Está en la página 1de 45

24/8/2015

DOFDiarioOficialdelaFederacin

NORMAOficialMexicanaNOM015SSA22010,Paralaprevencin,tratamientoycontroldeladiabetesmellitus.
AlmargenunselloconelEscudoNacional,quedice:EstadosUnidosMexicanos.SecretaradeSalud.
MAURICIO HERNANDEZ AVILA, Subsecretario de Prevencin y Promocin de la Salud y Presidente del Comit
ConsultivoNacionaldeNormalizacindePrevencinyControldeEnfermedades,confundamentoenlosartculos39dela
LeyOrgnicadelaAdministracinPblicaFederal4delaLeyFederaldeProcedimientoAdministrativo3o.fraccionesII,
XIVyXVIII,13apartadoA),fraccinI,158,159,160y161delaLeyGeneraldeSalud38,fraccinII,40,fraccionesIIIyXI,
41,47fraccinIVy51delaLeyFederalsobreMetrologayNormalizacin28y33delReglamentodelaLeyFederalsobre
MetrologayNormalizacin8fraccinV,10fraccionesVIIyXVIy45fraccinVII,delReglamentoInteriordelaSecretarade
Salud,mepermitoordenarlapublicacinenelDiarioOficialdelaFederacindela:
NORMAOFICIALMEXICANANOM015SSA22010,PARALAPREVENCION,TRATAMIENTOY
CONTROLDELADIABETESMELLITUS
CONSIDERANDO
Queconfecha24demarzode2009,encumplimientodeloprevistoenelartculo46,fraccinIdelaLeyFederalsobre
Metrologa y Normalizacin, el Centro Nacional de Vigilancia Epidemiolgica y Control de Enfermedades (CENAVECE),
ahora, Centro Nacional de Programas Preventivos y Control de Enfermedades (CENAPRECE), present al Comit
ConsultivoNacionaldeNormalizacindePrevencinyControldeEnfermedades, el anteproyecto de la presente Norma
OficialMexicana.
Que con fecha 23 de junio de 2009, el Comit Consultivo Nacional de Normalizacin de Prevencin y Control de
Enfermedades aprob el Proyecto de Modificacin a la Norma y, con fundamento en el artculo 47 fraccin I de la Ley
FederalsobreMetrologayNormalizacin,sepublicel20deoctubrede2009enelDiarioOficialdelaFederacin,aefecto
dequedentrodelossiguientessesentadasposterioresadichapublicacin,losinteresadospresentaransuscomentarios
alComitConsultivoNacionaldeNormalizacindePrevencinyControldeEnfermedades.
Que las respuestas a los comentarios recibidos por el mencionado Comit, fueron publicadas previamente a la
expedicindeestaNormaenelDiarioOficialdelaFederacin,enlostrminosdelartculo47,fraccinIIIdelaLeyFederal
sobreMetrologayNormalizacin.
Que en atencin a las anteriores consideraciones, contando con la aprobacin del Comit Consultivo Nacional de
NormalizacindePrevencinyControldeEnfermedades,seexpidelasiguiente:NormaOficialMexicanaNOM015SSA2
2010,Paralaprevencin,tratamientoycontroldeladiabetesmellitus.
PREFACIO
EnlaelaboracindeestaNormaOficialMexicanaparticiparonlasunidadesadministrativaseinstitucionessiguientes:
SECRETARIADESALUD

CentroNacionaldeProgramasPreventivosyControldeEnfermedades
DireccinGeneraldeCalidadyEducacinenSalud
CentroNacionaldeEquidaddeGneroySaludReproductiva
DireccinGeneraldePromocinalaSalud
DireccinGeneraldeComunicacinSocial
ComisinCoordinadoradeInstitutosNacionalesdeSaludyHospitalesdeAltaEspecialidad
InstitutoNacionaldeCienciasMdicasydeNutricinSalvadorZubirn
InstitutoNacionaldeCardiologaIgnacioChvez
HospitalGeneraldeMxico
SecretariadodelConsejoNacionaldeSalud
SECRETARIADELADEFENSANACIONAL

DireccinGeneraldeSanidad
SECRETARIADEMARINA

DireccinGeneralAdjuntadeSanidadNaval
SECRETARIADECOMUNICACIONESYTRANSPORTES

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

1/45

24/8/2015

DOFDiarioOficialdelaFederacin

DireccinGeneraldeProteccinyMedicinaPreventivaenelTransporte
INSTITUTOMEXICANODELSEGUROSOCIAL

UnidaddeSaludPblica
CoordinacindeProgramasIntegradosdeSalud
CoordinacindeSaludenelTrabajo
CoordinacindeAtencinMdica
CoordinacindePlaneacineInfraestructuraMdica
CoordinacindeEducacinMdica
CoordinacindeInvestigacinMdica
CoordinacindePrestacionesEconmicasySociales
CoordinacinGeneraldelProgramaIMSSOportunidades
INSTITUTODESEGURIDADYSERVICIOSSOCIALESDELOSTRABAJADORESDELESTADO
SISTEMANACIONALPARAELDESARROLLOINTEGRALDELAFAMILIA
PETROLEOSMEXICANOS

GerenciadeServiciosMdicos
Secretaras de Salud de los estados de Aguascalientes, Baja California, Baja California Sur, Campeche, Coahuila,
Colima, Chiapas, Chihuahua, Distrito Federal, Durango, Guanajuato, Guerrero, Hidalgo, Jalisco, Mxico, Michoacn,
Morelos, Nayarit, Nuevo Len, Oaxaca, Puebla, Quertaro, Quintana Roo, San Luis Potos, Sinaloa, Sonora, Tabasco,
Tamaulipas,Tlaxcala,Veracruz,YucatnyZacatecas.
UNIVERSIDADNACIONALAUTONOMADEMEXICO

FacultaddeMedicinadelaUNAM
INSTITUTOPOLITECNICONACIONAL

EscuelaSuperiordeMedicina
ORGANIZACIONPANAMERICANADELASALUD,ProgramadeEnfermedadesnoTransmisiblesyPromocindelaSaludOPS/MEX
FEDERACIONMEXICANADEDIABETES,A.C.
SOCIEDADMEXICANADENUTRICIONYENDOCRINOLOGIA,A.C.
COLEGIODEMEDICINAINTERNADEMEXICO,A.C.
ASOCIACIONNACIONALMEXICANADEEDUCADORESENDIABETES,A.C.
CENTRODEESTUDIOSENDIABETES,A.C.
COMITEINTERDISCIPLINARIODEDIABETES,OBESIDADYPREVENCIONDEENFERMEDADESCARDIOVASCULARES,A.C.
CAMARADELAINDUSTRIAFARMACEUTICA,A.C.
SOCIEDADDENUTRIOLOGIA,A.C.
COLEGIOMEXICANODENUTRIOLOGOS,A.C.
FUNDACIONMEXICANAPARALASALUD,A.C.

INDICE

Introduccin
Objetivoycampodeaplicacin
Referencias
Definiciones
Smbolosyabreviaturas
Generalidades
Clasificacin
Diabetesmellitus
Prevencin

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

2/45

24/8/2015

DOFDiarioOficialdelaFederacin

Deteccin
Diagnstico
Tratamientoycontrol
Referenciaalespecialistaoalsegundoniveldeatencin
Otrasformasdediabetes
Vigilanciaepidemiolgica
Bibliografa
Concordanciaconnormasinternacionalesymexicanas
ObservanciadelaNorma
Vigencia
Apndicesnormativos
Apndicesinformativos
0.Introduccin
La epidemia de la diabetes mellitus (DM) es reconocida por la Organizacin Mundial de la Salud (OMS) como una
amenazamundial.Secalculaqueenelmundoexistenmsde180millonesdepersonascondiabetesyesprobableque
estacifraaumenteamsdeldoblepara2030.En2005seregistraron1.1millonesdemuertesdebidasaladiabetes,delas
cuales alrededor de 80% ocurrieron en pases de ingresos bajos o medios, que en su mayora se encuentran menos
preparadosparaenfrentarestaepidemia.
De acuerdo a los resultados de la Encuesta Nacional de Salud 2000 (ENSA), la prevalencia nacional de diabetes
mellitusenhombresymujeresadultosdemsde20aosfuede7.5%(IC95%7.17.9),loquerepresenta3.6millonesde
casos prevalentes, de los cuales 77% contaba con diagnstico mdico previo. Laprevalencia fue ligeramente mayor en
mujeres(7.8%)respectodeloshombres(7.2%).
De conformidad con la informacin de la Encuesta Nacional de Salud y Nutricin 2006 (ENSANUT) la prevalencia
aumenta14%,loquerepresentauntotalde8millonesdepersonascondiabetesenlapoblacinurbana,laprevalencia
fuesignificativamentemayor.
EnMxico,laDMocupaelprimerlugarennmerodedefuncionesporao,tantoenhombrescomoenmujereslastasas
demortalidadmuestranunatendenciaascendenteenambossexosconmsde70milmuertesy400,000casosnuevos
anuales cabe sealar que segn la Direccin General de Informacin en Salud en el 2007 hubo un nmero mayor de
defuncionesenelgrupodelasmujeres(37,202muertes)comparadoconeldeloshombres(33,310),conunatasa69.2por
100,000habitantesenmujeresyde64enhombres,diferenciasimportantesaconsiderarenlasaccionespreventivas,de
deteccin, diagnstico y tratamiento de este padecimiento. La diabetes no es un factor de riesgo cardiovascular. Es un
equivalentedeenfermedadcardiovasculardebidoaqueelriesgodesufrirundesenlacecardiovascularesigualaldela
cardiopataisqumica.
La DM es un padecimiento complejo que lleva implcito una serie de situaciones que comprometen elcontrol en los
pacientes,locualfavoreceeldesarrollodecomplicaciones,conlosconsecuentestrastornosenlacalidaddevida,muertes
prematuraseincrementoenloscostosdeatencinytasasdehospitalizacin.Aligualqueotrospases,Mxicoenfrenta
problemas diversos que limitan la eficacia de los programas institucionales para la contencin de esta enfermedad.
Destacanporsuimportanciaelinsuficienteabastodemedicamentos, equipo inadecuado y obsoleto en las unidades de
salud, la inaccesibilidad a exmenes de laboratorio, deficiencias en el sistema de referencia y contrarreferencia de
pacientes,limitacionesdelosserviciosdeapoyopsicolgico,nutricional,nulapromocindeactividadfsica,automonitoreo
yescasasupervisindelosserviciosparaalcanzarlaadherenciateraputica.
Eldescontrolmetablicoylasconsecuentescomplicacionesseagravancuandoenlosserviciosdesaludnoserealiza
unaeficienteyoportunadeteccinyseguimientodegruposconfactoresderiesgo,aunadoaqueenlapoblacinhayuna
percepcininadecuadaydesconocimientodelriesgoparadesarrollardiabetes.Loanteriordalugaraquenoserealiceun
diagnsticooportunoyaquenosedlaprontaincorporacindelospacientesdetectadosaltratamiento.
Por consiguiente, se debe sealar la asociacin de altas tasas de comorbilidad que inciden en la gravedad de la
diabetesylapresenciacadavezmayordecomplicacionesmicroymacrovascularesporlafaltadediagnsticoytratamiento
oportunos y de seguimiento a los pacientes. La escasa utilizacin de intervenciones eficaces deriva en que hasta el
momento no se ha utilizado la evidencia cientfica disponible en la materia como base para una mejor atencin. La
insuficienciaderecursosesotrodelosfactoresqueincidenenlamagnituddeladiabetesenMxicoyenelcumplimiento
delosobjetivosdelosprogramasestatales.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

3/45

24/8/2015

DOFDiarioOficialdelaFederacin

LaaplicacindeestaNormaOficialMexicanacontribuirareducirlaelevadaincidenciadelaenfermedad,aevitaro
retrasarsuscomplicacionesyadisminuirlamortalidadasociadaaestacausa.
1.Objetivoycampodeaplicacin
1.1EstaNormaOficialMexicanatieneporobjetoestablecerlosprocedimientosparalaprevencin,tratamiento,control
deladiabetesylaprevencinmdicadesuscomplicaciones.
1.2 Esta Norma Oficial Mexicana es de observancia obligatoria en el territorio nacional para los establecimientos y
profesionales de la salud de los sectores pblico, social y privado que presten servicios deatencin a la diabetes en el
SistemaNacionaldeSalud.
2.Referencias
ParalacorrectaaplicacindelapresenteNormaOficialMexicanaesnecesarioconsultarlassiguientesnormasoficiales
mexicanas:
2.1NormaOficialMexicana017SSA21994,Paralavigilanciaepidemiolgica.
2.2NormaOficialMexicana168SSA11998,Delexpedienteclnico.
2.3NormaOficialMexicana174SSA11998,Paraelmanejointegraldelaobesidad.
2.4 Norma Oficial Mexicana 030SSA22009, Para la prevencin, deteccin, diagnstico, tratamiento y control de la
hipertensinarterialsistmica.
2.5NormaOficialMexicana037SSA22002,Paralaprevencinycontroldelasdislipidemias.
2.6 Norma Oficial Mexicana 043SSA22005, Servicios bsicos de salud. Promocin y educacin para la salud en
materiaalimentaria.Criteriosparabrindarorientacin.
2.7 Norma Oficial Mexicana NOM086SSA11994, Bienes y Servicios. Alimentos y bebidas no alcohlicas con
modificacionesensucomposicin.Especificacionesnutrimentales.
3.Definiciones
ParalosefectosdeestaNormaseentiendepor:
3.1ActividadFsica,alosactosmotorespropiosdelserhumano,realizadacomopartedesusactividadescotidianas.
3.2Alteracindelmetabolismo,alaalteracindelmetabolismodeprotenas,grasasycarbohidratosquesecaracteriza
pornivelesdeglucosaalterada,enayuno,oalaintoleranciaalaglucosaambascondicionessonprocesosmetablicos
intermediosentrelaausenciaylapresenciadediabetes.
3.3 Angiopata diabtica, a la alteracin de los vasos sanguneos que aparece como complicacin crnica de la
diabetes.Existendosclases:lamacroangiopata(aterosclerosis)ylamicroangiopata(alteracindelospequeosvasos).
3.4Arteriosclerosis,alendurecimientodelasarterias.
3.5Aterosclerosis,alavariedaddearteriosclerosis,enlaqueexisteinfiltracindelantimaconmacrfagoscargados
degrasa,proliferacindeclulasmuscularesconfibrosisyreduccindelaluzdelvasosanguneo.Algunasplacaspueden
llegaracalcificarse.Existedaoendotelialypredisposicinparalaformacindetrombos.Esunadelascomplicaciones
msfrecuentesdeladiabetesehipertensinarterialycausaimportantedemuerte.
3.6 Automonitoreo es el anlisis de glucosa (azcar) que las personas con diabetes realizan en su casa, lugar de
trabajo,escuela,ocualquierotrolugar,deacuerdoalasindicacionesdesuprofesionaldelasalud.Parahacerlosedebe
deutilizarglucmetrosyaquelamedicindelaglucosaenorinanoesaceptable.
3.7Ayuno,alaabstinenciadeingestacalrica,porunlapsodetiempode8hrs.
3.8Casoconfirmadodediabetes,alapersonacuyodiagnsticosecorroborapormediodellaboratorio:unaglucemia
plasmticaenayuno126mg/dl:unaglucemiaplasmticacasual200mg/dlobienunaglucemia200mg/dlalasdos
horasdespusdeunacargaoralde75gdeglucosaanhidradisueltaenagua,criterios diagnsticos de diabetes, en el
SistemaNacionaldeSalud.
3.9Casodeprediabetes,alapersonaconantecedentedepadreomadreoambosconestadometablicointermedio
entre el estado normal y la diabetes. El trmino prediabetes se aplica a los casos tantode Glucosa Anormal en Ayunas
(GAA),comoalosdeIntoleranciaalaGlucosa(ITG),segnloscriteriosdiagnsticosenelSistemaNacionaldeSalud.
3.10Casoencontrol,alpacientebajotratamientoenelSistemaNacionaldeSalud,quepresentademaneraregular,
nivelesdeglucemiaplasmticaenayunodeentre70y130mg/dlodeHemoglobinaGlucosilada(HbA1c)pordebajode
7%.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

4/45

24/8/2015

DOFDiarioOficialdelaFederacin

3.11 Caso en control metablico, al paciente bajo tratamiento en el Sistema Nacional de Salud, que presenta de
maneraregular,glucosaenayunonormal,IMCmenora25,lpidosypresinarterialnormales.
3.12Casoendescartado,alcasosospechosooprobableenquienporestudiosdelaboratoriosedeterminancifrasde
glucemianodiagnsticasdediabetesmellitus,presentasignososntomaspropiosdecualquierotropadecimientooevento
diferenteadiabetesmellitus,enellospuedeonohaberconfirmacinetiolgicadeotrodiagnstico.Aquelquenocumple
conloscriteriosdecasoprobable(siessospechoso)oconfirmado(siesprobable)
3.13Casosospechoso,alapersonaconfactoresderiesgocomunesparaenfermedadesnotransmisibles:edad(mayor
de20aos),antecedenteheredofamiliar(padresy/ohermanos),sobrepesouobesidad,circunferenciaabdominalmayorde
80cmenmujereso90cmenhombres,hijomacrosmicoenmujeres,hipertensinarterial.
3.14Casoprobable,alapersonaqueenelexamendedeteccin,presentaunaglucemiacapilarenayuno>100mg/dl,
ounaglucemiacapilarcasual>140mg/dl.
3.15Cetosis,alaacumulacindecuerposcetnicosenlostejidosylquidoscorporales.
3.16Cetoacidosis,alacomplicacinaguda,pordeficienciaabsolutaorelativadelasecrecindeinsulina.Talsituacin
conducealcatabolismodelasgrasascomofuentedeenerga,produciendolaformacindecuerposcetnicoslocualse
manifiestacomoacidosismetablica.
3.17Comunicacineducativaensalud,alprocesoydesarrollodeesquemasnovedososycreativosdecomunicacin
sustentadoentcnicasdemercadotecniasocial,quepermitenlaproduccinydifusindemensajesdealtoimpacto,conel
findereforzarlosconocimientosrelativosalasaludypromoverconductassaludablesenlapoblacin.
3.18 Deporte, a la actividad institucionalizada y reglamentada, desarrollada en competiciones que tiene por objeto
lograrelmximorendimiento.
3.19Deteccinotamizaje,alabsquedaactivadepersonascondiabetesnodiagnosticadaobienconalteracindela
glucosa.
3.20 Diabetes, a la enfermedad sistmica, crnicodegenerativa, de carcter heterogneo, con grados variables de
predisposicin hereditaria y con participacin de diversos factores ambientales, y que se caracteriza por hiperglucemia
crnica debido a la deficiencia en la produccin o accin de la insulina, lo queafecta al metabolismo intermedio de los
hidratosdecarbono,protenasygrasas.
3.21Diabetesgestacional:eslaalteracinenelmetabolismodeloshidratosdecarbonoquesedetectaporprimera
vezduranteelembarazo,statraduceunainsuficienteadaptacinalainsulinoresistenciaqueseproduceenlagestante.
3.22Diabetestipo1,altipodediabetesenlaqueexistedestruccindeclulasbetadelpncreas,generalmentecon
deficienciaabsolutadeinsulina.Lospacientespuedenserdecualquieredad,casisiempredelgados y suelen presentar
comienzoabruptodesignosysntomasconinsulinopeniaantesdelos30aosdeedad.
3.23Diabetestipo2,altipodediabetesenlaquesepresentaresistenciaalainsulinayenformaconcomitanteuna
deficienciaensuproduccin,puedeserabsolutaorelativa.Lospacientessuelensermayoresde30aoscuandosehace
eldiagnstico,sonobesosypresentanrelativamentepocossntomasclsicos.
3.24 Diagnstico de prediabetes, a la presencia de una o ambas de las alteraciones en la glucosa sangunea
mencionadas con anterioridad: Glucosa Anormal en Ayuno e Intolerancia a la Glucosa. Estas alteraciones pueden
presentarseenformaaisladaobienenformacombinadaenunamismapersona.
3.25Dieta,alconjuntodealimentosqueseconsumenalda.
3.26Educadorendiabetes,alprofesionaldelasaludcapacitadoeneducacinteraputicaendiabetes,quetrabajaen
colaboracinconelolamdicotratante.
3.27Educacinparalasalud,alprocesodeenseanzaaprendizajequepermite,medianteelintercambioyanlisisde
lainformacin,desarrollarhabilidadesycambiaractitudes,conelpropsitodeinducircomportamientosparacuidarlasalud
individualycolectiva.
3.28EducacinFsica,alprocesopormediodelcualseadquiere,transmiteyacrecientalaculturadeactividadfsica.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

5/45

24/8/2015

DOFDiarioOficialdelaFederacin

3.29Edulcorantesoendulzantesnutritivosononutritivos,alosproductosque,enelprimercaso,aportanenergaala
dieta e influyen sobre los niveles de insulina y glucosa entre stos se incluyen sacarosa, fructosa, dextrosa, lactosa,
maltosa, miel, jarabe de maz, concentrados de jugos de frutas y otros azcares derivados de los alcoholes, como los
poliolesenelsegundocaso,alosedulcorantesnonutritivosquesonendulzantespotentes,suaporteenergticoesmnimo
ynoafectanlosnivelesdeinsulinaoglucosasrica,porejemplo:sacarina,asprtame,acesulfamedepotasioysucralosa.
3.30Factorderiesgo, al atributo o exposicin de una persona, una poblacin o el medio, que estnasociadosala
probabilidaddelaocurrenciadeunevento.
3.31 Gnero, al conjunto de atributos sociales que se le asignan a las personas (formas de comportarse, valores,
normas,actividadesarealizar,recompensas,sulugarenelmundo),segnhayasidoidentificadocomo hombre o como
mujer.Dichosatributossonsocialmenteconstruidos,porloquecadacultura,segnlapoca y el grupo social, le da un
sentidodiferentealoquesignificaserhombreysermujer.
3.32 Glucemia casual, al nivel de glucosa capilar o plasmtica, a cualquier hora del da, independientemente del
periodotranscurridodespusdelaltimaingestindealimentos.
3.33Glucemiaderiesgoparadesarrollarcomplicacionescrnicas,>111mg/dlenayunoy>140mg/dlenelperiodo
posprandialinmediato.
3.34GlucosaAnormalenAyuno,glucosadeayuno>a100y<a125mg/dl.
3.35 Glucotoxicidad, a la hiperglucemia sostenida > 250 mg/dl, que inhibe la produccin y accin perifrica de la
insulinaquefavorecelaapoptosis(muertecelular)delasclulasbeta.
3.36GrasasTrans, a las grasas lquidas como los aceites que se hidrogenan qumicamente. Aumentan elcolesterol
LDLyreducenelcolesterolHDL.
3.37GruposdeAyudaMutua,alaorganizacindelasylospacientesquebajolasupervisinmdicayconelapoyode
los servicios de salud, sirve de escenario para la capacitacin necesaria en el control de lasenfermedades crnicas no
transmisible,facilitalaeducacinyautocuidadodelasalud.
3.38 Grupos de apoyo, a los grupos de personas con una enfermedad similar que se encuentran para intercambiar
opinionessobrelamejormaneradeenfrentarsuosusenfermedadesotratamiento.
3.39Hiperglucemiaenayuno,alaelevacindelaglucosaporarribadelonormal(>100mg/dl),duranteelperiodode
ayuno.Puedereferirsealaglucosaalteradaenayunooalahiperglucemiacompatiblecondiabetes,dependiendodelas
concentracionesdeglucosasegnloscriteriosespecificadosenestaNorma.
3.40Hiperglucemiaposprandial,alaglucemia>140mg/dl,doshorasdespusdelacomida.
3.41Hipoglucemia, al estado agudo en el que se presentan manifestaciones secundarias a descargasadrenrgicas
(sudoracin fra, temblor, hambre, palpitaciones y ansiedad), o neuroglucopnicas (visin borrosa, debilidad, mareos)
debido a valores subnormales de glucosa, generalmente <6050 mg/dl. Pueden aparecer sntomas sugestivos de
hipoglucemiacuandosereducenestadosdehiperglucemiasinllegaradescenderhastalos50mg/dl.
3.42 Hemoglobina glicada (glucosilada), a la prueba que utiliza la fraccin de la hemoglobina que interacciona
combinndoseconlaglucosacirculante,paradeterminarelvalorpromediodelaglucemiaenlasltimas12semanas.
3.43IndicedeMasaCorporalondicedeQuetelet,alpesocorporalenkilogramos,divididoentrelaestaturaenmetros
elevadaalcuadrado(Kg/m2).
3.44Individuoenriesgo,alapersonaconunoovariosfactoresparallegaradesarrollardiabetes.
3.45Ingresos, a los casos nuevos que se incorporan a tratamiento en una unidad mdica del Sistema Nacional de
Salud.
3.46 Instrumento de deteccin, al procedimiento o prueba para identificar a sujetos sospechosos de tener la
enfermedad,cuyasensibilidadyespecificidadhansidodebidamenteestablecidasenunapruebadevalidacin, tomando
comoparmetrodereferenciaelmtodoaceptadoparapruebasdiagnsticas.
3.47IntoleranciaalaGlucosa,alosnivelesdeglucosa2horaspostcargaoralde75gramosdeglucosaanhidra>140
y<199mg/dl.
3.48Microalbuminuria,alaexcrecinurinariaentre30y300mgalbmina/gcreatinina.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

6/45

24/8/2015

DOFDiarioOficialdelaFederacin

3.49Nefropatadiabtica,alacomplicacinrenaltardadeladiabetes.Serefierealdaopredominantementedetipo
glomerular,concompromisointersticialfrecuentementeseaadedaoporhipertensinarterialydebedevalorarsealos5
aosdeldiagnsticoendiabetestipo1yalmomentodeldiagnsticoenladiabetestipo2.
3.50Neuropatadiabtica, a la neuropata somtica que afecta los nervios sensitivos y motoresvoluntarios y puede
corresponder a un dao difuso (polineuropata) o localizado en un nervio (mononeuropata). La neuropata autonmica
(visceral) se manifiesta por diarrea, gastroparesia, vejiga neurognica, disfuncin erctil e hipotensin ortosttica, entre
otrascomplicaciones.Debedevalorarsealos5aosdeldiagnsticoendiabetestipo1yalmomentodeldiagnsticoenla
diabetestipo2.Elsubdiagnsticopermitelaevolucindelasalteracioneshastaextremospeligrososparalafuncindelpie
omanodaadaeinclusolavida,esrecomendableexplorarlasensibilidadylosreflejosenmanosypies.
3.51Perspectivadegneroenelcampodelasalud,alconceptoqueayudaaescucharycomprenderlasdiferentes
necesidadesyexpectativasdehombresymujeresfrentealcuidadodelasaludylaenfermedadalacudirauncentrode
saludademscondicionanlarespuestaaltratamientoyelapegoalateraputica.Esunaestrategiadestinadaahacerque
las preocupaciones y las experiencias de las mujeres y los hombres sean un elemento integrante de la elaboracin,
instrumentacin,supervisinyevaluacindepolticasyprogramasafindequeambossebeneficienporigualyseimpida
queladesigualdadseperpete.
3.52Participacinsocial,alprocesoquepermiteinvolucraralapoblacin,autoridadeslocales,institucionespblicasy
lossectoressocialyprivadoenlaplaneacin,programacin,ejecucinyevaluacindelosprogramasyaccionesdesalud,
conelpropsitodelograrunmayorimpactoyfortalecerelSistemaNacionaldeSalud.
3.53PesocorporaldeacuerdoconelIMC(kg/m2),alaclasificacindelasiguientemanera:IMC>18.5y<24.9,peso
normalIMC>25y<29.9,sobrepesoIMC>30,obesidad.
3.54Primerniveldeatencin,alasunidadesdeprimercontactodelpacienteconlosserviciosdesalud,quellevana
cabolasaccionesdirigidasalcuidadodelindividuo,lafamilia,lacomunidadysuambientesusserviciosestnenfocados
bsicamentealapromocindelasalud,aladeteccinyaltratamientotempranodelasenfermedades.
3.55Promocindelasalud,alprocesoquepermitefortalecerlosconocimientos,aptitudesyactitudesdelaspersonas
paraparticiparcorresponsablementeenelcuidadodesusaludyparaoptarporestilosdevidasaludables, facilitando el
logroylaconservacindeunadecuadoestadodesaludindividualycolectivamedianteactividadesdeparticipacinsocial,
comunicacineducativayeducacinparalasalud.
3.56 Proteinuria clnica o macroalbuminuria, a la excrecin urinaria > 300 mg de albmina por da o ms de 200
mg/min.
3.57Racinoporcin,alacantidaddealimentosexpresadaendiferentesmedidasdeusocomnparacadagrupode
alimentosqueseutilizaparalaprescripcindiettica.
3.58Reingreso,alaoalpacientequedespusdecausarbaja,porcambiodedomicilio,rechazoaltratamiento, por
haberse perdido o porque expresamente haya solicitado su baja por cualquier motivo, se incorpora nuevamente al
tratamientoenunaunidadmdicadelSectorSalud.
3.59Resistenciaalainsulina,aladisminucindelaefectividaddeestahormonayaseaexgenaoendgena,enlos
tejidosmuscular,hepticoyadiposo.
3.60 Retinopata diabtica, al compromiso de los vasos pequeos, incluyendo los capilares, con aumento de la
permeabilidad,quepermitelasalidadelpidosformandoexudadosduros,obstruccindevasosconinfartos,producindose
los exudados blandos. Puede haber ruptura de vasos, causando micro hemorragias la formacin de nuevos vasos
sanguneosporhipoxiapuedecondicionarhemorragiasmasivas.Sedebeevaluarenlospacientescondiabetestipo1alos
5 aos del diagnstico y en el momento del diagnstico a los pacientes con diabetes tipo 2 posteriormente debe ser
evaluadoanualmente.
3.61Segundoniveldeatencin,alasunidadesqueatiendenlosproblemasdesaludque,acausadesucomplejidad,
nopuedenseratendidosenelprimerniveldeatencin.
3.62Sndromemetablico,alaconstelacindeanormalidadesbioqumicas,fisiolgicasyantropomtricas,queocurren
simultneamenteypuedendaroportunidadoestarligadasalaresistenciaalainsulinay,porende,incrementarelriesgode
desarrollar diabetes mellitus, enfermedad cardiovascular o ambas. Dentro de estas entidades se encuentran: obesidad
abdominal, intolerancia a la glucosa o diabetes mellitus tipo 2, HTA y dislipidemia (hipertrigliceridemia y/o HDL bajo),
conformealApndiceNormativoA.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

7/45

24/8/2015

DOFDiarioOficialdelaFederacin

4.Smbolosyabreviaturas
ElsignificadodelossmbolosyabreviaturasutilizadasenestaNormaeselsiguiente:

AlaninaAminoTransferasa

AntagonistasdelosreceptoresdeAngiotensinaII

AspartatoAminoTransferasa

ElPaneldeTratamientoenAdultoIII

Calora
CentroNacionaldeProgramasPreventivosyControldeEnfermedadesdelaSecretaradeSalud.

ClasificacinInternacionaldeEnfermedades

Curvadetoleranciaalaglucosa

Diabetesmellitus

DiabetesmellitusTipo2

AcidoDesoxirribonuclico

Enzimadipeptidilpeptidasa4

Enzimaconvertidoradeangiotensina

Escaladefactoresderiesgo

Enfermedadcerebrovascular

AgenciadeMedicamentosyAlimentos

Factorderiesgo

Gramo

Glucosaanormaldeayuno

Polipptidoinsulinotrpicodependientedeinsulina

Pptidoparecidoalglucagntipo1

Hemoglobinaglicada(glucosilada)

Lipoprotenasdealtadensidad

3hidroxy3metilglutarilCoenzimaA

Horas

Hipertensinarterial

Infartoagudodelmiocardio

FederacinInternacionaldeDiabetes

Inhibidordelaenzimaconvertidoradeangiotensina

Indicedemasacorporal

Intoleranciaalaglucosa

Kilocalora

Kilogramo

Kilogramoentremetrocuadrado

Lipoprotenasdebajadensidad

Mayorque

Mayoroigualque

Menorque

Menoroigualque

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

8/45

24/8/2015

DOFDiarioOficialdelaFederacin

Metro

Microgramo

Miligramo

Miligramospordecilitro

Minutos

Mililitro

Milmetrosdemercurio

Milimolesporlitro

Diabetestipo2depresentacinenlosjvenes

NormaOficialMexicana

ProtenaNeutradeHagedorn

AsociacindeCardiologadeNuevaYork

Porciento

OrganizacinMundialdelaSalud

Presinarterial

Inhibidordelactivadordeplasmingeno1

Prediabetes

Pruebadeglucosaenayuno

Receptoresactivadosporproliferadoresdeperoxisomas

Pruebadetoleranciaalaglucosaoral

Estudioparaprevenirdiabetesmellitusnoinsulinodependiente

Tiazolidinedionas

Unidadesdeinsulina

Valorcalricototal

Valorenergticototal
5.Generalidades
5.1 Esta Norma define los procedimientos y acciones para la prevencin, deteccin, diagnstico y tratamiento de la
prediabetesydiabetesmellitustipo2ytipo1,tendientesadisminuirlaincidenciadeestaenfermedad y para establecer
programasdeatencinmdicaidneosafindelograruncontrolefectivodelospadecimientosyreducirsuscomplicaciones
ysumortalidad.
5.2Seconsiderancomosntomasclsicosdeladiabetes,alapoliuria,lapolidipsia,lapolifagiaylaprdidadepeso.
6.Clasificacin
6.1ParafinesdeclasificacinyregistroseutilizarlaCIE10.
6.2Confinesdediagnsticoytratamiento,seemplearlasiguienteclasificacin:
6.2.1DiabetesTipo1.
6.2.1.1Mediadainmunitariamente
6.2.1.2Idioptica
6.2.2DiabetesTipo2.
6.2.3Otrostiposespecficos:
6.2.3.1Defectosgenticosenlafuncindelasclulasbeta,quecomprendevariasentidades.
6.2.3.1.1Cromosoma12,HNF1alfa(antesMODY3).
6.2.3.1.2Cromosoma7,glucocinasa(antesMODY2).

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

9/45

24/8/2015

DOFDiarioOficialdelaFederacin

6.2.3.1.3Cromosoma20,HNF4alfa(antesMODY1).
6.2.3.1.4MutacionespuntiformesdelDNAmitocondrialasociadoasordera.
6.2.3.1.5Otros.
6.2.3.2Defectosgenticosenlaaccindelainsulina.
6.2.3.2.1ResistenciaalainsulinatipoA.
6.2.3.2.2Leprecaunismo.
6.2.3.2.3SndromeRabsonMendenhall.
6.2.3.2.4Diabeteslipoatrfica.
6.2.3.2.5Otros.
6.2.3.3Enfermedadesdelpncreasexcrino.
6.2.3.3.1Pancreatitis.
6.2.3.3.2Trauma/pancreatectoma.
6.2.3.3.3Neoplasia.
6.2.3.3.4Fibrosisqustica.
6.2.3.3.5Hemocromatosis.
6.2.3.3.6Pancreatopatafibrocalculosa.
6.2.3.3.7Otras.
6.2.3.4Endocrinopatas
6.2.3.4.1Acromegalia.
6.2.3.4.2SndromedeCushing.
6.2.3.4.3Glucagonoma.
6.2.3.4.4Feocromocitoma.
6.2.3.4.5Hipertiroidismo.
6.2.3.4.6Otras.
6.2.3.5Diabetesinducidaqumicamente,opordrogas.
6.2.3.5.1Vacor.
6.2.3.5.2Pentamidina.
6.2.3.5.3Acidonicotnico.
6.2.3.5.4Glucocorticoides.
6.2.3.5.5Hormonastiroideas.
6.2.3.5.6Diazxido.
6.2.3.5.7Agonistasbetaadrenrgicos.
6.2.3.5.8Tiazidas.
6.2.3.5.9Otros.
6.2.3.6Infecciones.
6.2.3.6.1Rubolacongnita.
6.2.3.6.2Citomegalovirus.
6.2.3.6.3Otros.
6.2.3.7Diabetespococomnmediadainmunitariamente.
6.2.3.7.1Sndromede"stiffman".
6.2.3.7.2Anticuerposcontraelreceptordeinsulina.
6.2.3.7.3Otros.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

10/45

24/8/2015

DOFDiarioOficialdelaFederacin

6.2.3.8Otrossndromesgenticos,algunasvecesasociadoscondiabetes.
6.2.3.8.1SndromedeDown.
6.2.3.8.2SndromedeKlinefelter.
6.2.3.8.3SndromedeTurner.
6.2.3.8.4SndromedeWolfram.
6.2.3.8.5Otros.
6.2.4Diabetesgestacional.
7.DiabetesTipo2
7.1Eslaformamscomndediabetes.Enlosapartados8,9,10y11deestaNOMseestablecenlosprocedimientosde
prevencin,deteccin,diagnsticoytratamientodeestetipodediabetes.
8.Prevencin
8.1Principiosgenerales.
8.1.1 La prevencin de la diabetes y sus complicaciones implica un conjunto de acciones adoptadas para evitar su
aparicinoprogresin.
8.1.2 La prevencin es un pilar que debe evitar la aparicin de la enfermedad, el desarrollo de las complicaciones
agudasycrnicas,paralocualdebellevarseacaboatravsdeunequipomultidisciplinarioyestrechamentevinculadoque
permita,atravsdesusacciones,obtenerimpactosenlasaluddelpacienteconfactoresderiesgoasociadosadiabetes
mellitusoquienesyalapadecen.
8.1.3Deteccindediabetesentrelapoblacingeneralyaquellosquetenganlosfactoresderiesgosealadosenel
numeral8.1.4
8.1.4 Los factores de riesgo son: sobrepeso y obesidad, sedentarismo, familiares de primer grado condiabetes, >45
aos de edad, las mujeres con antecedentes de productos macrosmicos (>4 kg) y/o con antecedentes obsttricos de
diabetesgestacional,mujeresconantecedentedeovariospoliqusticosasimismo,seconsideradentrodeestegrupoalas
personasconhipertensinarterial(>140/90),dislipidemias(colesterolHDL<40mg/dl,triglicridos>250mg/dl),alosylas
pacientesconenfermedadescardiovasculares(cardiopataisqumica,insuficienciavascularcerebral,oinsuficienciaarterial
demiembrosinferiores)yconantecedentesdeenfermedadespsiquitricasconusodeantipsicticos.
8.1.5Laprevencindeladiabetesmellitusserealizaentresniveles:primaria,secundariayterciaria.
8.1.5.1Prevencinprimaria
8.1.5.1.1Tienecomoobjetivoevitareliniciodelaenfermedad.Enlaprctica,prevencinestodaactividadquetiene
lugarantesdelasmanifestacionesdelaenfermedadconelpropsitoespecficodeprevenirsuaparicin.
8.1.5.1.2Existendostiposdeestrategiasdeintervencinprimaria:enlapoblacingeneralyenlapoblacinconfactores
deriesgoasociadosaladiabetes.
8.1.5.1.2.1Enlapoblacinengeneral
8.1.5.1.2.1.1 Medidas destinadas a modificar el estilo de vida y las caractersticas socioambientales, conforme a los
factoresderiesgosealadosenelnumeral8.1.4que,unidasafactoresgenticos,constituyencausasdesencadenantesde
ladiabetes.
8.1.5.1.2.1.2Puestoquelaprobabilidaddebeneficioindividualacortoplazoeslimitada,esnecesarioquelasmedidas
poblacionalesdeprevencinsemantengandemanerapermanenteparaqueseanefectivasalargoplazo.
8.1.5.1.2.1.3 Las acciones de prevencin primaria deben ejecutarse, no slo a travs de actividades mdicas, sino
tambinconlaparticipacinycompromisodelacomunidadyautoridadessanitariasutilizandolosmediosdecomunicacin
masivosexistentesencadaregincomoradio,prensaytelevisin,entreotros.
8.1.5.1.2.1.4 Los factores protectores para la prevencin y control de esta enfermedad consisten en modificar los
cambios en el estilo de vida que abarca reduccin de peso, una adecuada nutricin, la realizacin de ejercicio y la
disminucindelosfactoresderiesgocardiovascular.
8.1.5.1.2.2Enlapoblacinconfactoresderiesgo,sealadosenelnumeral8.1.4.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

11/45

24/8/2015

DOFDiarioOficialdelaFederacin

8.1.5.1.2.2.1 La intervencin inicial y a lo largo del padecimiento se realizar especialmente con tratamiento no
farmacolgicoyconsistiren:
8.1.5.1.2.2.2.1Educacinparalasalud:folletos,revistasyboletines,entreotros.
8.1.5.1.2.2.2.2Promocindelasalud:correccindefactoresdentrodelestilodevida.
8.1.5.1.2.2.2.3 Prevencin y correccin de obesidad: dietas con bajo contenido graso y azcares refinados y alta
proporcindefibraalimentaria.
8.1.5.1.2.2.2.4 Uso racional y prescripcin adecuada de medicamentos diabetognicos, por ejemplo, diurticos,
corticoides,betabloqueadores.
8.1.5.1.2.2.2.5Promocindelejerciciofsicorutinarioyprogramado.
8.1.5.1.2.2.2.6 Integracin a Grupos de Ayuda Mutua, encaminados a que el o la paciente sea responsable de su
autocuidadoypermanentementeseautogestionenenprodesucontrolmetablico.
8.1.5.1.2.2.2.7Usodelaevidenciacientficaatravsdemonofrmacospreventivos,quedisminuyanelporcentaje de
conversin a DMT2, conforme a la Gua de recomendaciones para la promocin de la salud, prevencin, deteccin,
diagnstico,tratamientoycontroldelaprediabetes.
8.1.5.2Prevencinsecundaria.
8.1.5.2.1Estarencaminadaapacientesyaconfirmadoscondiabetesmellitusycuyosobjetivossonevitarlaaparicin
decomplicacionesagudas,yevitaroretrasarlascomplicacionescrnicas.
8.1.5.2.2 Las acciones para cumplir los objetivos propuestos se fundamentan en el control metablico ptimo y
permanentedelaenfermedad.
8.1.5.3PrevencinTerciaria
8.1.5.3.1Estardirigidaapacientesquepresentancomplicacionescrnicasytienecomoobjetivoevitarladiscapacidad
porinsuficienciarenal,ceguera,piediabticoyevitarlamortalidadtempranaporenfermedadcardiovascular.
8.1.5.3.2Estasaccionesrequierendelaparticipacindeprofesionalesespecializadosenlasdiferentescomplicaciones.
8.2Controldepeso
8.2.1Elcontroldepesoesunadelasmetasbsicasparalaprevencindeladiabetes.
8.2.2Lareduccinidealdepesodebeserentreel5%yel10%delpesototal.Debeserunametaanualhastaalcanzar
supesoideal.
8.2.3 El primer paso en el tratamiento de la diabetes en adultos mayores debe ser la instauracin de un rgimen
alimentario que lo conlleve a una disminucin de peso, sobre todo si presentan sobrepeso, para que de esta manera
disminuya el patrn de insulinoresistencia, sin provocar prdida de masa muscular(sarcopenia). Es importante tener en
cuentalaedaddelpaciente,comorbilidadesasociadasonoaladiabetesmellitus,niveldefuncionalidadysoportesocial.
8.3Actividadfsica
8.3.1Laactividadfsicahabitualensusdiversasformas:actividadesdelavidadiaria,trabajonosedentario,recreaciny
ejercicio,tieneunefectoprotectorcontraladiabetes.
8.3.2Portalmotivo,sedeberecomendaralapoblacingeneral,mantenersefsicamenteactivaalolargodelavida,
adoptandoprcticasqueayudenaevitarelsedentarismo.
8.3.3Enelcasodepersonasdevidasedentaria,selesdeberecomendarlaprcticadeejercicioaerbico,enespecial
lacaminata,porlomenos150minutosalasemana.
8.3.4Laaplicacindelaanteriorindicacindeberefectuarsedemaneragradual,acompaadadelasinstrucciones
pertinentessobrelasprecaucionesparaevitarlesionesuotrosposiblesproblemas.
8.3.5Laactividadfsicamsrecomendadaesdetipoaerbico,intensidadleveamoderada,esimportanteaclararque
debeajustarseparapacientesconcardiopataisqumicaoenpacientesqueestnbajotratamientoconbetabloqueadores,
algunoscalcioantagonistascomoelverapamiloydiltiazem,quetomanantiarrtmicos,odigitlicos,entreotras,conformese
estableceenelApndiceNormativoE.
8.3.6Lassesionesdeactividadfsicaserealizarnentresetapasqueson:calentamiento,aerbicayrecuperacin.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

12/45

24/8/2015

DOFDiarioOficialdelaFederacin

8.4Alimentacin
8.4.1 Debe promoverse un tipo de alimentacin que sea til para la prevencin de la diabetes, conforme a las
recomendacionesdelaNormaOficialMexicanaNOM043SSA22005,Serviciosbsicosdesalud.Promocinyeducacin
paralasaludenmateriaalimentaria.Criteriosparabrindarorientacin.
8.4.2 El aporte energtico total debe adecuarse, a fin de mantener un peso adecuado, evitndose planes de
alimentacinconmenosde1200Kcalalda,comosesealaenelApndiceNormativoB.
8.4.3Elvalorcalricototal(VCT)diariodelosalimentosserdeterminadodeacuerdoalApndiceNormativoC.
8.4.4 El VCT derivado de los macronutrimentos para mantener un peso recomendable ser de la siguiente manera:
menos del 30% de las grasas, de lo cual no ms del 7% corresponder a las grasas saturadas, con predominio de las
monoinsaturadas (hasta 15%) 50%60% de hidratos de carbono predominantemente complejos (menos del 10% de
azcares simples), 14 g de fibra por cada 1000 kcal, preferentemente soluble. En promedio 15% de las kcal totales
corresponderaprotenasylaingestindecolesterolnosermayorde200mg/da.
8.4.5Elequipodesaluddeberserdebidamentecapacitadoparapoderestablecerunplandealimentacinadecuadoa
individuos con o sin diabetes, cuando no haya disponibilidad de un nutrilogo o especialistas en nutricin, con
conocimientosendiabetes.
8.4.6 Los productos industrializados que se incluyan en el plan de alimentacin de personas con diabetes, debern
cumplir los lineamientos para productos reducidos en grasa y sodio sealados en la Norma Oficial Mexicana NOM086
SSA11994, Bienes y Servicios. Alimentos y bebidas no alcohlicas con modificaciones en su composicin.
Especificacionesnutrimentales.Surecomendacinsebasarenquenoseanadicionadosconsacarosa,fructosa,glucosa.
8.5Promocindelasalud
8.5.1Elfomentodelosestilosdevidasaludables,necesariosparapreveniroretardarlaaparicindeladiabetes,se
llevaracabomedianteaccionesdepromocindelasalud.
8.5.2Lapromocindelasaludsellevaracaboentrelapoblacingeneral,medianteactividadesdeeducacinparala
salud,departicipacinsocialydecomunicacineducativa,connfasisenmbitosespecficoscomolafamilia,laescuela,la
comunidadygruposdealtoriesgo.
8.6Comunicacinsocial
8.6.1Lapoblacingeneralhabrdeseradecuadayoportunamenteinformada,mediantelosmediosdecomunicacin
social,sobrelosfactoresderiesgoquefavoreceneldesarrollodeladiabetes.
8.6.2Losmensajesalpblicodebenenfatizarqueelcontroldetalesfactorescontribuyeademsalaprevencinyal
controldeotrasenfermedadescrnicasimportantes.
8.6.3Losserviciospblicosdesalud,conapoyodelosserviciosdesaludprivados,efectuarncampaasparaeducara
lapoblacinsobrealimentacin,actividadfsica,obesidadyotrosfactoresderiesgocardiovascular.
8.6.4 Se debe establecer coordinacin con los organismos pblicos y privados, as como con asociaciones de
profesionalesdelacomunicacin,afindedesarrollaraccionesenelcampodelacomunicacineducativa, tendientes a
estimularelcambiohacialaprcticadeestilosdevidasaludables.
8.7Participacinsocial
8.7.1Sedebeestimularlaparticipacincomunitaria,ascomolacolaboracindelosgruposyorganizacionessociales,
parapromoverlaadopcindeestilosdevidasaludables,particularmenteentrelosgruposdemayorriesgo.
8.7.2Atravsdelacoordinacinconinstitucionesydependencias,pblicasyprivadas,ascomoconasociacionesde
profesionalesquetrabajanenelcampodelaactividadfsica,eldeporteyelacondicionamientofsico,sefomentalaprctica
delejercicioyeldeporte,dentrodelapoblacinengeneral.
8.8Educacinparalasalud
8.8.1 La Secretara de Salud debe establecer, en coordinacin con las instituciones educativas, programas de
informacinalapoblacinestudiantilsobrelosfactoresderiesgodeenfermedadesnotransmisiblesfrecuentes,entrestas,
ladiabetes,ascomolaactualizacindelosprogramaseducativossobrediabetesdelasinstitucionesquepreparanalos
profesionalesdelasalud.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

13/45

24/8/2015

DOFDiarioOficialdelaFederacin

8.8.2 Las actividades de educacin para la salud se deben dirigir principalmente a los nios, a los jvenes y a las
personasadultasenaltoriesgodedesarrollardiabetes.
8.8.3Sedebenpromoverprocesosquemodifiquenactitudestendientesamejorarlasaludindividual,familiarycolectiva
enlamateriadediabetes.
8.8.4Sedebepromovereldesarrollodefactoresprotectoresparaelcontroldeestaenfermedad,comosonelcontrolde
peso,prcticadeactividadfsicayunaalimentacinsaludabledeacuerdoalascaractersticasdelasregionesdondeviven.
8.9Prevencindeladiabetesmellitustipo2enindividuosdealtoriesgo.
8.9.1Personasenriesgodellegaratenerdiabetes.
8.9.1.1Enprimerlugarseincluyenloshijosdepadrescondiabetesindependientementedesuniveldeglucemia,alas
personas con prediabetes identificados mediante pruebas de deteccin con glucosa de ayuno o PTGO, de acuerdo a
criteriosdiagnsticosdeestaNorma.
8.9.1.2Tambinseconsideradentrodeestegrupoaaquellosindividuosconunoovariosdelossiguientesfactoresde
riesgo:sobrepeso,obesidad,sedentarismo,familiaresdeprimergradocondiabetes,>65 aos de edad, las mujeres con
antecedentesdeproductosmacrosmicos(>4kg)y/oconantecedentesdediabetesgestacionalymujeresconantecedente
deovariospoliqusticos.
8.9.1.3Asimismo,seconsideradentrodeestegrupoalaspersonasconhipertensinarterial(>140/90),dislipidemias
(colesterol HDL <40 mg/dl, triglicridos >250 mg/dl), a los pacientes con enfermedades cardiovasculares (cardiopata
isqumica, insuficiencia vascular cerebral, o insuficiencia arterial de miembros inferiores) y con antecedentes de
enfermedadespsiquitricasquerecibanantipsicticos.Deigualforma,antelaausenciadedichoscriteriosdebecomenzar
ahacerseapartirdelos45aos.Silosresultadossonnormales,sedebenrepetirlaspruebasenintervalosdetresaos.
8.9.2 Las personas consideradas en alto riesgo de diabetes deben ser informadas de tal situacin yapoyadas para
efectuarloscambiosnecesariosensusestilosdevida.
8.9.3 La prevencin especfica de la diabetes forma parte de las actividades correspondientes a la prestacin de
servicios de salud y requiere la intervencin de los mdicos, en especial de quienes tienen bajo su responsabilidad el
cuidadogeneraldelasaluddelospacientesydesusfamilias.
8.9.4Laparticipacindeotrosmiembrosdelequipodesalud,comoprofesionalesdelanutricin,enfermera, trabajo
social,educadoresendiabetes,odontologa,psicologaydeporte,esdegranimportanciaparaauxiliaralaspersonasen
altoriesgo.
8.9.5 Es importante apoyar el desarrollo de investigaciones, para la puesta en marcha de programas y acciones
efectivasdirigidasaprevenirladiabetesenindividuosdealtoriesgo.
8.10Laeducacinparalaspersonascondiabetesoenriesgodedesarrollarlapuedeapoyarseenmaterialeducativo
conformealosapndicesinformativosdeestaNOM.
9.Deteccin
9.1Ladeteccindelaprediabetesydeladiabetesmellitustipo2sedeberealizarenlapoblacingeneralapartirdelos
20aosdeedadoaliniciodelapubertadsipresentaobesidadyfactoresderiesgoconperiodicidaddecada3aos,a
travsdelProgramadeAccinespecficodeDiabetesMellitusvigenteyencampaasenelmbitocomunitarioysitiosde
trabajo, as como en los que los hombres o las mujeres suelenreunirse o desarrollar actividades y en los servicios del
sistemadeeducacinpblica,ademsdelosqueacudenaserviciosdesaludpblicayprivada.
9.2Eltamizajedeglucosaenpoblacinexpuesta,ayudaaidentificaralaspersonascondiabetesnodiagnosticadas,
individuosconalteracinalaglucosaenayuno,permitiendoestablecermedidaspreventivaspararetardarlaaparicindela
diabetes,modificandosuestilodevidadelpaciente,alimentacin,actividadfsica,medianteunaeducacinparalasalud.
9.3 Es recomendable que la deteccin de diabetes, se haga de manera integrada con otros factores de riesgo
cardiovascular,comohipertensinarterial,dislipidemias,tabaquismo,sedentarismoycircunferenciaabdominalanormal,as
comootrascondicionesclnicasasociadasalaresistenciaalainsulina.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

14/45

24/8/2015

DOFDiarioOficialdelaFederacin

9.4Programaspermanentesdedeteccin
9.4.1Silaglucemiacapilares<100mg/dlynohayfactoresderiesgoserealizarestamismapruebaen3aos.Sienla
deteccin la glucemia capilar es <100 mg/dl y el paciente presenta obesidad, sedentarismo, tabaquismo debe ser
capacitado para tener alimentacin correcta, realizar su plan de actividad fsica y suspender el tabaquismo y repetir la
deteccin en un ao. Si la glucemia es >100 mg/dl en ayuno o casual >140 mg/dl se proceder a la confirmacin
diagnsticaconmedicindeglucemiaplasmticadeayuno.
9.4.2Laglucosacapilarsedebederealizarconunmedidordeglucosaautomatizado,elcualtengalasespecificaciones
delfabricante,elpersonaldesaluddeberderecibirlacapacitacincontinua.
10.Diagnstico
10.1Seestableceeldiagnsticodeprediabetescuandolaglucosadeayunoesigualomayora100mg/dlymenoro
igualde125mg/dl(GAA)y/ocuandolaglucosadoshrs.postcargaoralde75gdeglucosaanhidraesigualomayora140
mg/dlymenoroigualde199mg/dl(ITG).
10.2Seestableceeldiagnsticodediabetessisecumplecualquieradelossiguientescriterios:presenciadesntomas
clsicosyunaglucemiaplasmticacasual>200mg/dlglucemiaplasmticaenayuno>126mg/dlobienglucemia>200
mg/dlalasdoshrs.despusdeunacargaoralde75gdeglucosaanhidradisueltaenagua,sinolvidarqueenlapruebade
ayunooenlaPTOG,oenausenciadesntomasinequvocosdehiperglucemia,estoscriteriossedebenconfirmarrepitiendo
lapruebaenundadiferente.
10.3Diagnsticodediabetesmellitusenniosyjvenes
10.3.1 Las pruebas para deteccin y diagnstico de prediabetes y diabetes mellitus en nios y jvenes serealiza si
presentanlossiguientescriterios:
10.3.1.1Sobrepesoennios(IMC>delpercentil85paralaedadysexo,pesoparalatalla>delpercentil85,opeso
mayorde120%idealparalatalla)concualquieradelostressiguientesfactoresderiesgo:
10.3.1.1.1HistoriadeDM2enelprimeroosegundogradofamiliar.
10.3.1.1.2Raza/Etnia(NativaAmericana,Afroamericana,Latina,Asitica/Americana,NativadelasIslasdelPacfico).
10.3.1.1.3Signosy/ocondicionesderesistenciaalainsulina(acantosisnigricans,hipertensinarterial,dislipidemia,o
sndromedeovariospoliqusticos).
10.3.2Enlamayoradelaspersonasjvenes,eldiagnsticodeladiabetestipo1deberhacersesindificultadyde
maneraurgente.Lossntomasdesed,ingestadelquidosymiccinexcesivosdebeninduciralarealizacininmediatade
pruebasanticuerposantiinsulares.
10.3.2.1 Glucosuria intensa (>1,0 g/dl) posible cetonuria (frecuentemente >0.4 g/dl de acetoacetato) hiperglucemia
aleatoria200mg/dl).
10.3.2.2 Pruebas repetidas al azar para determinar glucemia, glucosuria. Determinacin de marcadores de
autoanticuerposenclulasinsulares.
10.3.2.3Curvadetoleranciaoralalaglucosa(CTOG):enayuno,utilizandounacargadeglucosaporvaoralde1.75
g/kgdepesocorporal(mximo75g).
10.3.2.4Enlaspersonasjvenes,ladiabetestipo1comienzageneralmentedemanerarepentinayaguda,conpoliuria,
polidipsiayevidenciasdecetosis.Enunaminoradejvenes,elcomienzoesmslento,consntomasquevanapareciendo
eneltranscursodevariosmeses.
10.3.2.5 Datos clnicos adicionales: Enuresis de comienzo reciente o persistente. Dolor abdominal con osin vmitos.
Candidiasisvaginal.Pocoaumentodepesooprdidadepeso.Fatiga,irritabilidad,deteriorodelrendimiento acadmico.
Infeccionesdrmicasrecurrentes.
10.4Diabetesgestacional.
10.4.1 Antes de efectuar la prueba de tolerancia a la glucosa, se deber realizar la prueba de deteccin en toda
embarazadaentrelassemanas24y28degestacin.Siunahoradespusdeunacargade50gdeglucosaporvaoral,se
encuentraunaglucemiaplasmtica>140mg/dl,seefectuarlapruebadiagnstica.
10.4.2Serecomiendaquelosestudiosinicialessehaganentrelasemana24y28deembarazo(alrededordelos6
meses),aunquelasmujeresconmayorriesgopuedenserestudiadasdesdeantes.Elestudioconsisteenunamuestrade
glucosaensangre(50gdeglucosaporvaoral)ysilasospechaesaltasehacenestudiosmsespecficos,comolaprueba
detoleranciaalaglucosaentreshoras.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

15/45

24/8/2015

DOFDiarioOficialdelaFederacin

Enestaprueba,setomaunamuestradesangreenayuno,despus,lamujertomaunacantidadespecficadeglucosa
disueltaenaguaysecontinatomandomuestrasdesangrecadahorahastacompletar3horas.Sediagnosticadiabetessi
dosomsdelosnivelesdeglucosaseencuentranporarribadelossiguientesvalores:Enayuno95mg/dl,1 hora 180
mg/dl,alas2horas155mg/dlyalas3horas140mg/dl"(CriteriosdeCarpenteryCoustan)".
11.Tratamientoycontrol
11.1Eltratamientodeladiabetestienecomopropsitoaliviarlossntomas,mantenerelcontrolmetablico,prevenirlas
complicaciones agudas y crnicas, mejorar la calidad de vida y reducir la mortalidad por esta enfermedad o por sus
complicaciones.
11.2 Las personas identificadas con glucosa anormal en ayuno, y/o intolerancia a la glucosa, requieren de una
intervencinpreventivaporpartedelmdicoydelequipodesalud,yaqueelriesgoparadesarrollardiabetesmellitusTipo2
yenfermedadcardiovasculareselevado,conformealoestablecidoenlaGuaderecomendacionesparalapromocindela
salud,prevencin,deteccin,diagnstico,tratamientoycontroldelaprediabetes.
11.2.1Enlaspersonasconglucosaanormalenayuno,y/ointoleranciaalaglucosa,deprimeraintencinserecomienda
laintervencinnofarmacolgica(dietayejercicio).Nutricin:Reducirlasobreingestacalrica,principalmentelaingestade
carbohidratosrefinadosydegrasassaturadas.Elobjetivoeslograrlareduccindealmenosun5a10%delpesocorporal.
ConsultarManejoNutricionaldeladiabetesmellitustipo2yObesidad.Ejercicio:Serecomiendaejercicioaerbicomnimo
30minutosaldadurante5vecesalasemana.Eltipoeintensidaddelejerciciodebeadaptarsealaedadycondiciones
fsicas de cada paciente. Consultar Ejercicio en Diabetes mellitus y Obesidad. Tambin es importante considerar las
actividades y roles que tradicionalmente realizan tanto hombres como mujeres para sugerir acciones concretas en el
cuidadodesusalud.Elcambiodeestilodevidaesportiempoindefinido.
11.2.2Tratamientofarmacolgico.SellevaracaboconformealaGuaderecomendacionesparalapromocindela
salud,prevencin,deteccin,diagnstico,tratamientoycontroldelaprediabetes.
11.3Elplanteamientodeunprogramateraputicoalargoplazoparalaoeladultomayorcondiabetesdebeteneren
cuentalossiguientesaspectos:valoracindelaexpectativadevida,laexistenciadecomplicacionespropiasdeladiabetes,
la presencia de trastornos neuropsiquitricos u otros problemas mdicos coexistentes y la cooperacin y facultad del
pacienteparacomprenderelprogramateraputico.
11.4Componentesdeltratamiento
11.4.1Elmdico,encolaboracinconelequipodesalud,tienebajosuresponsabilidadlaelaboracinyaplicacindel
plandemanejointegraldelpaciente,elcualdeberseradecuadamenteregistradoenelexpedienteclnico,conformeala
NOM168SSA11998,Delexpedienteclnico.
11.4.2Para el propsito anterior, en la visita inicial se deben registrar los datos en una historia clnica debidamente
elaborada,enesamismavisitayenvisitassubsecuentes.
11.4.3Elplandemanejodebeincluirelestablecimientodelasmetasdetratamiento,elmanejonofarmacolgico, el
tratamientofarmacolgico,laeducacindelpaciente,elautomonitoreoylavigilanciadecomplicaciones.
11.4.4Lasmetasbsicasdeltratamientoincluyenellogrodenivelesadecuadosdeglucosa,colesteroltotal,colesterol
LDL, colesterolHDL, triglicridos, presin arterial, ndice de masa corporal, circunferencia abdominal, y la HbA1c. Estas
metassernobjetodevigilanciamdicademaneraperidica,conformealApndiceNormativoD.
11.4.5Elmanejoinicialdepacientescondiabetestipo2seharmediantemedidasnofarmacolgicas,mismasquese
debern mantener durante todo el curso del tratamiento. No obstante lo anterior, existe evidencia de que el uso de
medicamentosenetapastempranas(prediabetes:glucosadeayunoanormaleintoleranciaalaglucosa)puedendisminuir
laprogresinhacialadiabetesmanifiesta.Enelcasodediabetestipo1,laindicacinparaelusodeinsulinaesalmomento
deldiagnsticoenconjuntoconlasmedidasnofarmacolgicas.
11.4.6 En la diabetes tipo 2, el manejo farmacolgico se iniciar cuando el mdico tratante as lo juzgue pertinente,
inclusodesdeeldiagnstico,sobretodoenpresenciadehiperglucemiasintomticayparaalcanzarmetasdecontrolloms
tempranamenteposible,conformealaGuadeTratamientoFarmacolgicoparaelControldeladiabetesmellitus.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

16/45

24/8/2015

DOFDiarioOficialdelaFederacin

11.5Manejonofarmacolgico.
11.5.1Eslabaseparaeltratamientopacientesconprediabetesydiabetesyconsisteenunplandealimentacin,control
depesoyactividadfsicaapoyadoenunprogramaestructuradodeeducacinteraputica.
11.5.2 Es responsabilidad del personal mdico, apoyado con un equipo de salud, motivar a la o el paciente en la
adopcindemedidasdecarcternofarmacolgicoyaquesoncondicionesnecesariasparaelcontroldelaenfermedady
retrasodecomplicaciones.
11.5.2.1Esnecesarioqueelpersonalmdicoyelequipodesaludenelcualseapoyaestnsensibilizadosencuantoa
considerar las condiciones de vida que tienen tanto hombres como mujeres, derivadas del gnero, para adaptar las
medidasdecarcternofarmacolgico,conelfindefavorecerelcontroldelaenfermedadyretrasodecomplicaciones.
11.5.3Controldepeso.
11.5.3.1Se considera que el o la paciente ha logrado un control ideal de peso, si mantiene un IMC >18.5y <25 se
puedenestablecermetasintermedias,deacuerdoconloespecificadoenelApndiceNormativoE.
11.5.3.2 Para mantener el control de peso se debe seguir el plan de alimentacin, actividad fsica yejercicio en los
siguientestrminos:
11.5.4Plandeactividadfsicayejercicio.
11.5.4.1Elmdicodeprimercontactodebeestarcapacitadoparaestablecerelplanbsicodeactividadfsicaoejercicio
paralocualseapoyarenelequipodesaludyprofesionalesenestamateria.
11.5.4.2Eltipo,intensidad,duracinyfrecuenciadelejerciciosedebenfijardeacuerdoconloslineamientosdescritos
enelapartado8.3ydeconformidadconlasguastcnicasaplicablesparaelcumplimientodeestaNorma.
11.5.4.3Elprogramadeejerciciosedebefijardeacuerdoconlaevaluacinclnicadelpaciente,tomandoencuentala
edad,estadogeneraldesalud,evolucindelaenfermedad,alimentacinymedicamentos,ascomotambineltiempode
que disponen para realizarlo, dependiendo de los roles que desempea dentro de su entorno familiar y laboral
principalmente. En el Apndice Normativo E se describen los criterios para la evaluacin clnica del paciente antes de
establecerunprogramadeejercicio.
11.5.4.4 En caso de que el mdico no considere apropiado un programa de ejercicio, a causa de alguna
contraindicacin,ayudaralaoelpacienteaestablecerunplandeestilodevidafsicamenteactiva,comoestrategiapara
evitarelsedentarismo.
11.5.4.5Esindispensablequeelpacienteadultomayorrealicelaactividadfsicaencompaaconotrapersonaoen
grupos,quesuropaycalzadosseanadecuados,queevitelaprcticadelosmismosenclimasextremos(calor,fro)ocon
altosnivelesdecontaminacin,quetomelquidosantes,duranteydespusdelaactividadfsica,querevisesuspiesantesy
despus de cada sesin de ejercicio y, si el paciente se controla con insulina, es indispensable que se establezca un
programadeautomonitoreoyunbuencontrolmetablico.
11.5.5Plandealimentacin.
11.5.5.1Enlogeneral,seseguirnloscriteriossealadosenelnumeral8.4paraunaalimentacinsaludable,parala
aplicacindeestaNOM.
11.5.5.2Enelestablecimientodelplanalimentariosedebernanalizaryconsiderarloshbitosdelaoelpaciente y
realizarlasmodificacionesqueseannecesariasafindecontribuirenellogrodelasmetasdetratamiento.
11.5.5.3Paraproporcionaratencinnutricionalaladultomayorsedebenconocerlasmltiplesalteracionesqueafectan
al individuo, tanto las propias del envejecimiento, como las enfermedades crnicas y la falta de prtesis dental por la
adonciaparcialototal,queafectanlafuncindenutricin.
11.5.5.4 La dieta para el paciente diabtico ser variada con suficiente consumo de verduras y frutas, hidratos de
carbono complejos, fibra y con restricciones en el consumo de grasas, con el objetivo de mantener concentraciones
normalesdeglucosaenlasangreydisminuirlosnivelesdelpidos.
11.5.5.5Serecomiendareduciroevitarelconsumodeazcaressimples(miel,jaleas,dulcesybebidasazucaradas),
permitindose el uso de edulcorantes no nutritivos, como aspartame, acesulfame de potasio, sucralosa, sacarina y los
permitidosporlaSecretaradeSalud.Pacientestratadosconsulfonilureasoinsulinadistribuirnelconsumodealimentosa
lolargodeldadeacuerdoalasrecomendacionesdesumdico.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

17/45

24/8/2015

DOFDiarioOficialdelaFederacin

11.5.5.6 Se recomienda que en las comidas complementarias (colaciones), se consuman preferentemente verduras,
equivalentesdecerealesintegralesyderivadoslcteosdescremados.
11.5.5.7Larestriccindelconsumodealcoholesrecomendableentodoslospacientes,particularmenteenaquellos(as)
con descontrol metablico, obesos, hipertensos o con hipertrigliceridemia. El exceso de alcohol puede favorecer
hipoglucemiaensituacionesdeayunoprolongadoyefectodisulfirnencasostratadosconclorpropamida.
11.5.5.8 El (la) profesional de salud responsable del tratamiento indicar la dieta apropiada para cada paciente de
acuerdo con los requerimientos calricos por da/kg de peso ideal, y segn las condiciones clnicas. En el Apndice
NormativoF,semuestranrecomendacionesparaelplanalimentariosegncondicionesespecficasdelospacientes.
11.5.5.9Elmonitoreodeglucosaydelosotrosfactoresderiesgocardiovascularservirparadeterminarsielplande
alimentacinpermitecumplirlasmetasdeltratamiento.
11.6Educacinparapacientesyfamiliares
11.6.1Lamayorpartedelcuidadodeladiabetesdependedelapersonaconestepadecimiento.Paralograrelcontrol
necesitasereducadoensuautocuidadolaeducacinteraputicaesparteintegraldeltratamiento,debeproveersedesde
el diagnstico del padecimiento y luego, de manera continua, a lo largo del ciclo vital conforme aparezcan nuevos
tratamientosocomplicaciones.
11.6.2 Para garantizar la calidad de la educacin de la persona con diabetes se deben establecer programas de
educacinteraputica,individualesodegrupo,estructuradosyproporcionadosporpersonalcapacitadoy/oeducadoresen
diabetesdeacuerdoconelApndiceInformativoBdeestaNormasobrelosestndaresdeeducacin.
11.6.3La educacin teraputica comprender un programa educacional a travs del currculum educacional para la
personacondiabetes,enelqueseexponenlossietecomportamientosdelautocuidadodelasalud,conformealApndice
InformativoC.
11.6.4Laeducacinteraputicadebeincluiralapersonacondiabetesyasufamilia,motivndolosparapropiciarestilos
devidasaludablesensugruposocialyfamiliar,conlafinalidaddepreveniroretrasarlaaparicin de nuevos casos de
diabetes.
11.7GruposdeAyudaMutua
11.7.1Conelpropsitodeincorporarycrearredesdeapoyosocialylaincorporacindemaneraactivadelaspersonas
condiabetesenelautocuidadodesupadecimiento,facilitarypromoversucapacitacin,sefomentarlacreacindegrupos
de apoyo y ayuda mutua en las unidades de atencin del Sistema Nacional de Salud, as como en centros de trabajo,
escuelasyotrasorganizacionesdelasociedadcivil.Debenestarsupervisadasodirigidasporunprofesionaldelasalud
capacitado.
11.7.2 Los grupos de apoyo y de ayuda mutua deben servir para educar, estimular la adopcin de estilos de vida
saludablescomoactividadfsica,alimentacincorrecta,automonitoreoycumplimientodelasmetasdeltratamientoycontrol.
11.7.3El(la)profesionaldelasaludresponsabledeestosgrupos,debervigilarquesusactividadessedesarrollende
conformidadconloslineamientosestablecidosenlapresenteNorma.
11.7.4 Estos grupos deben cumplir los objetivos para los que fueron creados, debiendo evaluar los indicadores de
desempeocorrespondientes.
11.8Automonitoreo
11.8.1Lasventajasdelautomonitoreosonlassiguientes:
11.8.1.1Ajusteseneltratamiento:Lainformacinqueserecabedelosmonitoreosleserviralmdicoparaconocerel
avancedeltratamientodelpacienteyaspodrajustarloparalograrunmejorcontroldelpadecimiento.
11.8.1.2Atencinhipoglucemias:Losnivelesdeglucosapuedenbajardemasiadoyproducirloqueseconoce como
hipoglucemia.Sisepracticalapruebadeglucosacapilarysedescubrequeelnivelestpordebajodelnivelnormalse
podractuarenconsecuencia.
11.8.1.3Prevenir la hiperglucemia: El contar con la informacin del automonitoreo, tanto en los nivelesbajos o altos
puedenretrazaroprevenirlascomplicaciones.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

18/45

24/8/2015

DOFDiarioOficialdelaFederacin

11.8.1.4Conocerlasvariaciones:Alllevarelregistroderesultadossepodridentificarlasvariacionesdelaglucosa,as
sesabrenqumomentosdeldaeselevadaomuybajaoseencuentraennievesnormales.
11.8.2Vigilanciadelautomonitoreo:Esnecesarioqueelpersonalmdicoyelequipodesaludvigilenlacalidadtcnica
delautomonitoreoyconsisteenllevarunregistroconstantedelosnivelesdeglucosaensangre,delapresinarterialydel
peso.
11.8.3Frecuencia
11.8.3.1Losprofesionalesdelasaludsonlosindicadospararecomendarunadeterminadacantidaddemonitoreos,sin
embargo existen ciertas reglas de oro que marcan la pauta para el nmero de mediciones, de acuerdo al Apndice
normativo"G".
11.8.3.2Esrecomendablemedirlaglucosaantesydespusderealizarejercicio,conelloseevitarhipoglucemiase
hiperglucemias.
11.8.3.3Realizarunmonitoreosiseolvidalgunadosisdeinsulinaodemedicamento
11.8.3.4Sielpacientenosesientebienosillevaacabocambiosensualimentacinoactividadfsicadeberrevisarsu
glucosaconmayorfrecuencia.
11.9Manejofarmacolgico
11.9.1 Los medicamentos que pueden utilizarse para el control de la diabetes tipo 2 son sulfonilureas, biguanidas,
insulinasolascombinacionesdeestosmedicamentos.Asimismo,sepodrnutilizarlosinhibidoresdelaalfaglucosidasa,
tiazolidinedionas,glinidas,incretinaseinhibidoresdelaenzimadipeptidilpeptidasa(DPP4)ogliptinasyotrosqueensu
momento apruebe la Secretara de Salud, conforme a las Guas de Tratamiento Farmacolgico para el Control de la
diabetesmellitusaUsodeInsulinasenelTratamientodeladiabetesmellitustipo1y2yalaGuaderecomendaciones
paralapromocindelasalud,prevencin,deteccin,diagnstico,tratamientoycontroldelaprediabetes.
11.9.2LasdependenciasyentidadesdelaAdministracinPblicaFederalqueprestenserviciosdesaludslodebern
utilizarlosinsumosestablecidosenelCuadroBsicoparaelprimerniveldeatencinmdicayparaelsegundoytercer
niveldeatencin.
11.9.3Debeadvertirsequeenlamayoradelostratamientosmediantehipoglucemiantesorales,puededesarrollarse
falla secundaria a mediano y a largo plazos. Las causas ms frecuentes de la falla son la prdida progresiva en la
capacidaddeproducirinsulinaporlaclulabeta,especialmenteaquellosquepromuevenlaproduccindelahormonayla
faltadeadherenciaaltratamiento.
11.9.4Manejodepacientescondiabetestipo2quepresentanobesidad.
11.9.4.1 Uno de los objetivos primordiales del tratamiento para estos pacientes es alcanzar y mantener el peso
recomendable, tomando para tal efecto las consideraciones establecidas en la NOM174SSA11998, Para el manejo
integraldelaobesidad,conformealaGuadeTratamientoFarmacolgicoparaelControldeladiabetesmellitusylaGua
de recomendaciones para la promocin de la salud, prevencin, deteccin, diagnstico, tratamiento y control de la
prediabetes.
11.10Utilizacindeinsulina.
11.10.1Enladiabetestipo1eltratamientoindispensablequedebeserutilizadodesdeelmomentodeldiagnstico.En
ladiabetestipo2cuandopersistehiperglucemiaenayuno,sepuedeiniciarconinsulinanocturnademaneracombinada
conhipoglucemiantesoralesdeadministracindiurna,conformealaGuaUsodeInsulinasenelTratamientodeladiabetes
mellitustipo1y2.
11.10.2Enladiabetestipo2,antelafalladelosantidiabticosoralesadosismximas,seutilizarinsulinahumanao
anlogodeinsulina,conformealaGuaUsodeInsulinasenelTratamientodeladiabetesmellitustipo1y2.
11.10.3Lainsulinahumanadebeconsiderarsecomoelmedicamentodeprimeralneaendiabetesduranteelembarazo
yenladiabetesgestacional.
11.11Vigilanciamdicayprevencindecomplicaciones
11.11.1Aspectosgenerales
11.11.1.1 La frecuencia de las consultas depender del grado de cumplimiento de las metas deltratamiento, de los
ajustesnecesariosalmanejofarmacolgicoynofarmacolgicoydelaevolucinclnica.
11.11.1.2Aliniciodelmanejomultidisciplinario,sedebetenercontactoquincenaloconlaperiodicidadquedetermineel
profesionaldelasaludparaqueconjuntamenteconelpacienteselogreelcontrolmetablico.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

19/45

24/8/2015

DOFDiarioOficialdelaFederacin

11.11.1.3Encadavisitasedebeevaluarelcontrolmetablico,elplandealimentacinylaactividadfsicayseinvestiga
de manera intencionada la presencia de complicaciones. Se registra el peso, la presin arterial y el resultado de la
exploracindelospiessereforzarlaeducacinapacientesyendondeseaposible,sele estimula a participar en un
grupodeayudamutua.
11.11.1.4 Se debe realizar la medicin, al menos una vez al ao, de colesterol total, triglicridos, colesterolHDL,
colesterolLDL, HbA1c y examen general de orina, si este ltimo resulta negativo para albuminuria se debe buscar
microalbuminuria.
11.11.2Examendelosojos
11.11.2.1Encasosdediabetestipo2,almomentodeestablecereldiagnsticoyposteriormentedemaneraanual,se
efectuarelexamendeagudezavisualydelaretina.
11.11.2.2Encasodequeelmdicoalefectuarelexamendelosojosidentifiquecualquieradelassiguientesanomalas:
maculopata, disminucin de la agudeza visual, cambios proliferativos, dificultad para visualizar claramente la retina y
catarata,referiralaoelpacientealoftalmlogouoftalmloga.
11.11.2.3Encasodequeelmdiconopuedaefectuarelexamendelosojosocreanecesario,referiralaoelpaciente
alespecialista.Elexamenidealmenteesporeloftalmlogocondilatacinpupilarunavezalao.
11.11.3Neuropata
11.11.3.1Comolaneuropataavanzadaesirreversible,ladeteccintempranadeestacomplicacinesimportanteya
queeselantecedenteinmediatodelpiediabticoylacausanmerounodeamputacinnotraumtica.ApndiceNormativo
I
11.11.3.2Labsquedadeestascomplicacionessellevaacabomedianteunacuidadosarevisinclnica,queincluyael
examendelosreflejos,delasensibilidadperifrica,dolor,tacto,temperatura,vibracinyposicin.
11.11.3.3 El o la paciente es referido al especialista si se observa disminucin de la sensibilidad en los pies,
mononeuropata aislada, hiperestesia o dolor nocturno de pies o piernas, impotencia y signos o sntomas de neuropata
autonmica,comosudoracinexcesivadetroncoycabeza,diarreassincausaoestreimientopertinaz.
11.11.3.4Eltratamientosebasaenelcontroldelaglucemiaparaelcontroldeldolorsepuedenutilizarsintomticoslos
cualesnomodificanlahistorianaturaldelaenfermedadelcidoalfalipoicodealtaliberacinadosisde600mgdosotres
vecesaldahademostradoserelnicotratamientoetiopatognicodeleveamoderado.
11.11.4Elpiediabtico
11.11.4.1Laneuropataperifricaolaenfermedadvascularperifricapuedeconduciraulceracin,infeccinygangrena
delosmiembrosinferiores.
11.11.4.2Losfactoresderiesgoincluyen,principalmente,calzadoinadecuado,deformidadesdelpie,incapacidadpara
elautocuidado,descuido,alcoholismoytabaquismo.
11.11.4.3Lasestrategiasparaprevenirelpiediabticosonlaeducacindel(la)paciente,elcontroldelaglucemia,la
inspeccin peridica, el autocuidado de los pies y el envo inmediato al especialista, en caso de infeccin. Los zapatos
debendesersuaves,sinpuntosdepresinysinpuntaangosta.
11.11.5Nefropata
11.11.5.1Lamicroalbuminuriaesunmarcadordenefropataclnicaydeenfermedadmicrovascularamenudoseasocia
con dislipidemia e hipertensin arterial. Actualmente se considera como un factor aisladopara riesgo cardiovascular. La
metaeslograrteneralpacienteconunaexcrecindealbmina<30mg/da.
11.11.5.2Lapresenciademicroalbuminuriaindicalanecesidaddemejorarelcontrolglucmico,trataranlosaumentos
moderadosdetensinarterialyrestringirmoderadamentelaingestadeprotenasyagregaraltratamientofrmacoscomo
inhibidoresdelaenzimaconversivadeangiotensina,antagonistadelarecapturadeangiotensinaeinhibidoresdirectosde
renina.
11.11.6 Para el manejo de las dislipidemias en las personas con diabetes se aplicar la Gua de Tratamiento
farmacolgicoparaelcontroldelasDislipidemias.
11.11.6.1 La prevencin de la cardiopata isqumica es la meta prioritaria en nuestro pas, ya que es una de las
principalescausasdemuerte.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

20/45

24/8/2015

DOFDiarioOficialdelaFederacin

11.11.6.2 La normalizacin de los lpidos sricos es la meta prioritaria del tratamiento a largo plazo, disminuir los
triglicridos,elevarelcHDLyreducirlosnivelesdecLDL.
11.11.6.3LospacientescondiabetesmellitusdebenclasificarseenlacategoradealtoriesgoylametadecLDLdebe
sercLDL<de100mg/dlycuandoseclasifiquenconmuyaltoriesgo,conalgunaoalgunascondicionesclnicasasociadas
<70mg/dl,conformealApndiceNormativoG.
11.11.6.4Enpacientescondiabetesladeterminacindelpidosserecomiendarealizarlamnimocadatresmeses,sin
embargo,quedarbajoelcriteriodelmdicotratantedependiendodelarespuestaaltratamientoyevolucindelpaciente.
11.11.6.5Lamedicinnodebeserpracticadaenpersonasqueenlasltimasseissemanashayansufridouneventode
estrsfsico.Estoincluyeenfermedadesintercurrentesagudas,cirugaoprdidadepeso.
11.11.6.6Sedebeutilizardosdeterminacionesparaconfirmareldiagnsticodedislipidemia.Serecomiendamantener
unayunode12horasantesdesudeterminacin.
11.11.6.7Laevaluacindepacientesdebeincluirunahistoriaclnicacompletaqueincluyalabsquedaintencionadade
ECV,pancreatitis,alcoholismo,medicamentos,presenciadexantomas.
11.11.6.8Tratamientonofarmacolgico
11.11.6.8.1 El tratamiento debe iniciarse con el control de peso, actividad fsica y una ingestin reducida de grasas
saturadasytrans.Esindispensablequeserestrinjaelconsumodealcoholyseeviteeltabaquismo.
11.11.6.9Tratamientofarmacolgico
11.11.6.9.1SeaplicarlaGuadeTratamientofarmacolgicoparaelcontroldeladiabetesmellitustipo1y2.
11.11.6.9.2Loscidosgrasosomega3enaltasdosis(3gralda)sepuedenutilizarparacoadyuvarlareduccindelos
triglicridos.
11.11.7Hipertensinarterial
11.11.7.1El75%delaspersonascondiabetesfallecenporECV,el80%delashospitalizacionesestnrelacionadas
conproblemasdeateroesclerosisyelriesgodemuerteenestaspersonaseshasta5vecesmayor.
11.11.7.2Lamicroalbuminuriaesunmarcadortempranodedaorenalyunindicadorderiesgocardiovascularalto.
11.11.7.3Lasmetasdecontroldelapresinarterialconsistenenmantenerlosnivelesdelapresinsistlicaydiastlica
respectivamente, por debajo de <130/80 mmHg, tanto en pacientes con diabetes mellitus como con intolerancia a
carbohidratos.
11.11.7.4Siademsexistealbuminuriaoinsuficienciarenal,losylaspacientesdebernsertratadosparalograruna
presinarterial<120/75mmdeHg,tantoenpacientescondiabetesmellituscomoconintoleranciaacarbohidratos.
11.11.7.5Tratamientonofarmacolgico
11.11.7.5.1Disminuirelconsumosodio.Realizaractividadfsicaconcifrastensionales<140/90mmdeHg.
11.11.7.6Tratamientofarmacolgico
11.11.7.6.1 Iniciar tratamiento farmacolgico en personas con presin arterial > 130/80 mm de Hg, sobre todo en
presencia de microalbuminuria un IECA o ARA ll sin embargo se ha demostrado la eficacia yseguridad de otro tipo de
antihipertensivos,conformealaGuadeTratamientofarmacolgicoparaelcontroldeladiabetesmellitustipo1y2,yala
VerGuadeTratamientofarmacolgicoparaelcontroldelaHipertensinArterial
11.11.8Hipoglucemia.
11.11.8.1Losylaspacientestratadosconinsulinaysulfonilureasestnespecialmenteexpuestosaestacomplicacin.
11.11.8.2 Tambin puede producirse en pacientes que toman sulfonilureas de accin prolongada, especialmente en
aqullosbajotratamientoconcloropropamida,ocondisminucindelafuncinrenal.
11.11.8.3Cuandoseingierealcoholsinalimentostambinpuedeocurrirhipoglucemia.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

21/45

24/8/2015

DOFDiarioOficialdelaFederacin

11.11.8.4 Si el o la enfermo (a) en estado consciente presenta hipoglucemia, es recomendable utilizarcarbohidratos


lquidos(1020g),seguidosdecarbohidratosdeabsorcinmslenta,pudiendollegarasernecesariorepetirestaingestin.
11.11.8.5Encasodeprdidadelestadodealertaesnecesarioaplicarglucagnopreferentementeglucosaal50%por
vaendovenosayllevarconurgenciaalpacientealsegundoniveldeatencinoalespecialista.Delglucagnseaplicauna
dosisde0,51,0mgporvaintramuscularysedeberobservarlarespuestaalos10minutosdeaplicado.Sielpaciente
recupera el estado de despierto, deber ingerir carbohidratos por va oral, en caso contrario, se deber proceder a la
administracinintravenosadeglucosa.Debedecolocarsealpacienteconlacabezavolteadahaciaunlado,porelriesgo
depresentarvmitoybroncoaspiracin.
11.12Mtodosdetratamientonoaceptables.
11.12.1NosonaceptablesotrasformasdetratamientonodescritasenestaNorma.
12.Referenciaalespecialistaoalsegundoniveldeatencin
12.1 El o la paciente diabtico es referido al especialista o al segundo nivel de atencin, en cualquiera de las
circunstanciasqueseenumeranacontinuacin:
12.1.1Cuando,demanerapersistente,nosecumplanlasmetasdetratamientoapesardeltratamientofarmacolgico.
12.1.2Faltaderespuestaalacombinacindehipoglucemiantesysiademssecarecedeexperienciaenlautilizacin
deinsulina.
12.1.3Siunpacientesepresentaconhipoglucemiasevera,seleaplicarsolucinglucosadaal50%,despusdelo
cualseharlareferenciacorrespondientealespecialista.
12.1.4Sisiendotratadoconinsulina,presentahipoglucemiasfrecuentes.
12.1.5Encasodecomplicacionesgraves,comocetoacidosisocomahiperosmolarenmsdeunaocasinduranteel
ltimo ao, retinopata preproliferativa o proliferativa, glaucoma o edema macular, cardiopata isqumica, insuficiencia
carotdea, insuficiencia arterial de miembros inferiores, lesiones isqumicas o neuropticas de miembros inferiores,
neuropatasdiabticasdedifcilcontroloinfeccionesfrecuentes.
12.1.6Enpresenciadehipertensinarterialdedifcilcontrol,odislipidemiasseveras:colesterolotriglicridosenayuno
>300mg/dl,apesardetratamientodietticoadecuado.
12.1.7Encasodeembarazoydiabetes.
12.1.8Siemprequeelmdicotratantedelprimernivelasloconsiderenecesario.
12.1.9 Est recomendado el uso de aspirina a dosis bajas en todos los pacientes con diabetes que no presenten
contraindicacinabsolutaparasuutilizacin.
13.Otrasformasdediabetes
13.1Diabetesgestacional.
13.1.1Ladeteccinydiagnsticodediabetesgestacionalseefectuarsegnsesealaenelapartado10.4deesta
NormaOficialMexicana.
13.1.2Elmanejodeladiabetesgestacionalydeotrasformasespecficasdediabetesesresponsabilidaddelmdicoo
mdicaespecialista.
13.2Diabetestipo1.
13.2.1 Pacientes con sintomatologa sugestiva o diagnstico de diabetes tipo 1 son referidos al segundo nivel de
atencinoalespecialista.
13.2.2 Solamente cuando el o la paciente se presente con gran descompensacin y no sea posible referirlo(a) de
inmediatoaelolaespecialista,podrsertratado(a)provisionalmenteenelprimerniveldeatencin.
14.Vigilanciaepidemiolgica
14.1Poblacinenriesgo
El sobrepeso y la obesidad son factores de riesgo para la diabetes y otras enfermedades crnicas, la vigilancia
epidemiolgicadeestosfactoresderiesgoserealizardeconformidadconlasdisposicionesjurdicasaplicables.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

22/45

24/8/2015

DOFDiarioOficialdelaFederacin

Deconformidadconelartculo32bis2delreglamentointeriordelaSecretariadeSalud(fraccinX)encoordinacin
conelSistemaNacionaldeVigilanciaEpidemiolgica,ascomoproponerlaactualizacinenelmbitodesucompetencia
laNormaOficialMexicana017paralaVigilanciaEpidemiolgica.
SedebeincluirlaobesidadenelSistemaUnicodeInformacinenSaludenconformidadconelartculo32bis2del
Reglamento Interior de la Secretara de Salud (fraccin X) en coordinacin con el Sistema Nacional de Vigilancia
EpidemiolgicaparaproponerlaactualizacinalaNormaOficialMexicana017paralaVigilanciaEpidemiolgica,queesel
mbitodesucompetencia.
La vigilancia epidemiolgica de defunciones asociadas con diabetes y obesidad se practicar de acuerdo a lo
establecido por la Norma Oficial Mexicana NOM017SSA21994, Para la Vigilancia Epidemiolgica y los manuales,
lineamientos,resolutivosyacuerdosdelComitNacionaldeVigilanciaEpidemiolgica.
14.2Tamizaje
14.2.1 Los y las pacientes que de acuerdo a los resultados de la deteccin hayan sido detectados como probables
personascondiabetesdebernserconfirmadosenlaconsultadelmdicodeprimernivelynotificadosdeacuerdoalas
disposicionesjurdicasaplicablesenmateriadevigilanciaepidemiolgica.
14.2.2Sedebedeestablecerelseguimientoperidico,atravsdelascartillasnacionalesdesaludenelprimernivela
todaslasmujeresconantecedentedediabetesgestacionaloquesusproductoshayansidomacrosmicos.
14.3Notificacindecasos.
14.3.1LavigilanciaepidemiolgicadeladiabetesyobesidadsepracticardeacuerdoaloestablecidoporlaNorma
Oficial Mexicana NOM017SSA21994, Para la Vigilancia Epidemiolgica y los manuales, lineamientos, resolutivos y
acuerdosdelComitNacionaldeVigilanciaEpidemiolgica.
14.3.2 Se deben mantener actualizados los sistemas especiales vigentes para la Vigilancia Epidemiolgica de la
diabetesmellitustipo2.
14.4Defunciones.
14.4.1 El registro de las defunciones deber efectuarse siguiendo los lineamientos sealados en la Norma Oficial
MexicanaNOM017SSA21994,Paralavigilanciaepidemiolgica.
15.Bibliografa
15.1AACEDiabetesMellitusGuidelines,EndocrPract.200713(Suppl1)2007.
15.2AlpzarSM,SotomayorGA,CastroRMA,ZarateAA,MadrazoM.DiabetesMellitus,PrioridadInstitucional.RevMed
IMSS1998,36(1):12.
15.3 Alpzar SM: Diabetes mellitus en el adulto mayor. En: Gua para el manejo integral del paciente diabtico. 2a.
edicin,EditorialAlfil,2007.
15.4AlpzarSM:SndromeMetablico.En:Guaparaelmanejointegraldelpacientediabtico.2a.Edicin,EditorialAlfil,
2007.
15.5 Alpzar SM: Tratamiento de la Diabetes mellitus. En: Gua para el manejo integral del paciente diabtico. 2a.
Edicin,EditorialAlfil,2007.
15.6AmericanDiabetesAssociation:ExecutiveSummary:"StandardsofMedicalCareinDiabetes2008".DiabetesCare
31:S5S11.2008.
15.7AmericanDiabetesAssociation:Translationofthediabetesnutritionrecommendationsforhealthcareinstitutions.
DiabetesCare21(Suppl.1):S66S68,1998.
15.8AmericanDiabetesAssociation:Screeningfortype2diabetes.DiabetesCare21(Suppl.1):S20S22,1998.
15.9AmericanDiabetesAssociationClinicalPracticeRecommendations.DiabetesCare,Suppl1,January2007.
15.10AmericanDiabetesAssociation:Managementofdislipidemiainadultswithdiabetes.DiabetesCare21(Suppl.):
S3639,1998.
15.11AmericanDiabetesAssociation:Medicalmanagementoftype2diabetes.FourthEdition.1998.
15.12AmericanDiabetesAssociation:Screeningfottype2diabetes.DiabetesCare21/Suppl.):S20S22,1998.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

23/45

24/8/2015

DOFDiarioOficialdelaFederacin

15.13AmericanDiabetesAssociation:Diabetesmellitusandexercise(Positionstatement).DiabetesCare21(Suppl.1):
S40S48,1998.
15.14 American Diabetes Association: Nutrition recomendations and principles for people with diabetes mellitus.
DiabetesCare21(Suppl.1):S32S39,1998.
15.15AmericanDiabetesAssociation:Selfmonitoringofbloodglucose(Consensusstatement)DiabetesCare17(12):
8186,1994.
15.16AmericanDiabetesAssociation:Standardsofmedicalcareforpatientswithdiabetesmellitus(Positionstatement).
DiabetesCare:S8S9,1996.
15.17 American Diabetes Association: Nutrition Recommendations and Interventions for Diabetes. Diabetes Care 30
(SUPPL1):S48S63,2007.
15.18AmericanDiabetesAssociation:NutritionPrinciplesandRecommendationsinDiabetes.DiabetesCare27(Suppl
1):S36S46,2004.
15.19AmericanDieteticAssociation:Useofnutritiveandnonnutritivesweeteners(Positionstatement).JAmDietAssoc.
93:81621,1993.
15.20 Anderson JW, Bazel Gail P. Nutritional management of diabetes mellitus. En: Modern Nutrition in Health and
Disease,8thedition.ShilsME,OlsonJA,ShikeMeditors.pp.12591286,1994.
15.21AndersonJW.Tratamientonutricionaldeladiabetesmellitus.En:NutricinenSaludyEnfermedad,9a.edicin.
ShilsME,OlsonJA,ShikeMeditores.pp.15771614,2002.
15.22 Bourges RH: La agrupacin de los alimentos para fines de orientacin alimentaria: una controversia an no
resuelta.Rev.INNSZ4:MayJun1993.
15.23 BritoCrdova G. El cuidado de la diabetes. En: Lerman I, editor. Aprenda a vivir con Diabetes. Multicolor, 2a.
Edicin,pp.2751,2006.
15.24 BritoCrdova G. El cuidado de la diabetes (I. Nutricin). En: Lerman I, editor. Aprenda a vivir con Diabetes.
Multicolor,pp.2157,2006.
15.25BritoCrdovaGX,AguilarSalinasCA,RullRodrigoJA,GmezPrezFJ.AlimentacinenlaDiabetes:Unagua
prcticaparalaprevencinyeltratamiento.EditorialMcGrawHill,2004.
15.26BritoCrdovaGX.Losazcaresysusrepercusionesenelmetabolismodelaglucosayloslpidos.Rev.Nutricin
Clnica20047:185190.
15.27BritoCrdovaGX.ManejodelPesoCorporalyTratamientoDietticodelaObesidad.Rev.NutricinClnica1999
2:7480.
15.28 Burrit MR, Hanson E, Muerene NE, Zimmerman BR: Portable blood glucose meters: Teaching patients how to
correctlymonitordiabetes.PostgraduateMed89:7584,1991.
15.29"CouldYouHaveDiabetesandNotKnowit?TaketheTest.KnowtheScore"ADA,1995.
15.30ChvezM.M,MadrigalH,ChvezA,RosE.Guasdealimentacin.Mxico.INNSZ,OPS/OMS.Mxico1995.
15.31 Engelgeau MM, Albert RE, Thompson TJ, Herman W. Screening for NIDDM in nonpregnant adults. Areview of
principles,screeningtestsandrecommendationsDiabetesCare.18:1061618,1995.
15.32FanghnelSalmnG,SnchezRL,ArellanoMS,ValdsLE,ChaviraLJ,RascnPRA.Prevalenciadefactoresde
riesgodeenfermedadcoronariaentrabajadoresdelHospitalGeneraldeMxico.Rev.SaludPblicadeMxico39(5):427
432,1997.
15.33 Franz MJ: Lifestyle modifications for diabetes management In: Hirsch IB, Riddle Mc Editors.Endocrinology and
Metabolism.ClinicsofNorthAmerica26(3):499510,1997.
15.34GitaSen,Piroskastlin.Unequal,Unfair,IneffectiveandInefficientGenderInequityinHealth:Whyitexists and
howwecanchangeit.FinalReporttotheWHOCommissiononSocialDeterminantsofHealth.September2007.
15.35 GmezPrez FJ: Conceptos generales de tratamiento del paciente diabtico. En: GmezPrez FJ, Rull JA,
Editores.Diabetologa1997.InstitutoNacionaldelaNutricinSalvadorZubirn.
15.36GmezPrezFJ,AguilarSalinasCA.,En:Diabetes"ActualidadesTeraputicas".Cap.VIII"Cambiosenelestilode
vida:Tratamientonutricionalyatravsdelejercicio".1a.edicin,EditorialMEDICINA&MERCADOTECNIA,2004.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

24/45

24/8/2015

DOFDiarioOficialdelaFederacin

15.37 Gonzlez CHA, Lavalle GF, Rios GJ. Sndrome Metablico y Enfermedad Cardiovascular. Inter Sistemas
editores.15.2006.
15.38GuadeDeteccinIntegradadeDiabeteseHipertensinArterial.(CoordinacindeVigilanciaEpidemiolgica)en
http://www.ssa.gob.mxactualissate3mayo99notdihtm
15.39Guadiagnsticoteraputica,Diabetestipo2,Rev.Med.IMSS(Mex)35:353368,1997.
15.40Guadeejerciciosparalaprevencindeafeccionescardiovascularesehipertensinarterialenpersonasde30a
50aosdeedad.PROESA.DGPS,1998.
15.41Guadeejerciciosparalaprevencindepadecimientoscrnicodegenerativosparapersonasde51a70aosde
edad.PROESA.DGPS,1998.
15.42Guaderecomendacionesparalapromocindelasalud,prevencin,deteccin,diagnstico,tratamientoycontrol
delaprediabetes.
15.43GuadeTratamientoFarmacolgicoparaelControldeladiabetesmellitus.SecretaradeSalud.
15.44GutirrezAH,LaraEA,GuadalupeGR,SnchezMJCetal.Estudiocomparativodetresmtodosdedeteccinde
diabetestipo2.Mxico.ProgramadeSaluddelAdultoyelAnciano.Coord.deVigilanciaEpidemiolgica.SSA,1997.
15.45GutirrezAH,LaraEA,GuadalupeGR,TieneDiabetesynolosabe?diabetesHoy17:128130.1999.
15.46HarrisMI,KleinR,WelbornTA,KnuimanMW:OnsetofNIDDMoccursatleast47yearsbeforeclinicaldiagnosis.
DiabetesCare15:815819,1992.
15.47HermanWH.etal.Anewasimplequestionnairetoidentifypeopleatincreasedriskforundiagnoseddiabetes.
DiabetesCare18:382387,1995.
15.48HuangW,ConnorE,DelaRosaT,MuirA,SchatzD,SilversteinJ,CrockettS,SheJX,MaclaremNK.Although
DR3DQBI*maybeassociatedwithmultiplecomponentdiseasesoftheautoimmunepolyglandularsyndromes,thehuman
leukocyteantigenDR4DQBII0302haplotypeisimplicatedonlyinbetacellautoimmunity.J.ClinEndocrinolMetab81:15,
1996.
15.49JamesW.Anderson.En:ShilsME,OlsonJA,ShikeM,RossAC.NutricinenSaludyEnfermedad.9thEdicinen
Espaol,EditorialMcGrawHill:pp.15771613.2002.
15.50KnowlerWC:ScreeningforNIDDM:opportunitiesfordetection,treatment,andprevention.DiabetesCare17:445
450,1994.
15.51LebovitzEH,DefronzoAR:Tratamientodeladiabetesmellitusysuscomplicaciones.AsociacinAmericana de
Diabetes,1991.
15.52LeyFederalsobreMetrologayNormalizacin.CongresoGeneraldelosEstadosUnidosMexicanos.Mxico.
15.53LeyGeneraldeSalud.CongresoGeneraldelosEstadosUnidosMexicanos.Mxico.
15.54 Ley General para la igualdad entre hombres y mujeres. Congreso General de los Estados Unidos Mexicanos.
Mxico.
15.55LpezAJC,AguilarSCA,GmezPrezFJ,RullRJAAcarbosevs.Bedtimeinsulininthetreatmentofsecondary
failurestosulphonylureamatformintherapyintype2diabetesmellitus.Diabetes,ObesittyandMetabolism1:2935,1999.
15.56MarkovicTP,CampbellLV,BalasubramanianS,JenkinsAB,FleuryAC,SimonsLA,ChisholmDJ.BeneficalEffect
onaveragelipidlevelsfromenergyrestrictionandfatlossinobeseindividualswithorwithouttype 2 Diabetes. Diabetes
Care21:695700,1998.
15.57 Markovic TP, Jenkins AB, Campbell LV, Furler SM, Kraegen EW, Chisholm DJ. The determinants of glycemic
responsestodietrestrictionandweightlossinobesityandNIDDM2.DiabetesCare21:689694,1998.
15.58 McGregor MS, Pinkham C, Ahroni JH, Kerter CD, Doctor JD: The American Diabetes Association risk test for
diabetes:Isitausefulscreeningtool.DiabetesCare18:585586,1995.
15.59 Metzger BE, Caustan DR. Summary and Recommendations of fourth International WorkshopConference on
gestationaldiabetesmellitus.DiabetesCare21(Suppl.2):B161B167,1998.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

25/45

24/8/2015

DOFDiarioOficialdelaFederacin

15.60 Myers MA, Rabin DU, Rowley MJ: Pancreatic islet cell cytoplasmic antibody in diabetes is represented by
antibodiestoisletcellantigen512andglutamicaciddecarboxylase.DiabetesCare19:12901295,1995.
15.61PecoraroRE,ReiberGE,BurgessEM:Pathwaystodiabeticlimbamputation:Basisforprevention.DiabetesCare
13:51321,1990.
15.62PrezLizaurA.B.PlandeAlimentacinparaelindividuoSanoyEnfermo.En:NutriologaMdica.CasanuevaE,
KauferHorowitzM,PrezLizarAB,ArroyoPMxico,EditorialMdicaPanamericana1995.
15.63PrezLizaurA.B.,MarvnLL.SistemaMexicanodeAlimentosEquivalentes.FomentodeNutricinySalud,A.C.
2001.
15.64PrezLizaurA.B.,MarvanLabordeL.Manualdedietasnormalesyteraputicas.Losalimentosenlasaludyla
enfermedad.4a.Edicin.EdicionesCientficasLaPrensaMdicaMexicana.Mxico,2000.
15.65 Prez Lizaur A.B., Marvan Laborde L. Sistema Mexicano de Alimentos Equivalentes. Fomento de Nutricin y
Salud,A.C.Mxico.2a.Edicin.
15.66PrezPastenE.Manualparaelpacientecondiabetesmellitus.EditorialSolucionesGrficas.149161,1997.
15.67PiSunyerFX.Obesity.En:ShilsME,OlsonJA,ShikeM,RossAC.NutricinenSaludyEnfermedad.9thEdicinen
Espaol,EditorialMcGrawHill:pp.16151643.2002.
15.68PosadasRomeroC.Dislipidemiasyaterosclerosis.InteramericanaMcGrawHill.Mxico,1995.
15.69PracticalGuidetotheIdentification,EvaluationandTreatmentofOverweightandObesityinAdultsS.Department
ofHealthandHumanServices,PublicHealthService,NationalInstitutesofHealth,NationalHeart,Lung,andBloodInstitute.
NIHPublicationNo.004084,October2000.
15.70RatnerRe.Longtermhealthcareoutcomesindiabetes.Economicandpoliticalimplications.In:HirschIB,Riddle
MC,EditorsEndocrinologyandMetabolismclinicsofNorthAmerica26:487498,1997.
15.71ReportoftheExpertCommitteeontheDiagnosisandClassificationofDiabetesMellitus.DiabetesCare20:1183
1197,1997.
15.72RiddleIMC.TacticsfortypeIIDiabetes,In:HirschIB,RiddleMC,EditorsEndocrinologyandMetabolismClinicsof
NorthAmerica26:659677,1997.
15.73RomanSh,HarrisMI.Managementofdiabetesmellitusfromapublichealthperspective,In:HirschIB,RiddleMC,
EditorsEndocrinologyandMetabolismClinicsofNorthAmerica26:443474.1997.
15.74RullJA.Tratamientodelashiperlipidemias.En:GonzlezBarrancoJ,GuadalajaraBoo,Editores.Importanciade
loslpidosenlaMedicinaContempornea,1990.
15.75 Rull RJA, Chvez VA. y Bourges H. Grupo de alimentos: Recomendacin oficial del INNSZ. Rev.INNSZ 5(25):
Ene.Feb.1994.
15.76 Schmidli RS, Coleman PG, Harrison LC: Do glutamic acid decarboxylase antibodies improve the prediction of
IDDMinfirstdegreerelativesatriskforIDDM?JAutoimmunity7:873879,1994.
15.77SchottM,SchatzD,AtkinsonM,KrischerJ,MehtaH,VoldB,MaclarenN:GAD65autoantibodiesincrease the
predictabilitybutnotthesensitivityofisletcellandinsulinautoantibodiesfordevelopinginsulindependentdiabetesmellitus.
JAutoimnunity7:865872,1994.
15.78 Secretara de Salud. Proyecto de Modificacin a la Norma Oficial Mexicana para la Prevencin, Tratamiento y
ControldelaDiabetesMellitus.NOM015SSA1994.UsodeinsulinasenelTratamientodelaDiabetesMellitustipo1y2.
2005.
15.79 Secretara de Salud. Proyecto de Modificacin a la Norma Oficial Mexicana para la Prevencin, Tratamiento y
Control de la Diabetes Mellitus tipo 2. NOM015SSA1994. Uso de Combinaciones en el Tratamiento de la Diabetes
mellitustipo2.2003.
15.80SecretaradeSalud.ProgramaSectorialdeSalud20072012.Mxico,2008.
15.81SkylerJS.GlucoseControlinType2.DiabetesMellitus.AnnInterMed127:837838,1997.
15.82SociedadMexicanadeNutricinyEndocrinologa:Tratamientonutricioenlaprevencindelascomplicacionesde
ladiabetesmellitustipo2.RevistadeEndocrinologayNutricin2004,12(1):S15S22.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

26/45

24/8/2015

DOFDiarioOficialdelaFederacin

15.83 SolanoSnchez A. Plan de Alimentacin. En: Atencin integral del paciente diabtico, 3a. Edicin. Lerman I.
McGrawHill.pp.81108,2003.
15.84TapiaConyerR.etal.EncuestaNacionaldeEnfermedadesCrnicas.INNSZSecretaradeSalud,Mxico,1993.
15.85TapiaConyerR,VelzquezMO,LaraEA,MuozPL,MartnezMY,VzquezChC,AlpzarSM,RullRJA,Gmez
PrezF,AguilarSC,LermanGI,PrezPastenE,MoralesFHyPizaaBJ.ManualparaelManejodeInsulinas.Secretarade
Salud,Mxico2000.
15.86TratamientodelaDiabetesmellitusnoinsulinodependiente(DMNID).Unacontribucinalaimplementacindela
DeclaracindeSt.Vicente.2a.Edicin.GrupodePolticasparaEuropasobreDMNID,1993.
15.87TuomilehtoJetal.Preventionoftype2diabetesmellitusbychangesinlifestyleamongsubjectswithimpaired
glucosetolerance.NEnglJMed2001334:13431350.
15.88UNESCO.Recomendacionesparaunusonosexistadellenguaje.
15.89UsodeInsulinasenelTratamientodeladiabetesmellitustipo1y2.
15.90ValadezFigueroaIA,AldreteRodrguezMGyAlfaroAlfaroN.InfluenciadelaFamiliaenelControlMetablicodel
PacienteDiabticoTipoII.Rev.SaludPblicadeMxico35:464469,1993.
15.91 Velzquez MO, Lara EA. La deteccin como instrumento para vincular la prevencin primaria y la vigilancia
epidemiolgicadelosfactoresderiesgo.ForoSilans,4,9:2023,2000.
15.92VijanS,HoferTP,HaywardRA.Estimatedbenefitsofglucemiccontrolinmicrovascularcomplications in type 2
diabetes.
AnnInternMed127:788795,1997.
15.93 WHO. International statistical classification of diseases and related health problems. Tenth revision. (Vol. 1).
GinebraWHO,1992.
15.94WHO.PreventionofDiabetesMellitus.WHOTechnicalReportSeries.Genova,1994.
15.95Canadian Diabetes Association. Clinical Practice Guidelines for de Prevention and Management ofDiabetes in
Canada.CanadianJournalofDiabetesvol32,supplement1.September2008
15.96AmericanDiabetesAsociation.ClinicalPracticeRecommendations2010.January201033(Supplement1)
15.97 Federacin Internacional de diabetes. Gua global para la diabetes tipo 2. Internacional Diabetes Federation,
2005.
15.98FederacinInternacionaldediabetes.GuaGlobalparaladiabetestipo2,perspectivasmundialesdeladiabetes.
DiabetesVoice.2006,Septiembre,volumen
16.Concordanciaconnormasinternacionalesymexicanas
Esta Norma es parcialmente equivalente al Manual de Normas Tcnicas y Administrativas del Programade Diabetes
MellitusexpedidoporlaOrganizacinMundialdelaSaludynotieneequivalenteconnormasmexicanas.
17.ObservanciadelaNorma
LavigilanciadelaaplicacindeestaNormacorrespondealaSecretaradeSaludyalosgobiernosdelasentidades
federativas,ensusrespectivosmbitosdecompetencias,enlostrminosdelasdisposicionesjurdicasaplicables.
Las instituciones de atencin mdica pertenecientes al Sistema Nacional de Salud podrn solicitar, en cualquier
momento,unaevaluacindelaconformidad,siasloestimanpertinente.
18.Vigencia
EstaNormaOficialMexicanaentrarenvigoraldasiguientedesupublicacinenelDiarioOficialdelaFederacin.
SufragioEfectivo.NoReeleccin.
Mxico,D.F.,a5deagostode2010.ElSubsecretariodePrevencinyPromocindelaSaludyPresidentedelComit
ConsultivoNacionaldeNormalizacindePrevencinyControldeEnfermedades,MauricioHernndezAvila.Rbrica.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

27/45

24/8/2015

DOFDiarioOficialdelaFederacin

19.Apndicesnormativos
APENDICENORMATIVOA
CRITERIOSDESINDROMEMETABOLICO
Criterio
Presinarterial(mmHg)
Triglicridos(mg/dl)
ColesterolHDL(mg/dl)hombres
ColesterolHDL(mg/dl)mujeres
CircunferenciaAbdominal(cm)hombres
CircunferenciaAbdominal(cm)Mujeres
Glucosaplasmticadeayuno(mg/dl)

ATPIII
>130/85
>150
<40
<50
>90(modificada)
>80(modificada)
>110

IDF
>130/85
>150
<40
<50
>90(modificada)
>80(modificada)
>100

Sedeberncumplirde3de5criteriosdiagnsticosestablecidosporATPIIIeIDF
Fuente:AlbertiKG,EckelRH,GrundySM,ZimmetPZ,CleemanJI,DonatoKA,FruchartJC,JamesWP,LoriaCM,Smith
SC Jr International Diabetes Federation Task Force on Epidemiology and Prevention Hational Heart, Lung, and Blood
InstituteAmericanHeartAssociationWorldHeartFederationInternationalAtherosclerosisSocietyInternationalAssociation
for the Study of Obesity. Harmonizing the metabolic syndrome: a joint interim statement of the International Diabetes
Federation Task Force on Epidemiology and Prevention National Heart, Lung, and Blood Institute American Heart
Association World Heart Federation International Atherosclerosis Society and International Association for the Study of
Obesity.
APENDICENORMATIVOB
APENDICENORMATIVOB(1)
SISTEMADEEQUIVALENTES:COMPOSICIONPROMEDIODELOSGRUPOSDEALIMENTOS
Equivalente

1
1
1
1

1
1
1
1
1
1

Grupode
alimentos
P.O.A
Muybajoengrasa
Bajoengrasa
Moderadaengrasa
Altoengrasa
Leche
Descremada
Semidescremada
Entera
Conazcar
Leguminosas
Verduras
Cereales
y
Tubrculos
Singrasa
Congrasa
Aceitesygrasa
Sinprotena
Conprotena
Frutas
Azcares
Singrasa
Congrasa

1
1

1
1
1

1
1

Energa

Protena

Lpidos

HCO

40
55
75
100

95
110
150
200
120
25

7
7
7
7

9
9
9
8
8
2

1
3
5
8

2
4
58
5
1
0

0
0
0
0

12
12
12
30
20
4

70
115

45
70
60

40
85

2
2

0
3
0

0
0

0
5

5
5
0

0
5

15
15

0
3
15

10
10

AdaptadodelSistemaMexicanodeAlimentosEquivalentes
APENDICENORMATIVOB(2)

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

28/45

24/8/2015

DOFDiarioOficialdelaFederacin

DISTRIBUCIONDEEQUIVALENTESENUNPLANDEALIMENTACION
PARAPERSONASCONDIABETES
Grupode
alimentos

1200kcal

1400kcal

1600kcal

1800kcal

2000kcal

2500kcal

HCO=50%
Prot=25%
Lip=25%
Productos de 3
Origen Animal
(P.O.A)

Lcteos

Leguminosas 1

1.5

2.5

Verduras

Cereales
tubrculos

y5

6.5

Aceites
Grasas

y5

5.5

6.5

7.5

Frutas

El nmero de equivalentes vara de acuerdo a los requerimientos energticos. Estos se calculan deacuerdoalpeso
deseable,laestatura,laedad,elsexoylaactividadfsicadelindividuo.
APENDICENORMATIVOB(3)
RESUMENDELSISTEMAMEXICANODEALIMENTOSEQUIVALENTES

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

29/45

24/8/2015

DOFDiarioOficialdelaFederacin

L ACTEOS CONBAJOCONTENIDODE GRASA


EN TEORIA CADA RACION CONTIENE

95 KCAL, 12 GR DE HC, 9 DE

CEREALES Y TUBRCULOS ( ENERGA 68 KCAL, 15 GR DE HC,2 GR DE


PROTEINA,GRASA0G)

PROTEINAS Y 2GRDE GRASA

PANY TORTILLA

Lechelquidadescremada1taza(240ml)

Bolillosinmigajn1/3pieza

Lechedescremadaenpolvo3cdas.

Pandecaja

Yogurtnaturalsinazcar,descremado1taza

(blanco,tostado,integral) 1rebanada

Lecheevaporadadescremadatazao120ml

Tortillademaz1pieza

Jocoquenaturaldescremado1taza(240ml)

Tortilladeharinapieza

PRODUCTOS DE ORIGENANIMAL(P.O.A)

CEREALES

BAJOCONTENIDODE GRASA (ENERGA 55KCAL,PROTEINAS 7GR, GRASA 3

Arrozcocidotaza

GR)

1Racin(Yacocida)
AVES (carnesinpiel):Avestruz,codorniz,faisn,
gallina,pavoopollo40gramos
CERDO:maciza40gramos
CONEJO:cualquierpartemagra30gramos

Avenaenhojuelas1/3taza
Harina(todas) 2cdas
Hojuelasdearroz1/2taza
Hojuelasdemazsinazcar taza
Hojuelasdetrigointegraltaza

RES :aguayn,bistec,bola,carneseca,cecina, chamberete, Masadenixtamal50gr


falda,filete,macizaymolidaespecial40gramos
Palomitascaserassingrasa21/2tazas
T ERNERA :espaldilla,lomo,pierna40gramos

Sopadepastacocidataza

Clarasdehuevo2pzas

GALLETAS

EMBUTIDOS

Animalitos6piezas

Jamndepavo40gramos

Habaneras4piezas

QUESOS

Maras4piezas

Quesocanasto,cottage,panela,
frescodevaca,requesnyricotta30gramos
PESCADO
(Frescosoenlatadosenagua)
Atnenlatadoenagua(escurrido)30gramos
Pescado:cualquiera
(frescoocongelado) 30gramos
Sardinamedianasinaceite30gramos
Huachinango30gramos
Frutas(Energa60kcal,15grdeHC)
ALTOENFIBRA
Perapieza
Fresas1taza
Granada1pieza
Guayaba2piezas
MEDIOCONTENIDODE FIBRA

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

Saladas(singrasa) 4piezas
T UBERCULOS
Camote1/3taza
Papapieza
Papaenpur(singrasa) taza
LEGUMINOSAS (20GRDE HC,8GRDE PROTEINAS ,1GRDE GRASA)

Alubia,chcharo,frijol,garbanzo,haba,lenteja,soya1/2taza
VERDURAS (4grdeHC,2grdeprotenas)
AcelgatazaFlordecalabazataza
Apio1tazaHongos1taza
Calabacitas1piezaJitomate1pieza
Cebollinas3piezasLechuga3tazas
ChayotetazaNopales1taza
Pepino1tazaChilepoblanopza.
CilantrotazaPimiento2tazas
Col1tazaRabanitos2tazas

30/45

24/8/2015

DOFDiarioOficialdelaFederacin

MEDIOCONTENIDODE FIBRA

Col1tazaRabanitos2tazas

Chabacano4piezas

Coliflor tazaRomeritos1taza

Chicozapotepieza

Ejote1tazaTomateverde1taza

Durazno2piezas

Esprragos6piezasVerdolagas1taza

Manzana1piezapeq.

Berro1tazaHuitlacoche1/3taza

Ciruelas,higofresco3piezas

GRASAS(5GRDEGRASA)

Papayapicada2/3taza

MONOINSATURADAS

BAJOENFIBRA

Aceites:(cnola,oliva) 1cdita.

Mamey1/3pieza

Aceitunas8piezas

Mandarina2piezas

Aguacate1/3pieza

Mangopieza

POLINSATURADAS

Meln1taza

Aceites:

Naranjaengajos1taza

(crtamo,maz,soya,girasol) 1cdita.

Piataza

Almendras10piezas

Pltanopieza

Avellanas7piezas

Zapotenegropieza

Cacahuates18gr

Tuna2piezas

NuecesdeCastilla3cdas.

Sanda1taza

Pistaches4cditas

Uvarojataza

Mayonesa1cdita.

Uvaverdetaza
Kiwi1pieza

Adaptado de Sistema Mexicano de Alimentos Equivalentes (Se puede revisar el sistema Mexicano de Equivalentes
completo)
APENDICENORMATIVOC
ESTIMACION DE REQUERIMIENTOS ENERGETICOS DIARIOS, SEGUN DIVERSAS CONDICIONES DE LAS
PERSONAS
kcal/kgpeso
Hombresconactividadfsicanormalomujeresfsicamente
muyactivas
Mujeresconactividadfsicanormalyhombresconvida
sedentariaomayoresde55aosactivos
Mujeressedentariasyhombresmayoresde55aos
sedentarios
Mujeresembarazadas(1er.trimestre)
Mujeresembarazadas(2o.trimestre)
Mujereslactando

30
2528
20
2832
3638
3638

APENDICENORMATIVOD
METASBASICASDELTRATAMIENTOYCRITERIOSPARAEVALUARELGRADODECONTROLDELPACIENTE
Metasdeltratamiento
Glucemiaenayuno(mg/dl)
Glucemiapostprandialde2h.(mg/dl)
HbA1c(%)*
Colesteroltotal(mg/dl)
ColesterolLDL(mg/dl)
Triglicridosenayuno(mg/dl)
ColesterolHDL(mg/dl)hombres
http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

70130
<140
<7
<200
<100
<150
>40
31/45

24/8/2015

ColesterolHDL(md/dl)mujeres
Microalbuminuria(mg/da)
Presinarterial(mmdeHg)
IMC

DOFDiarioOficialdelaFederacin

>50
<30
<130/80
<24.9

Circunferenciaabdominal(cm)hombres
<90
Circunferenciaabdominal(cm)mujeres
<80
*Enloscasosenqueseaposibleefectuarestaprueba.
**EsnecesariouncontrolestrictodelaP.A.parareducirelriesgodedaorenal.Sielpacientefumaunametaadicional
esdejardefumar.
APENDICENORMATIVOE
EVALUACIONCLINICAAPACIENTESANTESDEESTABLECERUNPROGRAMADEACTIVIDADFISICA
Se debe tener especial cuidado en casos con ms de 10 aos de evolucin clnica y cuando estnpresentes otros
factoresderiesgocardiovascular,complicacionesmicrovasculares,enfermedadvasculardemiembrosinferiores,neuropata
autonmicaohistoriadehipoglucemiasseveras.Encasodedudadebeserreferido(a)auncentrode2o.nivelpararealizar
unaevaluacincardiolgicaantesdeliniciodelprogramadeejercicio.
Sedebedescartarlapresenciaderetinopataproliferativaconelfindeevitarlaprecipitacindeunahemorragiavtrea.
Noserecomiendaejerciciomoderadoaintensoenpersonasconalbuminuria.Debedescartarselapresenciadelesiones
en los pies, puntos de apoyo incorrectos, hipotensin postural, taquicardia persistente. Se recomienda la realizacin de
caminata,natacin,andarenbicicleta.Sedebevigilarelejercicionoaerbico,carrera,trote,ejerciciosenescaleras.
Sisedetectaunaglucemia>250mg/dlocetosis,debecontrolarseestaglucemiaafindeincorporarsealejercicio.Eloal
pacientecondiabetesdebeportarunaidentificacinalmomentoderealizarejerciciofueradesudomicilioytraerconsigo
algunafuentedecarbohidratossimplesparatratarrpidamenteunahipoglucemia.
Elhorariodeejerciciodebeseracordealtratamientohipoglucemiante.
ACTIVIDADFISICAYDIABETES
ActividadFsica:Esunaactividadfsica:libre,voluntaria,repetitiva,queseplanificayorganiza,conelobjetivodemejorar
lacalidaddevida.
EjercicioAerbico:Usagrandesgruposmusculares,querequierendeoxgenoporperodosprolongados.
Ejercicioanaerbico(resistencia),usamsculoslargosquenorequierenoxgenoporperiodoscortos.
EtapasdelasesindeEjercicioFsico.
Etapadecalentamiento:Prepararelcuerpopararealizarlaetapaprincipal,conmovimientossuavesdelospiesala
cabeza(10a15minutos)
Etapaprincipal(aerbico):Movimientosparafortalecerelsistemacardiovascular(coraznyarterias)(30a60minutos)
ejemplocaminar,trotar,nadar,bailar,bicicletafijasinresistencia.
Etapadeenfriamiento(recuperacin):Movimientossuavesparafinalizarlasesindeejerciciofsico(10a15minutos)
Recomendaciones:
Haceruntotalde150minutosdeejerciciomoderadointensocadasemanadivididoendasnoconsecutivos
Efectuarejercicioderesistencia3vecesalasemana
Cmoempezar:
FRECUENCIA:3a5vecesporsemana
DURACION:Comenzandode2030minutos,eiraumentandoprogresivamente,hastaalcanzar60minutos.
INTENSIDAD: Objetivo, alcanzar beneficios cardiovasculares y mejorar el metabolismo energtico. La intensidad del
ejerciciodeberestarentreel50a74%delafrecuenciacardiacamxima,conlafinalidaddeevitarriesgos.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

32/45

24/8/2015

DOFDiarioOficialdelaFederacin

Cmocalcularunritmorecomendable?
220(edad):_______(FCreposo):_______(*.50):_____(+FCreposo):_________
220(edad):_______(FCreposo):_______(*.75):_____(+FCreposo):_________
Ejemplo:
Mujerde30aos
FCReposo=60
220(30):190(60):130(*.50):65(+60):125
220(30):190(60):130(*.75):97.5(+60):157
Paraqueelejercicioseabenfico,supulsodeberestarentre125y157pulsacionesporminuto,durantelafasede
actividadprincipal,delejercicio.
Cmomedirlaintensidaddelejercicioenelpaciente?
Preguntndole:Cmosesiente?,Culessutemperatura?,Cmoessurespiracin?,Aquritmolatesucorazn?
Intensidadmuysuave:respiracinsuave.
Intensidadsuave:iniciodesensacindecalor,ligeroaumentodelritmocardiacoylarespiracin.
Intensidad moderada: aumenta la sensacin de calor, el ritmo de la respiracin y de los latidos del corazn se
incrementan,ylepermitehablar.
Intensidad vigorosa: aumenta la sensacin de calor, el ritmo de los latidos del corazn es elevado, al igual que la
respiracin.
Esfuerzomximo:sensacindecalormuyfuerte,elritmodeloslatidosdelcoraznesmuyelevadoyfaltaelaliento.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

33/45

24/8/2015

DOFDiarioOficialdelaFederacin

PrecaucionesenpersonascondiabetesTipo2:
Complicacin

Recomendado

Contraindicado

Nefropata

Debajaamoderadaintensidad

Dealtaintensidad

Neuropataperifrica

Actividadessinpeso

Caminataprolongada

Retinopata

Debajoimpacto

Actividadesdealtoimpacto

APENDICENORMATIVOF
PLANALIMENTARIOSEGUNCONDICIONESESPECIFICAS
a) Pacientes con obesidad (IMC >30): dietas con restriccin energtica 2025 kcal/da con base en el peso
recomendable.
Inicialmenteserecomiendareducirdelconsumohabitual250a500kcal/da,hastaalcanzar1200kcal/da,paralograr
unareduccindepesode0.5a1.0kg/semana.Descensosdepesopequeos,perosostenidoscomo 5% de sobrepeso
ayudanalcontrolmetablico.
Paradeterminarelconsumohabitual,cadapacienteregistrarlosalimentosdedosdasdelasemanaydeundadelfin
desemana.
Dietabajaenenerga:Noserecomiendaunconsumomenora1200kcal.ElVET(ValorEnergticoTotal)seajustarde
maneraindividualizadayequilibradaentrelosgruposdealimentos.
Fraccionarhastaseiscomidasdiarias,dependiendodeloshbitosdelpaciente.
Limitarlagrasa.Sugerirelconsumodecarnesmagras,res,pollo(sinpiel)ypavo.
Incrementarelconsumodepescado.
Recomendar aceites con mayor contenido de cidos grasos monoinsaturados (aceite de oliva, aguacate, cacahuate,
etc.)ycidosgrasospoliinsaturados(aceitesdepescado,girasol,maz,soya,etc.)

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

34/45

24/8/2015

DOFDiarioOficialdelaFederacin

b)Pacientesconpesonormal(IMC>18.5y<24.9kg/m2).
Dietanormalenenerga:dependerdelaactividadfsicayelmomentobiolgico:
ElVETsecalculaentre25y40kcalporkgdepesoporda.
Reducircontenidodeazcaresrefinadosygrasassaturadas.
Fraccionarde3a5comidasdiarias.
c)Pacientesconpesobajo(IMC<18.4kg/m).
Dietaconaltoconsumoenergtico.
Tratamientoadecuadoparalograrpesonormal.
d)Pacientesconcolesterolelevado.
Limitarelconsumodetodotipodegrasadeorigenanimal.
Aumentarelconsumodefibrassolubles(verduras,frutasconcscara,leguminosas,etc.)
Recomendaraceitesconmayorcontenidodecidosgrasosmonoinsaturados(aceitedeoliva,aguacate,cacahuate,
etc.)ycidosgrasospoliinsaturados(aceitesdepescado,girasol,maz,soya,etc.)
Evitaralimentosconaltocontenidodecolesterol(yemasdehuevo,vsceras,mariscos,etc.).
Eliminaralimentosricosencidosgrasossaturados(manteca,mantequilla,aceitedecoco,depalma,etc.).
e)Pacientescontriglicridoselevados.
Limitarelconsumodegrasassaturadasyazcaresrefinados.
Aumentarelconsumodefibrassolubles(verduras,frutasconcscara,leguminosas,etc.).
Evitarelconsumodebebidasalcohlicas.
f)Pacientesconcidoricoelevado.
Evitarfactoresprecipitantescomoeldescensobruscodepeso.
Reducirelconsumodefuentesdegrasassaturadas,vsceras,carnesrojas,leguminosasyembutidos.
Evitaroreducirelconsumodealcohol.
g)Pacientesconhipertensinarterial.
Restringirconsumodesodioamenosde2gporda.
Noaconsejarelconsumodesaladicionalalascomidas,sustituirlaporcondimentosnaturalesoutilizarsustitutosde
salpermitidosporlaSecretaradeSalud(comolasaldepotasio).
h)Pacientesconalbuminuria:calcularelconsumodeprotenasa0.8g/kg/da.
Adecuarelconsumodealimentosricosensodio,potasioycalciodependiendodelasconcentracionesdeelectrolitos
decadapaciente.
Adecuarlacantidaddelquidosdependiendodelapresenciadeedema.
APENDICENORMATIVOG
ESTRATEGIASPARALOGRARLASMETASDECONTROL
1.Automonitoreoconglucemiacapilar
La frecuencia y tiempo de automonitoreo de glucemia capilar debe ser dictada por las necesidades particulares y
objetivosdecadapaciente.Esespecialmenteimportanteenpacientestratadosconinsulinapara valorar hipoglucemia y
descontrolhiperglucmico.
Enpersonascondiabetesmellitustipo1,conrgimenintensificado,laglucemiacapilarserealizardiariamenteantesy
2horasdespusdecadaalimento,antesdedormiryalas3:00delamaana.Unavezqueelolapacientehalogradoun
controladecuado(HbA1c<7%)sepuedeajustarelautomonitoreoacriteriodelmdicoespecialista.
Laspacientesconembarazoentratamientoconinsulinaserecomiendantresomstomasdeglucemiacapilaralda,
tantopreprandialcomoposprandial.
Enpacientecondiabetesmellitustipo2debeserlosuficienteparafacilitaralcanzarlosobjetivosdecontrol.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

35/45

24/8/2015

DOFDiarioOficialdelaFederacin

Enpacientescondiabetesmellitustipo2entratamientocondietayejercicioy/ohipoglucemiantesoralesserecomienda
automonitoreo de glucemia capilar por lo menos una a dos veces a la semana, valorando tanto preprandial como
posprandial,endiferentescomidasdelda,ascomoantesydespusdelarealizacindeejercicio.
Enpersonascondiabetestipo2queseadministraninsulina,elautomonitoreodelaglucemiacapilarsedebermedir
tantolaglucosapreprandialcomoposprandialdelostresalimentoscuandomenosdosotresvecesalasemana.
Enpersonasconglucosadeayunonormal,peroconHbA1cfueradelametadecontrol,sedebenrealizarglucemias
capilaresdoshorasdespusdelosalimentosparadeterminarcmoseencuentralaglucosaposprandial(lasdoshorasse
midenapartirdelprimerbocado).
Cuando se inicia o modifica el manejo con medicamentos o insulina, el automonitoreo de glucemia capilar,tanto en
diabetesmellitustipo1comotipo2,sedeberhacermsfrecuentementequelousual.
Se debe evaluar por el personal de salud, la tcnica para la toma de glucemias capilares por el o la paciente o
familiares,tantoaliniciocomoaintervalosregulares.
Ventajasdelautomonitoreodelaglucemia
Losensayosclnicosquevaloranelimpactodelcontrolglucmicohanincluidoelautomonitoreodeglucemia capilar
comopartedeintervencionesmultifactoriales,sugiriendoqueesuncomponenteefectivoenlaterapia.Permiteevaluarla
respuestaindividualdelpacientealaterapiayvalorarsisecumplenlosobjetivosdecontrol.
Elautomonitoreoinformasobreelcomportamientodelaglucosasanguneaenlasdiferenteshorasdelda,ascomosus
variaciones con relacin a las comidas, ejercicio, enfermedades asociadas y condiciones emocionales. Los resultados
pueden usarse para el ajuste del manejo con medicamentos o insulina, el apego a las medidas de alimentacin y de
actividad fsica, as como detectar y prevenir cuadros de hipoglucemia y, sobre todo, mantener la glucemia dentro del
objetivoplanteado.
El automonitoreo nos va a permitir adems decidir correctamente acerca de la aplicacin de insulina rpidadurante
infecciones,enfermedadesintercurrentesoproblemasemocionalesseveros,ascomounamejorcomprensinrespectoalo
que son tanto la diabetes, como su manejo. De este modo, es posible corregir ideas errneas y mejorar el control del
padecimiento.
2. Tratamiento en situaciones especiales. Diabetes gestacional y casos de pacientes con diabetes que se
embarazan.
Enambassituacionesclnicas,cuandoserequieratratamientofarmacolgico,deberhacerseconinsulinahumana,ya
seaNPH,rpidaomezcladelasdos.Elmanejocorrespondealespecialista,porloqueestospacientesdebenderivarseal
segundootercerniveldeatencin.
APENDICENORMATIVOH
CondicionesClnicasAsociadas
CualquierformaclnicadeSndromeCoronarioateroscleroso:IAM,IMantiguo,anginadepecho,reanimacindeparo
cardiacodeorigencoronario
Evidenciadeisquemiamiocrdicasilenciosa
Cualquierformaclnicadeenfermedadvascularcerebralaterosclerosa:
Lesionescarotdeasobstructivasaunsilenciosas
Enfermedadarterialperifricaaterosclerosaclnica
Aneurismaartico
AlbuminuriaoproteinuriaasociadaaFRcardiovascular
Creatinina>1.5mg/dlenvaronesyde1.6mg/dlenmujeres
InsuficienciacardiacaorenalasociadasaFRcardiovascular
ApneaObstructivadelsueo
Retinopatadiabticay/ohipertensivagrados3y4
Hipercolesterolemiafamiliar,dislipidemiafamiliarcombinada,disbetalipoproteinemia

PrimerConsensoMexicanoparaelDiagnsticoyTratamientodelasdislipidemias

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

36/45

24/8/2015

DOFDiarioOficialdelaFederacin

APENDICENORMATIVOI

20.ApndicesInformativos
APENDICEINFORMATIVOA

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

37/45

24/8/2015

DOFDiarioOficialdelaFederacin

APENDICEINFORMATIVOB
EstndaresparalaEducacinenDiabetes
LaEducacinTeraputicaesparteintegraldeltratamientoydeberaestaraccesibleatodaslaspersonasenriesgoo
condiabetes.ElobjetivoprincipaldelaEducacinTeraputicaeslograrlaautonomadelapersonaenelmanejoycontrol
desudiabetesymejorarsucalidaddevida.
LosestndaresparaproveerEducacinTeraputicaenDiabetessondiseadosparadefinirygarantizarlacalidaddela
educacin que pueda ser implementada en diferentes lugares y debern facilitar el logro de mejores resultados en el
cuidadodelasalud.
Losestndaresdeeducacinendiabetesincluyen:
Programaeducativo
Educadores(as)capacitadosycertificados(as)
Asegurarlacalidad
Auditable
Programaeducativo
Centradoenlapersona,acordeasusnecesidadesyformaindividualdeaprender
Confiable,vlido,relevanteycomprensivo
Teorabasadaenevidencias
Flexibleycapazdesoportarladiversidad
Capazdeusardiferentesmtodosdeenseanza
Serunrecursoefectivoytenermaterialesdeapoyo.
Currculumescritoconcriteriospararesultadosdeaprendizajeexitosos.
Educadores(a)capacitadosycertificados(as)
Queentiendanlateoraeducativa,apropiadaalaedadynecesidadesdeloseducandos
Capacitados(as)ycompetentesparaproporcionarlateoraeducativadelosprogramasqueofrecen
Capacitados(as) y competentes para proporcionar los principios y contenidos del programa especfico que ofrecen
certificados.
Asegurarlacalidad
Elprogramaeducativoaplicadorequiereserrevisadoporasesores(as)capacitados(as),competenteseindependientes
queevalenlossiguientescriterios:
Estructura
Ambientedeaprendizaje
Estructuradelprograma
Proceso
Contenido
Usodemateriales
Formaenqueelprogramaestsiendoaplicado
Documentarlosresultados
Resultados
Evaluacineinformacindelosresultados
Evaluacindelprograma
EvaluacindelEducador(a)
Serauditable
Elprogramadebeserauditadoen:
resultadosbiomdicos
calidaddevida
experienciadelaoelpaciente
http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

38/45

24/8/2015

DOFDiarioOficialdelaFederacin

gradodeautomanejologradocomoresultadodelprograma

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

39/45

24/8/2015

DOFDiarioOficialdelaFederacin

APENDICEINFORMATIVOC
Currculumeducacionalparalapersonacondiabetes
Uncurrculumformalparalaeducacindelpacientedebeproporcionarunacomprensinclaradelanaturalezadela
diabetesysutratamiento,ydelaprevencindelascomplicaciones.Tambinsenecesitaeducacincontinuadaytodaesta
educacindeberasersupeditadaalaformapersonaldeaprender,decadapaciente,suedadyocupacin,suculturayel
tipodediabetes.
ELCURRICULUMEDUCACIONALDEBEINCLUIRLOSSIETECOMPORTAMENTOSDEAUTOCUIDADO*
Comiendosaludablemente
Haciendoactividadfsica
Vigilandomisvalores
Tomandomismedicamentos
Encontrandosoluciones
Reduciendomisriesgos
Adaptndomesaludablemente
*Loscomportamientosdeautocuidadoseenuncianenvozactiva
ElProcesoeducativoconstade:
ValoracinInicial
Planeacin(objetivosycontenidos)
Implementacin
Evaluacindelaestructura,procesoyresultados.
APENDICEINFORMATIVOD
AcidosGrasosTrans
La configuracin espacial de la molcula de los cidos grasos (AG) tiene una caracterstica llamada isomerismo
geomtrico, en donde las configuraciones pueden ser cis o trans. Los AG de la naturaleza tienen en su mayora
configuracincisymuypocosconfiguracintrans.Loscarbonoscondobleligaduraenlaposicincistienedostomosde
hidrgeno unidos del mismo lado respecto a la doble ligadura, mientras que en la configuracin trans, los tomos de
hidrgenoestncolocadosenladosopuestosrespectoaladobleligadura.Loanteriorhacequelacadenadecarbonosen
los trans adopte una configuracin lineal, en contraste con la configuracin angulada de los cis, lo cual cambia la
funcionalidaddelamolcula.
LosAGinsaturadosquecontienenalmenosunadobleligaduraenconfiguracintranssepresentandemaneranatural
opuedenproducirsedemaneraindustrialmedianteelcalentamientodeaceitesvegetalesenpresenciadecatalizadores
metlicosydehidrgenoypuedenllegarasercercade60%deunproducto.Estecambioenlaconfiguracinproduceuna
rigidezenlacadenadelAG,locualsetraduceenquelagrasaquelocontieneaumentasupuntodefusin,mantenindose
enestadoslidoatemperaturaambiente.
Laingestindecidosgrasostransseasociaconunodelosriesgosmsaltosdesufrirenfermedadcardiovascular,
inclusivemayoraldeloscidosgrasossaturados.LaconsecuenciadeunconsumoaltodeAGtranseselaumentoenla
sangre de las lipoprotenas de baja densidad (LDL) asociado con alto riesgo cardiovascular y con disminucin de las
lipoprotenasdealtadensidad(HDL),cardioprotectoras.LoanterioralteralarelacindecolesterolLDL/HDLpordobleva
multiplicando el riesgo cardiovascular. Adems, su consumo aumenta los triglicridos la lipoprotena Lp(a) y las
subfracciones de LDL densa y pequea, todos ellos asociados a mayor riesgo cardiovascular y con alteraciones en la
funcindelasarteriasincluyendounamayorfrecuenciadeenfermedadcoronaria.

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

40/45

24/8/2015

DOFDiarioOficialdelaFederacin

Loscidosgrasosysustipos
LOSACIDOSGRASOS:

CARACTERISTICASPRINCIPALES(EFECTOSENELCUERPO)
YALIMENTOSQUELASCONTIENEN:

Se dividen en saturados
o
insaturados dependiendo de su
estructura.
A su vez, las grasas insaturadas se
dividen en grasas monoinsaturadas y
poliinsaturadas.

Los cidos grasos son cadenas largas de tomos de carbono,


unidos entre s por uno o dos enlaces, completando su valencia
cuaternariacontomosdehidrgeno.
Acidos grasos saturados: Carecen de dobles ligaduras. Se
recomienda que no excedan ms de una tercera parte de los
cidos grasos consumidos. Algunos productos contienen
cantidadeselevadasdecidosgrasossaturados.Lasgrasasde
origen animal como: la mantequilla, las mantecas, la crema, los
quesos,elsuerovacuno,chicharrndecerdo,elchorizo,etc.
Losaceitesvegetales(comolosonporejemploelderivadodela
nuez de palma y del coco) que tienen una consistencia firme a
temperatura ambiente como el chocolate, las margarinas
contienennivelesmsaltosdecidosgrasossaturados.
Acidos grasos insaturados: Se les denomina a los que tienen
una(monoinsaturados)oms(poliinsaturados)dobles ligaduras.
Estn presentes en el aguacate y en la mayora de los aceites
vegetales, como: el de soja, canola, semilla de algodn, maz,
oliva, azafrn, girasol y otros vegetales que tienen una
consistencia lquida a temperatura ambiente contienen niveles
msaltosdecidosgrasosinsaturados.
Acidosgrasosmonoinsaturados:Selesdenominaasalosque
tienenunadobleligaduracomoloscidosoleicoypalminoleico.
Abundanenelaceitedeolivayotros.
Acidos grasos poliinsaturados: Se les denomina as a los que
tienenvariasdoblesligaduras.Loscidosgrasoslinoleicosson
indispensablesenladieta.Seencuentranenlosaceitesdemaz,
girasol, crtamo, colza o canola, soja, algodn e hgado de
bacalao, la mayora de los pescados y los alimentos de origen
vegetal.
Eltipodecidograsoquepredomineserelquedeterminesiuna
grasa es slida o lquida y si se la caracteriza como saturada
oinsaturada.

ACIDOSGRASOSTRANS:

Acidos grasos trans: se les denomina as a los ismeros de


cidos grasos monoinsaturados. Se pueden producir en la
hidrogenacin de aceites vegetales durante la elaboracin de
margarinaygrasasvegetales.Seleshanatribuidoefectostxicos.
Son cidos grasos insaturados que se forman cuando los
aceitesvegetalesseprocesanysetransformanenmsslidoso
enunlquidomsestable.Esteprocesosellamahidrogenacin.
Lasgrasastranstambinseencuentrannaturalmenteenalgunos
alimentos.
La mayora de las grasas trans provienen de los alimentos
procesados.
Aproximadamente 1/5 de las grasas trans de nuestra dieta
provienedefuentesanimalescomoporejemplo,ciertascarnesy
productoslcteos.
Lasgrasastransestnpresentesen:
alimentoshechosabasedeaceitesparcialmentehidrogenados,
comolosonlosproductoshorneados(pastelitos empaquetados),
fritosylamargarina.
Losaceitesparcialmentehidrogenadosseusanenlosalimentos
procesados porque ayudan en la fabricacin de productos
alimenticiosdealtacalidadquesemantienenfrescosdurantems
tiempoytienenunatexturamsapetitosa.
Puedenproducirgrasaparafrerpapas,pastashojaldradas,bases
para pay y crocantes galletas saladas. Los productos que se

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

41/45

24/8/2015

DOFDiarioOficialdelaFederacin

fabrican con aceites parcialmente hidrogenados no se ponen


rancios. Los alimentos que contienen estos aceites deben
mencionarensuetiquetanutricional"aceitevegetalparcialmente
hidrogenado".

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

42/45

24/8/2015

GRASASSATURADAS,LAS
GRASASTRANSYEL
COLESTEROL:

DOFDiarioOficialdelaFederacin

Se ha observado que estas tres grasas aumentan el nivel del


colesterol LDL en la sangre. Adems, existen evidencias que
sugieren que el consumo de grasastransdisminuye el nivel de
colesterolHDL.

ACIDOSGRASOSBENEFICOSO
PROTECTORESPARAEL
ORGANISMOSONLOS:
ACIDOSGRASOSOMEGA3Y
OMEGA6

Soncidosgrasosconunenlacedoblesituadorespectivamente
en el tercer y sexto tomo de carbono contado a partir del
extremoomega(metilo) de la molcula. Las fuentes principales
sonelpescadodeaguasfrasylosaceitesvegetales.Loscidos
grasos omega 3 y omega 6 tienen funciones protectoras en la
prevencin de cogulos de sangre y reducen el riesgo de
cardiopatacoronaria.

Ambosintervienenenlareduccindelcolesteroltransportadoen
lipoprotenas de baja densidad (sobre todo las partculas ms
pequeas y densas, y de mayor peligro, el "colesterol malo" o
LDL), y facilitando el aumento de las lipoprotenas de alta
densidad(el"colesterolbueno"oHDL)quelimpialasarteriasen
vezdedeteriorarlas.

ACIDOSGRASOSOMEGA3

Sonsustanciasgrasasquetomamosenladietaquepertenecenal
grupodeloscidosgrasospoliinsaturados(PUFAs),yqueestn
relacionadas con el cido alfalinolnico. Este es un cido graso
delosllamados"esenciales"porquenuestroorganismoesincapaz
defabricarlo,ytienequesertomadoconelalimento.Los cidos
grasosomega3estnimplicadosnosloenlamaduracinyel
crecimientocerebralyretinianodelnio(poresolalechematerna
llevaestoscidosgrasos),sinoqueintervienenenlosprocesosde
inflamacin,coagulacin,presinarterial,rganosreproductivosy
metabolismograso.

Entrelasvariascapacidadesdeloscidosomega3ylasgrasas
insaturadas se cuenta con corregir el perfil de colesterol,
favoreciendo que haya ms colesterol bueno (HDL). Tambin
promuevequelaspartculasdeLDLseanmenosdainas.Seha
observado que las dietas ricas en omega3, especialmente de
cadenamslarga,reducenlacantidaddetriglicridosensangre.
La toma de cidos grasos poliinsaturados parece retrasar o
corregirlaaparicindediabetesdeladulto,loquereducetambin,
asuvez,elriesgocardiovascular.
Lacantidadrecomendableseradeentre2y3gramossemanales
de cidos grasos omega3. Eso corresponde a tomar pescado
azul como mnimo entre una a tres veces a la semana. Otros
alimentos enriquecidos con cidos omega3 pueden acabar de
redondearlacantidadnecesariaatomar.Tambinseencuentran
en salmn y caballa entre otros, mejor en su forma natural que
cultivados.
Loscidosgrasospoliinsaturadosnosedegradanporlafrituraen
cantidad suficiente como para hacer perder sus cualidades
esenciales. Desde el pescado crudo japons o el marinado, el
asado, o el guisado, el planchado, o el frito rebozado se cuecen
sin hacer desaparecer significativamente los nutrientes que nos
ocupan.Inclusoelpescadofritorebozadosefretradicionalmente
enaceitedeolivaabajatemperaturaaportandoademsotrocido
graso monoinsaturado (el oleico) que refuerza en buena
proporcinelbeneficiocardiovasculardeladieta.

ACIDOSGRASOSOMEGA6

Estossonderivadosdelcidolinolico.Parecentener,unacierta
relacin con la aparicin de procesos inflamatorios y
arteriosclerosospueslosfavorececuandoladietaesdemasiado
ricaenellos.Sesuelenencontrarenaceitesrefinadosdealgunas
semillas como: cacahuate, girasol, maz. Pero lo realmente
importante es que la dieta tenga cantidades equilibradas de
ambos tipos de cidos grasos esenciales, que en nuestro
organismo compiten por las mismas enzimas. Un mal balance

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

43/45

24/8/2015

DOFDiarioOficialdelaFederacin

entreellospuedefavorecerlosprocesosinflamatorios.
________________________________

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

44/45

24/8/2015

DOFDiarioOficialdelaFederacin

http://dof.gob.mx/nota_detalle_popup.php?codigo=5168074

45/45