Está en la página 1de 222

s

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

Fundamentosde
ArcGIS
versin

ArcView9.1
Tutorialdeejercicios
preparado por
IvnSantiago
readeTecnologasdeInformacinGubernamental
OficinadeGerenciayPresupuesto
Versin1.1,enero26,2006

OFICINADEGERENCIAYPRESUPUESTODELESTADO LIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

1
ndice:
Ejercicio I: Fundamentos de ArcGIS....................................................... 4
Introduccin:..........................................................................................5
Examinarcapasdeinformacinycmoestnorganizadas: .....................................................7
Bookmarks:.............................................................................................................................8
Inspeccindeinformacintabulardeunlayer: ......................................................................10
Seleccionarfeatures(elementos,objetos)geogrficosbasadosencondiciones,presentesenla
tabladeatributos: ..................................................................................................................10
Ejercicio II: Despliegue de datos.......................................................... 18
Aadircapasdeinformacin: ................................................................................................20
Aadirunaimagenofotoarea: ............................................................................................23
Especificartransparencia:......................................................................................................23
Aadirlayersadicionales:.....................................................................................................24
Cambiarlaaparienciadeloslayers:.......................................................................................25
Aadirlabels(etiquetas):.......................................................................................................29
GenerarunmapausandoelLayoutView. .............................................................................31
Guardareltrabajo:.................................................................................................................34
Ejercicio III: Bsquedas Geogrficas y de atributos ............................ 35
Introduccin:...........................................................................................................................36
Aadirmaptips:....................................................................................................................37
Identificarobjetos(features):.................................................................................................39
Findfeatures: ........................................................................................................................40
Inspeccionarlatabladeatributos:..........................................................................................46
GenerarunSelectionLayer: ..................................................................................................48
Intentarotrasherramientasdeseleccin:...............................................................................48
Otrasselecciones(subseleccin):..........................................................................................49
Guardarellayerdeseleccinenotroformato:.......................................................................50
Ejercicio IV: Datos geogrficos digitales y formatos ........................... 53
Introduccin:...........................................................................................................................54
ComenzarsesindeArcCatalogycrearnuevaconexin .......................................................55
UsarelPreviewtabyexplorarunshapefile: ..........................................................................56
VisualizaryexplorarunacoberturaArcInfo: .........................................................................58
Explorarlosmetadatosdeunlayer: .......................................................................................59
ExplorarunaGeoDataBase(GDB):.......................................................................................60
ExplorarunarchivotipoCAD:..............................................................................................62
VisualizararchivosrsteryTIN: ...........................................................................................65
Ejercicio V: Datos en tablas ................................................................. 68
Introduccin:...........................................................................................................................69
Examinarpropiedadesdeunfeatureclass:(geodatabase,shapefile,cobertura):......................71
InspeccionartablasdeunaGeoDataBase(GDB): ..................................................................72
Cardinalidad..........................................................................................................................72
Unirtablasconcardinalidad1:1medianteJoin:.....................................................................73
Cambiarlaaparienciadelatablatemporera,productodelcomandoJoin: ..............................74
Relacionartablasconcardinalidad1amuchos(1:)usandoRelate: .....................................76
Cmoproduciretiquetasapiladas(multilinelabeling) ...........................................................81

2
Segunda parte:...................................................................................... 84
Introduccin:...........................................................................................................................84
Comenzarunagrficanuevaycambiarsuspropiedades........................................................85
Exportarlagrficaparausoposterior ....................................................................................88
Desplieguedecaractersticasdeuninformeyespecificarcampos .........................................89
Ejercicio VI: Entrada de datos y modificacin ..................................... 96
Introduccin:...........................................................................................................................97
AbrirelEditorToolbarycomenzarunasesindemodificacin ............................................98
Seleccionarymoverunobjeto...............................................................................................99
Girarorotarunobjeto:........................................................................................................100
Especificarnumricamenteelnguloderotacin: ...............................................................100
Mover,borraryaadirvrtices:...........................................................................................101
Borrarunobjeto: .................................................................................................................101
Crearunpolgono(rea)usandoelSketchtool....................................................................102
AadirotrosobjetosusandoopcionesdelSketchtool:.........................................................107
Usodeherramientasvariadas(multiplesketchtools):..........................................................108
GenerarunfeatureclassnuevousandoArcCatalog: ............................................................112
Entrarinformacinalnuevofeatureclass: ...........................................................................114
Segunda parte:.................................................................................... 116
Entradaymodificacindeatributosenlatabla ..................................................................116
Aadiruncampoenlatabladeatributos: ............................................................................116
UsarlacalculadoradecolumnasFieldCalculator: ...........................................................117
Seleccionarobjetosparainspeccionarvaloresenlatabla:....................................................118
Copiarypegarvaloresenlatabla(copy&paste): ...............................................................120
Algunasconsideraciones:modificarfeatureclassesdepolgonos ........................................121
Ejercicio VII: Georreferenciacin ....................................................... 123
Introduccin:.........................................................................................................................124
Visualizacindedistorsionesporcambiosdeproyeccin ....................................................124
Medirdistancia:...................................................................................................................125
Distorsinenformas: ..........................................................................................................127
Cambiodesistemadecoordenadas:TransformacindedatumPuertoRico1940aNorth
AmericanDatum1983yHARN..........................................................................................129
Reproyectarpermanentementeunshapefile:........................................................................133
Especificarunsistemadecoordenadasaunshapefile:.........................................................136
Ejercicio VIII: Produccin de mapas .................................................. 139
Introduccin:.........................................................................................................................140
AbrirunasesindeArcMapyacomodarlosDataframesenelLayout: ..............................141
Aadirttulos: .....................................................................................................................162
Incorporarcajasdetextoparaexplicarprocedimientos,yfuentesdedatos: .........................167
Aadirtextocurveadoencimadeundataframe: .................................................................171
Hacerunaretculaparamostrarlatitudylongitud:...............................................................177
Aadirorientacinalnorte:.................................................................................................178
Prepararlaimpresindellayout: .........................................................................................180
Exportarlacomposicindellayoutaotroformato:..............................................................182
Apndice a este ejercicio:.....................................................................................183

3
Ejercicio IX: Sobreimposicin y anlisis de datos geogrficos.......... 186
Introduccin:.........................................................................................................................187
ArcMapygeoprocesamiento:..............................................................................................189
PorquusarelModelBuilder?Porvariasrazones:...........................................................190
Comandosdeanlisis: .........................................................................................................194
Calcularvaloresparaelnuevocampo:.................................................................................201
Cambiarelnombredelmodelo:...........................................................................................204
Especificarqueseborrenlosarchivosintermedios: .............................................................204
HacerqueelresultadodelmodeloaparezcaenArcMap: ...................................................205
Parmetros: ........................................................................................................................205
Correrelmodelo:. ...............................................................................................................206
Seleccinporzonas:............................................................................................................212
Apndice: .......................................................................................................................218
Estimadodeerrordelacubiertadeterrenos:....................................................................220
Referencias:................................................................................... 221

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

Ejercicio I: Fundamentos de ArcGIS

OFICINADEGERENCIAYPRESUPUESTODELESTADO LIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

5
Introduccin:
Estemanualdeejerciciossuponequelosestudiantestenganconocimientosbsicosparaeluso
delsistemaoperativoWindowsXPoWindows2000.Sinoposeeestosconocimientosle
recomendamosleercualquierlibrooguaqueleexpliquelosconceptosyprocedimientos
bsicosparausarestesistemaoperativoparaelcualArcGISestprogramado.
Convenciones:
Enlamedidadeloposibleincluiremosfigurasygrficasparaayudaralestudiante,
especialmenteenlosprimeroscaptulos.Enloscaptulossiguienteslasinstruccionesincluirn
solamentelasgrficasnecesarias.
Estedocumentoestabiertoasugerencias.Agradeceramosquelashaganllegaralfinaldel
curso.
Datosutilizados:
Losdatosquepresentaremosenlosejerciciosprovienendevariasagenciasestatalesyfederales.
TodoslosdatossecircunscribenalrealocaldePuertoRico,exceptolosquetienenquevercon
elejerciciodeproyeccionescartogrficas.
Audiencia:
Elcursoestpreparadoparacualquieraudiencia,aunquevislumbramosqueparticipensolamente
losempleadosdelgobiernoestatalode gobiernosmunicipales.
Objetivos:
MostrarcmoseorganizalainformacingeogrficaenArcMap.
Visualizardistintascapasdeinformacinycmoserelacionanunasconotras.
Explorarinformacintabularqueestrelacionadaalosfeatures(elementos)geogrficos.
Familiarizarseconlainterfazparavisualizaryhacerbsquedas.

6
Abrir el programa ArcGIS:
Buscarenel Desktopelicono

yhacerdobleclick.

SinoapareceeliconodeArcMapenel Desktop puedesencontrarloen:Start|Programs|


ArcGIS|ArcMap.
Dependiendodelacapacidaddelacomputadora,esperarquelaaplicacincomience.
Sivelasiguienteforma:

Uselaopcin AnewemptymapyOK.
Tomeunmomentoparainspeccionarlaaplicacin,mens,botones,etc., yluegoprosigacon el
prximopaso.

7
Examinar capas de informacin y cmo estn organizadas:
Paraesteejerciciosepreparunmapdocument(mxd)contenidoeneldirectorioC:\ArcTrain.

Busqueenelmenprincipal:File|Open

NavegueporeldirectorioC:\ArcTrain\Guavatehastaqueencuentreelarchivo
Guavate.mxd

HagadobleclickenelarchivoGuavate.mxdparaquelopuedaverenArcMap.

Cuandoustedhayaesperadoquecarguelacomposicindemapasconsuslayersustedverun
mapadePuertoRicocondelimitacionesdelosmunicipiosyalgunascarreterasdeimportancia.
Ademspodrveralgunospuntosconcentradosenelreacentroestedelaisla.

Estospuntosrepresentanlalocalizacindevariasdenuestroscentrosdecomidatpica,msbien
conocidascomoLechoneras.Lamayorpartedelasmsdemillechonerasseencuentranalo
largodecarreterasenlasreasruralesdelaisla.Algunasdeestascarreteraspuedenteneruna
altaconcentracindeestosestablecimientosdecomidatpica. Esteeselcasodelaconocida
carretera184delbarrioGuavateenelMunicipiodeCayey.

8
Podrnotartambinquealgunascapasnosepuedenver.ArcMapproveefuncionalidadpara
desplegaronolainformacinsegnelgradodedistanciamiento(escala).Podemosindicar
medianteArcMap,quemientrasmslejos,menosinformacinsedespliegue.
Bookmarks:
Unamaneradepresentaruorganizarlamaneradevisualizarloslayersesmediantelos
bookmarks.Seaccedenenelmenprincipal:View|Bookmarks.Notelalistadebookmarks
quesepreparenestemapdocument:

Escojacadaunadelosbookmarksenelordenenqueaparecen.Amedidaquevayausandolos
bookmarksestarviendomsinformacinalacercarse.

Enesteejemploustedpodrver
unafotoareadeestaporcinde
Guavateconlashuellasde
edificiosylosnombresdelas
lechoneras.

Alfinal delalista,elbookmarkLechonerasAltosdebermostraralgoparecidoaesto:

9
Preguntas:
1.Cuntoslayers(capas)hayenlaTabladeContenido(TableofContents,TOC)?Latablade
contenidoeslaparteizquierdadelaaplicacinendondeselistanloslayersyotrosarchivos.
______________________________________________________________________________
2.DetodosloslayersdelalistaenlaTOC,cuntosestnvisiblesusandoelbookmark
LechonerasAltos?
______________________________________________________________________________
3.Qutipodegeometrautilizanlascapasdecarreteras?______________________________
Lasdecg_hidro_lagosycg_edificios?
_______________________________
LasdeCuadrnguloCaguas.tifycg_sw.sid?
_______________________________

Identificar relaciones entre objetos en el terreno.


AdiferenciadeotrosprogramascomoAutoCAD,un SIGcomoArcMapdebetenerlacapacidad
dedistinguiryseleccionarobjetosenelterreno.LosSIGutilizanalgoritmosmatemticosque
sirvenparadistinguirrelacionesdeproximidad,conectividadyadyacencia.Estos
procedimientossebasanenlacienciamatemticallamadatopologa,lacualseencargade
establecerrelacionesentreobjetosenelespacio.Conestasreglasylainformacindereas,
direccionesy longitudesdelneaslosSIGpuedenayudaraencontrarpatronesdistinguiblesenel
terreno.

EnelmenprincipalvayaaView|Bookmarks|Carr184IntPR1yPR52
Aculescarreteras(enestavista)seconectalaCarr184?______________________

Avecesnuestrapercepcinnoesexactamenteloquesemideenlosmapas.
UseelbookmarkCarr184BeatrizyGuavateeinspeccionelascolindancias
municipalesylalocalizacindelalechoneraLosAmigos.
Enquemunicipioestlocalizadoesteestablecimiento?____________________

Useelbotn IdentifylocalizadoeneltoolbarTools.

En Layers,seleccionedelalistaellayerMunicipios.

NaveguecercadelpuntoLosAmigosyhagaclick.

10
Yasabemosqueesteestablecimientodebepagarlosderechosdepatentesmunicipalesa
CidraynoaCayey. Porasociacinsetiendeapensarquesielestablecimientoesten
elreadeGuavate,deberaestarenCayey.Estopasafrecuentementeyalgunos
negociospaganpatentesaotrosmunicipiosporerror.

Inspeccin de informacin tabular de un layer:


Enestepasopodrverlosdatosdescriptivosasociadosaunlayer.ArcMap,latablaque
perteneceallayermuestranicamenteunrcordporfeature.
Ahora,enlatabladecontenido,hagaunrightclickenellayerAutopistas.

EnelmendecontextoescojaOpenattributetable

Examineelcontenidodelatablanavegandohaciaabajoyhacialoslados.

CierreestatablayrepitaelprocedimientoparaellayerLechoneras.
Cuntos record tieneestatabla?______________________________________
Ayuda:Vealaparteinferiorizquierdadondeestelnavegador.

MencioneloscamposquecontienelatablaAttributesofLechoneras.
_____________________________________________________________________

Seleccionar features (elementos, objetos) geogrficos basados en


condiciones, presentes en la tabla de atributos:
Porejemplo,enmltiplesocasionesesnecesarioseleccionargruposdeelementosquetienen
unacaractersticaencomn.
Enestecasotenemos:
Unlayerdelocalizacindelechoneras,y
QueremossaberculesdeestastienenlacertificacindelDepartamentode
Agricultura, LaRutadelLechn.
Estacertificacinno necesariamentequieredecirqueenestaslechonerassecocinemejoro
peor.Elletrerodecertificacinsolamentedicequeeseestablecimientousaexclusivamente
cerdodelpas.

11

VolveraView|Bookmarks|PuertoRico.Deestemodopodrnvertodoslos
establecimientosquefueronlocalizados.

EnelmenprincipalvayaaSelection|SelectbyAttributes.

LaventanaSelectbyattributespermiteescogerelementossegnciertoscriterios
definidosporelusuario.EstaventanausaciertaspalabrasdellenguajeSQLelcual
permitehaceroperacionesenbasesdedatos,entreellas,laseleccinderecordspor
caractersticas.
Comosedijoantes,seseleccionartodoslaslechonerasqueestncertificadaspor
elDepartamentodeAgriculturacomopartedeLaRutadelLechn.

EnLayerescogeLechoneras

En Method escojaCreateanewselection

En Fields,naveguehastaelfinalhastaencontrarelcampo
LechDescrip.CertifAgric
o Hagadobleclicken LechDescrip.CertifAgric
Aparecerelnombredelcampoenlacajadetextodondeseescribenlos
comandostipoSQL.
o Hagaclickenelbotn=
o Hagaclickenelbotn GetUniqueValues
o Luegotepresentarunalistadevalores<NULL>,N,Y.
HagadobleclickenY.

Contine

12

Suventanadeberparecersealasiguiente:

YapuedehacerclickenelbotnOK.
Elresultadoaparecerenel Dataviewdelasiguientemanera:

Losfeatures(objetos) escogidosaparecernenazulbrillante.

VayaaSelection|Clearselectedfeaturesparaquitarestaseleccin.

13
AhoravamosausarunadelascapacidadesdeArcGISparaseleccionarobjetosmediante
proximidad.
Ejemplo:ElDepartamentodeAgriculturanecesitasaberlacantidaddeLechonerasqueestn
alolargodelacarreteraPR175enelMunicipiodeTrujilloAlto. Elobjetivoesconocer
cuntosestncertificadosytratardeestimularquelosdueospatrocinenelcerdolocal.
Tenemosloslayersdecarreterasseparadosencincocapas,porcategoras,segnlasdividi
laAutoridaddeCarreteras.
NecesitamosseleccionarellayerCarreterasSecundariasyespecificarquequeremos
solamentelaPR175.
Despusdehaceresto,entoncespodemospasaralcomandodeseleccinporlocalizacin.

Ahora,vamospasoapaso:
Vayaalmenprincipalyhagaclicken Selection|Selectbyattributes.
o EnlaventanadeSelectbyattributes:
Layer :Carreterassecundarias
Method :Createanewselection
o HagadobleclickenelcampoNUM_CARRqueestenlalistadecampos
delatabladeatributos.
o Hagaunclickenelbotndeigualdad=
o Hagaotroclickenelbotn Getuniquevalues.
Navegueenlalistahastaqueencuentreelvalor175yhagadoble
clickencimadelnmero.(enrealidadestenoesunnmero,pero
hablaremosdeestoluego).
Suventanadebeparecerseaesta.

14
Entoncespodrhacerclicken elbotnOK.

Hacompletadolaprimerapartedeestaseleccin.Parapoderversuseleccintendr
queacercarseconunniveldezoomadecuado.
VayaalmenprincipalyescojaSelection|Zoomtoselectedfeatures

AsentoncespodrverlossegmentosdelneaquecomponenlaPR175.

ContodalaPR175seleccionada,ahorapasealasegundaparte:

15

VayaalmenprincipalyescojaSelection|SelectbyLocation.

Aparecerunaventanaconmltiplesopciones.Recuerdeque
necesitaescogertodaslaslechonerasqueestnenlaPR175.

Vamosahacerunaseleccinporproximidadseleccionando:
o Lechoneras
o Queestnaunadistanciade:
50metros
o UsandolaseleccinPR175,dellayerdeCarreterassecundarias.
Suventanadebeapareceras:

Recuerdequeporlogeneral laslechoneras
quedanmuycercadelacarretera.Porlo
tanto,unadistancia de 50metrosesmsque
suficiente,anoserqueelmapadecarreteras
tengaerroresdeposicionamiento.

Presioneelbotn Applyparaejecutarlaseleccin.
VayaalatabladecontenidoyhagarightclickencimadeLechoneras.

16
EscojaSelection|ZoomtoSelectedFeatures

DeberverlosiguienteenlapantallaDataviewdeArcMap:

Enesteejemploseseleccionaron 5establecimientosalolargodelaPR175.

17
Reto:
CuntosdeestosseisestncertificadosporelDepartamentodeAgricultura?
o Busqueenelmenprincipal,Selection|Selectbyattibutes.
o Layer:Lechoneras
Method:Selectfromcurrentselection
o Hagadobleclicken LechDescrip.CertifAgric
o Hagaclickenelsmbolo=
o Hagaclickenelbotn Getuniquevalues
o DobleclickenelvalorY.
o Suventanadebeverseas

PresioneOK
Observarqueenestarea,solounestablecimientotieneelcertificadodelDepartamentode
Agricultura,deloscincopreviamenteseleccionadosen estapartedelacarreteraPR175.
Undetalleinteresanteesquetodaslaslechonerasaparecen enelmapaalmismoladodela
carretera.Sinembargo,cuandostasfueronvisitadasylocalizadasmedianteGPS,algunas
estabanadistintosladosdelacarretera.Sitraemosotrasfuentesdeinformacinmsdetalladas
yexactasnosdaremoscuentadequelaalineacindelaPR175noeslamscorrecta.
Estoconcluyeesteprimerejercicio.

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

EjercicioII:Desplieguededatos
(DisplayingData)

OFICINADEGERENCIAYPRESUPUESTODELESTADO LIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

19
Introduccin:
Elobjetivodeesteejercicioesmostrarunmapaquecontengazonassusceptiblesainundaciones
endiferentescategorasdesusceptibilidad. Ademsseaadirncapasdeinformacintales
comoedificaciones,carreteras,fotosoimgenessatelitales,disponiblesparalasagenciasde
gobiernoymunicipios. Deestamaneranosiremosfamiliarizandomsconlainterfazdel
programaArcView
Funcionesausar:
1. Aadirlayers(capas)usandoArcMapyconArcCatalog.
2. Especificartransparenciaaunlayer.
3. Cambiarnombreaunlayer.
4. Clasificarysimbolizardatosgeogrficos.
5. Aadirlabels(etiquetas)aelementosgeogrficos.
6. Salvarsimbologaenformatolayerfile.
7. CrearunmapausandolainterfazLayoutView.
8. Especificarescaladelmapa.
9. Guardarelmapdocument(mxd).

20
Aadir capas de informacin:
ComienceporlevantarunasesindeArcCatalog:
Start|Programs|ArcGIS|ArcCatalog
Espereunmomentoenloquelaaplicacincomienzaylemuestralainterfazquesimulael
WindowsExplorerdeMicrosoft.ArcCatalogeslaherramientaparamanejarydocumentar
archivosdetipogeogrficocompatiblesconlosproductosdeEnvironmentalSystemsResearch
Institute,(ESRI).
Navegueatravsdel CatalogTreeyexpandaelsmboloC:\
haciendo
unclickenelsmbolo+ alladoizquierdodeliconodelflderyelmundo.

Catalogtree

HagaclickeneldirectorioArcTrainlocalizadoenC:\.

21
BusqueyhagaclickeneldirectorioArcTrain\BarcelonetadeldiscoC:\ desu
computadora.

Notequeyapodrveralgunascapasdeinformacin representadaspordistintossmbolos,todas
conprefijobt_.EsteeselcdigoutilizadoporelUSGeologicalSurveyparanombrareste
cuadrngulo.
Podrverdistintosiconosquerepresentanformatosdiferentesparaguardarlainformacin
geogrfica.Porejemplo,tenemoselsmbolo:
ParacoberturasArcInfo

ParadatosmatricialesArcInfoGrid,ocualquiertipodeimagenofotoarea:
Larepresentacinrsteresotramaneradecodificarlainformacingeogrficaenformadigital.
Unrsteresunamatriznumricadedatosregistradageogrficamente. Ennuestrocasobt_ele
contienedatosdealtitudenmetrosenelcuadrngulodeBarcelonetay bt_shdcontienevalores
querepresentanunmodelodesombreadodemontaassegnunosparmetrosdengulode
elevacineinclinacinsolar.
Geodatabase(GDB):Puedecontenertantolasrepresentacionesvectoriales
(punto,lnea,polgono)anotaciones,y lasdetiporster.
AhoraabriremosunasesindeArcMapusandoStart|Programs|ArcGIS|ArcMap.
PuedeusarelbotnparaabrirArcMaplocalizadoenelStandardToolbardeArcCatalog

EscojalaseleccinAnewemptymap
LaideaestenerambasaplicacionesabiertasparaqueArcMapdespliegueloslayersmediante
draganddrop.

22
Cambieeltamaodelasaplicaciones(resize)demodoquetengalasdosventanas(ArcMapy
ArcCatalog)en pantalla(desktop).
SupongamosqueunodelosasesoresdelalcaldedeBarcelonetanecesitahaceruninventariode
lasedificacionesqueestndentroycercadelaszonassusceptiblesainundacindelimitadaspor
FEMAylaJuntadePlanificacin. Antesdeiralcampoyponerseacontarcasas,loquehar
primeroserhacerunmapadelentornodelcascodelpueblo.
(Nota:notuvimosdisponibleelnuevomapadezonassusceptiblesainundaciones preparadoporFEMA)

EldirectorioArcTrain\BarcelonetatieneunaGeoDataBase(GDB)lacualcontienevarias
capasdeinformacinparaesteejercicio.
UsandoArcCatalog,hagadobleclickenlaGDBllamadaBarceloneta.mdb.
VerunlistadodelayersalladoderechodelaaplicacinArcCatalog.Deberusareltab
llamadoContentsparaquepuedavereselistado.

Hagaunclickenellayerllamadobt_floody arrstrelo(clickydrag)hacialatablade
contenidodeArcMap,debajodelapalabraLayersodentrodel DataView.
EstaeslaqueestalladoizquierdodelaaplicacinArcMapyquediceLayers:

23
Aadir una imagen o foto area:
UsandoArcMap,utiliceelbotnAddDataynaveguedentrodeldirectorio
C:\ArcTrain\IKONOS.
Busquelaimagen IKONOSllamadabt_66d5ne.sid. Estaesunaimagensatelital
tomadaalrededordelao2001enel cuadrantenordestedelcuadrngulodeBarceloneta
el cualcontieneelcascourbanodeestemunicipio.
Useelbotn Add (Nousedobleclickporqueabrirlaopcindeseleccionarlasbandas
delaimagen (RGB)porseparado).

NotarqueArcMapposicionaautomticamentelaimagendebajodelfeatureclassde
polgonosquecontienelaszonassusceptiblesainundacin.
ElordenautomticoenArcMapes:anotacin,punto,polgono,imagen.

Especificar transparencia:
Enocasionesesnecesariomostrarlacoincidenciadecapasdeinformacinenunmismolugar.
ArcMapproveelaherramientaparapodermostrarcapasdeinformacincondistintos
porcentajes(0a100%)detransparenciasegnloespecifiqueel usuario.
Cero(0%) escompletamenteopacoy100%escompletamentetransparente.
EnArcMaphagarightclickenellayerbt_floodenlatabladecontenido.
Escojalaopcin PropertiesalfinaldelalistadeopcionesdelContextMenudelos
layers.
EnlasopcionesLayerPropertiesescojeeltabllamadoDisplay.
Escriba33enlacajadetexto(textbox)comoapareceenlasiguientefigura:

24

Alternativamentesepuedeestablecer
transparenciadetresmaneras:
1.AtravsdeLayerproperties
2.UsandoelmenEffects

LuegopresioneOK.
Deunamaneramsavanzadasepuedeespecificargradacionesdetransparencia
medianteuncamponumrico.EstoestdisponibleenLayerProperties|Symbology
peronolopracticaremosenestetutorial.
Utilicelasherramientasdevisualizacin:acercamientoypanningparaubicarseenel
entornodelcascourbanodeBarceloneta.
ElcascourbanodeBarcelonetaestubicado cercade
laesquinainferiorizquierdadelaimagenIKONOS
bt_66d5ne.sid.

Aadir layers adicionales:


PondremosmscapasdeinformacindentrodelaaplicacinArcMaparrastrandolayersdesde
ArcCatalog.
EntredentrodelaGeoDataBase(GDB) Barceloneta.mdblocalizadaen
C:\ArcTrain\Barceloneta,haciendodobleclick.
Seleccioneloslayers:
o Bt_hyd, bt_hdp(hidrografa)
arrastreloslayers,yaseadentrodel espaciodondesedespleganloslayersen
ArcMap,comotambin arrastrndoloshaciaadentrodelatabladecontenido.

Cambiar los nombres a los layers:


Losnombressecambianenlatabladecontenidocondosclickslentosomedianteeldilogo
LayerPropertieseneltab General.

25
Hagadosclickslentosencimadelnombredelfeatureclassbt_floodenlatablade
contenidodeArcMap.
EscribaZonasInundacin(sinlascomillas)enlacajitadelnombre.

Repitaelproceso.
Parabt_hydescribaArroyosyros.
Parabt_hdpescribaRosylagos.
Parael layerbt_66d5ne.sidescribaImagensatelital,2001.

Cambiar la apariencia de los layers:


Laaparienciaayudarepresentarmejorloslayersusandosmbolosycoloresenelmapa.
HagaunclickenelsmbolodelneadellayerArroyosyros.Aparecerestaforma:

SeleccioneelsmboloRiver,elcuartoenlaprimeracolumnadebajodeCollector
Street.PresioneOK
RepitaelprocedimientoconellayerRosylagos. SeleccioneelsmboloBlue
dentrodel SymbolSelector.

26

Ahora,elprocedimientoparasimbolizarlaszonasdeinundacinesdiferente.
UtilizaremosuncampoenlatabladeatributosdelayerZonasInundacinelcual
describelasdiferentesreasozonassusceptiblesainundacin.
UbqueseencimadellayerZonasInundacinconelcursoryhagarightclick.
Seleccionelaopcin Properties
Escojaeltab Symbologydentrode LayerProperties.

Utilicelaopcin CategoriesalaizquierdayseleccioneUniquevalues
En ValueField,escojadelalistaelcampodelatablallamadoDESCRIPCIO

27
Hagaclicken elbotnAddAllValuesparatraerlasdiferentescategorasala
simbologayposteriormentealatabladecontenidoylaleyendadelmapa.

DependiendodelColorRamputilizadoasaparecernlosdiferentescolores.
Paraesteejercicio,usaremosunossmbolosconunpocomsrepresentativosagrupando
valoressimilaresyseparandovaloresdiferentes.
Primeroagruparemoslosvaloressimilares.HagaunclickenelitemllamadoZONA
2LLUVIA
Unavezseleccionado(sombreado),uselaflechahaciaarribaalladoderechohasta
llevarladebajodelitem ZONA1LLUVIADE100
Ahoracambiaremoslaaparienciadeestosvalores.
HagadobleclickenelsmbolodecoloralladoizquierdodeZONA1.
En elapartadoOptions,debajodePreview,seleccioneel dropdownlistallado
derechodeFillColor.

EscojaelcolorSevilleOrangeconunclickparasimbolizarZONA1.

28

PulseOKyrepitalainstruccinparaZONA2.

RepitiendolospasosanterioresahoraescojaelcolorTopazSandpara
simbolizarZONA2.
ParaelvalorZONA1Mrepitaelprocesonavegandohaciaabajohastallegaral
smbolollamadoWaterIntermittentyescjaloconunclick.Luegopresione
OK.

29
Hagauncheck enlaopcin<allother values>.
SuformadeLayer Propertiesdebeparecerseaesta:

Aadir labels (etiquetas):


Muchasvecesesnecesarioaadirpalabrasqueayudanaidentificarmsrpidamentelos
smbolosenmapas.Enestaparteaadiremosetiquetasautomticamentebasndonosenun
campodelatabladeatributosdellayerZonasinundacin.
HagarightclickenellayerZonasInundacinyseleccioneProperties
Presioneeltab Labelsyasegresedequeelcampodelatablaquemostrarloslabelses
elquesellamaDESCRIPCIO.
Hagacheck enlaopcin Labelfeaturesinthislayer.SuformadePropertiesdebe
verseas:

PresioneOKparaquepuedaverlasetiquetasenelmapa.
Algunasvecesnecesitamoshacerqueloslabelsseanmslegibles.Tenemosopcionestales
comoaumentarleseltamao,typeface(tipodeletra),yotrosefectos.

30
Eltamaodelasletrasdebeserproporcionalalmapaqueimprimiremos. Paraunmapaen
tamaocarta(8.5x11)untamaodeletramayorde18puntosllamarademasiadolaatencin
ypodracubrirotrossmbolosyobjetosenelmapa.
Aumentaremoseltamaodeloslabelsa10puntosyusaremoslaopcin paraaadirhaloalos
labels. Elhaloaadeunaespeciedeluzdifusaquecircundaelbordedel texto.
VuelvaalaformaLayerPropertieshaciendounrightclickenellayerZonas
Inundacin. Presioneeltab Labels.
En TextSymbol,envezde8,aumenteeltamaodeltextoa10.
Presioneelbotn SymbolDeberaparecerlaformaSymbolSelector.

Presioneelbotn Properties.
EnlaformaEditor desmbolos,presioneeltab Mask.
Escojaen Stylelaopcin Haloyen Sizecambiea1.
Suformadeberverseas:

PresioneOKenel Editor,
tambinOKenlaformaSymbol Selectory
finalmenteOKen LayerProperties.
Deberverenpantallaelmapacondoslabels,unoparacadazona.

31
Salvar simbologa:
ArcMapproveelafacilidaddeguardarlasimbologa(elconjuntodesmbolosycoloresque
usamospararepresentarlosobjetosgeogrficos).LasimbologaseguardaenArcMapen
formatoLayerfileconsufijolyr.
Loslayerfilessonmuytilesporquepuedensercompartidosyutilizadosenmltiplesocasiones
enotrosmapdocumentsdeArcMap(mxdfiles).
Enesteejercicio,guardaremossolamenteladefinicindesmbolosqueusamospararepresentar
ellayerdeZonasInundacin.
HagarightclickenellayerdeZonasInundacin.
EscojaSaveasaLayerFile

NaveguehastaeldirectorioC:\ArcTrain\Barceloneta,yescribaZonasInundacin.lyr
enlacajadetexto.
Presioneenter.Yaguardsudefinicindesmbolospermanentementeeneldisco.

Generar un mapa usando el Layout View.


Unaveztengamoshechalacomposicindeloslayersconsuslabelspodemospasaralaetapade
hacerelmapaparaimpresin.Enesteejercicionoharemosimpresin. Hastaelmomento
solamentehemostrabajadoenlainterfazDataViewdeArcMap.Ahoranosmoveremosala
interfazLayoutViewparaconoceralgunasdesuspropiedades.
Porahora,supongamosqueestemapaserpartedeundocumentode textodentrodeuninforme
enformatodigital.
VayaalmenprincipalypresioneView|LayoutView.
OtramanerademoversealLayoutVieweshacerclickenelbotn
esquinainferiorizquierda,enelDataView:

localizadoenla

32
Deberapareceralgoparecidoaesto.Tambinaparecerel LayoutToolbar paranavegar
dentrodelaaplicacindeLayoutView.

LapersonaqueesthaciendoelinformenecesitaquesemuestreelcascourbanodeBarceloneta
ysusalrededoresmscercanos,especialmentelasnuevasurbanizaciones.Paraesto
necesitaremoscambiarlaescala(niveldeacercamiento)yposiblementemoverelcontenidodel
mapasinmoverlapgina.
Primerotratedelocalizarelcentrodelpuebloconlaherramienta
ToolsToolbar.

disponibleenel

Podrmoverelcontenidodelmapasinmoverlahojadepapel.
Cuandocentralicelalocalizacindelcentrodelpueblo(cascourbano),vayaalacajade
textoqueleproveelaescala.Ustedpuedecambiarlaescalaencualquiermomento:

Endichacaja,borreesaescala.Escriba10,000(conosinlacoma)ypresioneenter.
Vercmoseacercalcascourbanoysusinmediaciones.
Experimenteconotrasescalasdeacercamiento.Porejemplo,escriba5000enlacajay
seacercaranms.
Estaescalaesunafraccin. Mientrasaumentemoseldenominador(aladerechadel1),
mspequeaserlafraccinymsreacubriremosenelmapa,peroconmenor
detalle.
Inversamente,mientrasmspequeoseaeldenominador,msgrandeserlafracciny
menosespaciopodremoscubrir.

33

Advertencia:Todomapatienesuniveldedetalledefinidoporlaescala.Aunquepodemosacercarnosa
escala1:1,estonotienesentidosielmapaoriginalfuecompilado(preparado)paraotraescalams
pequea.

Porltimo,parapropsitosdereferencia,aadalaescalagrfica.Estaservirprimero
paradarunaideamsclaradelespacioquecubreestemapaysegundopodrservirde
guaparamedirdistancias.
VuelvaalmenprincipalyescojaInsert|ScaleBar

Aparecerel ScaleBarSelector:

Seleccionelaprimeraopcin ScaleLine1.
PresioneOK.Dejaremoslascosascomoestn.
Aparecerlaescalagrficaenelcentrodelmapa.

34
Toquelaescalagrficaconelcursoryarrastrelaescalahaciaabajo. Centralicelaescala
conelcuadroquedefineelmapa.

Guardar el trabajo:
GuardeestedocumentoconelnombreExer_2.mxdeneldirectorio:
C:\ArcTrain\Barceloneta.
Vayaalmenprincipal,en File|SaveAs
EscribaExer_2.mxdenlacajadetextoy presioneenter.
Estoconcluyeelejercicio2.

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

EjercicioIII:BsquedasGeogrficasydeatributos
(GeographicandTabularQueries)

OFICINADEGERENCIAYPRESUPUESTODELESTADO LIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

36
Introduccin:
Enesteejercicio,nuestroobjetivoesidentificarreassusceptiblesainundaciones.LaAgencia
Municipal paraManejodeEmergenciasnecesitaunestimadodecuntasedificacionesestn
dentrodelasreasdemayorpeligro.Ademsestainformacinservirparaqueelgobierno
municipalestablezcamedidasdemitigacinyreglamentacinparaconstruir.
ContinuaremosusandoelejemplodeBarceloneta.Ahoraveremosotrasopcionesenlascuales
inspeccionaremoslainformacintabularpertenecientealascapasdeinformacin(layers).
Estavezusaremosunsubconjuntodedatosderivadosdeunmapaparcelariodelosalrededores
delcascourbanodelMunicipiodeBarceloneta.Losnmerosquerepresentanelvalordela
estructurasonficticios.
Tareas:
1. Maptips
2. Identificar(Identifytool).
3. Findfeatures(buscarelementosenelmapauobjetos.enlatabla).
4. Hacermediciones.
5. Spatial Queries.(Bsquedasgeogrficas)
6. Examinarlaseleccinenlatabladeatributos.
7. Calcularestadsticassobrelaseleccin.
8. Explorarseleccionesespaciales.
9. Explorarseleccionesdeatributos.
10. Guardarseleccinenotroformato.

37
Procedamosahora,abriendounasesindeArcMap.
Hagadobleclick eneliconodeArcMapensudesktop
ovayaaStart|Programs|ArcGIS|ArcMap.
CuandoaparezcaeldilogoescojaAnexistingmap
PresioneOK
UsandoeldilogoOpen,naveguehastallegaraC:\ArcTrain\Barceloneta\Exer_2.mxd.
Esteeselmapdocument(archivomxddeArcMap),queustedguardenelejercicio
anterior.
Sialabrirelmapdocumentleapareceen LayoutView,regresealainterfazDataView
usandoelbotnconiconodeglobo
LayoutView.

ubicadoenlaesquinainferiorizquierdadel

Alternativamente,puedeusarelmenprincipal:View|DataView.
Aadir map tips:
Unmaptipesunaespeciedeetiquetadointeractivo.Enotraspalabras,cadavezque
posicionemoselcursorenalgnobjetoenelDataView,senosmostrarelvalordeunodelos
camposdelatabladeatributosdeeselayerenparticular.
Paraesto,necesitamosaadirunlayeradicional.DentrodelaGDB(GeoDataBase)de
Barceloneta,hayunlayerdeedificacionesenelcascourbanodeestemunicipio.
Podrnotartambinquenotodoslosedificiosestndibujadosconrespecto alaimagen
satelital.Estosedebeaquelaimagenesmsrecientequeelmapadeedificiosprovistopor
elCentrodeRecadacindeIngresosMunicipales(CRIM). Elmapadeedificiossepublic
en1998ylaimagencorrespondealao 2001.

Aadaelfeatureclassllamadourban_bldsubicadoen
C:\ArcTrain\Barceloneta\Barceloneta.mdb,haciendorightclickencimadelDataviewy
escojaAdddata.
Unavezaadidourban_bldshagarightclick encimadelnombredeestelayerenla
TabladeContenido.
VayaalfinalyescojaProperties
Presioneeltab Fieldsyasegresedequeel PrimaryDisplayFieldseaNOMBRE.

38
Presioneeltab Displayyhagacheck en ShowMapTips(usesprimarydisplayfield)

PresioneOK
Ahorautiliceelcursor(flecha)ymuvalo,posicionndoloencimadecualquierestructura
hastaqueleaparezcaalgnnombre.Podrverlosnombresinteractivamenteenunas
cajasrectangularesamarillas.
Losmaptipssonindependientesdeloslabels(queyasetrabajaronenelejercicioanterior).
Accedaalaspropiedadesdellayerurban_blds:
Hagadobleclick encimadelnombredel layerenlatabladecontenido(estaesotra
manera,envezdeusarrightclick).
Presioneeltab Labelsyhagacheckenlaopcin Labelfeaturesinthislayer.
En TextString,ydentrode LabelFieldescojaLand_Use.

PresioneOK.Aparecernloscdigosdeusodeterrenocomoseregistranenporel
CRIM.
Muevaelcursorsobrecualquierestructuraquecontenganombres.Notarquelosmap
tipsyloslabelsfuncionandeformaindependiente.
Quiteloslabelshaciendoun rightclick enellayerurban_bldsyhagauncheck en
LabelFeatures.

39
Identificar objetos (features):
Elbotn IdentifyesunadelasherramientasmsbsicasenunSIG.EnArcMappuedeusarse
devariasmaneras.Puedeservirparaidentificarunaomscapassimultneamente.

HagaunclickenelbotndeIdentifylocalizadoenel ToolsToolbar.
En Layersescoja<Alllayers>.Estolebrindartodalainformacintabulardetodos
loslayerssubyacentes.
Escomosiustedutilizarauntaladroyobtuvieseunamuestradetodaslascapas.
Hagaclickenunadelasestructurasmsgrandesalsurdelreaurbana. Podrver
losresultadosparecidosaestossiescogielpolgonoqueseusenesteejemplo.

Pregunta:IdentifiqueeltipodeZonadeinundacinhaciendoclickenotroedificio
dentrodelcascourbano.CuleseltipodeZona?_________________________
CulessonlosvaloresRGBdelaimagensatelital?R:____,G_____,B_____
CierrelaventanaIdentifyResultshaciendoclickenlaxdelaesquinasuperior
derecha.

40
Find features:
Estaherramientaayudaalocalizarrpidamenteobjetosbasadosencriteriosbiensencillos.Por
ejemplopodemosbuscarunatributocomoelnombreyespecificarunnombre.

HagaunclickenlaherramientaFind.
EnlaformaFind,useeltab Features
En Find:,escribalasletrasberto(sinlascomillas).
En In:,escojaellayerurban_blds.
Asegresedetengacheck enlaopcin Findfeaturesthataresimilartoorcontainthe
searchstring.
En FieldsescojaNOMBRE.
SuformaFinddeberparecerseaesta

41

Presioneelbotn Find.
Vertodaslasocurrenciasquecontenganbertoen cadarecorddelcampo
NOMBRE.
Hagarightclickencualquieradelosrecordsqueaparecenenlaparteinferiordela
formaFind,dondeaparecierontodoslosrecordsquecontienenbertoenel
nombre:
LaherramientaFindproveeotrasopcionesparaseleccionaryvisualizar.

Flashfeature:prendeyapagaelobjetoseleccionado.
SetBookmark:Preparaunbookmark(especiedevistaconescalaoacercamientofijo)al
objeto.
Experimenteconestasopciones.Paravolveralaextensinanterior,uselas
diferentesherramientasdeacercamiento(zoom).

ZoomPrevious
ZoomExtent
Panning
ZoomIn
ZoomOut
Zoomin/OutFixed

usaunfactorfijoparaacercaroalejar.

42
Hacer mediciones lineales:
Enestaparte,mediremosunodelosladosdeunparquedepelotaubicadoalladooestedel
centro(casco)urbanodeBarceloneta.
Lascapasdeinformacinestnregistradasusandoelmetrocomounidaddedistancia.
LaherramientaMeasure,ubicadaenel ToolsToolbar,seusaparaestasmedicionessimples.

Podemoscambiarlasunidadesyenlugardemetrospodemosusarpiesuotrotipode
unidaddemedicin.
Paracambiarlasunidadeshagarightclickencimade lapalabra Layer dentrodela
tabladecontenidoyescojalaopcinProperties. Esteeseldilogo DataFrame
Properties quecontienemltiplesopciones.
Utiliceeltab General,yenUnits procedaacambiaralaunidaddemedidadeseada.

43

Ahora,mediremosunextremodelparquedebisbolqueapareceenelcentrode
estagrfica.UbiqueelparqueenelcentrodesuDataViewenArcMap
ConlaherramientaMeasure,midalalongituddelaverjaenel
extremooeste(alaizquierda)delparque.

Ubiqueelsmbolo+ enunodelosextremosyhagaclick.Luegohagaotroclickenel
extremoopuesto.
NotarqueenlabarrainferiordeArcMapensuextremoizquierdo,seleproveela
informacindelalongituddelsegmentoqueacabadehacer,ademslasumadelos
segmentosque hagaantesdedardobleclick:

Cuntosmetrosmideestaverja?_____________________
Cuntospies?_____________________(debercambiarlas
unidadesusandoDataFrameProperties.)
Terminedemedirhaciendodobleclick.

44
Bsquedas geogrficas (Spatial Queries):
Hastaelmomento,sehanhechobsquedassencillasymediciones.Ahora,haremosunejemplo
utilizandolosedificiosyellayerdezonassusceptiblesainundacin.
Elpropsitoesseleccionarlosedificiosdellayerurban_bldsquetoquen oestn dentrodela
Zona2dellayerZonasInundacin.
Hagarightclickenlacapaurban_bldsenlatabladecontenidoparapodervisualizar
mejorlaextensin completadellayerdeedificios.
EscojalaopcinZoomToLayer.
ArcMapmostrarlaextensindetodoslosedificiosenesearchivo.Comose
mencionantes,notarquehayedificiosquenohansidodibujadosporserrecientesy
otrosquenoaparecenporqueestnfueradelreadeesteejemplo.
Localiceelbotn SelectFeaturesenel ToolsToolbar

UsarestebotnparaescogerelreaZona2LLUVIADE500AOShaciendoun
clickenestarea.

45
Ahora,muevaelcursoralmenprincipalypresioneSelection|SelectbyLocation

AparecerlaformaSelectbyLocation consusmltiplesopciones.
Recuerdequeseleccionaremos:
o Edificios(urban_blds)
o queintersequen
o laZonadeInundacin2 (previamenteseleccionada)
o Aadaunreacircundante(buffer)de10metrosparacompensarerroresenel
layerdeZonasInundacin
Suformadeberparecerseaesta:

PresioneApply.
Alfinaldelprocesoaparecerlacantidaddeobjetosseleccionadosenlaesquina
inferiorizquierdadeArcMap.

46
PresioneClosey tratequesucursornopaseporencimadelasherramientasdedibujoy
Labels.
Silohace,seborrarelnmeroytendrquepresionarApplynuevamente
Cuntasestructurasfueronseleccionadas?______________________________
Conestaseleccinintentaremosvariastareas:
Examinaremoslatabladeatributosdellayerurban_blds.
Calcularemosestadsticasbsicasdeestaseleccin
GeneraremosunnuevoLayerdeseleccin
Usaremosotrosmtodosdeseleccin
Haremosunasubseleccin
Guardaremosestelayerdeseleccinenotroformato

Inspeccionar la tabla de atributos:


Hagarightclickenellayerurban_bldsenlatabladecontenido.
EscojaOpenAttributeTable.
Lasfilasseleccionadasaparecernenazulbrillanteclaro.
Enelextremoinferiorizquierdo,latablanosproveeunnavegador.

Presioneelbotn paraqueelnavegadorlleguehastalaltimafilaynosdeelnmero
real defilas(records).
Podrverqueenlugarde2000filas,sonenrealidad3042.
Presioneelbotn Selected
Ahoratodoslasfilasaparecernenazul.Estaopcinnosmuestrasolamentelasfilas
seleccionadas.
Cierrelatablausandoel botn

47
Clculo de estadsticas:
Laopcindeestadsticasnosproveeunresumenconvariasmedicionesdeparmetros
estadsticoscomolamedia(promedio),ladesviacinestndar(lavariabilidaddelosvalores),la
suma,elconteodefilas,ademsdelvalormnimoyelmximo.
NaveguehaciaelmenprincipalypresioneSelection|Statistics

Aparecerunaventananuevaenlacualaparecerunagrficaylosvaloresestadsticos
bsicos.
En Layer escojaurban_blds.
En FieldescojaelcampoValue.

Notequearriba aparece unnmerodiferentealvalorCountbajo Statistics.La


diferenciaesqueelconteosuperioresunoglobalmientrasqueelqueestbajo
Statisticsserefieresolamentealconteoenesecampoenparticular. Lagrfica
muestraquelamayoradelosedificiostienenvalorcero.
Paraentenderunpocoestagrficahayquedecirprimeroquelosvaloresnoson
realesyquesetomarondevaloresdetasacindel CentrodeRecaudacinde
IngresosMunicipales(CRIM).Aestosvaloresselemultiplicunfactorde16.7
arbitrariamentesoloparapropsitosdeesteejemplo.Muchosdelosedificios
estabanenparcelasquenotenanvalordeestructura.
Aladerechadelagrficasemuestranalgunosvaloresmuyaltosquecorrespondena
edificioscercanosaunazonaindustrialyalcentrourbanodeBarceloneta.

CierrelaformaSelectionStatistics.

48
Generar un Selection Layer:
Unlayerdeseleccinsirveparaguardarsolamenteen elmapdocumentlaseleccindeobjetos
hechosdentrode lasesin.
Hagarightclickenellayerurban_bldsyescojaSelection|CreateLayerfrom
SelectedFeatures.
Unavezaparezcaelnuevolayerdeseleccin,cmbieleelnombreaEdificiosen
ZonaInundacin2,haciendodosclickslentosenelnombredeestenuevolayer.
Apagueellayerllamadourban_blds.
Intentar otras herramientas de seleccin:
Existenotrasmanerasdeseleccionarobjetos,entreellassepuededibujarunalnea,puntoorea
y usarlaparaseleccionar. Ademspodemosseleccionarinteractivamente,pormediodeunacaja
usandoelbotndeseleccin
disponibleenel ToolsToolbar.
MuevaelcursoralmenprincipalypresioneSelection|Options
EnlaformaSelectionOptions
Presionelaopcin SelectFeaturescompletelywithintheboxorgraphic(s)

49
Estaopcinseusaparaseleccionarsolamentelosobjetosquecaenenteramentedentro
delacajaquesedibuje.Noadmiteobjetosparcialmentecontenidosenlacaja.
PresioneOK
Presioneeltab Selectionenlaparteinferiordelatabladecontenido.

Hagauncheck entodosloslayersexceptoelnuevolayerEdificiosenZonaInundacin
2.
Presioneelbotndeseleccin.
Hagaunaseleccinhaciendouncuadroconunclickyarrastrandoelcursor.
Inspeccioneelnmerodeobjetosseleccionados.Experimentehaciendootrascajas.

Otras selecciones (sub seleccin):


Muchasvecesesnecesariohacerseleccionesdentrodeunaseleccin.Enestecasoharemosuna
seleccindeedificiosenellayerEdificiosenZonaInundacin2 queseandetiporesidencial.
Latabladeatributosdellayerdeseleccinrecientementecreadoheredtodosloscamposdel
layerurban_blds. Podemoshacerunabsquedadeigualmanera.
MuevaelcursorhaciaelmenprincipalypresioneSelection|SelectbyAttributes.
EneldilogoSelectbyAttributes,busqueLayer:yescojaEdificiosenZona
Inundacin2.
En Method,escojaCreateanewselection.
Inmediatamenteabajoenlalistadecampos,naveguehaciaabajohastaqueveaelcampo
llamado[Land_Use]
Hagadobleclicken Land_Use
Presioneelbotn GetUniqueValuesparaquepuedaverlalistadevaloresvlidos.
Recuerdequeinteresamosseleccionarlosedificiosdeusoresidencial.Ennuestratabla
estncodificadosendistintosvalorestodosconvaloresentre1000y1008.
Presioneelbotn >= (mayoroiguala)yhagadobleclickenelvalor1000
Presioneelbotn ANDyhagadobleclicken [Land_Use]otravez

50
Presioneelbotn < (menorque)yescriba2000(conlascomillassencillas).

Hagaclickenelbotn Verifyparaasegurarsedequelaexpresinestbienescrita.
PresioneOK.
Cuntosedificiosestn clasificadoscomotiporesidencial?_________________________
MuevaelcursorhaciaelmenprincipalyescojaSelection|ClearSelectedFeatures.

Guardar el layer de seleccin en otro formato:


Podemosexportarelnuevolayeraunodetresformatos:shapefile,PersonalGDBfeatureclassy
SDEFeatureclass.Enesteejemplo,guardaremoselnuevolayercomounshapefileantela
posibilidaddecompartirelarchivoconotraspersonasquepuedenonotenerelprograma
ArcGIS.
HagaunrightclickallayerEdificiosenZonaInundacin2.
SeleccioneData|ExportData.

51
EnlaformaExportDatauseestasopcionescomoestanen estafigura:

Presioneelbotn

delflderyespecifiqueen Saveastype: Shapefile.

NavegueatravsdeldiscohastallegaraldirectorioC:\ArcTrain\Barceloneta.Guarde
elarchivoconelnombrebld_zi2.shp.
PresioneSave.

HagaclickenOKeneldilogoExportData.
LuegodeterminarlaexportacinArcMapledalaopcindecargarelnuevoarchivo
comounlayerenestasesin.
Presioneelbotn Yes.
Inspeccioneellayerparaversiexportcorrectamente.

52
Guardeelmapdocument.Muevaelcursoralmenprincipal,presioneFile|Save o
presioneel botn .Elarchivomxdseguardareneldirectorio
C:\ArcTrain\Barceloneta.

Estoconcluyeesteejercicio.

O|G|P

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

EjercicioIV:Datosgeogrficosdigitalesy formatos
(Spatialdataformats)

OFICINADEGERENCIAYPRESUPUESTODELESTADOLIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

54
Introduccin:
EnesteejercicioexploraremoslosformatosqueArcGISpuedeleerdirectamente.Los
archivosproducidosporlosprogramados(software)deESRIsonvarios,entreellos:
Lallamadacobertura(coverage),conestructuratopolgica,(Msadelantesediscutirun
pocomseltemadelatopologa).

Shapefilesintopologa(geometrasimple).
FeatureclassespresentesenlasGeoDataBasestantopersonales(formatomdbde
MSAccess)comolosFCqueseguardanenBasesdeDatosenambientescompartidos
enOracle,SQLyotros.

ESRItambinproduceotrosformatosmenosconocidosloscualesnoserndiscutidosaqu.
Puedereferirsealbancodedatosdeayuda(Help)delsistemaparainformacinadicional.
AhoracomenzaremosusandolaaplicacinArcCatalog.Estaaplicacinsirveprincipalmente
paraayudaraorganizarlosdatosysudocumentacin.Anuestroparecer,estaaplicacin
deberaserparteintegraldeunsoloprogramaparamanipular,organizarydocumentarlos
datosgeogrficos.
ArcCatalogtambinledaaccesoausuarioalasherramientasdeanlisisgeogrficoy
manipulacindedatos.Estasherramientasseaccedenmedianteelbotndeherramientas
(ArcToolbox),queantesvenaenunaaplicacinseparada.
Tareas:
ComenzarsesindeArcCatalogycrearnuevaconexin
VisualizarelcontenidodefldersusandoelContentsView
UsarelPreviewtabyexplorarunshapefile
VisualizaryexplorarunacoberturaArcInfo
Explorarlosmetadatosdeunlayer
ExplorarunaGeoDataBase(GDB)
ExplorarunarchivotipoCAD
ConvertirunshapefileaGDBFeatureclass
VisualizararchivosrsteryTIN
Producirungrficoanejoparametadatos.

55
Comenzar sesin de ArcCatalog y crear nueva conexin
ComienceunanuevasesindeArcCatalogmediante Start|Programs|ArcGIS|
ArcCatalog.
ArcCataloglemuestraelCatlogooelarchiveroolasantiguasplanerasdondese
guardabanlosplanosenpapel.Elprogramafacilitaelaccesoadirectoriosmediante
conexiones(shortcuts)quenosdirigenhaciaundirectorioeneldiscodurooen undiscoo
directorioenunared.
Hagamosunaconexinaldirectorioenelcualhemosestadotrabajando:
C:\ArcTrain
Utiliceelbotn ConnecttoFolder
AparecerundilogoqueutilizarparahacerclickeneldiscoC:.Hagaotroclickenel
directorioArcTrain.

Cuandonecesiteeliminarunaconexin,hagaunclickenlaconexinnodeseadaypresione
elbotn

DisconnectFolder

Visualizarelcontenidodedirectorios(folders)usandoelContentsView.
ArcCatalogpermitevisualizararchivosindividualesdetresmanerasdiferentes:
Contentstab:listaelcontenidodeundirectorio
Previewtab:seusaparaexplorarvisualmentelapartegrficaytabulardelarchivo
Metadatatab:Sirveparapresentaryproducirdocumentacinestandarizadadearchivos
GISindividuales.
CuandoseestusandoelContentstab,elStandardtoolbarproveeopcionesparecidasaMS
WindowsExplorerencuantoavisualizacindearchivos.

56
Enordendeizquierdaaderecha:largeicons,list,details,ythumbnails.Porejemplo,thumbnails
sirveparamostrarpequeosretratosdellayer,demaneraqueeltcnicopuedareconocer
rpidamenteunarchivo.
Utilicelaconexinqueacabdehacer:ArcTrain

Entreenel directorioBarceloneta,haciendodobleclickeneliconodeldirectorio.
ArcCatalogutilizasmbolosycoloresparadiferenciarlos.Alladodelacolumna
Name,lacolumnaTypedescribelatipologadelosarchivos.

Ahorautilicelosbotones

paraque puedaverlasdiferentesopciones.

Usar el Preview tab y explorar un shapefile:


ElPreviewtabpermiteverunarchivoindividualdedosmaneras:grficaotabular[Geography:
Table].Examinaremosunshapefile.
Hagaunclicksobreelarchivobt_luse01.shp.
Asegresequeel Previewtabestactivado.

57
Activelaopcin Geography
queaparecerenlaparte
inferiordeArcCatalogunavezel Previewtabestactivo.
Utilicelosbotonesqueproveeel Geographytoolbar
navegaratravsdelespaciogeogrficodellayer.

para

Enordendeizquierdaaderechasemuestralafuncionalidaddecadabotn:
zoomin
zoomout
panning
zoomextents
identifyfeature
createthumbnail
Sepuedehacerunthumbnailusandodistintosnivelesdeacercamiento.

Cambieel Preview(inferior)almodoTable.
Hagascrolling(moversehaciaarribaohaciaabajo)enlatablaparaverlasfilasy
columnasdellayer.
RecuerdequeunlayerpuedeseraadidoaunasesinabiertadeArcMapusandodrag
anddrop.PuedeabrirunasesindeArcMappresionandoelbotniconodeArcMap:

Contine

58
Visualizar y explorar una cobertura ArcInfo:
Unadelasdiferenciasmsobviasentreunshapefileyunacoberturaesquelacoberturaesun
directorioquecontienearchivosquepuedenguardardistintostiposdegeometra:puntos,lneas,
polgonosyanotaciones,ademsdeotros. Adiferenciadelosshapefilesylosfeatureclassesde
losGDBslascoberturasnopuedensermodificadasenArcMapdesdelaversin9. Las
coberturassonrepresentacionesvectorialesdelageografay noguardan ensuinterioirimgenes
oarchivosmatriciales. PasemosahoraalaaplicacinArcCatalog:
Hagaunclickeneltab Contents.
Hagaunclickenelarchivobt_bldconsmboloamarilloyblancodecoberturaArcInfo.
Podrverelcontenidodeesedirectorio:

Notelosdistintostiposdefeatureclassescontenidasenlacobertura
Culestiposdegeometras(featureclasses)estnpresentesenlacoberturabt_bld?
____________________________________________________________________
Hagaclickenel Previewtab
ynavegueusandolasopciones
devisualizacingrficaytabularparacadaunodelosdistintostiposdegeometra
presentesenestacobertura.
Notecmocambianlosdesplieguesdeinformacin.

Useel Tablepreview,

59
Hagarightclickenelencabezado(heading)delcampoAreayescojalaopcin Sort
Descending.
Rightclick

IdentifiqueelFID(featureid)demayorreaentodalatabla.
CuleselnmerodeFID? _______________________
Culesel valordelcampoHeight?________________(metrosdealtura).

Explorar los metadatos de un layer:


Losmetadatossonnecesariosparacompartirinformacinyparaconocerlosalcancesdecada
unadeestosarchivos.Enocasiones,luegodeleerlasdescripcionesdelosdatospodemosdarnos
cuentasisontilesonoparadeterminadostrabajos.
El tab Metadata deArcCatalogseutilizaparalaentradadeinformacinyparaleerlaen
diferentesmodosdepresentacin.

Asegresequeestusandoel featureclasspolygondelacoberturabt_bld

60

Enel MetadataToolbar asegresequetengaescojidalaopcin FGDCESRIen


Stylesheet.

ExplorelasopcionesDescription,Spatial,yAttributes
En Spatial,naveguehaciaSDTSDescriptionyhagaunclick.
Cuantospolgonoscontieneelarchivo?(GTPolygon)____________________
Anotaciones?(annotation.igds)___________________
Siguiendoen Spatial,culeselsistemadecoordenadas? (Projectedcoordinatesystem
name)_______________________________________

Explorar una GeoDataBase (GDB):


LaGDBeslanuevaversindeESRIparalacodificacindedatosgeogrficosdigitales.Enlas
GDBpodemosguardararchivosdediferentetipocomolosvectorialesylosdetiporstertales
comolasimgenesylosGRIDs.
LasGDBtambinorganizanlainformacinmedianteFeatureDatasetsquefuncionancomo
directoriosodepsitosenloscualespodemosguardarFeatureclasses(layer)con igual extensin
ysistemadecoordenadas. LosfeatureclassesdeunaGDBtambinpuedenexistir
independientesfueradeunFeatureDataset.
LasGDBsonbancosdedatosenformatoMSAccess.Paralaversin9.2deArcGISlasGDB
personales(comolasdeAccess)estarnenotroformatopropietariodeESRI.
EnArcCatalog,hagadobleclickenlaGDBBarceloneta.mdb.Verelcontenidodeeste
bancodedatos
Aculmodelodealmacenamientodedatos(deloquehavistohastaahora)separece?
____________________________________
Hagarightclicksobreelfeatureclassbt_soilsyescojaProperties.

61
Escojaeltab Fields.Inspeccionelosnombresyatributosdeloscamposdeestefeature

class(FC).
UnodeloscamposmsimportantesesShape.
Estandoanen Fields,hagaclickenelcampoShape.Inspeccionelaspropiedadesdel
campoenlaseccin FieldProperties.
CuleseltipodegeometradeesteFC?_____________________
Hagaclickenelbotn
alladodelitem SpatialReference
Culeselsistemadereferenciaespacial?
____________________________________________________________
LasGDBtambinpuedenalmacenarinformacintopolgicademaneraparecidaalas
coberturasArcInfo,aunquedemaneramsavanzada.Latopologaseutilizaparadepurarla
informacinyparaestablecerrelacionesentreobjetosenelterreno.Ademsexistela
topologaderedesquemereceotrotipodeinformacinyexplicacionesquenoestn dentro
delalcancedeestemanual.

62
Explorar un archivo tipo CAD:
EnArcGISlosarchivosCAD,tantodeAutoDesk(dxf,dwg)oMicrostation,(dgn)pueden
versededosmaneras.ArcGISdalaopcindeverlosportipodegeometraovisualizarlosde
maneraanlogaalacomposicindelayersycoloreshechascomosedibujaronenestos
programasCAD. AgradecemosalaAutoridaddeCarreterasyTransportacinporprestarnos
estearchivoCADdelMunicipiodeBarceloneta.
CADengeometrasindividuales

CADencombinacindelayers

Hagaclicken Annotation usandoeltab Previewparapoderverloslabels


separadamente.
Inspeccionetambin Polygony Polyline.
HagaclickeneliconoblancoBarcelonetaNAD83.dwg.Asegresedeteneractivado
eltab Preview. Noteladiferenciaentreambasrepresentaciones.

Contine

63
Convertir un shapefile a GDB Feature class:
PodemosaccederalasfuncionesdeconversinyanlisisdesdeArcCatalog. Podemosimportar
coberturas,shapefilesyarchivosCADaformatoGDB. Enestaparteharemosunaconversinde
formatodesdeshapefileafeatureclassdeunaGDB.
Hagaclickenelbotn
localizadoenel StandardToolbar.
AparecerlaventanadelasherramientasdeArcToolbox conmltiplesfunciones.
DentrodeArcToolbox,expandaConversionTools,luegoToGeodatabase
Hagadobleclicken FeatureClasstoFeatureClass
Esteesun ModelodeGeoProcesamientoquepermitehacerlaconversin.
Convertiremoselshapefiledeusodeterrenosde2001aformatoFeatureClassdela
GDBPersonalBarceloneta.mdb.

MuvaseaArcCatalogdenuevoyhagaclicken bt_luse01.shplocalizadoenelflder
BarcelonetadentrodeC:\ArcTrain.
Hagadraganddrop (arrastre)desdeel Catalogtree,localizadoalaizquierdade
ArcCatalog,hastaeltextbox Inputfeatures.

64
HagaclickenlaGDBBarceloneta.mdbyhagadraganddropenlacajadetextoOutput
Location.
En OutputFeatureClassNameescribabt_luse01.
Enlaseccin FieldInfoverloscampos. Aqupodemosmodificarlosnombresdelos
camposyeliminarlosquenoqueramosimportar.Solamenteimportaremoselcampo
LUse2001.
HagaclickdebajodeVisible.MantengaTRUEaLUse2001ycambieaFALSEtodos
losdemscampos.
Dejelasdemsopcionescomoestn.Suformadeberparecerseaesta.

Nose ocupeen traerloscamposAreayPerimeter.ArcGISgeneraestoscampos


automticamentecuandoimportamosFCdepolgonoshaciaunFCdeunaGDB.
PresioneOK.

65
PresioneCloseenlaventanaderesultadoseinspeccioneelcontenidodelaGDB
Barceloneta.mdbyasegresedequeapareceelnuevoFCbt_luse01.
HagadobleclickenesteFeatureClass(bt_luse01)einspeccioneelcontenidodecampos
eneltab Fields.CierrepresionandoOK.

Visualizar archivos rster y TIN:


Comosemencionantes,enArcCatalogoArcMappodemosvisualizarotrostiposde
representacingeogrficadigital talescomorstersyTINs.LosTINssonrepresentaciones
vectorialesdesuperficies(variablescontinuas)talescomoelevacin,temperatura,precipitacin,
acidezenelterrenoyotros.
UnaGDBpuedeguardardatostiporster,peroenestaocasinlasveremosenformatoGRID,
TIFFyMrSID.
Hagaunclickeneldirectorio(flder)Barceloneta.
Enlalistaverunossmbolosamarilloscuadriculadosparecidosaunwaffle.
HagaclickenelarchivoGRIDbt_eleyluegopresioneeltab Preview
EsteesunGRIDdeelevacionesenmetros.
Inspeccioneellayerusandolasherramientasdeacercamiento.
RepitaelprocesoparaelGRIDbt_shd.EsteesotroGRIDquemodelalassombrasde
montaas.
UtilicelasherramientasdisponiblesdeProperties(conrightclickenelnombredel
layer)yatravsdeltab Metadata.Averigelosiguiente:
ParaelGRIDbt_ele,culeseltamaodelasceldasquecomponenelGRID?(cellsize
x,y)______metros.
BajoStatisticsencuentreelvalormnimo________metros
mximo________metros.
Examineelarchivobarceloneta.tif.usandoeltab Preview.
Esteesunscanningdelcuadrngulotopogrficomsreciente(1977).
ExamineelTINbt_tinusandoeltab Preview.Esperemientrasdibujaelcontenido.
RepitaelprocesoconalgunadelasimgenesenelflderIKONOSoBarcel97Photos.
IKONOSesunconjuntodeortoimgenessatelitalesadquiridoparatodaslasagenciasdegobierno
central,municipalylaUniversidaddePR.
Barcel97PhotoscontieneortofofotografasquesonpartedelmapabasedelCentrodeRecaudacinde
IngresosMunicipales.

66
Producir un thumbnail para propsitos de documentacin:
Esta opcin estilparadarunaimpresindecmoesellayerofeatureclasseinclusosirvepara
loslayoutsdelosmapdocuments.
Activeellayerbt_shdenel CatalogTreeybajoeldirectorioBarceloneta.
Presioneeltab Preview.
Presioneelbotn CreateThumbnaillocalizadoen GeographyToolbar.
Presioneeltab Metadata.Elgrficoproducidoesestticoysepuedecambiarsiseusan
lasopcionesdeacercamiento.
Estoconcluyeesteejercicio.

67

O|G|P

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

Ejercicio V: Datos en tablas

OFICINADEGERENCIAYPRESUPUESTODELESTADOLIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

69
Introduccin:
Lainformacingeogrficadependetambin delainformacindescriptivaasociadaalas
localizacionestalesobjetosyeventos. Porejemplounmapadesectorescensalesesvalioso
cuandoseleasocialainformacindescriptivarecopiladaenloscensos. AunqueenArcGISse
puedenhacercambiosyaadirdatosalatabladeatributosdecadafeatureclass,enmuchas
ocasionesespreferiblequelainformacindescriptivasemanejeentablasaparte.Otros
programasdemanejodebancosdedatostalescomoMSAccessproveenmejoresfuncionesde
entradadedatos,informesimpresos,ybsquedasdedatossencillasycomplejasparaestasbases
dedatosmultitabulares.
Enesteejerciciousaremosunejemplocondatosdescriptivosficticios.El featureclassde
LechonerasdelreacentroestedePuertoRicocontendrinformacindelmendetiposde
comidas,bebidasypostresdisponiblesendichoslugares.Adiferenciadelainformacinficticia
delmen,lalocalizacindeestoslugaresesciertahastaunradiodeporlomenos3a7metros.
Reconocemosquepudimoshabertenidomstablasrepresentandoelmencomobebidas,
postres,comidasyprecios,todosellosentablasaparte.Sinembargo,enestaetapade
aprendizajeesmejormantenerlascosaslomssimpleposible.
Elobjetivodeesteejercicioesmostrarelconceptodecardinalidad(relacin)entrelastablasque
definenunbancodedatos.Lacardinalidaddefineeltipodeasociacindecantidadde
correspondenciaentrerecordsentredosomstablasenunbancodedatos.Paraesteejercicio
usaremoslostiposdecardinalidadunoaunoyunoamuchos.

Estediagramamuestralacardinalidaddelas
tablasqueseusarnparaesteejercicio.
Larelacinentrelatabladelfeatureclass
Restaurantes(enestecaso,lechoneras)y
Direccines1:1.
LatablaCorrespondencia manejalarelacin
entrelosrestaurantsyelmen.
Estatablaauxiliarregistralosidentificadores
que ocurrenenlastablas Restaurantesy
Men.

Enlasegundaparte,usaremosunejemplocondatosestadsticosdeleventoelectoraldel10de
juliode2005.Esteeventoplanteabaalapoblacin votantemedianteconsultasisepreferauna
AsambleaLegislativaunicameral odejarlascosascomoestncondoscmaras(senadoresy
representantes).

70
Mostraremosgrficasyresmenesdedatosloscualessernintegradosallayout. Eneste
aparecerelmapa,yseaadirnunagrficayuncortoinformecondatosestadsticos.
Tareas:
Examinarpropiedadesdeunfeatureclass
InspeccionartablasdeunaGeoDataBase(GDB)
Cardinalidad
Unirtablasconcardinalidad1:1medianteJoin
CambiarlaaparienciadelatablatemporeraproductodelcomandoJoin
Relacionartablasconcardinalidad1amuchos(1:)usandoRelate
Cmoproduciretiquetasapiladas(multilinelabeling)
Segundaparte:
Comenzarunagrficanuevaycambiarsuspropiedades
Exportarlagrficaparausoposterior
Desplieguedecaractersticasdeuninformeyespecificarcampos
Establecerpropiedadesdeloscamposparaimpresin
Integrarlagrficadentrodelinforme
Aadirelinformeallayout

71
Comosemencionenlaintroduccin,estaprimerapartemostrarelmanejodetablasasociadas.
Usaremoselejemplodelfeatureclassdelechonerasqueseusanteriormentecontenidoenel
directorioC:\ArcTrain\Guavate.EnestepodremostraeryutilizarelfeatureclassLechoneras,
ysustablas.
Examinar propiedades de un feature class:(geodatabase,shapefile,cobertura):
UsaremosArcCatalogen estaparte.
AbraunasesindeArcCatalogusandoStart|Programs|ArcGIS|ArcCatalog.
UbquesedentrodeldirectorioC:\ArcTrain\Guavate
Hagaunclickenelsigno+alladoizquierdodelaGDBLechoneras.mdb.ubicadaenel
CatalogtreealladoizquierdodelapantallaprincipaldeArcCatalog.
HagaunclickenelfeatureclassLechonerasyhagaclickeneltab Preview
Escojatambinlaopcin Tableenel Previewdropdownlistenlapartededebajodela
pantallaprincipaldeArcCatalog.

Verquehay28recordsypodrverelnombreeidentificadornumricoqueservirde
enlaceconotrastablas.
Ahoraregreseal CatalogtreealladoizquierdoyhagarightclickenelFeatureclass
LechonerasyescojaProperties.
AparecerlapantallaFeatureClassProperties.Hagaunclickeneltab Fieldsy
examinelaspropiedadesdeloscamposhaciendoclickenelnombredecadauno,
especialmenteelcampoSHAPE.
Notelasdiferenciasentretiposdecampo:geometry,text,number
Nopodrcambiarlaspropiedadesdeningncampopreviamentedefinidoysalvado
anteriormenteexceptoaadirDominio(Domain).Porelmomento,nolohaga.
Presioneelbotn Cancel parasalirdeestapantalla.

72

Inspeccionar tablas de una GeoDataBase (GDB):


LasGDBpuedenserdepsitosdetablassimplesquenocontieneninformacindegeometra.
Lastablasguardaninformacinquepuedeserasociadaaunlayerenalgnmomento.Enesta
partepodrexplorarlastablasqueseusarnenadelanteparalosejemplosdeJoiny Relate.
MantengaabiertalasesindeArcCatalog.
AsegresequetieneseleccionadolaGDBLechonerasyquepuedeverelcontenidodela
misma.
HagaunclickenlatablaLechDescripteinspeccionetodosloscampos,especialmenteel
campoPig_ID,queeselcampodeenlaceexterno(foreignkey)conelfeatureclass
Lechoneras.Estatablatieneinformacindescriptivadecadaestablecimiento:
direccin,telfono,dasyhoraslaborables,ydicesiestncertificadosporel
DepartamentodeAgriculturadePR.
Useelnavegador
parallegarhastaelfinaloprincipiodela
tabla.
PresionelatablaMenuyrepitaelprocedimientoanterior.Verunatablacon51filas
(records)condiferentestiposdecomidas,postresybebidasquesesirvennormalmente
enestaslechonerasenlaisla.
PresionelatablaCorrespondyhagalomismo.Veaqueestatablasolamentetiene
nmeros,loscualessonreferenciasalosidentificadoresdelfeatureclassLechonerasy
delatablaMenu.
Pig_IDenlatablaCorrespondeselcampodeenlaceconelfeatureclassLechoneras.
Menu_IDentonceseselcampodeenlaceconlatablaMenu.

Cardinalidad:
Sehabamencionadoquehaycamposdeenlace,primaryoforeignkeyseningls.Ennuestro
ejemplo,hemosvistoque Pig_IDestpresenteenelfeatureclassLechoneras,LechDescrip,y
Correspond.
EnelcasoLechonerasLechDescriptlacardinalidades1a1(1:1).Estoquieredecirque
paracadarecordenlatabladelfeatureclassLechoneras,existesolamenteunrecordquele
correspondeenlatablaLechDescript.
CuandovemoslarelacinentreLechonerasCorrespond,lacardinalidadesunoamuchos
(1:).EstosepuedeversiabrimoslatablaCorresponden ArcCatalogyvemoscmose
repitenlosnmerosenelcampoPig_ID.
LarelacinentreCorrespondy Menu tambinesunoamuchos.LatablaMenumantiene
solamenteunafila(record)portipodecomidaobebida.LatablaCorrespondsolamenterepite
losIDentrelastablas,demodoquesereducelaposibilidaddeerroresal volveraescribir
nombresdelmenonombresdeestablecimientos.

73

ActivelastablasCorrespond,Lechonerasy Menueinspeccioneloscamposcomunes
entreestastablas(Pig_IDy Menu_ID).Verquelatablaquerepitenmeroses
solamenteCorresp.

Unir tablas con cardinalidad 1:1 mediante Join:


Enestapartepracticaremosunirdostablasendondeacadarecordlecorrespondesolamenteun
recordenlaotratabla. AhorautilizaremosArcMap
AbraunasesindeArcMap
LocaliceelMapDocumentllamadoExer5_Tablas.mxddentrodeldirectorio
C:\ArcTrain\Guavate\Exer_5.Esteesunmapdocumentparecidoal queusted
trabajenelprimerejercicio.
Esperequeabraelmapdocumentylemuestrelascapasdeinformacinvisibles.
Enelmenprincipal,vayaaView|Bookmarks|Carr184BeatrizyGuavate.
Ahora,hagarightclickenellayerLechoneraslocalizadoenlaTabladeContenidoal
ladoizquierdodeArcMap.
EscojaJoinsandRelates|Join

74
Aparecerlaforma(dilogo)JoinData
UniremoslatablallamadaLechDescriptqueestlocalizadadentrodelaGDB
LechonerasconlatabladescriptivadelFCLechoneras.
UseelbotnBrowse
ybusquelatablaLechDescriptlocalizadaenlaGDB
Lechoneras.mdbdentrodeldirectorioC:\ArcTrain\Guavate.
EscojalatablaypresioneAdd.
UsaremoselcampoPig_IDcomocampodeenlace(Key)paraunirlatablaLechDescript
alatabladellayer(featureclass)llamadoLechonerasquecontienelalocalizacinde
estosestablecimientos.
SuformaJoinDatadebersercomoesta:

PresioneOK
Antesdeverelcontenidodelatablaunida,podemosescogerculescamposharemos
visibles.

Cambiar la apariencia de la tabla temporera, producto del comando


Join:
Para ocultarredundanciasocamposquenonecesitamosver,podemosusarelmende
propiedadesdeloslayeryescogerloscamposquequeramosdesplegar.
HagarightclickenellayerLechonerasyescojaProperties.

75
Presioneeltab Fields
Hagauncheck enlascajitasal ladodelnombredeLechoneras.OBJECTID,
LechDescript.OBJECTID,y LechDescript.Pig_ID.

EsprobablequenecesiteagrandarelespaciodelacolumnaName.Muevala
hendiduraalladodelheader(cabecera)delosnombresdeloscamposhacialaderecha
paraverelnombrecompleto
PresioneOK.
Paraverlatablaunida,hagarightclickenelnombreLechonerasyescojaOpen
AttributeTable.Aparecerlatablaconloscamposdelaotratablaconinformacin
descriptivaadicional.
Useelbotn Identify
localizadoenel ToolsToolbar paraverlosrecords
individualesenelmapa.

76
Relacionar tablas con cardinalidad 1 a muchos (1:) usando Relate:
Enestapartedelejercicio,uniremosdostablasrelacionadasalatabladelfeatureclass
Lechoneras.Setratadeinformacinsobreeltipodecomidas,postresybebidasqueofrececada
unodelosestablecimientos.
Paraevitarrepetirinformacinentretablas,sedeciditenerunsolorecordporestablecimientoy
unatablaconlosdiferentesofrecimientosdelmen.LatablaMenucontienelosnombresdelas
comidas,etc., sinrepeticin.LatablaCorrespondcontienelosidentificadoresqueaparecenen
latabladelfeatureclassLechoneras(Pig_ID)ylosidentificadoresqueestnpresentesenla
tablaMenu(Menu_ID).Paravisualizarinformacinconcardinalidadmltipleentretablasse
necesitausarlaopcin RelatedentrodeArcGIS.
NecesitaremosespecificardosRelates:
1.PararelacionarlatabladelfeatureclassLechonerasconlatablaCorrespond.
2.PararelacionarlatablaMenuconlatablaCorrespond.
Deestamanera,lastrestablasestarnrelacionadasypodremosnavegardeunladoaotroentre
tablas.Luegoveremosestoenmsdetalle.
Primerodefinamosel RelateentrelatabladelfeatureclassLechonerasconlatabla
Correspond.
Hagarightclicken LechonerasyescojaJoinsandRelates|Relate
En #1.Choosethefieldinthislayerthatrelatewillbebasedon:escojadelalistael
primarykey Lechoneras.Pig_ID.
En #2.Choosethetableorlayertorelatetothislayerorloadfromdisk:Useelbotn
browse ynaveguedentrodeC:\ArcTrain\Guavate\Lechoneras.mdbyescojala
tablaCorrespondusandoAdd.
En #3.Choosethefieldintherelatedtableorlayertobasetherelateon:Escojael
ForeignKey Pig_ID.

77
Enel #4.Chooseanamefortherelate:EscribaRelate_PigToCorresp.

PresioneOK.
Acabadeespecificarelrelateentreambastablas.Ahoraveremossi esterelatetrabaja.
Hagarightclicken LechonerasyescojaOpenAttributeTable.
Seleccioneelprimerrecorddelatablahaciendounclickenelextremoizquierdodel
primerrecord.Esteesunaespeciedebotnqueseleccionalafila(record).

Enlamismatabla,vayaalextremoinferioryhagaclicken Options,escojaRelated
Tables|Relate_PigToCorresp.
SesuponequeaparezcalatablarelacionadaCorrespond.Esposiblequelatabla
relacionadaestdetrsdelatablaprincipal.Muevalatablaparaquelapuedaver.
FjeseenlabarrademensajesdelatablaCorrespond.Lamismadebeteneralmenos
cuatrode404recordsseleccionados.

78

Naveguedentrodelatablasintocardentrodeellaparanoseleccionaraccidentalmente
algnrecord. Puedetambinhacerclickenelbotn Selected
y verloscuatro
recordsquecorrespondenalpuntonmero1enel featureclassLechoneras.

Hastaahoraloquevemosnonosparecemuydescriptivo. Necesitamosunirlatabla
conlosnombresdelmenparahacersentidoatodoesto.
Primeronecesitarpresionareltab Sourcelocalizadoenelextremoinferiordelatablade
Contenido(TableofContents)

HagarightclickenlatablaCorrespondyescojaJoinsandRelates|Relate

79
En #1.Choosethefieldinthislayerthatrelatewillbebasedon:escojaMenu_ID
En #2.Choosethetableorlayertorelatetothislayerorloadfromdisk:useelbotn
browseynaveguedentrodeC:\ArcTrain\Guavate\Lechoneras.mdb
yescojalatablaMenuusandoAdd.
En#3.Choosethefieldintherelatedtableorlayertobasetherelateon:escoja
Menu_ID
Enel#4.Chooseanamefortherelate:escribaRelate_CorrespToMenu
PresioneOK
ConlatablaCorrespondabierta,hagaclicken Options|RelatedTablesyescoja
Relate_CorrespondToMenu:Menu
AparecerlatablaMenuconlosrecordsseleccionados.Debenseralmenoscuatrosise
escogielrecord#1delatablaLechoneras.

Porelmomentohemosnavegadohaciadelante,desdeelpuntoenelmapahastallegaralrecord
correspondienteenlatablamenutilizandodosrelates.

80

Tambinpodemosnavegaralainversa.Porejemplo,supongaqueustedquiereiraalgn
establecimientoenestareadeGuavate,queofrezcaenelmenarrozconguinea.(Untipode
cocidodearroz,enelcualseusalacarnedeestaavegallincea,oriundadelacostadela
Guinea,enfrica).
Paranavegaralainversaentonces:
EnlatablaAttributesofMenu,presioneelbotn All.
Naveguehaciaabajoyseleccioneelrecordhaciendoclickenelrecord#48Arrozcon
Guinea.
Presioneelbotn OptionsdelatablaMenuyescojaRelatedTables|
Relate_CorrespToMenu.
EnlatablaCorrespondquedarnseleccionadostresrecords, todosconel Menu_ID=
48quecorrespondeaArrozconGuineadelatablaMenu
EnlatablaCorrespondpresioneelbotn OptionsdelatablaMenuyescojaRelated
Tables|Relate_PigToCorresp:Lechoneras_LechDescript
Notarqueseseleccionarntresrecords otrespuntosenlatabladelfeatureclass
Lechoneras.
HastaahoranohaymuchodeGIS.
Ahora,vayaalmenprincipalyescojaSelection|ZoomtoSelectedFeatures.
Podrverentoncesenelmapalalocalizacindelostresestablecimientosquecocinan
Arrozconguinea.Laterceratablamostrarlostresrecordsquecumplenconla
seleccin.

Puederepetirelprocedimientocon
postrestalescomoarrozcon dulce,
flanesyotros

81
Cmo producir etiquetas apiladas (multiline labeling)
Muchasvecesnecesitaremosproducirmapasquepresentenvariaslneasdetextoenunsolo
lugar.Porejemplo,elnombredeunobjetoyalgndatodescriptivoinmediatamentedebajo.
PodemosproducirestetipodelabelsmultilneausandounafuncindellenguajeVBScript
(VBCRLFoVBNewLine).
Estatcnica,aunqueayudaacomprendermejorelvalorreal deunobjeto,enocasionesnoes
efectivasiseusandemasiadaslneasdetexto.Sedeberecordarqueporlogeneral,para
representarresmenesdeinformacincomolosmapas,nodebemospresentartantosdetalles
porqueperdemoslaesenciadeloqueesunresumendeinformacin.
Comenzaremosconunmapdocumentnuevo.
VayaalmenprincipalyescojaFile|New
Dejelasopcionespordefecto(default):Blankdocument,Document

PresioneOK.
HagarightclickenlaTabladecontenido oenel DataViewyescojaAddData.
Navegueatravsdeldiscoybusqueelfeatureclass
C:\ArcTrain\Guavate\Lechoneras.mdb\Lechoneras.HagaclickenesteFeature
classypresioneAdd.

82
HagamosunacercamientoalreadeGuavatedondehayconcentracindepuntos.
Primeroseleccionaremoslospuntosquesevenenelgrficodeabajoconla
herramientaSelectfeatures

VayaalmenprincipalyescojaSelection|ZoomtoSelectedFeatures.
AutomticamenteseacercaralreadelaslechonerasdeGuavatedondehay una
decenadepuntosconcentrados.
Paralaprximaparte,necesitaremosunirmedianteJoinlatablaLechDescriptalatabladel
FeatureclassLechoneras(conrelacin1:1)paramostrarlainformacindescriptivadeestos
puntos.Luegoharemoslapartedeloslabels(etiquetas)multilneas.
HagarightclickenellayerLechonerasdentrodelatabladecontenido.EscojaJoins
andRelates|Join
Useelbotnbrowse
eneldilogoJoindata ybusquelatablaLechDescript
dentrodeC:\ArcTrain\Guavate\Lechoneras.mdb.
En1.Choosethefieldinthislayerthatjoinwillbebasedon:escojaPig_ID.
En3.Choosethefieldinthetabletobasethejoinon:EscojaPig_ID.

83
PresioneOK.
Unavezunidaslastablas,hagarightclickenellayerLechoneraslocalizadoenla
tabladecontenido.
EscojaPropertiesypresioneeltab Labels.
Hagachecken Labelfeaturesinthislayer
En TextStringpresioneelbotn Expression
Escribalasiguienteexpresinenlacajadetexto:
"Lechonera"&VBCRLF&[Lechoneras.Nombre]

84
Presioneelbotn Verifyparacorroborarlasintaxis.

PresioneOKenlaformaLabelExpressionVerification
PresioneOKenlaformaLabel ExpressionyenlaformaLayer Properties.
Podrverentoncesloslabelsmultilneasalladodelospuntos.Algunosdeellosno
seidentificanporqueestanmuycercaunosdeotrosysenecesitaacercamientopara
mostrarsusnombres.Tambinsepuedehacerexpresionesdelabelsconmsdeun
campo.
ArcMapofrecemltiplesopcionesdelabeling(color,tamao,typeface)lascualespuedenser
especificadasvaVBScript.Ademsproveeflexibilidadparahacerlabelssegnlosatributosde
latabla.Porejemplo,enunmismofeatureclassdecarreteras,podemosproducirsmbolos
diferentesparalostiposdecarreterasprimarias,secundariasoterciarias,sintenerqueguardarlas
enarchivosaparte.

Segunda parte:
Introduccin:
Enesteapartado,usaremoscomoejemplolageografaelectoraldelpas.Especficamente,nos
concentraremoseneleventoelectoraldel10dejuliode2005.EstesetratadelReferndumo
consultaalpueblo,enlacuallasopcioneseran:pedirlaconsolidacindelascmaraspara
convertirlaenunaasamblealegislativaunicameralocontinuarconlaasambleabicameral.
Podremosmostrarenelmapa,sielcomportamientodeloselectorestienealgnpatrn
geogrficoreconocible,ademsdemostrarunagrficayuncortoinformepordistritosenatorial.
Elejemploessolounaparteentremltiplesposibilidadesquetienen estetipodeprogramastipo
desktopmappingenelcampodelageografaelectoral.

85
AgradecemosalaOficinadePlanificacin delaComisinEstataldeEleccionesporprestarnos
elmapadeprecintoselectoralesyaManuellvarez(http://www.eleccionespr.org),porlosdatos
estadsticosparaesteeventoelectoraldejuliode2005.
Comenzar una grfica nueva y cambiar sus propiedades
PrimeroabriremosunasesindeArcMapconunmapdocumentexistente.
Vayaalmenprincipal:File|Openyabraelmapdocument
ReferndumUnicameralidad2005.mxdlocalizadoen C:\ArcTrain\Electoral
Aparecerunmapaparcialmentehechoenelcualpodrponerunagrficayuninformecorto
dondeaparecernlosresultadospordistritosenatorial.Entendemosqueelespacioqueresta
esmuylimitado,perolafinalidadesmostrarlasfuncionalidadesdeArcMapparaaadir
informes(reports)ygrficasenunLayout.
Elmapamuestralneasguaenlascualesservirnparadarunaideadecmoinsertarnla
grficayelinforme.
Alabrirelmapdocumentaparecerlosiguiente:

reapara
informe

reapara
grfica

Elrecuadrosuperiorderechoenlneasazulesseusarparainsertarelinformederesultadospor
Distritossenatorialesyel espacioinferiorderechocontendrlagrficarepresentandolos
porcentajesafavoryencontradelasopcionesdeunicameralidadobicameralidad.

86
ParaaadirunagrficavayaalmenprincipalyescojaTools|Graphs|Create.
Haremosunagrficaquemuestrelosporcentajesdepreferenciaporambasopciones.
Enelprimerpanel,escojaalaizquierdaColumn(terceraopcin)yaladerecha,
StackedColumn(segundaopcin).

OprimaNext
En Choosethelayerortablecontainingthedata:escojalatablaCameral.
Hagauncheck en Useselectedsetoffeaturesorrecords
Escojahaciendocheck enloscampos:
%Unicam
%Bicam

PresioneNext
PasaraltercerpanelenelcualescribirenTitle:UnicameralvsBicameral
DejeenblancolaparteSubtitle
Hagacheck en LabelXAxisWithyescojaelcampoPrec_numer.Estecontieneel
nmerodelprecintoelectoral.
Nota:Hastadondehemosexperimentado,nosepudolograrque apareciera nmeroalgunoenelejex(XAxis)
posiblementeporqueson110valoresynocabenenelespaciodeeste eje.

Mantengaen checklaopcin ShowLegend

87

Hagacheck en ShowGraphonLayout

Haremosunagrficaqueincluyatambinlosvaloresdeporcentajedeparticipacindevotantes
enesteevento.Paraesto,necesitaremosusarlaopcin AddOverlayqueaadirunalnea
uniendolosporcentajesporprecinto.Estalneamostrarlavariabilidadenlaparticipacin.
Presioneelbotn AddOverlay
Enelprimerpasodel GraphOverlayWizard,escojaLinesyhagachecken Display
OverlayGraph.
PresioneNext.
Enelpaso2en Choosethefieldtograph,escojaelcampo%Particip.
En Yaxisvalues,escojalaopcinrequireasecondYaxis(valuesarenotinthesame
range).
PresioneNext.
Enelpaso3,dejelasopcionescomoestn,
osiprefiere,puedehacercheck en DrawStatisticalLinesyescoger Mean(promedio)
PresioneFinishparaterminarel GraphOverlayWizard.
PresioneFinishotravezparaterminarel GraphWizard.
LagrficaaparecerenelcentrodelLayoutylamoveremosalespacioquehabamos
designadoparaacomodarla.

88
Cerciresequelagrficaestactiva:

MuevalagrficahacialaesquinainferiorderechadellayoutconlaherramientaSelect
Element

delToolstoolbar.

Conlamismaherramientacomienceaencogerlagrficahastaquequepaenelrecuadro
inferiorderecho

Estagrficamuestravariascosas:
EldominiodelaopcinUnicameralidadelcualmostrpocavariabilidad.
Elporcentajebajoylaaltavariabilidadenlaparticipacinenesteevento.

Exportar la grfica para uso posterior


EnmuchoscasosesmejorsacarlagrficaparaagrandarlayponerlaenotraaplicacincomoMS
Word.EnArcMap,esposiblehacerCopyyhacerPasteenWord.Demaneraalternativa,se
puedeexportarlagrficaaformatoWindowsEnhancedMetafile(WMF).
Paraexportarlagrficaaotroformato,vayaalmenprincipal Tools|Graphsy
escojaManagey abralagrfica
Presioneelbotn Closeparacerrarel GraphManager.
Hagarightclick enelTitlebardelaventanadelagrficaUnicameralidadvs
Bicameralidad.
Titlebar

89

Escojalaopcin Export
Guardelagrficaconelnombreunicmara.wmfdentrodeldirectorio
C:\ArcTrain\Electoral
PresioneSave.
Despliegue de caractersticas de un informe y especificar campos
ArcMapproveedosmanerasparahacerinformes(reports).Unaeslainterfazprovistaporel
mismoprogramaoinstalarCrystalReportsforESRI.Estapartedelejerciciousarlaopcinde
CrystalReports,porqueesmuchomsintuitivaparausar.
HaremosuninformecortosobreelmismoReferndum,estavezusandounatabladedatos
resumidosporDistritoSenatorial.
ElDistritoSenatorialesunaunidadgeogrficaqueencierralapoblacindePuertoRico,divididaen 8partes
iguales.Luego,seprocedeaagregarmunicipiosporpoblacinhastaquesellegaaobtenerunreaquese
compongademsomenosunaoctavapartedelapoblacindelaisla.SilapoblacinenelCensode2000
sumalrededorde3.8millones,cadadistritotendrenpromediounapoblacinrepresentativade pocomsde
400milhabitantes. Lasdivisionessubsiguientessehacenusandomsomenoslosmismoscriteriosde
poblacinyagregodemunicipios,exceptoporlasunidadeselectorales,lascualessonmspequeasquelos
municipios.

Paracomenzarelinforme,vayaalmenprincipalyescojaTools|Reportsyescoja
CrystalReportWizard.
EnlaprimerapartedelWizardescojaCreateareportusingtheselayersortables:.
Escojalatablacameral_ds,quecontienelainformacinresumidapordistritosenatorial.
EscribaelnombredelaGeoBasedeDatos(GDB)enlacuallosdatosdelinformesern
guardado.EstocreaunarchivoenformatoMSAccess.
C:\ArcTrain\Electoral\InformeReferendUnicam2005.mdb
PresioneNext

90
EnlasegundapartedelWizard,escojaloscamposquecontienenlosdatosquesern
partedelinformeenelordenqueapareceacontinuacin.Useelbotn
para
aadirloscampos.

PresioneNext.
Enelprximopasonohagaagrupaciones

EnelprximopasooprimaNext.

En elprximopasoescribaenReportTitleResultadosporDistritoSenatorial

91

Escojalaopcin TrailingBreak

PresioneNext.
Enlaprximaparte,escojalaopcin EditwithCrystalReportDesigner,para
modificarelinforme.
Presioneelbotn Finish.
AparecerlaaplicacinCrystalReports,enlacualpodrhacerlasmodificaciones

Presioneelbotn PrintPreview

AparecerelinformeenmodoPrintPreview.Enestaparteusarsumejorjuiciopara
acomodarloscamposamanotratandodedejarelmenorespacioposibleentrecampos
paraahorrarespacio.Deesemodo,seharmsfcilinsertarelinformedentrodel

92
layoutdeArcMap.

HagaclickenelvalorVIIIdelcampoDIST_SENAT.
Encojaelanchodelacolumna,haciendodragenelmango(handle)derechodelacaja.
ArrastreeltodoelcampohastaponerlomscercadelcampoDIST_NOMB,como
apareceenlafiguraabajo. Hagalomismoconlascabeceras.

Arrastrelosdemscamposhacialaizquierdaparaacercarlosalosdems
Modifiquelascabeceras(headings)deloscampos,ponindolesnombresms
explicativos.Hagaclickencadaheadingymodifiqueelnombreusandoestafigura:

Paraterminar,encojaeltamaodelaslneashorizontales,arrastrndolashaciala
izquierda,demodoquecuadrenconelltimoheading(%Participacin)

93

Eliminelafechadelinformeybajeelttulounpocomsabajo.

Borreelnmerodepginaylalneaalfinaldelapgina.
Yaestlistoparaexportar
VayaaFile|Export.
EnlacajaExport,escojaenFormat:RichTextFormat
en Destination,escojaApplication.
Estepuntodependedelaconfiguracindealgnprogramaqueestprogramadoparaabrirarchivosrtf.Porlo
regularseescojeMicrosoftOffice.
Deotramanera,esposibleexportarelinformedirectamenteaunarchivortf.Puedehacerlousandoelnombre
informeDistritoSenatorial.rtfyguardarloenC:\ArcTrain\Electoral.

En ExportOptionsescojaAll
PresioneOK.EstolellevaraMSWordyaparecerelInforme.
EnWord,cambielosmrgenesdelapgina,reducindoloshastaeltamaodelanchodel
informe,arrastrandolasbarras.

Hagalomismo,reduciendohaciaabajoelmargendelladoizquierdo.
EstandoanenWord,hagaSelectAlly Copy
VayaaArcMapyhagaPaste.

94
EnArcMap,tratedeacomodarelinformedentrodelLayoutenlaesquinasuperior
derecha.Alineandoconlagrficainferioryagrandandooachicandoelinformesegn
seanecesario.

Estoconcluyelasegundapartedeesteejerciciosobretablasdeatributoseinformesy
grficas.

95

O|G|P

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

Ejercicio VI: Entrada de datos y modificacin


(EditingData)

OFICINADEGERENCIAYPRESUPUESTODELESTADOLIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

97
Introduccin:
EnesteejerciciopracticaremosusandovariasdelasherramientasquetienedisponibleArcMap
paralaentradadedatosgeogrficos(geomtricos)einformacin tabular(textoonmeros).
Engeneral,ArcMappuedemodificarunaomscapas(layers),siempreycuandoexistandentro
delmismodirectorioenelcasodeshapefiles.Porsuparte,enlasGeoDataBases(GDB),
solamentesepuedehacercambiosafeatureclassesqueestncontenidasdentrodelamisma
GDB.LascoberturasArcInfo,aunquesiguenusndoseparavisualizacinyanlisis,yano
puedensermodificadasdesdeArcMapenlaversin9.Parapropsitosdeesteejercicio,
solamenteusaremoslosfeatureclassesdeunaGDB.
Losdatosparaesteejerciciosonimitacionesdedivisionesparcelariasyuncentrodeva,ambos
derivadosdeunaortofotode2004conresolucinespacialdeunmetro,ubicadasobreelrea
nordestedeBarceloneta.Contalnivelderesolucin,ladivisinparcelariaesparafines
ilustrativos.Unmapaparcelariomsrigurosorequiereinformacindemedidastopogrficasen
elcampoomtodosfotogramtricosconfotosdealtaresolucin(1/8 odemetroporpxel)y
mayorexactitud.
Tareas:
Primeraparte:Modificacindegeometra
AbrirelEditorToolbarycomenzarunasesindemodificacin.
Seleccionarymoverunobjeto
Girarorotarunobjeto
Especificarnumricamenteelnguloderotacin
Mover,borraryaadirvrtices
Borrarunobjeto
Crearunpolgono(rea)usandoelSketchtool
AadirotrosobjetosusandoopcionesdelSketchtool
Usodeherramientasvariadas(multiplesketchtools)
GenerarunfeatureclassnuevousandoArcCatalog
Entrarinformacinalnuevofeatureclass
Segundaparte:Entradaymodificacindeatributosenlatabla
Aadiruncampoenlatabladeatributos
UsarlacalculadoradecolumnasFieldCalculator
Escribirunaexpresinparacalcular
Seleccionarobjetosparainspeccionarvaloresenlatabla
Asignarvaloresaobjetos
Copiarypegarvaloresenlatabla(copy&paste)
Algunasconsideraciones:modificarfeatureclassesdepolgonos(rea)

98
Abrir el Editor Toolbar y comenzar una sesin de modificacin
PrimerodebemosabrirunasesindelprogramaArcMap. Paraesteejerciciousaremosuna
sesinprehechaenlacualpodremoshacerlasmodificacionesparapracticar.
AbraunasesindeArcMaphaciendodobleclickeneliconodeArcMap
estarpresenteensudesktopoen Start|Programs|ArcGIS|ArcMap.

quepuede

Useelmenprincipal File|OpenybusqueelmapdocumentllamadoExer_6.mxd,
localizadoen C:\ArcTrain\Exer_6.
Aparecerntreceparcelasyunalnearepresentandouncentrodevaadyacenteallado
oestedeestasparcelas,enelMunicipiodeBarceloneta.
Parapoderhacercambiosalosfeatureclassesdebeabrirunasesindemodificacin
(editing).Localiceel Editortoolbar.
Estepuedeserencontradomedianteelmenprincipalen View|Toolbars,yhaga
checken Editor.
Presionandoelbotn

paraactivarel EditorToolbar

Deotramanera,puedehacerrightclick encualquierpartedelmenolostoolbarsy
activarel EditorToolbar.

Enel EditorToolbar,hagaclicken EditoryescojaStartEditing.

Unavezactivadalasesindeedicin,seleccioneelfeatureclassquevaamodificar.Eneste
caso,usaremosprimeroelfeatureclassParcelas:
VayaaTargetyescojaParcelasenel menpulldown

99

Seleccionar y mover un objeto


Presioneelbotn
objetos.

enel EditorToolbar paraquepuedahacerlaseleccinde

Seleccionelaparcelainferioralaextremaderecha,haciendoclickenella.

Laparcelaoreaseleccionadacambiarelcolordesusbordesaazulbrillante.
Tambinmostrarunaxenelcentrolacualdenotaloquesellamael Selection
Anchor.
Paramoverlaparcelaacualquierparte,hagaclickydejandoelbotnizquierdoabajo,
arrastreelrealevementehacialaderecha.

100
Girar o rotar un objeto:
Conesteobjeto(parcela)seleccionado,presioneelbotn

Rotate.

Procedaahacergirarlaparcela,dejndoabajoelbotnizquierdodelmouseysoltando
cuandoencuentreelngulodeseado.
PuedeusarelmismobotnparadesplazarelSelectionAnchor(ancladeseleccin). Ubquese
exactamenteencimadelanclahastaquecambieelsmboloXaotrocomounaestrella*. Muvaloy
vuelvaahacergirarelrea.Notecmoelobjetosemoveralrededordeesta ancla.
**EncualquiermomentopuedeusarelbotnUndo ousarctrl+z(ambosalavez),paracancelar
cualquiermodificacinreciente.**

Especificar numricamente el ngulo de rotacin:


Mantengalaparcelaseleccionadayelbotn
teclado.Aparecerlasiguientecaja

activado.PresionelateclaAenel
.

Escribaelnguloderotacinde45gradosy presioneenter8 .

101
Mover, borrar y aadir vrtices:
Presioneelbotn
enel EditorToolbaryhagadobleclickalamismaparcela
seleccionadaymodificadaanteriormente.Laparcelamostrarlosvrticesque
componensuforma.Elvrticerojoeselorigenovrticecero(0).

Hagaclickenelvrticemsalaizquierdaymuvalocomoleparezca.Vercmopuede
cambiarlaformadelobjeto.
Paraborrarcualquiervrticedeunobjetoseleccionado,hagarightclickexactamente
encimadelyescojaDeleteVertex enelpopupmenu.

Paraaadirunvrtice,ubqueseenelbordedelobjetoyenellugardeseado,hagaright
clickparaactivarelpopupmenuyescojaInsertVertex.
ParavalidaroterminarloscambiosdeberusarlateclaF2ohacerdobleclickfueradel
polgonoseleccionado.
Canceleloscambios.Usectrl.+z.

Borrar un objeto:
Seleccionelaparcelaalacualacabadehacerloscambios.
PresionelateclaDelete,oelbotn
Estosbotonespuedenusarseparadistintasoperaciones,comopor
ejemplo,copiarobjetosypegarlos(copy&paste)entredistintoslayersqueestnenla
mismasesindemodificaciones(EditSession).

102
Paraguardarloscambios,vayaal EditorToolbar ypresioneEditor|SaveEdits.

Crear un polgono (rea) usando el Sketch tool


Aadiremosunaparcelaencadabloque.Primeroutilizaremoslasopcionesdel Snap
Environmentparaasegurarquelasmodificacionessepeguenalasparcelasexistentes.
PresioneEditor enel EditorToolbaryescojaSnapping.
Verlasiguienteforma,enlacualsedefineelambientesnapping.Elmismoseutiliza
paraescogeraculeslayersofeatureclassessepegarnlasmodificacionesyobjetos
nuevos.Elorden,determinalaprioridad,porejemplo,acullayersepegaraprimero
unnuevoobjetooalgunamodificacin.
Sepuedeescogerpegarsesolamentealosvrtices,alosbordesoalosextremos
(endpoints)oatodos.
LaparteEditSketchesparaespecificarsiqueremosquelosnuevosobjetossepeguena
smismos(vrtices,edges),ademsdeespecificarquesedibujeperpendicularmente
(ngulosrectos).
PorelmomentonoveremoslaparteRasterniTopologyElements.Bastadecirque
Rasterserefiereaimgenesodatosmatricialesylamaneraenquesepegarnlos
nuevosobjetosalrsterincluido.
TopologyElementstratasobreuntemamsavanzadoenelcualsepuedemodificar
mltiplescapasparaasegurarrelacionestopolgicasyreglasdecomportamientopre
definidasentreellas.

103
ParalosqueusanArcGISArcView,estacapacidadeslimitada.

Haremoscheckenlacajavertex,delfeatureclassParcelas.
ArrastreelfeatureclassParcelasyllveloalprimerlugar.
EnlaparteEditSketch,hagachecksolamenteen Editsketchverticesyen Editsketch
edges.
CierrelaformaSnappingEnvironmentpresionandoel botn

Ahoraespecificaremosladistanciaoumbraldetoleranciaparapegarlosobjetos.
Elconceptodetoleranciapuedeverseanlogamenteauncrculocuyocentroesel
vrticeopunto.Todoelementoqueestdentrodelradiodeestecrculocaer
dentrodelatoleranciaytenderapegarsealvecinoprximo.
EnArcMap,mientraselbotn Sketchtool ensusvariedadesestactivado,
puedepulsarlateclaTysepresentaruncrculorepresentandoladistanciade
tolerancia.

104
Paraespecificarlatoleranciahagaclicken Editor |Options ypresioneeltab General.
En Snappingtoleranceescriba10ydejelaopcin pixels(unidadesderesolucindel
monitor).Estoharquelatoleranciadependadelaescala(niveldeacercamiento).
En StickyMovetoleranceescriba10.
Stickymovetoleranceayudaaquenomovamosobjetosaccidentalmente.Estamos
especificandoqueparapodermoverunobjetodelugar,tenemosquemoverlomsde
10pxels.

Streammodeserefiereadigitalizardemaneracontinua.Latoleranciaespara
especificarladistanciaentrecadavrticequecomponeelsketch.
Dejelaopcinencero(0).
Group serefiereacuntosvrticesseagrupancomounconjuntoparaoperacionesde
cancelacin(undo).Elvalor50dicequeborrarlosltimos50vrticesque
componganelsketch.
PresioneOK.
Ahorapodemosprocederaaadirlasparcelasquefaltanenlosdosbloques.Usaremosla
tarea(task) AutoCompletePolygon,porquenospermiteobviarlosbordescompartidosal
digitalizar.Deestamaneranosahorramostiempoyfrustraciones.
En Task:seleccionedelalistaaAutoCompletePolygon.
En Target:seleccioneParcelascomoelfeatureclassamodificar.
Presioneelbotn Sketchtool

paracomenzarahacerlasparcelas.

105
Comienceelprimerpuntoenlaesquinasuperiorderechadelaparceladelbloque
superior.Siespecificlatolerancia,notarqueelcursorsepegaraesaesquina.

Muevaelcursoralbordesuperiordelaparcelaadyacenteyhagarightclick.
X
Hagarightclickaqu

Seactivarunmendecontextoconmltiplesopciones.
Escojalaopcin Parallel.Notarqueelmovimientoserestringedemodoquesolamente
sepodrmoveralineadoconelbordeescogido.

Muevaelcursoraladerechadelprimervrticeyhagarightclick.Escojalaopcin
Length.
Aparecerunacajapequeaendondeseespecificarladistancia.Lasunidadeseneste
featureclassestndefinidasenmetros. Escriba12.5.
PresioneEnter8 cuandoterminedeescribir.Elvrticeseposicionarenladistancia
especificada.
Parahacerelprximobordeyparaqueaparezcaalineado,ubqueseencimadelbordede
laparcelaadyacente.

106

Hagarightclickaqu

HagarightclickenelbordedeestaparcelaadyacenteyescojaParallel.Otravez,ver
queelmovimientoserestringe,alineadoconelbordederechodelaparcelaadyacente.
HagarightclickotravezyseleccioneLength.Enlacajaescriba27.8.
Paraterminar,muevaelcursorencimadelvrticeinferiorderechodelaparcela
adyacenteyhagadobleclick.TambinpuedeusarlateclaF2paraterminaroright
clickyescogerFinishSketch.

Estedeberserelresultado:unreanuevarepresentandounaparcela.
Repitaelprocesoparahacerlaparcelaenelbloqueinferior.Deberusar12.5mtsde
anchoy22.5mtsdelargoenlaslongitudes.
Puedecancelarundibujo(sketch)sinterminarusandoCtrl.+Delete.
Alfinalizar,hagaclicken Editor|SaveEdits.

107
Aadir otros objetos usando opciones del Sketch tool:
Enestaparteaadiremosunaseccindeuncentrodevaparalaparcelacinexistente.Lalnea
negradenorteasurrepresentaunacalleexistenteysenecesitadibujarunalnea(centrodecalle)
queconecteconestava.
Paraprepararnos, debemosespecificarelfeatureclassalquevamosaaadirelobjetoyel
mtodo(task)queusaremos.
Prepareelambienteparadigitalizar,especificando:
Task:CreateNewFeature
Target:CenterLine(esteeselfeatureclassquerecibirlaslneas)
VayaaEditor|Snappingyhagachecken Vertexy EdgeenellayerCenterLines.
MuevaellayerCenterLinesalprimerlugar,arrastrndoloporencimadeParcelas.
En EditSketch,hagachecken Editsketchverticesyen Editsketchedges.
Cierreel SnappingEnvironment.
Ahoraesttodolistoparaaadirelcentrodecallequefalta.Comenzaremosdesdeelpunto
mediodelacalleexistente,perpendicularaestaymedir95metrosdelongitud.
Presioneelbotn SketchTool

Muevaelcursorencimadelacalleexistenteyhagarightclickparaactivarelmende
contexto.
EscojaSnaptoFeature|Midpoint.
Elprimerpuntodelanuevalneasepegaralpuntomediodelalneaexistente.
Mantengaelcursorencimadelacalleexistenteyhagaotrorightclick.
EscojaPerpendicular.
Noseubiqueencimadelpuntoqueacabdehacer.Estolollevaraotromende
contexto.
Siporalgunaraznseequivoc,puedeusarlateclaEscyvolveraintentarlo.
Ahoraquetieneelmovimientorestringidoendireccinperpendicularalalnea,presione
lasteclascrtl+Lalavez
opuedeusarrightclick|Length
Enlacajaqueaparecer,escriba95ypresioneenter8 .
PresioneF2paraterminarlalnea
orightclick|Finishsketch.

108

Uso de herramientas variadas (multiple sketch tools):


Acontinuacinsepresentanlasotrasherramientasdisponiblesparadigitalizar.
Sketch

Arc

Midpoint

Tangent

DistanceDistance

Trace

Intersection
EndpointArc
DirectionDistance

Intersectionsirveparabuscarlainterseccinentredosbordes.Estilparacomenzarpuntos
alineadosabordesexistentes.
Archacesegmentosdearcoscirculares.
Midpointponeunvrticeenelpuntomedioentredoslocalizacionesespecificadasporel
digitalizadorousuariodelprograma.
Endpointarcpreparaunarcocircularconradiomodificable.
Tangenthaceunarcocircularbasadoenelsketchqueseestdibujando.
DistanceDistanceproducedoslugaresposiblesparaubicarunvrtice,apartirdelainterseccin
dedoscrculosdibujadosdesdedospuntosconocidos.
DirectionDistancepermiteaadirunvrticepartiendodeunnguloydistancia.
Tracesirveparadigitalizarporencimadebordesdeobjetosseleccionados,repitiendo
exactamentesugeometra.Estilparacopiargeometrasdeotroslayerssintenerquecopiarlos
fsicamentedentrodellayeramodificarse(targetlayer).
Paraestaparte,haremosunaparcelautilizandolaherramientaDistanceDistance(abasededos
distancias).Laparcelaserestablecidaapartirde16.4metrosdedistanciadelaesquina
superiorderechadelaltimaparcela(aleste)delbloquesur.Laotradistanciaespecificadaes
11metrosapartirdelaesquinainferiorderechadelaltimaparcela(aleste)delbloquenorte.

109

Volvamosal SnappingEnvironment.HagacheckenvertexenellayerParcelas.
ArrastreaParcelasalprimerlugar.(Editor|Snapping)
Hagauncheck enlasopcionesexistentes(vertexyedge)delfeatureclassCenterLines.
CierrelaformaSnappingEnvironment.
En Target,escojaParcelas.
En Task,escojaCreateNewFeature.
AbralasopcionesdeSketch

yescojaDistanceDistance

Hagaclickenlaesquinanordestedelaltimaparcela(deoesteaeste)delbloquesur.

110
PresionelateclaD.Escriba16.4ypresioneenter 8
Aparecerelprimercrculo.

Hagaclickenlaesquinainferiorderechadelaltimaparcela(deizquierdaaderecha)del
bloquenorte.

PresionelateclaDotravez,yescriba11enlacajaDistance.
Aparecerelsegundocrculo.Unadeestasinterseccionesserelpuntoqueseusar
paraponerelvrticedeinicio.

Aadaelprimervrtice,haciendoclickenelpuntoqueapareceenlainterseccin
derechadeloscrculos,comoestenlagrficaarriba.

111

Unavezaadidoelprimervrtice,expandalasopcionesdelSketchToolbar

y Presioneel botn

Ubqueseencimadelbordederechodelaltimaparceladelbloquenorte.
HagarightclickyescojaParallel.
Ahoraquetieneelmovimientorestringido,muvasealladoderechodelanuevaparcela
y hagaotrorightclickyescojaLength.
Escriba27.5enlacajaLength.Presioneenter8 .
Muvaseencimadelbordesuperiordelaltimaparceladelbloquenorte.
HagarightclickyescojaParallel.
Conelmovimientorestringido,vuelvaahacerrightclickyescojaLength.
Escriba12.5ypresioneenter.
Ubqueseenelbordederechodelaltimaparceladelbloquenorte.
HagarightclickyescojaParallel.
HagaotrorightclickyescojaSquareandFinishparaterminarlaparcela.

Paraguardarloscambios,vayaaEditor|SaveEdits.
Cerraremosestasesindemodificacin.MuvaseotravezaEditoryescojaStop
Editing.

112

Guardeelmapdocument.Vayaalmenprincipal,escojaFile|Save,
opresioneel botn .
CierretambinestasesindeArcMapparapasaralaprximaparte.
UsaremosArcCatalogyesnecesariocerrarArcMap.

Generar un feature class nuevo usando ArcCatalog:


Enestaparte,vamosahacerunfeatureclassdegeometrapuntual.Esterepresentarla
localizacindebocasdeincendioenestazona.
AbraunasesindeArcCatalog.VayaaStart|Programs|ArcGIS|ArcCatalog.
ohagadobleclickeneliconodeArcCatalogensudesktop.
NaveguehastaencontrareldirectorioC:\ArcTrain\Exer_6.
HagadobleclickenlaGeoDataBaseExer_6.mdb.
Presioneeltab Contents.
Hagarightclickenelreadondeestlalistadefeatureclassesoencimadelnombrede
laGDBExer_6.mdb.
EnelmendecontextoescojaNew|FeatureClass.
AparecerlaformaNewFeatureClass
En Name:escribaHidrantes.
En Alias:escribaBocasdeIncendio.
PresioneNext.
EnSpecifythedatabasestorageconfiguration,dejelasopcionescomoestn(Default).
PresioneNext.
Laprximaventanaseusaparainspeccionarymodificarlaestructuradelatabla:
aadiroeliminarcampos.
EnlacolumnaFieldName,hagaclicken SHAPE.
Definiremoseltipooniveldegeometra.Enestecasolasbocasdeincendioserepresentarn
comopuntos.
En FieldProperties,vayaaGeometryTypey enlacajaderechasiguienteescojaPoint.

113
Necesitamosdefinirelsistemadereferenciayextensingeogrfica.Paraestospropsitos
usaremoscomoplantilla(template)unfeatureclassexistentedelamismarea.
HagaclickenSpatialReference.
Presioneelbotn

alladoderechodelapalabraUnknown.

EnlaventanaSpatialReferenceProperties,presioneelbotn Import.
Escojaelfeatureclassparcels,localizadoen C:\ArcTrain\Exer_6\Exer_6.mdbcomo
fuente.
PresioneAddyluegoApplyy OK.

NouseelbotnImport.Estebotnseusaparacopiarlaestructuradeatributosdeotro
featureclassotablaexistente.
PresioneFinish.Notarqueseaadielnuevofeatureclassdepuntos Hidrantes.

YaestamoslistosparadigitalizarlasbocasdeincendiousandoArcMap.
CierrelasesindeArcCatalogcon File|Exit.

114
Entrar informacin al nuevo feature class:
Paracomenzar,abraunasesindeArcMap.
EscojaelarchivoExer_6.mxddelalistadearchivosrecientesonaveguehastaencontrar
elarchivoen C:\ArcTrain\Exer_6.
CuandoArcMapterminedeabrirelmapdocumentExer_6.mxd,presioneelbotn Add
Data

AadaelfeatureclassHidrantes.HagaclickenelnombreHidrantesypresioneel
botn Add.
AparecereneltopedelalistaporqueArcMapautomticamentecolocaloslayersde
puntosporencimadelneasyreas.Elordenautomticoesanotaciones,puntos,
lneas,reas,rasters.
ImaginemosquelasbocasdeincendiofueronpreviamentelocalizadosmedianteGPS.No
tenemoselarchivodigitalperotenemosunalistaimpresaconlascoordenadas.Lascoordenadas
estnreferidasalmismosistemadereferenciaespacialdeestosfeatureclasses.Usaremosla
opcin AbsoluteX,Yparaentrarlalocalizacinenelmapa.
Enel EditorToolbar presioneEditor|StartEditing.
En TargetescojaBocasdeIncendi.
En Task escojaCreateNewFeature.
Presioneelbotn Sketch.
HagarightclickencualquierlugardelDataView(dondeapareceelmapaconloslayers).
SeleccioneAbsoluteX,Y.
AparecerlacajaAbsoluteX,Y:
Escriba188898y 269310enestemismoordeny presioneenter8 .
EstassonlascoordenadasX,Ydelabocadeincendios. Noescribacomas.Estohar
queelpuntonoseregistre.

115

Elpuntoquedregistradoenlaesquinasuroestedelaprimeraparceladelbloquenorte.
HagaotrorightclickenotrapartedelDataView.
EscojaAbsoluteX,Y.Escribaenlacaja188993y 269297enesteorden.
PresioneEnter8 .

Lasegundabocadeincendioseregistrarenestaposicin.
Vayaal EditorToolbar,presioneEditory SaveEdits.
CierrelasesindemodificacinhaciendoclickenEditor|StopEditing.
Estoconcluyelaprimerapartedeesteejercicio.

116

Segunda parte:
Entrada y modificacin de atributos en la tabla
Aadiruncampoenlatabladeatributos
UsarlacalculadoradecolumnasFieldCalculator
Escribirunaexpresinparacalcular
Seleccionarobjetosparainspeccionarvaloresenlatabla
Asignarvaloresaobjetos
Copiarypegarvaloresenlatabla(copy&paste)
Algunasconsideraciones:modificarfeatureclassesdepolgonos(rea)
Aadir un campo en la tabla de atributos:
Enmuchasocasionesnecesitamosaadircamposquepuedenseronopermanentes.
Afortunadamente,noesnecesariovolveraArcCatalogparaaadiroquitarcampos.Usaremos
ArcMapparaaadiruncampomsalatabladeatributosdelfeatureclassParcelas.
Aclaramosquesihubiesesidonecesarioasignarleunalistadeposiblesvaloresauncampoen
particular(Domain),entoncestendramosqueusarArcCatalog.
Aadiremosuncamponuevoenlatabladondeguardaremosel valordelterreno,tomadode
valoresficticios(150dlarespormetrocuadrado).
SeguiremosusandoelmapdocumentExer_6.mxd.Sinoestactivaestedocumento
abraunasesindeArcMapyespecifiqueExer_6.mxd.
Vayaalatabladecontenidoalaizquierda,dondeestlalistadelayersyhagarightclick
en Parcelas.
EscojaOpenAttributeTable.
Aparecerlasiguientetabla:

Paraaadiruncampo,presioneelbotn OptionsyescojaAddField.
AparecerlaformaAddField.
EnlaformaAddField,escribaLandValueen Name:.(nodejeespaciosentrepalabras).

117
En Type:escojaLongInteger.(Proveeespacionumricoparavaloresmayoresdeun
billn.)

DejelasdemsopcionescomoestnypresioneOK.
Latablacontendrelnuevocampo:

Usar la calculadora de columnas Field Calculator:


Usaremosunaexpresinmatemticasimpleparacalcularelvalordelterreno.
Asegresequenohayparcelasseleccionadasdeantemano.
VayaaOptionsyescojaClearSelection.
HagarightclickencimadelnombredelcampoLandValue.
EscojaCalculateValues.

118
Aparecerelmensajesiguiente:

Comonoestamosenunasesinabiertademodificacin,ArcMapnosavisaquenohay
maneradecancelarestaoperacin.Detodosmodos,podemosvolveracalcularlo
mismosinosequivocamos.
PresioneYes.
EscribalaexpresinmatemticaenlacajadetextoqueproveelaformaField
Calculator.
HagadobleclickenelnombredelcampoSHAPE_Area
Hagaclickenelbotn * (paramultiplicar)aladerecha
Escriba150
Suformadeberverseas:

PresioneOK.
Notarquehaydistintosvaloressegnelreadecadaparcela.

Seleccionar objetos para inspeccionar valores en la tabla:


Paraestaparte,necesitaremosabrirlasesin demodificacin.
Vayaal EditorToolbarypresioneEditor|StartEditing.
SiabrelatabladeatributosdeParcelasnotarqueloscamposLandUsey LandValue
tienensuscabecerasconfondoblanco.Significaquepuedehacercambiosy
cancelarlos.

119

Ellpizalladoderechodelbotn Optionsleindicaademsqueestenmodode
modificacin.

VayaalEditToolbarypresioneelbotn

paraseleccionarobjetos.

Pasemosal DataViewyescojamosestasdosparcelas.
PresionelateclaShiftyhagaclickencadaunadeellas:

Presioneelbotn Attributes
enlatabla.

paraexplorarypodermodificarlosvaloresindividuales

Unainspeccinrecienteenelrea,demostrqueestasprimerasdosparcelastuvieroncambios
recientesensuusoprincipal.Ahoralasviviendascontienentiendasaldetal.Usaremosunalista
disponibledeusosparahacerlaactualizacinenelmapa.
Posteriormentetendremosqueajustarelvalordeestasparcelasparapropsitosdetasacin.
EnlaformaAttributesinspeccionelosvaloresdeloscamposencadaparcela.
AmbastienenusoResidencialunifamiliar.

120

HagaclickdebajodelacolumnaValuealladoderechodeLandUse.
Entrelalistadisponiblequeaparecer,seleccioneResidenciaconotratiendaaldetal.
Sinopuedeverladescripcincompleta,estirelacolumnaValuearrastrandoelfilo
derechodelacabecera.

Copiar y pegar valores en la tabla (copy & paste):


Hagarightclickencimadel +4debajodeParcelas,alladoizquierdodelaforma
Attributes.
EscojaCopy.
Hagarightclickencimadel +14yhagaPaste.
*NotequetambincambielvalororiginaldeLandValueylocopiexactamente
comolaparcela4.Enestecasonoimporta,porquetendremosquecalcularlosvalores
otravezdebidoalcambioenusodeterrenoenestasdosparcelas.*
Parafinalizar,haremoselajusteporcambiodeuso.UsaremoselFieldCalculatorpara
multiplicar150dlarespormetrocuadradoy aadiendounatasade25%adicionalporeluso
comercial.
Mantengalasdosparcelasseleccionadas.
AbralatabladeatributosdelfeatureclassParcelas.(rightclickenParcelasyOpen
AttributeTable).

121
HagarightclickenlacabeceradelcampoLandValue.
EscojaCalculateValues.
Escribalasiguenteexpresin:
[SHAPE_Area]*150*1.25
PresioneOK.
Inspeccionelatablaparacorroborarquelosvalorescambiarona68599enlaparcela4y
55155enlaparcela14.
Guardeloscambios.VayaaEditor|SaveEdits.
Cierrelasesindeedicinhaciendoclicken Editoryen StopEditing.
EstoconcluyelasegundapartedelejercicioVI.
Algunas consideraciones: modificar feature classes de polgonos
EnocasionespuedeserbastantetediosomodificarpolgonosenArcMap9ancontodaslas
herramientasdisponibles.Cuandotenemosarchivoscomplicadosconmuchospolgonos,pueden
ocurrirsorpresasdesagradables.Lasherramientasnosiempretrabajandelamaneraesperada.
EstoserroressondetipogeomtricoyestnvinculadosprobablementeacmoArcMapmaneja
laprecisin olatoleranciadelosvaloresdelascoordenadas.Notengomuy clarocmoArcMap
definelatoleranciaenmododemodificacin,peroestassituacionesnoocurrencuandose
trabajaconcoberturasArc/Info.
Hayquerecordarqueadiferenciadelascoberturascontopologaexplcita,losshapefilesy
featureclassesdeunaGDBrepitenlosbordescomunesencadapolgono.
Elefectoesquepuedenocurrirespaciosabiertos(gaps)ysolapenodeseadodepolgonos.
Existenaplicacionesdeterceros(thirdpartydevelopers)quetratandecorregirestosproblemas
enloqueESRI resuelveestosasuntos.Otrosprogramascomo,resuelvenesteproblemacuando
seespecificaunvalordetoleranciamayor,haciendoquelosvrticescercanoscolapsen,yse
eliminalainformacinredundante,peroenhonoralaverdad,estosotrosprogramastambin
generanestetipodeerrores.
Recomendacin:guardesusesindemodificacinconstantemente.Save,save,save.Puede
tambinbuscarsolucionesdeprogramasfueradeESRI,disponiblesenlaInternet.

122

O|G|P

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

Ejercicio VII: Georreferenciacin

OFICINADEGERENCIAYPRESUPUESTODELESTADOLIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

124

Introduccin:
Enesteejercicio,veremoscmolasproyeccionescartogrficasylossistemasdecoordenadas
cambianciertaspropiedadesdelosmapas.Entreestaspropiedadesestnlasdistorsionesenrea
otamaos,forma,distanciaydireccin.
LosshapefilesparaestaprimeraparteprovienendelDepartamentodeGeografadela
UniversidaddeIdaho:http://giscenter.isu.edu/data/index.htm.
Enlapartefinal,practicaremoscmohacerreproyecciones,cambiarsistemasdecoordenadasy
transformacionesdedatumscondatosdePuertoRico.
Visualizacindedistorsionesporcambiosdeproyeccin.
Cambiodesistemadecoordenadas:transformacindedatumPuertoRico1940aNorth
AmericanDatum1983yHARN.

Visualizacin de distorsiones por cambios de proyeccin


Parapodercomprendermejorcmoafectanloscambiosdeproyeccincartogrficaalos
archivosgeogrficos,esmejorusardatosanivelmundial.Loscambiossonmsdramticosy
tambintomanmstiempoparaprocesar.Antiguamenteestaeraunatareaarduaytediosa,que
podatomardas.
AbraunasesindeArcMap.BusqueelmapdocumentllamadoExer_7a.mxdlocalizado
en C:\ArcTrain\Georef.
EnelDataViewaparecernfeatureclassesdeciudades,fronterasdelospasesyotro
llamadocrculos,elcualseusarposteriormente.Estecontieneunoscrculosquele
ayudarnluegoavisualizarlasdistorsionesenformasyreas.
EnestemomentoelDataViewnotieneproyeccin.Haremospruebascon varias
proyeccionescartogrficasparavisualizarformasymedirdistancia.

125
Medir distancia:
Enestaparte, fijarsuatencinenlasunidadesdemedicin,tantoplanascomoangulares.Las
distanciassemedirnenmillas.
Paramedirdistancias,primerodebemoscambiarlasunidadesdemedidaangularesa
planas,porejemplo,enmillas.(1milla=1.6km)
MuevaelcursorhastalapalabraLayersenlaTabladeContenido.
HagarightclickyescojaProperties.
EnlaformaDataFrameProperties,presioneeltab General.
En Units,DisplaycambieaMiles(millas).

PresioneOK.
Presionelaherramientademedicin

localizadaenelToolsToolbar.

MidaladistanciadesdeSanJuanhastaCiudaddelCaboenSudfrica,haciendoclicken
lasestrelladeambasciudades.Estamedicinnoesexacta.
Apunteladistancia:_________________________________________
CuandotermineelsegmentopresionelateclaEsc.paradesactivarlaherramienta.
Ahoracambiaremosaunaproyeccinsinusoidal.
HagarightclickenlapalabraLayersenlaTabladeContenido yescojaProperties.
Presioneeltab CoordinateSystem.
En Selectacoordinatesystem,vayaaPredefined|ProjectedCoordinateSystem|
World.

126

Naveguehaciaabajohastaencontrar Sinusoidal(World)yhgaleclickpara
especificarlo.

PresioneOK.
Aparecerelsiguientemensaje:

Hagachecken Dontwarnmeagaininthissession.
Estemensajeesparaavisarlealusuarioquelaproyeccincartogrfica,sistemade
coordenadasoeldatumesdiferentealdeunaomsdesuslayers.
Vuelvaahacerrightclicken Layers,escojaPropertiesypresioneeltab General.
En Units,DisplayescojaMiles.
MidaladistanciadesdeSanJuan hastaCiudaddelCabo.
Apunteladistancia:_________________________________________
CuandotermineelsegmentopresionelateclaEsc.paradesactivarlaherramienta.

127
Distorsin en formas:
Ahoraveremoscmocambianlasformasdelosobjetoscuandocambiamosdeproyeccin.
Usaremoselfeatureclassdecrculosqueestpresenteenlatabladecontenido.
Primero,quitemoslaproyeccinsinusoidal.PongamoselcontenidodelDataViewcomo
estaba.Haciendorightclicken Layers.
Presioneeltab CoordinateSystem.
En Selectacoordinatesystem:,hagaclicken Layers,luegoen Ciudades,y en
GCS_Assumed_Geographic_1.
PresioneOK.
Loslayersvolvernalestadooriginal.
AhorahagacheckenellayerCrculos.Observelaformaoriginal.Todosmidenigual.

Vamosacambiaraunaproyeccincilndrica.
Hagarightclicken LayersyescojaProperties.Presioneeltab CoordinateSystem.
En Selectacoordinatesystem:escojaPredefined,ProjectedCoordinateSystem,
World.

128
Naveguehaciaabajohastaencontrar Mercator(World)

PresioneOK.
Cmocambiaeltamaodeloscrculosenelextremonorteysur?
_______________________________________________________
Probemosconotraproyeccin:
VuelvaaLayers,hagarightclick,escojaProperties.
En Selectacoordinatesystem:,escojaPredefined,ProjectedCoordinateSystems,
World.
Escoja Bonne(World).
PresioneOK.

Cmocambiaeltamaodeloscrculossegnsealejadelalatitudymeridianocero
(0)? ____________________________________________________
CierreestasesindeArcMap.Noesnecesariosalvarelmapdocument.

129
Cambio de sistema de coordenadas:
Transformacin de datum Puerto Rico 1940 a North American Datum 1983 y HARN

Desdefinesdelosaos80,enPuertoRicosehaestadorevisandolareddecontrolesgeodsicos
enelplanovertical.En1986sepubliceldatumNAD83paralazonadePuertoRicoeIslas
Vrgenes.Elnuevodatumconsoliddoszonasysuponeunatraslacindecoordenadas
(shifting)significativa.
En1993estedatum(198386)fuerevisadoyselellamHighAccuracyReferenceNetwork
(HARN).ParaelproyectocatastraldelCentrodeRecaudacindeIngresosMunicipales(CRIM)
en1996,seprodujounarevisindelHARN.
Datum:Marcodereferenciamatemticoenelcualsedefinenlascoordenadasgeogrficasa
partirderepresentacionesmatemticasdelaformaysuperficiedelatierra.Losdatumsson
definidosporagrimensoresespecializadosengeodesia,lacualesunacienciamatemtica
aplicadaaproducirmodelosdelaformadelplaneta.

Eldatumviejo,llamadoPuertoRicoDatum1940esundatumlocal quehatenido
modificacioneshastaelfinaldeladcadadel60.EldatumNAD83esglobal.
Enesteejemplo,haremosunatransformacindedatumentre:
SistemadecoordenadasplanasestatalescondatumPuertoRico1940[StatePlane(alias
NAD27)]yStatePlaneNAD83,zonaPRUSVI.
PrimeroveremoscmoArcMapreproyectademaneratemporeralosfeatureclassesqueestn
usandodiferentessistemasdecoordenadas.Usaremosunejemplodeunshapefiledehidrografa
delcuadrngulotopogrficodeCaboRojo,en elextremosuroestedelpas.
AbraunasesinnuevadeArcMap.EnenstartupdialogespecifiqueAnexistingmap,
Browseformap.
TraigaelmapdocumentllamadoExer_7b.mxd,localizadoen C:\ArcTrain\Georef.
Aparecerunafotografaareadelapuntasur(CaboRojo)delmunicipiodelmismonombre.
Laformadelpromontoriosedebeadepsitossedimentarios(tmbolos).
Verificaremosquelafototienereferenciageogrficadocumentada:
Hagarightclickenellayerdelafotografaareacb_subdoq.tify escojaProperties.
Presioneeltab Sourceynaveguehaciaabajohastaquevealapartequedescribeel
sistemadereferenciageogrfica.

130

Notarquelafotografaareaestreferenciadaalsistemadecoordenadasplanas
estatales,zonadePuertoRicoeIslasVrgenesyeldatumesNAD83.
Launidaddemedidaeselmetroysucesivamentemostrarotrosdetalles.
PresioneOK.
Presioneelbotn Adddata
enel Standardtoolbarybusqueelshapefilellamado
cb_hydspc40.shp,queestlocalizadoen C:\ArcTrain\Georef\Cabo_Rojo.
Aparecerlasiguientepantalla:

Estapantallaleadviertequeelsistemadecoordenadasdelshapefilequevaaaadir
estreferenciadoaunsistemadecoordenadas,proyeccinodatumdiferentealqueest
usandoelDataView.
PresioneOK.
Aparecerellayerdehidrografa,ysihaceunacercamientonotarquelascapasnosesolapan
exactamente.

131

ArcMaphacereproyeccintemporeraontheflyperonecesitaqueelusuarioespecifiquecul
serlatransformacinmatemticaentremuchasquehayparadiferenteslugares.
Paraarreglarestedesplazamiento,deberespecificarculserelalgoritmode
transformacinentredatums.Recuerdequeel DataViewestreferenciadoaState
PlaneNAD83acausadelafotoarea.
HagarightclickenlapalabraLayersenlaTabladecontenido,alladoizquierdo.
Presioneeltab CoordinateSystemypresioneelbotn Transformations
AparecerlaformaGeographicalCoordinateSystemTransformations.
En Convertfrom:,asegresequeestactivado(enazuloscuro)laopcin
GCS_North_American_1927.
En into:, GCS_North_American_1983.

132
En Using:,busqueenlalistayescojaNAD1927_To_NAD1983_PR_VI.

PresioneOKenestaformay
PresioneOKenlaformaDataViewProperties.
Ahoraverquelosdoslayersestnalineados.

133
Reproyectar permanentemente un shapefile:
Esrecomendablequetodassuscapasdeinformacinestnreferenciadasalmismosistemade
coordenadasparaoptimizarelfuncionamientodeArcMap. Podrvisualizarmsrpidoyno
recibirmensajesdeerrorodeadvertenciacuandohagaoperacionesdeanlisisgeogrfico.
UsaremoslainterfazArcToolboxincluidaenlaaplicacinArcMapdesdelaversin9.0.Esta
contienetodaslasherramientasdemanejoyanlisisgeogrficoqueaumentanennmerosegn
laversinqueustedhayaadquirido(ArcView,ArcEditoroArcInfo).
PresioneelbotnparaactivarArcToolbox
AparecerlaventanadeArctoolbox:

Enestaventanapresioneelsigno+
andTransformations|Feature.
Hagadobleclicken Project
AparecerlaformaProject.

localizadoenelStandardtoolbar.

en DataManagementTools yen Projections

134

En InputDatasetorFeatureClass,hagaclickenelbotn
layersdisponibles.

paraactivarlalistade

Escojaellayerdisponiblecb_hydspc40.
En OutputDatasetorFeatureClass,useelbotnbrowse,naveguehasta
C:\ArcTrain\Georef\Cabo_Rojo.Allescribaelnombredelnuevoshapefile:
cb_hyd.shp.
En OutputCoordinateSystem,presioneelbotn
coordenadasdestino.Aparecerlaforma:

paraescogerelsistemade

Presioneelbotn Select.
EscojaProjectedCoordinateSystems|StatePlane|NAD1983 ynaveguehasta
encontrarelarchivocorrespondientealazonadePuertoRicoeIslasVrgenes:
NAD1983StatePlanePuertoRicoVirginIslandsFIPS5200.prj
Hagaclickenelnombredeestearchivoypresioneelbotn Add.
AparecerlaformaSpatialReferencePropertiesconlainformacinsobreelsistema

135
decoordenadasescogidoparaeloutput.

PresioneOK.
En GeographicTransformation(Optional),useelbotn paraescogerelalgoritmo
detransformacincorrespondienteentrePR40yNAD83.Escojalaopcin
NAD_1927_To_NAD_1983_PR_VI:

Seaadirestaopcinenlalistaabajo.
PresioneOK.Aparecerunacajadedilogoquelemostrareltranscursodelproceso.

136
PresioneCloseenestaformadeprogreso.
Aparecerelshapefiletransformado(cb_hyd.shp)enlatabladecontenidoy
correctamenteposicionadoencimadelafotografaareaenelDataview.

Especificar un sistema de coordenadas a un shapefile:


Enmuchasocasiones,recibimosshapefilesuotrosarchivosquenotieneninformacinsobrecul
eselsistemadereferenciageogrficaquedichoarchivoestreferido.Parasolucionarlo,
podemosusartantoArcToolscomoArcCatalog.Sepuedefijarunsistemadereferenciaa
mltiplesfeatureclassesoshapefilesmedianteunscript.

ParadefinirsistemasdereferenciageogrficaenArcToolbox,useDefineProjection,localizado
en DataManagement,ProjectionsandTransformations.
Hagadobleclicken DefineProjection.
AparecerlaformaDefineProjection:

Presioneelbotnbrowse

paratraerelshapefilesinreferenciageogrfica.

Busqueelarchivocb_hydutm40.shplocalizadoen C:\ArcTrain\Georef\Cabo_Rojo.

137

En CoordinateSystem presioneelbotn
paraactivareldilogoparabsquedade
archivosquedefinenlossistemasdereferenciageogrfica.
Presioneelbotn Select
Hagadobleclicken ProjectedCoordinateSystemsyluegoen UTMyen NAD27.
LocaliceelarchivoquedefinelazonaenqueestelcuadrngulodeCaboRojo.
NAD1927UTMZone19N.prj
PuertoRicoestubicadoentredoszonasUTM:19y20.Lazona20comienzadesdeel
meridiano66E,alladoestedelMunicipiodeSanJuan.
HagaclickenestenombreypresioneAdd.
PresioneOKenlaformaSpatialReferenceProperties.
PresioneOKenlaformaDefineProjection.
Alfinaldeldilogodeprocesos,deberaparecerunaadvertenciaenverdesobreun
conflictoentredatums. Estosedebeaquedefinimoselsistemadelshapefileen
PR1940yArcMaprecibealfinaldelprocesoelshapefileenel DataView,queest
referidoaldatumNAD1983.

TambinpodemosdefinirelsistemadereferenciaespacialenArcCatalog,medianterightclicky
Properties.

138

EneltutorialdelecturasqueselesentregaenelCDconlosdatos,seexplicaademscmohacer
cambiosdedatumdesdeeldatumviejo(PR1940,aliasNAD27)hastaelmsrecienteNAD83
ltimarevisin(HARN).
Parahacerlareproyeccin/cambiodesistemadecoordenadassernecesarioelusodedos
transformaciones:
1.TransformardesdePR1940aNAD83.
2.TransformardesdeNAD83hastaNAD83HARN.

Lastransformacionescorrespondientesseescogendesdeun pulldounmenuenGeographic
Transformation.

Estoconcluyeesteejercicio.

O|G|P

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

Ejercicio VIII: Produccin de mapas

OFICINADEGERENCIAYPRESUPUESTODELESTADOLIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

140
Introduccin:
EnesteejercicioestaremosusandovariasdelasfuncionalidadesdelprogramaArcMappara
producirmapasparaimprimiroparaexportaraotrosformatosgrficos.Hacermapasesun
procesobastanteengorrosoquetomatiempoymuchodetalle,sisehaceaconciencia.
UnodeloslugaresmsinteresantessobreloscualessepuedehacermapaseselBosqueNacional
delCaribe(ElYunque),localizadoenlaSierradeLuquillo,al nordestedePuertoRico.Este
bosque,queocupaactualmenteunreade28milacres,esadministradoporelgobiernofederal
desde1903,atravsdelServiciodeBosquesdelDepartamentodeAgriculturadelosEEUU.
EnelperidicoPuertoRicoHerald(7dejuniode2002)sepublicunartculosobreestebosque:
EselbosquemspequeoqueadministraelSistemaNacionaldeBosques,perotieneelsistemams
diversodetodosyeslareservaforestalmsantiguadelhemisferiooccidental.Elbosquefuecreadoen
1876cuandoelReyAlfonsoXIIdeEspaadesign12,000cuerdas(aproximadamente11,000acres)
paraproteccinperpetua.En1903elbosqueseproclamcomolaReservaForestaldeLuquilloypas
aformarpartedelSistemaNacionaldeBosquesdelosEstadosUnidosbajolaadministracindel
ServicioForestaldelDepartamentodeAgriculturadelosEstadosUnidos.

Haremosentoncesunmapacompuestodetrescuadros:unmapaprincipalmostrandoelreaque
rodeaaestebosqueydoscuadrosmspequeos,representandoprecipitacinanualy
temperaturamnimapromedioanual,respectivamente.Eldiseosermsomenoscomoel
siguiente:
Ttulodelapgina
Ttulo

Ttulo

Escala
Leyenda

Ttulo
Escala
Leyenda

Leyenda

Norte
Escala

Parahaceresteejercicioproveeremosunmapdocumentparcialmentecompletado,demanera
quepermitapracticarconloselementosdeunlayout,aadirescalas,leyendas,textos
explicativosymodificarsuspropiedades.
Ademsellayouttendrdosdataframesconsusrespectivasleyendaspreviamentehechas.De
estamanera,podremospasaraotrosaspectosdelacomposicindelapginayfinalizarms
rpidamente.
AdiferenciadeotrasversionespreviasaArcGIS8,ArcView3.xpodacontenermltiples
Layoutsdentrodeunmismodocumento.EstonoesposibleenArcMapamenosquesehaga
medianteprogramacinadicional.

141

Tareas:
1. AbrirunasesindeArcMapyacomodarlosDataframesenelLayout
2. ElLayoutToolbar
3. AadirlaleyendaaldataframeMapaPrincipal.
4. Modificarlaleyendaluegodehaberlainsertado
5. Hacercambiosglobalesenlaspropiedadesdelasletrasenlaleyenda
6. Escalasgrficas
7. Aadirttulos
8. Incorporarcajasdetextoparaexplicarprocedimientos,yfuentesdedatos
9. Aadirtextocurveadoencimadeundataframe
10. Hacerunaretculaparamostrarlatitudylongitud
11. Aadirorientacin alnorte
12. Prepararlaimpresindellayout
13. Exportarlacomposicindellayoutaotroformato

Abrir una sesin de ArcMap y acomodar los Data frames en el Layout:


ComencemosporabrirunasesindeArcMapyabrirelmapdocumentllamadoExer_8.mxd.
AlabrirArcMap,vayaalmenprincipal:File|Open,naveguedentrodeldirectorio
C:\ArcTrain\CartoyabraelmapdocumentExer8.mxd.
SiapareceeldilogoStartusingArcMapwith,hagaclickenlaopcinAnexisting
map:ypresioneOK.NaveguehastaencontraraExcer8.mxddentrode
C:\ArcTrain\Carto.
EstemapdocumenttienecuatroDataframes[MapaPrincipal,Temperatura,Precipitaciny
Localizacin]loscualesserepresentanenlatabladecontenidodeestamanera:

Ustednotendrqueaadirmsdataframes.
Debidoaltiempoquetomahacerestacomposicin,todo
loquetienequeverconlaadicindelayers,gradaciones
decolor,simbologaencadadataframeesthecho.

Parasuinformacin,losdataframesseaadendesdeelmenprincipalenInsert|DataFrame.

142
AparecerenelDataviewlacomposicinquecorrespondealDataframeMapa
Principal.
AsegresequeelmapaestcentralizadoenelreadelYunqueyquelaescalasea
1:71,773.
Denoseras,puedeiralmenprincipalenView|Bookmarks.
Escojaentonceselbookmarkllamado ElYunqueMapaPrincipal.
CadaDataFramecontieneunbookmarkparacompensarporcualquiermovidao
cambiodeescalaenelcontenidodeldataframe.

ParaentrarenelmodoLayoutView,presioneelbotn
inferiorizquierdadeArcMap.

localizadocercadelaesquina

AparecerelsiguienteLayoutparcialmentehecho:

Estelayoutmide24x36pulgadasyestenformatohorizontal(Landscape).Contiene
cuatroDataframes,untextoparaaadirelnombredelautorydosrectngulosque
sirvencomofondosparalosmapasyparaelttulodelapgina.
Losdataframesestanenmodo Draft,paraquepodamosaprovechareltiempoenlapartedediseo
preliminardelapgina.EnmodoDraftsolamentevemoselbordeynombredeldataframe,loquenos
ahorratiempo,porquenotenemosqueesperaraqueelDataFrameredibuje,cadavezquesea
modificado.

143

Ademsellayoutestpreparadoconlneasgua(guidelines)queasuvezseusarn
parapegarelementosyalinearlosentres,dandounaaparienciadeorganizaciny
coherencia.
AsegresequeademsdelToolsToolbaraparezcael Layouttoolbar,quelepermitir
moverynavegaratravsdeesteLayout.
El Layouttoolbar apareceenelmenprincipalen View|Toolbars|Layout.

DetngaseaverlasleyendasmscercahaciendozoomconlaherramientaZoomIndel
LayoutToolbar.

NoconfundaestaherramientaconelzoomindelToolsToolbar.Amenudosepueden
confundir.
ElZoomindellayouttoolbarhaceacercamientosdentrodelapgina.
ElZoomindelToolstoolbarhaceacercamientosdentrodeldataframeactivo,ycambiarla
escalaycontenidodeestedataframe.

ParanavegartambinpuedeusarelbotnPan

elcualseusaparaarrastrarlapgina.

Fixedzoominesparaacercamientosusandounfactorfijo(2x)
Fixedzoomoutseusaparaalejarseusandounfactorfijo.
Zoomwholepagelellevaavertodalapginaensuextensin.
Zoomto100%lellevaaverlapginaamsomenoscmoseverlacomposicin
dellayoutenelpapelcuandoseimprima.
Gotobackextentlellevaalniveldeacercamientoanterior.
Goforwardtoextentsirveparallevaranivelesdeacercamientoanteriorescuando
sehacendiferentesacercamientos. Estosseguardanenmemoriaypuedenser
recogidosconestebotn.
Tambinpodemosespecificarnumricamenteelporcientodenivelde
acercamiento.
ToggledraftmodecambiaaDraftmodetodosloselementosdellayouty
viceversa.Eldraftmodeseusacuandonecesitamoshacercambiosrpidosyno
queremosquesedespliegueelcontenidodelosdataframes,loscualespuedentardar
bastante,segnsucompliejidad.
Focustodataframehacequepodamosaadirelementostalescomotexto,
grficas,einclusomodificarelcontenidodelosfeatureclassesdentrodeldataframe
activo.

144
Aadir la leyenda al data frame Mapa Principal
Despusdeestaexplicacin,faltahacerlaleyendadeldataframeMapaPrincipal.Estedata
framecontieneunamayorcantidaddelayers:hidrografa,sistemadecarreteras,elevacin,
sombreado,yotrosms. Esposibleintegrartodoslositems(layers)enunasolaleyenda.Sin
embargo,parapropsitosdeenseanzaymanejodelaspropiasleyendas,consideramosqueera
mejordividirlaleyendaenporcionesparaquepuedanseracomodadasmsfcilmentedentro
delespacio,debajodeldataframeMapaPrincipal.
Enestaparteaadiremosloslayersquetienenqueverconelsistemadecarreteras,hidrografa,y
lmitesmunicipales.
HagaclickencimadeldataframeMapaPrincipal.
VayaalmenprincipalyescojaInsert|Legend.
AparecerelLegendwizard.Dejaremossolamentelossiguientestems:
Autopistas
Carreterasprimarias
Carreterassecundarias
Carreterasterciarias
Calles
Lmitesmunicipales
Rosyquebradas
Useelbotn
paraeliminartodoslostems.Seleccionetodoslostemshaciendoshift
yclickalavez.
AhoradesdeMapLayers,transfieraaladerechalostemsdelalistaprevia:
Autopistas,Carreterasprimarias,secundarias,terciarias,calles,lmitesmunicipalesy
rosyquebradas.
Seleccionecadalayerenelordendadounoauno(desdeAutopistashastaros)yuseel
botn
paratransferirlos.Estoesnecesarioparaobtenerelordendeseadoenlos
temsdelaleyenda.
Unaveztransferidos,sulistaderechadebeverseas:

Presioneelbotn Next.

145

EscribaSistemavial,hidrografaylmitesmunicipalesenlaparteLegend.
Cambieeltamaoa12 bold.
PresioneNext.
PresioneNexten Legendframe.
Cambieeltamaodelpatch paracadaitemdelalista.Eltamaoeselmismo:
16paraancho(width)
12paraalto(height)
(Almomento,nohayatajosparahacerestaparte.)

PresioneNext.
Enlasiguientepartedelwizard, tmeseuntiempoparahacerclickentodaslascajasdetexto
antesdecambiarlas.
Notarqueelsmbolorojospacingvacambiandodelugarsegnlacajadetextoactivada.
Iremospasoapaso,paraqueveacmoseespecificanlasopcionesparalosespaciosydistancias
entreelementosgrficosenlaleyenda.
Uselassiguientesespecificacionesparaterminarelproceso:

146

En TitleandLegendItems(elespacioentrelapalabraLeyendaylostemsdela
leyenda),use3puntos.FjeseenelsmbolorojoaladerechaentreTitleyLegendItem
1yLegendItem3.

En LegendItems:djeloen 8.57.Esteespaciodefineladistanciaentrecadaitemdela
leyenda.

147
En Columns,(espacioentrecolumnas)use8.57.

En HeadingandClasses:use3puntos.Esteeselespacioentreelnombredellayery
susrespectivascajas.

148
En LabelsandDescriptions,use8.57puntos.

En Patches(vertically):escriba3.Estaesladistanciaentrecadacajaosmboloyla
prximahaciaabajo.

149

Finalmenteen PatchesandLabelsuse3.Esteeselespacioentrecadacajaosmboloy
sudescripcininmediata.

PresioneFinish.
Ahoraentraremosenelprocesodeajustarlaleyenda,demodoquepuedacaberdentrodel
espacio.Cambiaremoseltamaodelasletras. Uselasherramientasdeacercamientoparaverla
leyenda,siesnecesario.

Modificar la leyenda luego de haberla insertado y hacer cambios


globales en el texto
Laleyendanecesitasercambiadaparaquequepaenelespaciodesignado.

Necesitamosentoncesusarlasopcionesdemodificacinparalaleyenda.Primerocambiaremos
eltamaodelasletrasdelasdescripcionesdetemsdelaleyenda.
Hagadobleclickencimadelaleyendaqueacabadeinsertar(MapaPrincipal).

Uselaflechanegra
grficos.

disponibleenel ToolsToolbar,paraseleccionarelementos

EnlaformaLegendProperties,hagaclickeneltab Legend.

150

InserteelcursorjustodelantedelapalabrayeneltextoSistemavial,hidrografay
lmitesmunicipales.
Presionelateclaenter.

Supongamosahoraqueluegodeverdecercalaleyenda,encontramosquelossmbolosestn
demasiadocercadesuslabels(etiquetas).Afortunadamente,podemosmodificarestayotras
propiedadesusandoLegendProperties.Estas opcionesestnubicadaseneltabLegend.

reaparamodificarespacios
entreelementosgrficosdela
leyenda.
Refirasealasfiguras
anterioresparauna
explicacindecadaelemento.

reaparamodificarel
tamaodelossmbolos:cajas
parareas,lneasyespacio
alrededordeunsmbolode
puntos.

Todavaeneltab Legend,vayaaSpacingBetween:ynaveguehaciaabajohasta
encontrarPatchesandLabels.

151
Cambieelvaloractualde3puntosa cinco(5):

PresioneOKparaverloscambios.
Parahacercambiosglobalesenlostextosdedescripcin,usaremoseltab Items.
Hagadobleclickencimadelaleyendaotravez.
Presioneahoraeltab Items.
En Changetextsymbol,uselaopcin Allitems.
SeleccioneApplytothelabel dentrodeldropdownlist.

Ahora,presioneelbotn Symbol
Cambieeltamaoa10 normal.
PresioneOK.

152
PresioneOKen LegendPropertiesparaquevealoscambios. Useel LayoutToolbary
susherramientasdeacercamientoparavermsdecercalaleyenda,siesnecesario.
Enrealidad,nonecesitamoselnombredellayer,comotampocoel heading,porqueambosson
redundantes,sisomosconsistentesconlasdescripcionesdelsistemadecarreterasyloslmites
municipales.
Hagadobleclickencimadelaleyenda.
Eneltab Items,seleccionedelalistaderechaeltiem Rosyquebradasy presioneel
botn Style
En LegendItemSelector,presioneelbotn Properties.
En LegendItem,presioneeltab Generalyen Appearance,hagauncheck en Show
LayerName.
Hagauncheck en ShowHeading.
PresioneOK.
PresioneOKen LegendItemSelector.
PresioneApplyen LegendPropertiesparaverloscambios.
PresioneOKparapodermoverlaleyenda.
Notarquelaleyendaesmuylargaanysesaledelapgina.Moveremoslostems
relacionadosconlahidrografaylmitesmunicipalesaotracolumna.
Hagadobleclickenlaleyenda.
Seleccioneelitem Lmitesmunicipales.
Hagacheckenlaopcin Placeinnewcolumn.
PresioneApplyypresioneOK.
Arrastrelaleyendaparaquesepeguealaslneasguaenlaesquinainferiorizquierdadel
dataframeMapaPrincipal.

153
Aadirlasegundaleyendadelmapaprincipal:
DebemosaadirahoralapartequetienequeverconlaexpansinurbanaylaReservadel
BosquedeElYunque.
HagaclickencimadeldataframeMapaPrincipal.
VayaalmenprincipalyescojaInsert|Legend.
Enelwizard,seleccioneunodelosLegenditems.
Con el botn
transfieratodoslostemshacialaizquierda. Estoesnecesariopara
seleccionarsolamentelostemsquequeremospresentarenla2leyenda.
Ahora,muevalostemsquedebemosponerenlaleyenda. Uselabarradenavegacinpara
poderseleccionarlostems1980,1990y2000.Estosrepresentanloslmitesdeexpansin
urbanaparacadadcada,segndelimitadosporelNegociadoFederaldelCenso.
Seleccioneellayer1980ytransfiraloalalistadeladerecha(legenditems)conel
botn

Repitaelprocesocon 1990, 2000y Reservaforestal El Yunque.

Presioneelbotn Next.
EscribaExpansinurbanaen LegendTitle.
Cambieeltamaodelaletraa 12bold.
PresioneNext.
PresioneNexten Legendframe.
Cambieeltamaodelospatchesacadaunodeloslegenditems.Cambieeltamaoa:
16ancho
12alto

154
PresioneNext.
Enlaltimaparte,uselassiguientesespecificaciones:

PresioneFinish.
Ahoracambiaremoseltamaodelaletradelasdescripcionesdelossmbolos.
Hagadobleclickencimadelaleyendaacabadadehacer(1980,90etc)
Presioneeltab Items.
En Changetextsymbol,uselaopcin All items,comotambinlaopcin Applytothe
label.

Presioneelbotn Symbol
Cambieeltamaoa10normal.
PresioneOKen SymbolSelector.
PresioneOKen LegendProperties.
Arrastrelaleyendahastallevarlaallugarindicado:

155
PasemosaaadirlaltimaporcindelaleyendadeldataframeMapaPrincipal:laelevacin
enmetros,quesehardemanerahorizontal,comolasdemsleyendasdetemperaturay
precipitacin.
HagaclickeneldataframeMapaPrincipal.
VayaalmenprincipalyescojaInsert|Legend.
Aparecerel LegendWizard,ylapartederechaLegendItems,escojaunodelostems
yuseelbotn

parasacaratodosdelalista.

En MapLayers(lalistaalaizquierda),escojaElevacinenmetrosyuseelbotn
paratransferirloalalistaLegendItems.
Oprimaelbotn Next.
En LegendTitle,escribaElevacinenmetros.
Cambieeltamaodelaletraa 12bold.
PresioneNext.
PresioneNexten LegendFrame.
Enestaparte,cambieeltamaodelpatch:
16width
12height
PresioneNext.
EnlaparteSpacingbetween,uselassiguientesespecificaciones:

PresioneFinish.

156
Cambiaremoslaorientacinyeltamaodelaletraparaquetengacoherenciaconlasdems
leyendasyocupemenosespacio.
Primerocambiemoslaorientacindelaleyenda,horzontalmente.
Hagadobleclickenlaleyenda.
En Legenditems,seleccioneelitem Elevacinenmetros.
Presioneelbotn Style
En LegendItemSelector,escojalaopcin Horizontalbarwithheading,labelsand
description.
PresioneProperties
En LegendItem,presioneeltab Generalyhagaunchecken ShowHeading.
Presioneelbotn LabelSymbol.
Cambieeltamaodeletraa10 normal.
PresioneOK.
PresioneOKen LegendItemSelector.
PresioneOKen LegendProperties.
Arrastrelaleyendaallugardesignado,alladoderechodelaleyendarelacionadaala
expansinurbanayelbosque.Susleyendasdebenverseas:

Conesto,hemosterminadolapartedelasleyendas.
Enestepunto,lerecomendamosqueguardesutrabajo,presionandoelbotn Save .

157
Escalas grficas:
Unaescalagrficaesnecesariaparadarideadelasdimensionesdelmapa.Pondremostres
escalasgrfica,unaparacadadataframe.Lasprimerasdosserniguales,(Precipitaciny
Temperatura)dadoaqueestnalamismaescala,peroelqueleaelmapanolosabeamenosque
seleescribaenelmapa.Porestarazn,decidimosponerlastresescalas.
Paraaadirunaescalasernecesarioactivarundataframe.
Recuerdeusarlasherramientasdenavegacindel LayoutToolbar paracentralizarellayouten
eldataframeescogido.

HagaclickeneldataframePrecipitacin,localizadoenlaesquinasuperiorizquierda.
ViajealmenprincipalyescojaInsert|ScaleBar.
AparecerlaformaScaleBarSelector.Escojalaopcin ScaleLine1.
Presioneelbotn Properties
AparecerlaformaScaleBar enlacualharlossiguientescambios:
Eneltab ScaleandUnits,useestasespecificaciones:
Hagachecken Showonedivisionbeforezero.
En DivisionUnitsescojaKilometers.
En Label:escribakm.
En Gap:escriba5pt.

Presioneeltab NumbersandMarks.
Abajo,en DivisionHeight,escriba10.
Escriba5en SubdivisionHeight.

158

Presioneeltab Format.
En Text,cambieeltamaodeletraa8.
En Bar,asegresequeelanchodelneasea1.00presionandoelbotn Symbol...
PresioneOK.
PresioneOKen ScaleBarSelector.
NotarquelaescalagrficatomcasitodoelanchodeldataframePrecipitacin.Porregla
general,lalongituddelaescalagrficanodebepasardeunatercerapartedelanchodelmapa,en
estecaso,deldataframe.

Useloscuadrosdeagarre(handles)decolorazul, paraachicarlaescalayarrastrarlaa
laesquinainferiorderechadeestedataframe.
Hagaclickenelcuadroazuldelmedioyarrstrelohastaquelleguea10kilmetros,
msomenosaloqueverenestegrfico:

159

Aclaramosquecadadataframeestpreparadoconlayersquetienendefinicindesistemade
coordenadasyproyeccin.Sinestainformacin,nosepuedehacerescalas.

Yacolocamoslaprimeraescala.Lasegundaesparaeldataframe,Temperatura.
NaveguehastaeldataframeTemperaturayhagaclickencimaparaactivarlo.
Enelmenprincipal,escojaInsert|ScaleBar.
En ScaleBarSelector,escojaScaleLine1.
Presioneelbotn Properties
Presioneeltab ScaleandUnits.Uselassiguientesespecificaciones:
Eneltab ScaleandUnits,useestasespecificaciones:
Hagachecken Showonedivisionbeforezero.
En DivisionUnitsescojaKilometers.
En Label:escribakm.

160
En Gap:escriba5pt

Presioneeltab NumbersandMarks.
Abajo,en DivisionHeight,escriba10.
Escriba5en SubdivisionHeight.
Presioneeltab Format.
En Text,cambieeltamaodeletraa8.
En Bar,asegresequeelanchodelneasea1.00presionandoelbotn Symbol...
PresioneOK.
PresioneOKen ScaleBarSelector.
Otravez,laescalatomarmuchoespacio.Repitaelprocedimientoparaencogerlaescala
aligualquesehizoenlaescaladePrecipitacin.
Useloscuadrosdeagarre(handles)decolorazul, paraachicarlaescalayarrastrarlaa
laesquinainferiorderechadeestedataframe.
Hagaclickenelcuadroazuldelmedioyarrastreysultelohastaquelleguea10

161
kilmetros,msomenosaloqueverenestegrfico:

AhoraslofaltaaadirlaescaladeldataframeMapaPrincipal.
Activeeldataframegrande,MapaPrincipal.
Enelmenprincipal,escojaInsert|ScaleBar.
En ScaleBarSelector,elijaScaleLine1.
Presioneelbotn Properties
Presioneeltab ScaleandUnits,yuselassiguientesespecificaciones:

Presioneeltab Format.
Cambieeltamaodelaletraa 10.

162
PresioneOK
PresioneOKen ScaleBarSelector.
Aparecerlaescala,quetendrqueserajustadaparaqueocupeellugaralladoderecho
delaleyenda.
Ajstelacomosehizoanteriormenteenlasotrasescalas.Suescaladebequedarcomo
enestegrfico:

Estoconcluyelapartedelasescalasgrficas.
Paraestelayout,norecomendamosponerlaescalanumrica(1:N)porqueesprobablequeel
layoutseimprimaadiferentestamaosdepginayenotrasaplicacionescomoAdobeAcrobat
enformatoPDF.Alcambiareltamaodellayout,yanoesvlidalaescalanumrica.
Recuerdeguardarsutrabajo(Save).

Aadir ttulos:
Enestaparte,aadiremoslosttulosdelosdataframes,omapasquecomponenellayout.
Empezaremosporelttulodelapginayluegolosdemsdataframes.
Presioneelbotn zoomtowholepage enel LayoutToolbar.
Paraponerelttulo,usaremoselbotn

localizadoenel DrawToolbar.

Sinoaparece,puedebuscarloenelmenprincipal,View|Toolbars|Draw.

Hagaclickenelbotn
ymuevaelcursorhacialaesquinainferiorizquierdadel
rectnguloverde,encimadelosdataframes.

+
A

Cuandoaparezcalacajadetexto,escribaBosqueNacionaldelCaribeElYunque
presioneEnter8 .
Hagadobleclickenlalneadetextoqueacabadeescribir.
AparecerlaformaPropertiesdeestalneadetexto.
Presioneelbotn ChangeSymbol

163

En SymbolSelector,presioneelbotn Properties.
AparecerlaformaEditor.Presioneeltab General.
Cambieeltamaodelaletraa 82.Elttuloocuparcasitodoelrectnguloverdeydebe
llamarlaatencin.
Cambieeltipodeletraa Arial black
Cambieelcolora gray10% con elbotn
.Seusarestecolorporquelacajaque
contieneelttuloesverdeoscuroyqueremosqueeltextoresalte.
Presioneeltab FormattedText.
En CharacterSpacing,escriba40.
Presioneeltab AdvancedText.
Hagachecken Textfillpattern.
Presioneelbotn Properties
En Options|useelbotn FillColor,

yelijaelcolor gray10%.

En Outlinewidth,use1.0
y Outlinecolor:black 100%
RegresealaformaEditor presionandoOKen SymbolPropertyEditoryen Symbol
Selector.
DevueltaenlaformaEditor,vayaaShadowy useelcolorgray70%
En Xoffsetescriba3
En Yoffsetescriba3

164
PresioneOK.

PresioneOKen SymbolSelector.
PresioneOK en Properties.
Ahorasolamentenecesitaacomodarlalneadetextodentrodelacajaverde.Arrastreel
ttulohastaqueestdentrodelacaja.

Vamosahoraaagregarlosotrosttulos.
Presioneelbotn
.
MuevaelcursorcercadelaesquinasuperiorderechadeldataframePrecipitacin.
Hagaclickencimadeestedataframeycuandoaparezcalacajadetextoescriba
Precipitacinypresioneenter8..

165

Coneltextoseleccionado,uselasherramientasdel DrawToolbar paramodificarlas


propiedadesdeltexto.

Cambieeltamaoa48 ypresioneelbotn Bparacambiarabold.


Elttulodeberversemsgrande.Arrstrelohacialaesquinasuperiorizquierda.

Usaremoselmismotipodeletraytamaoparalosdemssubttulos.
HagaclickencimadeestesubttuloypresioneCrtl+CoEdit|Copy.
PresioneCtrl+VoEdit|Paste.
MuevalapalabraPrecipitacinqueacabadecopiarycolquelaenlaesquinasuperior
derechadeldataframeTemperatura.
Hagadobleclickenestesubttulo.
CambieeltextoaTemperatura.

166
PresioneOK.

Paraaadirelprximottulo,presioneelbotn Pasteopresionectrl+v.
ArrastrelapalabraPrecipitacincercadelaesquinasuperiorderechadeldataframe
MapaPrincipal.
Hagadobleclickencimadeestesubttulo.
CuandoaparezcalaformaProperties,cambieeltextoa EntornodelaReserva
Forestal. Presioneenter8 .
Arrstrelohastaqueocupelaesquinasuperiorderechadeestedataframe.

Estoconcluyelapartedeaadirttulos.

167

Incorporar cajas de texto para explicar procedimientos, y fuentes de datos:

Cadamapadebetenerexplicacionessobrelametodologausada,fuentesdedatos,mtodode
proyeccincartogrfica,fechas,yotrainformacinqueseanecesariapresentar.
Enesteejercicio,usaremosarchivosdetextoconlainformacinparaquenotengamosque
extendernosmstiempoenestetema.
Abrael WindowsExplorer (uselasteclas+E)ybusqueeldirectorio
C:\ArcTrain\Carto\TextForMap.
HagadobleclickenelarchivoPrecipita.txt.
En Notepad,vayaalmenyelijaEdit|SelectAllyluegoEdit|Copy.
VuelvaaArcMapyhagarightclickencimadellayout.
Noactiveningndataframe,porqueentonceselarchivoirapararaldataframecomo
otrofeatureclass.
Sitienealgndataframeactivadoconloscuadritosazules,hagaclickencualquier
lugarfueradellayout.
EscojaPaste.Aparecerunacajadetextocontodoelcontenidodelarchivo.
Cmbieleeltamaoa8 usandoel DrawToolbarenlaparteinferiordeArcMap.
ArrstrelohastaqueencajedebajodelaescalagrficadeldataframePrecipitacin.

168

Pasemosahoraaaadireltextocorrespondientealmapadetemperaturamnima.
VuelvaalWindowsExplorerusandolasteclasaltyTabChooseanamefortherelate:a
lavez,ysultelocuandoaparezcael cuadroencimadel iconodelWindowsExplorer:

HagadobleclickenelarchivoTempera.txtlocalizadoen
C:\ArcTrain\Carto\TextForMap.
AparecerelprogramaNotepad,dondeentoncesusarlasteclasctrl+aparaseleccionar
todoy ctrl+cparacopiar.Puedehacerlotambincon Edit|SelectAlly Edit|Copyen
Notepad.
Unavezcopiado,hagapasteencimadellayoutde ArcMap,haciendorightclickencima
delapginadelayout:

DespusdehaberhechoPaste,asegresedeverdndecaylacajadetexto.Esposible
quehayacadoenelmediodellayoutysuniveldeacercamientoseamuypequeo.
Uselasherramientasdeacercamiento,siesnecesario.
Mientraslacajadetextoestactivada,arrstrelahastaponerladebajodelaescalagrfica
deldataframeTemperatura.
Cmbieleeltamaodeletraa8.
Verqueanreduciendoeltamao,lacajadetextosesaledelacajaamarilloverde.
Tendremosquehacerunoscambios.
Esteesunbuenmomentoparadejarverlosdataframes,solamentedeprecipitaciny
temperatura.
ActiveelcuadrodePrecipitacinyhagarightclickencimadeestedataframe
EscojaProperties.
Presioneeltab Frameyhagauncheck en Draftmodejustshowname.

169
PresioneOK.
Verqueesposiblemoverlaescalagrficaenlaesquinainferiorderechadeldata
framePrecipitacin(debajodelaisladeVieques).

Activelaescalagrficahaciendoclickencimadeestayarrstrelahastalaesquina
inferiorderechadeldataframe.
Activeluegolacajadetextoyarrstrelahaciaellugarqueocupabalaescalagrfica
anteriormente,usandolaslneasguas.

Repitaelprocedimientoconlaescalagrficaycajadetextodeldataframe
Temperatura.

NohagavisibleaneldataframeMapaPrincipal.Estedataframeesunpococomplejoytarda

170
endibujarse,porlagrancantidaddetextoysmbolosquetiene.

Nosfaltanlascajasdetextodeldataframemsgrande,MapaPrincipal,quecontienedoscajas.
HagaotravezAlt+Tabysultelohastaqueaparezcalacajaencimadel Windows
Explorer:

HagadobleclickenelarchivoFuentes.txtlocalizadoen
C:\ArcTrain\Carto\TextForMap.
Seleccionetodoeltexto,cpieloyhagapasteenArcMapdelamaneraantesdiscutida:
rightclickypasteenellayout:

Cmbieleeltamaodelaletraa8.
Arrastrelacajadetexto,ypguelaalladoderechodelalneaguaqueestpegadaal
mapapequeodePuertoRico:

Solamentefaltaaadireltextorelacionadoalaproyeccincartogrficadelosdataframes.
Vuelvaal WindowsExplorer,hagadobleclickenelarchivoProyeccin.txt.

171

Seleccionetodoeltexto(ctrl.+a)ycopie(ctrl+c).
VuelvaaArcMap(alt+tab)yhagarightclick|Pasteencimadellayout.
Cambieeltamaodeletraa8.
ArrastreestacajadetextodebajodeldataframeMapaPrincipal,debajodelapalabra
Autor:_______________

Presioneelbotn Save,comoprecaucin.

Aadir texto curveado encima de un data frame:


Enestepuntoveremoscmopodemoscolocarlneasdetexto,estavezpararepresentarnombres
decuerposdeaguaocenica.AadiremoselnombreOcanoAtlnticoalnortey Pasajede
Viequesaleste.Laslneasdetextopuedenseraadidastantoenellayoutcomodentrodeldata
frame,comosiestuvieramosaadiendoungrficoaldataview.
Hacemosladistincinqueparaactivareldataframe,solosenecesitahacerclick.Sinembargo
enmuchasocasionesesconvenientecolocartextoygrficasdentrodeldataframe.
Paracolocartextoogrficasdentrodeldataframesedebehacerdobleclick encimadeldata
frameorightclick|FocusDataFrame.
AssevecuandoestenmodoFocusDataframe:

172
Elbordedeldataframecambiaymuestraunaslneas////enngulo.
ParaestapartetendremosquehacervisiblealdataframeMapaPrincipal.
HagaclickencimadeldataframeMapaPrincipalparaactivarlo.
Hagarightclick|Properties.
Presioneeltab Frameyhagauncheck en DraftMode justshowname.
Puedeusartambinelbotn ToggleDraftModelocalizadoenel LayoutToolbar:

PresioneOKyespereunratoenloqueestedataframeterminadedibujarse.Puede
presionarlateclaEscparacancelarelprocesodedibujar.Sulayoutdebeversemso
menosas:

Recuerde quesielmapanoest
centralizadooestenotraescala,puede
usarelbookmarkElYunqueMapa
Principalusando View|Bookmarksen
elmenuprincipal

Usaremosotrobotndetextoenel DrawToolbarparaaadirestaslneasdenombres.Estees
elsegundobotnenlaprimerafila,Newsplinedtext.
Hagaclickeneltringulonegro
paraverlasopciones

Eltextoenestecaso, debeseguirlaformadelcontornodelacosta,demanerabiengeneralo
suavizada:
Hagaclickenelbotn NewSplinedtext.

173
DibujeunalneacurvasuavizadaalolargodelacostadesdePuntaLimaenNaguabo
hastaPuntaPuercaenCeibayhagadobleclickparaterminarla:

EscribaPasajedeViequesypresioneenter8 .
Cambiaremoslaaparienciadeltextoparaqueguardecoherenciaconlostextosquetienenque
verconhidrografa:tipodeletraTimesNewRoman,itlicoydemayortamao
Conlalneadetextoseleccionada,hagadobleclickencimadeestalnea.
AparecerlaformaProperties.Presioneeltab Textypresioneelbotn Change
SymbolCambieeltamaodeletraa24.
CambieeltipodeletraaTimesNewRomanypresioneelbotn Iparacambiarlaa
itlica(bastardilla).
Cambieelcoloraazul,(lapislazuli)

LaformaSymbolSelector debeverseas:

174

PresioneOK.
DevueltaaProperties,escriba200en CharacterSpacing.
Estoayudaraestirarlalneadetextoparaquecubramsespacio,yeliminardudas
sobreculeselnombredetodaesaextensinmarina.
PresioneOK.
Sumapadebeverseas:

Procedamosaponerlalnea:OcanoAtlntico,alNorte
Presioneelbotn NewSplinedText,localizadoenel DrawToolbar.

175
Hagaunalneacurvasuavealnorte,siguiendolalneadecostadesdePuntaPicaen
RoGrande,hastalasCabezasdeSanJuanenFajardo.

Hagadobleclickparaterminarlalnea.
Cuandoaparezcalacajadetexto, escribaOcanoAtlnticoypresioneenter8 .
Cambiaremoslaaparienciadeltextoparaqueguardecoherenciaconlostextosquetienenque
verconhidrografa:tipodeletraTimesNewRoman,itlicoydemayortamao
Conlalneadetextoseleccionada,hagadobleclickencimadeestalnea.
AparecerlaformaProperties.Presioneeltab Textypresioneelbotn Change
SymbolCambieeltamaodeletraa24.
CambieeltipodeletraaTimesNewRomanypresioneelbotn Iparacambiarlaa
itlica(bastardilla).
Cambieelcolora azul,(lapislazuli)

LaformaSymbolSelector debeverseas:

176

PresioneOK.
DevueltaaProperties,escriba300en CharacterSpacing.
Estoayudaraestirarlalneadetextoparaquecubramsespacio,yeliminardudas
sobreculeselnombredetodaesaextensinmarina.
PresioneOK.
Sumapadebeverseas:

Presioneelbotn Saveparaguardarsutrabajohastaahora.

177
Hacer una retcula para mostrar latitud y longitud:
Enmuchoscasos,especialmenteparamapastopogrficos,esnecesarioaadirunaretcula(grid)
paradarsentidodelocalizacinenelcontextoglobalyparadarideadelaescaladelmapa.En
ArcMappodemossobreimponerretculasgrficamente,sinnecesidaddecrearmapasdelneas
representandomeridianos(longitud)yparalelos(latitud).
Paraaadirunaretcula,esnecesarioactivareldataframe.
ActiveeldataframeMapaPrincipal haciendoclickencimadeestedataframe.
HagarightclickyescojaProperties.
EnlaformaDataFrameProperties,presioneeltab Grid.
Presioneelbotn NewGrid.
Aparecerel GridandGraticulesWizard.EnlaprimeraparteescojaGraticuleyen
GridNameescribaRetculaMapaPrincipal.
Presioneelbotn Next.
En AppearanceescojaGraticuleandLabels.
Comoelmapatienepocaextensinconrespectoaladistanciaentrenmerosenterosdegrados,
tenemosquehacerunaretculaquerepresentefraccionesdegrado.
En Intervals,vayaaPlaceParallelseveryyescriba:
7enlacajadetextoMinutes
30enlacajadetextoSeconds
en Placemeridianseveryescriba:
7enlacajadetextoMinutes
30enlacajadetextoSeconds.
7.5minutoseselintervalodeespacioengradosdeuncuadrngulotopogrficodelUS
GeologicalSurvey publicadoaescala1:20,000.
PresioneNext.
En Axesy Labeling,dejelasopcionescomoestn.
PresioneNext.
En Graticuleborder,Neatliney Graticuleproperties,dejelasopcionescomoestn.
PresioneFinish.
PresioneOKenlaformaDataFrameProperties.

178
Aparecerentonceslaretcula,engrados,minutosysegundos.
Sisefija,losnmerosaladerechasesalendelacajaverde
Paracorregirelproblemapodemoscambiarlaorientacindeloslabelsyhacerlos
verticales.
ActiveeldataframehaciendorightclickyescojaProperties.
Presioneeltab Grids.
EnlalistahagaclickencimadeRetculaMapaPrincipalypresioneelbotn
Properties.
EnlaformaReferenceSystemProperties,presioneeltab Labels.
Abajo,en LabelOrientation,hagachecken Leftyen Right.
PresioneOK.
EnDataFrameProperties,presioneOK.Laorientacindeloslabelsdelladoderecho
eizquierdocambiaravertical.
Aadir orientacin al norte:
Esteelementoesimportante,comodiceelttuloparahacerverallectorculeslaorientacindel
mapa,dndeestelnorteuotradireccin.
Paraaadirungrficotipoflechadeorientacin,debeiralmenprincipal Insert|North
Arrow.
AparecerlaformaNorthArrowSelector.
Escojacualquieradeellas,ennuestroejemplousaremoslanmero8,ESRINorth8.
PresioneOK.
Activey arrastrelaRosadelosvientos(northarrow)hastaqueestsobreelcerooel
puntomediodelaescalagrficadelMapaPrincipal.

179
Encojaeltamaodelarosadelosvientoshastaquequepadentrodelespaciosobrela
escalagrfica:

PuedehacerrightclickencimadelarosadelosvientosyescojaProperties.
En size,cambieeltamaoa74.
PresioneOK.

180
Preparar la impresin del layout:
Estapartedependedelaimpresoraquesetengadisponible.Porestaraznnoprofundizaremos
muchoyslomostraremosalgunascosas.
UnadelaspartesmsimportantesesPageandPrintsetup,dondepodemosfijareltamaode
pgina,laorientacindelahoja,yeltipodeimpresoradisponible.

Podrnverqueelgrficoenlaesquinaderechaabajo,muestralarelacindelpapeldisponiblede
laimpresorayeltamaodelapginaescogidaparahacerellayout.Enestecasoes36x24y
eltamaomximodelaimpresoraes11x17landscape.
Sihacencheckenlaopcin ScaleMapElementsproportionallytochangesinPageSize,
ArcMapampliaroreducirlaescaladelmapasegneltamaodepginadestino,(locuales
bienconvieniente).
Tambinexistelaopcin PrintPreview,paravermsomenoscmosaldrellayoutantesdela
impresin,conunainterfazbienparecidaalasqueestamosacostumbradosconlosprogramas
Microsoft.

181
ElmenPrint,acontinuacin:

proveedosopcionesparaimprimirquemerecenatencin:
Primero,sepuedeimprimirusandolaopcin ScaleMaptofitPrinterPaper.Estaestirao
reduceelmapaparaacomodarloalapginadeimpresin.
Segundo,laopcin TilemaptoPrinterPapersirveparaimprimirellayoutalamismaescala,
enmltiplespapelesmspequeos.Esanlogoaunirunrompecabezasdepiezascuadradas.

Sepuedeimprimirtodaslashojas,variasounaenparticular.
LaopcinprinterenginepuedeproveerelusodelmduloArcPressparaimpresin.La
disponibilidaddependedelaexistenciadeunalicenciaparaestemduloqueparalaversin9.1
enadelante,quedaincluidaenlicenciasdeArcView,ArcEditoryArcInfo.(
http://www.esri.com/software/arcgis/about/whatsnew.html#desktop)

182

Exportar la composicin del layout a otro formato:


Algunasvecesypordiversasrazonestcnicas,esmsconvenienteexportarellayoutaalgn
formatogrficodedifusinamplia.ArcMapproveevariosformatos,tantovectorialescomo
imgenestipogif,jpg,bmp,etc.Laventajadeexportaraimagenesquelaexportacinesun
retratodellayout,aunquelacalidaddestadependedelaresolucin.
Losformatosvectorialestienenmayorfidelidad,peropuedenocuparbastanteespacio,segnel
tipodearchivo.Paralayoutsbiencargadosdetextoysmboloscomoeldeesteejercicio,toma
minutoshacerlaexportacin,dependiendodelacapacidadyvelocidaddelacomputadora.
Paraterminarentonces,ycomoejercicioopcional,exportaremosellayoutalformatopdf de
AdobeAcrobat,queesunodelosformatosmsdifundidosy estdisponiblegratuitamenteen
Internet.Deestamanera,podrenviarelarchivoaimprimiraotrolugar,sinlanecesidadde
instalarArcMapotenerqueintentarotrosformatosgrficos.
Paraexportarellayout,vayaal menprincipalyescojaFile|ExportMap.
AparecerlaformaExportMap.En SaveasType:escojaPDF.
PresionelostabsGeneralyFormatparaquevealasopciones.
Porejemplo,en OutputImageQuality,dejeelratioen 1:4.
Notequemientrasmejorsealacalidaddelaimagen,mayortamaotendrelarchivo
PDF.
Laopcin ClipOutputtoGraphicExtentseusaparaexportarsolamenteelespacio
ocupadoporlasgrficas(dataframes,escalas,textos)ynolaextensincompletadela
pgina.
En FilenameescribaLayoutElYunque36x24.pdf
PresioneSave.
Comosemencionaraantes,tendrqueesperarvariosminutos,segnlacapacidaddela
computadora.Nuestraprimerapruebatard9minutosenunalaptopconprocesador
Pentium4,y512MegabytesdeRAM.

183
Apndice a este ejercicio:
Parafinalizaresteejercicio,queremosaclararqueporrazonesdetiemponoentramosenlaparte
desimbolizacinytextospararepresentarnombresdeelementosgeogrficos.Ensulugar
pensamosquepodamosahorrartiempoymostrarcmoaccederalasopcionesquetienenque
verdirectamenteconloslayouts:escalagrfica,leyenda,textoexplicativo,ttulos,lneasgua,y
otros.Aclaramostambinquesepuedeinsertarimgenesenloslayouts,peroenestecaso,no
habamuchoespacioparallo.
Parasuinformacin,eldirectorioC:\ArcTrain\Cartotienetodoslosfeatureclassesylayers,
paraquelosinspeccioneconmstiempo.Ademsexisteunsubdirectoriollamado
LabelExpressions,elcualcontienelosenunciadosen VBScriptparadesplegarlabelspor
coloresyotrasespecificaciones.
Sobrelosfeatureclassesdisponiblesenestedirectorio(Carto),explicaremosalgunos:
Nombre

Layer asociado

Descripcin

GNamesUSGS.shp

Toponmicos.lyr

PREastContours.shp

Elevacinen
metros.lyr

Highpoints.shp

Lugares
elevados.lyr

Places.shp

Lugares
poblados.lyr

Contienelosnombresgeogrficoscomoaparecenenlabasede
datosdenombresgeogrficosdelUSGeologicalSurvey.
Losnombrespuedentenererrorestipogrficos.
Representavaloresdeelevacinenmetrosporcategoras.Esun
mapadecontornosenpolgonosdeigualvalorporclases.Este
featureclassfuederivadousandoManifold6.5yexportadoa
shapefile.Elmodelodeelevacinqueseusprovenadeun
ArcInfoGRIDconresolucinde15metrosporpxel.
Contienepuntosdeelevacinendiversoslugaressegnaparecen
enloscuadrngulostopogrficosyhansidoajustadosparaque
coincidanconloscontornosdeelevacin,distribuidosenotros
archivosdigitales.
ContienedelimitacionesdelugaresdenominadoscomoPlaces,
segnelNegociadodelCensoFederal.Estefeatureclassayuda
adarideadelaextensindecomunidadesquenonecesariamente
sonbarrios,ciudadesomunicipios.
EsteshapefilefuederivadotambinusandoelprogramaGIS
Manifold6.5.Enestecaso,usamoselmduloSurfaceToolsde
Manifoldparaderivarunasuperficiesuavizadaquepermitiera
conservarlosvaloresoriginalesdelasestacionesclimatolgicas.

Precip_conts_gravity.shp Estimacinde
normalde
precipitacin.lyr

Precip_east.shp

Temperatura
mnima
promedio.lyr

ElalgoritmousadofueeldeGravedadcuyosresultadosse
parecenalosalgoritmosdeinterpolacinexacta,comoelde
DistanciaInversaPonderada.Posteriormente,lasuperficieen
formatorsterfueinterpoladaparaproducirunmapade
polgonoscuyasreasrepresentaranbandasmsomenos
uniformesdeprecipitacin.Esteresultadofueelqueseexport
aformatoshapefileparaArcMap.
ElspreadsheetClimateEastPRNOAA.xlscontienelosdatos
originalestomadosdelaNOAAenelwebsite:
http://www.dnr.sc.gov/climate/sercc/climateinfo/historical/histori
cal_pr.html
EstearchivosederivtambinusandoManifold6.5.A
diferenciadelmapadeprecipitacinqueus31puntos,elmapa
detemperaturasseajustuncmputoderegresinenMSExcel
elcualmostrunacorrelacinde.70.Laecuacinderivadade
21puntosalestedePuertoRicofueY=70.42 0.003x.Esta

184
ecuacinfueusadaenManifoldSurfaceToolsytransformarel
mapadeelevacionesenunodetemperaturasenfuncinala
elevacin.

Shadeast.tif

Sombreado
topogrfico.lyr

Posteriormenteinterpolamoslasreaspropiasdelmapade
contornos(areasentreisolneas)yelresultadofueexportadoa
formatoshapefileparausodeesteejercicio.Ningunodeestos
resultadoshapasadopruebaalgunaporlaNOAAoelNegociado
delTiempo.
RepresentaelsombreadotopogrficodelreaestedePuerto
Rico.ElmismofuederivadotambinusandoManifold6.5.

LabelExpresions:
Nombre del archivo

Funcin

PrecipitacionLabels.lxp

1)Colocaeltextocontenidoenel
campo[StationNam],
2)Poneunanuevalneaconenter
3)Escribelaprecipitacin
4)Colocaelsigno alfinaldel
enunciado.
Ejemplo:
VIEQUESSTATION
45.0
Hacelomismoperoalfinalcoloca
elsmbolodegrados.
Cambiaelcolorsegnelcontenido
delcampo[Type].
1)Sitypecontiencape,cemetery,
forest,oisland,entonces
2)colocaellabelsindistincinde
color
3)siesotracosa,despligaloen
coloraazulsegnelmodelode
colorRGB.

TemperaturaLabels.lxp
ToponmicosColores.lxp

Cdigo VBScript
[StationNam]&vbcrlf&[PrecipInYr]&"''"

[StationNam]&vbcrlf&[MinTempF]&""
FunctionFindLabel([RealName],[Type])
IF([Type]="cape"or[Type]="cemetery"
or[Type]="forest"or[Type]="island")
then
FindLabel=[RealName]
ELSE
FindLabel="<CLRred='0'green='0'
blue='255'>"&[RealName]&"</CLR>"
ENDIF
EndFunction

EldataframeLocalizacintieneuncomponentequemerecediscutirse.Sinosacercamosaeste
dataframe,notaremosquecontieneelmapadelaislaconuncuadrorojo,querepresentala
extensindeunodelosframes,(mapaprincipal).
EstoselograatravsdelasPropiedadesdeldataframeypresionandoeltab Extent
Rectangles.
Endichoapartado,puedeescogerseel(los)dataframe(s)quesequierenpresentarcomola
extensincubiertaporlosotrosframes.Ennuestrocasoescogimosunoporquesesuponeque
cadaframecontengalamismaextensinderea,aunquenolamismaescala.

185

Hayotrascosasquepuedenserexploradasenestemapdocumenttalescomodefinitionqueriesy
otrasms.Lasdejamoscomoejemplosparaquelasexaminen.

O|G|P

SistemasdeInformacinGeogrfica

readeTecnologa

OficinadeGerenciayPresupuesto

Ejercicio IX: Sobreimposicin y anlisis de datos


geogrficos
(Overlay andanalysis)

OFICINADEGERENCIAYPRESUPUESTODELESTADOLIBREASOCIADODEPUERTORICO
CalleCruz254,Apartado9023228,SanJuan,PuertoRico009023228telfono:(787)9779200

www.ogp.gobierno.pr

187
Introduccin:
Estaltimaseccintratasobrecmopodemoscombinardistintascapasdeinformacinpara
producirnuevainformacin,agregarlaohastahacerverpatronesqueasimplevistanosontan
claros.
Casitodoslosaos,enalgnpuntodenuestropasnosencontramosconelproblemadelos
deslizamientosdetierra.Sobreestetipodepeligronatural,elmsrecurrenteesel deslizamiento
inducidoporeventosdelluvia.MuchosrecuerdaneldesastreocurridoenPonce,enlapartesur
delaisla,enenerode1985,enelcualmurieroncientosdepersonasenunaavalanchadelodo
inducidaporuneventodelluviaprolongada.
Existeunmapaanivelisla,(Monroe,1979)publicadoaescala1:250,000,elcualmuestrazonas
susceptiblesadeslizamientos.Enelcasodelmapamencionado,elmismopresentareascuya
litologamuestradepsitospordeslizamientosyunafranjaenelnorte,enlacual aflorauntipo
demargasubyacenteaotraformacingeolgicasuperficial(Karst).Lamarga(marl)esuna
combinacinderocacaliza(carbonatoclcico)yarcilla.
Eneventosdelluviaprolongados,elaguasefiltraatravsdelmaterialporososuperior,
saturandolamarga,loquepuedecausardeslizamientosconsiderables.Estaeselreaendonde
ocurrieldeslizamientoenelmunicipiodeLaresenlacualtodaunacomunidadtuvoqueser
evacuada.Losocupantestuvieronqueabandonarsusviviendasparasiempre.
Enesteejercicio,trataremosconotrareaenelsurdelaisla,enelMunicipiodeVillalba,fuera
delreadelcarso.Cuandovemoselmapageneralizadodesusceptibilidad,(Monroe)podemos
verqueenVillalbaexistenalgunoslugarescon altopeligrodedeslizamientos:

188

Sinembargo,luegodeinvestigarenelUSGeologicalSurvey,senosinformquelos
deslizamientosenestemapanoserelacionannecesariamenteconaquellosquesoninducidospor
lluvias.Afortunadamente,estaagenciafederalhahechoinvestigacionesyhapublicadoartculos
sobreestepeligronaturalrecurrente.Nuestroejerciciosebasaenteramenteeneltrabajo
investigativodelUSGS,especialmentehechoporMatthewCLarsenyotros(199798yss).
EnelestudiodesusceptibilidadhechoparaelmunicipiodeComero,LarsenyParks(OpenFile
Report98566)muestranunametodologasencillaparadelimitarestasreasdepeligroen
distintosnivelesdeintensidad:altomoderadoybajo.Seusanlossiguientescriteriosyfuentes
deinformacin:
Modelodeelevacindigital:delcualsederivanlossiguientes
o Pendientes(inclinacin)
o Aspect(orientacindelapendiente)
Tantolaspendientescomolaorientacindelasmismasylaelevacinsonagrupadasenclases
dondesehaestudiadopreviamenteloseventosdedeslizamientosentresdiferentescuencasde
rosdelaisla:
TheFrequencyandDistributionofRecentLandslidesinthreeMontaneTropicalRegionsofPuertoRico,
Geomorphology24(1998),pp309331.
Endichoartculosemuestranlascaractersticasquemuestranlosumbralesquedividenlas
clasificacionesquesenecesitanparaagruparlaspendientesysuorientacin,ademsdelas
zonasdeelevacin.
Segnelestudiode1998enlascuencasmencionadoarriba,estossonlosumbrales:
Elevacin:300a400metros.Escogeremos300metros.
Pendientes(engrados):trescategorasderiesgo:
o 0a7:bajo
o 7a12:moderado
o 12oms:alto
Aspect(orientacindelapendiente).Lacantidaddelluviarecibidaesmayorenaszonas
dondeserecibemayorcantidaddevientos.PuertoRicorecibevientosdelnordeste
principalmente,loquehacequedebamosconsiderarlascarasdelasmontaasquemiran
haciaelnordestecomolasdemayorriesgo:
o 22.5a112.5grados:alto
o 202.5a292.5
:bajo
o Elresto
:normal0a22.5,112.5a202.5,y292.5a360.
Cubiertadeterrenos:Tieneespecialconsideracinporqueelusoolacubiertaeneste
caso,tieneunfactormultiplicadorderiesgo(vanselaspublicacionesincluidas).Ms
adelanteexplicaremosunpoco.Porloprontoyparahacerelmodelolomssencillo
posible,solamenteconsideraremoslassiguientescubiertasdeterrenos:
o reaconstruida:viviendas,carreteras
o reasagrcolas :incluyepastosyzonasdepastoreoalternado.
o reasboscosas :tantolosdensoscomoarboledamsomenosdispersa.

189
Parahaceresteejercicio,loidealestenerunprogramadoSIGquemanejedatosmatriciales.
ArcGIStieneunmduloquesevendeseparadamente,peroaunaltocosto.Dadoaqueeste
manualdeejerciciossebasaenlascapacidadesestndaresdeArcMap,elejerciciocomenzar
condatospreviamentecategorizadosusandolosumbralesdescritosanteriormente.La
informacinderivadadelmodelodeelevacindigital(pendientes,aspect)fueprocesadausando
Manifold6.5ProfessionalconelmduloSurfaceToolsdebajocosto.Posteriormentelascapas
clasificadasfueronexportadasaformatoshapefileparaserusadasenArcMap.
ArcMap y geoprocesamiento:
ESRItrajoalaversin3deArcViewlaideadehacermodeloscartogrficosusandounainterfaz
grfica.SelellamModelBuilderysetrajotambinalasversiones8ysubsiguientes.
ElModelBuilderseinvocadesdeArcMapoArcCatalogatravsdeArcToolbox.
ArcToolboxsirveparacontenerycorrerloscomandosymodelosdeanlisisgeogrfico,las
cajasdeheramientasconlosnuevosmodelosolosscripts(programas)degeoprocesamiento.

Vistadecajasdeherramientas

ndiceparalocalizarcomandosymodelos

Herramientas:Modelos

yscripts :

Motordebsquedadecomandosymodelos

190
Por qu usar el Model Builder? Porvariasrazones:
Claridad:Podemosvergrficamentecmoprocesaremoslainformacin.Esteconceptonoes
nuevo,peroesmuytilparasepararentreprocesos,flujodeinformacinyresultados
intermedios.
Eficiencia:Permiteborrardatosintermedios,loscualesamenudosenosolvidaborrary
podemosconfundirconresultadosfinales.Encasodemodificacinpodemosvolveracorrerel
modelocambiandocualquieradelosinsumos.
Losmodelossonreciclables:sepuedecorrerelmismoprocesounayotravez.Esposiblehacer
cambiosenparmetrosyproducirdistintosescenarios(prediccin).
ParaabrirlainterfazModelBuilderpuedehacerrightclickencualquiermodeloyescoger
EditEstoabrirlaventanadelModelBuilderypodrvercmosehicieronlosmodelosque
estndisponibles,cadaunocondistintosgradosdecomplejidad.
Paraesteejercicioharemosunanuevacajadeherramientas.Estanuevacajacontendrel
modeloqueustedgenerarparahacerelanlisisdedatosgeogrficos.Primeronos
familiarizaremosconelreadelMunicipiodeVillalba,susalrededoresinmediatosylascapasde
informacinquecontieneestemapdocument.

191

AbraelmapdocumentllamadoDeslizam_Villalba.mxdqueestlocalizadoen
C:\ArcTrain\Exer_9.
Verenlatabladecontenidovariascapasdeinformacin.Hagavisiblecadaunade
ellas,unaalavez.
Cadalayerestdivididoenreasderiesgorepresentadoporlacantidaddetintanegra
encadarea:mayorriesgo,msoscuro.
Cadacapadereases50%transparente.Estonospermitevisualizarlasreasdemayor
riesgo,unasobreotra.
Elevacin

Pendientes

Cubiertadeterrenos

Aspect

Todos

Inspeccinvisual

Alparecer,segnlaintensidaddelcoloroscuro,lasreasdemayorriesgoparecenserlasreas
construidas.Estaeslaapreciacinvisual,peroelmodelopresentadoporLarsenyotros,toma
cadacombinacinyledaunpesodiferentealacubiertadeterrenos,haciendoelresultado
diferentealanlisisvisual.
Antesdecomenzaraaadirmodelosesrecomendablehaceralgunoscambiosparaindicardnde
guardaremosnuestronuevomodelo.Losmodelosseguardanmedianteunscriptodentrodeuna
cajadeherramientas.Lascajasdeherramientasseguardanconextensin.tbx.
EnArcMapvayaalmenprincipalyescojaTools|Options.
Hagaclickeneltab Geoprocessing.

192
Uselassiguientesespecificacionescomoaparecenenestapantalla:

Hagaclickenelbotn Environments
Uselassiguientesespecificaciones,talcomoaparecenenestapantalla:

PresioneOKen EnvironmentSettingsyOKenOptions.

193
Yaestamoslistosparacomenzar.Vayamosalprocesodecombinarlascapas(overlay).
Hagaclickenelbotndelacajadeherramientas
localizadoen elStandardToolbar.
AparecerelArcToolbox.Hagarightclickenelicono
escojaNewToolbox

EscribaAnalisis(sinacento).
Comenzaremosconelprimermodelo.Hagarightclickencimadelanuevaherramienta
AnalisisyescojaNew|Model.
AparecerlainterfazModelBuilder.

Enesteespacioenblancopondremosloscomandosquecompondrnelprocesopara
llevaraacabolacombinacindecapasdeinformacin.
Porloprontoveamoslosbotonesparafamiliarizarnos:

Aadecapasdeinformacinytablas.
Enderezaeldiagrama,acomodandolaspiezas.
Herramientasdeacercamiento(zoomall,zoomin,zoomout).
Herramientasdenavegacin(zoomin,arrastre[panning],
zoomdinmico,navegadordeprocesoaproceso.
Seleccindeelementos
Paraconectardatosconprocesos
Paracorrerelmodelo.

194
Comandos de anlisis:
Paraesteejemplousaremosalgunosdeloscomandostpicosparacombinarinformacin.
Nuestromodeloesunobasadoencombinaciones.Tomartodaslascombinacionessin
exclusin(exceptosiaparecenerrores).
LaherramientaUnioncombinatodosloselementosdeunacapaconlaotra.Esequivalenteala
uninenundiagramadeVennoelusodelaclusulaORenunaexpresinBooleana:

Nuestromodelosersencillo,basndonosenestecomando.Comencemoscombinandolacapa
deelevacinconlacapadependientes(ambasestnclasificadascomosedescribi
anteriormente).ArcViewsolamentepermitecombinardoscapasalavez.
VayaaArcToolbox,hagadobleclickencimadeAnalysisTools.
ExpandalacajaOverlay.Arrastre(haciendodrag&drop)laherramientaUniondentro
delespacioenblancoenlainterfazModelBuilder.

HagadobleclickencimadelacajacuadradaUnion.
AparecerlaformaUnionparaespecificarculessonlascapasqueseusarnpara
combinar.
En InputFeatures,hagaclickenelsmbolo enelcualaparecerunalistaque
corresponderconlalistadelayersenlatabladecontenidoenestasesindeArcMap.
EscojavillaElevay villaSlopes.
En OutputFeatureClassescribaC:\ArcTrain\Exer_9\UnionElevSlope.shp

195
En JoinAttributes(optional)escojaNO_FID.Nonecesitamosqueelresultado
combinetambinlosIDinternosdelastablasdeambascapas.
En ClusterTolerance,escriba10yescojaMetersenlalistadeunidadesdemedida.
Seescoge10porquecorrespondeconeltamaodelpxeldelosdatosoriginalesdelamatrizdeelevaciones..

Dejecheck enlaopcin GapsAllowed.EstoevitarqueArcMaprellenealgn espacio


vacoconpolgonossinvalores:algoquequeremosevitar.

PresioneOK.Aparecerlosiguiente:

Elcambiodecoloressirveparanotificaralusuarioqueelmodelo
estlistoparacorrerse.
Elcolorazulindicadatosdeentrada:layers,featureclasses,tablas,
etc.
Lacajacolormostazaindicaelcomando,enestecasoUnion.
Elelipseverdedenotadatosderivados,ennuestrocaso,elresultado
delauninElevacinyPendientes.

Necesitamosaadirlasotrascapasdeinformacin.
Repitaelproceso,arrastrandootravezlaherramientaUniondentrodelespacioenblanco
delainterfazModelBuilder.
HagadobleclickencimadelacajablancaUnion(2).AparecerlaformaUnionpara
especificarculessonlascapasqueseusarnparacombinar:

196

EscojavillAspecty villaLandCovdelalista.
habrnotadoqueaparecernunostemsenazul.Estossonlayers(temporeros).Luego
losusaremos.
En OutputFeatureClassescribaC:\ArcTrain\Exer_9\UnionAspectLandCov.shp
En JoinAttributesescojaNO_FID.
En ClusterToleranceescriba10yescojameterscomounidades.
Dejelaopcin GapsAllowedconcheck.

PresioneOK.VolveralainterfazModelBuilderyverambosprocesosencolores.
Paraarreglarestepequeoreguero,deberseparar
ambosprocesos.

Presioneelbotn

Luegopresione

paraorganizarlos.

paravertodoelmodelo.

197
Deberveralgocomoesto:

Ahoranecesitamossobreimponerelresultadodeambosprocesos:Elevacinconpendientesy
Aspectconcubiertadeterrenos.ParaestosenecesitaotroprocesodeUnion.
RepitaelprocesodearrastrarlaherramientaUniondentrodelainterfazModelBuilder.
Estavezarrstrelademodoquequedealladoderecho,entreUnionyUnion(2):

LosinputparaesteprocesodeUnionsonlosderivadosdelosprimerosdosUnion.
EnModelBuilder,podemoshacerlogrficamentemedianteelbotn
datosconherramientas.

queune

Presioneelbotn
ytireunalneahaciendounaflechadesdelaelipseverdesuperior
(datosderivados)hacialacajaUnion(3).
Enestepuntopuedeaparecerlasiguientepantalla:Escojalaopcin InputFeatures
(Parameter)

198

Hagalomismoconlasegundaelipseverdetirandolalnea(flecha)hacialacajaUnion
(3).
HagadobleclickenlacajaUnion(3).AparecerlaformaUnionendondepodrver
queestavezlosinputestnsimbolizadosenazulconunsmboloparecidoalde
reciclaje .Estosrepresentan layerstemporerosquesolamenteexistenmientrasdure
lasesindeArcMap.
EstosseusanenModelBuilderporquecontienenalgoparecidoaunbosquejodela
informacinoloscamposqueseproyectatenercuandoelmodeloestcorriendo.

Uselasopcionestalcomoaparecenenlapantallasuperior.
En OutputFeatureClassescribaC:\ArcTrain\Exer_9\TempRisk.shp
JoinAtributes:NO_FID
ClusterTolerance:10
unidades:Meters
GapsAllowed:Check

199
PresioneOK.Deberveralgoparecidoaesto:

Esteesunbuenmomentopara
guardarsutrabajo.
VayaalmenprincipaldeModel
Builder.
EnModel,escojaSaveo presioneel
botnSave.

Hastaelmomentosolohemosmodeladolascombinaciones,unirtodoslosinputenunasola
capaquetendrtodaslascombinacionesde:
Tipodeelevacin Tipodeaspect(orientacin)
Tipodependiente Tipodecubierta
Elresultadodaralrededorde72combinacionestomandoenconsideracinqueelreadeinters
(elmunicipio)tienedosrepresas.Sedecidiaadirunaclaseadicionalenelfeatureclass
villaLandCovpararepresentarestasrepresas.
EldirectorioC:\ArcTrain\Exer_9contieneunarchivodbfquecontienetodasestas
combinacionesdecapasmencionadas.
Paraverlatabla,presionelapestaa(tab)Source.
VeralfinalunsmbolorepresentandolatablaconnombreLandSusc.
Sinoapareceestatabla,adalaalatabladecontenidousandoAddData
enC:\ArcTrain\Exer_9\LandSusc.dbf.

.Estatablaseencuentra

HagarightclickencimadelsmbolodelatablayescojaOpen.Aparecerlatabla:

Campos:
E= Elevacin

200
S= Slope
A= Aspect
LC= Cubierta
LCScore=Pesoqueseleasignaalacubiertasegnocurralacombinacinde
carctersticastopogrficas(vaseestudiodeComero,OpenFileReport98566del
USGeologicalSurvey).Vade1a3.Estaeslatabla:
Susceptibilidad a Derrubios

Caractersticas topogrficas

1:baja,2:moderada,3:alta

Cubierta de terrenos
Elevacin

Pendiente

Aspect

Todas
Baja
Baja
Baja
Baja
Baja
Baja
Alta
Alta
Alta
Alta
Alta
Alta

Suave
Moderada
Moderada
Moderada
Empinada
Empinada
Empinada
Moderada
Moderada
Moderada
Empinada
Empinada
Empinada

Todas
Contra
Normal
Decara
Contra
Normal
Decara
Encontra
Normal
Decara
Encontra
Normal
Decara

Bosque

Agrcola

Construida

1
1
1
1
1
2
2
2
2
2
2
2
2

1
1
1
1
2
2
3
2
2
2
2
2
3

1
1
1
2
2
3
3
2
3
3
3
3
3

*Elevacin: baja: <300metros,alta: >300


*Pendientes:suaves: <7grados (prcticamenteplana),moderadas: >7y<12,empinadas: >12
*Aspect: contra: 202.5a292.5grados,decara: 22.2a112.5,normal: 0a22.5,112.5a202.5y292.5a360.

Podrnotarqueenlatabladbfestntodaslascombinaciones. Cadaparteserepresenta
porlaprimeraletradeltipotopogrficoycubierta,lascualesseintegranenelcampo
TypeCombs(Tipodecombinacin).Estecamposerutilizadoluego.
Cierrelatabla.Despuslaabriremosotravez.
Elresultadodetodaslasunionescontendrunaunatablaquetendrloscdigosdeunasolaletra
paracadatipotopogrficoycubierta.Solamentetenemosquecombinarlasenunanueva
columna.ParaestousaremoslasherramientasAddField y CalculateField.
Aadir campo:
VuelvaaArcToolbox.HagadobleclickencimadelacajadeherramientasData
ManagementTools.
HagadobleclickencimadelacajaFields. HagaclickencimadelaherramientaAdd
FieldyarrastrelaherramientadentrodelespacioblancodelainterfazModelBuilder.
Hagaclickenelbotn
paratrazarunaflechaqueconectelaelipseverdeque
contieneelresultadodetodaslasuniones(TempRisk.shp)yunirloconlacajaAdd
Field.
EnlaformaSelectParameterescojaInputTable(Parameter).

201

HagadobleclickenlacajaAddFieldparaqueaparezcalaformayterminarde
completarconlainformacinnecesariaparaaadirunnuevocampoquecontendrel
cdigodeelevacin,pendientes,aspect,ycubierta.
NotequeenInputTableapareceTempRisk.shpconelsmboloazul,querepresentaun
layerenmemoria.
En FieldNamesescribaTypeCombs(talcomoestenlatablaLandSusc.dbf)
En FieldTypeescojaText.
En FieldLengthescriba4.Esteeselnmerodecaracteresquecomponelacombinacin
talcomoseveenlatablaLandSusc.dbf.

PresioneOK.
EnlainterfazModelBuilder,hagaclickenlosbotones
elementosyparacentralizareldiagrama.

paraacomodarlos

Calcular valores para el nuevo campo:


Parallenarelnuevocampoconlosvaloresdecaractersticastopogrficasycubiertausaremos
otraherramientallamadaCalculateFields.Estaherramientaestcontenidadentrodelacaja
Fieldsen ArcToolbox.
HagaclickenlaherramientaCalculateFieldsen ArcToolboxyarrstreladentrodel
espacioenblancoen ModelBuilder.

202

Useelbotnparaconectar
ytraceunaflechadesdeelresultadodelprocesoAdd
Field(elipseverde)hastalacajaCalculateField.
Sepuedecambiarlaformadelconectoraadindolevrticesalalneaconelbotn
:

HagadobleclickencimadelacajaCalculateField.
ApareceralaformaCalculateField.
en FieldNameescojaelcampoTypeCombs.
En Expression,presioneelbotndecalculadora.
Aparecerlalistadecamposquecontendrelfeatureclass.
Debemosconcatenarloscdigosdeloscamposconcaractersticastopogrficasconel
decubierta.Estosehaceconeloperador & and
Concateneloscdigosusandoesteorden:Sinosehaceenesteorden,noservirel
modelo
HagadobleclickenelcampoElevCode
Presioneelbotn &
3
HagadobleclickenelcampoSlopeCode
1
Presioneelbotn &
HagadobleclickenelcampoAspCode
4
Presioneelbotn &
HagadobleclickenelcampoLCCode
2
Lapantalladeberversecomosta:
PresioneOK.

203
LaformaCalculatefieldseveras:

PresioneOKenlaformaCalculateField.
LaventanadeModelBuilderdeberaparecerseasta.

Ademsdehaberaadidoycalculadoelcampoquecontienelascombinacionestopogrficasyla
cubierta,necesitamosasignarleelpesocorrespondienteacadacombinacin.Paralograresto
debemosaadirotrocampo,elcualrecibirlaspuntuacionesolospesoscorrespondientesacada
unadelas72combinaciones.Estascombinacionesyahansidocalculadasenlatabla
LandSusc.dbf.
Repitamoselproceso,solamenteparaaadiruncampo. VuelvaaArcToolboxyhaga
clickyarrastrelaherramientaAddFieldhaciaunespacioenblancodisponibledentro
delModelBuilder.
EnModelBuilder,hagadobleclickencimadelacajaAddField(2)queacabadeaadir.
Uselaherramienta
Field.

ytraceunalneadesdelaelipseverdealaderechadeCalculate

204

Escojalaopcin InputTable(Parameter)enlaformaSelectParameter.
HagadobleclickencimadelacajaAddField(2).
En FieldNameescribaHazardRank.(RangodePeligrosidad)
En FieldType,escojaSHORT.Losvaloresestnentre0 ytres..
PresioneOK.
Esteesunbuenpuntoparaguardarelmodeloyhaceralgunasmodificaciones.

Cambiar el nombre del modelo:


EnModelBuilder,vayaalmenprincipalyhagaclicken Model|ModelProperties.
Presioneeltab Generalyen Name:escribaDeslizamientos.
En Label:escribaDeslizamientosporlluvias.
En Description:escribaModeloparaevaluarriesgodedeslizamientodetierras
causadoporeventosprolongadosdelluvia.
PresioneOK.
Presioneelbotn Save.NotecmocambiaelnombredelmodeloenArcToolboxyen
ModelBuilder.

Especificar que se borren los archivos intermedios:


Pordefecto,ModelBuilderasignaautomticamentecomoarchivointermedioalosresultadosde
procesosintermedios.Paracomprobarlo,hagarightclickencadaunadelaselipsesala
izquierdadelprocesofinalyverqueestnmarcadascomoIntermediate:

205
Parahacerqueseborrenlosarchivosintermedios,vayaalmenprincipalyescoja
Model|DeleteIntermediateData.
PongacomoIntermediatealosresultadosdeUniony Union(2).
PresioneSave.
Hacer que el resultado del modelo aparezca en ArcMap:
Porconveniencia,estilqueModelBuildertraigaelresultadoautomticamente.
Hagarightclickenlaelipse,aladerechadelprocesoUnion(3).
EscojaAddToDisplay.
Antesdecorrerelmodelorepasemos:
Paraelmodelodedeslizamientos,tenemoscuatrocapas,tresdeellasconcaractersticas
topogrficas(elevacin,pendientes,orientacin)ylacapadecubiertedelterreno.Las
combinaremosmediantelaherramientaUnion.Alresultadoleaadiremosdoscamposnuevos:
unoquecontengaloscdigosconlascombinacionesyotro(vaco)querecibirlaspuntuaciones
deriesgo,deceroa3.
Parmetros:
Sehabamencionadoquelosmodelossonreciclables.Parahacerqueestemodelopuedausarse
enotroslugaresoconotrosarchivos,solamentetenemosquedefinirlosinsumoscomo
parmetrosdelmodelo.EstosehaceenModelBuilderhaciendorightclickencimadelaelipse
azulydefinindolacomoun parmetro.ModelBuilderlepondrunaetiquetaPpara
distinguirladelasdems.
Hagarightclickenlaelipsesuperior,alladoizquierdodeModelBuilder.
EscojaModelParameter.
Repitaelprocesoconlasdemselipsesazulesalladoizquierdo.
Presioneelbotn Save.
VayaaArcToolboxyhagadobleclickencimadeliconodelmodeloquehaestado
trabajandohastaahora.Notelosiguiente:

losnombresdeloslayersserepitenenloquedebeserelnombredelparmetro.Esto
noesnadaqueafecteeldesempeodelmodelo.Sinembargo,pormantenerlascosas
claras,esrecomendablecambiarelnombredelaetiquetadelparmetro(nodelarchivo
ofeatureclass).

206

PresioneCancelyvuelvaalaventanaModelBuilder.
Paracambiarlaetiquetadelparmetrohagarightclckenelprimeroalaizquierda,de
arrribahaciaabajo(VillaLandCov)yescojaRename
EnlacajadetextoescribaLandCover(Cubierta).PresioneOK
En villAspectrepitaelprocesoconrightclickyescribaAspect(Orientacin).
En villaSlopescambieaSlopes(Pendientes)
En villaElevacambieaElevation.
Presioneelbotn Save.

Correr el modelo:
Elmodeloestlistoparacorrerse.Enestepuntoesimportantehacersaberqueelmodelopuede
correrseporprocesooensutotalidad.
ParacorrerelmodeloporprocesohacemosrightclickencadaprocesoyescogemosRun.
ParacorrertodoelmodelousandoModelBuilderpodemosiralmenprincipalyescoger
Model|RunEntireModel.
DesdeArcToolbox,hacemosdoblepickencimadeliconodelmodelo,aceptamosocambiamos
losparmetrosyhacemosclickenOK.
Correremoselmodelocompleto.EnArcToolboxhagadobleclick,aceptelosparmetros
ypresioneOK.

Estacajaindicaqueseestefectuandounproceso.
Cuandotodoelmodeloterminedeserprocesadoel
botnCancelcambiaraCloseparacerraresta
ventana.
Elprocesopuededemorarvariosminutos,dependiendo
delavelocidaddelprocesadorodeldiscodurodela
computadora.

Poralgunarazn(desconocida)almomentodehaceresteejercicio,elresultadonose
desplegenArcMap,aunquesaparecieneldirectoriodetrabajoC:\ArcTrain\Exer_9.
Noobstante,podemoscontinuar,aadiendoelfeatureclassproducido.Estesellama
TempRisk.shp.Localceloen C:\ArcTrain\Exer_9ytrigaloaArcMapusandoel botn
AddData

UnaveztengaelfeatureclassproducidodentrodelatabladecontenidodeArcMap,abra
sutabladeatributos:

207
rightclickencimadelnombreTempRisky OpenTableparaverloscdigosdel
campoTypeCombs.VertambinqueelcampoHazardRank solamentetiene
valoresconcero.
EstecampolocalcularemosmanualmenteusandolaCalculadoradeAtributos(Field
Calculator)
ParacalcularlosvalorescorrespondientesacadacombinacinenelcampoHazardRank
necesitaremosusarlatablaLandSusc.dbf.
HagarightclickencimaencimadeTempRiskyescojaJoinsandRelates|Join
UseloscamposTypeCombsenambastablasparaunirlasenunarelacin1:1:
En1.EscojaTypeCombs
En2:EscojalatablaLandSuscquehabamosvistoantes.
En3:EscojaelcampoTypeCombsdelatablaLandSusc.

PresioneOK.
Silatabladeatributosde TempRisknoestabierta,brala.Vercmoparearonlas
lneasdecadaunadelascombinacionesexceptoporalgunaspocasquenotienen
cdigoscompletos(4letras).
EnestaparteesimportanteexplicarqueelmodelopodasercompletadoensutotalidaddesdeModel
Builder.Sinembargoestospocosrecordsquenopareancausanunerrorenlaaplicacinynopermiten

208
quesecalculeelmodeloautomticamente.Habamosindicadounatoleranciade10 metrosparatratarde
eliminarpolgonossinsignificacinperoestonoimpidiquesalieranalgunospolgonossincdigos
completos.
Detodosmodos,noestmalverelresultadoparcial,explorarsucontenidoypracticarcmocalcular
valoresenlatabla.
Paracompletarestepasoseranecesario:
*Generarunlayertemporeroquerecibalosvalores(MakeFeatureLayer)
*UnirlatablaLandSuscconlatabladeatributosdelLayer(AddJoin)
*CalcularlosvaloresenelLayerusandolosvaloresdesignadosenelcampoLCScoredelatabla
LandSusc.dbf(CalculateField)
*Finalmente,convertirelLayerenunfeatureclassnuevo(CopyFeatures)
Lapartequefaltadelmodeloseveraas:

Volviendoalmodeloquetenemos,necesitamoscalcularlosvalorescorrespondientesderiesgo
segnlacombinacintopogrficaycubierta.Yaquetenemoslastablasunidas:
VayaalatabladeatributosdeTempRiskyhagarightclickenelcampo
TempRisk.HazardRank.
EscojaCalculateValues.Apareceresteaviso:

Estoesparaindicarlequeestfueradeunasesindemodificacinyquenopodrir
atrsenesteproceso.Estonoescrticoporquecalcularemostodoslosvaloresalavez.
PresioneYes.
HagadobleclickenelcampoLandSusc.LCSCOREypresioneOK.Aparecereste
mensajedeerror:

209

Estesurgeporquehayrecordsquenopareanconotros.PresioneYesparaquecalcule
todoslosdems.
Unavezterminedecalcular,inspeccionelosvaloresdelatabladeatributos.
Hagarightclicken ellayerTempRisk (enlatabladecontenido)y escojaJoinsand
Relates|RemoveJoin(s)|RemoveAllJoins.
Paravercmoserelfeatureclassderiesgos,esbuenaidearepresentarlosvalorescon
tonalidadesdegris,segnelorden.
Blancoparacero
Gris20% paravalor1(bajoriesgo)
Gris50% paravalor2(moderado)
100%negroparavalor3(altoriesgo)
Hagarightclicken TempRiskyescojaProperties.
Presioneeltab SymbologyyescojaCategories
En ValueFieldescojaHazardRank.
Presioneelbotn AddAllValuesparaqueaparezcanloscdigosconsuscajasypoder
cambiarloscoloresdeestossmbolos.
Hagadobleclickencadacuadroparacambiarleelcolor,segnelnmerodescritoarriba:
usecualquierotrocolorparalosnopareados<NULL>
PresioneOK.

210
Inspeccioneelmapa.Notarquecadacategorasecomponedemuchospolgonos.
Esrecomendableagregarcadacategoraparahacermssencilloestefeatureclass.

Paraagregar(integrar)datossegnsuvalorusaremoselcomandoDissolve,disponibleen
ArcToolbox enlaseccin Generalization.
Hagamosotromodeloquecontengaestecomando.Pormssencilloqueparezcaes
prcticotenerelprocesoenunmodeloparausoposterior.
HagarightclickenlacajadeherramientasnuevaAnalisis.EscojaNew|Model.
ParaaadirlaherramientaDissolve,localcelaen DataManagementTools|
Generalization.
HagaclickyarrastrelaherramientaDissolvedentrodelespacioenblancodeModel
Builder.
HagadobleclickenlacajaDissolve.AparecerlaformaDissolve.
En InputFeaturesescojaTempRisk.
En OutputFeatureClassescribaC:\ArcTrain\Exer_9\DerrubioRiesgo.shp
Esteserel mapafinalderiesgoporDeslizamientodetierras.
En DissolveFieldescojaconcheckelcampoHazardRank.

211
Hagauncheck enlaopcin Multipart.Queremosquecadarearesultanteynocontigua
estseparada.
PresioneOK.
TempRisk

Cambieelnombredelmodelo.VayaalmenprincipalyescojaModel|Model
Properties.
HagaclickenGeneralyescribaGeneralizaRiesgoen Nameyen Label.
PresioneOK
HagarightclickenlaelipseazulymrquelacomoModelParameter
Hagarightclickenlaelipseverde.
QuiteelcheckIntermediateyhagacheken AddtoDisplay.
Presioneelbotn Save.
Presioneelbotn Run>.
NotarquelacajaDissolvecambiaacolorrojo.Estosignificaqueelprocesoest
corriendo.
TempRisk

Alfinalsesuponequeaparezcaelnuevofeatureclassyelmodelotengasombrasenlos

212
elementosDissolveylaelipseverde.
TempRisk

Uselasopcionesdesimbologapararepresentarlosnivelesdepeligrosidad.

Separeceestefeatureclassalacombinacinvisualquesemostralprincipio?______
Enqusediferencian?____________________________________________________
EstodemuestralacapacidaddeunGISdecombinarinformacindemaneraquesepueda
ponderardistintosvaloresparadistintostiposdecombinaciones.
Seleccin por zonas:
Paraelgobiernomunicipal(OficinadeManejodeEmergencias),nosolamenteesdeinters
saberculessonlaszonasenaltoriesgosinotambincuntasedificacionesseafectarnporestar
enestaszonas.TenemosunarchivodepuntosquerepresentalasedificacionesenVillalba
(villaBuilds).Estearchivoseactualizusandounaortofotoareade2004.
EnArcMap,hagavisibleelfeatureclassvillaBuilds.Vealadistribucindelosedificios
sobreelmunicipio.
PodemosusarlasherramientasdeArcToolboxparahacerunresumenenelcualaparecerel
nmerodeedificios(puntos)porcadacategoraderiesgo.
Haremosdosprocedimientosenestaparte:
1. UsaremoselcomandoIntersectparacalcularlaInterseccingeomtricaentredos
featureclasses:
villaBuilds(edificios)y DerrubioRiesgo(zonasdeintensidaddepeligro)
Lainterseccineslacoincidenciageomtricaentredoscapas:
1

1A

3
3C
2

2B

4
4D

INTERSECCIN

RESULTADO

CampoMapa1
1
2
3
4

CampoMapa2
A
B
C
D

2. UsaremoselcomandoSummaryStatistics(resumenestadstico)parahacerun
conteodeedificiosporcategoraderiesgo.Enestecomandoseusarlaopcin

213
CASE,pararesumirporcategora.
VuelvaaArcToolboxyaadaotromodelo,haciendorightclickencimadelapalabra
Analisis.
EscojaNew|Model.AparecerlainterfazModelBuilder.
ExpandalacajadeherramientasAnalysisToolsybusqueelcomandoIntersectdentro
delacajadeherramientasOverlay.
HagaclickencimadeIntersectyarrastreestecomandodentrodelespacioenblancode
ModelBuilder.
EnModelBuilderhagadobleclickenlacajablancaIntersect.
En InputFeatures,escojadelalistaelfeatureclassdepuntos(villaBuilds),seguidodel
featureclassdeRiesgo(DerrubioRiesgo).
EnlaparteOutputfeatureClass,escriba
C:\ArcTrain\Exer_9\villaBuildsEnRiesgos.shp
En JoinAtributes,escojaNO_FID.
En ClusterTolerante,escriba10yunidadesenmetros.
En OutputType,escojaINPUT.Estaopcinpreservaeltipodegeometradelprimero
delosinsumos.Suformadeberverseas:

214
PresioneOK.
LainterfazModelBuilderseveras:

Ahora,parahacerelresumenporcategoras,usaremoselcomandoSummaryStatistics,bajo
AnalysisToolsy Statistics.
HagaclickenSummaryStatisticsyarrastreestecomandodentrodeModelBuilder.
HagadobleclickenlacajaSummaryStatistics.AparecerlaformaSummary
Statistics.
En InputTableescojaellayervillaBuildsEnRiesgos.shpenazul.
En OutputTableescribaC:\ArcTrain\Exer_9\EdifRiesgoPorZonas.dbf
NoaadanadaenStatisticsField(s).Loquenosinteresaesresumirporcategoraypara
esoestlasiguienteseccin.

215
En Casefield,escojaHazardRank.
Suformadebeverseas

PresioneOK.
Presionelosbotones
sucesivamenteparaarreglareldiagramayparaverlotodo
enpantallaycentralizarlo.
HagarightclickencimadelaelipseEdifRiesgoPorZonas.dbf
qutelelaopcin IntermediateyescojaAddToDisplay.
HagarightclickenlasdoselipsesazulesyescojaModelParameter paraconvertirlasen
parmetros.
Antesdeguardarelmodeloparacorrerlo,vayaalmenprincipalen Model|Model
Properties.
Hagaclickeneltab General.
En NameescribaEdificiosPorZonasRiesgo
En Label escribaResumenEdificacionesporzonasderiesgo
En Description,escriba:
Resumecuantosedificios(puntos)estnencadatipodezonaderiesgopor
deslizamientoscausadosporlluvia
PresioneOK
Corraelmodelousandoelbotn Run>.

216
CierrelaventanadeavisosobreelprocesoyvayaalatabladecontenidodeArcMap.
Presioneeltab Source.VerlatablaEdifEnRiesgoPorZona.dbf.
AbralatablahaciendorightclickencimadelnombreyescojaOpen.
Verlatablaresumenconel desglose,conlosedificiossumadosporcategorade
riesgo.
Cuntosedificioscayeronenzona0?_____________
EnZona1___________
EnZona2___________
EnZona3___________
Sesuponequelazona0correspondaalasrepresas(riesgonoasignado).Unnmero
mnimodepuntoscayenestazona.Aqusedebequesehayanregistradoestos
casos?______________________________________________________________
____________________________________________________________________
(recuerdeelprocesamientounionyagujerosnogaps)
ConesteresumenlaagenciadeManejodeEmergenciaspuedetenerunaideadeculessonlos
edificiosqueestnenestaszonasderiesgo.
Esciertoqueporexperiencia,eltcnicodelaagenciaconocelasreas,pero,laspuede
delimitardeestamanera?Esteexperimentopuedeconfirmaronosuexperiencia.Despusde
todoaveceslacienciasebasaenexperienciacuantificada.

Estoterminaelejercicio.

Sitienetiempo,considerelosiguiente:
EnlosdistintosartculosdeLarsenyotros(USGeologicalSurvey),seestablecequela
proximidadasurcosproducidosporeventosdelluvia,(corrientesefmeras)sonzonasdealto
peligrotambin.Larsenestableceunmargendeproximidadde10metroscomopotencialmente
peligroso.
Uselaherramientadeproximidad(buffer)pararepresentaresteespaciode10metrosa
cadaladodecorrientesdeaguaefmeras.Existeunfeatureclassdecorrientesefmeras
paraestepropsito.
Recuerdeintegrarlosbuffersadyacentesdisolviendobordescomunes.
Tambinseencontrquelascarreteras,queenmltiplescasosafectanlatopografalocal,son
zonasdealtoriesgo.Elumbralencontradofuede85metrosacadaladoenpendientesmayores
de4gradosyenzonasmayoresde300metros. Produzcaunnuevomodeloconlassiguientes
especificaciones:
Repitaelprocedimientoparaesterenglndecarreteras.

217
o NecesitarusarelcomandodeanlisisSelectparaextraerlasreascuyapendientees
de7gradosoms,yotroselectparaextraerlaszonasaltas>300metros.
o UseUnionparaunirlosresultadosdeambosselects
o UseDissolveparacrearunazonanica:reasaltasquealaveztenganpendientes
moderadasaaltas.
o UseClipusandoelresultadodeestedissolveparaeliminarlascarreterasquequeden
fueradeestazona.
o EntoncespodrusarlaherramientaBuffer paraelanlisisdeproximidadde85
metrossobrelascarreteras. (Uselaopcin All)
Podrvisualizarlaszonasde85metrosacadaladodelascarreteras
Cuntosedificiosestnenestaszonasdeproximidaddelascarreteras?
o UseelcomandoSelectdentrodeestemodeloparaenumerarlas
Cuntosestnenaltoriesgo,enlazonadeproximidadacarreteras(7gradosoms)yen
laszonascercanasacorrientesefmeras? Usela(s)herramientascorrespondientes.
CalculeelreadecadapolgonoenelfeatureclassDerrubioRiesgo.shp.
Pararesumirzonasporreadentrodelmunicipio,uselaherramientaClipoIntersect
parasepararlaszonasderiesgoenVillalbadelosdemsmunicipios.
Slorestacomprobarelmodelo,revisandolugaresquepresentandeslizamientostantoen
fotosareasdedistintaspocas,medianteviajesdecampo,omedianteinformes
existentesenlasagenciasregionalesdeManejodeEmergencias.

218

Apndice:
Advertencia:Elresultadodeesteejercicioessolamentedeutilidadparaconoceralgunasdelas
capacidadesdeanlisisgeogrfico,quetieneelprogramaArcGISversin9.1.Aunquenuestra
informacinbasecumpleconlosestndaresdecorreccincartogrficadelosEstadosUnidos,no
necesariamenteendosamoselusodelresultadodeesteejercicioparaelmunicipiodeVillalba
Explicacinsobrelascapasdeinformacinqueseusaronparaesteejercicio.
Nombredelshapefile Tema
Cmosederiv
villaBuilds
Edificios
Tomamoscomopartidalashuellasdeedificiosdel
mapabasedecatastrodelCentrodeRecaudacin
deIngresosMunicipales(CRIM).Seextrajoel
centroidedecadareaysellenarondoscampos
conlacoordenadaXYdecadarea.
ElmapadepuntosseprodujousandoTools|Add
XYDataenArcMap,yposteriormenteseguard
enunshapefile.
villaRoads
Carreteras,
Esunaversindegradadadelmapadecentrosde
callesycaminos calledelmapabasedelCRIM.
villaNonPerenStreams Corrientes
Seusunmodelodeelvacindigitalparaextraer
efmerasde
unamatrizdeflujodeaguasuperficialusando
aguasuperficial ArcInfoGRID.
villaDrain
Hidrografa
Mapahidrogrficoconrepresas,pantanos,ytodas
lascorrientesdeagua,permanentesy efmeras.
villaLandCov
Cubiertade
Seusunprocesadordeimgenes(Imagine8.7)
terrenos
parahacerunaclasificacinnosupervisada.La
versinAdvantagedeesteprogramado,no
contieneelmduloconotrametodologa
(supervisada,etc).Finalmente,tuvimosque
refinarelresultado,porquelaclasificacionoriginal
mezcllosvaloresespectralesdebosqueconlos
depastosyzonasagrcolas.

villAspect

Orientacinde
lapendiente

Pararefinarlaclasificacinusamoslafotografa
areadisponiblede2004.Sobreestafotose
trazaronmltlipesreasagrcolasydepastos.Vea
lamatrizdeerroralfinaldeestedocumento.
Elpuntodecomienzoeselnorte,alquesele
asignaelvalorcerogrados.Losvaloresaumentan
afavordelasmanecillasdel reloj,terminandoen
360.
EsteshapefileseprodujousandoManifold6.5
SurfaceToolsderivndosedelarchivode
elevaciones.UsandolaherramientaContoursse
reclasificyexportsimultneamenteaformato

219

villaSlopes

Pendienteen
grados

villaEleva

Elevacinen
metros

villaoi

readeinters

LandSusc.dbf

Combinaciones

vectorial.Estearchivovectorialfueexportadoa
shapefileparasuusoenArcGIS.
Elarchivomatricialdependientessinclasificarse
derivdelarchivodeelevaciones.
AligualqueelarchivodeAspect,seusaronlas
mismasherramientasenManifold6.5para
exportarelresultadoenshapefileaArcGIS.
Tambinprovienedeunprocesoanteriorhechoen
Manifold6.5,deigualformaqueelarchivode
Aspectypendientes.
Elarchivooriginaldeelevaciones,seimporta
Manifolddesdeunarchivoexportfile(.e00)de
ArcInfoGRID.
Delimitaelreadeestudioyprovienedeun
cuadrodibujadoarbitrariamentetomandoen
consideracinlaextensinmunicipaldeVillalbay
unespacioreducidoparasusalrededores.
Contienelas72combinacionesresultantesde
caractersticastopogrficasyeltipodecubiertade
terrenos.Seglacombinacindecaractersticas,
seleasignaunfactordepesoentreceroytres.
VaseestudiosdeLarsenyotros,incluidosenlos
datosdigitales.

220

Estimadodeerrordelacubiertadeterrenos:
Serealizunmuestreosistemticoaleatoriotomando10puntosporcategora,exceptolas
represascon4.Cadagrupode10ocuatropuntosfueronubicadosalazar.Basadoeninspeccin
visualdelafotollegamosaestamatrizdeerrorentreloclasificadoenelmapadecubiertaylos
valoresencontradosenlafotoarea.
Matrizdeerrorenlaclasificacin:
Clasificacinenlafotoarea
Bosques Pastos/Agric Represa Construido/
Expuesto
suma
Bosques
9
2
11
Pastos/Agric
1
8
1
10
Represa
4
4
Construido/Expuesto
9
9
suma
10
10
4
10
34
Clasificacinenel
mapa

Valorenladiagonal(puntosconpareocorrectofoto/mapa):30
Porcentajedeerror:4/34(11.76%)
Certeza:88.23%

221
Referencias:
ProgramaArcView:
Kasianchuk,P.Taggart,M,IntroductiontoArcGIS1ESRI,RedlandsCalifornia,EEUU.
Minami,M.UsingArcMapversion8,ESRIPress,Redlands,California
Ormsbyetal.GettingtoKnowArcGISDesktop,version8,ESRIPress,Redlands,California
McCoy,J.GeoprocessinginArcGISversion8,ESRIPress,Redlands,California
Mitchel,A. TheESRIGuidetoGISAnalysis,ESRIPress,1999,RedlandsCalifornia
SistemasdeInformacinGeogrfica:
Burrough,P.,McDonnel,R. PrinciplesofGeographicalInformationSystemsOxfordUniversityPress,
1998,NewCork.
Programacin:VBScript:
Lomas,P.,etal.VBScriptinaNutshell 2ndEd.,OReilly,2003,Sebastopol,California.
Cartografa/Diseogrfico:
Williams,R. TheNonDesignersDesignBook PeachpitPress,Berkeley,California
AnlisisgeogrficoEstudiosdedeslizamientosdetierra:
Larsen,M.Torres,ngel.Thefrequencyanddistributionofrecentlandslidesinthreemontanetropical
regionsofPuertoRico.Geomorphology,24(1998)pp309331
Larsen,M.etal.MapShowingSusceptibilitytoRainfallTriggeredLandslidesintheMunicipalityof
Ponce,PuertoRico,ScientificInvestigationsMapI2818.USGeologicalSurvey,CaribbeanDistrict,
Guaynabo,PuertoRico.
Larsen,M.Parks,J.MapShowingLandslideSusceptibilityintheComeroMunicipality,PuertoRico.
OpenFileReport98566,USGeologicalSurvey,CaribbeanDistrict,Guaynabo,PuertoRico
Monroe,WH.MapshowinglandslidesandareasofsusceptibilitytolandslidinginPuertoRico. US
GeologicalSurveyMapI1148,scale1:240,000,1sheet.
Marsh,W. LandscapePlanningEncironmentalApplications,3edicin,Wiley&Sons,1998NewCork,
NYChap34.
Estadsticas,errorestadstico,muestreo:
Eastman,J.E.etal. GISandDecisionMaking:ExplorationsinGISTechnologyUnitedNationsInstitute
forTrainingandResearch(UNITAR),1993,Ginebra,Suiza.
SnchezViera,J. FundamentosdelRazonamientoEstadstico,CentroCaribeodeEstudios
Postgraduados,1988,SanJuan,PuertoRico.

AgradecemosaMatthewLarsendelUSGeologicalSurveyporsucontribucinalaseccindeanlisis
geogrficopormediodesuspublicacionesylascontestacionesanuestraspreguntas.