONES
Enconjunto,losresultadosanalizadostransmitenlaideadequecuantomssimplees
unapginawebdeinicio,esdecir,cuantosmenoscontenidosexponeensuhomepage,
ms agradable (mayor valencia), ms excitante (mayor activacin) y ms dominante
(mayor sumisin) resulta emocionalmente para los sujetos, y se sita en mejores
posicionesensuspreferencias.Estehechoseintensificamsenlasmujeresqueenlos
hombres,yaquestasmuestranunaclarapreferenciaporlaspginassimplesfrentea
lascomplejas.
De acuerdo con Sutcliffe (2002), el atractivo global de una pgina web puede
considerarseelresultadodeunirlasmotivacionesyrequerimientosdelusuarioconlas
caractersticas del diseo del website. En esta lnea, es importante resear que
determinadas caractersticas referentes a la esttica y a la usabilidad percibida de las
pginasparecenserfundamentalesalahoradevalorarlas,yquedichascaractersticas
seasocianmsalaspginassimplesquealascomplejas.Laspginassimples,adems,
motivan msla exploracinporparte de losusuarios,algomuy a tener en cuenta ya
que,talycomoapuntaSutcliffe(2002),lamotivacincreadadurantelafaseinicialde
la navegacin puede fomentar que el usuario sea ms tolerante en fases posteriores
anteerroresdefuncionalidad.Tambinlaspginassimplessuscitaronmayorintencin
de compra que las complejas en los sujetos, lo que parece estar relacionado con su
mayorxitoemocional(Dormann,2003;HartmannyZorrilla,1998).
Puesto que los dos sistemas motivacionales primarios, apetitivo y aversivo, estn
directamente relacionados con la dimensin de valencia (Lang, 1995), los sujetos
tenderan hacia una conducta de evitacin ante pginas de inicio ms complejas
(mayor nmero de contenidos expuestos), cuyos resultados obtenidos fueron
notoriamentemsbajosenelgradodevalencia,yaquesetiendehacialaevitacinante
aquelloqueresultamenosagradable(Lang,1995).Enestaspginas,adems,lossujetos
sesentanmscontroladores,menoscautivadosporlapgina,yellopodramotivar

146

TRABAJOS COMPLETOS

incluso una conducta de rechazo, al ser la dominancia la dimensin emocional que


determina el dominio de la situacin: la persona o el estmulo desencadenante
(FernndezAbascaletal.,2010).
Encuantoalaactivacin,enelcontextodelaspginasdeinicioestararelacionadacon
la agitacin y el inters del usuario, puesto que imprime la energa necesaria para
realizarlaconductadeaproximacinoevitacin,dependiendodelgradodeactivacin
de cada sistema, funcionando de manera aditiva a la valencia emocional (Muoz,
2007). Dado que los sujetos se sentan menos excitados y menos motivados ante
pginas con ms contenidos, este hecho tambin podra provocar una conducta de
evitacin.
TodoelloponedemanifiestolaposibilidadderechazodelosusuariosdeInternetante
homepages que expongan excesivos contenidos, hiptesis de partida de la presente
investigacin.

REFERENCIAS
Dormann, C. (2003, abril). Affective experience in the Home: measuring emotion. Ponencia
presentada en HOIT 2003: The networked home and the home of the future, Family
Dynamics,California,EEUU.
Eroglu,S.A.,Machleit,K.A.yDavis,L.M.(2003).Empiricaltestingofamodelofonlinestore
atmosphericsandshopperresponses.PsychologyandMarketing,20(2),139150.
FernndezAbascal,E.G.,Garca,B.,Jimnez,M.P.,Martn,M.D.yDomnguez,F.J.,(2010).
Psicologadelaemocin.Madrid:RamnAreces.
Hartman,P.yZorrilla,P.(1998).LaTiendaVirtual.HardvardDeustoMarketingyVentas,59,
6065.
Lang, P. J. (1995). The emotion probe: Studies of motivation and attention. American
Psychologist,50(5),372385.
Muoz, M.A. (2007). Mecanismos motivacionales del craving: ansia por el tabaco. (Tesis
Doctoral, Universidad de Granada). Granada: Servicio de Publicaciones de la
UniversidaddeGranada.
Sutcliffe, A. (2002, enero). Assessing the Reliability of Heuristic Evaluation for Website
AttractivenessandUsability.Ponenciapresentadaen35thAnnualHawaiiInternational
Conference,SystemScience,Hawaii,EEUU.

147

TRABAJOS COMPLETOS

PRIMINGEMOCIONAL

MDoloresHurtadoMontielyPedroRalMontoro.
FacultaddePsicologa,UNED.

RESUMEN
ElparadigmadeprimingemocionalfueinvestigadoporprimeravezporFazioenel
ao1986,pretendaevaluarlacongruenciaemocionalentreprimeytarget,atravsde
una tarea de decisin lxica. El experimento que presento est formado por 441
ensayos con cierta carga emocional (positiva, negativa y neutra), distribuidos en 7
bloques experimentales. Las instrucciones administradas al sujeto es que tienen que
discriminarentrepalabraypseudopalabraenelmenortiempoposibleeintentandono
cometererrores.Enstecasosepasaaunamuestrade11estudiantesdelaUnedenel
Departamentodepsicologabsicadelapercepcin,elobjetivodemiinvestigacines
medirlostiemposdereaccindelossujetos,versiel primeinfluyesobreel probe, y
sobretodolainfluenciadelprimingemocionalenlosprocesoscognitivos.

PALABRASCLAVES
Priming,emocionesimplcitas,regulacinemocional,interferencia,probe.

INTRODUCCIN
Los estudios de priming han sido replicados varias veces utilizando diferentes
estmulos primes como son las expresiones faciales por Kemps, Erauw y
Zandierendonck, (1996). Murphy y Zanjonc, (1993), dibujos. Jackson, Dunton y
Williams(1995);palabrasconsignificado.Hermans,DeHouweryEelen,1994;Klauer,
Robnagel y Musch, (1997) pseudopalabras, convirtindose en una estrategia
metodolgica importante en la clnica aplicada a pacientes con ansiedad, depresin,
esquizofrenia,Alzheimereinclusoasujetosenunprocesodeanestesiageneral.
Losresultadosdelparadigmanecesitandemsinvestigacinporquenosetienendatos
concluyentes, se han encontrado resultados controvertidos, sobre todo para poder
explicarsilacongruenciaafectivaesunprocesodefacilitacinoinhibicin(Hermans,
1996),olosmecanismossubyacentesalprimingafectivo(Fazio,2001).
Sehainvestigadoacercadelarelacinentreemocionesyprocesoscognitivos,siendo
un tema central dentro de la psicologa (Forgas, 1995), pero sta interpretacin
constituye un problema no resuelto, mientras para los tericos la cognicin es

149

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

prerrequisito para la emocin, para otros la cognicin es slo uno de los varios
procesos responsables de la activacin emocional, para comprender la relacin entre
ambasesimportantedistinguirlas.
La emocin es un estado psicolgico complejo, con cambios conductuales complejos,
tendencia afrontar la situacin y sentimientos positivos o negativos, siendo una
definicin menos unitaria que proceso cognitivo, siendo su problema el definirse de
forma amplia que incluye percepcin implcita, memoria implcita, la toma de
decisiones y aprendizaje implcito (Kihisltrom 1987). La relacin entre conciencia y
emocinescompleja.OtrosinvestigadorescomoZanjonc(1980)defiendelaexistencia
de procesos afectivos no conscientes, que seran los encargados de colorear la vida
afectiva.
Elsustratoneuraldelaemocin,ansesigueinvestigandoloscircuitosimplicadosen
lasreaccionesemocionales,lamayorpartedeconocimientosprovienedeinvestigacin
conanimales,existendosredesneuronalesimplicadasenlaactivacindeemociones;
redsubcorticalycorticolmbica, el elemento central de ambases laamgdala, situada
debajo del lbulo temporal, implicada en muchas funciones emocionales. La red
subcortical puede activar emociones sin que intervenga la corteza cerebral (LeDoux,
1987), ste descubrimiento ha sido muy importantes porque le permite al sujeto
responder con prontitud ante una situacin comprometida, de forma casi automtica
anteunasituacindealarma.
OBJETIVO
Elobjetivodelpresenteexperimento,escomprobarsilostiemposdereaccindesta
muestra generan tiempos menores cuando existe congruencia emocional entre el
primeyeltargetotiemposdereaccinmayoresenincongruenciaemocional,esdecir
comprobarsiexisteunprocesodefacilitacinodeinhibicin,paraelloaplicaremosel
siguienteprocedimiento.
MTODO
Participantes:
Lamuestrafueungrupode11estudiantesde2cursodeGradoenPsicologaporla
UNED,compuestapor8mujeresy3hombresconedadescomprendidasentre19y53
aos,media=31,64aos,desviacintpica=11,62.
Procedimiento:
Losparticipantesformarondosmuestras,parapoderrealizarelexperimentosegnel
ndecabinasexperimentalesdeldepartamento.Elprimergrupode7miembros(tres
hombres y 4 mujeres), he obtenido una media de edad de 33, 42. El segundo grupo
formadopor4participantesmujeresconunamediadeedadde28,5.

150

TRABAJOS COMPLETOS

Los participantes recibieron por su colaboracin 0,5 en calificacin final de la


asignaturadepercepcin.
Sefiltraronlosensayosdeprcticaysecalcullaproporcindeaciertos.Serealizun
ANOVA de medidas repetidas 3 x 3 con los factores valencia del prime (negativa,
neutra,positiva)yvalenciadelprobe(negativa,pseudopalabra,positiva).
Los resultados mostraron un EFECTO PRINCIPAL SIGNIFICATIVO del factor
valencia del probe: F (2, 20) = 12,61, p < .001. Las comparaciones por pares con
correccin Bonferroni mostraron la existencia de diferencias significativas (p < .05)
entrelossiguientespares:negativaypseudopalabra;positivaypseudopalabra.
Nosedetectaronotrosefectossignificativos.
TIEMPODEREACCIN
Se filtraron los ensayos de prctica, los errores y los TRs inferiores a 200 ms y
superiores a 1500 ms. Se realiz un ANOVA de medidas repetidas 3 x 3 con los
factoresvalenciadelprime(negativa,neutra,positiva)yvalenciadelprobe(negativa,
pseudopalabra,positiva)yconeltiempodereaccincomovariabledependiente.
De nuevo, los resultados mostraron un EFECTO PRINCIPAL SIGNIFICATIVO del
factorvalenciadelprobe:F(2,20)=48,27,p<.001.Lascomparacionesporparescon
correccin Bonferroni mostraron la existencia de diferencias significativas (p < .05)
entre los tres pares comparados, a saber: positivanegativa, positivapseudopalabra,
negativapseudopalabra.Nosedetectaronotrosefectossignificativos.

Grfica de Precisin:

Grfica de Tiempos de reaccin:

151

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

RESULTADOEXPERIMENTALES
Segnelpatrndedatosencontrados,conindependenciadesuvalenciaemocional,el
primenoinfluyesobrelarespuestadelprobe(existeunainteraccinentrefactoresque
no desvela el anlisis, yo pienso que la causa puede ser porque es una muestra muy
pequeatansolon=11comofactordeinterferencia,esprecisogenerarinvestigacino
nuevosestudiosparadesvelarlainteraccinentreestosfactores.
Revisando la bibliografa he encontrado que Palmer (1999): procesar un estmulo
objetivo particular es ms rpido y efectivo. Si el que se presenta en primer lugar es
decir,elestmuloseal,esdeparecidascaractersticasalestmuloobjetivo.Debido,a
quelosprocesosquerealizalapercepcinoelsistemacognitivoestnenunestadode
mejorpreparacin.
Influye la valencia emocional en el probe, pero sin olvidar el efecto de especificado
anteriormente, es decir que tiempos de reaccin menores cuando el probe tiene
valencia emocional positiva, valores entorno a 538539, despus le sigue el probe
negativo equiparndose 560570 y ocupando un tiempo de reaccin mayor
pseudopalabras.
SegnlosestudiosdeprimingafectivollevadosacaboporFazio,Sanbonmatsu,Powell
y Kardes (1986) han demostrado que la latencia de respuesta ante un estmulo est
mediada por la relacin afectiva entre el estmulo seal y el posterior estmulo
objetivo.Estosignificaqueelestimulosealnosiempretienequeserunestimulosin
contenidoemocional,sinoquepuedeserunapalabra,locualimplicayaunsignificado
yjuntoconelloalgntipoderelacinafectiva.
SielsignificadoemocionalovalenciaafectivadelE.sealyE.objetivosonparecidos
(dolor tristeza) la respuesta del sujeto se ve facilitada, por el contrario cuando las
valencias de ambos estmulos son contradictorias (dolor alegra), la respuesta se
inhibe,dandolugaraunmayorTRy/ounmayornmerodeerroresdeR.
Paraconcluirelefectoempricodemsfortalezaencontradoenlosdatoshasidoqueel
sujetotardamstiempoenrespondercuandoseencuentraconpseupalabrasqueno
correspondenanuestrolxico,despuslesiguenlosTRcuandolavalenciadelprobe
es negativa. Los sujetos responden ms rpido cuando el probe tiene una carga
emocionalpositiva.

REFERENCIAS
GarcaSevilla,J.(1991).Paradigmasexperimentalesenlasteorasdelaautomaticidad.Anales
depsicologa,7(1),130.
Neil, W.T. (1978). Decisions Processes in selective attention: Response Priming in the Stroop
colourwordtask.PerceptionandPsychophysics,23,8084.

152

TRABAJOS COMPLETOS

Acosta,A.yLupiez,J.(2003).Efectosdelprimingenlatareastroopemocionaldenombrar
color:Modulacinautomticaoestratgicadelainterferencia.RevistaElectrnicade
MotivacinyEmocin.VI(1415).

153

TRABAJOS COMPLETOS

ELPROCESODECONSTRUCCINIDENTITARIAHBRIDAENLA
NARRACINAUTOBIOGRFICADEMSICOSESPAOLES

MarcoJosBernalMarcos
FacultaddePsicologa,UNED.

RESUMEN
Analizamos el proceso de construccin identitaria hbrida en msicos espaoles que
incorporan a sus vidas, a sus narraciones, la tradicin cultural afroamericana,
concretamentelamsicablues.Partimosdeunmarcotericogeneralconstituidoporla
Psicologa Cultural, representada por psiclogos como Michael Cole o Jaan Valsiner,
querecogenlatradicinclsicadelaescuelaculturalhistricarusadeLevVygotskyo
Mijal Bajtn, entre otros. Tanto la msica como las narraciones autobiogrficas
derivadasdeella,sonentendidascomoartefactosculturalesdetipoticoyestticoque
median nuestra experiencia vital y la dotan de sentido. La metodologa cualitativa
empleada estar compuesta de entrevistas semiestructuradas a msicos espaoles de
entre35y55aos.Losdatosrecogidossernsometidosaanlisisdeldiscurso,donde
intentaremosidentificareltipodemediadoressimblicosymaterialesqueconforman
elcontextoespecficodelaconstruccinidentitariahbridadenuestrossujetos.

PALABRAS CLAVE: Psicologa cultural, identidad, hibridismo cultural, actos de


identificacin,mediacinporartefactos.

INTRODUCCIN
El presente trabajo de investigacin constituye un estudio piloto con carcter
exploratorio que pretende comenzar a apuntar temticas que sern desarrolladas en
mayorprofundidadenelTrabajoFindeMster.Paraestablecerelcontextotericoen
el que cobran sentido y significado las cuestiones a tratar debemos mencionar, en
primer lugar, la idea de hibridismo cultural desarrollada por autores como Burke
(2010) o Canclini (2003), perspectivas que asumen que las sociedades actuales viven
inmersasencontinuosflujosdeintercambio,combinacinotraduccinculturalyque,
msalldelmerosincretismoomestizaje,prestanespecialatencinalamaneraenque
nossituamosenmediodelaheterogeneidad,sindescuidarosimplificarlasdiferencias
departida.
Elhibridismoculturalconstituyeunespaciomultidisciplinaralquenosotros,como
psiclogos,nosacercamosdesdelaPsicologaCulturaldeautorescomoCole(1999)o

155

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Valsiner(2009).Desdeestaformadeentenderlapsicologa,losproductosculturalesno
sonconsideradoscomomerasvariablesindependientessinocomopartesustancialde
losprocesospsicolgicosquedebemosinvestigar(Valsiner,2009).Lacaractersticams
importante de la Psicologa Cultural, tomada de la escuela sociohistrica y cultural
rusadeLevVygotskyoMijalBajtn,eslaideadeactividadmediadaporartefactos.El
proceso de enculturacin conlleva la participacin necesaria de herramientas
materialesysimblicas(religin,msica,lenguaje,mitos,etc.)quedelimitanlaforma,
posibilidades y propsitos de la accin. As, para nuestro estudio, consideramos la
msica como mediador tico y esttico, y la estructura narrativa como medio de dar
sentidoyorientarlaexperienciavitaldelaspersonas.
En cuanto a la cuestin de la identidad, no partimos de una concepcin esencialista,
esttica o trascendental, nos interesa ms bien su condicin de acto, proceso o
posicionamiento a partir del cual imaginamos y construimos relatos sobre nuestro
origen y desarrollo como personas (Canclini, 2003; Rosa y Blanco, 2008). En este
sentido, las teoras psicolgicas actuales sobre identidad, muy en la lnea de lo
apuntadoporlaPsicologaCultural,secentranenelincrementodelacomplejidadyla
experienciadeincertidumbrequeexperimentanlassociedadesactualesylainfluencia
que dicha circunstancia tiene en los fenmenos identitarios (Hermans, 2001; Gergen,
1991)
En la lnea conceptual apuntada, consideramos la identidad hbrida en tanto que
accin, proceso o posicionamiento por el que un sujeto puede adscribirse a varios
referentes culturales aparentemente distanciados (en trminos temporales o
geogrficos),siendocapazdeensamblarlosnarrativamenteenunrelatoautobiogrfico.
Nuestroobjetivoprincipalconsistirenanalizarelprocesodeconstruccinidentitaria
hbrida en msicos espaoles que incorporan referentes culturales de la tradicin
afroamericana,concretamentelamsicablues.Estonosllevaatresobjetivosderivados
en el estudio de dichos referentes culturales: el proceso sociohistrico de
incorporacin a la cultura personal de cada msico; los artefactos culturales
implicados;lacomposicindefuncionesvalorativasticasyestticas.
MTODO
Contamos con tres msicos espaoles de entre 35 y 55 aos a los que realizamos
entrevistas semiestructuradas en gran profundidad, diseadas en pasado, presente y
futuro, que requirieron transcripciones muy extensas y que siguieron un guin de 11
preguntas del tipo: Cul fue tu primer contacto con el blues?, Qu opinas de la
mezcladelbluesconotrasmsicas?oQutepareceelbluescantadoenespaol?.
Una vez transcritas, mediante el anlisis del discurso de nuestros sujetos, llevamos a
cabo una exploracin cualitativa organizada temticamente basada en nuestros tres

156

TRABAJOS COMPLETOS

objetivos derivados mencionados con anterioridad. La propia situacin de entrevista


fueconsideradacomoparteconnaturaldelprocesodeconstruccinidentitariaydela
condicin hbrida del mismo. La interaccin con el entrevistado promueve actos de
identificacin no formalizados hasta el momento e, incluso, reflexiones sobre este
mismo proceso en tanto que acto de creacin. Nuestros msicos pueden, as,
redescubriryredefinirsucondicindesujetosticosyestticos.
RESULTADOS
Los contenidos temticos encontrados conforman los elementos que componen el
contexto de hibridacin musical identitaria y las formas de construir un relato
autobiogrfico en relacin al blues en nuestros sujetos. Dichos contenidos temticos,
resumidosbrevemente,sonlossiguientes:
Base militar EEUU en Rota (Cdiz): la funcin militar inicial de esta base queda
desbordada para cumplir una funcin cultural inesperada en la difusin del blues, a
travsdelaemisoraderadiolocalomediantediferentesintercambiosculturalesentre
americanos y espaoles, a finales de los aos sesenta. Supone para uno de nuestros
sujetos la contradiccin valorativa y tica entre la msica que ama y el
militarismo/imperialismonorteamericanodesdeelquelarecibe.
Fascinacin por el imaginario blues: en la profundizacin en las races del blues se
produceunaincorporacin,mayoromenor,deciertoselementosdesuimaginarioal
proyecto de vida o profesional de los sujetos, dando incluso lugar a viajes
experiencialesbuscandolamsicacomoentorno(NewOrleans,Clarksdale,Ruta66)
Laguitarra:instrumentomusicalquesuponeunretodeaprendizajeyprofundizacin
tcnica y estilstica desde el blues y hacia un contexto ms amplio. En tanto que
artefactomediadorqueexigeunatcnicadecoordinacincorporalymotoracompleja,
la guitarra abre, adems, un mbito de prcticas identitarias, significativas y
propositivas,nomediadasespecficamenteporellenguaje.
Eric Clapton: figura clave comn para nuestros sujetos, tanto en la recepcin ya
hibridadadelbluesrockbritnicoblancocomoenlaprofundizacinensusraceshacia
elbluesdelDelta.
Reflexinnoesencialista:lossujetosdanmuestrasdesuconocimientodelacondicin
hbrida del blues pero el discurso deja entrever cierto matiz de normativizacin en
referenciaalbluescantadoenespaol.
Evidentemente,estaprimeraclasificacintemticaesprospectivaynoquedaagotada
en este estudio ya que en el TFM se pretenden desarrollar otros temas encontrados
comolamsicaysufuncinevocadoraoelprocesodecambiopersonal/musical.
DISCUSIN

157

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

En relacin a la incorporacin del blues a la cultura personal de cada sujeto


encontramos un proceso de recepcin ligado a un contexto sociohistrico concreto
dentrodelainiciacinenlapasincompartidaporelblues.Entodoellodestaca,por
unlado,lapeculiaridadestticoticasociolgicadelabasenorteamericanadeRotay,
porotrolado,laprofundizacinespecficaquecadamsicohaceenelimaginariodel
blues.
En cuanto a los artefactos culturales implicados, el aprendizaje de un instrumento
comolaguitarrasuponeparanuestrossujetosunmodelotcnico,estilsticoyesttico
que vehicula la pasin por el blues, adems de constituir un reto de aprendizaje y
apropiacin,conlafiguradeEricClaptoncomoejevertebradoryreferenteinicitico.
Por ltimo, encontramos reflexiones no esencialistas respecto a la interpretacin
original y creativa del blues aunque apreciamos interesantes procesos identitarios de
indefinicin con cierto discurso de normativizacin respecto al blues cantado en
espaol.
En general, nuestro trabajo quiere constituir un desafo al pensamiento analtico
esencialistaqueacostumbraatrabajarconcategorasdicotmicas:elnortefrentealsur,
lonacionalfrentealoextranjero,losalvajefrentealocivilizado,occidentalesfrentea
musulmanes.Losintercambiosculturales,sincaerenlassimplificacionesyteniendoen
cuenta toda sucomplejidad, producenreinterpretaciones originalesy creativas de los
procesos y prcticas culturales e identitarias. En lnea con los retos que asumen los
estudios psicolgicos identitarios actuales, pretendemos acercarnos a las identidades
hbridas en culturas de frontera y comunidades en dispora, tratando de entender
cmo las personas coordinan posiciones culturales y personales incompatibles y
frecuentementeconflictivas(BathiayRam,2001).

REFERENCIAS
Bathia,SyRam,A.(2001).LocatingtheDialogicalSelfintheAgeofTransnationalMigrations,
BorderCrossingsandDiasporas.Culture&Psychology.Vol.7(3):297309
Burke,P.(2010).HibridismoCultural.Madrid:EdicionesAkal.
Cole,M.(1999).PsicologaCultural.Madrid:Morata.
GarcaCanclini,N.(2003).Noticiasrecientessobrelahibridacin.Trans.RevistaTranscultural
deMsica.Vol.7.
Gergen, K.J. (1991). El yo saturado. Dilemas de identidad en el mundo contemporneo.
Barcelona:Paids
Hermans,H.J.(2001).Thedialogicalself:Towardatheoryofpersonalandculturalpositioning.
Culture&Psychology,7,243281.
Rosa,A.yBlanco,F.(2008).ActuationsofidentificationinthegamesofIdentity.EuropeanPh.
D.onSocialRepresentationsandCommunication.
Valsiner, J. (2009). Cultural Psychology Today: Innovations and Oversights. Culture &
Psychology.Vol.15(1),539SAGEPublications[DOI:10.1177/1354067X08101427]

158

TRABAJOS COMPLETOS

EFECTOSDELCOACHINGGRUPALSOBRELOSNIVELESDERESILIENCIAY
DEBIENESTARPERCIBIDO

MTeresaInglsyGarcadelaCalerayEnriqueGarcaFernndezAbascal
FacultaddePsicologa,UNED.

RESUMEN
El presente estudio examina los efectos de un proceso de Coaching grupal, de ocho
sesionesdeduracin,dirigidoalentrenamientodehabilidadesdegestindeconflictos
y autogestin emocional, con un grupo experimental y un grupo control de n=14
participantescadauno.Laresilienciaysusfactoresprotectoresseevaluaronpreypost
intervencinconlaConnorDavidsonResilienceScaleyconlaEscaladeResiliencia
para adultos de Friborg et al., respectivamente. Como medida de bienestar
psicolgico se acudi a la escala de Ryff. Tras la intervencin, el grupo experimental
mostr mejores puntuaciones significativas en tres factores protectores de resiliencia
(Percepcin de uno mismo, Estructura personal y Apoyo social) y en el total de la
escala. El grupo control mejor significativamente slo en Apoyo Social como factor
protectorderesiliencia.Nohubomejoraenbienestarautopercibidoparaningunode
losdosgrupos.

PALABRASCLAVE
Resiliencia, Bienestar, Coaching grupal, ConnorDavidson Resilience Scale, Escala de
Resilienciaparaadultos

INTRODUCCIN
ExisteanpocainvestigacinacercadelimpactoquepuedatenerelCoachingsobrelos
nivelesderesilienciadelaspersonasysobresubienestarpsicolgicoautopercibido.El
presente estudio examina los efectos en estas variables de una intervencin de
Coaching grupal, dirigida al entrenamiento de habilidades de gestin de conflictos y
autogestin de emociones, enfocado a una posible aplicacin tanto profesional como
personal.
MTODO
Sujetos
El estudio const de grupo experimental y grupo control. En el grupo experimental
comenzaron17participantes16mujeresyunvarn,perotrastresabandonosslo14
terminaronelproceso13mujeresyunvarn).

159

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Laedadmediadelgrupoexperimentalerade45aos,yde39,57aosparaelgrupo
control.
Encadaunodeellos,elnmerodeparticipantesqueterminaronelexperimentofueron
n=14adultos.
AparatosoInstrumentos
La resiliencia y sus factores protectores se evaluaron pre y post intervencin con los
dosinstrumentossiguientes.Porunlado,laresilienciacomocualidadlamedimoscon
Escala de resiliencia abreviada de ConnorDavidson (CDRISC) (2003). En ella, la
resiliencia es una medida de la habilidad para afrontar el estrs con xito. Mide dos
factores: dureza, entendida como resistencia ante la adversidad, y persistencia. Por
otro, evaluamos factores crticos protectores de resiliencia con la Escala de resiliencia
para adultos de Friborg, Hjemdal, Rosenvinge, y Martinussen (2003, versin de
Friborg, Barlaug,Martinussen, RosenvingeyHjemdalde 2005), la cualestableceseis
factores protectores crticos: Percepcin de uno mismo, Futuro planeado, Estructura
personal (planificacin y organizacin del tiempo), Competencia social, Cohesin
familiaryApoyosocial.
Como medida de bienestar psicolgico se acudi a la escala de Ryff (1989) en su
adaptacin espaola de Daz, RodrguezCarvajal, Blanco, MorenoJimnez, Gallardo,
Valleetal.(2006).
Procedimiento
Elformatoelegidofueelestudioexploratorioconmedicinpreypostintervencin.
Lacoachllevacaboochoreunionessemanalesconcadasubgrupoexperimental,con
unaduracindeentredoshorasymediaytreshorascadauna.Enellas,setrabajaban
estrategiasderesolucindeconflictosydeautogestinemocional.
Paralelamente al proceso de Coaching grupal, los participantes del grupo control
acudancadamaana,delunesaviernesdurantetresmeses,auncursodeformacin
enelquesededicabaundaalasemana(treshoras)alentrenamientoenhabilidades
sociales.EnestecursonoparticipabalaCoach.
RESULTADOS
Para la comparacin prepost intervencin, se realizaron anlisis de varianza
bidireccionales(ANOVA)demedidasrepetidasparacadavariable,condosgruposde
variables independientes, los cuales fueron Momento (preintervencin y post
intervencin) x Grupos (experimental y control) para cada uno de las variables
aplicadas. Las variables dependientes fueron los resultados en los autoinformes
descritosenelepgrafedeinstrumentos.
Del anlisis de los resultados postintervencin para el grupo experimental, se
desprendequeshuboevolucinfavorableeneltotaldeFactoresprotectoresenla

160

TRABAJOS COMPLETOS

Escala de Resiliencia, as como en sus correspondientes factores Percepcin de uno


mismo,EstructuraPersonalyApoyoSocial.
Paraelgrupocontrol,huboevolucinfavorablesignificativasloenelfactorprotector
deresilienciaApoyoSocialdelaEscaladeResilienciaparaadultos.
DISCUSIN
Respecto de los factores protectores de resiliencia, hemos visto que el grupo
experimental mejora significativamente en Percepcin de uno mismo. El contenido
de los tems que conforman este factor tiene que ver con habilidades de solucin de
problemas y autoconfianza, aspectos que tuvieron cabida en las estrategias que se
disearonduranteelprocesodeintervencin,porloquenoesdeextraarestamejora.
Lo mismo ocurre con el Apoyo social, pues se trataron estrategias de resolucin y
prevencindeconflictos.Noencontramosrelacin,empero,entrelamejoradelfactor
Estructurapersonal,relativaaplanificacinyorganizacineficientedeltiempo,yel
contenidodelaintervencin,puesstanocontemplestosaspectosdemaneradirecta.
Tratando el bienestar percibido, vemos que, a pesar de que el grupo experimental
mejoralaspuntuacionesprepostentodoslosfactoresdelaescaladeRyffyeneltotal,
nuestra intervencin de Coaching parece haber sido insuficiente como para que el
impacto positivo sobre sus niveles de bienestar percibidos sea estadsticamente
significativo. Ello puede ser debido a una combinacin de varias circunstancias.
Primero, el tipo de temtica abordada (gestin de conflictos en su mayora), o los
ejemplos concretos tratados. Segundo, el tiempo total de intervencin (ocho sesiones)
puede ser insuficiente como para que se perciban efectos significativos. Tercero,
pudiera haber influido, como variable extraa, el estilo de la profesional coach. S
parece, a tenor de los esperanzadores resultados, que el Coaching puede resultar
beneficioso,quizsmejorandoelprotocolodeaplicacin.
Pasemosalgrupocontrol.Paraste,enresiliencia,empeorantantolapercepcinglobal
de habilidad global de afrontar el estrs, como sus dos dimensiones, Dureza y
Persistencia.Tambinempeoralavaloracinquelossujetosdelgrupocontrolhacende
sucapacidadparaplanificaryorganizarse(factorprotectorEstructurapersonal).Yen
niveles de bienestar (Ryff), se ven menoscabadas las sensaciones de Autonoma,
DominiodelentornoyCrecimientopersonal.Estosresultadosparecenapuntaraltipo
deintervencinmeramenteformativaqueharecibidoelgrupocontrol,dondeelno
control de las variables emocionales ha podido desembocar en un incremento de la
desesperanza.
En general, los resultados son positivos y esperanzadores tanto en el mbito de la
resiliencia como enel del bienestarpsicolgico, y animan a seguir investigando en el

161

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Coaching como mtodo de intervencin en poblacin no clnica para la mejora de la


saludmental.

REFERENCIAS
Connor, K.M. y Davidson, J.R.T. (2003). Development of a new resilience scale: the Connor
DavidsonResilienceScale(CDRISC).DepressionandAnxiety,18(2),7682.
Daz, D., RodrguezCarvajal, R., Blanco, A., MorenoJimnez, B., Gallardo, I., Valle, C. y van
Dierendonck,D.(2006).Adaptacinespaoladelasescalasdebienestarpsicolgicode
Ryff.Psicothema,18(3),572577.
Friborg,O.,Hjemdal,O.,Rosenvinge,J.H.,Martinussen,M.(2003).Anewratingscaleforadult
resilience: What are the central protective resources behind healthy adjustment?.
InternationalJournalofMethodsinPsychiatricResearch,12(2),6576.
Ryff, C. D. (1989). Happiness is everything, or is it? Explorations on the meaning of
psychological wellbeing. Journal of Personality and Social Psychology, 57(6), 1069
1081.

162

TRABAJOS COMPLETOS

PERSONALIDAD,AFRONTAMIENTOYCALIDADDEVIDAENPACIENTES
CONENFERMEDADCARDIOVASCULAR

EsperanzaVallsLzaro1,2yBeatrizRuedaLafond1
FacultaddePsicologa.UNED;2CSMActurSur,Zaragoza

RESUMEN
Este estudio investig la asociacin y la capacidad predictiva de los rasgos de
personalidadconrespectoalafrontamientoylacalidaddevida(CV)en107enfermos
cardiovasculares (ECV). Asimismo se examin la contribucin del afrontamiento con
respectoalaCV.
Los resultadosindicaron quela Estabilidad emocional (EE) predijounmenorusodel
afrontamiento centrado en la emocin, y un mayor nivel de aceptacin de la
enfermedadydelaCV.Laafabilidadseasocipositivamenteconelapoyosocial,yla
extraversin con el uso del humor, el desenganche mental y la satisfaccin. La
reevaluacinpositivacontribuyaexplicarpositivamentelasatisfaccin;mientrasque
laculpa,eldesenganchementalyelusodesustanciaspredijeronunamenorCV.
Estos resultados sugieren la importancia de la personalidad y el afrontamiento
utilizadoporpacientesconECVenelmanejodesuECVyenlapromocindesuCV.

PALABRASCLAVE:Personalidad;afrontamiento;calidaddevida;ajuste;enfermedad
cardiovascular

INTRODUCCIN
Diferentes estudios han destacado la importancia de identificar los procesos
psicosocialesqueinfluyensobreelmalestarpsicolgicoasociadoalasECV,conelfin
dequesepuedanmejorarlosresultadosclnicosyelpronsticodelospacientes.Los
rasgos de personalidad, las estrategias de afrontamiento utilizadas, un bajo nivel de
emocionesnegativasylacalidaddevidapercibidaparecenasociarsedeformapositiva
con un menor riesgo de padecer ECV, una comorbilidad ms baja, mayor
supervivencia y una mejor adherencia a los tratamientos. Los objetivos que nos
planteamosenesteestudiofueron:(a)examinarenunamuestradepacientesconECV
lacapacidadpredictivadelosrasgosdepersonalidadconrespectoalasestrategiasde
afrontamiento que utilizaban para manejar su enfermedad; y (b) analizar en qu
medidalosrasgosylasestrategiasdeafrontamientopredecanniveldecalidaddevida
(CV). Esperbamos que la estabilidad emocional (EE), la energa y la afabilidad se

163

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

relacionaran con un mayor afrontamiento activo y con una CV ms alta; y que el


afrontamientodetipoemocionalpasivopredijeranegativamentelaCV.
MTODO
Participantesyprocedimiento
Para la seleccin de la muestra se contact con dos hospitales de Zaragoza. Cada
paciente fue informado de los objetivos de la investigacin y su carcter voluntario,
desestimndoselaspersonasquepresentabanuntrastornopsiquitricodiagnosticado
previamente, o unas condiciones fsicas que les impedan la realizacin del
cuestionario.Delos312pacientescontactados,107pacientesconstituyeronlamuestra
finaldelestudio.Deellos,el59.8%(N=64)fueronvaronesyel40.2%(N=43)mujeres.
Laedadmediafuede63aos(rango3087).
Instrumentosyprocedimiento
El cuadernillo entregado inclua diferentes cuestiones relativas a los aspectos
sociodemogrficos (edad, sexo, estado civil, estudios y situacin laboral) y al tipo de
patologa cardiaca padecida (insuficiencia cardiaca, angina de pecho, ciruga,
valvulopata, arrtmias,fibrilacin o infarto demiocardio). Lasvariables psicosociales
evaluadasfueron:(a)losrasgosdepersonalidad(energa,afabilidadyEE)medidasa
travsdelcuestionarioBFQ(Capraraetal.,1993);(b)elafrontamientoutilizadoantela
enfermedad, evaluado a travs del cuestionario BRIEF COPE (Carver, 1997); y (c) la
calidaddevidapercibida(dimensionesdeapoyosocial,bienestar,satisfaccinvitaly
calidad de vida global) medida mediante el cuestionario de calidad de vida (Ruiz y
Baca,1993).
Resultados
ElanlisisdedatosserealizconelpaqueteestadsticoSPSSV.15.0.
Estadsticosdescriptivos
La patologa cardiovascular, los infartos de miocardio, la insuficiencia cardiaca, y la
angina de pecho representaron las causas principales por las que los participantes
estabansiendoasistidosenlaespecialidaddecardiologa.Atendiendoalosrasgosde
personalidadlamediaobtenidaenafabilidadfuelamselevadaseguidadelaenerga
ylaEE.Encuantoalafrontamiento,lasestrategiasmsutilizadasfueronlasreferidasa
laaceptacin,elafrontamientoactivo,laplanificacin,elusodeapoyotantoemocional
como instrumentaly lareevaluacin positiva. Lasestrategiasmenosusadasfueronel
usodesustancias,eldesengancheconductual,lanegacinyelsentidodelhumor.Por
ltimo,conrespectoalaCV,laspuntuacionesmsaltasseobtuvieronensatisfaccin
personalyapoyosocial,ylasmsbajasenbienestar.
Relacinentrelapersonalidad,lasestrategiasdeafrontamientoylaCV

164

TRABAJOS COMPLETOS

Los resultados mostraron, en primer lugar, que el rasgo de energa se relacionaba


positivamente con el empleo del humor, la ventilacin emocional y el desenganche
mental. La afabilidad se asoci con un mayor uso del afrontamiento activo, el apoyo
emocionaleinstrumentalylareevaluacinpositiva.LaEE,porsuparte,correlacion
conunmenorusodeldesenganchemental,laventilacinemocionalylaculpa,ycon
unmayorempleodelaaceptacinylareevaluacinpositiva.Encuantoalasrelaciones
conlaCV,seapreciquelaenergaseasociabaconunamayorsatisfaccin,mientras
quelaEEseasocipositivamenteconlaCVglobalyelbienestar,ylaafabilidadlohizo
conunmayorapoyosocial.
Con respecto a las correlaciones entre el afrontamiento y la CV, la estrategias de
bsquedadeapoyoemocionaleinstrumentalseasociaronpositivamenteconelapoyo
social, mientras que el uso de sustancias correlacion con esta dimensin de forma
negativa.Lareevaluacinpositivaserelacionconmayorsatisfaccin.Eldesenganche
conductual y mental,la culpay la negacincorrelacionaroncon un nivelde CV yde
bienestar ms bajos. La culpa y la negacin se asociaron tambin con una menor
satisfaccin.
PrediccindelasestrategiasdeafrontamientoylaCV

RASGOS PERSONALIDAD

R2

F (3, 103)

.14

5.65***

.34***
.29**

.08

3.04*

.31**

.10

3.92**

.35**

R2

F (8, 98)

.30

5.27***

-.39***
-.18*

.17

2.56**

.25**

.21

3.35**

-.32**

.21

3.44**

-.25**

Satisfaccin General
Energa
Estabilidad Emocional
Bienestar
Estabilidad Emocional
CV. Global
Estabilidad Emocional
ESTRAT. AFRONTAMIENTO
Apoyo social
Uso Sustancias
Culpa
Satisfaccin
Reevaluacin Positiva
Bienestar
Desenganche Mental
CV. Global
Culpa

Tabla: Prediccin de la CV a partir de los rasgos de personalidad y el afrontamiento. Nota: Se muestran solo
los datos significativos; *** p < .001 **p < .01 *p < .05

165

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

LaEEtuvounpesonegativoenlaprediccindelasestrategiasreferidasalaculpa,la
ventilacin emocional y el desenganche mental, siendo su peso positivo en la
prediccindelaaceptacin.Laenergapredijopositivamenteelsentidodelhumoryel
desenganche mental mientras que la afabilidad predijo un mayor uso del apoyo
instrumental. Con respecto a la CV, la EE fue el rasgo que mayor peso tuvo en la
prediccin tanto de la CV global como de las dems dimensiones a excepcin del
apoyosocial.Laenerga,tambinseasociconunmayorniveldesatisfaccinvital.
Porltimo,conrespectoalacapacidadpredictivadelasestrategiasdeafrontamiento
enrelacinconlaCV,laculpapredijonegativamentelaCVglobalyelapoyosocial.El
uso de sustancias predijo negativamente el apoyo social y el desenganche mental se
relacionconunmenorgradodebienestar.Lareevaluacinpositivafue,porsuparte,
lanicaestrategiaquepredijodeformapositivalasatisfaccingeneral.
DISCUSIN
Como esperbamos, los resultados de la presente investigacin pusieron de
manifiesto,enprimerlugar,quelaEEpredecaunmenorniveldeculpa,deventilacin
emocionalydedesenganchemental,ascomounamayoraceptacindelaenfermedad.
La energa se asoci con el uso del humor, aunque tambin lo hizo con un mayor
desenganche mental. Finalmente la afabilidad predijo un mayor empleo del apoyo
instrumental. Estos datos avalan el hecho de que los pacientes con mayor EE y
afabilidad tienden a utilizar menos el afrontamiento centrado en la emocin y a
recurrir ms a la bsqueda de apoyo social conforme la ECV va evolucionando
(ConnorSmithyFlachbart,2007;VegayGonzlez,2009).Porotraparte,puestoquelos
pacientesconunnivelmsaltodeEEsecaracterizanporunamenorvulnerabilidada
experimentar emociones negativas, es probable que tambin se sientan menos
culpables en relacin con su enfermedad pudiendo implicarse ms a la hora de
afrontarlayaceptarlamejor(CarveryConnorSmith,2010).
LaEEfueelrasgoquetambinseasocienmayormedidaconlaCV,lasatisfacciny
elbienestar,sibienlaenergatambinpredijounamayorsatisfaccin.Estosresultados,
consistentes con investigaciones previas (Steel et al., 2008), sugieren que el polo
opuesto a la EE, esto es el neuroticismo, contribuye de forma importante a la
disminucin de la CV y a un peor ajuste a este tipo de enfermedad, lo cual se ha
constatado a travs del bajo nivel de bienestar y de satisfaccin que informan los
pacientesconaltoneuroticismo.
EncuantoalpesodelafrontamientoenlaprediccindelaCV,losresultadosapoyaron
lahiptesisplanteadayaquelasestrategiascentradasenlaemocinnegativa,estoes,
la culpa, la negacin, el desenganche mental y el uso de sustancias fueron las
estrategiasqueserelacionaronconunapeorCV.Lareevaluacinpositivaseasocicon

166

TRABAJOS COMPLETOS

unamayorsatisfaccin,confirmndosedeestemodolaevidenciaobtenidaentrabajos
previos(Moskovitz,etal.2009).
La presente investigacin cuenta con una serie de limitaciones, como su carcter
trasversal, por ello sera conveniente confirmar los resultados obtenidos con otros
procedentesdeestudioslongitudinales.
En resumen, esta investigacin pone de manifiesto que la EE, la energa y el
afrontamientocentradoenlareevaluacinpositivadelasituacinrepresentanfactores
psicosociales protectores en la medida en que contribuyen a aumentar la CV de los
pacientes con ECV, y a disminuir otras estrategias de afrontamiento ms
desadaptativas.
Estos resultados permiten dar luz a la hora de planificar mejor los tratamientos con
pacientesconECVcrnica,porloque,ademsdeconsiderarlosaspectosbiomdicos,
sera conveniente valorar la posibilidad de intervenir sobre determinadas
caractersticasdepersonalidaddelospacientesysobrelasestrategiasdeafrontamiento
que estn utilizando, con la finalidad de potenciar una mayor CV conforme la ECV
vayaevolucionando.

REFERENCIAS
CapraraGV.,BarbaranelliC.,BorgogniL.(1993).CuestionarioBigFive.Adaptacinespaolade
BermdezJ.;UNED.(1995).TEAEdicionesS.A.,Madrid.
Carver, C.S. (1997). You want to measure coping but your protocols too long: Consider the
BriefCope.InternationalJournalofBehavioralMedicine,4,92100.
Carver,C.S.yConnorSmith,J.(2010).Personalityandcoping.AnnualReviewofPsychology,
61,679704.
ConnorSmith, J. y Flachsbart, C. (2007). Relations between personality and coping: A meta
analysis.JournalofPersonalityandSocialPsychology,93,10801107.
Moskowitz,J.T.,Hult,J.R.,Bussolari,C.yAcree,M.(2009).WhatworksincopingwithHIV?A
metaanalysiswithimplicationsforcopingwithseriousillness.PsychologicalBulletin
135,121141.
Ruiz, M.A., y Baca, E. (1993). Design and validation of the quality of life questionnaire. A
generic healthrelated quality of life instrument. European Journal of Psychological
Assessment,9,1932
Steel, P., Schmidt, J. y Shultz, J. (2008). Refining the relationship between personality and
subjectivewellbeing.PsychologicalBulletin,134,138161.
Vega, O.M., y Gonzlez, D.S. (2009). Apoyo social: Elemento clave en el afrontamiento de la
enfermedadcrnica.EnfermeraGlobal,16,111.

167

TRABAJOS COMPLETOS

PERSONALIDAD,RESILIENCIAYBIENESTARSUBJETIVOENPERSONAL
SANITARIOYNOSANITARIO

scarArroganteMaroto1,2;AnaMaraPrezGarca1
FacultaddePsicologaUNED;2HospitalUniversitariodeFuenlabrada(Madrid);

RESUMEN
Estainvestigacinestdirigidaaanalizarloscincograndesfactoresdelapersonalidad,
laresilienciayelbienestarsubjetivo(satisfaccinconlavidamsbalanceafectivo)en
dos grupos: uno formado por profesionales sanitarios y otro por trabajadores no
sanitarios. Los anlisis de regresin mostraron que el bienestar subjetivo estuvo
asociadoconunamayorresilienciayunmenorneuroticismoenelgrupodepersonal
sanitario. La extraversin y el tesn (relacionados positivamente) y el neuroticismo
(negativamente relacionado) fueron los predictores significativos del bienestar
subjetivo en el grupo de trabajadores no sanitarios. Finalmente, los anlisis revelaron
que la resiliencia medi las relaciones entre extraversin (mediacin total) y
neuroticismo (mediacin parcial) con bienestar subjetivo solamente en el personal
sanitario. La discusin de los resultados subraya la importancia de la resiliencia a la
hora de hacer frente a un entorno laboral adverso, el cual es ms caracterstico en
ambienteshospitalarios.

PALABRASCLAVE
Personalidad,Resiliencia,BienestarSubjetivo,Personalsanitario.

INTRODUCCIN
Lamayorpartedelos autorescoincidenenla consideracindetrescomponentesdel
Bienestar Subjetivo (BS): satisfaccin con la vida, afecto positivo y afecto negativo.
Diener,Suh,LucasySmith(1999)consideranqueelBSserefierealoquelaspersonas
piensanysientenacercadesusvidas,esdecir,alosaspectoscognitivosyafectivosque
alcanzancuandoevalansuexistencia.
La investigacin en este campo ha demostrado ampliamente que existen factores
psicolgicos que contribuyen aun mayor bienestarfsico y psicolgico.Entre ellos se
encuentranlasdimensionesdelapersonalidadylaresiliencia.

169

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Por lo que respecta a la personalidad, en los ltimos aos se ha alcanzado un


significativo consenso en torno al empleo del Modelo de los Cinco Factores como
marcodereferenciaparalainvestigacinsobrelasrelacionesentrepersonalidad,salud
ybienestar.Laevidenciaempricahalladaenestecampoconsistentementesealaala
extraversin y al tesn como las dimensiones relacionadas positivamente con el BS
percibidoporlaspersonas,mientrasqueelneuroticismolohacenegativamente.
Porotrolado,laresilienciaserefierealahabilidadocapacidadindividualdecrecera
pesardelaadversidadysobreponerseaella.Laliteraturacientficahaevidenciadoque
la resiliencia se relaciona positivamente con el afecto positivo y con el BS y
negativamente con el afecto negativo. Especficamente en el personal sanitario, el
estudio de la resiliencia tiene una enorme utilidad, ya que los sanitarios son testigos
directos del sufrimiento humano y hacen frente a un entorno laboral adverso y
estresante.
Losobjetivosprincipalesdelapresenteinvestigacinfueronlossiguientes:1)analizar
si existen diferencias en funcin de las variables psicolgicas evaluadas entre una
muestradepersonalsanitarioyotranosanitaria;2)determinarsiexistencaractersticas
delapersonalidad(loscincorasgosylaresiliencia)queprediganelBSpercibidoenlas
dosmuestras;y3)analizarelpapelmediacionaldelaresilienciaenlasrelacionesentre
loscincorasgosyelBSpercibidoenlasmismas.
MATERIALYMTODO
Participantes
Enesteestudioparticiparon109adultos(86mujeresy23hombres)deedadesentre18
y 59 aos (M = 36,24; DT = 8,7) de los cuales 59 eran profesionales sanitarios que
trabajaban en el Hospital Universitario de Fuenlabrada (Madrid) en las unidades de
cuidados intensivos y de cardiologa. Los 50 participantes restantes eran estudiantes
universitariosdelcentroasociadoJacintoVerdaguerdelaUNEDenMadridyque,a
suvez,trabajabanprincipalmentecomofuncionariosocomodocentes.
Instrumentos
*Satisfaction With Life Scale (SWLS) (versin espaola de Cabaero et al., 2004):
Consta de 5 tems (escala Likert de 7 puntos) en los que se pide al participante que
hagaunavaloracinglobaldesuvida.
*Positive and Negative Affect Schedule (PANAS) (versin espaola de Sandn y
Chorot,1995):Constade20tems(escalaLikertde5puntos),diezdeloscualesevalan
afecto positivo (AP) y diez afecto negativo (AN), en los que se describen diferentes
sentimientosyemocionesquedebensercalificadosporelparticipante.
EnesteestudiosetomcomondicedelBSlaconsideracinconjuntadelasatisfaccin
conlavidamselbalanceafectivo(APAN)(SheldonyElliot,1999).

170

TRABAJOS COMPLETOS

*Big Five Inventory (BFI) (BenetMartnez yJohn, 1998): Consta de 44 tems (escala
Likert de 5 puntos) en los que se valoran los rasgos de extraversin, neuroticismo,
afabilidad,tesnyaperturamental.
*EgoResiliencyScale(ER89)(versinespaoladePrezGarca,2008):Constade14
tems(escalaLikertde4puntos)quevaloranlacapacidaddelaspersonasdeadaptarse
alasdemandasdelentorno.
Procedimiento
Acadaparticipanteselesuministruncuadernillodondeseincluyeronlosanteriores
cuestionarios, el cual fue recogido pasadas tres semanas. Los participantes deban de
depositar el cuadernillo en una urna situada en la secretara del centro asociado
(personalnosanitario)oenelreadedescanso(personalsanitario).
RESULTADOS
Anlisis Preliminares. El ANOVA mostr que la ocupacin tena efectos principales
sobrelaaperturamental(F(2,108)=8,35;p<0,001),puntuandomsaltoelpersonalno
sanitario(M=38,94)queelsanitario(M=34,9).Dichoanlisistambinmostrqueel
gnero tena efectos principales sobre el neuroticismo (F(2,108) = 5,63; p < 0,001),
puntuandomsaltolasmujeres(M=21,13)queloshombres(M=16,96).
AnlisisdeRegresinMltiple.Seobtuvounmodelopredictivosignificativo(F(7,42)=
4,35; p < 0,001) que explicaba el 29% de la varianza del BS en el personal sanitario,
formadoporunaaltaresilienciaylabajapresenciadeneuroticismo.Enelpersonalno
sanitario se obtuvo un modelo predictivo significativo (F(7,42) = 8,69; p < 0,001) que
explicaba el 52% de la varianza del BS, formado por niveles altos de extraversin y
tesnybajosenneuroticismo.
AnlisisMediacional.SiguiendoelprocedimientopropuestoporBaronyKenny(1986),
el anlisis mediacional confirm (mediante el test de Sobel) que la relacin entre la
extraversin y el BS fue totalmente mediada por la resiliencia (Z = 2,10, p < 0,04).
Asimismo, se confirm que la contribucin de la resiliencia a la relacin entre el
neuroticismo y el BS podra ser, en cualquier caso, parcial, porque el neuroticismo
continu siendo significativo despus de la inclusin de la resiliencia en el modelo,
aunque la Z obtenida con el test deSobel no alcanz la significacin estadstica (Z=
1,82,p<0,07).LosdosanterioresmodelosmediacionalessemuestranenlaFigura1.

171

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

DISUSIN
Lasmenorespuntuacionesenaperturamentaldelossanitariosapuntanaquestosse
sienten an ms responsables por la labor que prestan, hacindoles mantener una
actitudmenosflexiblequeelpersonalnosanitario,ajustndosemsalasnormasque
son inherentes a su ejercicio profesional. En cuanto a las diferencias en funcin del
sexo, las mujeres presentaron un mayor nivel de neuroticismo que los hombres. Este
resultadoesconsistenteconelestereotiposexualexistente(Eysenck,EysenckyBarret,
1995).
El resultado ms relevante del estudio es la importancia que tiene la resiliencia en el
personalsanitario.Porunlado,losprofesionalesdelasaludquesesentanmsfelices
y mejor consigo mismos eran los ms resilientes y los que mejor ajuste emocional
mantenan.Sinembargo,enelpersonalnosanitariolaresilienciapierdesupapeltan
destacado y es ahora cuando las dimensiones ms estables de personalidad cobran
mayorimportanciaytienenmspesoalahoradepredecirelBSendichamuestra.As,
laextraversin,elneuroticismoyeltesnlopredicen.Estasmismasdimensionesson
las que ms consistentemente se relacionan con el BS segn la literatura existente
(Steel, Schmidt y Schultz, 2008). Por otro lado, solamente en el personal sanitario la
resilienciamedilasrelacionesentredosdimensionesdepersonalidad(extraversiny
neuroticismo) y el BS. La mediacin fue total en el caso de la relacin entre la
extraversinyelBS.Sinembargo,laresilienciamediparcialmentelasrelacionesentre
neuroticismoyBSendichamuestra,loquesugierequeexistenotrasvas,ademsdela
resiliencia,porlasqueelneuroticismopuedainfluirenelBSdelossanitarios.
La resiliencia, a tenor de estos resultados, se constituye como una caracterstica
fundamental del personal sanitario. Las implicaciones clnicas de este resultado son
diversas ya que se trata de una caracterstica que se puede entrenar. Por un lado, la
resiliencia se podra desarrollar en aquellos profesionales que muestren bajos niveles
delamismay,porotrolado,podraayudarlesaafrontarelestrsalqueseenfrentan
en su actividad sanitaria diaria. No slo les ayudara a amortiguar las consecuencias

172

TRABAJOS COMPLETOS

negativas del estrs laboral (Giordano, 1997), sino tambin a desarrollar unas
estrategiasdeafrontamientomseficacesyadaptativasalahoradehacerfrentealas
situacionesestresanteshabitualesenelentornohospitalario(McGee,2006).

REFERENCIAS
Baron, R. M. y Kenny, D. A. (1986). The moderatormediator variable distinction in social
psychological research: Conceptual, strategic, and statistical considerations. Journal of
PersonalityandSocialPsychology,51,11731182.
BenetMartnez,V.yJohn,O.P.(1998).LosCincoGrandesacrossculturesandethnicgroups:
Multitrait Multimethod analyses of the Big Five in Spanish and English. Journal of
PersonalityandSocialPsychology,75,729750.
Cabaero, M. J., Richart, M., Cabrero, J., Orts, M. I., Reig, A. y Tosal, B. (2004). Fiabilidad y
validezdelaEscaladeSatisfaccinconlaVidadeDienerenunamuestrademujeres
embarazadasypurperas.Psicothema,16,448455.
Diener,E.,Suh,E.M.,Lucas,R.E.ySmith,H.L.(1999).Subjectivewellbeing.Threedecadesof
progress.PsychologicalBulletin,125,276302.
Eysenck,H.J.,Eysenck,S.B.G.yBarrett,P.(1995).Personalitydifferencesaccordingtogender.
PsychologicalReports,76,711716.
Giordano, B. (1997). Resilience: a survival tool for the nineties. Association of Perioperative
RegisteredNursesJournal,65,10321036.
McGee,E.M.(2006).Thehealingcircle:Resiliencyinnurses.IssuesinMentalHealthNursing,
27,4357.
PrezGarca, A. M. (2008). Versin espaola de la EgoResilience Scale (ER89) de Block y
Kremen (1996). Documento del Departamento de Personalidad, Evaluacin y
TratamientoPsicolgico.Madrid:UNED.
Sandn,B.yChorot,P.(1995).Conceptoycategorizacindelostrastornosdeansiedad.EnA.
Belloch,B.SandnyF.Ramos(Eds.),Manualdepsicopatologa.VolumenII(pp.5380).
Madrid:McGrawHill.
Sheldon, K. M. y Elliot, A. J. (1999). Goal striving, needsatisfaction, and longitudinal well
being: The SelfConcordance Model. Journal of Personality and Social Psychology, 76,
482497.
Steel, P., Schmidt, J. y Schultz, J. (2008). Refining the relationship between personality and
subjectivewellbeing.PsychologicalBulletin,134,138161.

173

TRABAJOS COMPLETOS

POSITIVIDAD,BALANCEAFECTIVOYCONDUCTASDESALUDEN
ADOLESCENTES

M.DoloresLaraBeltrn;AnaMaraPrezGarca;JosBermdez
FacultaddePsicologa,UNED.

RESUMEN
La investigacin ha puesto de manifiesto la relacin entre un adecuado balance
afectivo (alto afecto positivo y bajo afecto negativo) y una mejor salud fsica y
psicolgica.Elpresenteestudioanaliz,enunamuestrade106adolescentes(54chicas
y52chicos;1217aos)lacontribucinalarelacinentrebalanceafectivoyconducta
saludabledelconstructodePositividad.Estacaractersticadediferenciacinindividual
se conceptualiza como la predisposicin de conducta relativamente estable y
generalizable que subyace a la autoestima, el optimismo y la satisfaccin vital,
explicando mayor porcentaje de varianza en conducta que el atribuido a estas
expectativas individual o conjuntamente consideradas. Los resultados mostraron que
larelacinentrebalanceafectivoyconductasaludableestabatotalmentemediadapor
la Positividad, de forma que una afectividad adecuada favoreca una mayor
Positividadque,alapostre,seasociabaconmayorfrecuenciadeconductassaludables
desarrolladasenlamuestradeedadanalizada.

PALABRASCLAVE
Positividad,balanceafectivo,conductasdesalud,adolescencia.

INTRODUCCIN
La adolescencia es una etapa de cambios y de cierta inestabilidad, asociada a la
bsqueda de la identidad y autonoma personal y en la que se aprecia una mayor
susceptibilidad a la influencia social. Durante esta etapa de la vida se inician
generalmente las conductas de riesgo para la salud, particularmente el consumo de

175

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

alcohol y de tabaco. Asimismo, se observan ciertos hbitos inadecuados relacionados


conlaalimentacin(consumoexcesivodegrasas,aperitivos,dulces,osal,unidoaun
bajoconsumodefrutasyverduras),laseguridad(noutilizarcinturndeseguridado
seguirlasnormasnecesariasenlasactividadesderiesgo),hacerpocoejerciciofsico,o
nodormirelnmerosuficientedehorasalda.
En este contexto, un volumen creciente de investigacin se est centrando en la
identificacin de los factores psicosociales que podran explicar el inicio y
mantenimiento del consumo de sustancias en la adolescencia o de las prcticas de
saludinadecuadas,conelpropsitodedisearestrategiasapropiadasparaprevenirsu
aparicin y desarrollo. Entre estos factores, se incluye la Positividad (Caprara, Steca,
Alesandri, Abela y McWhinnie, 2010) que supone lo que es comn a la Satisfaccin
Vital como componente cognitivo del constructo Bienestar Subjetivo, a la Autoestima
como sentimiento de aceptacin y aprecio hacia uno mismo, de competencia y vala
personal, y al Optimismo como tendencia a creer que uno experimentar buenos
resultadosenlavida.
Junto con este constructo, es importante la consideracin del Balance Afectivo,
propuesto como uno de los componentes (emocional), junto con la Satisfaccin Vital
del Bienestar Subjetivo. Se refiere a las respuestas emocionales de la persona cuando
hace juicios valorativos sobre su vida. Sera el resultado de la consideracin conjunta
de las emociones positivas y negativas experimentadas a lo largo de un perodo de
tiempo determinado, calculado como la diferencia entre el afecto positivo
(experimentar emociones agradables) y el afecto negativo (experimentar emociones
desagradables)(Sanjun,2011).Larelacinentrelamayorpresenciadeafectopositivo
ylasaludhasidopuestademanifiestoennumerosasinvestigaciones(verrevisinde
PressmanyCohen,2005).
El objetivo de este estudio fue analizar la contribucin de la Positividad a la relacin
entreBalanceAfectivoyConductaSaludable.Paraello,seestablecierondoshiptesis:
(1) la Positividad tendr un efecto mediador positivo en la relacin entre Balance
AfectivoyConductasdeSaludenlaetapadelaadolescenciay(2)elsexoinfluirenla
relacinentrePositividad,BalanceAfectivoyConductasdeSalud.

176

TRABAJOS COMPLETOS

MTODO
Participantes
Lamuestraestabaformadaporuntotalde106adolescentes(54chicasy52chicos)con
una edad media de 14,10 aos (Dt= 0,98). Los participantes eran estudiantes de los
cursosde2y3delaEnseanzaSecundariaObligatoria,ascomodelprimercursode
los Programas de Cualificacin Profesional Individual, de un Instituto de Enseanza
SecundariadelaprovinciadeHuelva.
Instrumentos
Se aplicaron tres instrumentos. (1) La Escala de Positividad (Caprara, 2011), formada
por 8 tems, que recogen aspectos asociados a autoestima, optimismo y satisfaccin
vital. (2) El PANASN, versin espaola para nios y adolescentes (Sandn, 2003) del
PositiveandNegativeAffectSchedule(PANAS;Watson,Clark,yTellegen,1988),que
comprendedosescalasde10temscadauna,dirigidasamedirelafectopositivoyel
afecto negativo. En la presente investigacin se tom el Balance Afectivo (afecto
positivoafectonegativo)comovariabledeestudio.Y(3)unRepertoriodeConductas
deSaludelaboradoparalapresenteinvestigacinapartir,entreotros,delostrabajos
deBermdez,LasayContreras(2002)yVickers,ConwayyHervig(1990),queincluye
14 conductas de salud, tanto positivas como negativas, y se codifica de forma que a
mayorpuntuacin,mejorsaludomejoreshbitos.
Procedimiento
Las pruebas se administraron durante las clases de tutora. Una vez dadas las
instrucciones, cada chico/a individualmente, cumpliment los tres instrumentos,
presentadosenunnicodocumento.
RESULTADOS
Los resultados mostraron, por una parte, una adecuada fiabilidad de las pruebas
(desde 0,57 hasta 0,80), y por otra, la presencia de correlaciones directas y
estadsticamente significativas entre Positividad, Balance Afectivo y Conductas de
Salud(verTabla1).Encuantoalsexo,seobtuvounamayorrelacindeloschicoscon
la prctica de conductas saludables, no habiendo diferencias entre chicos y chicas en
PositividadoenBalanceAfectivo.

177

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Variables

Positividad

Balance afectivo

Conductas de salud

Positividad

---

Balance afectivo

0,46***

---

Conductas de salud

0,25**

0,32***

---

Sexo

-0,15

-0,13

-0,24*

Media (Dt)

32,04 (4,71)

13,6 (9,88)

41,59 (4,89)

0,80

0,72

0,57

Nota: *p < 0,05; **p < 0,01; ***p < 0,001; Sexo: 0 = chicos, 1= chicas
Tabla 1. Correlaciones, datos descriptivos y fiabilidad ( de Cronbach) de las variables analizadas.

Finalmente,serealizunanlisisderegresinjerrquicasobrelasConductasdeSalud
incluyendoenelprimerpasoelsexo[F(1,104)=6,63,p<0,05;R2=0,06],enelsegundo
paso el Balance Afectivo [F (2,103) = 6,27, p<0,01; R2 = 0,11], y en el tercer paso la
Positividad [F (3,102) = 6,25, p<0,001; R2 = 0,16]. Si bien el Balance Afectivo era
significativo en el segundo paso, perda su significacin al incluir en el modelo la
Positividad,siendofinalmentelospredictoressignificativosdelasConductasdeSalud
el sexo ( = 0,20, p<0,05) y la Positividad ( = 0,24, p<0,05). Los datos muestran, por
tanto, que la relacin entre Balance Afectivo y Conductas de Salud, controlando el
efecto del sexo, estaba totalmente mediada por la Positividad (ver Figura 1), como
indicalasignificacinobtenidaeneltestdeSobel(Z=2,14,p<0,03).

0,30** [0,24*]

0,45***
0,22* [0,11]

Figura1.EfectomediadordelaPositividadenlasrelacionesencontradasentreBalanceAfectivo
yConductasdeSalud,controlandoelefectodelsexo.Notas:*p<0,05;**p<0,01;***p<0,001

178

TRABAJOS COMPLETOS

DISCUSIN
Los resultados muestran, tal y como planteaba la primera hiptesis, que la relacin
entre Balance Afectivo y Conductas de Salud estaba mediada por la Positividad, de
forma que una afectividad adecuada favorece una mayor Positividad (satisfaccin,
optimismo y autoestima) que, adems, se asocia con mayor frecuencia de conductas
saludables desarrolladas en la muestra de edad analizada. Este patrn de resultados
sugiere el valor protector sobre la salud de la dimensin de Positividad; resultado
consistente con la evidencia disponible sobre el efecto beneficioso para la salud
asociadoaloptimismo,lasatisfaccinconlavidaylaautoestima,elementosintegrados
enladimensindePositividad(Alessandri,CaprarayTisak,2012).Porotraparte,yde
acuerdo con la segunda hiptesis planteada, el sexo influy en la relacin entre
Positividad, Balance Afectivo y Conductas de Salud, ya que dicha relacin se
potenciaba en el caso de los chicos, que presentaban ms hbitos saludables que las
chicas.Posiblemente,partedeesteresultadoobedezcaalainclusindelejerciciofsico
entreloshbitossaludables,msfrecuenteenelcasodelosadolescentes.
La complejidad de esta relacin plantea la necesidad de llevar a cabo investigaciones
de carcter prospectivo para poder establecer relaciones de causalidad entre las
variables analizadas, as como contrastar los datos de autoinforme con observaciones
ms objetivas de las conductas de salud medidas y/o datos heteroinformados por
personas significativas (padres, profesores, compaeros). Estas consideraciones
permitirancontrastarlosresultadosobtenidosenlapresenteinvestigacin,conelfin
dedisearprogramasadecuadosdeintervencinparaprevenirlapuestaenmarchade
conductasyhbitospocossaludablesenestamuestradeedad.

REFERENCIAS
Alessandri,G.,Caprara,G.V.yTisak,J.(2012).Theuniquecontributionofpositiveorientation
tooptimalfunctioning.EuropeanPsychologist,17,4454.
Bermdez,J.,Lasa,A.yContreras,A.(2002).Personalidad,procesospsicolgicosintencinde
cambio de conducta: Implicaciones para el desarrollo de conducta saludable. Accin
Psicolgica,2,151164.

179

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Caprara,G.V.(2011).OrientacinPositivaysusimplicacionesparalasaludyelxitoacadmico
ylaboral.ConferenciaimpartidaenlaFacultaddePsicologadelaUNED,Madrid,22
deMayo.
Caprara, G.V., Steca, P., Alessandri, G., Abela, J.R.Z. y McWhinnie, C.M. (2010). Positive
Orientation: Explorations of what is common to Life Satisfaction, SelfEsteem, and
Optimism.EpidemiologyandPsychiatricSciences,19,6371.
Pressman,S.D.yCohen,S.(2005).Doespositiveaffectinfluencehealth?PsychologicalBulletin,
131,925971.
Sandn, B. (2003). Escalas PANAS de afecto positivo y negativo para nios y adolescentes
(PANASN).RevistadePsicopatologayPsicologaClnica,2,173182.
Sanjun, P. (2011). Affect balance as mediating variable between effective psychological
functioningandsatisfactionwithlife.JournalofHappinessStudies,12,373384.
Vickers, R.R., Conway, T.L. y Hervig, L.K. (1990). Demonstration of replicable dimensions of
healthbehaviors.PreventiveMedicine,19,377401.
Watson,D.,Clark,L.A.,yTellegen,A.(1988).Developmentandvalidationofbriefmeasuresof
positive and negative affect: The PANAS scales. Journal of Personality and Social
Psychology,54,10631070.

180

TRABAJOS COMPLETOS

ESELEMBARAZOUNADULCEESPERA?ESTUDIODESINTOMATOLOGA
ANSIOSA,DEPRESIVAYDERELACINDEPAREJADURANTELA
GESTACIN

BeatrizConsueloArnalRemn,CarmenMorenoRosseteIsabelRamrezUcls.
FacultaddePsicologa,UNED.

RESUMEN
El estudio analiza si existen diferencias en sintomatologa ansiosa y depresiva y de
relacindeparejaentrehombresymujeresensutercertrimestredeembarazo(grupo
de estudio) y hombres y mujeres con y sin hijos que no esperan un beb (grupos
control).Lamuestratotalesde156participantes.Laansiedad,depresinyrelacinde
parejafueronevaluadasconelSTAI,elBDIIylasubescaladerelacionesconlapareja
del EBP, respectivamente. Los resultados muestran ausencia de diferencias
significativasenansiedad/estadoparalosgruposyelsexo.Loshombresymujeresdel
gruponoembarazosinhijosobtienenpuntuacionesmsaltasenansiedad/rasgoqueel
restodelosgrupos.Elgrupodeestudiopresentamenorespuntuacionesenrelacinde
pareja y mayores niveles de depresin, siendo las mujeres embarazadas quienes
obtienenpuntuacionessignificativamentemsaltasqueloshombres.

PALABRASCLAVE
Embarazo,ansiedad,depresin,relacindepareja,bebs.

INTRODUCCIN
Cuandonosimaginamosalamujerembarazadanosvienealamentelaimagendeuna
mujerfelizycontentaconlaesperadesubeb,peroloscambiosqueseexperimentana
nivel fsico, psicolgico y social pueden hacer que algunas de ellas desarrollen
alteracionesemocionales.
Durantelaedadreproductivaladepresinpuedepresentarseconmayorfrecuenciaen
la mujer, posiblemente debido a las variaciones hormonales que estas presentan
llegandoalacspide durante elembarazo (Escobar, Pacora, Custodio yVillar, 2009).
Hoy en da sabemos que entre el 10 y el 15% de las mujeres embarazadas presenta
depresinclnica(Dornelas,Ferrand,Stepnowski,BarbagalloyMcCullough,2010).

181

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Aunquelostrastornosdeansiedadenelperodoperinatalhansidomenosestudiados,
tambin son comunes durante el embarazo, adems la depresin y la ansiedad
presentancomorbilidadesfrecuentes(GoodmanyTyerViola,2010)loquecontribuye
asuestudioconjunto.
Las relaciones de pareja tambin pueden verse alteradas, tanto sexual (Gkyildiz y
Beji, 2005) como emocionalmente lo que puede predecir sntomas de ansiedad y
depresin, que incrementaran hacia el tercer trimestre afectando no slo a la madre
sinotambinaldesarrollofsicoyemocionaldelbeb(Whisman,DavilayGoodman,
2011).
El objetivo del estudio es analizar la presencia de sintomatologa depresiva y ansiosa
enunamuestradehombresymujeresembarazadasensutercertrimestreyconocerel
gradodebienestarenlarelacindepareja,comparandolamuestradeestudiocondos
gruposcontrolesdeparejasconysinhijosquenoesperanningnbeb.
MTODO
Sujetos
Lamuestraestformadapor156participantes,76hombres(M=35.16;ST=4.493)y80
mujeres (M= 33.80; ST= 4.643). El grupo de estudio (grupo embarazo) lo forman 50
participantes en su tercer trimestre de embarazo Los grupos control los forman, 52
personasquetienenhijosperonoesperanningnbeb(gruponoembarazoconhijos)
y 54 personas sin hijos que tampoco esperan ningn beb (grupo no embarazo sin
hijos).Noexistendiferenciassignificativasentreambosgruposnienelniveleducativo,
2(4)=5.474;p=.242;nienlasituacinlaboral2(12)=16.134;p=.185;nienlaexistencia
deproblemasdefertilidad2(2)=4.140;p=.124.
Instrumentos
Cuestionario de Ansiedad Estado Rasgo (STAI; Spielberger, Gorsuch and Lushene,
2008).
InventariodeDepresindeBeck(BDI;BeckySteer,1991),versinrevisada,adaptada
ytraducidaalcastellanoporVzquezySanz(1991).
Subescala de relaciones con la pareja (EBP, Escala de Bienestar Psicolgico, Jos
SnchezCnovas,2007).
Procedimiento
Los participantes del grupo de estudio acudan a clases de preparacin al parto
impartidasenunCentrodeSaluddeZaragoza.Trasexplicarelobjetivodelestudiolos
interesados firmaban el consentimiento informado y pasaban a formar parte de la
muestra. Se les entreg un cuadernillo de evaluacin que contena una carta de
presentacin, preguntas correspondientes a los datos sociodemogrficos y mdicos y
losinstrumentosdeevaluacinpsicolgicaquerellenabanenpresenciadelapsicloga.

182

TRABAJOS COMPLETOS

RESULTADOS
De acuerdo con los objetivos del estudio se han realizado cuatro anlisis univariados
(ANOVAS)independientesparaundiseobifactorialentregrupos,considerandocomo
variables independientes las variables grupo y sexo y como dependientes los
distintos cuestionarios aplicados en el estudio. En cuanto a los resultados para la
variableansiedadestado,ningunodelosfactoresprincipalesresultsignificativo,nila
interaccin entre ambos. En la variable ansiedadrasgo encontramos un efecto
significativo del Grupo F(2, 150)=6,950; MCE=55,599; p=0,001; aunque el tamao del
efecto de esta variable result bajo 2p=0,085. Las comparaciones a posteriori de
Tukey mostraron que era el grupo de no embarazo sin hijos el que mayores
puntuacionesenansiedadrasgopresentabaconrespectoalosotrosdosgrupos,figura
1. En cuanto a la variable depresin ninguno de los factores principales result
significativo pero s la interaccin entre ambos, F(2,150)=3,070; MCE=27,248; p=0,049;
aunqueeltamaodelefectodeestavariableresultbajo2p=0,039.ConlapruebaT
para muestras independientes, obtuvimos diferencias significativas entre hombres y
mujeres en el grupo embarazo, t (48)=2,566, p=0,013 (p<0,05), siendo las mujeres las
quepresentanmayoresnivelesdedepresin.Losdosgruposrestantesnopresentaron
diferencias significativas entre hombres y mujeres, figura 1. Finalmente, para la
variablerelacionesdeparejasehallunefectosignificativodelavariableGrupoF(2,
148)=18,621;MCE=52,734;p=0,000;aunqueeltamaodelefectodeestavariableresult
bajo 2p=0,201. Las comparaciones a posteriori de Tukey mostraron diferencias
significativas entre el grupo embarazo y no embarazo con hijos siendo el grupo
embarazo el que menores puntuaciones obtiene. Entre los dos grupos control no se
obtuvierondiferenciassignificativas,figura1.

183

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

DISCUSIN
En nuestro estudio las mujeres embarazadas no presentan puntuaciones
estadsticamente superiores en ansiedadestado; quiz la ilusin de la llegada
inminentedelbebcontrarrestelosposiblesefectosdelaansiedadestadoademslos
recursos socioeconmicos medioaltos de los participantes pueden hacer disminuir
esta variable. El nivel superior de ansiedad rasgo encontrado en el grupo de no
embarazosinhijos,tambincontrastaconestudiosrealizadossobrepoblacionesfrtil
con hijos e infrtil en los que los niveles de ansiedad rasgo eran equiparables entre
ambas poblaciones (MorenoRosset y Martn, 2009). Respecto a la sintomatologa
depresiva, los resultados obtenidos concuerdan con estudios previos, alcanzando su
nivelmximoeneltercertrimestre(Escobarycols.2009).Encuantoalasrelacionesde
pareja,losresultadostambinconcuerdanconestudiosqueestablecenqueduranteel
embarazoalgunosaspectosdelarelacindeparejapuedeversealterados,comoesel
caso de la sexualidad y otros autores que indican que el comienzo de trastornos
emocionalespuedeafectaralarelacindepareja(Gkyildizycols.,2005).
Nuestro estudio resalta la importancia que desde la atencin primaria tiene la salud
mentaldelasembarazadasysusparejas.Proponemoslautilizacindemuestrasms

184

TRABAJOS COMPLETOS

amplias y estudios longitudinales trimestre a trimestre, as como la conveniencia de


aplicar pruebas de screening relacionadas con el ciclo reproductivo que midan
desajuste emocional, como posible prdromo de trastornos emocionales, y ms
informacinacercadelarepercusinqueelembarazotieneparaelhombre.

REFERENCIAS
Dornelas,E.A.,Ferrand,J.,Stepnowski,R.,Barbagallo,J.yMcCullough,L.(2010).APilotStudy
ofAffectFocusedPsychotherapyforAntepartumDepression.JournalofPsychotherapy
Integration,20(4),364382.
Escobar, J., Pacora, P., Custodio, N., y Villar, W. (2009). Depresin posparto: se encuentra
asociadaalaviolenciabasadaengnero?AnalesdelaFacultaddeMedicina,70(2),
115118.
Gkyildiz, S., y Beji, N. K. (2005). The Effects of Pregnancy on Sexual Life. Journal of Sex &
MaritalTherapy,31,201215.
Goodman, J. H. y TyerViola, L. (2010). Detection, Treatment, and Referral of Perinatal
Depressionand Anxiety by Obstetrical Providers. Journal of WomensHealth, 19 (3),
477489.
MorenoRosset,C.yMartn,M.D.(2009).Laansiedadenparejasfrtileseinfrtiles.Ansiedady
estrs,15(1),97109.
Whisman,M.A.,Davila,J.yGoodman,S.H.(2011).RelationshipAdjustment,Depression,and
Anxiety during Pregnancy and the Postpartum Period.Journal of Family Psychology,
25,(3),375383.

185

TRABAJOS COMPLETOS

ANLISISDELAEFICACIADEUNPROGRAMADEESTIMULACIN
COGNITIVAPARAANCIANOSCONDETERIOROCOGNITIVOLEVE

MaraTeresaRosique,TeresaSanzyFranciscoJavierMenndez.
FacultaddePsicologa.UNED;HospitalDoctorRodriguezLafora.

RESUMEN
SemuestranlosdatosobtenidosenunprogramadeEstimulacinCognitivaaplicadoa
lolargodedosmeses,tresvecesporsemanadurantenoventaminutos.Lamuestrase
compone de diez ancianos diagnosticados de demencia con deterioro cognitivo leve.
Mientras que en el grupo experimental se aplica la intervencin, el grupo control
permanece ocho meses sin formar parte del programa, si bien posteriormente se les
incluyeenunanuevaedicin.Seevalaalosdosgrupos(antesdelprograma,unavez
finalizadoytranscurridosseismeses)conelMEC(MiniExamenCognoscitivo,Loboet
al., 1999), que proporciona un cribado sobre el estado global de las funciones
superiores.Seobtienendiferenciasestadsticamentesignificativasentreambosgrupos
unavezaplicadoelprograma,dichasdiferenciassemantienenseismesesdespus.

PALABRASCLAVE
Estimulacincognitiva,programadepsicoestimulacin,demencia,deteriorocognitivo
leve.

INTRODUCCIN
Desde hace aos se viene comprobando un envejecimiento poblacional debido
fundamentalmente al aumento de la supervivencia generacional, hallndose un
considerableaumentoenlasltimasdcadasenlaproporcindepersonasmayoresde
64aos,pasandodel10%al17%(Prez,2010).
Lalongevidadsueleestarparejaaundeteriorogradualo,enocasiones,progresivode
las capacidades mentales bsicas (atencin, memoria, lenguaje). La disciplina
psicolgica conocida como Estimulacin Cognitiva aplicada a la tercera edad tiene
como objetivo optimizar y retener los recursos o funciones mentales a travs del
entrenamiento de las distintas capacidades y los componentes que la integran. Estos
programassuelenencuadrarsedentrodeabordajesmultidisciplinaresintegradorescon
elementoscomplementariosdeltipofarmacolgicouocupacional.

187

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

El objetivo del estudio es comprobar la eficacia de un programa de rehabilitacin


cognitiva para ancianos con deterioro cognitivo leve, centrndonos en el componente
dememoria,dadoqueeseldficitpredominanteenfasesiniciales.
MTODO
Participantes
Lamuestraestcompuestapordiezancianos,deedadescomprendidasentrelos70y
77 aos diagnosticados por su mdico de atencin primaria de CDR=1, es decir,
demencialeve,segnlaEscaladeClasificacindelaDemenciaClnicadeHughesetal.
(1982).Cincodeellossonincluidosaleatoriamenteenelgrupoquerecibeelprograma,
mientrasqueotroscinco,decaractersticassimilares,norecibenningntratamiento;si
bien, una vez finalizada la investigacin selleva a cabo conelloselmismoprograma
aplicadoalgrupoexperimental.
Instrumentos
El deterioro cognitivo se mide en ambos grupos (control y experimental) en tres
ocasiones antes, despus y seis meses despus de la intervencin con el test de
cribadoparalademenciaMiniExamenCognoscitivoMEC(Loboetal.,1999).
Tarea
Se trabajan nicamente los componentes de la memoria a travs distintas tareas y
lminas:memoriainmediatavisual,auditiva,visoespacialyasociativa(conejercicios
de evocacin de material simple, material complejo y material del entorno, de
repeticin y reconocimiento de sonidos y tareas de span, de evocacin de
localizacionesyderecorridosyconejerciciosdeparesdeestmulos),memoriaacorto
plazooreciente(conejerciciosdeevocacindemoradaconinterferencias),memoriade
trabajo(conejerciciosdeordenar,invertir,evocarpartesdeinformacinyconclculos
mentales), memoria episdica (con ejercicios de recuerdo de hechos recientes y de
recuerdos autobiogrficos), memoria a largo plazo semntica (con ejercicios de
evocacindeconceptosydeconocimientosdelmundoengeneral)ymemoriaalargo
plazo procedimental (con ejercicios de reconocer acciones de una actividad y de
reconocerantiguasdestrezas).
Procedimiento
Las sesiones se llevan a cabo por una psicloga en formato grupal con los cinco
ancianos.Seprograman24sesionesde90minutosdeduracindistribuidasalolargo
dedosmesesconunafrecuenciadetresvecesporsemana.
RESULTADOS
La puntuacin media en el MEC vara entre ambos grupos. Antes del programa la
puntuacinmediadetodoslossujetoseneltestesde22,encontrndoseunmximode
23 y un mnimo de 21, siendo a su vez las medias para los dos subgrupos de 22

188

TRABAJOS COMPLETOS

tambin, junto con los mismos valores mnimos y mximos. Las medias del grupo
control en las distintas fases son: 22 al inicio, 21,40 a los dos meses y 20,80 a los seis
meses.Laspuntuacionesmediasdelgrupoexperimentalson:22alinicio,23,20trasla
finalizacin del programa y 22,60 seis meses despus. Se puede observar que las
diferencias en la media del MEC entre ambos grupos son estadsticamente
significativas (p<.005), tanto cuando se evala tras la aplicacin del programa de
estimulacincognitiva,comoseismesesdespusdelaintervencin.Acontinuacinse
puedenobservarlosresultadosobtenidosenlasiguientetabla.

DISCUSIN
Los resultados obtenidos son relevantes a nivel clnico, dado que indican que la
posibilidaddeintervencinnodebeceirseexclusivamentealosestadiosmoderadoso
graves de la demencia,sino que intervenir en momentos precoces puede favorecer el
enlentecimientodeldeteriorodelashabilidadescognitivas.

REFERENCIAS
Camp, C.J., Bird, M.J. y Cherry, K.E. (2000). Retrieval strategies as a rehabilitation aid for
cognitivelossinpathologicalaging.EnR.D.BckmanyL.Stigsdotter(eds.).Cognitive
RehabilitationinOldAge.(224248).Oxford:HillOxfordUniversityPress.
DeRotrou,J.(1989).Stimulationetrducationdelamemoire.GazetteMd,96,4953.
Francs,I.,Barandiarn,M.,Marcelln,T.yMoreno,L.(2003).Estimulacinpsicocognoscitiva
enlasdemencias.AnalesdelSistemaSanitariodeNavarra,26(3),405422.
Martnez,J.M.,Blanco,F.J.,Martn,C.yAnsean,A.(1997).Rehabilitacinneuropsicolgicade
lospacientescondemencia.Informacionespsiquitricas,147,4148.
Prez,J.(2010).Elenvejecimientodelapoblacinespaola.InvestigacinyCiencia,410,3442.

189

TRABAJOS COMPLETOS

INTERVENCINESTRUCTURADAENELTRATAMIENTODELACOSO
LABORAL

MaraTeresaRosique,TeresaSanzyFranciscoJavierMenndez.
FacultaddePsicologa.UNED;HospitalDoctorRodriguezLafora.

RESUMEN
Se presentan los resultados de un tratamiento estructurado para vctimas de acoso
laboral. La muestra se compone de diez pacientes en situacin de baja laboral con
sntomasansiosodepresivos.ComomedidaprepostsecumplimentaelBDIdeBecky
el ASSQ de Kendall y Hollon, obtenindose puntuaciones indicativas de depresin
moderada/grave y de elevada ansiedad disfuncional. Se desarrolla un programa con
formato individual durante dos meses, una sesin de 60 minutos por semana. La
intervencinconstadeseismdulos:anlisisdelproblema,identificacinytrabajode
las distorsiones cognitivas, desactivacin y distanciamiento emocional, anlisis de las
estrategias empleadas, bsqueda de nuevas estrategias y recuperacin de imagen
previaalconflictoatravsdelaexternalizacindelproblema.Losresultadosmuestran
una mejora significativa en la sintomatologa ansiosodepresiva y una sensacin
subjetivademejora.Nuevedelosdiezpacientesseincorporanaltrabajoalfinalizarla
intervencin,elrestanteunmesdespus.
PALABRASCLAVE
Acosolaboral,mobbing,depresin,ansiedad,intervencinpsicolgica.
INTRODUCCIN
Durante los ltimos aos se ha incrementado el problema del acoso laboral,
constatndose en Europa entre los aos 19952005 un ligero aumento del nivel de
violencia (European Foundation for the Improvement of Living and Working
Conditions,2005)yunacrecienteimplicacindedistintasinstituciones.Sibiennohay
un consenso nico respecto al significado del trmino, la mayora de los autores
coinciden en que se debe hacer referencia a tres parmetros bsicos a la hora de
establecerunadefinicin.Enprimerlugar,setratadeuntrminogenricoqueincluye
diferentesconductasytiposdeviolencia,abuso,amenazayataquefsico.Ensegundo
lugar,noimplicanecesariamenteunaocurrenciaenellugardetrabajo,sinoquepuede
producirse en cualquier situacin relacionada con el mbito laboral, incluso en el
propio hogar del trabajador. Y, finalmente, se trata de conductas deliberadas y
mantenidas que desafan, humillan, degradan o hieren el bienestar, la vala, la

191

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

dignidad,laseguridad,elequilibrio,laresistenciay,endefinitiva,lasaludpsicolgica
yfsicadeltrabajador.
En el mbito sanitario hay una mayor demanda de ayuda profesional como
consecuencia del aumento de este fenmeno, suponiendo un peligroso riesgo para la
saludtantoindividualcomocolectiva.Enestetrabajosevanaexponerloscontenidosy
resultados de un tratamiento estructurado aplicado a pacientes vctimas de acoso
laboral.
MTODO
Participantes
La muestra est formada por diez pacientes ambulatorios de un Centro de Salud
MentaldelaComunidaddeMadridensituacindebajalaboralporsntomasansioso
depresivos reactivos a un problema de acoso laboral. Los diez sujetos son derivados
desde psiquiatra al psiclogo para valoracin de posible psicoterapia, dado que se
podranbeneficiardeella.
Instrumentos
Previamentealaintervencinserealizaunavaloracinconlassiguientespruebasde
evaluacin:InventariodeDepresindeBeckBDI(Beckycols.,1979)yCuestionario
de Autoverbalizaciones Ansiosas ASSQ (Kendall y Hollon, 1989). Una semana
despus de haber finalizado el programa se vuelven a cumplimentar las mismas
pruebasdetalformaquesedisponedemedidasprepost.
Tarea
Elprogramasebasaenunarecopilacindelosmdulosmsempleadosenelabordaje
del acoso laboral por destacados manuales. Para ello se disea una intervencin
estndarqueconstadelossiguientescontenidos:anlisisdelproblema(identificacin
delproblemaylafuentedeestrsatravsdeltriplesistemaderespuesta),trabajocon
las distorsiones cognitivas y falsas creencias (identificacin y cuestionamiento),
desactivacinydistanciamientoemocional(elaboracindelasreaccionesemocionales
negativasira,rabia, vergenza,culpabilidaddesencadenadasautomticamente para
su correcta canalizacin y control), anlisis de estrategias empleadas (bsqueda de
soluciones correctas y fallidas previas), bsqueda de nuevas estrategias (deteccin de
posibles herramientas eficaces), recuperacin de imagen previa al conflicto
externalizando el problema (visualizacin de situaciones de acoso con perspectiva de
observadorexternojuntoconrefuerzodeotrasidentidadeseintegracindelproblema
dentrodelaperspectivavital).
Procedimiento
El programa consta de seis mdulos y se lleva a cabo con formato de entrevista
individualporunpsiclogodelCentro.Laduracinesde2mesesensesinsemanal

192

TRABAJOS COMPLETOS

de 60 minutos. Una vez cumplimentados los cuestionarios tanto antes como despus
delaintervencinserealizaunanlisisestadsticomedianteelprogramaSPSSv.20.
RESULTADOS
Alcompararlosresultadosobtenidosantesydespusdelaaplicacindelprogramaa
travs de la prueba T de Student para muestras relacionadas se observa una mejora
estadsticamentesignificativaenlasintomatologaansiosaydepresivaatravsdelas
puntuacionesenelBDI(t9=6.230,p<0.05)yenelASSQ(t9=13.012,p<0.05).

Todos los pacientes muestran puntuaciones ms bajas en ambos instrumentos tras la


intervencin.

BDI_pre

BDI_post

ASSQ_pre

ASSQ_post

Sujeto 1

45

128

64

Sujeto 2

60

134

52

Sujeto 3

27

119

34

Sujeto 4

29

125

41

Sujeto 5

22

96

38

Sujeto 6

58

132

32

Sujeto 7

24

111

68

Sujeto 8

34

114

49

Sujeto 9

25

92

38

Sujeto 10

32

118

40

193

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Asimismo, indican una sensacin subjetiva de mejora. Nueve de diez pacientes se


incorporan al trabajo a partir de la segunda semana de tratamiento, el restante se
incorporaalpuestounmestraslafinalizacin.

DISCUSIN
Tras la aplicacin del programa se objetiva en los pacientes una mejora clnica
(constatada por los instrumentos de evaluacin y la propia percepcin) y funcional
(todos se reincorporaron). Dado que es un problema creciente con grandes
repercusionesanivelpersonal,socialylaboralseranecesariodisponerdeestrategias
detratamientoeficaces,fomentndoselacreacindeespaciosparaello.
En cuanto a las perspectivas futuras, sera interesante la posibilidad de intervencin
grupal, pues en caso de ser igual de efectiva, se mostrara ms eficiente. Convendra
analizarentrabajosposterioreslosdistintoselementosdelprogramaparadevercules
resultanmstiles.

REFERENCIAS
Fernndez, T. Peasco, P. y Losada, L. (2009). Actualizacin y aspectos prcticos sobre el
mobbing. Revista Formacin Mdica Continuada en Atencin Primaria, 16 (10), 605
611.
Fidalgo, M., Gallego, Y., Ferrer, R., Nogareda, C., Prez, G. y Garca, R. (2010). Acoso
psicolgico en el trabajo: definicin. En Notas Tcnicas de Prevencin 854. Madrid:
INSHT.
Lpez, M.A., Vzquez, P. (2003). Mobbing. Cmo prevenir, identificar y solucionar el acoso
psicolgicoeneltrabajo.Madrid:Eds.Pirmide.
Luciano,J.V.(2012).Laviolenciayelacosolaboral(mobing)enEuropa.EnRevistaFOCAD,17
(1),pp.314.
Piuel, I. (2001). Mobbling. Cmo sobrevivir al acoso psicolgico en el trabajo. Santander: Sal
Trrea.

194

TRABAJOS COMPLETOS

EXPLORACINDELAESTRUCTURACOGNITIVAENUNAMUESTRADE
PACIENTESCONESQUIZOFRENIACRNICAGRAVE.COMPARACINCON
UNAMUESTRANOCLNICA

MJosMartnVzquez1,2;LusngelSalGutirrez1
FacultaddePsicologa,UNED;2DepartamentodePsiquiatra.HospitalInfantaSofa(San

SebastindelosReyes).

RESUMEN
Segn La Teora de los Constructos Personales (TCP) el pensamiento esquizofrnico
estcaracterizadopor unasasociacioneslaxasy desorganizadas. El objetivoprincipal
deesteestudioesobservarlascaractersticasdelasrejillasenlaesquizofreniacrnica
graveycompararlasconungrupocontrol,ascomorelacionarlosndicesconvariables
clnicas.Seelicitanlosconstructosmedianteunarejillasemiestructurada.Incluimos60
sujetos,30encadagrupo.
Laestructurade la rejillamuestra intensidadtotal similar en ambosgrupos, y enlos
pacientesmayorpolaridadtotalyunprimerfactorqueexplicaunporcentajecercanoal
50%delavarianza,sealandohaciaunaestructuracognitivargidayunidimensional.
En la esquizofrenia la correlacin yo actualotros es prcticamente nula, siendo
superiorenyoactualyoidealyyoidealotros.Enloscontrolesestascorrelacionesson
positivasyentreelyoactualotrosessignificativamentemayorqueenlospacientes.

PALABRASCLAVE
Tcnica de rejilla, esquizofrenia, estructura cognitiva, constructos personales,
autoconcepto

INTRODUCCIN
EsteestudiosebasaenlateoradelosconstructospersonalesdeKelly,queentiendeal
hombrecomouncientficoinformal(Kelly,1966).Elpostuladofundamentalpropugna
quelosprocesospsquicosestndeterminadosporelmodoenqueunoanticipaloque
va a ocurrir en el futuro. Si la anticipacin se cumple, la prediccin se valida. En la
esquizofrenia aparece una construccin laxa, signo de trastorno del pensamiento.
Segn la teora de la mente estn alterados los corolarios de sociabilidad y
comunalidadoglobalidad(Kernycols,2009).Laestructuradepensamientoesrgida

195

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

y/ocaticaynohayconstructossupraordinariospermeables.Elautoconceptosurgede
laexperienciayelaprendizajeduranteeldesarrollo.Laconstruccindelyoapareceen
la comparacin con los otros y de la visin que le devuelven de uno mismo
(Nieznanski,2003).Lainvalidacinseriadasuponeunadisrupcindelsentidodelself
(Lysaker y Lyssaker, 2002). En la esquizofrenia, el sentimiento de unicidad, la
integridad interna y la continuidad a lo largo de la vida se ven afectados, el
autoconceptoesdeficitario,conconstructosincongruentesycontradictorios.Losotros
aparecen menos diferenciados. El aislamiento social tambin supone restriccin de
roles(Bannister,1965).
LaTcnicaderejillatienecomoinstrumentolarejilla:unamatrizdedobleentradaen
laquedistintoselementossonclasificadosenfuncindeconstructospersonales,para
captarunrepertoriodestosqueseempleanparaestructurarycomprenderelmundo
(teorasimplcitasdelarealidad)(FeixasyCornejo,1996).Segnestatcnicapodemos
encontrar constructos dilemticos, en los que el yo ideal est en el punto medio y
Dilemasimplicativos(DI):estructuracognitivaorganizadadetalmodoqueelcambio
enunconstructodiscrepanteproducira uncambioenun constructocongruente,que
supondra una alteracin en el sentido de la realidad por el hecho de estar ambos
constructosrelacionados.ElporcentajedeDIessuperiorenpoblacinclnica.(Feixas,
SalyvilaEspada,2009;Sal,2006).LaAutoestimasemidesegnlasimilitudenla
construccin del yo actual y el yo ideal. Otros ndices de medida en la tcnica de la
rejilla son el Porcentaje de dilemas implicativos (PID). Porcentaje de la varianza
explicada por el primer factor (PVEPF), Intensidad, Polarizacin, Correlacin yo
actual/yoidealyCorrelacinyoactual/otros;yoideal/otros.
En la esquizofrenia se observa un trastorno del pensamiento por experiencias de
invalidacin seriadas (Spealman y cols., 1971; Waugh, 1980). El pensamiento es ms
complejo cuando es menor el PVEPF y la mayor polarizacin se corresponde con
mayorrigidezcognitiva(BannisteryFransella,1966;Poole,1979).
MTODO
Setratadeunestudioexpostfactoprospectivodecomparacindegrupos,(clnicoy
control). Con el grupo clnico se realiza un estudio ex post facto de grupo nico. La
muestraestconstituidapordosgrupos,de30participantes,21hombresy9mujeres
encadauno,elgrupoclnicofuerecogidoentrepacientesconesquizofreniaingresados
enlargaestancia(43,98,19aos)yelcontrolseextrajodelabasededatosdelProyecto
Multicntrico Dilema, un estudio previo con voluntarios, estudiantes de psicologa
de la UNED (edad media: 43,677,52 aos). En el grupo clnico se recogen datos
sociodemogrficos y se utilizan las escalas Positive and Negative Syndrome Scale for
Schizophrenia(PANSS)yBriefPsychiatricRatingScale(BPRS),variablessobreelcurso

196

TRABAJOS COMPLETOS

de la enfermedad y el tratamiento y variables epidemiolgicas y personales. En la


muestraclnicaseadministraunarejillasemiestructuradacon11elementosfijosyenla
muestra no clnica una rejilla abierta (con slo dos elementos previos: yo actual y yo
ideal). En ambas se estudian los ndices de rejilla y la correlacin entre los diferentes
elementos.
RESULTADOS
Enelgrupoclnicofrentealcontrol:

Menoselementosymenosconstructos
MayorPVEPFymayorpolarizacin
MenosconstructosdiscrepantesenlosDIymenorintensidaddestos

197

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Dentrodelgrupoclnico:
MayorpolarizacinamayortiempodeingresoymayorpuntuacinenBPRS.
Mayordosisdeneurolpticos:mayorcorrelacinyoactual/otroseintensidadDI
Sinuncahabantrabajado:menorcorrelacinyoideal/padreymenorPVPF
Si vivan con su familia de origen antes del ingreso: menor correlacin persona non
grata/madreyyoideal/padre
Relacinpositivaentrendeelementosycorrelacinyoideal/padre
Relacinnegativaentredosisbenzodiacepinasyyoideal/otrosyyoideal/padre
Relacinpositivaentreyoideal/otrosyyoideal/padre.

C o rre lac ione s en tr e ndic e s gen er ale s d e la re jilla


1.
2.
3.
4.
5.

Tie m p o d e in g re so
P o la riz a ci n t o ta l
In t e ns id a d to t a l
P V E PF
n d ice d e co n f lict o

1
1
,4 4 *
-, 1 7
-, 1 9
-, 0 6

1
,1 2
,1 5
-,2 6

1
, 92 * *
-, 4 0*

1
-, 4 2*

* . La co rr el ac i n es si g n ifi ca tiv a al n i v el 0 ,0 5 ( b ila ter a l).


* * . L a c o rr el ac i n es si g n ifi ca tiv a al n i ve l 0 ,0 1 ( b ila ter al ).

DISCUSIN
Enlaesquizofrenia laconstruccin del mundo interpersonal es ms extrema, aparece
unavisinmsrestringidayconmenorfinurapsicolgicadelmundodelosotrosen
las personas con esquizofrenia que en el grupo control. Se observa en un ndice de
polarizacintotalmayorenelgrupoclnicoqueenelgrupocontrol.
Lospacientesquesiguentratamientocondosismsaltasdeneurolpticostienenuna
visindesmismomscercanaalavisinquetienendelosotros,loqueproporciona
mayorsensacindecomunalidadquelosque tienentratamientocondosisinferiores.
Tambintienenunavisinmspositivadelafiguramaterna.
CuandoexistealgnDI,laintensidaddesteessuperiorenlospacientesquesiguen
tratamientocondosismayores.Lospacientescondosisaltasdebenzodiacepinastienen
una visin ms negativa de los otros y de la figura paterna, perciben el mundo de
formamstemerosa,loquejustificaestetratamientoansiolticorecibido.
Lavisin msextremadelmundointerpersonal se relaciona con la gravedad general
de la enfermedad y con el tiempo de ingreso, existe una mayor polarizacin por una
visinmsrestringidadelasrelacionesinterpersonales.
En los pacientes con esquizofrenia aparece una visin de los otros como poco
diferenciados,condificultadesparalaindividuacinyladiferenciacinconlosdems.
Tienen menor sentimiento de comunalidad que los controles, manteniendo una
autoestima similar, aunque percibiendo a los dems como menos adecuados que los
controles. Cuando existe una construccin de la figura paterna ms positiva, el

198

TRABAJOS COMPLETOS

paciente con esquizofrenia es capaz de elicitar ms elementos, tienen ms figuras


significativasenlaconstruccindelasrelacionesinterpersonales.
ElporcentajedeDIessimilarenelgrupoclnicoyelgrupocontrol,perolaintensidad
destosesmayorenelgrupoclnicoyserelacionaconmenordiferenciacincognitiva.
Los intereses de los pacientes con dilemas implicativos estn ms centrados en stos
queenloscontroles.
Lospacientesquehantrabajadoantesdelingresotienenunavisinmspositivadela
figura paterna, pero tienen una visin ms restringida del mundo interpersonal. La
adecuacindelyoactualylosotrosdependedelaconvivenciapreviaalingresoydel
estado civil, siendo la visin ms positiva la que tienen los solteros que siguen
viviendoconsufamiliadeorigen.

REFERENCIAS

Bannister, D. (1965). The genesis of schizophrenic thought disorder: Retest of the serial
invalidationhypothesis.BritishJournalofPsychiatry,111(474),377382.
Bannister, D. y Fransella, F. (1966). A grid test of schizophrenic thought disorder. The British
JournalofSocialandClinicalPsychology,5(2),95102.
Feixas,G.,Cornejo,J.M.ManualdelatcnicaderejillamedianteelprogramaRECORDv.2.0
Ed.PaidsIbrica,1edicin,Barcelona,1996
Feixas,G.ySal,L.A.(2004).Themulticenterdilemmaproject:Aninvestigationontheroleof
cognitiveconflictsinhealth.TheSpanishJournalofPsychology,7(1),6978.
Feixas, G., Sal, L. A. y vilaEspada, A. (2009). Viewing cognitive conflicts as dilemmas:
Implicationsformentalhealth.JournalofConstructivistPsychology,22(2),141169.
Kelly, G.A. (1966). Teora de la personalidad. Biblioteca el tema del hombre, Editorial
Troquel,BuenosAires.
Kern,R.S.,Green,M.F.,Fiske,A.P.,Kee,K.S.,Lee,J.,Sergi,M.J.,....(2009).Theoryofmind
deficits for processing counterfactual information in persons with chronic
schizophrenia.PsychologicalMedicine,39(4),645654.
Lysaker, P.H. y Lysaker, J.T. (2002). Narrative structure in Psychosis Schizophrenia and
disruptionsinthedialogicalself.TheoryandPsychology,1,135
Nieznaski, M. (2003). The yo and schizophrenia: A cognitive approach. Swiss Journal of
Psychology/Schweizerische Zeitschrift Fr Psychologie/Revue Suisse De Psychologie,
62(1),4551.
Poole, A. D. (1979). The grid test of schizophrenic thought disorder and psychiatric
symptomatology.TheBritishJournalofMedicalPsychology,52(2),183186.
Sal,L.A.(2006).Elpapeldelosconflictoscognitivosenlasaludmental:Implicacionesparael
cambioteraputico.Salamanca:EdicionesUniversidaddeSalamanca.
Spelman, M. S., Harrison, A. W. y Mellsop, G. W. (1971). Grid test for schizophrenic thought
disorderinacuteandchronicschizophrenia.PsychologicalMedicine,1(3),234238.
Waugh, M. H. (1980). Predictive accuracy and clinical utility of the grid test of schizophrenic
thoughtdisorder.TheBritishJournalofPsychiatry:TheJournalofMentalScience,137,
300300.

199

TRABAJOS COMPLETOS

LASDIMENSIONESDELOSESTILOSEDUCATIVOSCOMOFACTORESDE
PROTECCINDELCOMPORTAMIENTOAGRESIVOENTRELAINFANCIAY
LAADOLESCENCIA

AnaTeresaGarcaMoral*,InmaculadaSnchezQueija**eIsabelGmezVeiga*
FacultaddePsicologa,UNED*,UniversidaddeSevilla**

RESUMEN
Enestetrabajoseanalizanlasrelacionesexistentesentredeterminadasdimensionesde
los estilos educativos paterno y materno con la manifestacin de conductas agresivas
durantelapreadolescenciayadolescenciainicial.Hanparticipado271alumnos/ascon
edades entre los 10 y 14 aos procedentes de distintos centros educativos de Jan
cumplimentando el cuestionario de agresin de Buss y Perry (1992) y la escala de
estilos educativos de Oliva, Parra, SnchezQueija y LpezGavio (2007). Los
resultados obtenidos muestran que el control conductual paterno y materno es la
dimensin de los estilos educativos que ms correlaciona con las medidas de
agresividad si bien tambin el afecto y la revelacin tanto paternos como maternos
correlacionanconvariasmedidasdeagresividad.Losdatossediscutenanalizandola
importanciadelcontextofamiliarcomofactordeproteccindelasconductasagresivas
yladiferenteinfluenciapaternaymaternaenlaconductaagresivadesudescendencia.

PALABRASCLAVE
Estiloeducativo,factordeproteccin,controlconductual,agresividad,adolescencia.

INTRODUCCIN
Laagresividadenadolescenteshasidoobjetodeestudioenmltiplesinvestigaciones,
unadelasvariablesquehademostradoejercerinfluenciaeselestiloeducativodelos
padres definido por Glasgow, Dornbusch, Troyer, Steinberg y Ritter (1997) como un
compendio de actitudes, comportamientos y expresiones de carcter no verbal que
caracterizanlanaturalezadelasrelacionesestablecidasentrelospadresymadresysus
hijos/asendistintoscontextos.Enestesentido,Prevatt(2003)afirmaquelasprcticas
positivas fomentan el correcto desarrollo de los hijos y las negativas favorecen la
aparicin de conductas agresivas, y esta afirmacin ha recibido un notable apoyo
emprico; no obstante, la variable control ha demostrado ser la ms controvertida,

201

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

apuntandolosltimosresultadoshacialaimportanciadefavorecerlaautorrevelacin
comolanicaformapositivadeejercercontrol(Kerr,StattinyBurk,2010).
Los objetivos son describir las variables estudiadas en funcin del sexo, edad,
titularidad y hbitat de los participantes y determinar qu dimensiones del estilo
educativo son un factor de proteccin de agresividad, siendo nuestras hiptesis de
partidaquealtaspuntuacionesendimensionesnegativaspredecirnenmayormedida
la agresividad y que puntuaciones elevadas en las positivas sern un factor de
proteccin.
MTODO
Participantes
La muestra participante est compuesta por 271 estudiantes (146 chicos y 125 chicas,
edad media de 12.11 aos y desviacin tpica de 1.36 de distintos centros educativos
pblicosyconcertadosdencleosurbanosyruralesdelaprovinciadeJan.
Instrumentos
Los cuestionarios utilizados para esta investigacin han sido el cuestionario de
agresindeBussyPerry(1992queconstadelassiguientessubescalas:agresinfsica,
agresin verbal, hostilidad e ira. Asimismo se ha aplicado la escala de estilos
educativosdeOlivaetal.(2007)compuestadeseissubescalas:afecto,promocindela
autonoma,controlconductual,controlpsicolgico,revelacinysentidodelhumor.
Procedimiento
La secuencia de pasos de la investigacin es la siguiente: seleccin de los centros
educativos,entrevistaconelorientadory/odirectordelcentro,presentacinalConsejo
Escolar y aprobacin en su caso, aplicacin de los cuestionarios en una nica sesin
garantizando el anonimato de los participantes y deteccin de cuestionarios
defectuosos.
RESULTADOS
El anlisis de las diferencias muestra que las chicas puntan ms alto en afecto del
padre (t (269) = 3.33; p< 0.05; d= 0.39) y la madre (t (269) = 2.20;p< 0.05; d = 0.27),
control conductual del padre (t (269) = 2.56;p< 0.05; d= 0.30) y la madre (t (269) =
2.59;p< 0.05; d = 0.31), y revelacin con el padre (t (269) = 2.63;p< 0.05; d = 0.41) y la
madre(t(269)=2.98;p<0.05;d=0.30),mientrasqueloschicossuperanalaschicasen
agresin fsica (t (247) = 6.23;p< 0.05; d= 0.75), agresin verbal (t (259) = 2.40;p< 0.05;
d=0.56) y en agresividad total (t (226) = 3.64;p< 0.05; d=0.51). Respecto a la edad, el
grupodelaadolescenciainicialpuntamsaltoenpromocindeautonomaporparte
del padre (t (269)= 2.89;p< 0.05; d=0.33) y la madre (t (269) = 2.31;p< 0.05; d=0.31) y
revelacin con la madre (t (269) = 3.42; p < 0.05; d=0.46), sin embargo, los
preadolescentestienenpuntuacionesmayoresencontrolconductualdelpadre(t(269)

202

TRABAJOS COMPLETOS

=2.04;p<0.05;d=0.22),controlpsicolgicodelpadre(t(269)=3.60;p<0.05;d=0.46)yla
madre (t (269) = 6.32;p< 0.05; d=0.72). El grupo de menor edad, tambin tiene
puntuacionesmayoresenira(t(262)=2.16;p<0.05;d=0.2)yhostilidad(t(248)=2.68;p<
0.05;d=0.46).Respectoalatitularidaddelcentro,elalumnadodecentrosconcertados
puntamsaltoenpromocindelaautonomaporpartedelpadre(t(269)=2.99;p<
0.05;d=0.27)yenira(t(262)=1.96;p<0.05;d=0.21).Finalmente,encuantoalhbitat,
los participantes de localidades rurales puntan ms alto en control psicolgico del
padre(t(269)=5.30;p<0.05; d=0.67) y de la madre (t (269) =6.59;p<0.05;d=0.89) as
como en hostilidad (t (248) =2.79;p< 0.05; d=0.33), mientras que los chicos de
poblacionesurbanaspuntanmsaltoencontrolconductualpaterno(t(269)=2.45;p<
0.05;d=0.22),promocindelaautonomaporpartedelamadre(t(269)=2.70;p<0.05;
d=0.27) y agresin fsica (t (247) = 2.08;p< 0.05; d=0.28). Por otra parte, el anlisis de
correlaciones entre las dimensiones del estilo educativo paterno y materno con las
variables de agresividad evidencia el control conductual como variable central para
promoverlabajaagresividad,yaquecorrelacionacontodoslostiposdeagresividad,
tanto si tomamos como referencia al padre como a la madre. Debemos destacar
tambin que, exceptuando la promocin de la autonoma, todas las dimensiones del
cuestionario de estilo educativo estn relacionadas con la agresividad fsica,
disminuyendo la misma a medida que aumentan los valores de las diferentes
dimensiones,incluyendoelcontrolpsicolgico,comopuedeobservarseenlatabla1

203

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Alanalizarlaecuacinderegresinrealizadaencontramosquelasvariablesquemejor
predicen la agresividad total son el sexo, el control conductual paterno, la revelacin
maternaylapromocindelaautonomadeambos.Lasorpresadelosdatossaltacon
la variable promocin de la autonoma, que no correlacionaba con la agresin total,
peroquealcontrolarelrestodevariablesmuestraquelamaternareducelosnivelesde
agresividadmientrasquelapaternaaumentalaspuntuacionesenagresividad.
DISCUSIN
Respecto al primer objetivo, los resultados replican una parte de los resultados
obtenidosporOlivaetal.(2007)queencuentranunavaloracindelaschicasrespectoa
lasdimensionesdelestiloeducativomaternosignificativamentemsaltaqueladelos
chicos.Estasdiferenciashablandecomportamientosparentalesycontextosfamiliares
diferentesparachicasychicos.Encuantoalasdiferenciasenagresividadencontramos
que, en la lnea de los informes del Defensor del Pueblo (2007), los chicos tienden a
mostrar un mayor ndice de agresividad pudiendo explicarse por estereotipos de
gnerooporfactoresbiolgicos.Enrelacinalasdiferenciasencontradasenfuncin
delaedad,sonesperablesyaquelospadrestiendenasuavizarelcontroldesushijosy
fomentarsuautonomaamedidaquesonmayores.
Respectoalsegundoobjetivo,losdatosapoyanparcialmentelahiptesisdepartidaya
quesibienelafecto,elcontrolconductual,elhumorylarevelacinsehanrelacionado
de forma negativa con la agresividad, la dimensin control psicolgico ha mostrado
una relacin inversa a la esperada. Es un dato que no se ajusta a las conclusiones de
otros investigadores (Kerr et al., 2010) y que puede llevarnos a pensar que chicos y
chicas no sufren los efectos de dicho control psicolgico o que han desarrollado
estrategiasparaqueeseintentodemanipulacinporpartedesuspadresnoafecteasu
comportamiento.
Sinembargo,eldatomsllamativoenestainvestigacineseldiferenterolqueejercela
promocindelaautonomaenfuncindesiesejercidaporelpadreoporlamadre.De
esta forma, cuando el padre estimula la autonoma parece promover el
comportamiento agresivo, mientras que si es la madre quien favorece los
comportamientos autnomos estimula la baja agresividad. Esta relacin se da en los
preadolescentesperonoenlosadolescentesjvenes,undatodedifcilexplicacinque
requiere un anlisis ms pormenorizado aunque resultados similares se recogen en
SnchezQueija(2007).

REFERENCIAS
Buss,A.H.,&Perry,M.(1992).TheAggressionQuestionnaire.JournalofPersonalityandSocial
Psychology,63,452459.

204

TRABAJOS COMPLETOS

Defensor del PuebloUNICEF (2007). Violencia escolar: el maltrato entre iguales en la E.S.O.
19992006.Madrid:OficinadelDefensordelPueblo.
Glasgow,K.L.,Dornbusch,S.M.,Troyer,L.,Steinberg,L.yRitter,P.L.(1997).Parentingstyles,
adolescents attributions, and educational outcomes in nine heterogeneous high
schools.ChildDevelopment,68,507529.
Kerr, M., Stattin, H. y Burk, W.J. (2010). A Reinterpretation of Parental Monitoring in
LongitudinalPerspective.JournalofResearchonAdolescence,20,3964.
Oliva,A.,Parra,A.,SnchezQueija,I.yLpezGavio,F.(2007).Estiloseducativosmaternoy
paterno:Evaluacinyrelacinconelajusteadolescente.AnalesdePsicologa,23,4956.
Prevatt, F. (2003). The contribution of parenting practices in a risk and resiliency model of
childrensadjustment.BritishJournalofDevelopmentalPsychology,21,469480.
SnchezQueija, I. (2007). Anlisis longitudinal de las relaciones con los iguales durante la
adolescencia. Antecedentes familiares e influencia sobre el ajuste. Universidad de
Sevilla.Tesisdoctoralsinpublicar.

205

TRABAJOS COMPLETOS

ESTIMULACINDEHABILIDADESPRAGMATICASENAULASDE
EDUCACININFATIL

CristinaJunquera
FacultaddePsicologa.UNED

RESUMEN:
En este trabajo se expone la intervencin llevada a cabo en un centro de Educacin
Infantilduranteelcurso201112.Elobjetivodeltrabajoeraelaborareimplementarun
programadeestimulacindelashabilidadespragmticasparasujetosde35aos.
Paraeldiseodelprogramaserecogiinformacindeobservacindirecta,anlisisde
programas existentes y revisin bibliogrfica. Se seleccionaron contenidos de
intervencinrelativos a lashabilidades conversacionales, organizacin de discursos y
comprensin/expresindediversostiposdeactosdehabla.
El programa se desarroll durante 7 semanas en las aulas de un centro educativo. Se
recogieronmedidasdelacompetenciapragmticasantesydespusdelaintervencin
de 13 participantes en el programa. Para ello se recurri al uso de pruebas
estandarizadasquesecomplementaronconotrasmedidasdelenguajesugerido.
Losresultadosmuestranunamejoraenlacompetenciapragmtica,ascomoenotros
componentesdellenguaje.

PALABRASCLAVE:
Pragmtica,lenguaje,estimulacin,educacininfantil.

INTRODUCCIN
Los primeros aos de vida constituyen una etapa muy importante debido a la gran
cantidaddehabilidadesquesedesarrollan(controlmotor,habilidadeslingsticas...).
Por ello, en las ltimas dcadas, se han multiplicado los programas de atencin
temprana(de0a6aos)dirigidosalaprevencin.Elobjetivodeestosprogramases
favorecerelcorrectodesarrollodehabilidadesenelperiodonormativo.
Ellenguajeesunadelashabilidadesquesedesarrolladuranteestosprimerosaos,y
portantoesuncontenidofrecuenteenlosprogramasdeatencintemprana.Losnios
dedican los seis primeros aos de su vida a procesar, organizar y estructurar estas
reglas. En condiciones normales, esta tarea resulta exitosa. Sin embargo, es una tarea

207

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

muy exigente que puede dar lugar a dificultades en el desarrollo y adquisicin del
lenguaje
Para prevenir la aparicin de problemas del lenguaje existen muchos programas de
estimulacin en el mercado. La mayora de estos programas se fundamentan en la
concepcingenerativistadellenguaje(Chomsky,1957)quehasidolateoradominante
hastalosaosochenta.
Estacorrientesigueteniendoungranpesoenlaactualidad,peroenlosaosochentase
produjo una ruptura en esta hegemona terica(Austin, 1962),dandolugar al inters
por el estudio de otros componentes del lenguaje. Entre estos componentes se
encuentralapragmtica,entendidacomolasreglasquerigenelusodeloshablantesde
una lengua. Gracias a estas aportaciones (Austin, 1962; Searle, 1976), comienza el
intersporelestudiodelapragmticadesdelapsicologa.
En la actualidad existen numerosos datos sobre el desarrollo normativo de este
componente. De esta forma, se sabe que desde las primeras expresiones vocales, los
bebsmanifiestanintencionescomunicativas.Eldesarrollodelcomponentepragmtico
comienzaaedadestempranas.Losbebsutilizanactosintencionalespreverbalespara
comunicar necesidades (Bates, 1979; Halliday, 1975). Hacia los dos aos los bebs
comienzan a utilizar marcadores especficos de funciones (Ninio, 1990), utilizan
diferentestiposdeactosdehabla,participanenformatosdeinteraccin(Bruner,1976)
yexpresanemociones(Hobson,2002).
Posteriormente,seadquierenhabilidadesconversacionescomolavelocidad,elinicioy
el mantenimiento del turno, la seleccin y el mantenimiento del tpico, y el uso de
estrategiasde reparacin. Tambin se inicia la adquisicin de habilidades discursivas
(Bruner,1996).Portanto,entrelos3ylos5aos,losniosestnadquiriendounaserie
de habilidades pragmticas complejas como la elaboracin de discurso, la
automatizacin de las mximas conversaciones y la comprensin de significados
indirectos.
A pesar de que existen numerosos estudios descriptivos sobre el desarrollo de
habilidades pragmticas, no existen datos sobre la intervencin y la promocin del
desarrollodeestashabilidadesenpoblacinnormal.
El objetivo de este trabajo es implementar un programa de estimulacin de las
habilidadespragmticasenaulasdeeducacininfantilycomprobarlaeficaciadeesta
actuacinenlamejoradelacompetenciapragmticadelossujetosparticipantes.
MTODO
Muestra

208

TRABAJOS COMPLETOS

La muestra de la investigacin estuvo compuesta por 14 (12 nios y 2 nias) de un


centropblicodeeducacininfantildenivelsocioeconmicomedioalto.Lamediade
edaddelamuestraes3,875aos.
Instrumentos
Para evaluar las habilidades lingsticas de los participantes antes y despus de la
intervencin,seutilizlapruebaestandarizadaPLONR(Aguinaga,Armentia,Fraile,
OlanguayUriz,2004).
DescripcindelprogramadeIntervencin
Se implement un programa de estimulacin de las habilidades pragmticas que se
dise especficamente para esta experiencia. En el programa se trabajan las
habilidades pragmticas que estn en desarrollo durante esta etapa, con el fin de
asegurarlacorrectaadquisicindelasmismas.Enconcreto,elusoycomprensinde
los actos de habla expresivos y directivos, el uso de las reglas que rigen las
conversacionesylaestructuracindepequeosdiscursos.
Lametodologadetrabajosefundamentenelaprendizajepormodelosylaimitacin
enformatosdeinteraccin.Losobjetivossesecuenciaronpordificultadysetrabajaron
atravsdediferentesactividadesfavoreciendolageneralizacindelosaprendizajesa
otroscontextos
Procedimiento
Antes de iniciar el programa de intervencin, un evaluador administr de manera
individualelPLONRalosparticipantes.
Posteriormenteseimplementelprogramadeestimulacindurantesietesemanas.La
frecuenciafuededossesionessemanalesde30minutoscadauna.
RESULTADOS
Paracomprobarelefectodelaintervencin,seoptporelanlisisdelasdiferenciasen
lapruebaPLONRantesydespusdeltratamiento.
Dado el bajo nmero de sujetos, y la falta de normalidad y linealidad de las
distribuciones de datos, se opt por una prueba Wilcoxon para el anlisis de las
diferencias entre dos muestras relacionadas. En la tabla 1 se muestra los resultados
obtenidosenlapruebaWilcoxonparalaspuntuacionestotalesdelPLONR.

Estadstico (Z)
N (14)

-2,852

Sig asindtica (bilateral)

,004*

Tabla 1: Resultados de la prueba Wilcoxon para los resultados totales del PLON-R

Losresultados,muestranlaexistenciadediferenciassignificativasenlaejecucindela
pruebaantesydespusdelaintervencinparalamuestracompleta(Z=2.852;p=.004).

209

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Tambin se analizaron los resultados obtenidos en las diferentes subtests de: forma,
contenidoyuso.Elanlisisdeestosresultadosserecogeenlastabla2.

Sub-test forma
Estadstico(Z)
N (14)

-1,218

Sub-test contenido
Sig
,223

Estadstico (Z)
-2,157

Sub-test uso
Sig
,031*

Estadstico (Z)
-2,653

Sig
,008*

Tabla 2: Resultados de la prueba Wilcoxon para el sub-test forma del PLON-R

En el subtest forma no existen diferencias significativas (Z=1,218; p=.223) entre las


medidaspreviasyposterioresalaintervencin.Enelcasodelcontenidolosresultados
recogidosenlatabla2muestranlaexistenciadediferenciassignificativasenlamuestra
total(Z=2.157;p=.031).Porltimo,enelanlisisdelosresultadosdelsubtestdeuso,
existendiferenciassignificativasenlamuestratotal(Z=2.653;p=.008.
Por lo tanto, en la prueba PLONR se observan diferencias significativas en los sub
testsdecontenido,elusoyenlaspuntuacionestotales,peronoenlaspuntuacionesdel
subtestdeforma.
DISCUSIN
Los resultados obtenidos en esta investigacin avalan la posibilidad de intervencin
directa sobre aspectos de tipo pragmtico, as como los beneficios que este tipo de
intervencintienesobrelosparticipantes.
Tras siete semanas de intervencin estructurada y directa, los sujetos mostraron
mejoras en la ejecucin de actividades en las que se demandaba el uso de las
habilidadesentrenadas.
Adems, los resultados del PLONR muestran que la mejora de la competencia
lingstica tras la intervencin no se limita al componente pragmtico sino que tuvo
repercusionespositivasenaspectosdetiposemntico(subtestdecontenido).Estose
debeaque,duranteelprogramadeintervencinsetrabajconvocabularioadaptadoa
laedaddelamuestra,asusinteresesyalaprogramacindeeducacininfantil.Porlo
tanto,ademsdemejorarenlascompetenciasentrenadas(habilidadespragmticas),se
adquirieroncontenidos(competenciasemntica).
Con estos resultados, se puede afirmar que la intervencin formal en el rea
pragmtica,tienerepercusionespositivasenaspectosrelacionadosconelcontenido.
Estedatocontradicelatendencianaturalatrabajardemaneraestructuradaaspectosde
forma y contenido, suponiendo que la competencia pragmtica se beneficia de estas
intervenciones. Por lo tanto, se puede plantear la estimulacin del lenguaje de forma

210

TRABAJOS COMPLETOS

que a travs del entrenamiento en el uso del lenguaje se promocione el desarrollo de


otroscomponenteslingsticos.
Apesardelosresultadosencontrados,esnecesariodestacarunaseriededificultades.
Enprimerlugar,noexistendemasiadasherramientasparaevaluarestacompetenciaen
sujetosdeeducacininfantilporloqueseutilizunapruebascreeningqueofreceuna
informacinmuylimitada.
Otroaspectoquemerecelapenadestacardeestainvestigacinesquealossujetosse
les administr el instrumento de evaluacin dos veces en 7 semanas. Por tanto, la
mejoraenlaspuntuacionespuededeberseaprocesodeaprendizajedelapruebayno
demejoradelacompetencialingstica.
Encualquiercaso,losresultadosmuestranqueesposibleyeficazintervenirdemanera
reglada sobre el componente pragmtico del lenguaje. Estos resultados suponen un
apoyoalarupturaconlahegemonadelascorrientesformalistas.Esnecesarioseguir
trabajando para perfeccionar los objetivos de intervencin para cada edad, los
contenidosatrabajar,ascomolametodologapropuesta.Adems,convieneincidiren
la necesidad de generar materiales que permitan la evaluacin exhaustiva del
componentepragmticoensujetosmenoresde5aos.

REFERENCIAS
Aguinaga, G., Armentia, M. L., Fraile, A., Olangua, P. y Uriz, N (2004). Prueba del Lenguaje
OraldeNavarraRevisada(PLONR).Madrid:TEA.
Austin,J.L.(1962).HowtoDoThingsWithWords.Oxford:OxfordUniversityPress.
Bates, E., L. Benigni, I. Bretherton, L. Camaioni, y V. Volterra. (1979). The emergence of
symbols:Cognitionandcommunicationininfancy.NuevaYork:AcademicPress.
Brunner,J.ySherwood,V.(1976).Earlyrulestructure:Thecaseifpeekaboo.EnJ.Brunner,A.
Jolly y K. Sylva (Eds.), Play: its role in evolution and development. Londre: Penguin
Books.
Bruner,J.(1983).ChildsTalk:LearningtoUseLanguage.NuevaYork:Norton.
Chomsky,N.(1957).SyntacticStructures.TheHague:Mouton
Halliday,M.(1975).Learninghowtomean.Londres:EdwardArnold
Hobson,P.(2002).TheCradleofThought.Londres:PanMacmillan.
Ninio, A. (1990). FCA First Communicative Acts Coding System. Manual distribuido por el
departamentodepsicologa,HebrewUniversity,Jerusalem,Israel.
Searle,J.(1976).AClassificationofIllocutionaryActs.LanguageinSociety,Vol.5,pp.12

211

TRABAJOS COMPLETOS

TEORADELAMENTEYDESARROLLOEMOCIONALENNIOSCON
DISCAPACIDADAUDITIVA

RenataSarmentoHenrique1,2,MartaGimnezDas2yPastoraMartnezCastilla1
FacultaddePsicologaUNED;2.UniversidaddeValencia

RESUMEN
El presente trabajo trata de revisar las investigaciones recientes en el campo del
desarrollo de la teora de la mente y su relacin con el desarrollo emocional en los
nios con discapacidad auditiva. Se comprueba el retraso que sufren los nios con
discapacidad auditiva en cuanto al desarrollo de la teora de la mente y se discute la
hiptesismsaceptadaactualmenteparaexplicardichadificultad.

PALABRASCLAVE
Teora de la mente, habilidades mentalistas, discapacidad auditiva, desarrollo
emocional

INTRODUCCIN
Lafaltadeaudicintieneconsecuenciaspermanenteseneldesarrollodellenguajeoral
y, adems, por su papel fundamental en procesos cognitivos ms complejos, puede
alterar el desarrollo intelectual, emocional y social del nio (Alzina de Aguilar,
DomnechMartnez,lvarezZallo,2011).Algunosestudiosepidemiolgicosmuestran
que los nios con hipoacusia severa y profunda tienen de 1,5 a 3 veces ms
probalidadesdepresentartrastornospsiquitricosgraves(Carvill,2001).
Unodeloscomponentesdelacognicinquesepuedeveralteradoeseldesarrollode
la Teora de la Mente (TM). Se entiende por TM la capacidad para atribuir creencias,
deseos,intencionesyemocionesasmismoyalosotrosconelobjetivodepredeciry
comprenderelcomportamiento(Astington,2000).LaTMseposiciona,pues,comouna
habilidadindispensablealahoradeadquirirunajustadodesarrollosocial.Estoesas
porque la ausencia de una capacidad adecuada para atribuir intenciones y deseos
dificultarelestablecimientoderelacionesconlosigualesylosadultosenlosdistintos
entornos sociales en los que el nio se desarrolla. Adems, puede dificultar la
resolucin de conflictos sociales y el establecimiento de intercambios comunicativos
que requieren la adaptacin al interlocutor y/o la interpretacin de un sentido no
literal.DeahquesehayavinculadolaTMambitosesencialesdeldesarrollocomola

213

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

comunicacin,ellenguaje,lainteraccinylarepresentacinmental(SiegalyPeterson,
2008).
DESARROLLOEMOCIONALYTEORIADELAMENTE
PetersonySiegal(1995)analizaronlaejecucinentareasdecreenciafalsadesignantes
tardosdeentre8y13aos.Tansoloel37%resolvaconxitolastareasdecreencia
falsaquelosniosoyentessuelenresolveralrededordelos4aosymedio.Apartirde
este y otros estudios posteriores (Peterson, 2004; Peterson y Siegal, 2000; Schick, de
Villiers,deVilliersyHoffmeister,2007)concluiramosquelosniossignantestardos
consistentementemuestranretrasosprolongadosyposiblementedesarrolloincompleto
delacomprensindelaTM.
Desdelaperspectivadelahiptesisconversacionalseexplicaelretrasoeneldesarrollo
de la TM por parte de los nios con DA en funcin de la escasa interaccin
conversacional que mantienen con sus padres a una edad temprana. Aunque los
padresoyenteshaganesfuerzosporaprenderlalenguadesignos,nuncalleganaserlo
suficientemente competentes como para establecer una conversacin fluida sobre
estados mentales cuando sus hijos con DA son an pequeos. Esta falta de input
conversacional sobre estados mentales ajenos y propios pone a los nios con DA en
unasituacindeclaradesventajaconrespectoasusigualessignantesnativosyoyentes
(Peterson, 2004). En estrecha relacin con las habilidades mentalistas tiene lugar el
desarrollodelacomprensinemocional.Aseldesarrolloemocional,ensusentidoms
amplio,implica,almenos,algunoselementosesencialesdeTM.Nohaydudadequela
TM y la comprensin emocional son aspectos entrelazados en su desarrollo. En este
sentido, algunas de las conclusiones a las que llegan los trabajos que analizan la
adquisicindelaTMenniosconDAsepodranhacerextensivasaldesarrollodela
comprensin emocional. Los elementos relativos a la comunicacin que parecen
subyacer a las competencias mentalistas de estos nios, nos sirven tambin para
predecir y comprender su pauta de desarrollo emocional. En este sentido, pues,
podemos asumir las conclusiones de los estudios sobre TM y resumirlas en dos
afirmaciones. Por un lado, las oportunidades de interaccin, que son el pilar
fundamental del desarrollo sociocognitivo, pueden ser menores en nios con DA
signantes tardos (Schick et al., 2007). Por otro lado, los posibles problemas de
comunicacin y/o lenguaje de los nios con DA signantes tardos afectan tanto al
desarrollodelaTMcomoaldesarrolloemocional(Gayetal.,2007).
Como acabamos de ver, algunos estudios ponen de manifiesto que mientras que los
niossignantestardospresentanretrasoenTM,losniosconDAsignantesnativos
muestran la misma pauta de desarrollo que sus iguales oyentes (Peterson y Siegal,
1995; Peterson, 2004; Peterson,2009; Woolfe, Want y Siegal., 2002).Estoindica que el

214

TRABAJOS COMPLETOS

acceso temprano al lenguaje en situaciones en las que el lenguaje es un medio y una


parteintegraldelacomunicacin,tieneunefectodeterminanteeneldesarrollodelas
habilidadesmentalistas(Meristo,HjelmquistyMorgan,2012).
En una investigacin reciente, Peterson (2009) plantea que las oportunidades
tempranasdelossignantesnativosparacompartirconversacionessobrepensamientos
y sentimientos en casa y en la escuela son cruciales para la comprensin de creencia
falsa,ascomoparaeldesarrolloemocional.Peterson(2009)afirmaademsquetener
la capacidad de comunicarse a travs de la lengua de signos y tener padres con DA
influenciadeformapositivalaadquisicindelaTM.
A pesar de la coherencia que parece tener esta propuesta, es necesario sealar un
importantsimomatizrelacionadoconeltipodeescuelaalquedebenacudirlosnios
con DA, ya que los signantes nativos que frecuentan escuelas exclusivamente orales
muestranundesarrollodelaTMtanretrasadocomoeldelosniossignantestardos
que frecuentan escuelas bilinges (Meristo et al., 2007). As, el hecho de ser signante
nativonoparecesersuficienteparagarantizarundesarrolloptimodelaTM.Adems,
esnecesarioqueelentornoescolarseafavorecedordelautilizacindesignosparala
comunicacin. Asimismo, otro elemento que parece tener relacin con la adquisicin
de la TM es el vnculo emocional. Se ha comprobado que la cercana del vnculo
emocional entre signantes nativos y sus hermanos (con DA u oyentes) predice la
comprensin en TM por encima de la edad y de las habilidades de comunicacin
referencial.Estosugierequelasrelacionespositivasentrehermanospuedenfacilitarel
acceso al complejo mundo de los estados mentales propios y ajenos, tal como han
puestodemanifiestoPerner,RuffmanyLeekam(1994).
Endefinitiva,losestudiosrevisadosnosindicanqueeldesarrollodelaTMserelaciona
con mltiples variables. En primer lugar, es necesario acceder al lenguaje de forma
temprana(enelcasodelaspersonasconDA,enlamodalidaddelalenguadesignos).
Adems,esnecesariodisponerdecontextoseducativosquepermitanlautilizacinde
signosdeformapermanentey,porltimo,esimportanteestablecerrelacionesafectivas
concuidadoresyhermanosquepermitancompartiryexperimentarestadosmentales.
Enconclusin,lainvestigacinactualsugierequeelfactorquemejorexplicaelretraso
enTMdelosniossignantestardoseslaexperienciamuyreducidadeconversacin
tempranaysupapelcomovehculoparalaestructuracindelamente.

REFERENCIAS
Alzina de Aguilar, V., Domnech Martnez, E., y lvarez Zallo, N. (2011). Prevencin de la
hipoacusia. Factores de riesgo. En G. Trinidad, y C. Judenas (Eds.), Sordera Infantil.
Del diagnstico precoz a la inclusin educativa. Gua prctica para el abordaje

215

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

interdisciplinar (pp. 2749). Madrid: Confederacin Espaola de Familias de Personas


SordasFIAPAS.
Astington,J.W.(2000).Languageandmetalanguageinchildrensunderstandingofmind.EnJ.
W.Astington(Ed.),Mindsinthemaking:EssaysinhonorofDavidR.Olson(pp.267
284).Oxford:Blackwell.
Carvill, S. (2001). Sensory impairments, intellectual disability and psychiatry. Journal of
IntellectualDisabilityResearch,45,467483.doi:10.1046/j.13652788.2001.00366.x
Gray, C., Hosie, J., Russell, P., Scott, C., y Hunter, N. (2007). Attribution of emotions to story
characters by severely and profoundly deaf children. Journal of Developmental and
PhysicalDisabilities,19(2),145159.doi:10.1007/s1088200690291
Meristo,M.,Falkman,K.,Hjelmquist,E.,Tedoldi,M.,Surian,L.,ySiegal,M.(2007)Language
access and theory of mind reasoning: evidence from deaf children in bilingual and
oralist environments. Developmental Psychology, 43(5), 11561169. doi: 10.1037/0012
1649.43.5.1156
Meristo,M.,Hjelmquist,E.yMorgan,G.(2012)HowAccesstolanguageaffectstheoryofmind
in deaf children. En Siegal, M. y Surian, L. (Eds.) Access to language and cognitive
development(pp.4461).Oxford:OxfordUniversityPress.
Perner,J.,Ruffman,T.,yLeekam,S.R.(1994).Theoryofmindiscontagious:Youcatchitfrom
yoursibs.ChildDevelopment,65,12281238.doi:10.2307/1131316
Peterson, C. C. (2004). Theoryofmind in oral deaf children with cochlear implants or
conventional hearing aids. Journal of Child Psychology and Psychiatry, 45(6), 1096
1106.doi:10.1111/j.14697610.2004.t01100302.x
Peterson, C. C. (2009) Development of socialcognitive and communication skills in children
born deaf. Scandinavian Journal of Psychology, 50, 475483. doi: 10.1111/j.1467
9450.2009.00750.x
Peterson, C. C., y Siegal, M. (2000). Insights into theory of mind from deafness and autism.
Mind&Language,15(1),123145.
Schick,B.,deVilliers,P.,deVilliers,J.,yHoffmeister,R.(2007).Languageandtheoryofmind:
Astudyofdeafchildren.ChildDevelopment,78,376396.
Siegal, M., y Peterson, C. C. (2008). Language and theory of mind in atypically developing
children: Evidence from studies of deafness, blindness, and autism. En C. Sharp, P.
Fonagy,yI.Goodyer(Eds.),SocialCognitionanddevelopmentalpsychopathology(pp.
81105).NuevaYork:OxfordUniversityPress.
Woolfe,T.,Want,S.C.,ySiegal,M.(2002).Signpoststodevelopment:theoryofmindindeaf
children.ChildDevelopment,73(3),768778.doi:10.1111/14678624.00437.

216

TRABAJOS COMPLETOS

MEDIDADELDESARROLLOLEXICOYGRAMATICALTEMPRANOENNIOS
HABLANTESDEESPAOL:UNESTUDIODEVALIDEZSOBRELOS
INVENTARIOSMACARTHUR

CarolinaCorreaReizbalySoniaMariscalAltares
FacultaddePsicologa,UNED.

RESUMEN
Este estudio analiza la validez concurrente de la adaptacin espaola del Inventario
MacArthur II a partir de una muestra de 26 nios participantes. Se analizaron las
relaciones entre las puntuaciones obtenidas en el Inventario II, los datos procedentes
de una muestra de lenguaje espontneo y una escala estandarizada de comprensin
verbal. As, las medidas de gramtica y vocabulario del Inventario II se compararon
con dos medidas conductuales de vocabulario expresivo (nmero de palabras
diferentesdeunamuestradelenguajeyelnmerodeobjetosnombradosenunatarea
deelicitacinlxica),unamedidadevocabulariocomprensivo(EscalaReynell)yuna
medida de conocimiento gramatical (longitud media de las emisiones producidas
espontneamente).Losresultadosmuestranunconsiderablegradodeasociacintanto
enlasmedidasdevocabulariocomoenlasgramaticales.Estosuponeunaaportacin
msparaconsiderarlainformacindelosinventariosparentalescomomedidafiabley
vlidadeldesarrollolingsticotempranoenniosdeentre24y30mesesdeedad.

PALABRASCLAVE
Informes Parentales, adaptacin espaola, desarrollo lingstico, vocabulario,
gramtica.

INTRODUCCIN
En un gran nmero de investigaciones queda patente la importancia de estudiar el
desarrollolxicoenedadestempranas(GallegoyLpezOrnat,2005).Diversosautores
sealanquelosavancesenelcomponentegramaticalsucedenunavezelvocabulario
haalcanzadociertamagnitud(lahiptesisdelamasacrtica,MarchmanyBates,
1994). Al mismo tiempo, debemos sealar los resultados obtenidos con las
adaptaciones de los Inventarios de Desarrollo Comunicativo MacArthurBates
realizadas en nuestro pas. Basndonos en la revisin llevada a cabo por Law y Roy
(2008) sobre los informes parentales, podemos sealar tres grandes mtodos para

217

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

evaluareldesarrollodellenguaje:laspruebasestandarizadas,losanlisisdemuestras
delenguajeespontneoylosinformesparentales.Enelestudioactualutilizamoslas3
medidas combinadas: una prueba estandarizada (Escala Reynell de comprensin del
lenguaje), muestras de lenguaje espontneo (grabacin en video de situaciones de
juego) e informes parentales (Inventario Mac Arthur II). La adaptacin al espaol
(europeo) de los inventarios MacArthur (Lpez Ornat, Gallego, Gallo, Karousou,
MariscalyMartnez,2005)sehadesarrolladoapartirdelaversinoriginal(Fensonet
al., 1993). La validez concurrente de los inventarios en la adaptacin espaola se ha
determinadoevaluandolarelacinentrelaspuntuacionesobtenidasenelInventarioII
y una serie de medidas conductuales de los nios (Mariscal, Nieva, y Lpez Ornat,
2010).Hastaelmomentosloseharealizadounestudiodevalidezsobrelosapartados
gramaticales del Inventario II (versin espaola) pero no sobre los relativos al
vocabulario.Enrelacinalaevaluacindelacomprensinlingstica,losInventarios
MacArthur no incluyen ningn apartado al respecto. Esta ausencia est justificada
debido a la falta de validez de los informes parentales en este subdominio y en este
rangodeedad.Enestecontextocobrasentidoplantearlainclusindeunamedidade
vocabulario receptivo obtenida mediante la utilizacin de la Escala Reynell para
analizar la correlacin existente entre las medidas de vocabulario expresivo del
InventarioMacArthurylaspuntuacionesobtenidasenvocabulariocomprensivoenla
Escala Reynell. El objetivo principal del estudio actual es analizar la validez de las
medidas de vocabulario y gramtica procedentes del Inventario de Desarrollo
ComunicativoMacArthurenespaol(InventarioII)enniosqueseencuentranenel
intervalocomprendidoentrelos24y30mesesdeedad.
MTODO
Participantes
En el estudio han participado 26 nios/as monolinges de espaol de 24 a 30 meses
(media= 26.4 meses; dt= 2.04). Todos ellos eran nacidos a trmino y presentaban un
desarrollonormal.
Procedimiento
BasndonosenlainvestigacinllevadaacaboporThal,D.,JacksonMaldonado,D.y
Acosta,D.(2000)elprocedimientoincluye:
Tareadeelicitacinlxica:Sepresentaronalniounaseriede10objetosysepedasu
denominacin... Estos objetos aparecen en la lista de vocabulario del Inventario de
DesarrolloComunicativoMacArthur.
Muestra de lenguaje espontneo: Se decidi registrar una muestra de lenguaje
espontneomediantelafilmacindecadanio.Laduracindecadaunadeellasfue

218

TRABAJOS COMPLETOS

de35minutosyseorganizaronen3partesindependientes,talycomolohicieronThat
etal.(2000).
SistemadeTranscripcineInstrumentosutilizados
El habla espontnea de los nios fue transcrita utilizando el sistema internacional
Childes(McWhinney,2000).Seregistrmediantetranscripcinortogrficasiguiendo
el formato CHAT (Codes for the Human Analysis Transcripts). El anlisis de las
producciones transcritas se llev a cabo con el programa CLAN (Computerized
LanguageAnalysis.LosInventariosdeDesarrolloComunicativoMacArthurII,sehan
utilizado para medir: el vocabulario expresivo, la longitud media de los tres
enunciados ms largos (LME3) y la complejidad gramatical. Como medida
estandarizadaparaevaluarlacomprensinverbal,sehautilizadolaformaAdelas
EscalasReynelldeDesarrollodelLenguaje(Reynell,1980;ReynellyHuntley,1987).
RESULTADOS
La tabla 1 muestra los resultados del anlisis de correlacin entre las medidas de los
inventariosylasmedidasconductualesprocedentestantodelaobservacin,comode
la prueba estandarizada de comprensin verbal. As, observamos en las medidas de
vocabulariounaaltacorrelacin(0.705;p=0.01)entrelaspuntuacionesobtenidasenla
EscalaReynellyelnmerototaldepalabras(Totaldice)delInventarioII.
Podemosobservarquelascorrelacionesentrelasmedidasgramaticaleshanresultado
moderadas altas. As se obtuvieron correlaciones de 0.617 a 0.624 (p=0.01) entre la
longitud media del enunciado (LME_clan) de las medidas observacionales y las 2
medidas gramaticales de los inventarios: Longitud de los tres enunciados ms largos
(LME3)ylaComplejidadmorfosintctica(COMP_MORF)respectivamente.

M.conductuales

Inventario MacArthur
TOTAL_DICE

LME3

COMP_MORF

OBJ_NOMB

0.675**

0.399*

0.545**

DTP_clan

0.557**

0.384

0.345

LME-clan

0.556**

0.617**

0.624**

COMP_Reynell

0.705**

0.606**

0.616**

** La correlacin es significativa
al nivel 0.01

*La correlacin es significativa al nivel 0.05

Tabla1. Correlaciones entre las medidas de los inventarios y las medidas conductuales

La correlacin entre la medida de vocabulario nmero total de palabras del


Inventario II y la medida conductual de gramtica (LME_clan) ha sido moderada
(0.556;p=0.01).Porotrolado,sehanmostradocorrelacionessignificativasdebajasa

219

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

moderadas (de 0.399 a 0.545; p=0.01) entre las puntuaciones gramaticales del
InventarioII(LME3yCOMPMORF)ylamedidaconductualdevocabulariototalde
objetos nombrados. Hay que destacar las correlaciones, bajas y no significativas,
entre las citadas medidas gramaticales y la medida conductual de vocabulario
nmerodepalabrasdiferentes(DTP_clan)(de0.345a0.384;p=0.01).
DISCUSIN
Los resultados obtenidos mediante la correlacin entre las puntuaciones en los
inventarios y las medidas conductuales aportan informacin que apoya la validez
concurrentedelasmedidastantodevocabulariocomodegramtica.Estosresultados
estn en consonancia con los encontrados en estudios anteriores, tanto en lengua
inglesa (Dale, 1991; Feldman et al., .2005), como en espaolmejicano (Thal, Jackson
Maldonado y Acosta), en gallego (Prez Pereira y Resches, 2008). y en espaol,
Mariscaletal.(2010).Enloquerespectaalascorrelacionesentrelasdistintasmedidas
de vocabulario y entre las distintas medidas gramaticales respectivamente, los
resultadosseencuentranenlalneadelosobtenidosporThaletal.(2000).Encuanto
alascorrelacionesexistentesentrevocabularioygramticaesespecialmentellamativo
el hecho de que las correlaciones entre una de las medidas conductuales de
vocabulario(DTPclan)ylasmedidasgramaticalesdelInventarioMacArthur(LME3y
COMP_MORF) sean no significativas. Esto resulta contradictorio con el patrn
observado para el resto de medidas de nuestro estudio, as como en los resultados
halladosenlasinvestigacionesquemuestranlaconexinentrelxicoygramtica.Una
posible explicacin podemos encontrarla en la propia medida de diversidad lxica
(DTPclan) y en las limitaciones del propio contexto utilizado para la obtencin del
lenguaje. Otro factor que podra explicar esta discrepancia en los resultados, es el
intervalo de edad de la muestra. En el caso de Thal et al. (2000) la muestra estaba
formadapordosgruposindependientesdenios(20y28mesesrespectivamente).En
nuestro caso se seleccion un solo grupo con edades que abarcaban entre los 24 y 30
meses.EncuantoalascorrelacionesnosignificativasrespectoalaLME3delInventario
podrandeberseaquesteeselnicoapartadoqueplanteaalospadresunatareade
recuerdo,ynodereconocimiento.Adems,sloselespideanotarlas3emisionesms
largasquerecuerdenloquepuedeconstituirunamuestrabastantesesgadaenrelacin
a la produccin lingstica espontnea de sus hijos. Los resultados obtenidos en este
estudio redundan una vez ms en la idea de que los informes parentales conforman
un instrumento vlido en la evaluacin del desarrollo lingstico temprano tanto en
vocabulariocomoengramtica.

220

TRABAJOS COMPLETOS

REFERENCIAS
Gallego,C.yLpezOrnat,S.(2005).Eldesarrollodelvocabulariotemprano.Suevaluacincon
elILC.EnMayorCinca,M.A.,ZubiauzdePedro,B,yDezVilloria,E.Estudiossobre
laadquisicindellenguaje.UniversidaddeSalamanca:AquilafuenteEds.
Law, J. y Penny, R. (2008). Parental Report of Infant Language Skills: a review of the
developmentandapplicationoftheComunicativeDevelopmentInventories.Childand
AdolescentMentalHealth,Volumen13,n4,.198206
Lpez Ornat, S., Gallego, C., Gallo, P., Karousou, A., Mariscal, S. y Martnez, M. (2005).
Inventarios de Desarrollo Comunicativo Mac Arthur. Manual Tcnico. Madrid: TEA
Ediciones.
MacWhitney,B.(2000).TheChildesProyect:Toolsforanalyzingtalk.Mahwah;NJ,Erlbaum.
Marchman,VyBates,E.(1994).Continuityinlexicalandmorphologicaldevelopment:atestof
thecriticalmasshypothesis.JournalofChildLanguage,21,339366.
Mariscal, S., Nieva, S., y Lpez Ornat, S. (2010). Observar y medir el desarrollo gramatical
tempranoenespaol.Psicothema,22(1),5156.
Prez Pereira, M. y Resches, M. (2008). Validez concurrente y predictiva del IDHC.
Implicaciones para el posterior desarrollo del lenguaje y de la cognicin social. En E.
DezItza (Ed.) Estudios de desarrollo del lenguaje y educacin (pp.8794). Oviedo:
UniversidaddeOviedoICE.
Thal, D., Jackson Maldonado, D. y Acosta (2000) Validity of a Parent Report Measure of
VocabularyandGrammarforSpanishSpeakingToddlers.JournalofSpeech,Language
andHearingResearch,43,10871100.

221

TRABAJOS COMPLETOS

LOSRASGOSDEPERSONALIDADDELOSDOCENTESINNOVADORES:UN
ESTUDIOTERICO

CarlosMongeLpez1,2
FacultaddePsicologa,UNED.2FacultaddeEducacin,UniversidaddeAlcal

RESUMEN
Este texto se presenta como un estudio terico acerca de una de las diversas
contribuciones de la Psicologa a la Educacin. En concreto, se procura hipotetizar la
relacin existente entre personalidad e innovacin educativa: qu rasgos de
personalidad poseen los docentes innovadores en comparacin con los menos
innovadores. Y para ello, en primer lugar, se revisan algunas de las teoras ms
importantes sobre Psicologa de la personalidad. Posteriormente, trassealar algunas
delasdefinicionesmsrelevantesdeinnovacineducativa,seproponeunanueva.Y,
finalmente,seestudiantericamentelascaractersticasdepersonalidaddelosdocentes
innovadores. As, dependiendo de la perspectiva de los diversos autores sobre los
rasgos de la personalidad se adoptan varias soluciones a la cuestin planteada. Con
ello, es posible concluir que la Psicologa de la personalidad puede contribuir
significativamente a facilitar los procesos de cambio e innovacin en los centros
educativosconelobjetivodemejorarlos.

PALABRASCLAVE
Caractersticas individuales, innovacin pedaggica, investigacin terica, personal
docente,rasgosdepersonalidad.

INTRODUCCIN
Si bien es cierto que numerosas aportaciones de la Psicologa de la Educacin se
centran en el alumnado, tambin se preocupa de aspectos relacionados con el
profesorado, la organizacin escolar, el contexto educativo o las interacciones de
varios de ellos. Adems, para el mbito educacional no slo es fundamental la
Psicologa de la Educacin, sino que tambin se nutre de conocimientos de diversas
especialidades del campo psicolgico, como la Psicologa social, Psicologa de la
motivacin, Psicologa de la emocin, etc. Y, entre todas ellas, se encuentra la
Psicologadelapersonalidad.

223

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

En este caso, lo que aqu pretende es realizar un estudio terico sobre los rasgos de
personalidaddelosdocentesinnovadores.Y,paraello,setratanlasprincipalesteoras
sobre rasgos de personalidad, el concepto de innovacin educativa, la relacin entre
Psicologa de la personalidad e innovacin docente y, finalmente, unas conclusiones
sobrelatemticaabordada.
MTODO
Se trata de una revisin sistemtica (Cohen, Manion y Morrison, 2011) donde se han
analizadolasprincipalesreferenciasbibliogrficasentornoatresejes:(1)losrasgosde
personalidad,(2)laconceptualizacindelainnovacineducativay(3)Psicologadela
personalidad e innovacin docente. Para ello se han considerado las referencias con
mayoresndicesdeimpactoy/onmerodecitas,ascomoelprestigioeditorialydelos
autores,sobrelostresejes.Ytraslaseleccin,losdatossignificativosparaesteestudio
han sido incorporados en los instrumentos utilizados (fichas de resumen), donde se
seala: la referencia, las palabras clave, el mtodo, los resultados y las principales
conclusiones.
RESULTADOS
Principalesteorassobrerasgosdepersonalidad
Sobre rasgos de personalidad existe una amplia gama de concepciones, cada una
atendiendoalaperspectivatericaadoptada.Sinembargo,enunintentodeformular
unadefinicinuniversalmenteaceptada,PrezGarcayBermdez(2011)apuntanque
los rasgos de personalidad son la consistencia de la respuesta de un individuo ante
distintas situaciones y se aproximan al concepto que la gente utiliza para describir la
conductadelosdems,esdecir,losrasgossonconstructostericosqueseutilizanpara
describiralaspersonasycompararunasconotras.
Fundamentalmente,entrelosautoresmsrelevantesalrespectoseencuentran:Cattell,
CattellyCattell(1949),CostayMcCrae(1978),Caprara,BarbaranelliyBorgogni(1993),
EysenckyEysenck(1975),Cloninger,Przybeck,SvrakicyWetzel(1994),etc.
En primer lugar, Cattell y otros (1949), tras un anlisis lxico y, posteriormente,
factorial,determinanquelosrasgosdepersonalidadson16:afabilidad,razonamiento,
estabilidad emocional, dominancia, animacin, atencin a normas, atrevimiento,
sensibilidad, vigilancia, abstraccin, privacidad, aprensin, apertura al cambio,
autosuficiencia,perfeccionismoytesn.
En segundo lugar, pueden encontrarse los modelos pentafactoriales, que actualmente
suelen ser los ms utilizados (PrezGarca y Bermdez, 2011). Entre todos ellos se
puededestacareldeCostayMcCrae(1978)yeldeCaprarayotros(1993).As,segnel
primero los factores de personalidad son: extraversin, amabilidad, responsabilidad,
apertura y neuroticismo. Y, por otro lado, Caprara y otros (1993) encuentran cinco

224

TRABAJOS COMPLETOS

grandes factores, compuestos stos a su vez por dos subdimensiones: energa


(dinamismo y dominancia), afabilidad (cooperacin y cordialidad), tesn
(escrupulosidad y perseverancia), estabilidad emocional (control de las emociones y
control de los impulsos) y apertura mental (apertura a la cultura y apretura a la
experiencia).
En tercer lugar, el modelo de Eysenck y Eysenck (1975) inicialmente est constituido
por dos dimensiones (neuroticismo versus emocionalidad y extraversin versus
introversin). Sin embargo, finalmente aade una tercera dimensin independiente a
las anteriores: psicoticismo versus control de los impulsos. Adems, seala que cada
suprafactorestformadoporotrosrasgosdemenornivel.
Finalmente,Cloningeryotros(1994)sostienenquelapersonalidadestconstituidapor
cuatro dimensiones de temperamento (bsqueda de novedad, evitacin del dao,
persistencia y dependencia de recompensa) y tres de carcter (autodireccin,
cooperatividadyautotranscendencia).
Conceptualizacindelainnovacineducativa
Apartirdelasdefinicionespropuestasporvariosautoresrelevantesenlatemtica,se
puedesealarquelainnovacineducativaeselconjuntodeideas,actitudes,procesos
de cambio y estrategias de indagacin, ms o menos sistematizados y efectuados de
maneracolectiva,orientadosagenerarconocimientodesdelainformacinpropiadela
organizacin, cuyo fin es mejorar la prctica educativa, buscando la calidad, y
propiciarladisposicinaindagar,descubrir,reflexionarycriticar.
EstudiosrelevantessobrePsicologadelapersonalidadeinnovacindocente
Las primeras investigaciones relevantes sobre qu personalidad poseen los docentes
innovadores las revisa Huberman (1973). Sin embargo, son escasos los estudios
actuales al respecto (Ros, 2004, 2006a, 2006b y 2009), identificando a los docentes
innovadorescomo:
Personaspersistentes,quesonresistentes,metdicasyplanificadoras(Ros,2004).
Personasconaltamotivacinpedaggicaysocial(Ros,2006a).
Personasrealistas,prcticas,nointeresadasenloquenocreenqueestil.Lasencanta
organizarydirigiractividades.Yempleanmselpensamientoparasuvidaexteriory
lasensacindesuvidainterior(Ros,2006b).
Personascercanasyafectuosas,cariosasyalegres,sobreprotectoras,yconsecuentes
yhonestas(Ros,2009).
CONCLUSIN
Amododeeplogo,pareceserquelapsicologadelapersonalidadaportainformacin
relevante acerca de las caractersticas de los docentes innovadores. As, diversos
estudios (Huberman, 1973; Ros, 2004, 2006a, 2006b y 2009; Jimnez Gallardo y otros

225

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

2011) tratan de determinar cmo es la personalidad de los profesionales de la


educacin que innovan en su prctica educativa. Sin embargo, no existe un consenso
generalizadosobrelacuestin.
Aparte de las investigaciones ya realizadas al respecto, se pueden plantear nuevas
hiptesisdeinvestigacinenrelacinalosrasgosdepersonalidad.
DesdelateoradelapersonalidaddeCattellyotros(1949),esposiblequelosdocentes
innovadores punten, por un lado, bajos en dominancia (caracterizando a la persona
como cooperativa) y en autosuficiencia (integrndose en el grupo) y, por otro lado,
punten altos en atrevimiento (siendo emprendedores), abstraccin (caracterizndose
comoimaginativos)y,especialmente,abiertosalcambio.
Si se plantea esto mismo desde el modelo de los cinco factores de Costa y McCrae
(1978),sepuedeesperarquelosdocentesinnovadoresseanextravertidos(sociablesy
asertivos), abiertos al cambio (creativos, con amplios intereses y flexibles), amables
(cooperativos y empticos). Y si se realiza desde la perspectiva de Caprara y otros
(1993), los docentes que innovan pueden puntuar alto en afabilidad (siendo
cooperativos),tesn(porquesonreflexivos)yaperturamental(caracterizndosecomo
cultos,informadosyabiertosaexperienciasnuevas).
En el caso de que se determinen los rasgos de personalidad de los docentes
innovadores desde los planteamientos de Eyseck y Eysenck (1975), se puede esperar
que posean como rasgos primarios: sociabilidad, aventura y racionalidad; y como
rasgosecundario:bajopsicoticismo.
Tambin, siguiendo la propuesta de Cloninger y otros (1994) es probable que los
docentes ms innovadores correlacionen positivamente en las dimensiones bsqueda
denovedadesycooperatividad.
Sinembargo,estashiptesissolamentesontericas,porloquesedebencontrastarpor
medio de investigaciones empricas. As, como futuras lneas de investigacin se
propone la creacin de un cuestionario vlido y fiable que cuantifique cmo de
innovadores son los docentes y la bsqueda de correlaciones con los instrumentos
tipificados de personalidad, con el fin de complementar las investigaciones previas
(eminentementedecarctercualitativo).

REFERENCIAS
Caprara,G.V.,Barbaranelli,C.yBorgogni,L.(1993).BFQ.Florencia:OrganizzazioniSeciali.
Cattell,R.B.,Cattell,A.K.yCattell,H.E.P.(1949).16PFQuestionnaire.Champaign:Institute
forPersonalityandAbilityTesting.
Cloninger C. R., Przybeck T. R., Svrakic D. M. y Wetzel R. D. (1994). The Temperament and
CharacterInventory.Washington:CenterforPsychologyofPersonality.
Cohen,L.,Manion,L.yMorrison,K.(2011).ResearchmethodsinEducation(7edicin.Nueva
York:Routledge.

226

TRABAJOS COMPLETOS

Costa,P.T.yMcCrae,R.R.(1978).NEOPI.Florida:PsychologicalAssesmentResources.
Eysenck, H. J. y Eysenck, S. B. G. (1975). Manual of the Eysenck Personality Questionnaire.
Londres:HodderandStoughton.
Huberman, A. M. (1973). Cmo se realizan los cambios en educacin: una contribucin al
estudiodelainnovacin.Pars:UNESCO.
PrezGarca,A.M.yBermdez,J.(2011).Introduccinalestudiodelapersonalidad:unidades
de anlisis. En J. Bermdez, A. M. PrezGarca, J. A. Ruiz Caballero, P. Sanjun y B.
Rueda,Psicologadelapersonalidad(pp.2568).Madrid:UNED.
Ros, D. (2004). Rasgos de personalidad de profesores innovadores: autonoma, persistencia y
orden.RevistaLatinoamericanadeEstudiosEducativos,34(2),95112.
Ros, D.(2006a).Motivaciones y caractersticasde personalidadde profesores queinnovan en
suprcticapedaggica.EnI.Magaa(Comp.),IJornadadeDiscusinsobreProyectos
deInvestigacin(pp.137156).SantiagodeChile:USACH.
Ros, D. (2006b). Tipos psicolgicos de profesores primarios innovadores: extroversin,
sensacin, pensamiento y juicio. Revista Latinoamericana de Estudios Educativos, 36
(3),103128.
Ros, D. (2009). Caractersticas personales y profesionales de profesores innovadores. Revista
LatinoamericanadeEstudiosEducativos,39(2),153169.

227

TRABAJOS COMPLETOS

PUEDELAEVALUACINCRITERIALSERUNPROCEDIMIENTOFIABLEDE
DIAGNSTICOYDETECCIONDELASDIFICULTADESDEAPRENDIZAJEDEL
CLCULO?

AntonioCoronadoHijn.
FacultaddePsicologa,UNED.

RESUMEN
Para la deteccin y evaluacin de las dificultades especficas de aprendizaje, el uso
exclusivo de test no representa la opinin ms representada en las investigaciones
actuales sobre la cuestin (Ortiz, 2004). Esta deteccin se justifica mejor en estilos de
evaluacinvariadosquecontemplenpruebasdediagnsticocriterial,pruebasbasadas
encontenidoscurriculares,anlisisdeloserroresmedianteobservacinsistematizada
y procedimientos alternativos de identificacin criterial, contrastados y validados en
losresultadosdelainvestigacin(OSERS,2006).
Este estudio defiende y justifica experimentalmente la metodologa observacional
sistematizada, como procedimiento fiable para la evaluacin de las dificultades de
aprendizajeenelclculo,mostrandolosresultadospositivosdefiabilidad,encontrados
enlaaplicacindeunarbricadeanlisisolistadecontrol.

PALABRASCLAVE
Evaluacindelasdificultadesdeaprendizajeenelclculo,observacinsistematizada,

INTRODUCCIN
Elpresenteestudioseenmarcadentrodelcontextodelasdificultadesenelaprendizaje
de las matemticas (DAM) y, ms concretamente, en una de las dificultades menos
investigadas(Orranta,2000),lasdificultadesparaoperarconlosnmerosycalcular.
Desde el punto de vista de la intervencin psicopedaggica, resulta imprescindible
realizar una evaluacin criterial que nos informe acerca de los errores y problemas
concretosdecadasujetoenelaprendizajematemtico,conocimientosqueconstituyen
el prerrequisito bsico para la puesta en marcha de programas funcionales de
reeducacinoremediacin(GonzlezPiendayGonzlezPumariega,1998;Blancoy
Bermejo,2008;Coronado,2008,2010).
La opcin de deteccin criterial ha sido recogida en la Ley norteamericana IDEA,
enmarcada en el modelo de deteccin e intervencin, respuesta a la intervencin

229

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

(RTI). La ley IDEA The Individuals with Disabilities Education Act (2004), aun
manteniendo la misma conceptualizacin de las DA de anteriores legislaciones, s
vara considerablemente las indicaciones que regulan el proceso de identificacin,
asumiendocomocriteriopreferentelarespuestaalaintervencinynoasumiendola
exclusividaddelusodelCIparalaidentificacindelalumnadoconDA(IDEA,2004).
ComosealanGonzlezPiendayGonzlezPumariega(1998),paraelesclarecimiento
de los mecanismos subyacentes a los errores sistemticos, el diagnstico y la
evaluacin deben dirigirse hacia las dificultades del que aprende, utilizando
instrumentos de observacin y valoracin, vlidos y fiables, para la identificacin y
valoracindesurelevanciaenlasdificultadesconcretasdeaprendizaje.
En este contexto se justifica la elaboracin y estudio de fiabilidad de una rbrica de
anlisis o lista de control para detectar dificultades procedimentales especficas, en el
aprendizajedelclculoaritmtico.
MTODO
Participantes
Ochoobservadoresasignadosmediantemuestreoaleatoriosimpleentreestudiantesde
5 Pedagoga y Psicopedagoga que mediante un muestreo aleatorio por
conglomerados,observan920indicadoresdeDACen46sujetosde4dePrimariade
uncolegiodeSevilla,yotrosochoobservadorestambinasignadosmediantemuestreo
aleatoriosimpleentreestudiantesde5PedagogayPsicopedagoga,quemedianteun
muestreoaleatorioporconglomerados,observan960indicadoresdeDACen48sujetos
de1ESOdeunIESdeSevilla.
Instrumento
Una rbrica de anlisis o lista de control para detectar dificultades procedimentales
especficas,enelaprendizajedelclculoaritmtico.
Setratadeuninstrumento,nonormativo,diseadoparaunaevaluacincriterialque
facilite un diagnstico orientador y formativo, previo a la intervencin, basado en el
anlisis de los errores especficos que comete el sujeto en las reas definidas, para
posibilitarunaremediacincontextualizada.
Consta de 20 indicadores clasificados y subdivididos siguiendo un sistema de
categoras, en cuatro rbricas de anlisis referentes a las categoras de suma, resta,
multiplicacinydivisin.
Los destinatarios son pedagogos, psicopedagogos, psiclogos de la educacin y
profesoradodematemticas.
Tarea
La tarea seencuadra dentro de la observacin sistematizada, en la que el observador
tiene determinado previamente las categoras a observar, los datos que interesan

230

TRABAJOS COMPLETOS

registrarseindicanconantelacinyesunaobservacincuantificable.Deestaformase
facilita considerablemente la observacin y se posibilita que distintos observadores
prestenatencinalasmismasrealizacionesy,portanto,susobservacionespuedanser,
ademsdecuantificables,directamentecomparables(Padilla,2002).
Procedimiento
Metodologa Observacional Sistematizada mediante la utilizacin secuenciada de las
metodologas cualitativa y cuantitativa (Anguera, 2004), en la que se especifica con
antelacinlascategorasaobservar,lasproduccionesqueinteresaregistrarsedefinen
previamente, se utiliza un instrumento de registro y finalmente se miden de manera
cuantitativa.
Esta metodologa observacional es susceptible de comprobaciones de validez y
fiabilidad.
RESULTADOS
Seevalulaprecisindelarbricadeanlisismediantelarealizacindeunanlisisde
fiabilidad.SegnGeorgeyMallery(1995),elAlfadeCronbach;enelintervalo0,80,9
se puede calificar como de un nivel de fiabilidad bueno. Ese ha sido el intervalo
encontrado e en los datos del grupo de 4 de Primaria con un ndice de 0904 y de
0865para1ESO
En cuanto a la fiabilidad de la observacin y valoracin interjueces, se estim la
concordanciaentre losobservadores medianteel estadstico Kappa de Fleiss (1969),a
travs de la implementacin de una nueva sintaxis en el programa estadstico SPSS
18.0.
Elgrado deconcordanciade las valoracionesrealizadas porlos dosgrupos de jueces
sobre las puntuaciones de los respectivos grupos de alumnado, se ha situado en un
nivelmoderado,porencimadeaceptable,segnLandisyKoch(1977).Encuantoalas
920 respuestas aritmticas valoradas en el grupo de alumnado de 4 de Primaria (20
indicadores x 46 sujetos), el ndice Kappa de Fleiss obtenido ha sido del 05363. En
relacinalasotras960respuestasobservadasenelgrupode1deESO(20indicadores
x48sujetos),elndiceresultantehasidodel04429.
DISCUSIN
Los instrumentos utilizados en las ciencias sociales se consideran fiables si,
independientementedequinlosadministre,seobtienenresultadossimilares.
La precisin de un procedimiento se ve afectada por dos factores fundamentales: la
variacinproducidaporelinstrumentoylavariacindelexaminador.
LosresultadosobtenidosconelestadsticoAlfadeCronbach,queeselindicadorms
utilizadoparaelprimertipodeanlisis,sitanalinstrumentoenunniveldefiabilidad
bueno(GeorgeyMallery,1995).

231

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

El grado de concordancia de las observaciones o evaluaciones, realizadas por los dos


gruposdeobservadores,averiguadomedianteelndiceKappadeFleiss(1969),sesita
enunnivelmoderado,porencimadeaceptable,segnLandisyKoch(1977).
Con todos estos datos podemos confirmar la hiptesis inicial de que la metodologa
observacionalsistematizada,puedeserunprocedimientofiableparalaevaluacinde
lasdificultadesdeaprendizajeenelclculo.
Por tanto, una rbrica de anlisis o lista de control, es un instrumento de evaluacin
criterial, que elaborado bajo los criterios cientficos de la observacin sistematizada,
puede utilizarse complementariamente a otras pruebas criteriales y/o normativas y
tiene las ventajas de su fcil utilizacin y aplicacin a tareas en contextos naturales,
ejercicios de clase, exmenes, etc., siendo su uso generalizable no solo a personal
especializadoendiagnsticopsicopedaggicosinoadems,alprofesorado.

REFERENCIAS.
Anguera,M.T.(2004).Posicindelametodologaobservacionaleneldebateentrelasopciones
metodolgicas cualitativa y cuantitativa. Enfrentamiento, complementariedad,
integracin?PsicologiaemRevista(BeloHorizonte,Brasil),10(15),1327.
Blanco, M. y Bermejo, V. (2008). Nos permite la evaluacin criterial por ciclos la deteccin
precozdelasdificultadesdeaprendizajeenmatemticas?EnJ.A.GonzlezPienday
J.C. Nez (Coords.), Psicologa y Educacin: Un lugar de encuentro (pp. 19431948).
Oviedo:Ediuno.
Coronado, A. (2008). Dificultades de aprendizaje de las matemticas: conceptos bsicos y
diagnstico.RevistadeHumanidadesn15.
Coronado, A. (2010). Evaluacin criterial de las dificultades de aprendizaje en el clculo. Un
anlisis de caso en evaluacin inicial en la ESO. UNO. Revista de Didctica de las
Matemticas,54,88102.
Fleiss,J.L.;Cohen,J.YEveritt,B.S.(1969).Largesamplestandarderrorsofkappaandweighted
kappa.Psycologicalbulletin,72,232327
George, D. y Mallery, P. (1995). SPSS/PC+ Step by step. A simple guide and reference.
WadsworthPublishing,Belmont.
GonzlezPienda,J.A.yGonzlezPumariega,S.,Evaluacineintervencinenlasdificultades
deaprendizajedelasmatemticas.EnGonzlezPienda,J.A.yNuezPrez,J.C.(1998).
DificultadesdeAprendizajeEscolar.Madrid:Pirmide
IDEA(2004).IndividualswithDisabilitiesEducationImprovementActPub.L.108466.
Landis, J.R., Koch, G.G. (1977). The measurement of observer agreement for categorical data.
Biometrics33,159174
Orranta, J (2000). Las dificultades en al aprendizaje del clculo desde el punto de vista
cognitivo.Premiosnacionalesdeinvestigacineinnovacineducativa,N.1,pgs.75
102
Ortiz,M.R.,(2004).ManualdeDificultadesdeAprendizaje.Madrid:Pirmide.
OSERS (2006) Office of Special Education and Rehabilitative Services; Overview Information;
NationalInstituteonDisabilityandRehabilitationResearch(NIDRR)
Padilla, M T. (2002). Tcnicas e instrumentos para el diagnstico y la evaluacin educativa.
Madrid:Ed.CCS

232

TRABAJOS COMPLETOS

ESTUDIOPILOTOSOBRELARELACINMADREHIJODURANTELOS
PRIMEROS6MESESDEVIDAENMUJERESMENORESDE18AOS.

MaraJezlvarezyCintiaRodrguezGarrido
FacultaddePsicologa,UNEDyFacultaddePsicologa,UAM.

RESUMEN
Losprimerosmesesdevidasonfundamentalesparacualquierindividuo.Enalgunos
estudios, se establece una relacin indirecta entre el nmero de factores de riesgo al
nacer y la edad de la madre en el momento de la concepcin. A continuacin
presentamosunestudioobservacionalsobrelasensibilidaddedosdadas:dosmadres
menores de 18 aos con sus respectivos recin nacidos. Para ello, se realiz el
seguimiento de estos casos, durante los 6 primeros meses de vida. Segn los datos
observados, apreciamos una sensibilidad de la madre y un estado de bienestar en el
bebdentroderangostpicos(denoriesgo),aunquelaspuntuacionesdeautoestimay
apego de dichas madres, muestran estilos de relacin sin vnculo seguro. Llama la
atencin, ladiscordancia de resultados entrevariables quesesuponan concordantes.
133/150
PALABRASCLAVES
Intersubjetividad,sensibilidad,maternidad(precoz)yadolescencia.
INTRODUCCIN
Algunas fuentes, sealan que cuando nos acercamos a la poblacin de madres
adolescentes,observamosunmayorriesgoderetrasoeneldesarrollosocial,emocional
y cognitivo, y una mayor incidencia de abuso, negligencia y morbilidad (AAP, 2001;
CorenyBarlow,2008;INE,2008),especialmentecuandoelnionoesdeseadoy/ono
haycontroldelembarazo(Issler,2001;Klein,2005;RamosyGogna2004).
Interesadosporelbienestardeestasmadresysushijos,realizamosunseguimientode
cmosevagestandoelencuentrodelamadreadolescenteconsubebyvaloramosla
sensibilidadconqueestarespondealasnecesidadesdelnio.
MTODOS
Sujetos
Lamuestratotal,tomadaalolargodedosaosymedio,siguiendolametodologade
muestreoconsecutivo,estabacompuestapor18madresadolescentesquecumplanlos
criterios de inclusin: 1) pertenecer al rea Sanitaria correspondiente al Hospital
Clnico de San Carlos de Madrid, 2) haber sido detectados a partir de Noviembre de

233

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

2008 por la Seccin Trabajo Social e incluidos en el estudio, tras su consentimiento


informado;3)y,porltimo,tenerundesarrollonormotpicosinpatologabiolgica.
Trascontactarconlamuestraseleccionada,solo6aceptaronparticiparenelestudio.Se
perdieron4casospormuerteexperimentalalolargodelassesionesdeseguimiento.
Porloquelamuestrafinal,secompusodedoscasosenseguimientocompleto.
Procedimiento:
Setratadeunestudiopilotoenel queaplicamosundiseodeseguimientodecasos,
dentrodelmarcodelametodologaobservacional.Ademsdelmuestreoconsecutivo,
empleamos 2prcticas filmadas en escenarios y situaciones naturales, situndonos
en el mismo hogar de la madre, en el mismo momento de la alimentacin (dado su
valor emocional y social). Se fijaron unos momentos programados de evaluacin: los
dasposterioresalparto,almes,alostresmesesyalos6mesescumplidos.
Utilizamos el MODELO DE ANLISIS DE LA INTERSUBJETIVIDAD (M.A.I.)
planteadoporlaDra.PrezMinguez(1996),ytomamossuscategorasdeobservacin
(sensibilidad del adulto y actitud emocional del nio). Dicho modelo de
observacin y anlisis, est diseado para analizar la actividad comunicativa
intersubjetiva en contextos naturales e informales no definidos previamente. Cada
categorade observacin se subdivide en otrascuatro (sensibilidad(sensible:muy
s, poco s, no s; y actitud emocional: soando, estable, regulando y
estrs).
Ademsdelosdatosdeobservacin,utilizamosotrasherramientasparalavaloracin
devariablesindependientesasociadas:EntrevistaSemiEstructuradadedatosclnicos
ysocioculturalesdiseadaadhocparalaevaluacindelosfamiliares,confactoresde
riesgo y proteccin); Test adaptado de Lebovici; Test de Autoestima de Rosenberg
paralamadreenlasprimerasentrevistas;CuestionariodeApegoAdulto(Melero,R.y
Cantero,M.J.,2005);EvolucindelDesarrolloPsicomotordelaPrimeraInfanciade12
a 30 meses (BrunetLzine Revisado, 1988), que consta de 5 puntuaciones: control
postural, lenguaje, sociabilidad, coordinacin visomotora y una puntuacin global.
Despus de la recogida de datos, las grabaciones se digitalizaron y analizaron con el
programainformticoELLAN,deacuerdoconlascategorasdelmodelodeanlisisde
intersubjetividadreferido

234

TRABAJOS COMPLETOS

Figura1(ejemplodedigitalizacindeunaimagenconelprogramaellan:caso1)

Hiptesis
Partimosdelahiptesisdequecabraesperar,segnloplanteadoenlaintroduccin,
que en situaciones de maternidad adolescente, la escucha de la madre respecto a su
hijo,mostraraunpatrndebajasensibilidad(M.A.I.,1999).
RESULTADOS
Como hemos indicado, dadas las dificultades del muestreo, la muestra se redujo a 2
mujeresysushijos.Enambasmadres,apreciamosciertaestabilidadenlasrespuestas

235

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

emocionales que dan a sus hijos; las respuestas ms extremas (no sensible y muy
sensible) tienden a ser las menos probables y las ms probables son las respuestas
sensibles. Por otra parte, parece que las respuestas muy sensibles durante la
alimentacin,aparecensobretodocuandolosbebssonmspequeos.
Los resultados de los tests muestran que los datos en la prueba de autoestima de
ambaspacientes,sevenconfirmadosconlosdelapruebaquemideeltipodeapego.
Enambas,esclaralatendenciaalaevitacinyanocontarconotroscuandotienenque
enfrentar situaciones problemticas. Por otra parte, apreciamos en la muestra tanto
FACTORES PROTECTORES (apoyo familiar, abandono de estilos peligrosos,
responsabilizacin)comodeRIESGO(nivelsociocultural,abandonoescolarizacin).
En las pruebas de desarrollo de los bebs, los datos revelan que ambos nios
obtuvieron puntuaciones de desarrollo general tpicas. Aunque observamos que el
bebdelsegundocaso,tieneunaedaddedesarrollosocialligeramentepordebajodela
mediaesperada

Interaccin Daniela-Victoria

Adulto

Sensibilidad

Beb

Bienestar

1 Sesin
0 meses
(pecho)

2 Sesin
1 mes
(pecho)

3 Sesin
3 meses (bibern)

4 Sesin
6 meses (bibern)

Muy sensible

9 (18%)

7 (13 %)

28 (20%)

3 (8%)

Sensible

26 (52%)

20 (37%)

73 (52%)

18 (46%)

Parcialmente

11 (22%)

18 (33%)

33 (24%)

14 (36%)

No sensible

4 (8%)

9 (17%)

6 (4%)

4 (10%)

Soando

30 (45%)

37 (55%)

Estable

8 (16%)

9 (17%)

78 (56%)

35 (90%)

Regulando

6 (12%)

8 (15%)

47 (33%)

4 (10%)

Estrs

6 (12%)

15 (11%)

Tabla 1 (datos del caso 1)

Atendiendo a lo observado: apreciamos conductas sensibles, ms estables en Marilla


(Caso2),quienexpresaaltaocurrenciaenrespuestasdesensibilidadpositiva.Daniela,
aunquesemuestraatenta,sueleserintrusiva(menoscontingente)conVictoria(C1)
En ambos casos observamos una baja ocurrencia de respuestas de estrs o malestar
intenso,siendostasuperiorenelprimercaso.Eduardo(bebdelCaso2)muestraun
menor nivel de estrs, slo presente en el primer (1%) y ltimo contacto (3%),
coincidiendo estas sesiones con momentos en los que su madre expresa un mayor
cansancio o malestar, coincidiendo con la tasa ms alta de baja sensibilidad (20%) de
todaslassesionesdeMarilla.

236

TRABAJOS COMPLETOS

Enambasmadres,apreciamosciertaestabilidadenlasrespuestasemocionalesquedan
a sus hijos, con una mayor prevalencia de las respuestas sensibles; siendo la
respuestamenosfrecuentelanosensible.Lasrespuestasmsextremastiendenaser
lasmenosprobablesylasmsprobablessonlasrespuestassensibles.Porotraparte,
parece que las respuestas muy sensibles durante la alimentacin, aparecen sobre
todocuandolosbebssonmspequeos.
La actitud emocional, o bienestar mostrado por el beb, mantiene un patrn de
estabilidadenlasconductasderegulacinyestrs,conaltaprobabilidadenlaprimera
ybajaenlasegunda.Habiendomsfluctuacinenlaactituddesoandoquetiende
airdisminuyendo,frentealadeestabilidadque,porelcontrario,tiendeaaumentar.
Cuando la visin micro, la completamos con un nivel macro, apreciamos cmo una
baja disposicin de la madre conlleva el aumento de la conducta de autorregulacin
del beb y, al contrario, cmo en un momento de alto rechazo; una actitud muy
sensible de la madre puede aumentar el bienestar del beb y su colaboracin en la
accinconjunta.Inclusolocontrario,cmolarespuestadeestrsenelbeb,msque
responderaunanosensibilidaddelamadre,dalugaraunaumentoenlacalidaddela
sensibilidad de la respuesta de la madre. Esto es, a veces las respuestas de estrs
correlacionanconrespuestasnosensiblesdelamadre.
DISCUSION
En contra de lo esperado, se evidencia una proporcin alta de respuestas sensibles y
estadodebienestarpositivoenelbeb.
Apreciamos en la muestra tanto FACTORES PROTECTORES (apoyo familiar,
abandono de estilos peligrosos, responsabilizacin) como de RIESGO (edad, nivel
sociocultural,abandonoescolarizacin)quepuedenexplicarlosresultadosfavorables.
Dadoslosresultados,creemosqueesimportanterevisarlaidoneidaddelcriteriodela
edadenlacomparacindeexperiencias.
Asuvez,nosplanteamoslautilidaddeestomtodoobservacionalcomoinstrumento
deintervencinyaplicableaotroscontextos.Ascomolarevisindelametodologa.

REFERENCIAS
Jaez,M.(2011).Proyectodeinvestigacin:Seguimientodelarelacinmadrehijodurantelos
primeros6mesesdevidaencondicionesdematernidadprecoz.Madrid:UNED.
Palacios, J. (1990). Adaptacin y promocin en embarazos adolescentes. Datos desde la
PsicologaEvolutiva.ISimposiodeSaludInfantil,Granada,Julio1990.
PrezMinguez Casariego, C. (1999).Satisfaccin de las necesidades bsicas del recin nacido
(R.N.) hospitalizado: anlisis de las primeras relaciones interpersonales. Revista de la
Asociacin Catalana de Atencin Precoz. Desenvolvimiento infantil. Atencin Precoz,
1314.
Rodrguez, C. (2006). Del ritmo al smbolo. Los signos en el nacimiento de la inteligencia.
UniversitatdeBarcelona:ColeccinCuadernosdeEducacin.ICEHORSORI.

237

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Rodrguez,C.yMoro,C.(1999).Elmtodoobservacional.En:C.RodrguezyC.Moro(eds).El
mgiconmerotres:cuandolosniosannohablan(131155).Barcelona:Paids.

238

TRABAJOS COMPLETOS

RELACINDELAPERSONALIDADTIPODYELAGOTAMIENTOVITALCON
LASEMOCIONESNEGATIVASYELAJUSTEPSICOLGICOALA
ENFERMEDADCARDIACA

PilarMonteroMartn,BeatrizRuedaLaffondyJosBermdezMoreno
FacultaddePsicologa,UNED.

RESUMEN
En este estudio nos propusimos examinar dos factores de riesgo emergentes en el
campodelaenfermedadcardiaca:lapersonalidadtipoDyelagotamientovital(AV);
su relacin con la presencia de emociones negativas (iradentro, irafuera, ansiedad y
depresin) y el ajuste psicolgico (competencia percibida, autoestima, satisfaccin y
apoyosocial);ysedeterminlacapacidadpredictivadeltipoDyelAVenrelacincon
todosestoscriterios.

PALABRASCLAVE
PersonalidadtipoD,agotamientovital,ajuste,emociones,factorespsicosociales

INTRODUCCIN
Los factores psicosociales, centrados en las emociones negativas y en la falta de
recursospersonales,sehanincorporadoalosestudiossobreincidenciayprogresinde
laenfermedadcardiovascular(BhattacharyyaySteptoe,2007;Rozanskietal.,2005).
Dentro de este marco, dos variables estn recibiendo atencin importante: la
personalidadtipoDyelagotamientovital.Diversosestudioshanmostradoqueestos
dosconstructosestnvinculadosconunmayorriesgodesufrircardiopataisqumica,
repeticindeinfartos,diferentesproblemascardiacosyunpeorajustealaenfermedad
(Appels,2004;DenolletyBrutsaert,1998;Pedersen,MiddelyLarsen,2002).
LapersonalidadtipoD(distressed),conceptointroducidoporDenollet,SysyBrutsaert
(1995), se define como la tendencia a experimentar simultneamente intensas
emociones negativas (afectividad negativa) y a inhibir su expresin durante la
interaccinsocial(inhibicinsocial)(PedersenyDenollet,2006).
Las personas que puntan alto en afectividad negativa manifiestan ms sentimientos
de disforia, tensin, preocupacin e irritabilidad (Emons, Meijer y Denollet, 2007);
tienenunavisinnegativadesmismas,refierenmayornmerodequejassomticas,y
presentan un sesgo atencional que les predispone hacia los estmulos negativos
(Denollet,2000).
Laspersonasconaltainhibicinsocialtiendenaevitarpeligrospotencialesderivados
de la interaccin social, dado que anticipan reacciones negativas por parte de los
dems.Sepuedensentirinhibidas,tensaseinsegurasencompaadeotros,yporeso

239

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

prefierenmantenersealejadasdelosdemsensituacionesdecontactosocial(Denollet,
Gidron,VrintsyConraads,2010).
LaprevalenciadeltipoDoscilaentreel13yel25%enpoblacingeneralyentreel26y
el53%enpacientescardiacos(Denollet,2005).
Elagotamientovital,introducidoporAppelsycol.(1980)representaunestadomental
desagradable, caracterizado por excesiva fatiga mental y falta de energa, incremento
delairritabilidadysentimientosdedesmoralizacin.Sussntomasaparecenenel50%
delospacientessiseconsideraunperodode1a6mesesantesdelinfarto,yenel80%
siseconsideran10meses.
Nuestrosobjetivosfueron:1.Analizarenunamuestradepacientescardiacossihaba
diferencias de sexo respecto a: la personalidad tipo D, el agotamiento vital, las
emocionesnegativas(iradentro,irafuera,ansiedad,depresin)yelajustepsicolgico
(competenciapercibida,autoestima,satisfaccin,apoyosocial).2.Estudiarlarelaciny
lacapacidadpredictivadelapersonalidadtipoDyelagotamientovitalrespectoalas
emocionesnegativasyelajustepsicolgico.
MTODO
Participantes
Lamuestrasecompusode164pacientescardiacosdetrescentrossanitariosdeMadrid
(40,24%mujeres;59,76%hombres;edadmedia=56,30aos;DT=12,88).
Procedimiento
ElprotocolodeinvestigacinseaprobporelComitdeticadeloscentros,quelos
pacientes cumplimentaban en una nica sesin tras firmar el consentimiento
informado.
Instrumentosdeevaluacin
EscaladepersonalidadtipoD(DS14;Denollet,2005);CuestionarioMaastrich:FormaB
(MQ; Appels, 1989); Escala de Expresin de la Ira (AX; Spielberger, Jacobs, Rusell y
Crane,1983);InventariodeAnsiedadEstado(STAIE;Spielberger,GorsuchyLushene,
1970);InventariodeDepresindeBeck(BDI;Beck,Rush,ShawyEmery,1979);Escala
de Competencia Percibida de Wallston (Smith, Dobbins y Wallston, 1991); Escala de
Autoestima (SES; Rosenberg, 1965); Cuestionario de Calidad de Vida (Ruiz y Baca,
1993)
Anlisisestadstico
Los datos se analizaron mediante el programa estadstico SPSS, versin 15.0. El nivel
designificacinelegidofuede0.05.
RESULTADOS
Un 50% de los pacientes cumpla los criterios para ser diagnosticados como tipo D
(puntuaciones10encadasubescala).Yun61%cumplaloscriteriosdecorteparaAV
(puntuaciones14).
Al considerar la distribucin por sexo, las mujeres puntuaron significativamente ms
altoentipoD,AV,ansiedadydepresin,ypresentaronunaautoestimamsbaja(fig.
1).

240

TRABAJOS COMPLETOS

Fig. 1. Puntuaciones medias de las variables psicosociales en funcin del sexo.*(p 0,05); **(p 0,01)

La personalidad tipo D y sus dos dimensiones correlacionaron de forma positiva y


moderadaconelAV.EltipoDyelAVseasociaronconunmayorgradodeiradentro,
irafuera, ansiedad y depresin. Hay que sealar, en este sentido, que la correlacin
entre el AV y la depresin fue notablemente alta (r = 0,68). Con respecto al ajuste
psicolgico, tanto el tipo D como el AV se relacionaron con niveles ms bajos en
competenciapercibida,autoestima,apoyosocialysatisfaccinpersonal.
Enlosanlisisderegresinmltiple,eltipoDyelAVseasociaronconmsansiedady
peorajustepsicolgico.EltipoDpredijotambinmsiradentro;yelAVfuepredictor
deunapoyosocialmsbajoydemayordepresin(tabla1).

VARIABLES

F(2,163)

Sig.

ANSIEDAD Tipo D Agotamiento


vital

0,24

25,528

0,18
0,37

0,030
0,000

DEPRESIN Tipo D Agotamiento


vital

0,48

74,227

0,09
0,64

ns
0,000

IRA-FUERA Tipo D Agotamiento


vital

0,04

3,045

0,08
0,13

ns
ns

IRA-DENTRO Tipo D Agotamiento


vital

0,09

7,934

0,29
0,01

0,001
ns

COMPETENCIA Tipo D Agotamiento


vital

0,33

39,854

-0,33
-0,33

0,000
0,000

AUTOESTIMA Tipo D Agotamiento


vital

0,30

34,585

-0,26
-0,37

0,001
0,000

APOYO SOCIAL Tipo D


Agotamiento vital

0,29

5,240

-0,10
-0,22

ns
0,036

SATISFACCIN Tipo D
Agotamiento vital

0,29

16,922

-0,33
-0,28

0,004
0,014

Tabla 1. Prediccin de las variables psicosociales a partir de la personalidad tipo D y el agotamiento vital

241

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

DISCUSIN
Los resultados de esta investigacin pusieron de manifiesto que las mujeres
presentaban un perfil psicolgico ms negativo, tanto en lo referido a tipo D y a AV
comoenrelacinalasemocionesnegativasyaunpeorajustepsicolgico.
Por otra parte, la personalidad tipo D y el AV predijeron un estado emocional ms
negativo, y un peor ajuste psicolgico a la enfermedad cardiaca. Ambas variables
mostraronunpesopositivoenlaprediccindelaansiedad.Yseasociaronconniveles
msbajosdecompetenciapercibida,autoestimaysatisfaccin;relacionesquepodran
explicarseporlavisinnegativadesmismasquetienenestaspersonas,ascomopor
suincapacidadparaenfrentarseasituacionesestresantes.
Tambinseapreciarondiferenciasenlacapacidadpredictivadeambosconstructos:
LapersonalidadtipoDpredijounmayorgradodeiradentro.Larumiacincognitiva
pornomanifestarestaemocindeformahabitualpuedeincrementarlaactivacindel
sistemanerviososimpticoyreducirlavariabilidaddelafrecuenciacardiaca,aspectos
consideradospredictoresdemortalidaddespusdeuninfarto.ElAVfueunpredictor
positivo de depresin, con sentimientos de incapacidad y falta de energa como
elementoscomunesaambosconstructos;ynegativodeapoyosocial.
Amododeconclusinpodramossealarquelaenfermedadcardiovasculartiene,en
lasmujeres,caractersticasespecficasqueesprecisoconsiderar,dadoqueelriesgoes
mayor en ellas que en los hombres. Igualmente destacar la relevancia de la
personalidad tipo D y el AV en los factores de riesgo cardiovascular, las emociones
negativas y el ajuste psicolgico en pacientes con enfermedad cardiaca, y cmo las
dificultadesadaptativasdeestaspersonasparaafrontarloseventosdesuenfermedad
repercute en su calidad de vida. Por ltimo, destacar la conveniencia de disear y
desarrollar estrategias de deteccin y tratamiento de pacientes tipo D y/o agotados
vitalmente;ascomollevaracabounaadecuadaprevencinsecundaria.

REFERENCIAS
Appels, A. (2004). Exhaustion and coronary heart disease: the history of a scientific quest.
PatientEducationandCounseling,55,223229.
Bhattacharyya, R. y Steptoe, A. (2007). Emotional Triggers of Acute Coronary Syndromes:
Strength of Evidence, Biological Processes and Clinical Implications. Progress in
CardiovascularDisease,49,353365.
Denollet,J.(2000).TypeDpersonality.Apotentialriskfactorrefined.JournalofPsychosomatic
Research,49,255266.
Denollet, J. (2005). DS14: Standard Assessment of Negative Affectivity, Social Inhibition, and
TypeDPersonality.PsychosomaticMedicine,67,8997.
Denollet,J.,Gidron,Y.,Vrints,C.J.yConraads,V.M.(2010).Anger,suppressedanger,andrisk
of adverse effects in patients with coronary artery disease. American Journal of
Cardiology,105,15551560.

242

TRABAJOS COMPLETOS

Denollet, J., Sys, S., y Brutsaert, D. L. (1995). Personality and Mortality after myocardial
infarction.PsychosomaticMedicine,57,582591.
Denollet, J. y Brutsaert, D. L. (1998). Personality, Disease Severity and the Risk of Longterm
Cardiac Event in patients with decreased ejection fraction after myocardial infarction.
Circulation,97,167173.
Pedersen, S.S., Middel, B. y Larsen, M.L. (2002). The role of personality variables and social
supportindistressandperceivedhealthinpatientsfollowingmyocardial
infarction.JournalofPsychosomaticResearch,53,11711175.
Pedersen, S.S. y Denollet, J. (2006). Is Type D Personality Here to Stay?. Emerging evidence
acrosscardiovasculardiseasepatientgroups.CurrentCardiologyReviews,2,205213.
Emons, W.H.M, Meijer, R.R. y Denollet, J. (2007). Negative affectivity and social inhibition in
cardiovascular disease: Evaluating typeD personality and its assessment using item
responsetheory.JournalofPsychosomaticResearch,63,2739.
Rozanski, A., Blumenthal, J.A. y Kaplan, J. (1999). Impact of psychological factors on the
pathogenesis of cardiovascular disease and implications for therapy. Circulation,
JournaloftheAmericanHeartAssociation,99,21922217.

243

TRABAJOS COMPLETOS

PROPIEDADESPSICMTRICASYANLISISDELDIFDELAESCALASKUAS
APLICADAAUNIVERSITARIOSYPROFESIONALESDELAENFERMERA

MDoloresLpezMartnez1,2,MDoloresHidalgoMontesinos2,JuanCarlosSurezFalcn1,
yPaulaLubnPigouche1
FacultaddePsicologa,UNED;2UniversidaddeMurcia

RESUMEN
La ansiedad es uno de los problemas psicolgicos con mayor prevalencia. Entre los
instrumentosparamedirlaseencuentralaKUAS,TheKuwaitUniversityAnxietyScale
(AbdelKhalek,2000),estemideelgradodeansiedadcomorasgogeneral.
Elpropsitodelapresenteinvestigacines:(1)estimarlaspropiedadespsicomtricas
yestructurafactorialdelaversin espaola,SKUAS(AbdelKhalek,etal.,2004),en
una muestra de estudiantes universitarios y Enfermeros/as titulados, y (2) analizar el
posible funcionamiento diferencial de los tems (DIF) del cuestionario, considerando
las variables gnero y estudios, aplicando dos tcnicas de deteccin: Anlisis
Discriminante Logstico y estadstico de MantelHaenszel, junto con el proceso de
purificacinbietpico,paraesteltimo.
Los resultados han evidenciado una fiabilidad y estructura factorial equivalentes a la
versin original, KUAS y a la versin espaola. Respecto al DIF, el acuerdo entre
procedimientoshasidoalto.

PALABRASCLAVE
Ansiedad,DIF,Enfermera,AnlisisDiscriminanteLogstico,ManthelHaennszel.

INTRODUCCIN
La ansiedad puede definirse como una emocin humana universal, caracterizada por
intensos sentimientos de preocupacin, estrs, angustia, disforia e inseguridad. Esta
emocin es un sentimiento subjetivo que implica la presencia de aprensin, tensin,
inquietud,temorindefinidoeinseguridadanteunpeligrodefinidoonoespecfico.
La ansiedad es un fenmeno complejo que se manifiesta mediante un sistema de
respuesta multidimensional del organismo. Cuando se refiere al estado, ste se
identifica como el proceso o reaccin de ansiedad (FernndezAbascal, E. G., et al.,
2003).

245

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

AbdelKhalek(2000) desarrollala Kuwait University Anxiety Scale (KUAS) con el fin


deaportaruninstrumentoqueseavlidoparaevaluarlaansiedadcomorasgogeneral,
presentandoalavezunasadecuadaspropiedadespsicomtricas.En2004sepublicala
versinespaoladelKUAS,laSKUAS,estamostrunabuenafiabilidad,coherencia
interna, estabilidad y validez. El anlisis factorial arroj tres factores, cognitivo
afectivo, conductualsubjetivo y somtico, lo que equivale a la versin original en
rabe. Las mujeres estudiantes alcanzaron puntuaciones medias significativamente
ms altas que sus homlogos masculinos. En general, los hallazgos en el estudio de
adaptacinproporcionaronevidenciadelautilidaddelaSKUASenlaevaluacinde
losnivelesdeansiedadrasgoenelcontextouniversitarioespaol.
MTODO
Sujetos
Muestra de estudiantes de la Universidad de Barcelona (de psicologa, enfermera y
logopedia)ydeDiplomadosenenfermera(SistemaNacionaldeSaluddelaprovincia
deBarcelona).
Instrumento
El SKUAS est compuesto por 20 tems, 9 evalan el componente cognitivoafectivo
(CA), 7 el componente conductualsubjetivo (CS), y los 4 restantes el componente
somtico(S).ElSKUASesautoadministradoporlosindividuosdelamuestra.
Procedimiento
EnelEstudio1secomparaelposibleFuncionamientoDiferencialdelostems(DIF)en
funcin del grupo de pertenencia, clasificando los grupos en funcin de la variable
sexo (mujeres y hombres). En el Estudio 2 se compara el posible Funcionamiento
Diferencial de los tems (DIF) en funcin del grupo de pertenencia, clasificando los
gruposenfuncindelavariableestudios(estudiantesdepsicologayestudiantesde
enfermera).
LapresenciadeDIFpuedeponerenpeligrolavalidezdelapruebaypuedeinducira
error sobre las diferencias entre grupos. Por lo tanto, es fundamental identificar
aquellos tems que muestran DIF. En el presente trabajo se emple el anlisis
discriminantelogstico(ADL)yelestadsticoMantelHaenszel(MH)paraladeteccin
delDIF,juntoaesteltimoseempleelCocienteAcumuladodeRazonescomnLiu
Agresti (LALOR), ya que proporciona un ndice descriptivo del sentido del DIF,
indicandoaqugrupofavoreceeltem.
RESULTADOS
Estudio1.
LamediadelapuntuacintotaldelaSKUAS,fueparalasmujeresde36.34(DT:7.50),
mientras que los hombres obtuvieron una puntuacin media de 33.22 (DT: 7.64). La

246

TRABAJOS COMPLETOS

diferenciaporsexoresultestadsticamentesignificativa(t:4.49y474gl;p<0.01).
De los tems identificados con DIF mediante el Anlisis Discriminante Logstico, slo
lostems2y 20,presenta DIF nouniforme, Sientomiedo yEstoy inquieto/a.Los
tems1,4,6y14,Tengolosnerviosentensin,Piensoencosasmolestas,Sufro
mareosovrtigosyNoestoyagusto,presentanDIFuniforme.
Elsiguientepasoescomprobareltamaodelefectomediantelasdiferenciasenladel
modelo2respectoal1ydelmodelo3respectoal2(slotemsconDIFnouniforme).
SiguiendoloscriteriospropuestosporJodoinyGierl(2001),enestecasoeltem2y4
mostraranDIFmoderado,mientrasque,enlosotrostems,serainapreciable.
Finalmente, tras el proceso de purificacin, el estadstico MantelHaenszel (MH),
estableciendo como Grupo de Referencia a las mujeres y como Grupo Focal a los
hombres, identifica como tems con DIF los tems: 1 Tengo los nervios en tensin
favoreciendo al grupo de mujeres, tem 2 Siento miedo favoreciendo tambin al
grupo de mujeres, tem 4 Pienso en cosas molestas favoreciendo al grupo de los
hombresy6Sufromareosovrtigos,temquefavorecealgrupodemujeres.
Estudio2.
Losestudiantesdeenfermeraobtuvieronunapuntuacinmediade34.50(DT:7.87)en
la SKUAS, y los estudiantes de psicologa de 35.85 (DT: 7.80). No resultando
estadsticamentesignificativaladiferenciaentrelaspuntuacionesmediasenelSKUAS
(t:1.704y386gl;p=0.089).Apesardenoexistirdiferenciassignificativas,seconsidera
recomendable el anlisis del DIF. Cualquier instrumento de medida tiene que ser
objetivoensumedicin,esdecir,hadegarantizarresultadosidnticosensujetosque
tienen el mismo nivel en el atributo medido, sea cual sea el grupo de pertenencia
(Gmez Benito et al., 2005), por este motivo se incluye en este estudio el anlisis del
DIF,comopruebadevalidezdelaescala.
Son cuatro, los tems identificados con DIF mediante el Anlisis Discriminante
Logstico tem (2, 14, 15, 19). Todos los tems identificados con DIF, Siento miedo ,
Noestoyagusto,Mepreocupaelfuturo,yMesientomolesto/a,presentanDIF
uniforme.
Elsiguientepasoescomprobareltamaodelefectomediantelasdiferenciasenladel
modelo 2 respecto al 1. Siguiendo los criterios propuestos por Jodoin y Gierl (2001),
todoslostemsidentificadosmostraraunDIFinapreciable.
Finalmente, tras el proceso de purificacin, el estadstico MantelHaenszel (MH),
estableciendo como Grupo de Referencia a los estudiantes de enfermera y como
Grupo Focal a los de psicologa, detecta 1 tem con DIF: el tem 15 Me preocupa el
futuro,temquefavorecealgrupodeestudiantesdedeenfermera.

247

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

RespectoalanlisisdeDIF,cabedestacarelacuerdoentreprocedimiento,ADLyMH,
alahoradedeterminarlostemsconDIF.

ElnmerodetemsdetectadosconDIFporambosprocedimientos,enelEstudio1,ha
sidode4,yelnmerodetemsdetectadosporambosprocedimientoscomonoDIFha
sido de 14 (a un nivel de significacin del 5%). El porcentaje de acuerdo entre los
procedimientosenelEstudio1fuedel90%.
Aunniveldeconfianzadel95%,enelEstudio2,esdetectado1temconDIF,siendoel
nmero de tems detectados como no DIF de 16, por ambos procedimientos. Por lo
tanto,elporcentajedeacuerdoentreambosprocedimientosfuedel80%.
DISCUSIN
En general, los resultados de la presente investigacin proporcionan una buena
evidencia de la utilidad de la SKUAS para evaluar los niveles de ansiedad rasgo en
estudiantes universitarios espaoles. Los coeficientes de consistencia interna de la S

248

TRABAJOS COMPLETOS

KUAS,enestosestudios,sonmuysimilaresalosencontradosenotrosestudiosycon
otrasmuestras,loquedenotalabuenaconsistenciainternadelinstrumento.
ElanlisisfactorialdelSKUAS,enestosestudios,arrojtresfactoresdealtacargade
conductualsubjetivo,cognitivoafectivoysomtico,siendoestaestructuraidnticaala
encontradaenlaversinespaolaSKUAS(AbdelKhalek,etal.,2004).
RespectoalanlisisdelDIF,elacuerdoentreprocedimientoshasidoalto.
Las diferencias en las puntuaciones observadas entre mujeres y hombres deben ser
estudiadasmsenprofundidad,conelfindedeterminarsisedebenexclusivamenteal
funcionamiento diferencial de algunos de sus tems, o por el contrario, al factor
impacto de la prueba. Siguiendo los criterios propuestos por Jodoin y Gierl (2001),
nicamente el tem 4 Pienso en cosas molestas mostrara un DIF moderado,
favoreciendoalgrupodehombres.Esdecir,queantemujeresyhombres,igualadosen
niveldeansiedad,estosltimosrespondencondiferentefrecuenciaenestaopcin.
Noobstante,anteladificultaddeaceptarquelasmujeresexperimentanmsansiedad,
sehapropuestodesdelaperspectivaexpresivoemocional(Stillon,1985)explicacina
las diferencias, las puntuaciones ms altas en ansiedad en las mujeres, reflejan una
mayorfacilidaddelasmujeresaadmitiryexpresarlossentimientosdepreocupacin.
Enestesentidosedeberanreformularlostems1,2,4y6,detectadosconDIF,enel
primerestudio,paraevitarsufuncionamientodiferencialentrehombresymujeres,yel
tem15,decaraaevitarsufuncionamientodiferencialentreestudiantesdepsicologay
enfermera.

REFERENCIAS
AbdelKhalek,A.M.,TomsSabdo,J.&GmezBenito,J.(2004).PsychometricParametersof
the Spanish Version of the Kuwait University Anxiety Scale (SKUAS). European
JournalofPsychologicalAssessment,Vol20(4),pp.349357.
AbdelKhalek, A. M. (2000). The Kuwait University Anxiety Scale: Psychometric properties.
PsychologicalReports,Vol87(2),pp.478492.
FernndezAbascal E.G, Jimnez Snchez, M.P. & Martn Daz, M.D. (2003). Emocin y
motivacin.Laadaptacinhumana.Madrid:RamnAreces.
Gmez, J., Hidalgo, M.D. & Guilera, G. (2005). Introduccin al funcionamiento diferencial del
tem.Psicologa.com,9(2).
Stillon,J.M.(1985).Deathandthesexes.Washington:HemispherePublishing.

249

TRABAJOS COMPLETOS

VIOLENCIAHACIALAMUJERENLAADOLESCENCIA:IMPORTANCIADELA
VARIABLESEXISMOYLASCARACTERSTICASPERSONALESDE
AGRESORESYVCTIMAS

ManuelMolinaEstrada
FacultaddePsicologa,UNED.

RESUMEN
Este trabajo analiza el maltrato hacia la mujer que se produce en las relaciones de
parejadurantelaadolescencia,lafrecuenciaconqueseproduceylaimportanciadelas
actitudessexistasylascaractersticasindividualesdeagresoresyvctimas,agresiny
asercin respectivamente. Los resultados indican una frecuencia preocupante de este
tipo de maltrato y el papel fundamental jugado por las actitudes sexistas, siendo
irrelevante o secundario el papel de las caractersticas individuales de agresores y
vctimas.

PALABRASCLAVE
Maltratohacialamujer,adolescencia,actitudessexistas,agresin,asercin.

INTRODUCCIN
La Asamblea General de las Naciones Unidas aprob en diciembre de 1993 la
Declaracin sobre la Eliminacin de la Violencia contra las Mujeres, definiendo la
violenciacontralamujerensuartculo1comotodoactodeviolenciabasadoenla
pertenencia al sexo femenino que tenga o pueda tener como resultado un dao o
sufrimiento fsico, sexual o sicolgico para la mujer, as como las amenazas de tales
actos,lacoaccinolaprivacinarbitrariadelalibertad,tantosiseproducenenlavida
pblicacomoenlaprivada.Estadefinicinsugierelaexistenciadediversasformasde
violencia:
Violencia Fsica. Toda accin voluntariamente realizada que provoque o pueda
provocardaoolesionesfsicasalamujer(Sanmartn,2003).
Violencia Psicolgica. Conductas que producen desvalorizacin y sufrimiento en
quieneslapadecen(Bennet,CohenyEllard,1991).
Violencia Sexual. Cualquier actividad sexual no deseada y forzada por parte de la
pareja,nolimitndosealapenetracinvaginaloanal,sinocontemplandoelsexooralo
lapenetracindeobjetos.
Enlaexplicacindelaviolenciahacialamujerpredominanlosmodelosmulticausales.
Lacaractersticacomnatodoselloseslaconsideracindelaviolenciadegnerocomo
un fenmeno complejo en el que intervienen un conjunto de factores individuales,
sociales y del contexto de la pareja (Bosch y Ferrer, 2002). Pero, como sealan Corsi
(1995) o Heise (1997), y Echebura y FernndezMontalvo (1998), en el centro de la

251

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

explicacin de este tipo de violencia se encuentra una concepcin sexista de los


agresores, siendo el sexismo es una actitud basada en la supuesta inferioridad de las
mujerescomogrupo.
Porotrolado,elestilocomunicativodeambosmiembrosdelaparejahacereferenciaa
la ausencia de habilidades asertivas que faciliten la comprensin y el respeto mutuo.
Mientras que el agresor recurre a conductas que agreden permanentemente los
derechosdesuparejaparaimponersusdeseosynecesidades,stadesarrollaunestilo
relacional sumiso apoyado en fantasas que refuerzan el pensamiento de que con su
conducta puede evitar incurrir nuevamente en la fase de descarga o estallido de
violenciaquedescribeWalker(1979)ensuTeorasobreelCiclodeviolencia.
En definitiva, puede decirse que en la actualidad el maltrato o violencia contra las
mujeresenlaparejatiendeaanalizarsecomounfenmenomulticausalencuyagnesis
desempearan un papel relevante las creencias y actitudes sexistas, y que la
manifestacin de estas creencias y actitudes puede verse mediada por determinadas
caractersticaspersonalesdeagresoresyvctimas.
Por otro lado, diversos investigadores y organismos pblicos han mostrado un
crecienteintersporelproblemadelaviolenciaenlasrelacionesdeparejadurantela
adolescencia. Los principales resultados del estudio Igualdad y Prevencin de la
Violencia de Gnero en la Adolescencia (DazAguado, Martnez y Martn, 2010)
indican que el 32,1% de los chicos aprueba en cierto modo el sexismo y la violencia,
mientras que casi un 10% (9,2%) de las jvenes afirman haber sido vctimas de una
situacindeviolenciaacargodesusparejas.
El trabajo que aqu se presenta, de carcter descriptivo y correlacional, tiene como
finalidad analizar, desde el punto de vista del agresor y de la vctima, la violencia
contralamujerqueseproduceenlasrelacionesdeparejadurantelaadolescencia:la
frecuencia conlaquese producen diferentes situaciones de maltrato, losfactoresque
puedenestarimplicadosenlamismaylasposiblesrelacionesqueseestablezcanentre
estosfactores.
MTODO
Sujetos
La muestra est formada por 208 estudiantes de segundo ciclo de Educacin
SecundariaObligatoria,conedadescomprendidasentrelos14ylos18aos(),siendo
dividida en dos submuestras en funcin del sexo, una integrada por hombres y otra
por mujeres. Se llev a cabo un muestreo incidental, siendo escogidos para la
realizacin del estudio dos centros que permitieron un mejor acceso por diversas
circunstancias.
Variables
Violencia hacia la mujer ejercida por los adolescentes (VMEA). Situaciones de
maltratofsico,verbalysexualejercidasporloschicosenelmarcodelasrelacionesde
parejaenlaadolescencia.
Violenciahacialamujersufridaporlasadolescentes(VMSA).Situacionesdemaltrato
fsico,verbalysexualsufridasporlaschicas.
Sexismo.Actitudbasadaenlasupuestainferioridaddelasmujerescomogrupo.
Agresin. Conjunto de conductas y sentimientos que incluye agresividad fsica y
verbal,ysentimientosdeirayhostilidad.

252

TRABAJOS COMPLETOS

Asercin.Capacidaddelindividuoparaladefensadesusderechosenlasrelaciones
interpersonales;msconcretamente,hacereferenciaalasrelacionesdelosadolescentes
conpersonaldeservicios(camarerosydependientes),yconconocidosydesconocidos
enlacalle.
Instrumentos
Cuestionario sobre Situaciones de maltrato en la pareja que los adolescentes han
ejercidoointentado(SMPAE).DazAguado,MartnezyMartn,2010.
Cuestionario sobre Situaciones de maltrato en la pareja que las adolescentes han
sufrido(SMPAS).DazAguado,MartnezyMartn,2010.
Escala de Deteccin de Sexismo en Adolescentes (DSA). Cuadrado, Recio y Ramos,
2005.
Cuestionario de Agresin (AQ). Buss y Perry, 1992 (Adaptacin de Andreu, Pea y
Graa,2002).
EscalaAsercindelCuestionariodeEvaluacindeDificultadesInterpersonalesen
laAdolescencia(CEDIA).Ingls,MndezeHidalgo(2000).
Procedimiento
Se elaboraron dos cuadernillos distintos, segn fueran a ser cumplimentados por los
chicosoporlaschicas.Elcuadernilloacumplimentarporloschicos,estabaintegrado
por (1) el cuestionario SMPEA, (2) la escala DSA y (3) el AQ. El cuadernillo a
cumplimentar por las chicas, estaba integrado por (1) el cuestionario SMPAS, (2) la
escala DSA y (3) la escala de asercin del CEDIA. La recogida de datos fue realizada
por los profesores de los distintos grupos en el aula donde ordinariamente reciben
claselosalumnos.
Anlisisestadsticos
Se llev a cabo el anlisis de fiabilidad de los instrumentos utilizados (coeficiente de
fiabilidad de Cronbach y correlaciones temtotal corregidas), se hallaron las
frecuencias y porcentajes de las diferentes situaciones de maltrato, y se utiliz la
regresin lineal mltiple para el anlisis de las relaciones entre las variables
independientes sexismo, agresin y asercin, y las variables dependientes VMEA y
VMSA, y la regresin lineal simple para el anlisis de las variables dependientes
agresinyasercinylavariabledependientesexismo.
RESULTADOS
Fiabilidad de los instrumentos de medida. Se obtuvieron coeficientes de fiabilidad
elevadosenlaescalaDSAyenloscuestionariosAQySMPAE.Loscoeficientesde
fiabilidad fueron menores en el cuestionario SMPAS y la Escala de Asercin del
CEDIA.

253

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Grfica 1: Porcentajes de las distintas situaciones de maltrato

Frecuenciadelmaltratohacialamujerenlaadolescencia
El7.88%deloschicosyel12.29%delaschicasmanifiestanhaberinfringidoosufrido,
respectivamente, algn tipo de maltrato a sus parejas, siendo las situaciones ms
comunes:
(1) los intentos de controlar hasta el ms mnimo detalle, (2) el intento de aislar de
amistadesy(3)losinsultosyridiculizaciones.
Relacionesentrelasvariablesdelestudio
Se obtuvo una correlacin positiva y estadsticamente significativa entre VMEA y
sexismo,yentreVMEAyagresin.Loscoeficientesderegresinparcialylaspruebast
de significacin indican una mayor importancia de la variable sexismo en la
explicacindelaviolenciahacialamujerejercidaporloschicos.
EncuantoalavariableViolenciahacialaMujerSufridaporlasAdolescentes(VMSA)
se obtiene una correlacin positiva con la variable sexismo, mientras que la variable
asercinnoresultasignificativa.
Porltimo,seobtieneunacorrelacinpositivaysignificativaentresexismoyagresin,
mientrasquelacorrelacinentresexismoyasercinnoresultasignificativa.

254

TRABAJOS COMPLETOS

Tabla 1: Correlaciones y coeficientes de regresin parcial de las variables

CONCLUSIONESYDISCUSIN
Este trabajo deja de manifiesto que el maltrato hacia la mujer es un problema
preocupante durante la adolescencia, siendo la violencia psicolgica la forma ms
comnenestaetapa,yquelascreenciasyactitudessexistasjueganunpapelrelevante
enestetipodeviolencia,tantodesdeelpuntodevistadelagresorcomodelavctima.
En cuanto a las caractersticas individuales de los/las adolescentes, por s mismas, no
resultan relevantes en la explicacin de la violencia hacia la mujer. En el caso de los
chicos,lavariableagresinsoloresultarelevanteporsuinteraccinconlascreenciasy
actitudessexistas.Enelcasodelaschicas,lavariableasercincarecederelevanciapara
explicarlaviolenciaquesufrenstasensusrelacionesdepareja.
Porltimo,lascreenciasyactitudessexistasestnrelacionadasengranmedidaconlos
comportamientosagresivosenloschicos,loquesugiereuncomponentesociocultural
delmaltratohacialamujeryexplicalamayorfrecuenciademaltratodelhombrehacia
lamujerqueviceversa.Sinembargo,noseobservaunarelacinsignificativaentrelas
creenciasyactitudessexistasdelaschicasysucapacidadparadefendersusderechos
en las relaciones interpersonales, lo que contradice lo esperado desde el modelo
masculinotradicional,queprediceconductasdeobedienciaypasividadenlasnias.

REFERENCIAS
Andreu,J.M.,Pea,M.E.yGraa,J.L.(2002).Adaptacinpsicomtricadelaversinespaola
delCuestionariodeAgresin.Psicothema,vol.14,n2,pp.476482.
AsambleaGeneraldelaONU(1993).DeclaracinsobrelaEliminacindelaViolenciacontrala
Mujer.Resolucin48/104,20dediciembrede1993.
Bennet,H.,Cohen,R.yEllard,J.H.(1991).Copingwithanabusiverelationship:Howandwhy
dowomenstay?Journalofmarriageandthefamily,53(2),311325.
Bosch,E.yFerrer,V.A.(2002).Lavozdelasinvisibles.Lasvctimasdeunmalamorquemata.
Madrid:Ctedra.
Buss, A.H. yPerry,M.(1992). Theaggressionquestionnaire. Journal of Personality andSocial
Psychology,63,452459.
Corsi, J. (1995). Violencia masculina en la pareja. Una aproximacin al diagnstico y a los
modelosdeintervencin.BuenosAires:Paids.

255

II FORO DE INVESTIGADORES NOVELES DE LA FACULTAD DE PSICOLOGA. UNED

Cuadrado,I.,Recio,P.yRamos,E.(2005).Elsexismoenadolescentes:depuracindeunaescala.
Ponencia presentada en el Simposium Mtodos y tcnicas de investigacin en
PsicologaSocial,IXCongresodeMetodologadelasCienciasSocialesydelaSalud.
Granada,1416deseptiembrede2005.
DazAguado,M.J.,Martnez,R.yMartn,J.(2010).IgualdadyPrevencindelaViolenciade
Gnero en la Adolescencia. Delegacin del Gobierno para la Violencia de Gnero.
MinisteriodeIgualdaddelGobiernodeEspaa.
Echebura, E. y FernndezMontalvo, J. (1998). Hombres maltratadores. Aspectos tericos. En
E.EcheburayP.Corral(Eds.),Manualdeviolenciafamiliar(pp.7390).Madrid:Siglo
XXI.
Heise, L. L. (1997). La violencia contra la mujer. Organizacin global para el cambio. En J. L.
EdlesonyZ.C.Eisikovits.Violenciadomstica:Lamujergolpeadaylafamilia(pp.19
58).Barcelona:Granica(Original1996).
Ingls,C.J.,Mndez,F.X.eHidalgo,M.D.(2000).CuestionariodeEvaluacindeDificultades
InterpersonalesenlaAdolescencia.Psicothema,vol.12,n3,pp.390398.
Sanmartn,J.(2003).Violenciadomstica.JornadasdelDaInternacionalcontraelmaltratoalas
mujeres.Mlaga,6y7denoviembre.
Walker,L.(1979).Thebatteredwoman.NewYork:HarperandRow.

256