Está en la página 1de 303

TCNICASINTEGRADASSIMPLIFICADASEN

LASETAPASPREVIASDELANLISIS

AMBIENTALCONELUSODESISTEMAS

SUPRAMOLECULARES

TESISDOCTORAL
NoeliaLuquePlata
Crdoba,Juliode2012

TITULO: TCNICAS INTEGRADAS-SIMPLIFICADAS EN LAS ETAPAS


PREVIAS DEL ANLISIS AMBIENTAL CON EL USO DE SISTEMAS
SUPRAMOLECULARES
AUTOR: NOELIA LUQUE PLATA
Edita: Servicio de Publicaciones de la Universidad de Crdoba.
Campus de Rabanales
Ctra. Nacional IV, Km. 396 A
14071 Crdoba
www.uco.es/publicaciones
publicaciones@uco.es


TCNICASINTEGRADASSIMPLIFICADASENLASETAPASPREVIAS
DELANLISISAMBIENTALCONELUSODESISTEMAS
SUPRAMOLECULARES

MemoriapresentadaparaaspiraralgradodeDoctorpor
LADOCTORANDA,
quelofirmaenCrdoba,a2deJuliode2012

Fdo.:NoeliaLuquePlata
LicenciadaenCienciasAmbientales

ConelVBde
LADIRECTORA,

Fdo:Dra.Soledad.RubioBravo
CatedrticadelDepartamentodeQumicaAnaltica
delaUniversidaddeCrdoba

TTULO DE LA TESIS: TCNICAS INTEGRADASSIMPLIFICADAS EN LAS ETAPAS


PREVIAS DEL ANLISIS AMBIENTAL CON EL USO DE SISTEMAS
SUPRAMOLECULARES.

DOCTORANDO/A:NOELIALUQUEPLATA

INFORMERAZONADODEL/DELOSDIRECTOR/ESDELATESIS

Las investigaciones que se incluyen en esta Tesis Doctoral han tenido como
objetivo general simplificar e integrar las diferentes operaciones que constituyen la
etapa de tratamiento de muestras ambientales haciendo uso de disolventes y
adsorbentes supramoleculares. Se ha demostrado que estos sistemas extractantes
proporcionandiferentesmicroambientesdentrodesuestructuratridimensionaldonde
seincrementalaestabilidaddelamayoradeloscompuestosorgnicos.Estapropiedad,
unidaalagrancapacidaddeextraccindelossistemassupramoleculares,derivadade
losdiferentestiposdeinteraccionesqueestablecenyelgranelgrannmerodecentros
enlazantes que ofrecen, y su compatibilidad con cromatografa de lquidos y distintos
sistemas de deteccin, han hecho posible el desarrollo de metodologas analticas
simplesyrpidasparaladeterminacindecontaminantesprioritariosyemergentesen
muestrasambientales.Losobjetivoscientficosconcretosqueseplantearonaliniciode
laTesisfuerondosyenellossehacentradolalabordeladoctorandaDa.NoeliaLuque
Plataduranteeldesarrollodelamisma.

Elprimerobjetivotuvocomofinalidadexplorarlacapacidaddelosdisolventes
y adsorbentes supramoleculares para integrar las etapas de extraccin, estabilizacin,
preconcentracin y limpieza de contaminantes prioritarios. Se ha incidido en aquellos
contaminantes para los que las metodologas convencionales no ofrecen respuesta
adecuada para su monitorizacin en campaas ambientales en las que se requiere la
recogida y anlisis no inmediato de un gran nmero de muestras. Estos estudios han
permitido el desarrollo de tres mtodos analticos para la determinacin de

tensioactivos de benzalconio, hidrocarburos aromticos policclicos y plaguicidas en


aguasnaturalesyresiduales.

Elsegundoobjetivofuedesarrollarnuevasmetodologasbasadasenagregados
supramolecularesparaladeterminacindecontaminantesemergentes,concretamente
sustancias perfluoroalquiladas, en muestras biolgicas. Como resultado se pusieron a
punto dos mtodos simples, rpidos y con elevado rendimiento de extraccin para la
determinacindeestassustanciasentejidosdeavesypecesysuerosanguneo.Eneste
contexto, se desarroll una nueva metodologa para eliminar o reducir
considerablemente el efecto espacio carga frecuentemente presente en la
cuantificacin de contaminantes en muestras ambientales cuando se usa
espectrometrademasascontrampainica

Las investigaciones realizadas se han materializado en la publicacin de 5


artculos en revistas del primer decil del rea de Qumica Analtica (4 artculos en J.
Chromatogr.Ay1artculoenAnal.Chim.Acta)yenlapresentacinde9contribuciones
aCongresos,5internacionalesy4nacionales.LaDoctorandahaobtenidoelDiplomade
Estudios Avanzados dentro del programa de doctorado de Qumica Fina, con mencin
de calidad, que se imparte en la Universidad de Crdoba, obteniendo la mxima
calificacinenlasasignaturascursadasyeneltrabajodeinvestigacinpresentado.

Teniendo en cuenta la originalidad y extensin del trabajo de investigacin


realizadoylaformacinadquiridaporDaNoeliaLuquePlatadurantelarealizacinde
laTesisDoctoral,ladirectoradeestetrabajoautorizasupresentacin.

Portodoello,seautorizalapresentacindelatesisdoctoral.

Crdoba,a2dejuliode2012

Fdo.:SOLEDADRUBIOBRAVO

D Soledad Rubio Bravo, catedrtica del Departamento de Qumica


Analtica de la Universidad de Crdoba, en calidad de Directora de la Tesis
DoctoralpresentadaporlalicenciadaenCienciasAmbientales,D.NoeliaLuque
Plata,

CERTIFICA:QuelacitadaTesisDoctoralTcnicasintegradassimplificadasenlas
etapaspreviasdelanlisisambientalconelusodeagregadossupramoleculares
seharealizadoenloslaboratoriosdelDepartamentodeQumicaAnalticadela
Facultad de Ciencias de la Universidad de Crdoba y que, a mi juicio, rene
todoslosrequisitosexigidosaestetipodetrabajo.

Y para que conste y surta los efectos pertinentes, expide el presente


certificadoenCrdoba,2dejuliode2012.

Dra.Soledad.RubioBravo
CatedrticadelDepartamentodeQumicaAnaltica
delaUniversidaddeCrdoba

A mis padres,
que me lo han dado todo

Mis Agradecimientos:
En primer lugar quiero agradecer a M Dolores Prez Bendito y
Soledad Rubio Bravo la oportunidad que me dieron de formar parte de su
grupo de investigacin.
Asimismo, agradezco al Ministerio de Educacin y Ciencia la
concesin de una beca de Formacin de Profesorado Universitario (FPU), con
referencia AP-2004-3644, que me ha posibilitado la dedicacin a esta Tesis
Doctoral durante cuatro aos, as como el apoyo econmico del grupo de
investigacin FQM-186 que ha cubierto el resto del tiempo necesario hasta la
finalizacin de la misma.
Gracias a todas aquellas personas que han dedicado parte de su tiempo
a ensearme conocimientos de Qumica Analtica y sobre todo a investigar.
Mencin especial merece Ana Ballesteros por guiarme tan acertadamente en
nuestros ltimos trabajos de perfluoros y bisfenol A.
Estoy profundamente agradecida a todos mis compaeros y amigos
analticos por los momentos de discusin de resultados y bsqueda de
soluciones, por animarme y ayudarme cuando ya no poda ms, por las risas,
peroles, cafs y cervezas compartidas y por su paciencia conmigo. He
aprendido de todos, habis sido suelo en mi camino diario y peldaos en mis
ascensos durante esta etapa de mi vida. Me llevo grandes amigos y solo por eso
ya ha merecido la pena esta Tesis Doctoral. Sin nimo de ofender a nadie no
puedo pasar este prrafo sin nombrar a 4 analticos especiales para m. A
Antonio por sus infinitos consejos, por ser un amigo de verdad, de esas
personas tan honestas y tan autnticas que son difciles encontrar, que suerte
haberte conocido . A Amalia por llenar de alegra nuestro cuartito, por bailar
Jamiroquai como una loca o cantar La llorona de Chavela Vargas esas tardes
en las que las experiencias parecan no tener fin, porque hemos redo y llorado
muchas veces juntas y porque siempre te llevo en mi corazn. Y a Francisco y

Anita porque en los ltimos aos he pasado ms tiempo con ellos que con mi
familia y ya se sabe que el roce hace el cario!... y por muchas cosas ms que
no hace falta explicar me siento muy unida a vosotros dos.
Y no pueden faltar en estos agradecimientos mis nias y Rafita y
todos mis amigos fuera del labo (Eu y Mari vosotros tambin estis
incluidos), expertos muchos de ellos en coacervacin y espectrometra de masas
de tanto escuchar mis problemas analticos!. Como olvidar esas meriendas tan
riquisimas en Casa Molina-Barranco (centro neurlgico de operaciones), esas
etapas de senderismo que reconfortan cuerpo y alma despus de horas
caminando a vuestro lado, esas veladas en el bar de mi cochera despus de un
duro da de trabajo, esos conciertos de Take That en primera fila que pasamos
Lolita y yo todo un ao planeando, esos cumpleaos todos juntos y
ltimamente tambien bodas en definitiva mil gracias por estar siempre a mi
lado ao tras ao compartiendo las alegras y las penas, porque everything

changes but you Os quiero mucho, qu triste sera mi vida sin vosotros!
Gracias a mi Sito por soportarme, apoyarme y animarme en los
momentos de desanimo que no han sido pocos. Y sobre todo gracias por tener
tanta fe en mi, por quererme tal y como soy y por hacerme tan feliz.
Y a mis abuelos y mi hermano por estar siempre ah.
Por ltimo eternamente agradecida a mi amado y castigado planeta
Tierra por proporcionarme folios donde poder imprimir esta Tesis, energa para
encender mi ordenador, caf para despejarme y aire para poder respirar. Con la
esperanza de que algn da todos los recursos naturales estn protegidos y
alcancemos el desarrollo sostenible, because the earth matters.
Gracias a todos,

Noelia.

NDICE
OBJETO ...............................................................................................................1
CONTENIDO........................................................................................................7
INTRODUCCIN................................................................................................11
1. ANLISISAMBIENTAL:MARCOLEGISLATIVO...........................................13
2. RETOSYTENDENCIASENELANLISISAMBIENTAL .................................23
2.1.

Aspectosgenerales................................................................... 23

2.2.

Muestreoambiental................................................................. 25

2.3.

Preparacindemuestrasambientales..................................... 30

2.3.1.

Muestrasacuosas..................................................................... 30

2.3.1.1. Extraccinenfaseslida .......................................................... 30


2.3.1.2. Disolventessupramoleculares ................................................. 46
2.3.2.

Muestrasslidasambientalesybiolgicas .............................. 62

2.3.2.1. Tcnicasasistidasporenergasauxiliares ................................ 62


2.3.2.2. Dispersindelamatrizenfaseslida...................................... 64
2.3.2.3. Microextraccinenfaseslida................................................. 66
2.3.2.4. Disolventessupramoleculares ................................................. 67
2.3.3.

Compuestosvoltilesysemivoltiles....................................... 71

2.4.

Tcnicasdeseparacinydeteccin ......................................... 75

2.4.1.

Cromatografadegases/espectrometrademasas. ................ 75

2.4.2.

Cromatografadelquidos/espectrometrademasas. ............ 76

2.4.3.

Electroforesiscapilar. ............................................................... 79

PARTE I: SISTEMAS SUPRAMOLECULARES PARA LA SIMPLIFICACIN DE


OPERACIONES PREVIAS EN LA DETERMINACIN DE CONTAMINANTES EN
MUESTRASACUOSAS .......................................................................................81
OBJETO ..........................................................................................................83
CAPTULO 1: Stability of benzalkonium surfactants on hemimicelles
basedsolidphaseextractioncartridges........................................................85
CAPTULO 2: Extraction and stability of pesticide multiresidue from
naturalwateronamixedmodeadmicellarsorbent..................................102

CAPTULO3:Useofcoacervatesfortheonsiteextraction/preservation
ofpolycyclicaromatichydrocarbonsandbenzalkoniumsurfactants ........ 125

PARTE II: NUEVAS METODOLOGAS PARA EL ANLISIS DE SUSTANCIAS


PERFLUOROALQUILADASENMUESTRASBIOLGICAS ................................. 145
OBJETO........................................................................................................ 147
CAPTULO 4: Analysis of perfluorinated compounds in biota by
microextraction with tetrahydrofuran and liquid chromatography/ion
isolationbasediontrapmassspectrometry .............................................. 150
CAPTULO 5: A simple and rapid extraction method for sensitive
determination of perfluoroalkyl substances in blood serum suitable for
exposureevaluation ................................................................................... 177

RESUMENYDISCUSINDELOSRESULTADOS .............................................. 203


1. INTRODUCCIN ..................................................................................... 205
2. SISTEMAS SUPRAMOLECULARES PARA LA SIMPLIFICACIN DE
OPERACIONESPREVIASENLADETERMINACINDECONTAMINANTESEN
MUESTRASACUOSAS.................................................................................. 207
2.1.

Muestrasyanalitos ................................................................ 208

2.2.

Extraccinyconcentracindelosanalitos ............................ 215

2.2.1.

Sntesis y caractersticas de los sistemas supramoleculares


empleados .............................................................................. 216

2.2.2.

Extraccinypreconcentracin ............................................... 219

2.3.

Estabilizacindeloscontaminantesenmuestrasacuosas .... 223

2.3.1.

Estabilizacinenadsorbenteshemimicelares/admicelares .. 224

2.3.2.

Estabilizacinendisolventessupramoleculares .................... 230

2.4.

Cuantificacin ......................................................................... 233

3. DESARROLLODENUEVASMETODOLOGASPARALADETERMINACIN
DESUSTANCIASPERFLUOROALQUILADASENMUESTRASBIOLGICAS. ... 238
3.1.

Muestrasyanalitos ................................................................ 240

3.2.

Extraccindelosanalitos ....................................................... 243

3.2.1.

Sntesis y caractersticas de los sistemas extractantes


empleados .............................................................................. 244

3.2.2.

Extraccinypreconcentracin............................................... 247

3.3.

Cuantificacin......................................................................... 255

3.3.1.

Sensibilidad ............................................................................ 257

3.3.2.

Selectividad ............................................................................ 260

3.3.3.

Controldelacontaminacin .................................................. 263

3.3.4.

Veracidad................................................................................ 264

3.3.5.

Precisin ................................................................................. 265

3.3.6.

Anlisisdemuestras............................................................... 266

CONCLUSIONES ..............................................................................................269
APNDICES .....................................................................................................275

OBJETO

Objeto
El estudio de la calidad de ecosistemas naturales y contaminados
requiere el anlisis de un nmero elevado de muestras para la obtencin de
resultadosrepresentativosdadalagranvariabilidadespacialytemporalconla
que se distribuyen los contaminantes. Por otro lado, los contaminantes estn
presentes a muy baja concentracin en los sistemas acuticos lo que exige la
recogida de volmenes elevados de muestra para el anlisis y plantea serios
problemas de estabilidad. Por tanto, un aspecto clave en campaas de
monitorizacin es disponer de estrategias que simplifiquen e integren los
procesos de toma de muestra, transporte, conservacin y tratamiento de la
misma.Entrelasestrategiasquesehanpropuesto,elusodeextraccinenfase
slida on site ha adquirido gran aceptacin, dado los requerimientos mnimos
exigidos para el transporte, y en muchos casos para la conservacin de las
muestras. Es interesante por tanto investigar el uso de nuevas fases
adsorbentes para extraccin en fase slida, as como desarrollar nuevos
mediiosdeestabilizacin, conelfinde ampliarsuaplicacinal mayornmero
posibledecontaminantesytiposdemuestrasymejorarlasprestacionesdelos
sistemaspropuestoshastalafecha.

El objeto genrico de las investigaciones que se presentan en la


Memoria de estaTesisDoctoralse centraenel desarrollodenuevosmtodos
basados en el empleo de agregados supramoleculares que integren y/o
simplifiquen las operaciones de toma de muestra, extraccin, limpieza,
preconcentracin, transporte y conservacin de contaminantes ambientales,
prioritarios y emergentes, en matrices acuosas y biolgicas. Los agregados
objeto de estudio han sido adsorbentes supramoleculares como nuevas fases
adsorbentes para extraccin en fase slida y disolventes supramoleculares
como nuevos sistemas de extraccin lquidolquido. Estos agregados,
independientemente del estado en el que se encuentran, presentan un
conjunto de caractersticas comunes de gran relevancia para los procesos de
extraccin:

-3-

a) Los agregados que constituyen los materiales supramoleculares tienen


estructura tridimensional y presentan regiones de diferente polaridad que
muestranunaexcelentecapacidaddeextraccinparaunagranvariedadde
compuestosorgnicos,dadolosmltiplesenlacesquepuedenestablecerse
entrelossolutosyelextractante

b) Las propiedades de los agregados pueden modificarse variando el grupo


polarolacadenahidrocarbonadaloquelesconfiereunagranversatilidad

c) Lasntesisdelasestructurastridimensionalesqueconformanlosagregados
seproducedeformaespontneay,porlotanto,estalalcancedecualquier
laboratorio

d) Presentanbajavolatilidadeinflamabilidad,loquehacequelosprocesosde
extraccin sean menos contaminantes y ms seguros. Se adaptan a los
principiosdelaQumicaverde

e) Proporcionanmicroambientesqueevitanladegradacindelosanalitos.

f)

Seadaptanalosformatosconvencionalesyminiaturizadosdeextraccin

Constituyen por tanto una alternativa interesante a los disolventes


orgnicos y a los adsorbentes convencionales y la investigacin que se
desarrollar en esta Memoria pretende ampliar su aplicacin en anlisis
ambiental. Con esta premisa, los objetivos especficos de los trabajos de
investigacinrealizadoshansido:

1) Evaluarlacapacidaddelossistemassupramolecularesparalasimplificacin
delasoperacionespreviasenladeterminacindecontaminantesorgnicos
prioritariosenmuestrasacuosas

2) Desarrollar nuevas metodologas basadas en sistemas supramoleculares


paraladeterminacindecontaminantesemergentesenmuestrasbiolgicas

-4-

Objeto
Paralelamente,laformacindeladoctorandamedianteeldesarrollo
deactividadescomplementariasalalaborinvestigadora,comolapublicacin
de artculos cientficos y la asistencia y presentacin de comunicaciones a
congresos,constituyeunobjetivofundamentaleneldesarrollodeestaTesis.

-5-

CONTENIDO

Contenido
ElcontenidodelaMemoriadeestaTesisDoctoralsehaestructuradoen
dos partes, precedidas de una Introduccin en la que se desarrolla el marco
legislativoylosretosytendenciasdelanlisisambiental.Enestaintroduccinse
profundizaenaspectostericosyprcticosrelacionadosconlosadsorbentesy
disolventes supramoleculares tales como tipos de agregados, formacin,
mecanismos de solubilizacin, modos de operacin y aplicaciones en procesos
deextraccin.

LoscontenidosdelasdospartesenlasquesehadivididoestaMemoria
sonlossiguientes:

PARTEI:Sistemassupramoleculares paralasimplificacindelasoperaciones
previas en la determinacin de contaminantes en muestras acuosas. En este
bloque se presentan en tres captulos los resultados obtenidos en las
investigaciones realizadas para evaluar la capacidad de los sistemas
supramoleculares para simplificar las operaciones previas en procesos
analticos.Enlosdosprimeroscaptulossedesarrollandosmetodologasparala
extraccin/preconcentracin y estabilizacin de tensioactivos de benzalconio y
plaguicidas.Conestefin,seempleanhemimicelasdedodecilsulfatoyadmicelas
mixtas de dodecilsulfato y tetrabutilamonio sobre almina como adsorbentes
paralaextraccin enfaseslidadeestoscontaminantesenmuestrasdeagua
naturales (fluviales y subterrneas) y residuales. En el tercer captulo se
proponen los disolventes supramoleculares de micelas acuosas de cido
dodecanosulfnicoparaextraer/preconcentraryestabilizarlostensioactivosde
benzalconioehidrocarburosaromticospolicclicos(PAHs)enaguasresidualesy
fluviales. Los estudios de estabilidad de los analitos en los diferentes
adsorbentesydisolventesinvestigadosserealizaronendistintascondicionesde
temperatura, iluminacin y acidez durante un periodo de tres meses. Las
metodologas desarrolladas permiten la determinacin de los contaminantes
prioritariosseleccionadosalnivelexigidoporlalegislacinvigente.

PARTE II: Nuevas metodologas para el anlisis de sustancias


perfluoroalquiladasenmuestrasbiolgicas.Trasexplicarbrevementeelobjeto

-9-

de esta parte de la Tesis, se presentan en dos captulos los resultados de las


investigacionesllevadasacabo.Sedesarrollandosnuevasmetodologasparael
anlisis de un grupo de contaminates emergentes; las sustancias
perfluoroalquiladas(PFASs).Estassustanciassontensioactivosquesehanusado
sininterrupcindesdelosaos50perosudeteccinenelmedioambienteno
se inici hasta principios de la pasada dcada. Aunque ha habido muchos
progresos en su anlisis, an se siguen demandando nuevos mtodos que
proporcionen mayor sensibilidad y selectividad. En el captulo cuatro, se
proponelaextraccindelasPFASsenunintervaloampliodepolaridadusando
una mezcla de THF:agua en la que las PFASs forman agregados inversos. Esta
metodologa se aplica al anlisis de muestras de distintos tejidos (hgado y
msculo)depescadosyavesmarinas.Elltimomtododesarrolladosebasaen
la extraccin/preconcentracin de estos analitos en muestras de suero
sanguneo mediante una microextraccin con disolvente supramolecular de
micelas inversas de cido hexanoico en tetrahidrofuranoagua. Este disolvente
sedescribeporvezprimeraenestaMemoria.Seincluyeportantoelestudiode
sucomposicinenfuncindelaconcentracindeloscomponentesenelmedio
en el que se produce el autoensamblaje de los mismos y cmo afecta la
composicinalaeficienciadelaextraccindelasPFASs.Lasdosmetodologas
desarrolladas permiten la determinacin de los contaminantes al nivel
recomendadoparaevaluarlaexposicinhumanaalosmismos.

Acontinuacin,seincluyeenlaMemoriaunaseccindondesediscuten
de forma global los resultados de esta Tesis, destacando las aportaciones ms
relevanteseinnovadorasyporltimosepresentanlasconclusionesobtenidas
delostrabajosdeinvestigacinrealizados.

Finalmente se incluyen los siguientes anexos: (A) artculos de


investigacin publicados en revistas internacionales derivados de las
investigaciones realizadas dentro del contexto de la Tesis, (B) comunicaciones
realizadasaCongresosnacionaleseinternacionales.

- 10 -

INTRODUCCIN

Introduccin

1.

ANLISISAMBIENTAL:MARCOLEGISLATIVO

La continua entrada, a travs de vertidos de aguas residuales, de


contaminantes orgnicos derivados de productos de cuidado personal,
productosfarmacuticosyproductosqumicosindustrialesenlosrosyarroyos
es un motivo de preocupacin evidente para las autoridades comunitarias [1].
Adems,nosolosecontaminanlasaguassuperficiales,sinoquesuelos,biotay
aguas potables subterrneas estn igualmente expuestos y los efectos
potencialmentetxicosysusconsecuenciasalargoplazosondesconocidospara
muchosdeestosproductos.Portanto,paralaevaluacinycontroldelacalidad
ecolgica de las zonas hmedas resulta imprescindible el estudio tanto de la
matrizaguaolossedimentoscubiertosporstacomodelabiotaqueloshabita.

Sinoscentramosenlaherramientalegislativavigenteparaelcontrolde
la contaminacin en materia de aguas, Europa se rige por la Directiva
2000/60/CE,tambindenominadaDirectivaMarcodelAgua(DMA)[2].Estase
caracteriza por presentar una visin global y un marco de accin local, y
especificarlasmedidasatomarparaconseguirlaproteccinintegradadelagua
ylacalidadqumicayecolgicadelamisma,mediantelareduccinprogresiva
de la contaminacin existente y, en el caso de las denominadas sustancias
peligrosasprioritarias,medianteelceseolaprogresivaeliminacindevertidos,
emisiones y fugas. Esta Directiva tambin resalt dos mbitos en que era
necesariaunanormativamsespecfica:lasaguassubterrneasylassustancias
prioritarias.

Las sustancias que esta directiva establece como de inters prioritario


en el agua (33 en total) se encuentran actualmente recogidas en una lista

[1] The state of our river: EU-wide survey results. (Disponible en: http://ec.europa.eu/
environment/integration/research/newsalert/pdf/139na4.pdf).
[2] DO L 327 de 22.12.2000, p. 1 Directiva 2000/60/CE del Parlamento Europeo y del
Consejo, de 23 de octubre de 2000, por la que se establece un marco comunitario de
actuacin en el mbito de la poltica de aguas.

- 13 -


dinmica(Directiva2008/105/CE)queserevisacadacuatroaos[3].Estaslistas
contienen una variedad de compuestos orgnicos, inorgnicos y metales
consideradospeligrososparalasaludhumanay/odelmedioambiente.Muchos
de estos compuestos, como los hidrocarburos aromticos policclicos, los
plaguicidas y la mayor parte de los metales, han sido objeto de estudio y
regulacin durante dcadas. Otros, por el contrario, han sido incluidos en las
listasdesustanciasprioritariasrecientemente.Esteeselcaso,porejemplo,de
los alquilfenoles (productos de degradacin de detergentes de tipo alquilfenol
etoxilado), de los difenilteres bromados (utilizados fundamentalmente como
retardantes de llama) o los ftalatos, considerados hasta hace poco como
contaminantesemergentes.Loscontaminantesemergentessoncontaminantes
previamente desconocidos o no reconocidos como tales, cuya presencia en el
medio ambiente no es necesariamente nueva pero si la preocupacin por las
posibleconsecuenciasdelamisma[4,5].Porlotantosuelenestarpocoonada
investigados, hay escasez o ausencia de datos ambientales y faltan mtodos
analticos adecuados para su determinacin, lo cual dificulta su estudio en las
campaasdemonitorizacinambiental.Entreestoscontaminantesemergentes
actualmente destacan los frmacos, las hormonas, compuestos alteradores
endocrinos (EDCs) como el bisfenol A, el cido de perfluorooctano sulfonato
(PFOS) y otros compuestos perfluorados, nanomateriales, productos derivados
de la desinfeccin de aguas potables y piscinas, productos de degradacin de
pesticidas, el perclorato, ciertas toxinas de algas, filtros ultravioleta,
benzotriazoles,dioxano,arsnico,metiltertbutilterycidosnaftnicos.

Como complemento a la DMA se adopt la Directiva 2006/118/CE, de


12 de diciembre de 2006, relativa a la proteccin de las aguas subterrneas
[3] DO L 348 de 24.12.2008, p. 84. Directiva 2008/105/CE del parlamento europeo y del
consejo de 16 de diciembre de 2008 relativas a las normas de calidad ambiental en el
mbito de la poltica de aguas, por la que se modifican y derogan ulteriormente las
Directivas 82/176/ CEE, 83/513/CEE, 84/156/CEE, 84/491/CEE y 86/280/CEE del
Consejo, y por la que se modifica la Directiva 2000/60/CE.
[4] S.D. Richardson, Anal. Chem. 80 (2008) 4373.
[5] L.D. Barcel, M.J. Lpez de Alda, Contaminacin y calidad qumica del agua: el
problema de los contaminantes emergentes. (Disponible en: www.unizar.es/fnca/
varios/panel/15.pdf)

- 14 -

Introduccin
contralacontaminacinyeldeterioro[6]ysehapropuestootrarelativaalas
normasdecalidadambientalenelmbitodelapolticadeaguas,porlaquese
modifica la Directiva 2000/60/CE, en la que se definen concentraciones
mximas admisibles y medias anuales para las sustancias consideradas como
prioritariasyotroscontaminantesenaguassuperficialesybiota[3].

Enaplicacindelartculo5delaDMA,losEstadosmiembrostenande
plazo hasta diciembre de 2004 para elaborar un anlisis de las caractersticas
particulares de cada distrito hidrogrfico, un estudio de la incidencia de la
actividadhumanasobrelasaguas,unanlisiseconmicodesuusoyunregistro
de las zonas que necesitan una proteccin especial, utilizando ante todo la
informacin existente. Por lo general, casi todos los Estados miembros
dedicaron considerables esfuerzos a este primer anlisis, creando una base de
informacin que nunca haba existido a escala comunitaria. Los resultados
mostraronqueporcentajeselevadosdemasasdeaguacorranelriesgodeno
alcanzar los objetivos previstos, los cuales estaban claramente vinculados a
zonasyregionesdensamentepobladasenlasquesehacaunusointensivoya
menudonosostenibledelagua.

Sobre la base de esta primera fase (20022004), distintas cuencas


hidrogrficas piloto participaron en la segunda fase (20052006) relativa a la
estrategia comn para la implementacin de la DMA. Para ello cada distrito
hidrogrfico trabaj en distintas tareas y actividades clasificadas en grupos de
trabajo (estado ecolgico, gestin de las cuencas hidrolgicas, aguas
subterrneas,informesysustanciasprioritarias)ymantuvieronunintercambio
de informacin constante. El objetivo era que los casos de estudio realizados
sirvieran de ejemplo y facilitaran la implementacin de la DMA en los Estados
miembros, especialmente para el establecimiento de las redes de
monitorizacinylaredaccindelosplanesdegestindecuenca.

[6] DO L 372 de 27.12.2006, p.19 Directiva 2006/118/CE del parlamento europeo y del
consejo de 12 de diciembre de 2006 relativa a la proteccin de las aguas subterrneas
contra la contaminacin y el deterioro.

- 15 -


En2007laComisinEuropeallevacabounestudioparadeterminarel
estadodelosrosyarroyosdelaUninEuropea[7].Serecogieronnumerosas
muestras de agua, concretamente en 122 puntos de muestreo de ms de 100
puntos hidrogrficos de toda Europa, y se enviaron a analizar a un centro de
investigacin asociado a la Comisin Europea. Gracias a estos anlisis se
identificaron un nmero importante de contaminantes y pudo realizarse una
estadstica sobre las mayores emisiones y frecuencia de aparicin en los
diferentes ros. Slo el 10 % de los ros estudiados pudieron clasificarse como
muy limpios en trminos de contaminacin qumica y se puso de relieve la
necesidad de incrementar las medidas para frenar el deterioro de los ros
europeos. El estudio tambin destac la necesidad de anticipar los problemas
ambientalesderivadosdelautilizacindeproductosqumicosenEuropa.

Las tareas de implantacin continuaron con la entrada en vigor de los


planes hidrolgicos en enero de 2010, los cuales son el eje principal de la
aplicacindelaDMA,enlamedidaenqueconstituyelaprincipalherramienta
degestin.Estosplanesdebenhabersidoespecficamentediseadosparacada
demarcacin hidrogrfica y llevan asociados programas de medidas que
incluyen todas las medidas necesarias para lograr los objetivos
medioambientales. Actualmente, algunos Estados miembros llevan un
considerableretrasoenlapuestaenmarchadelosplaneshidrolgicosyaque
las consultas de participacin pblicas estn todava en curso o no han
comenzado an (caso de las cuencas hidrogrficas en Espaa) o los planes no
hansidotodavaestablecidos.Antesdequeacabe2012losEstadosmiembros
deben enviar un informe intermedio a la Comisin europea sobre el grado de
aplicacindelprogramademedidasyparafinalesde2015seprevconseguir
unbuenestadodelasaguaseuropeas.Losplaneshidrolgicosyprogramasde
medidas sern revisados cada 6 aos y si fuera necesario se actualizarn o
elaborarnnuevosplanesen2015,2021,etc.siendo2027lafechatopeparala
consecucindelosobjetivoplanteados.

[7] V. Naddeo, T. Zarra, V. Belgiorno, Environ. Sci. Policy, 10 (2007) 243.

- 16 -

Introduccin
EnrelacinconelusodelassustanciasqumicasenEuropa,hastahace
poco,lalegislacineuropearelativaalosproductosqumicoseraunmosaicode
distintasnormativasyreglamentos,ynosedisponadesuficienteinformacin
para evaluar y controlar las sustancias qumicas de forma eficaz. La nueva
poltica europea REACH [8], cuyas siglas en ingls corresponden a registro,
evaluacinyautorizacin desustanciasqumicas,entrenvigorel1dejunio
de2007ycreunsistemanormativonicoparaeltratamientodelassustancias
qumicas. Este sistema pretende acabar con las carencias informativas que
existan hasta la fecha, y hace recaer sobre la industria una mayor
responsabilidad sobre la gestin del riesgo de los productos qumicos y la
informacin en materia de seguridad que se debe proporcionar a los usuarios
profesionales.Todaslosempresasquefabricanoimportanalmenos1tonelada
de sustancias qumicas al ao deben registrarlos en la Agencia Europea de
Sustancias y Preparados Qumicos (ECHA), y presentar informacin sobre sus
propiedades,usosylosmediosparamanipularlosdeformasegura.Adems,los
productores e importadores tienen que transmitir la informacin sobre
seguridadpertinenteatodoslosqueutilicenlassustanciaseneltranscursode
su actividad industrial o profesional. De este modo se garantiza que se sepa
cmo utilizarlas sin riesgo para los trabajadores, los consumidores y el medio
ambiente.LaECHA,consedeenHelsinki,seencargadegestionareldaadade
los procesos de registro, evaluacin, autorizacin y restriccin de sustancias
qumicas. Las empresas necesitarn autorizacin para poder utilizar sustancias
qumicas que provocan cncer, mutaciones o problemas en el sistema
reproductivo,oqueseacumulanennuestroorganismoyenelentornoyestas
noseconcedernsilaempresaencuestinnodemuestraunadecuadocontrol
de los riesgos. El objetivo final de esta poltica es fomentar la sustitucin
progresivaydefinitivadelassustanciasmspeligrosasporunaalternativams
[8] DO L 369 de 30.12.2006, p.1 Reglamento (EC) n 1907/2006 del Parlamento Europeo
y del Consejo de 18 de Diciembre de 2006 relativo al registro, la evaluacin, la
autorizacin y la restriccin de las sustancias y preparados qumicos (REACH), por el
que se crea la Agencia Europea de Sustancias y Preparados Qumicos, se modifica la
Directiva 1999/45/CE y se deroga el Reglamento (CEE) n793/93 del Consejo y el
Reglamento (CE) n 1488/94 de la Comisin as como la Directiva 76/769/CEE del
Consejo y las Directivas 9/155/CEE, 93/67/CEE, 93/105/CE y 2000/21/CE de la
Comisin.

- 17 -


segura y cabe la posibilidad de que se impongan restricciones o prohibiciones
sobre la produccin, introduccin en el mercado o uso de determinadas
sustanciasqueplanteenriesgosinaceptablesparalasaludoelmedioambiente.

Por otro lado, la poltica sobre seguridad alimentaria en la Unin


Europea fue reformada en 2002 volvindose mucho ms rigurosa con el
objetivodeprotegerlasaludylosinteresesdelosconsumidores,altiempoque
garantiza el buen funcionamiento del mercado interior. El reglamento CE
n178/2002 revis los principios generales de legislacin alimentaria y los
procedimientos relativos a la seguridad de los alimentos, que se aplican
igualmenteapiensos.Loscontrolesyelseguimientoseefectanalolargode
todalacadenaalimentariaadaptndosealenfoque<<delagranjaalamesa>>.
EstemismoactolegislativocrealaAutoridadEuropeadeSeguridadAlimentaria
(EFSA);organismoeuropeocuyamisinconsisteenemitirdictmenesyprestar
apoyocientficoytcnicoentodoslosmbitosquetienenunimpactosobrela
seguridadalimentaria.Paralograrestosobjetivos,laUninEuropeaestablecey
velaporelcumplimientodeunasnormasdecontrolenmateriadehigienede
los productos alimenticios [9], de salud y bienestar de los animales [10], de
fitosanidad[11]ydeprevencindelosriesgosdecontaminacinporsustancias
externas [12]. De este modo, la Unin regula el uso de algunas sustancias
qumicas especficas, como las que se utilizan en agricultura [13,14] o en

[9] Higiene de los productos alimenticios. (Disponible en: http://europa.eu/legislation_


summaries/food_safety/veterinary_checks_and_food_hygiene/f84001_es.htm).
[10] Bienestar de los animales. (Disponible en: http://europa.eu/legislation_summaries/
food_safety/animal_welfare/index_es.htm).
[11] Controles fitosanitarios. (Disponible en: http://europa.eu/legislation_summaries/
food_safety/plant_health_checks/index_es.htm).
[12] Contaminacin y factores medioambientales. (Disponible en: http://europa.eu/
legislation_summaries/food_safety/contamination_environmental_factors/index_es.htm).
[13] DO L 375 de 31.12.1991, p.1 Directiva 91/676/CEE del Consejo, de 12 de diciembre
de 1991, relativa a la proteccin de las aguas contra la contaminacin producida por
nitratos utilizados en la agricultura.
[14] Estrategia temtica sobre la utilizacin sostenible de los plaguicidas. (Disponible en:
http://europa.eu/legislation_summaries/food_safety/contamination_environmental_factor
s/l28178_es.htm

- 18 -

Introduccin
determinadas tcnicas de produccin o transformacin de alimentos [15].
Adems,sehanadoptadomedidasparalimitarlacontaminacinacausadela
polucin del agua o el aire [16] o por exposicin a la radiactividad [17] y se
controlan tambin los riesgos de contaminacin por organismos modificados
genticamente[18]yporenvasesalimentarios[19].

As, la Unin Europea regula los contenidos de contaminantes


aceptados en los alimentos y los mantiene en los niveles ms bajos posibles
mediante el Reglamento (CEE) n 315/93 [20]. Un Estado miembro puede
adoptar medidas ms rigurosas respecto del presente Reglamento cuando
sospeche que la presencia de un contaminante puede representar un peligro
paralasaludhumana.Enesecaso,dichoEstadomiembroinformadeelloalos
otros Estados miembros y a la Comisin, que adoptar las medidas adecuadas
en colaboracin con el Comit Permanente de la Cadena Alimentaria y de
Sanidad Animal. Adems, este Comit asiste a la Comisin en todas las
cuestiones relativas a los contaminantes, incluida la fijacin de las tolerancias
mximas. El presente reglamento no se aplica a los contaminantes que sean
objeto de una normativa ms especfica. Por ejemplo, el Reglamento (CE) n
[15] DO L 141 de 6.6.2009, p. 3 Directiva 2009/32/CE del Parlamento Europeo y del
Consejo, de 23 de abril de 2009 , relativa a la aproximacin de las legislaciones de los
Estados miembros sobre los disolventes de extraccin utilizados en la fabricacin de
productos alimenticios y de sus ingredientes.
[16] DO L 209 de 31.7.2006, p. 1 Decisin 2006/507/CE del Consejo, de 14 de octubre
de 2004, relativa a la celebracin, en nombre la Comunidad Europea, del Convenio de
Estocolmo sobre contaminantes orgnicos persistentes.
[17] DO L 371 de 30.12.1987, p. 11 Reglamento (Euratom) n 3954/87 del Consejo de 22
de diciembre de 1987 por el que se establecen tolerancias mximas de contaminacin
radiactiva de los productos alimenticios y los piensos tras un accidente nuclear o
cualquier otro caso de emergencia radiolgica.
[18] DO L 268 de 18.10.2003, p. 1 Reglamento (CE) n1829/2003 del Parlamento
Europeo y del Consejo, de 22 de septiembre de 2003, sobre alimentos y piensos
modificados genticamente.
[19] DO L 338 de 13.11.2004, p. 4 Reglamento (CE) n 1935/2004 del Parlamento
Europeo y del Consejo, de 27 de octubre de 2004, sobre los materiales y objetos
destinados a entrar en contacto con alimentos y por el que se derogan las Directivas
80/590/CEE y 89/109/CEE.
[20] DO L 37 de 13.2.1993, p. 1 Reglamento (CEE) n 315/93 del Consejo, de 8 de
febrero de 1993, por el que se establecen procedimientos comunitarios en relacin con los
contaminantes presentes en los productos alimenticios.

- 19 -


1881/2006 [21] fija para una serie de alimentos, los contenidos mximos
admisibles de nitratos, micotoxinas, metales, dioxinas e hidrocarburos
aromticos policclicos y reduce estos valores para lactantes y nios de corta
edad con el fin de proteger la salud de ese grupo vulnerable. El muestreo y
anlisis para el control oficial de los contenidos mximos especificados debe
efectuarsedeconformidadconlosreglamentos(CE)n1882/2006[22],(CE)n
401/2006[23],(CE)n1883/2006[24]y(CE)n333/2007[25]delacomisiny
los productos alimenticios enumerados en los anexos no se comercializarn
cuandocontenganunodeloscontaminantesenumeradosenelmismoenuna
cantidadquesupereelcontenidomximoestablecido.

En relacin con estas normas, tambin se encuentra la Directiva


96/23/CE[26]relativaalasmedidasdecontrolparabuscarresiduosclasificados
endosgrupos:porunlado,lassustanciasconefectoanabolizanteysustancias
noautorizadas,yporotrolado,losmedicamentosveterinariosycontaminantes
en productos animales. Otra normativa relacionada con la contaminacin por

[21] DO L 364 de 20.12.2006, p. 5 Reglamento (CE) n 1881/2006 de la Comisin, de 19


de diciembre de 2006, por el que se fija el contenido mximo de determinados
contaminantes en los productos alimenticios.
[22] DO L 364 de 20.12.2006, p. 25 Reglamento (CE) n 1882/2006 de la Comisin, de
19 de diciembre de 2006, por el que se establecen los mtodos de muestreo y de anlisis
para el control oficial del contenido de nitratos en ciertos productos alimenticios.
[23] DO L 70 de 9.3.2006, p. 12 Reglamento (CE) n 401/2006 de la Comisin, de 23 de
febrero de 2006, por el que se establecen los mtodos de muestreo y de anlisis para el
control oficial del contenido de micotoxinas en los productos alimenticios.
[24] DO L 364 de 20.12.2006, p. 32 Reglamento (CE) n 1883/2006 de la Comisin, de
19 de diciembre de 2006, por el que se establecen mtodos de muestreo y de anlisis para
el control oficial de los niveles de dioxinas y PCB similares a las dioxinas en
determinados productos alimenticios.
[25] DO L 88 de 29.3.2007, p. 29 Reglamento (CE) n 333/2007 de la Comisin, de 28 de
marzo de 2007 , por el que se establecen los mtodos de muestreo y anlisis para el
control oficial de los niveles de plomo, cadmio, mercurio, estao inorgnico, 3-MCPD y
benzo(a)pireno en los productos alimenticios.
[26] DO L 125 de 23.5.1996, p. 10 Directiva 96/23/CE del Consejo, de 29 de abril de
1996, relativa a las medidas de control aplicables respecto de determinadas sustancias y
sus residuos en los animales vivos y sus productos y por la que se derogan las Directivas
85/358/CEE y 86/469/CEE y las Decisiones 89/187/CEE y 91/664/CEE.

- 20 -

Introduccin
sustancias de efecto hormonal es la Directiva 96/22/CE [27] la cual tiene por
objeto regular la utilizacin de determinadas sustancias de efecto hormonal y
tireostticoysustanciasbetaagonistasenlacradeganadoparaprotegeralos
consumidores y preservar la calidad de los alimentos de origen animal. Esta
Directiva se ha modificado mediante las Directivas 2003/74/CE y 2008/97/CE
por las que se prohbe utilizar determinadas sustancias de efecto hormonal y
tireostticoysustancias agonistasenlacra de ganado.Loslmitesmximos
de residuos para las sustancias farmacolgicamente activas en productos de
origenanimalestnestablecidosenelReglamentoCEn37/2010.

La contaminacin por plaguicidas en productos destinados a


alimentacin humana o animal tambin tiene un reglamento especfico, el
Reglamento (CE) n 396/2005 [28], donde se recogen los lmites mximos de
residuosdeplaguicidas(LMR)ensucomposicin.DichosLMRcomprenden,por
una parte, LMR especficos para ciertos alimentos destinados a las personas o
los animales y, por otra, un lmite general aplicable cuando no se haya fijado
ningn LMR. El contenido mximo de residuos de plaguicidas en los alimentos
sesitaen0,01mgkg1.Estelmitegeneralesaplicablepordefecto,esdecir,
entodosloscasosenquenosehayafijadounLMRdeformaespecficaparaun
productoountipodeproducto.Porprimeravezexisteunlmitecomnaescala
europea para todos los tipos de plaguicidas, sin hacer distinciones entre las
categoras de alimentos. Mediante programas plurianuales comunitarios y
nacionales actualizados cada ao, los Estados miembros realizan controles de
losresiduosdeplaguicidasparaverificarelcumplimientodelosLMR.

Como complemento a toda esta estricta legislacin, en Europa existe

unaherramientaclaveempleadaparareaccionarconrapidezantelosincidentes
[27] DO L 125 de 23.5.1996, p. 3 Directiva 96/22/CE del Consejo, de 29 de abril de
1996, por la que se prohbe utilizar determinadas sustancias de efecto hormonal y
tireosttico y sustancias - agonistas en la cra de ganado y por la que se derogan las
Directivas 81/602/CEE, 88/146/CEE y 88/299/CEE.
[28] DO L 70 de 16.3.2005, p. 1 Reglamento (CE) n 396/2005 del Parlamento Europeo y
del Consejo, de 23 de febrero de 2005, relativo a los lmites mximos de residuos de
plaguicidas en alimentos y piensos de origen vegetal y animal y que modifica la Directiva
91/414/CEE del Consejo.

- 21 -


registradosenelmbitodelosalimentosylospiensosdenominadaRASFFel
sistemadealertarpidaparaalimentosypiensos.Los27Estadosmiembrosde
la UE forman parte del RASFF, junto con la Comisin Europea y la Autoridad
Europea de Seguridad Alimentaria (EFSA). As, cuando un miembro del RASFF
dispone de informacin sobre un riesgo sanitario grave procedente de
alimentos o piensos, debe informar inmediatamente a la Comisin Europea
mediante el sistema RASFF que a su vez informa sin demora al resto de
miembros con la finalidad de adoptar las acciones apropiadas. Existen cuatro
tiposdiferentesdenotificacindependiendodelagravedad:lasnotificaciones
dealertasemandanenelcasodequeestnalaventaalimentosopiensosque
presentenungraveriesgoydebanemprenderseaccionesdeformarpida;las
notificaciones de informacin se usan en la misma situacin, pero cuando los
otrosmiembrosnodebenadoptarmedidasdeformarpidaporqueelproducto
noseencuentraenelmercadooelriesgonoseconsideragrave;elrechazoen
frontera afecta a las remesas de alimentos y piensos que se han examinado y
rechazadoenlasfronterasexterioresdelaUEaldetectarseunriesgosanitario,
y por ltimo cualquier informacin relacionada con la seguridad de los
alimentos y los piensos que no se haya comunicado como una notificacin de
alertaodeinformacin,peroquelasautoridadesdecontrolhayanconsiderado
interesante se transmite a los miembros bajo el epgrafe de noticias. A
continuacin,segneltipodenotificacinlosmiembrosdelRASFFemprenden
acciones e informan de inmediato a la Comisin de las medidas adoptadas,
entre las que puede incluirse la retirada de un producto del mercado para
proteger la salud de los consumidores. Durante 2010, un total de 3.358
notificacionesfuerontramitadasatravsdelaRASFF,delascuales1.806fueron
dentro del territorio de la UE y 1.552 fueron notificaciones en frontera de
alimentosprocedentesdepasesfueradelaUE.Lamayoradelasnotificaciones
fueron debidas a micotoxinas (principalmente aflatoxinas en frutos secos,
semillas y verduras), seguidas de microorganismos entre los que destaca
salmonellasp,residuosdepesticidasenfrutasyverduras,presenciadeanisakiy

- 22 -

Introduccin
mercurioenpescado,cerealesmodificadosgenticamente,migracindecromo
desdelosrecipientesadiferentesalimentos,biotoxinasmarinasydioxinas[29].

2.

RETOSYTENDENCIASENELANLISISAMBIENTAL

2.1.

Aspectosgenerales

Aunque los objetivos para los que se analizan los diferentes


compartimentos ambientales (aire, agua, suelo, biota, etc.) son muy variados,
en lneas generales puede considerarse que los resultados obtenidos estarn
destinadosacontrolarocaracterizarlacalidaddelosmismos.Losprogramasde
controldecalidadtienencomoobjetivoconocerlaconcentracindeunooms
contaminantes para dilucidar, a travs de los resultados, si es necesaria o no
unaaccincorrectivadelacalidaddelcompartimento[30,31].Esfrecuenteque
serequieradeterminarsiexistenreaslocalizadasdecontaminacindentrode
un objeto (hot spot) con el fin de disear la recuperacin del mismo. El
objetivofinalesdeterminarsisecumpleconlalegislacinvigenteyparaellolos
mtodosanalticoscorrespondientesdebenalcanzarlosnivelesdesensibilidad
yexactitudadecuadosparaofrecerunarespuestainequvoca.

Otro de los objetivos esenciales es establecer la distribucin,


concentracin,comportamientoydestinodeloscontaminantesemergentesen
losdiferentescompartimentosambientales.Porlogeneral,noexistenmtodos
analticos adecuados para esta finalidad y se requiere un elevado nivel de

[29] The Rapid Alert System for Food and Feed. Annual Report 2010. (Disponible en:
http://ec.europa.eu/food/food/rapidalert/docs/rasff_annual_report_2010_en.pdf).
[30] D. Prez-Bendito, S. Rubio en: Environmental analytical chemistry, Elsevier,
Amsterdam, 1999.
[31] E. Andreu Moliner, A. Camacho Gonzlez en: Recomendaciones para la toma de
muestras de agua, biota y sedimentos en humedales Ramsar, Direccin General de
Conservacin de la Naturaleza (DGCN), Secretaria General de Medio Ambiente,
Ministerio de Medio Ambiente, Madrid, 2002.

- 23 -


sensibilidad y selectividad para determinar con exactitud las bajas
concentracionesgeneralmentepresentes.

Disolventessupramoleculares
SPE
SDME
SPME

Aumentodela
frecuenciade
recogidade
muestras simples
Muestreo
pasivo

Obtencinde
muestras
representativas

Simplificacine
integracindelas
etapasde
extraccin/conserva
cin/transporte

Tomademuestra

Extraccin mediante uso


deenergasauxiliares
MSPD

Reduccindel
consumode
disolventesorgnicos
y/otiempode
extraccinen
muestrasslidas

Desarrollode
nuevas
metodologaspara
contaminantes
emergentes

Operacionesprevias

PROCESO
ANALTICO
Medicindelasealanaltica

Tratamientodedatos

Envirometra

Cuantificacindecantidades
trazaeidentificacinde
compuestosenmuestras
complejas

Cromatografalquidaespetrometrademasas:
UPLC
HILIC
Detectoresdenuevageneracinohbridos:
QqQ,QqTOF,QqLIT,LTQOrbitrap.

Cromatografadegasesespetrometra
demasas

GCcapilar

GCbidimensional

TcnicasLVI

SPE: Extraccin en fase slida; SDME: Microextraccin en una gota; SPME: Microextraccin en fase
slida,MSPD:Dispersindelamatrizenfaseslida;UPLC:Cromatografalquidadeultrapresin;HILIC:
Cromatografa lquida de interaccin hidroflica; QqQ: Triple cuadrupolo, QqTOF: Cuadrupolotiempo
de vuelo; QqLIT: Cuadrupolotrampas lineales; LTQOrbitrap: Trampa inica linealOrbitrap; Tcnicas
LVI:Tcnicasdegranvolumendeinyeccin.

Figura1. Esquema de los retos y estrategias desarrolladas en anlisis ambiental.

- 24 -

Introduccin
El desarrollo de mtodos en anlisis ambiental se enfrenta a
importantes retos en cada una de las etapas que constituyen el proceso
analtico. En la Figura 1 se muestran estas etapas, algunos de los retos
implicados y las estrategias que se han desarrollado hasta la fecha para su
solucin.

2.2.

Muestreoambiental

En relacin a la toma de muestra, los dos problemas esenciales


continan siendo cmo obtener muestras representativas en sistemas
afectados por elevada variabilidad espacial y temporal e identificar la fraccin
decontaminantequedebeutilizarseparalaevaluacinderiesgos[32 34].
33,

La recogida de muestras simples o puntuales contina siendo la


estrategiademuestreomspopular,validadaylegalmenteaceptadadetodos
los mtodos de muestreo ambiental desarrollados [32,35]. Sin embargo, estas
muestras slo representan a un punto concreto del sistema en un momento
determinado y para obtener representatividad debe aumentarse la frecuencia
demuestreoloqueencareceelproceso,enalgunoscasosdeformaprohibitiva
[36].Elusodemuestreadoresautomticosquecolectanmuestrascompuestasa
lo largo de un periodo de tiempo variable (minutoshorasdas) es apropiado
para evaluar la calidad media de sistemas ambientales cuya composicin
presentaelevadavariabilidadtemporal,yaquesereducedeformaconsiderable
elnmerodemuestrasaanalizar.Entodocaso,laevaluacindesistemasmuy
dinmicostalescomolossistemasacuticosrequerirdeunnmeroelevadode
[32] USEPA Handbook for sampling and sample preservation of water and wastewater.
EPA-600/4-83-039. Cincinnati, 1982.
[33] D. Barcel, M. C. Hennion en: Techniques and instrumentation in analytical
chemistry vol. 19: Trace determination of pesticides and their degradation products in
water, Elsevier, Amsterdam, 2003, Chapter 2, p. 95.
[34] A. Hildebrandt, S. Lacorte, D. Barcel, Anal. Bioanal. Chem. 386 (2006) 1075.
[35] L.H. Keith en: Principles of environmental sampling, American Chemical Society,
Washington DC, 1996.
[36] V. Naddeo, T. Zarra, V. Belgiorno, Environ. Sci. Policy 10 (2007) 243.

- 25 -


muestras, adems de las muestras blanco, los duplicados, las submuestras y
muestrasconadicionesconocidasdecontaminantesnecesariasparaelcontroly
lagarantadelacalidad,lascualeshayqueconservar,transportaryalmacenar
adecuadamente para finalmente analizarlas. Al objeto de reducir el esfuerzo y
coste implicado en el transporte y almacenamiento de relativamente altos
volmenes de muestras acuosas ambientales durante campaas de
monitorizacin se han desarrollado estrategias que integran las etapas de
extraccin,conservacinytransportedeloscontaminantesdeinters.

Simplificacineintegracindeoperacionesprevias

Nocabedudadequehoyendalatcnicadeextraccinenfaseslida
(SPE) es la estrategia ms aceptada para la preparacin de muestras acuosas
[37]. Est tcnica permite la extraccin/preconcentracin y conservacin
simultneadeloscompuestosenunaslaetapa.Porlotanto,elempleodeSPE
en campo evita tener que transportar y almacenar grandes volmenes de
muestras acuosas con la ventaja aadida de que los compuestos permanecen
estabilizados en cartuchos de pequeo tamao. Adems, debido al poco
volumen que ocupan, los cartuchos pueden mantenerse fcilmente a bajas
temperaturas durante largos periodos de tiempos antes de su determinacin.
Suportabilidad,fcilusoypotencialparaestabilizarlosanalitoshacenqueSPE
seaunatcnicaatractivaparasimplificareintegrarlasoperacionespreviasdel
procesoanaltico.

Sehanpropuestodiferentesformatos(discosocartuchos)deSPEpara
laextraccin,preconcentracinyestabilizacindecontaminantesorgnicos.En
bibliografapueden encontrarsenumerosaspublicacionesdonde sedemuestra
lautilidaddeestatcnicaparaladeterminacindehidrocarburos[38],fenoles
[39],tensioactivos[40],colorantes[41,42]yantibiticos[43],perosindudalos
[37] C.J. Koester, Anal. Chem. 77 (2005) 3737.
[38] D.R. Green, D. Le Pape, Anal. Chem. 59 (1987) 699.
[39] M. Castillo, D. Puig, D. Barcel, J. Chromatogr. A 778 (1997) 301.
[40] M. Petrovi, D. Barcel, Fresenius J. Anal.Chem. 368 (2000) 676.
[41] M.C. Alonso, D. Barcel, J. Chromatogr. A 889 (2000) 2231.

- 26 -

Introduccin
analitos ms investigados han sido los plaguicidas [4456] ya que la
4546

4748

4950

5152

estructura de stos se disean para que su persistencia en el ambiente sea


5354

5556

mnima, por lo que se degradan rpidamente y son necesarias metodologas


queasegurenlapreservacindelasmuestrashastaelmomentodesuanlisis.
Los materiales adsorbentes empleados como relleno para la simultnea
extraccin, preconcentracin y conservacin de los compuestos comprenden
fasesconvencionalesdeslicemodificadaconcadenasdeoctadecil(C18),negro
de carbn grafitizado (GCB), copolmeros de poliestireno y divinilbenceno y
otras fases un poco ms recientes como copolmeros de divinilbenceno y N
vinilpirrolidona.Respectoalascondicionesdeconservacindeloscartuchosde
SPE, la luz y la temperatura son factores clave, y como regla general puede
decirse que los analitos son estabilizados en los cartuchos durante mayores
periodosdetiempo(quepuedenirdesdesemanasamesesdependiendodelas
caractersticasdelosdiferentescompuestos)cuantomsbajaeslatemperatura
dealmacenamiento,independientementedelanaturalezadelafasesorbente.

[42] M.C. Alonso Barcel, Analyst 127 (2002) 472.


[43] E. Turiel, A. Martn-Esteban, G. Bordin, A.R. Rodriguez, Anal. Bioanal. Chem. 380
(2004) 123.
[44] A. Di Corcia, M. Marchetti, J. Chromatogr. A 541 (1991) 365.
[45] S.A. Senseman, T.L. Lavy, J.D. Mattice, B.M. Myers, B.W. Skulman, Environ. Sci.
Technol. 27 (1993) 516.
[46] D. Barcel, S. Chiron, S. Lacorte, E. Martnez, J.S. Salau, M.C. Hennion, Trends
Anal. Chem. 13 (1993) 352.
[47] W.G. Johnson, T.L. Lavy, J.A. Senseman, J. Environ. Qual. 23 (1994) 1027.
[48] C. Crezenci, A. Di Corcia, M.D. Madbouly, R. Samperi, Environ. Sci. Technol. 29
(1995) 2185.
[49] S. Lacorte, N. Ehresmann, D. Barcel, Sci. Technol. 29 (1995) 2841.
[50] E. Martinez, D. Barcel, Chromatographia 42 (1996) 72.
[51] I. Ferrer, D. Barcel, J. Chromatogr. A 778 (1997) 161.
[52] I. Lika, K. Blikov, J. Chromatogr. A 795 (1998) 61.
[53] C. Aguilar, I. Ferrer, F. Borrul, R.M. Marce, D. Barcel, Anal. Chim. Acta 386
(1999) 237.
[54] J. Deplagne, J. Vial, V. Pichon, B. Lalere, G. Hervouet, M-C. Hennion, J.
Chromatogr. A 1123 (2006) 31.
[55] J.M. Cobb, J.D. Mattice, S.A. Senseman, J.A. Dumas, W. Mersie, M.B. Riley, T.C.
Mueller, E. B. Watson, J. AOAC Int. 89 (2006) 903.
[56] T.L. Potter, M.A. Mohamed, H. Ali, J. Agric. Food Chem. 55 (2007) 204.

- 27 -


Los sistemas supramoleculares tambin son tiles para la mejora e
integracin de las operaciones previas del proceso analtico. As, se ha
demostrado que los medios micelares constituidos por tensioactivos inicos
(cetilpiridinio cloruro, dodecilsulfato sdico y acido dodecilsulfnico) y no
inicos (Tritn X114 y Brij35) son tiles para evitar la degradacin de los
hidrocarburos aromticos policclicos en disoluciones acuosas y su adsorcin
sobre la superficie del contenedor [5759]. Tambin se ha demostrado que
5859

algunos colorantes naturales [60] y fungicidas [61] mejoran su estabilidad en


disoluciones acuosas mediante el uso de micelas normales de SDS y Triton X
114, respectivamente. La ventaja aadida de estos procedimientos es que
ademsdeestabilizarloscompuestosduranteeltransporteyalmacenamiento,
losmediosmicelarespermitenlaextraccinypreconcentracindelosanalitos
mediante el fenmeno de la coacervacin o mejoran los factores de
preconcentracin de SPE al evitar la dilucin de las muestras con disolventes
orgnicos.

La capacidad que presentan los sistemas supramoleculares para


estabilizar los compuestos que solubilizan o encapsulan ha hecho que sean
ampliamenteutilizadosenmuydiferentesreas.Porejemplo,laincorporacin
delasciclodextrinasenlosprocesosdefabricacindeunaampliavariedadde
productos se ha hecho muy comn en los ltimos aos [62]. Estas
macromolculas tienen la capacidad de formar complejos de inclusin que
modifican las propiedades de la molcula encapsulada, siendo una de estas
propiedades la estabilizacin de la misma. Las ciclodextrinas se han empleado
en numerosas aplicaciones en alimentacin, farmacia, medicina, cosmtica y
[57] A. Lpez Garca, E. Blanco Gonzlez, J.I. Garca Alonso, A. Sanz-Medel, Anal.
Chim. Acta 264 (1992) 241.
[58] C. Garca Pinto, J.L. Prez Pavn, B. Moreno Cordero, Anal. Chem. 66 (1994) 874.
[59] D. Sicilia, S. Rubio, D. Prez-Bendito, N. Maniasso, E.A.G. Zagatto, Anal. Chim.
Acta 392 (1999) 29.
[60] N. Mulinacci, A. Romani, P. Pinelli, S. Gallori, C. Giaccherini, F.F. Vinceri, Int. J.
Pharm. 216 (2001) 23.
[61] R. Carabias Martnez, E. Rodrguez Gonzalo, M.G. Garca Jimnez, C. Garca Pinto,
J.L. Prez Pavn, J. Hernndez Mndez, J. Chromatogr. A 754 (1996) 85.
[62] E.M. Martn Del Valle, Process Biochem. 39 (2004) 1033.

- 28 -

Introduccin
algunos procesos qumicos. Por ejemplo, los saborizantes son, por lo general,
sustancias voltiles que se deterioran rpidamente y que en presencia de
ciclodextrinas forman complejos estables que pueden permanecer en estado
secosindegradarsedurantelargosperiodosdetiempoatemperaturaambiente
[62,63].Otroscompuestos,comoporejemplolasvitaminas,sedestruyenporel
calor y gracias a su complejacin con ciclodextrinas se estabilizan sin sufrir
prdidas en los procesos de procesamiento trmico [64]. Tambin se han
utilizado para mejorar la conservacin de diversos alimentos [64,65] y las
industrias de cosmticos y aseo personal tambin las han usado ampliamente
para la estabilizacin de fragancias [66,67], tintes y bronceadores. El principal
usofarmacuticodelasciclodextrinasesaumentarlasolubilidad,estabilidady
biodisponibilidad de los principios activos en medicamentos [62]. Con este
mismo fin, tambin se han usado otros sistemas supramoleculares tales como
micelas acuosas [68], e inversas [69] y liposomas [68]. Diferentes sistemas
coloidales

lipdicos

[70,71]

(como

nanocpsulas,

nanoemulsiones,

nanopartculas slidas lipdicas, etc.) se han empleado para proteger y


estabilizarprincipiosactivosdediferentenaturalezaqumica.Porltimo,sehan
usado micelas inversas y microemulsiones [72] para solubilizar enzimas
(principalmentelipasas)yaumentarsuestabilidad.

Otraestrategiaqueestganandoconsiderableintersenlosprogramas
de monitorizacin ambiental es el uso del muestreo pasivo debido a su
potencialparaafrontarelenormeretodeobtenermuestrasrepresentativasen
los sistemasambientales, sujetos a elevada variabilidad espacial y/o temporal,
[63] S. Muoz-Botella, B. del Castillo, M.A. Martn, Ars Pharm. 36 (1995) 187.
[64] L. Szente, J. Szejtli, Trends Food Sci. Technol. 15 (2004) 137.
[65] K. Takeshita, T. Urata, Antimicrobial food preservatives containing cyclodextrin
inclusion complexes. Japanese Patent JP 29, 054 (2001).
[66] R.A. Hedges, Chem. Rev. 98 (1998) 2035.
[67] S. Tatsuya, Stabilization of fragance in bathing preparations, Japanese Patent 11,
209, 787 (1999).
[68] G. Bonacucina, M. Cespi, M. Misici-Falzi, G.F. Palmieri, J. Pharm. Sci. 98 (2009) 1.
[69] H. Sah, Biomed. Chromatogr. 20 (2006) 1142.
[70] M. Garca-Fuentes, D. Torres, M.J. Alonso, Int. J. Pharm. 296 (2005) 122.
[71] M. Rawat, D. Singh, S. Saraf, S. Saraf, Yakugaku Zasshi 182 (2008) 269.
[72] C.M.L. Carvalho, J.M.S. Cabral, Biochimie 82 (2000) 1063.

- 29 -


de una manera efectiva, robusta y de bajo coste [73]. Los muestreadores
pasivosfuerondiseadosinicialmenteparacompuestosgaseososenaire,rea
donde han ganado una importante aceptacin por parte de la industria y las
autoridadeslegislativas[74,75].Sinembargo,elusodemuestreadorespasivos
paramuestreoacuosoesttodavalimitadoalmbitodelainvestigacin.Sise
considera el potencial de esta tecnologa, el limitado uso que actualmente
presentapuedeatribuirseprobablementeasurelativamentetempranoestado
de desarrollo y a la falta de informacin sobre esta tcnica por parte de
fabricantes y cientficos [76]. En los ltimos aos, el muestreo pasivo en
matricesslidastalescomosuelosysedimentosseestconvirtiendoenunrea
deinvestigacinmuyactiva.

2.3.

Preparacindemuestrasambientales

La preparacin de muestras contina siendo una etapa clave en el


anlisis ambiental. La tendencia en esta rea es el desarrollo de mtodos ms
rpidos, econmicos y respetuosos con el medio ambiente y por tanto se ha
dedicado mucho esfuerzo a la sustitucin y/o eliminacin de los disolventes
orgnicosyaldesarrollodeestrategiasautomticasaplicablesuniversalmente.

2.3.1. Muestrasacuosas

2.3.1.1. Extraccinenfaseslida

[73] A. Ballesteros-Gmez, S. Rubio, Anal. Chem. 83 (2011) 4579.


[74] S. Seethapathy, T. Gorecki, X. Li, J. Chromatogr. A 1184 (2008) 234.
[75] H.J. McDermott (Ed.) en: Air monitoring for toxic exposures, Wiley-Interscience,
New Jersey, 2004, parte II, captulo 6.
[76] A. Kot-Wasik, B. Zabiegala, M. Urbanowicz, E. Dominiak, A. Wasik, J. Namiesnik,
Anal. Chim. Acta 602 (2007) 141.

- 30 -

Introduccin
Como se coment anteriormente, la extraccin en fase slida es la
tcnica ms popular y establecida para el tratamiento de muestras acuosas
ambientales.Recientesdesarrollosenestareasonlosrelacionadosconeluso
de nuevos materiales adsorbentes por ejemplo, polmeros de impresin
molecular (MIPs), nanotubos de carbono (CNTs), hemimicelas/admicelas, etc.
conpotencialparamejorarlaeficaciadeextraccinyextenderlaaplicabilidad
de SPE. Por otro lado, los materiales sorbentes que permiten la retencin de
compuestos en un amplio intervalo de polaridad continan utilizndose
ampliamente,porejemploloscopolmerosdedivilbenceno/Nvinilpirrodilonay
aquellosquepermitenestablecermecanismosmixtosdeinteraccin.

A continuacin se describen las principales caractersticas de estos


adsorbentes con especial nfasis en hemimicelas/admicelas que sern los
sistemasutilizadosenlasinvestigacionesllevadasacaboenestaMemoria.

Copolmeros de divinilbenceno/Nvinilpirrolidona (patentados por Waters,


nombre comercial, OASIS HLB). Su elevada rea superficial (800 m2g1) y la
presenciaenelpolmerodelgrupopirrolidona,queesunaceptordehidrgeno,
mejora notablemente la retencin de compuestos polares, mientras que el
polmero divilnilbenceno permite la retencin eficaz de los compuestos
hidrfobos. El adsorbente es estable en un amplio intervalo de pH (114) y
aunqueinicialmenteseaplicprincipalmenteenelcampodedelabioanaltica
hoyendaesmuyutilizadoenelanlisisdecontaminantesenmuestrasacuosas
ambientales[7780].

78,79,80

Adsorbentes que proporcionan mecanismos de retencin mixto. Existen


diferentes tipos de estos sorbentes pero pueden clasificarse en tres grandes
grupos.Elprimeroestconstituidoporsorbentesdeslicefuncionalizadaalque
se enlazan cadenas alquilo (C4, C8 y C18) y grupos cambiadores de iones (ej.
[77] X. Chen, R.X. Hao, N. Yao, Prog. Environ. Sci. Technol. 1 (2007) 377.
[78] G. Gervais, S. Brosillon, A. Laplanche, C. Helen, J. Chromatogr. A 1202 (2008)
163.
[79] A. Arditsoglou, D. Voutsa, Environ. Sci. Pollut. Res. 15 (2008) 228.
[80] E. Gracia-Lor, J.V. Sancho, F. Hernandez, J. Chromatogr. A 1217 (2010) 622.

- 31 -


Isolute HCX, HCX3, HCX5, HCXQ y HAX), el segundo grupo lo forman
sorbentes polimricos modificados qumicamente a los que se le introducen
gruposfuncionalesdeintercambioinico(ej.OasisMCX,MAX,WCXyWAX)yel
tercer grupo est constituido por una mezcla de sorbentes sliceC8 o C18 y
polmeros altamente entrecruzados de poliestireno divinilbenceno (ej. Isolute
C8/Env+, C18/Env+). El doble mecanismo de retencin de estos adsorbentes
permite la elucin secuencial de las interferencias de la matriz y proporciona
extractosfcilmenteanalizablesporLC/MS[81].

Los polmeros de impresin molecular (MIPs) se obtienen mediante el


ensamblajedeunamatrizpolimricaalrededordeunanalitoomolculadiana,
demaneraquesecreaunahuelladelanalito.Unavezobtenidoelpolmeroes
posible extraer el compuesto quedando as huecos libres con memoria
selectiva que reconocern de forma especfica nuevas molculas del
contaminantemolde.AslosMIPstienenunaselectividadpredeterminadapara
unanalitodadoogrupodecompuestosrelacionadosestructuralmente.Aunque
muchosestudiostrataneldesarrollodeMIPsparaanalitosdianaindividuales,el
desarrollo de MIPs para la extraccin de grupos de compuestos anlogos
estructuralmenteesunatendenciaenestarea.Paraestepropsito,elmolde
tienequesercuidadosamenteseleccionadoparaproducirlascavidadescapaces
depresentarafinidadporelgrupocompleto.Laafinidadyselectividaddelsitio
de unin por el analito es muchas veces comparable a la desarrollada por los
anticuerpos. La extraccin en fase slida de contaminantes mediante MIPs ha
sidorevisadaconrespectoalasmolculasusadascomomoldes,lasaplicaciones
desarrolladasylasventajaseinconvenientesdesupreparacinyuso[8284].
83,84

Entre las ventajas de estos materiales destacan la sencillez y rapidez de


preparacin, la elevada estabilidad qumica, fsica y trmica y el bajo coste.
Presentanelinconvenientedelaincompletaeliminacindelasmolculasmolde
lo que origina problemas de contaminacin. Los MIPs se han aplicado
[81] L. Grey, B. Nguyen, P. Yang, J. Chromatogr. A 958 (2002) 25.
[82] V. Pichon, F. Chapuis-Hugon, Anal. Chim. Acta 27 (2008) 48.
[83] C.Y. He, Y.Y. Long, J.L. Pan, K. Li, F Liu, J. Biochem. Biopys. Methods 70 (2007)
133.
[84] F.G. Tamayo, E. Turiel, A. Martn-Esteban, J. Chromatogr. A 1152 (2007) 32.

- 32 -

Introduccin
ampliamenteenelreamedioambientalybiolgica[8486]. Variosejemplosde
85,86

extraccin de estructuras anlogas pueden encontrarse en bibliografa por


ejemplo, bloqueantes en aguas residuales [87], fluoroquinolonas en suelos
[88], verde malaquita en peces y alimento para pescado [89], nonilfenol y sus
derivadosetoxiladosensedimentosylodos[90],etc.

Adsorbentes de carbono. Los adsorbentes de carbono inicialmente utilizados


eran no porosos con un rea superficial muy baja (por ejemplo ENVICarb,
comercializado por Supelco). An as, la retencin de analitos polares era
superior comparada con la correspondiente en sliceC18. En la actualidad se
investiga extensamente el uso de fullerenos y nanotubos de carbono (CNTs)
como adsorbentes para SPE. Ambas formas alotrpicas del carbono presentan
unaelevadareasuperficialysehanaplicadohastalafechaalaextraccinde
diferentes tipos de compuestos tales como alteradores endocrinos, protenas,
compuestos orgnicos voltiles, iones metlicos, etc. [91,92]. Los CNTs son
hojas de grafito enrolladas formando un tubo coaxial. Las hojas de grafito
enrolladas una sola vez forman nanotubos monocapa (SWCNTs), mientras que
los nanotubos multicapas (MWCNTs) estn constituidos por varias hojas de
grafitoenrolladas.Lainvestigacinenestareasehacentradoeneldesarrollo
de nuevas aplicaciones y la mejora de las propiedades de los CNTs. Una
aplicacin interesante en este contexto es el uso de MWCNTs como
adsorbentes de SPE para multiextraccin de pesticidas en aguas superficiales
antesdecromatografadegases(GC)/MS[93].Loslmitesdedeteccinparalos
pesticidas estudiados (carbofuran, iprobenfos, metil paratin, prometrin,
fenitrotion, etil paratin, isocarbofos, fentoato, metidation, endrn, etin,
[85] V. Pichon, J. Chromatogr. A 1152 (2007) 41.
[86] D. Stevenson, Trends Anal. Chem. 18 (1999) 154.
[87] M. Gros, T.M. Pizzolato, M. Petrovic, M.J. Lpez de Alda, D. Barcel, J.
Chromatogr. A, 1189 (2008) 374.
[88] E. Turiel, A. Martin-Esteban, J.L. Tadeo, J. Chromatogr. A 1172 (2007) 97.
[89] Y.H. Li, T. Lang, X.L. Qi, Y. Qiao, A. Deng, Anal. Chim. Acta 624 (2008) 317.
[90] L. Nuez, E. Turiel, A. Martin-Esteban, J.L. Tadeo, J. Sep. Sci. 31 (2008) 2492.
[91] K. Pyrzynska, Anal. Sci. 23 (2007) 631.
[92] M. Valcrcel, B.M. Simonet, S. Crdenas, B. Surez, Anal. Bioanal. Chem. 382
(2005) 1783.
[93] S. Wang, P. Zhao, G. Min, G. Fang, J. Chromatogr. A 1165 (2007) 166.

- 33 -


metoxicloro) estuvieron en el intervalo 0,010,03 g L1. Los MWCNTs son
tambin vlidos para extraer metales pesados, por ejemplo, Cu (II), Cd (II), Pb
(II),Zn(II),Ni(II)yCo(II)antesdesudeterminacinporespectrometraatmica
[94]. Los lmites de deteccin para estos iones, extrados como quelatos con
pirrolidinaditiocarbamatoamnico,estuvieronenelintervalo0,300,60gL1.
Estos MWCNTs (300 mg) se usaron en 250 experimentos sin que se observara
ningunaprdidaensucapacidaddeadsorcin.

Muchos autores han intentado mejorar las propiedades de los CNTs a

travsdeunprocesodeoxidacin.Sesabequeeltratamientoconacidontrico
incrementa el rea superficial y el dimetro de los CNTs modificando las
propiedades de adsorcin de los SWCNTs. ElSheikh et al. [95] estudiaron la
influenciadelaoxidacindelosMWCNTsenlaextraccindealgunospesticidas
modelo (atrazina, propoxur y metidatin) concluyendo que la oxidacin
afectabaalaeficaciadeextraccindelosmismosdependiendodelanaturaleza
del MWCNTs y del agente oxidante empleado. En los MWCNTs oxidados con
perxido de hidrgeno y persulfato amnico no se observaron mejoras en las
recuperaciones de los pesticidas, mientras que aquellos oxidados con cido
ntrico mostraron mejor eficiencia de enriquecimiento a pH 5 comparado con
los MWCNTs sin oxidar. Los lmites de deteccin para propoxur, atrazina y
metidatinfueron220,57,5y37,5ngL1,respectivamente.

Las hemimicelas y admicelas son adsorbentes constituidos por agregados de


tensioactivos inicos adsorbidos sobre la superficie de xidos minerales. Las
hemimicelasconsistenenmonocapasdetensioactivoenlasqueelgrupoinico
interaccionaelectrostticamenteconlasuperficiedeunoxidomineraldecarga
opuesta y las cadenas hidrocarbonadas experimentan fuertes interacciones
laterales entre ellas. Se producen estructuras tipo teepee en la terminologa
anglosajona. Las admicelas son agregados tridimensionales de tensioactivo,
similares a las micelas en disolucin acuosa, adsorbidos sobre lasuperficie del
xido mineral. Se forman despus de que las hemimicelas hayan neutralizado
[94] M. Tuzen, K.O. Saygi, M. Soylak, J. Hazard. Mater. 152 (2008) 632.
[95] A.H. El-Sheikh, A.A. Insisi, J.A. Sweileh, J. Chromatogr. A 1164 (2007) 25.

- 34 -

Introduccin
completamente la superficie del xido. Las estructuras de estos agregados
molecularespuedenverseenlaFigura2.

Monmerode
tensioactivo
xidomineral

Hemimicelas

Admicelas

Figura 2. Representacin simplificada de hemimicelas y admicelas de


tensioactivos.

Estos sistemas poseen caractersticas nicas que los hacen muy


verstiles como materiales para SPE. Debido al carcter anfiflico de los
tensioactivos, sus agregados tienen regiones de diferente polaridad donde los
analitos de un amplio intervalo de polaridad y carga pueden solubilizarse.
Siempre proporcionan mecanismos mixtos de interaccin que pueden variarse
mediantelaseleccindelgrupopolardeltensioactivo(ej.interaccionesinicas,
catin, puentes de hidrgeno) y la cadena hidrocarbonada (ej. interacciones
dedispersin,,etc).

Para poder utilizar este tipo de adsorbentes en SPE es necesario


conocer las isotermas de adsorcin del correspondiente tensioactivo sobre el
xido adecuado en las condiciones experimentales en las que se va a llevar a
cabolaextraccin.Engeneral,lasisotermassedividenencuatroregionesbien
diferenciadas cuando se representa, en una escala logartmica, la cantidad de
tensioactivo adsorbidoenfuncindelacantidaddetensioactivoendisolucin
(Figura3).

- 35 -

Logtensioactivoadsorbido(mgg1xido)

Mximacarga
CHC dehemimicelas
Reginde
Henry
I

Mximacarga
detensioactivo CMC

Regin
Regin
hemimicelar hemimicelar/admicelar
II
III

Reginadmicelar
IVa
IVb

Logconcentracindetensioactivo

Figura 3. Representacin esquemtica de una isoterma de adsorcin tpica de


cuatro regiones y estructuras propuestas para los diferentes agregados de
tensioactivo formados.

En la regin I, denominada regin de Henry, el grupo polar de los


monmerosdetensioactivointeraccionanelectrostticamenteconlasuperficie
del xido mineral. La adsorcin de las molculas de tensioactivo ocurre de
forma aislada, sin ningn tipo de interaccin entre los monmeros adsorbidos
(Figura 3). La formacin de hemimicelas se inicia cuando se alcanza la
concentracin hemimicelar crtica (CHC). La adsorcin de tensioactivo en la
regin hemimicelar se produce por interacciones electrostticas con la
superficiedelxidoeinteraccioneslateralesentrelascadenashidrocarbonadas
produciendo una monocapa con estructuras de agregacin tpicas (Figura 3),
denominadasteepee.LareginIIIcomienzacuandoseproducelasaturacin
deloscentrosactivosdelxidoporeltensioactivoadsorbido.Enestaregin,la
adsorcin del tensioactivo se debe exclusivamente a las interacciones
hidrfobas entre las cadenas hidrocarbonadas producindose agregados
denominados admicelas. Una vez alcanzada la carga mxima de tensioactivo
sobre el xido mineral, la adicin de ms tensioactivo al sistema producir el
aumento de la concentracin del mismo en disolucin hasta alcanzar la
concentracin micelar crtica (CMC), a partir de la cual se forman micelas en

- 36 -

Introduccin
disolucin.Algunosdelossistemasxidomineraltensioactivocuyasisotermas
son similares a la descrita [96] estn constituidos por agregados de dodecil
sulfonato sdico, alquilbenceno sulfonato, dodecil sulfato sdico o 4C11
paraxilenosulfonatosobrealmina;agregadosdeclorurodetetradecilpiridinio,
bromuro de tetradecil piridinio o bromuro de dodecil piridinio sobre gel de
slice;agregadosdeIgepalCo660sobreslicepirognica;yagregadosdecloruro
dedodecilpiridinioop3nonilbencenosulfonatosdicosobrerutilo.

Laformacindehemimicelasyadmicelassobrelasuperficiedeunxido
mineral est influenciada fundamentalmente por el pH y la longitud de la
cadena hidrocarbonada de la molcula de tensioactivo. El pH determina la
densidad de carga superficial del xido mineral y por tanto la cantidad de
tensioactivoquepuedeadsorberse.Losxidosmineralesmsusados,alminay
slice, tienen punto de carga cero (pcz) a valores de pH alrededor de 9 y 3,
respectivamente. Por tanto, la almina se usa a valores de pH cidos para la
adsorcin de tensioactivos aninicos y la slice a valores de pH neutros o
ligeramentebsicosparalaadsorcindetensioactivoscatinicos.Conrelacina
la cadena hidrocarbonada, cuanto mayor es su longitud, ms hidrfoba es la
molcula y mayor es su facilidad para formar agregados, con la consiguiente
disminucin de la CHC o CMC. Un incremento de un grupo CH2 en la cadena
hidrocarbonadadeltensioactivoproduceunadisminucindelaCMCyCHCde
tresveces(regladeTraube)[97].

Mecanismosdeadsolubilizacindelosanalitos

El fenmeno de adsolubilizacin de compuestos orgnicos sobre


hemimicelas y admicelas presenta un gran potencial para extraccin en fase
slida. Los agregados de tensioactivos poseen estructura tridimensional con
diferentes microambientes donde analitos de muy diversa polaridad y carga
pueden solubilizarse. Las interacciones que pueden ofrecer son muy variadas
dependiendodelascaractersticasdelgrupopolardeltensioactivoydeltipode
[96] S. Paria, K.C. Khilar, Adv. Colloid Interfac. 110 (2004) 75.
[97] A. Fan, P. Somasundaran, N.J. Turro, Langmuir 13 (1997) 506.

- 37 -


agregado seleccionado. En la figura 4 se muestra el tipo de interacciones que
puedendarsedependiendodelaregindelaisotermadondenosencontremos.

Figura4. Mecanismo de adsorcin del tensioactivo sobre el xido mineral y de


adsolubilizacin de solutos sobre los agregados formados en las distintas
regiones de la isoterma de adsorcin.

Delascuatroregionesenlasquesedivideunaisoterma,notodasson
adecuadas para su utilizacin en SPE. Las regiones que pueden utilizarse son

- 38 -

Introduccin
aquellasenlasquehemimicelasyadmicelasestnenequilibrioconmonmeros
en disolucin. As, la regin I (Figura 4), donde el mecanismo de adsorcin de
tensioactivo sobre el xido mineral se debe a interacciones meramente
electrostticas, no es apta para SPE puesto que no se forma ningn tipo de
agregado donde los analitos puedan solubilizarse. En la regin hemimicelar
(reginII,Figura4)losanalitospuedensolubilizarseeneladsorbentemediante
interacciones hidrfobas con la cadena hidrocarbonada del tensioactivo. Las
regionesIII(constituidaporhemimicelasyadmicelas)yIVa(admicelas)sonlas
que ofrecen mayores posibilidades en SPE puesto que la superficie exterior es
polaroinicayeltipodeinteraccinpuedemodificarsemedianteseleccindel
tensioactivo.Enestasregionespuedenadsolubilizarseanalitosdemuydiferente
polaridad, ya que pueden producirse enlaces por puente de hidrgeno,
interacciones inicas, de Van der Waals o catin y formacin de agregados
mixtos(cuandolosanalitospresentancarcteranfiflico).As,sepodralograrla
retencin simultnea de analitos con muy diferente polaridad, siendo esta
caracterstica muy importante en monitorizacin medioambiental. Cuando la
concentracindetensioactivoendisolucinalcanzalaCMC,reginIVb,(Figura
4), comienzan a formarse micelas y en este caso la retencin de los analitos
sobre el adsorbente no es cuantitativa ya que stos se distribuyen entre el
adsorbente y las micelas en disolucin. Por consiguiente, esta regin de la
isotermatampocoesaptaparaSPE.

Mododeoperacin

Unaspectoimportanteaconsiderarcuandosetrabajaconhemimicelas
y/o admicelas como adsorbente en SPE es que la adsorcin del tensioactivo
sobre el xido mineral es un proceso dinmico, por lo que estos agregados se
encuentranenequilibrioconmolculasdetensioactivoendisolucin.Portanto,
durantelapercolacindelamuestraatravsdeladsorbenteseproduciruna
prdida progresiva de tensioactivo, lo cual modificar la cantidad y/o
caractersticas de la fase adsorbente usada. Si se trabaja en la regin
hemimicelar,laconcentracinendisolucinesdelordendegL1ylaprdida
de tensioactivo durante la percolacin de la muestra es despreciable, no

- 39 -


necesitndose hacer un aporte adicional de tensioactivo a la muestra. Sin
embargo,laconcentracindetensioactivoendisolucinenlasregionesdonde
seproducenadmicelasesdelordendemgL1,yportantosiestosagregadosse
usanenSPEesfundamentalaadiralamuestralaconcentracinadecuadade
tensioactivo,paramantenerconstantelacantidaddetensioactivoadsorbido.

Elmododeoperacincuandosetrabajaenextraccinenfaseslidacon
hemimicelas/admicelas es similar a la extraccin en fase slida convencional
(Figura5):

a)Formacinde
hemimicelas/admicelas
Disolucin de tensioactivo
al pH de la extraccin

b)Adsolubilizacindelos
contaminantes

c)Elucindelos
contaminantes

Muestra ambiental

Me

1-2 mL de disolvente
orgnico o disolucin
acuosa

OH

H
H
H

xido mineral

H
H H

Me
OH

Figura5. Modo de operacin cuando se usan hemimicelas y/o admicelas como


adsorbente en SPE.

a) En primer lugar se procede a la formacin de hemimicela y/o admicelas


pasandounadisolucindeltensioactivoseleccionado,alpHalquesellevara
cabolaextraccin,atravsdelxidomineral.

b) Acontinuacinseprocedealapercolacindelamuestrademaneraquese
producelaadsolubilizacindelosanalitos(retencin).Hayquetenerpresente
eltipodeagregadoconelquesetrabaja,puessegnseacabademencionar,si
se trabaja en la zona admicelar hay que aadir a la muestra la concentracin

- 40 -

Introduccin
adecuada de tensioactivo, para mantener constante la cantidad adsorbida del
mismo.

c) Finalmente, los analitos se eluyen con 12 mL de disolvente orgnico o


disolucionesacuosasaunvalordepHadecuadopararomperlasinteracciones
tensioactivoxidomineral.

Aplicaciones

Inicialmentelosadsorbenteshemimicelares/admicelaresseaplicarona
la extraccin de metales pesados presentes en muestras acuosas mediante la
formacin de complejos con agentes quelatantes, previamente solubilizados
sobre el agregado [98101] o bien mediante formacin de un quelato en
99,100,101

disolucinacuosayposterioradsolubilizacin[98,99,101,102].

Hasta hace pocos aos, las hemimicelas/admicelas no comenzaron a


utilizarseparalaextraccin/preconcentracindecompuestosorgnicospreviaa
sudeterminacinanaltica.Lapresenciaderegionesdediferentepolaridaden
estos agregados supramoleculares hace que tengan una excelente capacidad
para solubilizar una gran variedad de compuestos orgnicos. Muchos de los
mtodos desarrollados han empleado hemimicelas del tensioactivo aninico
dodecil sulfato sdico adsorbido sobre almina para la extraccin y
preconcentracindediferentescompuestostalescomoclorofenoles[103,104],
alquilfenoles y alquilfenoles carboxilados [105], ftalatos [104,106],

[98] J.L. Manzoori, M.H. Sorouraddin, A.M.H. Shabani, J. Anal. At. Spectrom. 13 (1998)
305.
[99] J.L. Manzoori, M.H. Sorouraddin, A.M H. Shabani, Microchem. J. 63 (1999) 295.
[100] J.L. Manzoori, M.H. Sorouranddin, F. Semirani, Talanta 42 (1995) 1151.
[101] M. Hirade, J. Iwasawa, H. Tawaguchi, Talanta 44 (1997) 231.
[102] M. Hirade, J. Hori, Anal. Sci. 15 (1999) 1055.
[103] T. Saitoh, Y. Nakayama, M.T. Hiraide, J. Chromatogr. A 972 (2002) 205.
[104] T. Saitoh, Y. Nakayama, M.T. Hiraide, J. Chromatogr. A 1040 (2004) 185.
[105] M. Cantero, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1120 (2006) 271.
[106] F.J. Lpez-Jimnez, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 551 (2005) 142.

- 41 -


hidrocarburospolicclicosaromticos(PAHs)[107]yestrgenos[108]presentes
en muestras acuosas ambientales. Tambin se ha propuesto la determinacin
declorofenolesenaguadero[109]yPAHsendistintasmuestrasacuosas[110]
usando admicelas de aerosol OT sobre almina y de bromuro de
dihexadecildimetilamoniosobreslice,respectivamente.Enlamayoradeestas
aplicaciones el mecanismo principal de solubilizacin de los analitos sobre el
agregado se debe al establecimiento de interacciones hidrfobas, aunque
tambin pueden darse otro tipo de interacciones (electrostticas, catin,
puentes de hidrgeno, etc.) dependiendo de la naturaleza del grupo polar del
tensioactivo,pudindoseseleccionarapriorieladsorbentemsadecuadopara
una aplicacin concreta. As, se ha llevado a cabo la extraccin de
benzimidazoles [111] y herbicidas de amonio cuaternario quats [112]
utilizando admicelas de SDS sobre almina donde los analitos se retienen
medianteinteraccionesdetipoelectrostticooporformacindeparesinicos,
respectivamente. En la aplicacin relativa a los quats, se propuso por vez
primeraelacoplamientoonlinedeunadsorbentedeSPEbasadoenagregados
supramolecularesdetensioactivoacromatografadelquidos.

La formacin de hemimicelas/admicelas mixtas de tetrabutilamonio


(TBA)SDS adsorbidas sobre almina ofrece otro mecanismo de retencin de
analitos por el establecimiento de interacciones catin entre el grupo
aromticodestosyelgrupoamoniodeltetrabutilamonio.Conestaestrategia
sehanextradobisfenolesymultiresiduosdeplaguicidas[113,114].

[107] T. Saitoh, S. Matsushima, M. Hiraide, J. Chromatogr. A 1069 (2005) 271.


[108] A. Garca-Prieto, L. Lunar, S. Rubio, D. Prez-Bendito, Analyst 131 (2006) 407.
[109] T. Saitoh, S. Matsushima, M. Hiraide, J. Chromatogr. A 1040 (2004) 185.
[110] Q. Zhao, J. Simmons, E.D. Conte, J. Chromatogr. A 1132 (2006) 1.
[111] A. Moral, M.D. Sicilia, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 569 (2006)
132.
[112] F. Merino, S. Rubio, D. Prez-Bendito, Anal. Chem. 76 (2004) 3878.
[113] A. Moral, M.D. Sicilia, S. Rubio, D. Prez-Bendito J. Chromatogr. A 1100 (2005)
8.
[114] A. Moral, M.D. Sicilia, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 608 (2008)
61.

- 42 -

Introduccin
Recientemente se han desarrollado mtodos en los que el mecanismo
deextraccinsebasaenlaformacindeagregadosmixtosanalitoextractante,
siendo requisito indispensable el carcter anfiflico del analito por lo que esta
metodologahasidomuyaplicadaparaelanlisisdetensioactivos.Hemimicelas
del tensioactivo aninico SDS adsorbidas sobre almina o resinas de
intercambio aninico se han empleado para extraer tensioactivos catinicos
[115,116] y no inicos [117], mientras que hemimicelas de tensioactivos
catinicos (cloruro de cetilpiridinio y bromuro de cetiltrimetilamonio)
adsorbidassobreslicesehanempleadoparaextraertensioactivosaninicosde
muestrasdeaguapotable,deroyresiduales[118,119].

Enlosltimosaoslainvestigacinsobrehemimicelas/admicelascomo
sorbentes para SPE ha estado relacionada principalmente con el desarrollo de
nuevas aplicaciones [114,119121] y formatos [122127] as como estudios
120,121

123124125

126127

tericos para elucidar y comprender los mecanismos de interaccin que


gobiernanelprocesodeSPE[128].

Li

et

al

[120]

propusieron

el

adsorbente

bromuro

de

octadeciltrimetilamonio adsorbido sobre almina para la extraccin de


[115] F. Merino, S. Rubio, D. Prez-Bendito, Anal. Chem. 75 (2003) 6799.
[116] J.K. Autry, E.G.Vaught, E.D. Conte, Microchem. J. 80 (2005) 25.
[117] M. Cantero, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1067 (2005) 161.
[118] L. Lunar, S. Rubio, D. Prez-Bendito, Analyst 131 (2006) 835.
[119] X. Zhao, J. Li, Y. Shi, Y. Cai, S. Mou, G. Jiang, J. Chromatogr. A 1154 (2007) 52.
[120] J-D. Li, Y-Q. Cai, Y.L. Shi, S.F. Mou, G.B. Jiang, J. Chromatogr. A 1139 (2007)
178.
[121] E.M. Costi, I. Goryacheva, M.D. Sicilia, S. Rubio, D. Prez-Bendito, J.
Chromatogr. A 1210 (2008) 1210.
[122] H. Niu, Y. Cai, Y. Shi, F. Wei, S. Mou, G. Jiang, J. Chromatogr. A 1172 (2007)
113.
[123] J. Li, X. Zhao, Y. Shi, Y. Cai, S. Mou, G. Jiang, J. Chromatogr. A 1180 (2008) 24.
[124] X. Zhao, Y. Shi, T. Wang, Y. Cai, G. Jiang, J. Chromatogr. A 1188 (2008) 140.
[125] X. Zhao, Y. Shi, Y. Cai, S. Mou, Environ. Sci. Technol. 42 (2008) 1201.
[126] L. Sun, C. Zhang, L. Chen, J. Liu, H. Jin, H. Xu, L. Diang, Anal. Chim. Acta 638
(2009) 162.
[127] A. Ballesteros-Gmez, S. Rubio, Anal. Chem. 81 (2009) 9012.
[128] A. Garca-Prieto, L. Lunar, S. Rubio, D. Prez-Bendito, Anal. Bioanal. Chem. 388
(2007) 1823.

- 43 -


sulfonamidas

(suldiazina,

sulfatiazol,

sulfapiridina,

sulfametazina

sulfametoxazol) en aguas de ro y residuales previamente a su deteccin por


cromatografa lquidadeteccin ultravioleta (LCUV). Las sulfonamidas se
retuvieron cuantitativamente, los factores de preconcentracin estuvieron
entre300y600yloslmitesdedeteccinestuvieroncomprendidosentre0,15y
0,35 g L1. Costi et al [121] usaron el sorbente SDS adsorbido sobre almina
paralaextraccincuantitativadeibuprofenoynaproxenoenaguasresiduales.
Lasdrogasformaronagregadosmixtosconeltensioactivoyconsecuentemente
fueronfuertementeretenidassobreeladsorbente.Losvolmenesderupturay
lmitesdedeteccinparaelnaproxenoeibuprofenoenlasmuestrasestuvieron
alrededor de 0,75 L y 1L y 0,50,8 y 79 ng L1, respectivamente. El mtodo se
aplicaladeterminacindeestasdrogasen3plantasdetratamientodeaguas
residuales del sur de Espaa. Las concentraciones de naproxeno e ibuprofeno
estuvieronentre2,0y7,4gL1 y0,9y3,3gL1enlosinfluentesy0,4y1,4g
L1y0,2y0,8gL1enefluentes,respectivamente.

La capacidad de las hemimicelas/admicelas para proporcionar


diferentes mecanismos de retencin las hace adsorbentes ideales para los
anlisis multiresiduo. Esta propiedad fue aprovechada por Moral et al. [114]
para la extraccin de 17 pesticidas representativos de los diferentes grupos
(triazinas,

fenilureas,

carbamatos,

azoles,

anilidas,

cloroacetanilidas,

organofosforados,fenoxicidos,cidosariloxicidosyfenoles)enaguasderoy
subterrneas. El adsorbente seleccionado (hemimicelas/admicelas mixtas de
dodecil sulfato sdico y tetrabutilamonio sobre almina) proporcion
interacciones hidrofbicas, inicas y catin que retuvieron fuertemente los
pesticidas con diferentes polaridades y acidez (bases, neutros y cidos). Se
obtuvieronlmitesdedeteccinmenoresde100ngL1paraladeterminacinde
los17pesticidasmedianteLCUV.

Conelfindeacelerarlaextraccinenfaseslidaconvencionalyevitar
la percolacin de la muestra, varios grupos de investigacin han utilizado
nanopartculas como soporte slido para las hemimicelas/admicelas. Niu et al
[122]prepararonnanotubosdetitaniatocubiertosdehemimicelasyadmicelas

- 44 -

Introduccin
debromurodecetiltrimetilamonioparapreconcentrarsteresdeftalato(din
propilftalato, dinbutilftalato, diciclohexilftalato y dinoctilftalato) en
muestrasacuosas.Elmtodoalcanzlmitesdedeteccinentre19y39ngL1.Li
etal[123]propusieronelusodenanopartculasdeFe3O4 comoxidomineral.
Deestemodo,laSPEsellevaacaboenmodobatchyacontinuacinseseparan
las nanopartculas utilizando un imn de NdFeB. El mtodo propuesto se ha
usado para la extraccin de clorofenoles (2clorofenol, 2,4diclorofenol, 2,4,6
diclorofenol y pentaclorofenol) en muestras acuosas ambientales usando
bromurodecetiltrimetilamonioadsorbidosobreFe3O4.Loselevadosfactoresde
preconcentracin(700)quesealcanzaronparalosanalitosresultaronenlmites
de deteccin entre 0,110,15 g L1 usando LCUV. Ballesteros et al. [127]
utilizaron una estrategia parecida empleando nanopartculas magnticas
recubiertas con hemimicelas de tetradecanoato para extraer hidrocarburos
aromticos policclicos (benzo(a)antraceno, criseno, benzo(b)fluoranteno,
benzo(k)fluoranteno,

benzo(a)pireno,

dibenzo(a,h)antraceno,

benzo(ghi)

perilenoeindeno(1,2,3cd)pireno).Laprincipalventajadeesteadsorbenteesel
fuerte enlace qumico entre las nanopartculas y las hemimicelas que evita la
elucindelasmismasyportanto,seproducenextractoslibresdetensioactivo.
Laeficienciadeextraccinnoseinfluenciaporlaconcentracindesaleshasta1
M y valores de pH comprendidos entre 2,59 y el factor de preconcentracin
alcanzado fue 116. Los lmites de cuantificacin obtenidos estuvieron
comprendidos entre 0,20,5 ng L1 utilizando cromatografa lquidadeteccin
porfluorescencia(LCFL).Elmtodopropuestoseaplicaladeterminacinde
estoscontaminantesenaguassuperficialesysubterrneasdevarioslugaresdel
surdeEspaa.

Un buen conocimiento de las interacciones entre la matriz y el


adsorbente es esencial para prevenir las interferencias y desarrollar mtodos
SPE eficientes y robustos. GarcaPrieto et al. [128] estudiaron el efecto de los
componentes de la matriz de aguas de ro y residuales en la adsorcin del
dodecilsulfato sdico sobre la almina, el cual es el adsorbente
hemimicelar/admicelar ms usado en SPE, y discuti las consecuencias
analticas de las modificaciones observadas. Se demostr que los electrolitos

- 45 -


competan con las molculas de tensioactivo por los sitios de carga superficial
enlaprimerapartedelareginhemimicelar.Porotroladosecomprobquelos
agentes precipitantes producan sales insolubles con el tensioactivo en el
adsorbente admicelar y que la materia orgnica no tena ningn tipo de
influencia. A partir de estos resultados, se establecieron reglas simples para
prevenir y detectar modificaciones en la adsorcin del tensioactivo, inducidas
porlamatrizdelamuestra.Asimismo,conelconocimientoadquiridoapartirde
estos resultados, es posible conocer, a priori, la idoneidad de un adsorbente
paraunaaplicacinespecficalocualdeberapermitireldesarrollodemtodos
msrobustosysimples.

2.3.1.2. Disolventessupramoleculares

Labsquedadealternativasalosdisolventesorgnicostradicionalesen
las extracciones lquidolquido ha fomentado el uso de lquidos ms
respetuosos con el medio ambiente como es el caso de los disolventes
supramoleculares (SUPRASs). El inters por aplicar estos disolventes en
procesosdeextraccinyotrastcnicasdeseparacinsedebeasuversatilidad,
principalmente derivada de los diferentes tipos de interacciones que pueden
establecer con los analitos, lo que hace que tengan capacidad para solubilizar
compuestosenunampliointervalodepolaridad.

Los disolventes supramoleculares se sintetizan a partir de disoluciones


de molculas anfiflicas mediante procesos de autoensamblaje y coacervacin.
La IUPAC define la coacervacin como un fenmeno que consiste en la
separacin de sistemas coloidales en dos fases lquidas [129]. A la fase ms
concentradaenelcomponentecoloidalseledenominacoacervadoodisolvente
supramolecular,laotrafasetienemuybajaconcentracinenestecomponente
ysedenominafaseenequilibrio.

[129] IUPAC Compendium of chemicals terminology 31 (1972) 611.

- 46 -

Introduccin
A continuacin se comentan los aspectos ms importantes de los
diferentes tipos de disolventes supramoleculares con especial nfasis en los
constituidos por micelas normales e inversas y vesculas de tensioactivos
aninicosquesernlossistemasutilizadosenlasinvestigacionesllevadasacabo
enestamemoria.

Losdisolventessupramolecularesconstituidospormicelasdetensioactivosno
inicos hansidolosmsutilizadosen lasextraccionesanalticasylosquems
atencinhanrecibidodesdequefuerondescritosporWatanabeetal.[130].Se
forman al elevarse la temperatura de las disoluciones acuosas que contienen
concentraciones de tensioactivos no inicos superiores a su concentracin
micelarcrtica(cmc).Latemperaturaapartirdelacualseproduceelfenmeno
decoacervacinsedenominapuntodenubecloudpointyvaraenfuncinde
la estructura molecular del tensioactivo y de su concentracin en disolucin.
Esta metodologa denominada cloud point extraction (CPE) se ha aplicado
usando fundamentalmente Triton X114 para la extraccin de sustancias
apolares en muestras acuosas ambientales [131135] y quelatos metlicos

132133

134135

[136,137]. CPE contina siendo una de las tcnicas lder para la extraccin de
metales en agua previa a su determinacin por espectrometra de absorcin
atmica. La aplicacin de CPE a la extraccin de contaminantes orgnicos ha
encontradomsproblemasdebidoalacoelucinoriginadaporlostensioactivos
no inicos en cromatografa lquida, ya que stos slo estn disponibles
comercialmentecomomezclasdehomlogoseismeros.
[130] H. Ishii, J. Miura, H. Watanabe, Bunseki Kagaku 26 (1997) 252
[131] S. Rubio, D. Prez-Bendito, Trend Anal. Chem 22 (2002) 470.
[132] E. Pramauro, A.B. Prevot, Recent Res. Develop. in Pure & Appl. Anal. Chem. 1
(1998) 225.
[133] Z. Sosa Ferrera, C. Padrn Sanz, C. Mahugo Santana, J.J. Santana Rodrguez,
Trends Anal. Chem. 23 (2004) 469.
[134] R. Carabias-Martnez, E. Rodrguez-Gonzalo, B. Moreno-Cordero, J.L. PrezPavn, E. Fernndez Laespada, J. Chromatogr. A 902 (2000) 251.
[135] S. Sie, M.C. Paau, C.F. Li, D. Xiao, M.M.F. Choi, J. Chromatogr. A 1217 (2010)
2306.
[136] M. Bezerra, M.A. Arruda, S.L. Ferreira, Applied Spectrosc. Reviews 40 (2005)
269.
[137] C.D. Stalikas, Trends Anal. Chem. 21 (2002) 343.

- 47 -


Disolventes supramoleculares constituidos por micelas de tensioactivos
anfteros. El uso de este tipo de disolventes en procesos de extraccin fue
propuestaporSaitohetal.enladcadadelos90[138].Alcontrarioqueocurre
conlostensioactivosnoinicos,laformacindeldisolventesupramolecularen
disoluciones de tensioactivos anfteros se produce cuando la temperatura
disminuyepordebajodeunvalorcrtico.

Disolventes supramoleculares constituidos por micelas de tensioactivos


catinicos. Las disoluciones de tensioactivos catinicos experimentan por lo
general coacervacin en presencia de sales inorgnicas [139], aunque existen
casosenlosqueademsdelaadicindelasalesnecesarialapresenciadeun
cotensioactivo para que se produzca el fenmeno de la coacervacin. Existen
pocasaplicacionesdeestosdisolventesenprocesosdeextraccinanalticayse
limitan a la determinacin de compuestos orgnicos en aguas naturales
[139,140].

Disolventes supramoleculares constituidos por micelas de tensioactivos


aninicos.Estosdisolventesestnconstituidospormicelasdelostensioactivos
alquilsulfatos,alquilsulfonatos,alquilbencenosulfonatosyalquilsulfosucinatos
y se forman en presencia de cidos a concentraciones 23 M [141], siendo su
coacervacinindependientedela temperatura[142]. Dodecilsulfatoydodecil
sulfonato sdico han sido los tensioactivos aninicos ms utilizados en los
procesosdeextraccinanalticas[59,143145].
144,145

[138] T. Saitoh, W. L. Hinze, Anal. Chem. 63 (1991) 2520.


[139] X. Jin, M. Zhu, E.D. Conte, Anal. Chem. 71 (1999) 514.
[140] B.K.W. Man, M.H.W. Lam, P.K.S. Lam, R.S.S. Wu, G.Shaw, Environ. Sci.
Technol. 36 (2002) 3985.
[141] I. Casero, M.D. Sicilia, S. Rubio, D. Prez-Bendito, Anal. Chem. 71 (1999) 4519.
[142] M.D. Sicilia, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 460 (2002) 13.
[143] I.Y. Goryacheva, S.N. Shtykov, A.S. Loginov, I.V. Panteleeva, Anal. Bioanal.
Chem. 382 (2005) 1413.
[144] G. Jia, L. Li, J. Qiu, X. Wang, W. Zhu, Y. Sun, Z. Zhou, Spectrochim. Acta 67
(2007) 460.
[145] A. Santalad, S. Srijarani, R. Burakham, T. Sakai, R.L. Deming, Microchem. J. 90
(2008) 50.

- 48 -

Introduccin
Disolventes supramoleculares constituidos por micelas mixtas. Estos
disolventesseobtienenapartirdedisolucionesacuosasquecontienenmezclas
de tensioactivos no inicos, mezclas de un tensioactivo no inico y un
tensioactivo inico o mezclas de un tensioactivo catinico y otro aninico. El
agenteinductordelacoacervacineslatemperaturayelvaloralquesealcanza
elcloudpointdelasdisolucionesdependedelamezcladetensioactivosdecada
sistema. Estos disolventes se han usado para extraer y preconcentrar
compuestosorgnicos[146151] y metales[152157].
147,148,149

150,151

153,154,155,156,157

Disolventes supramoleculares constituidos por micelas inversas de cidos


alquilcarboxlicos. Los disolventes supramoleculares de micelas inversas se
producen al adicionar agua a disoluciones de cidos carboxlicos entre 6 y 18
tomos de carbono en tetrahidrofurano [158]. Ya que la micela inversa se
produceapartirdelaformaprotonadadeloscidos,eldisolventesloseforma
a valores de pH inferiores a 4 (pka RCOOH = 4.80.2). Estos disolventes son
compatibles con cromatografa lquida seguida de deteccin UV, FL y
espectrometra de masas (MS). Su potencial para la extraccin de

[146] R.P. Frankewich, W.L. Hinze, Anal. Chem. 66 (1994) 944.


[147] E. Evdokimov, R. von Wandruszka, Anal. Lett. 31 (1998) 2289.
[148] E.J. Kim, D.O. Shah, Langmuir, 18 (2002) 10105.
[149] J.C.A. de Wuilloud, R.G. Wuilloud, B.B.M. Sadi, J.A. Caruso, Analyst, 128 (2003)
453.
[150] B. Delgado, V. Pino, J.H. Ayala, V. Gonzlez, A.M. Alonso, Anal. Chim. Acta 518
(2004) 165.
[151] A.R. Zarei, Anal. Biochem. 369 (2007) 161.
[152] E.K. Paleologos, A.G. Vlessidis, M.I. Karayannis, N.P. Evmiridis, Anal. Chim.
Acta 477 (2003) 223.
[153] D.L. Giokas, E.K. Paleologos, M.I. Karayannis, Anal. Bioanal. Chem. 373 (2002)
237.
[154] D.L. Giokas, J. Antelo, E.K. Paleologos, F. Aree, M.I. Karayannis, J. Environ.
Monit. 4 (2002) 505.
[155] E.K. Paleologos, D.L. Giokas, S.M. Tzouwara-Karayanni, Anal. Chim. Acta 458
(2002) 241.
[156] N.N. Meeravali, S.J. Jiang, J. Anal. At. Spectrom. 23 (2008) 1365.
[157] H. Filik, F. Dondurmacioglu, R. Apak, Int. J. Environ. Anal. Chem. 80 (2008) 637.
[158] F.J. Ruiz, S. Rubio, D. Prez-Bendito, Anal. Chem. 79 (2007) 7473.

- 49 -


contaminantesorgnicosenunampliointervalodepolaridadsehademostrado
mediantesuaplicacinaaguasnaturalesyresiduales[158,159].

Disolventes de vesculas de cidos alquilcarboxlicos. Estos disolventes se


producen en disoluciones acuosas de cidos alquilcarboxlicos, con longitudes
de cadena hidrocarbonada comprendida entre 6 y 18 tomos de carbono, a
valores de pH en los cuales los cidos se encuentran protonados y
desprotonados

en

proporciones

equimoleculares

[160].

El

catin

tetrabutilamonio acta como agente inductor de la coacervacin mediante la


neutralizacindelascargasnegativasdelasmolculasdealquilcarboxilatoenla
superficie de la vescula, lo que facilita las interacciones entre las
macromolculas que originan el disolvente supramolecular. El pH es un factor
clave en la formacin de estos disolventes y son necesarios valores
comprendidosenelintervalodepKa(aparente)1,dondepKa(aparente)corresponde
al pka del cido cuando est formando parte de la vescula. El valor de pKa
(aparente) varia entre 6 y 8,5 para los cidos alquilcarboxlicos con longitudes de

cadena hidrocarbonada entre 8 y 18 tomos de carbono. Los disolventes


supramolecularesdevesculassehanempleadoparalaextraccindedistintos
contaminantesorgnicosenaguasnaturalesyresiduales[160,161].

La Figura 6 muestra una representacin simplificada de las estructuras


supramoleculares que componen los disolventes supramoleculares descritos y
aplicadosaextraccionesanalticaspornuestrogrupodeinvestigacin,ascomo
fotografas de microscopa ptica de los disolventes supramoleculares de
micelas normales y de micelas inversas y una fotografa de microscopa
electrnicadetransmisindeundisolventesupramoleculardevesculas.

[159] A. Ballesteros-Gmez, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1203 (2008)


168.
[160] F.J. Ruiz, S. Rubio, D. Prez-Bendito, Anal. Chem. 72 (2006) 7229.
[161] F.J. Lpez-Jimnez, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1195 (2008) 25.

- 50 -

Introduccin

Micelaacuosa

Vescula

Micelainversa

a)

b)

c)

20x

20x

Figura 6. Representacin simplificada de diferentes tipos de agregados y


fotografas obtenidas para disolventes supramoleculares constituidos por
micelas aninicas de SDS (a), micelas inversas de cido decanoico (b) y
vesculas de cido decanoico (c) mediante microscopia ptica (a y b) y de
microscopa electrnica de transmisin (c).

Existendiferenciasmorfolgicasyestructuralesentrelosdistintostipos
de agregados producidos en disolucin las cuales afectan al proceso de
extraccin. As, aunque las micelas acuosas e inversas son entidades esfricas
condimetrosmuysimilares(360y4080,respectivamente)lasprimerasse
forman en agua y la segundas en disolventes apolares y de baja constante
dielctrica y por tanto, los medios de extraccin utilizados son diferentes. El
tamao de las vesculas es considerablemente mayor (3005000 ) y como
consecuenciaelnmerodemolculasdesolutoquepuedensolubilizarseenlas
mismasessuperioralquesesolubilizanenlasmicelas.En2010sepublicuna

- 51 -


revisinsobreaspectostericoprcticosrelacionadosconelusodediferentes
SUPRASsenextraccionesanalticas[162].

Diagramadefases

Para describir el comportamiento de sistemas en equilibrio donde se


generandiferentesfasesserecurrealosdenominadosdiagramasdefases,que
sonrepresentacionesgrficasdondesemuestraelcomportamientodelsistema
en funcin de diferentes variables. Concretamente, en el proceso de
coacervacin es muy importante determinar los valores relativos
(concentraciones,temperatura,etc.)deloscomponentesdelsistemaalosque
ocurrelaseparacindefasesconobjetodedeterminarloslmitesenlosquese
obtieneeldisolventesupramolecular.Enlafigura7semuestranlosdiagramas
de fases de distintos tensioactivos dando lugar a diferentes disolventes
supramoleculares. En (a) y (c) se muestran los diagramas de fases a partir de
disoluciones acuosas del tensioactivo no inico (triton X114) y de un
tensioactivo anftero 3(nonildimetilamonio) propil sulfato (C9APSO4) en
funcin de la temperatura. La denominada curva de coexistencia separa dos
regiones; en la regin L el tensioactivo forma micelas acuosas, mientras en la
regin LL coexisten dos fases: el disolvente supramolecular constituido por
micelas acuosas de grandes dimensiones y la fase en equilibrio donde el
tensioactivo se encuentra en forma monomrica a la concentracin micelar
crtica. Las disoluciones de micelas aninicas acuosa constituidas por alquil
sulfatos, alquil sulfonatos y alquil sulfosucinatos, que experimentan
coacervacininducidaporcidosatemperaturaambiente,presentandiagramas
defasescomplejos[141,59].EnlaFigura7bsemuestraeldiagramadefasesde
micelasacuosasdedodecanosulfonatosdico(SDSA).Enestecasosedefinen
cuatroregionesenlasqueseobserva:unafaselquidahomognea(L),laregin
decoacervacin(LL),unaemulsin(E)yunareginconstituidapordosfases,
unadeellaslquidaylaotraslida(S).Lafigura7dmuestraeldiagramadefases
correspondientealsistematetrahidrofurano/cidodecanoico(DA)/aguaqueda
lugaradisolventessupramolecularesdemicelasinversas.LareginSrepresenta
[162] A. Ballesteros-Gmez, M.D. Sicilia, S. Rubio, Anal. Chim. Acta 677 (2010) 108.

- 52 -

Introduccin
una regin heterognea donde el cido decanoico permanece insoluble
mientrasqueenlareginLLcoexisteneldisolventesupramolecularylafaseen
equilibrio. A altos porcentajes de tetrahidrofurano se forma una nica fase
homognea donde el biotensioactivo forma micelas inversas (regin L).
Finalmente en la figura 7e puede observarse el comportamiento de fases de
mezclas de cido decanoico/decanoato en relacin 1:1 en presencia de
tetrabutilamonio bromuro a temperatura ambiente. En la regin L mezclas de
cidos carboxlicos protonados y desprotonados en relacin 1:1 producen
vesculas. La presencia de iones tetrabutilamonio hace que estas vesculas
coacervenformndoseeldisolventesupramolecularenlareginLL.Unexceso
de estos iones provocara mezclas del disolvente supramolecular con
precipitadosslidoscorrespondientesalareginSdelagrfica.

Engeneral, todoslosdiagramasdefasessemodificanen presenciade


aditivostalescomosales,disolventesorgnicos,etc.porloqueestehechodebe
tenerse en cuenta en los procesos de extraccin basados en fenmenos de
coacervacin.AslaadicindeaditivosaunadisolucinacuosadeTritnX100
puedeproducirunaumentoounadisminucindelatemperaturadelpuntode
nube y en los tensioactivos anfteros, por lo general, la adicin de una sal
provoca un aumento en la temperatura del punto de nube. Los diagramas de
fasesdetensioactivosinicostambinpuedenmodificarseporlapresenciade
aditivos. Por ejemplo, la adicin de concentraciones de cloruro sdico
superiores a 0,4 M a disoluciones acuosas cidas (03,5 M HCl) de
dodecanosulfonato sdico a una concentracin del 1% (w/v) provoca la
precipitacindeltensioactivo.

- 53 -

40

10
8

(a)
L-L

30
20
10

[HCl], M

TEMPERATURA, C

S
E

6
4

L-L

2
0

(b)

10 12

60
40

L-L

Agua (v/v)

TEMPERATURA, C

20

(d)

40
60

30
20
10
[C APSO ] (w/v)
9
4

80
L

60
L-L

80

40
20

100

10

S
0

Tetrahidrofurano (v/v)

20

(c)

80

[SDSA] (w/v)

Triton X-114 (w/v)

100

3
1
2
4
[cido decanoico] (w/v)

Bu4NBr (M)

0,8

(e)
S

0,6
0,4
L-L
0,2
0

L
0 0,04 0,08 0,12 0,16 0,2
[decanoico+decanoato] (M)

Figura 7. Diagrama de fases de (a) micelas acuosas de Triton X-114, (b)


micelas acuosas de dodecanosulfonato sdico, (c) micelas acuosas de 3(nonildimetilamonio)propil sulfato, (d) micelas inversas de cido decanoico
y (e) vesculas de cido decanoico/decanoato.

- 54 -

Introduccin
Mecanismosdesolubilizacinyconcentracindelosanalitos

La solubilizacin de analitos en las macromolculas que forman el


disolvente supramolecular constituye la base de su aplicacin en procesos de
separacin.Teniendoencuentaqueeldisolventesupramolecularestaformado
por agregados tridimensionales de sustancias anfiflicas, stos presentan
diferentesregionesdondesepuedensolubilizaranalitosdedistintapolaridady
carga. As, los analitos hidrfobos se solubilizarn en la regin hidrocarbonada
de las macromolculas que conforman el disolvente supramolecular debido
exclusivamente a interacciones hidrfobas mientras que los analitos inicos y
polares se solubilizarn en la regin polar a travs de diferentes interacciones
inicas, catin, enlaces por puentes de hidrgeno, etc. Por otro lado, los
solutos con carcter anfiflico formarn agregados mixtos con el disolvente
supramolecularmedianteinteraccionesconlosgrupospolaresehidrfobosde
lostensioactivosquelasconstituyen.

El volumen de disolvente supramolecular obtenido ser el que


determineelfactordepreconcentracintericoencadacaso,mientrasqueel
factordepreconcentracinrealvariarenfuncindelarecuperacinobtenida
paracadaanalitoconcreto.

No existe uniformidad en la bibliografa acerca de la definicin del


coeficientedeparticinodelaconstantedeequilibrioquepuedeusarsepara
representarlasolubilizacindeloscomponentesdeunadisolucinensistemas
supramoleculares[163].Paraaplicacionesanalticas,unodelosprocedimientos
mscomuneshasidocalcularuncoeficientededistribucin(D),quevienedado
porlasiguienteexpresinmatemtica:

D=[A]d/[A]aq

[163] S.D. Christian, J.F. Scamehorn (Eds.) en: Surfactant-Based Separation Processes,
Surfactant Science Series 33, Dekker, New York, 1989.

- 55 -


donde[A]dy[A]aq sonlasconcentraciones,eneldisolventesupramolecularyen
lafaseacuosa,respectivamente.

Mododeoperacin

El modo de operacin cuando se trabaja en extraccin lquidolquido


usandodisolventessupramolecularesconstadedosetapas:

a) Formacin del disolvente supramolecular. En esta etapa el tensioactivo se


aade a la muestra a concentraciones por encima de la concentracin micelar
crtica y se establecen las condiciones de coacervacin. En estos casos, la
formacindeldisolventesellevaacaboenunosbotesdevidrioespecialmente
diseados que poseen un cuello estrecho en la parte superior que facilita la
posteriormedidayrecogidadelvolumendeldisolventesupramolecularconlos
analitosextrados(Figura8a).

a)Formacindeldisolvente
supramolecular

b)Extraccin/concentracindelosanalitos

Disolucindel Adicindel
tensioactivo
agente
enlamuestra coacervante
acuosa

Disolvente
supramolecular
conlosanalitos
extraidos

Agitacin

Centrifugacin

Figura 8. Modo de operacin cuando se forma el disolvente supramolecular


en presencia de la muestra acuosa.

- 56 -

Introduccin
b)Extraccindelosanalitos.Lamezclaseagitaduranteundeterminadotiempo
con objeto de favorecer la transferencia del analito o analitos al disolvente
supramolecularyacontinuacinsecentrifugaparaacelerarlaseparacindelas
fases.Losanalitosextradosgeneralmentesedeterminanmediantelainyeccin
de una alcuota de disolvente supramolecular en un cromatgrafo de lquidos
(Figura8b).

Asimismo, los disolventes supramoleculares pueden usarse en el


formatodemicroextraccinenunagota[161]. Concretamente,sehadescritoel
uso de gotas de 1030 L de SUPRAS constituido por vesculas de
decanoico/decanoato a la extraccin de clorofenoles en muestras acuosas
ambientales. Las muestras se agitaron mediante una varilla magntica para
favorecerlatransferenciadelosanalitosaldisolventesupramolecularyunavez
alcanzadoeltiempodeextraccin,lasgotasserecogieronenlamicrojeringay
se inyectaron directamente en un cromatgrafo de lquidos (Figura 9). La
dinmica de este tipo de microextraccin se ajusta a la ecuacin general de
extraccinlquidolquido.

Microjeringade50L
Gotadedisolvente
supramolecular
+analitos

Vasotermostatado
Gotadedisolvente
supramolecular
Vialconlamuestra

Recuperacin
delagotaenla
microjeringa

Agitacin
magntica

Figura 9. Extraccin de los analitos operando en modo microextraccin en


una gota con disolvente supramolecular formado en ausencia de la muestra
acuosa.

- 57 -


Aplicaciones

Lamayoradelasaplicacionesanalticasquesehandesarrolladohasta
la fecha han hecho uso de disolventes supramoleculares constituidos por
micelas de tensioactivos no inicos (ej. tritn X100; la serie PONPE, teres
polietileneglicolmono4nonilfenol, etc.). Entre las aplicaciones destacan la
extraccin de aminocidos [164], protenas [138,165]; vitaminas [166]; iones
metlicos previa formacin de complejos neutros [136,137,167170]; y
168,169,170

compuestosorgnicostalescomoPAHs[58,171],PCBs[172];cidoshmicosy
flvicos[173],plaguicidas[174,175],drogasteraputicas[176],etc.

Ladescripcindedisolventessupramolecularesconstituidospormicelas
acuosas de tensioactivos catinicos [139] y aninicos [141] elimin algunos de
los inconvenientes asociados al uso de tensioactivos no inicos como eran los
problemas de coelucin. Adems,, fue posible la extraccin de compuestos en
un mayor intervalo de polaridad mediante su solubilizacin en los grupos
polares de las micelas a travs de diferentes interacciones (electrostticas,
catin, formacin de agregados mixtos, etc.). Basada en la coacervacin de
tensioactivoscatinicossepropusolaextraccin/concentracindeclorofenoles
en agua de ro [140]. En este caso la eficacia de extraccin es muy elevada ya
[164] C. Mahugo, Z. Sosa, J.J. Santana, Analyst 127 (2002) 1031.
[165] J. Bouvier, R.J. Etges, C. Bordier, J. Biol. Chem. 260 (1985) 15504.
[166] S.R. Sirimanne, D.G. Patterson, L. Ma, J.B. Justice, J. Chromatogr. B 716 (1998)
129.
[167] J. Chen, K.C. Teo, Anal. Chim. Acta 434 (2001) 325.
[168] E.K. Paleologos, D.L. Giokas, M.I. Karayannis, Trends Anal. Chem. 24 (2005)
426.
[169] C. Bosh, F. Snchez, Anal. Bioanal. Chem. 394 (2009) 759.
[170] A.R. Rod, S. Borhani, F. Shemirani, Eur. Food Res. Technol. 223 (2006) 649.
[171] R. Ferrer, J.L. Beltrn, J. Guiteras, Anal. Chim. Acta 330 (1996) 199.
[172] A. Eiguren-Fernndez, Z. Sosa-Ferrera, J.J. Santana-Rodrguez, Quim. Anal. 16
(1997) 283.
[173] R.L. Revia, G.A. Makharadze, Talanta 48 (1999) 409.
[174] C. Garca-Pinto, J.L. Prez-Pavn, B. Moreno-Cordero, Anal. Chem. 67 (1995)
2606.
[175] J. Zhou, J. Chen, Y. Cheng, D. Li, F. Hu, H. Li, Talanta 79 (2009) 189.
[176] M.D. Rukhadze, S.K. Tsagareli, N.S. Sidamonidze, V.R. Meyer, Anal. Biochem.
287 (2009) 279.

- 58 -

Introduccin
que adems de interacciones hidrfobas entre los analitos y las micelas se
produceninteraccionescatinentreelanilloaromticodelosclorofenolesy
el grupo amonio del tensioactivo. El inconveniente de estos disolventes
supramoleculareseslaelevadaconcentracindeelectrolitonecesariaparaque
seproduzcalacoacervacin(400gL1deNaCl),loqueharestringidosuuso.

Lacoacervacindemicelasacuosasdetensioactivosaninicos,inducida
por cido, fue propuesta por nuestro grupo de investigacin con objeto de
evitar la coelucin de los analitos polares y los tensioactivos en el sistema
cromatogrfico[141].Laausenciadeanillosaromticosenlaestructuradelos
tensioactivosysucarcterpolarhapermitidolaaplicacindeestosdisolventes
supramolecularesalaextraccindeplaguicidas[144,145]yPAHs[59,143]ysu
posterior determinacin mediante cromatografa lquida combinada con
deteccinUV,fluorescenteyespectrometrademasas.

Respecto a los disolventes supramoleculares de micelas mixtas, su uso

ha estado muy centrado en la determinacin de iones metlicos [152157] en


muestras acuosas aunque tambin se han utilizado, en menor medida, en el
anlisisdecompuestosorgnicos[146151].Elusodemezclasdetensioactivos
catinicos y no inicos permite incrementar la eficacia de extraccin para
algunos compuestos orgnicos polares [146,149] en muestras de aguas
naturales.

En los ltimos aos, una de las lneas prioritarias de investigacin en


nuestrogrupohasidoeldesarrollodenuevosdisolventessupramolecularesque
se sinteticen en condiciones experimentales suaves, permitan el
establecimiento de diferentes interacciones con los analitos y puedan
alcanzarse elevados factores de preconcentracin. En este contexto destacan
los disolventes supramoleculares constituidos por micelas inversas [158] y
vesculas [160] de cidos alquilcarboxlicos, inducidos por agua y
tetrabutilamonio, respectivamente. Adems de las interacciones que permiten
establecer (hidrfobas, puentes de hidrgeno, inicas y catin), un aspecto
clave de estos disolventes supramoleculares es la elevada concentracin de

- 59 -


cidos alquilcarboxlicos que contienen (entre 0,7 y 1 mg L1) lo que permite
alcanzarelevadosrendimientosutilizandopequeosvolmenesdelosmismos.
Comoconsecuencia,sealcanzanfactoresdepreconcentracinentre100y400.
Porotrolado,losdisolventessupramolecularesdemicelasinversasseproducen
a pH inferiores a 4 y los de vesculas en el intervalo de pH entre 5 y 10,
abarcando un amplio intervalo en el que se puede seleccionar el valor ms
apropiadoparalaextraccin,dependiendodelascaractersticasdelosanalitos.
EnlaTabla1secomparanlasrecuperacionesobtenidasempleandodisolventes
supramoleculares de vesculas y micelas inversas para diferentes analitos,
clasificadosrespectoaltipodeinteraccinpredominantequeseproduceconel
tensioactivoqueformaeldisolventesupramolecular.

Tabla1. Recuperaciones, expresadas en porcentajes, obtenidas en la extraccin


coacervativa

de

diferentes

compuestos

orgnicos

usando

disolventes

supramoleculares de vesculas de cido decanoico y micelas inversas de cido


octanoico..
Tipode
Interaccin
Hidrfoba
Agregados
mixtos

Enlacesde
hidrgeno

Inica

[Analito]
(M)

Analito
Naftaleno
Antraceno
Benzo(a)pireno
TritnX100
Alquilbencenosulfonatos
4clorofenol
2,4diclorofenol
2,4,6triclorofenol
Pentaclorofenol
BisfenolA
BisfenolF
Bencilbutilftalato
Dibutilftalato
Paratin
Atrazina
Hidroquinonasulfonada
Hidroquinonasulfonada
Azulbrillantedecumasn
Difenzoquat

- 60 -

3.9x105
2.8x105
2.0x105
8.3x106
2.9x105
3.9x105
3.2x105
2.6x105
1.9x105
3.8x105
3.6x105
5.1x105
4.8x105
4.1x105

5.2x105
5.2x105
7.3x107
6.9x106

Recuperaciones(%)

Vesculas M.inversas
993
952
1012
981
1003
971
991
983
1002
51
951
972
1001
991
982
1011
1002
1011
993
953
1002
971
803
991
854
1001
902
962
984
954

953

953

1004

502

Introduccin
Comopuedeobservarse,prcticamenteentodosloscasosseobtienen
recuperaciones cuantitativas a excepcin de la extraccin de alquilbenceno
sulfonatos y difenzoquat cuando se utilizan disolventes supramoleculares de
micelasinversasyvesculas,respectivamente.

Hastalafecha,losdisolventessupramolecularesdemicelasinversasse
hanaplicadoalaextraccindebisfenolesAyFyloscorrespondientesteresy
diglicidlicosenaguasresiduales[177],debisfenolAenmuestrasdeorina[178]
yalimentoslquidos[179],deOcratoxinaAenvino,vinagreycerveza[179,180],
dePAHsent,caf,aguasnaturalesyresiduales[179,181]ydecolorantesde
tipo Sudan en salsas para alimentos [182]. Por otro lado, los disolventes
supramoleculares de vesculas de cido decanoico inducidas por
tetrabutilamoniotambinsehanpropuestoparalaextraccindebisfenolAyF
y sus correspondientes teres diglicidlicos en aguas residuales y de ro [183].
Losfactoresdepreconcentracinestuvieroncomprendidosentre477y569,las
extracciones fueron independientes de la presencia de sales hasta 1M o
temperatura hasta 60C y las condiciones de equilibrio se alcanzaron en 5
minutos. La combinacin de coacervacin vesicular con CLfluorescencia
permitilacuantificacindelosanalitosconlmitesdedeteccinde910ngL1.
Los disolventes supramoleculares vesiculares combinados con fluorescencia
tambin se han empleado para la determinacin de fungicidas benzimidazoles
[184].Hastalafecha,sonlosnicostiposdedisolventessupramolecularesque
sehanutilizadoenelformatodemicroextraccinenunagota[161].
[177] A. Ballesteros-Gmez, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 603 (2007)
51.
[178] A. Garca-Prieto, L. Lunar, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 630
(2008) 19.
[179] A. Ballesteros-Gmez, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1216 (2009)
530.
[180] S. Garca-Fonseca, A. Ballesteros-Gmez, S. Rubio, D. Prez-Bendito, Anal. Chim.
Acta 617 (2008) 3.
[181] A. Ballesteros-Gmez, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1203 (2008)
168.
[182] F.J. Lpez-Jimnez, S. Rubio, D. Prez-Bendito, Food Chem. 121 (2010) 763.
[183] F.J. Ruiz, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1163 (2007) 269.
[184] A. Moral, M.D. Sicilia, S. Rubio, J. Chromatogr. A 1216 (2009) 3740.

- 61 -

2.3.2. Muestrasslidasambientalesybiolgicas

La extraccin/concentracin de los contaminantes qumicos presentes


en muestras slidas se lleva a cabo rutinariamente utilizando disolventes
orgnicos y es necesario que la muestra est suficientemente homogenizada
para que se obtengan resultados reproducibles. Con objeto de alcanzar
suficiente sensibilidad y selectividad, el proceso requiere generalmente el
tratamiento de una cantidad considerable de muestra, el desarrollo de
extracciones repetidas para asegurar el aislamiento completo del analito de
inters,una etapadelimpiezadelextractoylaevaporacindeldisolvente. En
este contexto, las investigaciones en los ltimos aos se han centrado en el
desarrollo de estrategias que permitan reducir el consumo de disolventes y el
tiempo necesario para la extraccin. Las estrategias con mayor xito se han
basado en el aumento de la eficacia de la extraccin mediante el uso de
energas auxiliares [ej. extraccin asistida por microondas (MAE), extraccin
aceleradaporultrasonidosyextraccinconlquidospresurizados(PLE)],eluso
de disolventes alternativos [ej. fluidos supercrticos (SFE) o disolventes
supramoleculares], o el uso combinado de disolventes y adsorbentes para la
simultneaextraccinylimpiezadelamuestra(dispersindelamatrizenfase
slida).

2.3.2.1. Tcnicasasistidasporenergasauxiliares

Laextraccinasistidapormicroondasserealizaenequiposquedifieren
eneltipodeenergaaplicadaalamuestra(multimodoofocalizada)yeneluso
o no de sobrepresin. Generalmente, los sistemas cerrados (los que operan a
alta presin) son multimodo, es decir la radiacin generada se dispersa de
formaaleatoriaenunacavidad.Lossistemasabiertos(enlosqueelprocesose
lleva a cabo a presin atmosfrica) son sistemas focalizados o monomodo, es
decir la radiacin microondas se confina en un espacio mucho ms reducido,
dondesesitalamuestra,yportantolaradiacinquellegaalamismaesms
intensaqueenlossistemasmultimodo.Existennumerosasrevisionesenlasque

- 62 -

Introduccin
sedescribenlosequiposutilizados,losprincipiosenlosquesebasalatcnicay
lasaplicacionesdesarrolladashastalafecha[185187].
186,187

En la extraccin asistida por ultrasonidos (sonidos con una frecuencia


superioralaqueelodohumanopuedepercibir,>20kHz)seutilizandostipos
dedispositivos;losbaosylassondas[188].Enlosprimeros,lareproducibilidad
es muy baja debido a la falta de uniformidad en la transmisin de los
ultrasonidos y la disminucin de la potencia con el tiempo, por lo que su uso
debera restringirse a operaciones como las de eliminacin de gases disueltos,
disolucin etc., para las que han sido diseadas. Las sondas ultrasnicas o
sonotrodos focalizan su energa en una zona especfica y producen resultados
ms reproducibles, aunque en general son poco robustos y dependen de la
composicindelamatrizdelamuestraydeltamaodepartculadelamisma.

La extraccin con lquidos presurizados, tambin denominada


extraccin acelerada con disolventes (ASE), implica el uso de disolventes a
elevada temperatura (40200C) y presin (1.0002.500 psi). En estas
condicioneslosdisolventesaumentanelpoderdesolvatacinyseincrementala
velocidad de extraccin. La tcnica tiene capacidad para realizar mltiples
extracciones, puede automatizarse y ha encontrado amplia aplicacin en la
extraccin de contaminantes en muestras ambientales, biolgicas y de
alimentos [189192]. La USEPA (United States Environmental Protection
190191192

Agency)haadoptadoestatcnicaparaelanlisisdeplaguicidasensuelos[193].
[185] L. Cheng, D Song, Y. Tian, L. Ding, A. Yu, H. Zhang, Trends Anal. Chem. 47
(2008) 151.
[186] J.L. Luque-Garca, M.D. Luque de Castro, Trends Anal. Chem. 22 (2003) 90.
[187] Q. Jin, F. Liang, H. Zhang, L. Zhao, Y. Huan, D. Song, Trends Anal. Chem. 18
(1999) 479.
[188] J.L. Luque-Garca, M.D. Luque de Castro, Trends Anal. Chem. 22 (2003) 41.
[189] R. Carabas-Martnez, E. Rodrguez-Gonzalo, P. Revilla-Ruiz, J. HernndezMndel, J. Chromatogr. A 1089 (2005) 1.
[190] L. Ramos, E.M. Kristenson, U.A.T. Brinkman, J. Chromatogr. A 975 (2002) 3.
[191] H. Runnqvist, S.A. Back, M. Hansen, B. Styrishave, B. Halling-Sorensen, E.
Bjrklund, J. Chromatogr. A 1217 (2010) 2447.
[192] A. Nieto, F. Borrull,E. Pocurull, R.M. Marc, Trends Anal. Chem. 29 (2010) 752.
[193] EPA Method 3545, US Environmental Protection Agency, Washington, DC, 1996.

- 63 -


Frecuentemente, PLE se combina con SPE o extraccin por adsorcin con
barritas agitadoras (SBSE una variedad de SPME, comercialmente conocidas
comoTwister)parapreconcentrarlosanalitos.

Los fluidos supercrticos son extractantes con propiedades intermedias


entreloslquidosylosgases.Tienenviscosidadparecidaalosgases,densidad
parecidaaloslquidosyelevadadifusividad[194].Ladensidaddelfluido,ypor
tanto su capacidad de solvatacin para el soluto depende de la presin y la
temperatura.Elfluidomsutilizadoeseldixidodecarbono(puntocrtico31C
y 74 bar). Tiene baja polaridad y es ideal para extraccin de compuestos
apolares. La adicin de metanol (110%) aumenta la polaridad y permite su
aplicacinalaextraccindeunamplionmerodecompuestos[195,196].

2.3.2.2. Dispersindelamatrizenfaseslida

La dispersin de la matriz en fase slida (MSPD) es una tcnica


ampliamenteaceptadaparalaextraccindemuestrasdealimentosybiolgicas
slidas, semislidas y/o de elevada viscosidad [197,198]. El procedimiento
consiste en dispersar la muestra con un adsorbente tal como C18, C8, sulfato
sdico, tierra de diatomeas, etc. hasta conseguir una mezcla homognea. A
continuacin se procede al lavado de la mezcla con un pequeo volumen de
disolventeobienstasesitaenunaminicolumnadeSPEantesdelaelucin.El
procedimiento es simple, verstil y ofrece la posibilidad de llevar a cabo la
extraccin y la purificacin de la muestra en una nica etapa con lo que se
reduceeltiempodeanlisisyelconsumodedisolventeorgnico.LaMSPDse
utiliza ampliamente en la extraccin de drogas en tejidos animales y
[194] M. Valcarcel, M.D. Luque de Castro, M.T. Tena en: Extraccin con fluidos
supercrticos en el proceso analtico, Editorial Revert S.A., Barcelona, 1993.
[195] S.M. Pourmortazavi, S.S. Hajimirsadeghi, J. Chromatogr. A 1163 (2007) 2.
[196] M. Herrero, J.A. Mendiola, A. Cifuentes, E. Ibez, J. Chromatogr. A 1217 (2010)
2495.
[197] S. Bogialli, A. Di Corcia, J. Biochem. Bioph. Methods 70 (2007) 163.
[198] S.A. Baker, J. Biochem. Bioph. Methods 70 (2007) 151.

- 64 -

Introduccin
multiresiduosdeplaguicidasenfrutasyverduras[199]ysuutilidadesevidente
alaluzdelgrannmerodeaplicacionesdesarrolladasyrevisadasenlosltimos
aos[198,200,201].Nuevastendenciasenestareasonlasrelacionadasconel
uso de nuevos adsorbentes y la combinacin de MSPD y PLE para conseguir
extraccionesMSPDmsrpidas,exhaustivasyautomticas.

Entre los nuevos adsorbentes evaluados como dispersantes MSPD, los


MIPs han despertado especial inters. Estos fueron propuestos por Yan et al.
[202]paralaextraccindecincofluoroquinolonasenhuevosdepolloytejidos
de cerdo alcanzando mejores recuperaciones que con los adsorbentes
convencionales C18, slica, Florisil o arena y con la ventaja aadida de una
extraordinaria mejora de la selectividad. Canosa et al. [203] desarrollaron un
procedimientoPLEparaladeterminacindeparabenosytriclosnenpolvocon
Florisil,sulfatosdicoyacetatodeetiloa103Cy1.500psi,conunaetapade
lavado con nhexano. Las recuperaciones del ms polar de los analitos bajo
estudio fueron ligeramente superiores con la metodologa PLE propuesta.
Adems,laautomatizacindelapreparacindelamuestrapermitirealizarlas
extraccionesmsrpidamente.

Un ejemplo interesante es la extraccin de especies de arsnico


(arsenito, As (III); arsenito, As (V); cido monometil arsnico; cido
dimetilarsnico; arsenobetana y arsenocolina) de diferentes moluscos y peces
[204]. Se obtuvieron recuperaciones cuantitativas de las especies de arsnico
orgnicas e inorgnicas usando tierra de diatomeas o gel de slice octadecil
funcionalizado(C18)comomaterialslidosoporte.SeusLCespectrometrade
[199] M. Anastassiades, S.J. Lehotay, D. Stajnbaher, F.J. Schenck, J. AOAC 86 (2003)
412.
[200] M. Garca-Lpez, P. Canosa, I. Rodriguez, Anal. Bioanal. Chem. 391 (2008) 963.
[201] N. Fidalgo-Used, E. Blanco-Gonzlez, A. Sanz-Medel, Anal. Chim. Acta 590
(2007) 1.
[202] H. Yan, F. Qiao, K.-H. Row, Anal. Chem. 79 (2007) 8242.
[203] P. Canosa, D. Prez-Palacios, A. Garrido-Lpez, M.T. Tena, I. Rodrguez, E. Rubi,
R. Cela, J. Chromatogr. A 1161 (2007) 105.
[204] A. Moreda-Pineiro, E. Pena-Vazquez, P. Hermelo-Herbello, P. Bermejo-Barrera, J.
Moreda-Pineiro, E. Alonso-Rodrguez, S. Muniategui-Lorenzo, P. Lopez-Mahia, D.
Prada-Rodrguez, Anal. Chem. 80 (2008) 9272.

- 65 -


masasconfuentedeplasmaacoplada(ICPMS)parasepararydetectartodaslas
especiesdearsnico.Otroejemplointeresanteconsisteenlaextraccinde27
PAHs en lodos de depuradoras de Madrid [205]. Los PAHs se extrajeron con
MSPDasistidaconultrasonidos.Lapurificacindelosextractossellevacabo
medianteSPEconC18ylosPAHssedeterminaronpordilucinisotpicaGC/MS.
Los lmites de deteccin estuvieron comprendidos entre 0,03 ng g1 para el
acenaftileno y 0,45 ng g1 para el benzo[b]nafto[2,1d]tiofeno. Se detectaron
PAHsentodaslasmuestrasconconcentracionesentre390y6.390ngg1(peso
seco) y en la mayora de los lodos examinados el compuesto principal fue el
fenantrenoconconcentracionesmediasde1.062ngg1.

2.3.2.3. Microextraccinenfaseslida

Lamicroextraccinenfaseslida(SPME)sebasaenlaextraccindelos
analitosdelamatrizdelamuestramedianteunafibradeslicefundidaqueest
recubiertadeunadsorbente,enlamayoradeloscasospolimrico,seguidade
la desorcin de los analitos mediante temperatura o un disolvente orgnico
[206]. El pequeo tamao de la fibra y su geometra cilndrica permiten
incorporarla en una jeringa. De esta forma, se facilita su manipulacin y al
mismotiemposeprotegelafibracuandonoseutiliza,yaquestapermanece
dentrodelaagujadelajeringa.

Su uso para la purificacin de los extractos, obtenidos despus de la


extraccin con disolventes de muestras slidas y biolgicas se est
incrementando. Para este fin, se prefieren las fibras de SPME recubiertas de
MIP.Porejemplo,Huetal.[207]desarrollaronunafibradeMIPdeprometrin
paralamicroextraccinselectivadetriazinas.ElMIPsepolimerizinsitusobre
lasuperficieinteriordelcapilardesliceactivaylafibraSPMEseacoplonline
conLCparaladeterminacindelastriazinasenalimentosyextractosdesuelos,
[205] C. Snchez-Brunete, E. Miguel, J.L. Tadeo, J. Chromatogr. A 1148 (2007) 219.
[206] M.F. Alpendurada, J. Chromatogr. A 889 (2000) 3.
[207] X. Hu, Y. Hu, G. Li, J. Chromatogr. A 1147 (2007) 1.

- 66 -

Introduccin
previamente diluidos en benceno con el fin de favorecer las interacciones
especficas cercanas a aquellas desarrolladas durante la sntesis del MIP en
tolueno. Turiel et al. [208] obtuvieron una fibra MIP sintetizando un monolito
dentro del capilar de slice que actuaba como molde, siendo la slice grabada
despus de la polimerizacin. Este MIP se sintetiz usando propazina como
moldeyseusparalaextraccindetriazinasydosmetabolitosenverdurasy
extractosdesuelo,previamentediluidoseneldisolventeporognicodesntesis
(tolueno).

2.3.2.4. Disolventessupramoleculares

Los disolventes supramoleculares (SUPRAS) tambin se han empleado


enlosprocesosdeextraccindemuestrasslidas,comounaalternativaaluso
delosdisolventesorgnicos.

Mododeoperacin

El modo de operacin es muy similar al seguido con las muestras


lquidas aunque la formacin del disolvente supramolecular puede llevarse a
cabo en presencia o en ausencia de la muestra. En presencia de la muestra
slida,unadisolucinacuosadeltensioactivoaconcentracionesporencimade
laconcentracinmicelarcrticaseaadealboteyseestablecenlascondiciones
de coacervacin (Figura 10a). La mezcla se agita un determinado tiempo y a
continuacin se centrifuga para acelerar la separacin del disolvente
supramolecularquecontienelosanalitos(Figura10b).

Enausenciadelamuestra,elSUPRASsesintetizapreviamenteenagua
destilada (Figura 11) y despus se aade a una pequea cantidad de muestra
slida. La mezcla se agita en vortex para favorecer la transferencia de los
analitosaldisolventesupramolecularyacontinuacinseultracentrifugapara

[208] E. Turiel, J.L. Tadeo, A. Martin-Esteban, Anal. Chem. 79 (2007) 3099.

- 67 -


a)Formacindeldisolvente
supramolecular

b)Extraccin/concentracindelosanalitos

Adicindela Adicindel
disolucindel
agente
tensioactivoala coacervante
muestraslida

Disolvente
supramolecular
conlosanalitos
extrados

Agitacin

Figura10. Modo de operacin cuando se forma el disolvente supramolecular


en presencia de una muestra slida.

Disolucin Adicindel
acuosade
agente
tensioactivo coacervante

Agitacin

Disolvente
supramolecular

Centrifugacin

Figura11. Formacin del disolvente supramolecular en ausencia de muestra


lquida.

- 68 -

Introduccin
separar la muestra del SUPRAS con los analitos solubilizados. Alcuotas de
SUPRASseinyectanenCLparaladeterminacindeloscompuestosdeinters
(Figura12).

Disolventesupramolecular
conlos
analitosextrados

Adicindeldisolvente
supramolecularala
muestraslida

Centrifugacin

Agitacinenvortex

Figura12. Extraccin de los analitos de muestras slidas mediante adicin del


disolvente supramolecular formado en ausencia de la muestra.

Aplicaciones
Aunque en menor medida si se compara con las aplicaciones en
muestras acuosas, en la bibliografa se han descrito diferentes aplicaciones de
disolventes supramoleculares de micelas no inicas y micelas mixtas en
procesosdeextraccindecontaminantesenmuestrasslidas.Ejemplosdetales
aplicaciones son la descontaminacin de suelos [147] y la determinacin de
plaguicidasenfrutas,cereales[209211] ysuelos[175]ydemetalesensuelos
210,211

[156].

La introduccin de los disolventes de micelas acuosas de tensioactivos


aninicosfuedegranutilidadparaeltratamientodemuestrasslidasdebidoa
[209] Z. Zhou, J. Chen, D. Zhao, M. Yang, J. Agric. Food Chem. 57 (2009) 57.
[210] J. Chen, W. Zhao, W. Liu, Z. Zhou, M. Yang, Food Chem. 115 (2009) 1038.
[211] A. Snatlad, S. Srijarani, R. Burakham, J.D. Glennon, R.L. Deming, Anal. Bioanal.
Chem. 394 (2009) 1307.

- 69 -


las drsticas condiciones cidas en las que se producen, alrededor de 3 M, lo
que permite obtener eficientes extracciones de los contaminantes que estn
fuertementeretenidosenmatricescomosuelos,sedimentosylodos.Eseneste
campodondeestosdisolventessupramoleculareshantenidomayorrelevancia
yentrelasaplicacionesdesarrolladasdestacanlaextraccindePAHsensuelos,
lodos y sedimentos [212] y sobre todo la extraccin de sustancias anfiflicas
tales como tensioactivos aninicos (alquibencenosulfonatos) [213], catinicos
(alquilamonio) [214] y no inicos (alquilfenoles polietoxilados y alcoholes
etoxilados) [215] en lodos. La formacin de agregados mixtos entre los
tensioactivos analitos y el tensioactivo aninico que constituye el disolvente
supramolecularhapermitidolaextraccindelosmismosconelevadaeficiencia
yfactoresdepreconcentracinentre50y100.

Enlosltimosaosnuestrogrupodeinvestigacinsehacentradoenel
desarrollo de metodologas para el control y determinacin de contaminantes
orgnicos en alimentos mediante el uso de disolventes supramoleculares de
micelasinversasyvesculas.Hastalafecha,losdisolventessupramolecularesde
micelasinversassehanaplicadoalaextraccindebisfenolAenfrutas,verduras
y alimentos grasos enlatados [216,217], de ocratoxina A en trigo [218] y de
antibiticosenpescadosymariscos[219].Losdisolventesvesiculareshansido
solo aplicados para la determinacin de fungicidas bencimidazoles en frutas y
verduras[220].

[212] F. Merino, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 962 (2002) 1.


[213] F.J. Ruiz, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1030 (2004) 109.
[214] F. Merino, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 998 (2003) 143.
[215] M. Cantero, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1046 (2004) 147.
[216] A. Garca-Prieto, L. Lunar, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 617
(2008) 51.
[217] A. Garca-Prieto, L. Lunar, S. Rubio, D. Prez-Bendito, Food Addit. Contam. 26
(2009) 265.
[218] S. Garca-Fonseca, A. Ballesteros-Gmez, S. Rubio, D. Prez-Bendito, J.
Chromatogr. A 1217 (2010) 2376.
[219] E.M. Costi, M.D. Sicilia, S. Rubio, J. Chromatogr. A 1217 (2010) 1447.
[220] A. Moral, M.D. silicia, S. Rubio, Anal. Chim. Acta 650 (2009) 207.

- 70 -

Introduccin

2.3.3. Compuestosvoltilesysemivoltiles

Enestareahahabidouncrecimientoespectaculardeaplicacionesque
usantcnicasdemicroextraccinconespaciodecabeza(HS)paraelanlisisde
contaminantes en muestras ambientales [221], siendo las ms interesantes
microextraccin en fase slida (HSSPME) y microextraccin en una gota (HS
SDME).

Aplicaciones tpicas de HSSPME se realizan en combinacin con


cromatografa de gases donde, despus de un paso de extraccin, los analitos
son desorbidos trmicamente en el inyector del cromatgrafo. Como ejemplo
Yang et al. desarrollaron un mtodo para la diferenciacin y cuantificacin de
ismerosdexilenoporcombinacindeHSSPME/GCyespectrometrademasas
contrampainica[222].LaaplicacindeHSSPME/GCalanlisisdecompuestos
novoltileseinestablestrmicamenterequiereunaderivatizacinpreviadelos
analitos.Normalmenteestaderivatizacinsellevaacaboenlamuestraacuosa
durante la etapa de extraccin con espacio de cabeza, aunque tambin es
posible incluir la derivatizacin sobre la fibra de SPME; sin embargo, esta
segunda aproximacin es ms lenta que si se aade el agente derivatizante
directamente a la muestra. Un ejemplo es la aplicacin de HSSPME para la
extraccin simultnea de metilmercurio (MeHg+), monobutilestao (MBT),
dibutilestao (DBT), tributilestao (TBT), monofenilestao, difenilestao y
trifenilestao en sedimentos y biota con previa derivatizacin con
tetraetilborato sdico [223]. El mtodo de preconcentracin optimizado se
aplic a la determinacin de MeHg+ y butil y fenilestaos en materiales de
referenciacertificadosmedianteelusodeGCcondeteccindeplasmainducido
pormicroondas.

[221] D.A. Lambropoulou, I.K. Konstantinou, T.A. Albanis, J. Chromatogr. A 1152


(2007) 70.
[222] C.H. Yang, N.A. Khan, H.F. Wu, J. Sep. Sci. 31 (2008) 3050.
[223] A. Delgado, A. Usobiaga, A. Prieto, O. Zuloaga, A. de Diego, J.M. Madariaga, J.
Sep. Sci. 31 (2008) 768.

- 71 -


Muchas aplicaciones han tratado sobre el desarrollo de nuevos
recubrimentos de fibra polimricos con el fin de mejorar la selectividad y
exactitud de los anlisis. As, Bagheri et al. [224] usaron la tecnologa de
recubrimientosolgelparasintetizarunnuevopolmeroaminofuncionalizadoa
partir de de 3(trimetoxisilil)propilamino como precursor. La novedosa fibra
aminofuncionalizada se emple para la HSSPME de algunos clorofenoles
importantes desde el punto de vista medioambiental, previamente
derivatizados con anhdrido actico. La comparacin de los resultados con los
datosobtenidosusandounafibracubiertadepoliacrilatodemostrquelafibra
propuesta mostraba una sensibilidad hasta 2,6 veces mayor para la extraccin
delosfenolesdemuestrasacuosas.

Porotrolado,latcnicadeHSSDMEparecemuyatractiva,aunquesus
mtodosestntodavaenunestadoincipientededesarrolloysehanpublicado
pocos trabajos. A diferencia de las fibras, las gotas se renuevan en cada
extraccin y es una estrategia para superar la limitada disponibilidad de
recubrimentosparalasfibrasdadolaampliavariedaddedisolventesyagentes
deatrapamientoquepuedenusarse.EnHSSDME,unamicrogotadedisolvente
con alto punto de ebullicin se suspende en la punta de la aguja de una
microjeringa y se coloca en el espacio de cabeza de una disolucin. Dado que
slo los compuestos que se volatilizan al espacio de cabeza pueden ser
atrapadosenlamicrogota,lasinterferenciasprocedentesdematricescomplejas
decrecensignificativamente.

Laderivatizacininsituespropuestafrecuentementeparaextenderla
aplicabilidaddeHSSDMEacompuestospolares.Porejemplo,Xiaoetal.[225]
propusieron un mtodo para la especiacin de compuestos butilestao en
muestras ambientales y biolgicas, el cual estuvo basado en HSSDME en
combinacin con GCICPMS, con derivatizacin previa de los compuestos con
tetraetilboratosdico.Loslmitesdedeteccinobtenidosfueron1,4ngL1para
MBT,1,8ngL1paraDBTy0,8ngL1paraTBT.LasconcentracionesdeMBT,DBT
[224] H. Bagheri, E. Babanezhad, F. Khalilian, Anal. Chim. Acta 616 (2008) 49.
[225] Q. Xiao, B. Hu, M. He, J. Chromatogr. A 1211 (2008) 135.

- 72 -

Introduccin
yTBTenaguadelmarfueron31,79y32ngL1,respectivamente,mientrasque
las concentraciones en diferentes mariscos estuvieron en el intervalo de 11,6
30,4;11,88,9y12,852,6ngg1,respectivamente.Tratamientostericosyuna
evaluacin experimental de derivatizacin en una gota fueron publicados por
Fiamengos y Stalikas [226]. En este estudio, dos aldehdos de bajo peso
molecular

fueron

derivatizados

en

una

gota

conteniendo

2,4,6

triclorofenilhidrazina. La teora de la doble capa fue usada para explicar la


transferenciademasayparadiscutirelclculodelostiemposcaractersticosy
tasas especficas de absorcin. Despus de que los procesos relevantes de las
diferentes partes de los sistemas de 3 fases fueran explicados, se confirm el
modelodetransferenciademasaenelsistematotalascomoenelespaciode
cabezaconlagotaorgnica.

Loslquidosinicos(IL)tienenungranpotencialenHSSDMEdebidoa
sualtaviscosidady novolatilidad que permitelaformacin degotasestables.
Zhao et al. [227] propusieron el uso del lquido inico hexafluorofosfato de 1
octil3metilimidazolio en HSSDME para la extraccin de fenoles antes de GC
deteccinconionizacindellama(FID).Elvolumendelamicrogotadelquido
inico usada fue 1 L. Despus de la extraccin, se realiz la desercin de los
analitosenlavlvuladeinyeccinyelILnovoltilseretirconlamicrojeringa.
El mtodo se aplic a la determinacin de fenoles en agua de lago y aguas
residuales.

Una de las principales ventajas de los ILs cuando se usan en SDME es


quepermitenlaaplicacindetiemposdemuestreomayoresascomoelusode
volmenesdegotasmayores,loquepermiteincrementarlasensibilidadenLC.
Vidaletal.[228]propusieronelusodemicrogotasde5Ldehexafluorofosfato
de 1butil3metilamidazolio en HSSDME para la extraccin de clorobencenos
enmuestrasacuosasambientalesantesdesuseparacinporCL.Loslmitesde
[226] Y.C. Fiamegos, C.D. Stalikas, Anal. Chim. Acta 599 (2007) 76.
[227] F.Q. Zhao, J. Li, B.Z. Zeng, J. Sep. Sci. 31 (2008) 3045.
[228] L. Vidal, E. Psillakis, C.E. Domini, N. Gran, F. Marken, A. Canals, Anal. Chim.
Acta 584 (2007) 189.

- 73 -


deteccin estuvieron comprendidos entre 0,102 y 0,203 g L1 y el mtodo se
validutilizandomuestrasfortificadasdeaguadegrifo,depozoyresiduales.

Independientemente del tipo de muestra ambiental considerada


(acuosas,slidasogaseosas),esdegraninterseldesarrollodeestrategiasque
integrentodaslasetapasdelprocesodeanlisisqumicoylassimplifiquen,con
el objeto de reducir tiempo y costes en los estudios de contaminacin
ambiental.Ademsexistelanecesidaddedesarrollarmetodologasapropiadas
para el anlisis de contaminantes emergentes con el fin de poder estudiar y
establecer su distribucin y efectos txicos en el medio ambiente. As, el
objetivodelaTesishasidoeldesarrollodemtodosparaelanlisisqumicode
contaminantesemergentesyprioritariosenmuestrasacuosasybiolgicasque
integren y simplifiquen las diferentes etapas previas del anlisis (toma de
muestra,extraccin,preconcentracin,limpiezayalmacenamiento)yreduzcan
el consumo de disolventes orgnicos en coherencia con los principios de la
QumicaVerde.Estafilosofaqumicavadirigidahaciaeldiseodeproductosy
procesos qumicos que impliquen la reduccin o eliminacin de productos
qumicospeligrososparalosmateriales,laspersonasyelmedioambiente.

Las estrategias que se abordan en esta Tesis para el anlisis de las


muestrasacuosassebasanelusodehemimicelasyadmicelascomomateriales
adsorbentes,enformatoSPEconvencional,ydedisolventessupramoleculares.
Ambostiposdesistemassupramolecularestienencapacidadparalaretenciny
estabilidad de analitos de muy diferente polaridad gracias a las mltiples
interacciones que proporcionan los diferentes microambientes que los
constituyen. Respecto a la extraccin de contaminantes en muestras de
alimentosybiolgicasseabordaconelusodemezclasdedisolventesacuososy
orgnicos de muy diferentes propiedades con el fin de mejorar su capacidad
extractante y mediante el uso de nuevos disolventes supramoleculares como
unaalternativamuyventajosaalusodedisolventesorgnicos.

- 74 -

Introduccin

2.4.

Tcnicasdeseparacinydeteccin
La cromatografa lquida y gaseosa, en combinacin con la

espectrometrademasas(LCMS,GCMS)ysustandemenMS(LCMS/MS,GC
MS/MS) son las tcnicas predominantes para la identificacin y cuantificacin
decompuestosorgnicos,susmetabolitosyproductosdetransformacinenel
medio ambiente. Ambas se consideran necesarias para cubrir la necesidad del
anlisis de un amplio intervalo de contaminantes y matrices. GCMS y LC
MS/MS se han usado como tcnicas complementarias para cuantificar las 33
sustancias prioritarias de la lista europea del sistema de registro, evaluacin y
autorizacindecompuestosqumicos[229].

Asimismo,

los

recientes

avances

en

electroforesis

capilar

espectrometra de masas (CEMS) han hecho que esta tcnica combinada sea
ms competitiva en el anlisis de muestras ambientales aunque an necesita
proporcionar mayores prestaciones en su capacidad de deteccin debido a las
cantidades traza de contaminantes presentes en el medio ambiente y la alta
complejidaddelamatrizdelasmuestras.

2.4.1. Cromatografadegases/espectrometrademasas.

La cromatografa de gases en combinacin con MS y los mtodos


multidimensionales proporcionan elevada resolucin y sensibilidad en anlisis
ambiental.

Las ltimas tendencias en este mbito son el uso de tcnicas de gran


volumendeinyeccin(LVI)paraincrementarlasensibilidadyreduciroeliminar
lanecesidaddeetapasdepreconcentracindelosextractos[230]yelempleo

[229] J.B. Baugros, B. Giroud, G. Dessalces, M.F. Grenier-Loustalot, C. Cren-Oliv,


Anal. Chim. Acta 607 (2008) 191.
[230] Y.T. Li, J. Whitaker, C. McCarty, J. Liq. Chromatogr. Relat. Technol. 32 (2009)
1644.

- 75 -


deGCcapilarconprogramasdetemperaturamuyrpidosparahacerfrenteal
procesadodegrancantidaddemuestras[231].

Respectoalosdetectoresdemasas,loscuadrupolares(Q)odetrampa
inica(IT)sonlosmsutilizadosenelanlisisambiental.Losespectrmetrosde
tiempo de vuelo (TOF) con resolucin de unidades de masa a altas tasas de
adquisicin de datos (hasta 500 espectros/s) se acoplan a GC rpida o GC
bidimensional mientras los de moderada tasa de adquisicin de datos (2025
espectros/s) pero con gran resolucin de masas son ms apropiados para la
resolucindelosanalitosconrelacinaloscomponentesdelamatriz.Durante
los ltimos aos ha habido una gran tendencia a usar GC/ITMS dado que su
capacidad de deteccin mediante MS/MS, basada en la seleccin de un in
precursor y el espectro de masas completo de sus iones producto, permite la
identificacin con gran fiabilidad de los analitos de inters a bajos lmites de
deteccinybajocostedeoperacin.

Por ltimo la capacidad de separacin de GC bidimensional (GC x GC)


hacequeestetipodecromatografaseaunaeleccinexcelenteparaelanlisis
cualitativo de muestras con matrices muy complejas. Una revisin sobre sus
ventajasydesventajashasidorealizadaporMondeloetal.[232].

2.4.2. Cromatografadelquidos/espectrometrademasas.

LCMSyLCMS/MScontriplecuadrupolo(QqQ)ytrampainica(IT)son
ahora tcnicas ampliamente utilizadas para el anlisis de contaminantes
ambientales y de hecho incluso han reemplazado a GC/MS en muchas
aplicacionesdebidoasusensibilidadeidoneidadparadeterminarcompuestos
en amplios intervalos de masa y polaridad. La interfase de ionizacin
electrospray (ESI) seguida de ionizacin qumica a presin atmosfrica (APCI)
[231] M. Dmtrov, E. Matisov, J. Chromatogr. A 1207 (2008) 1.
[232] L. Mondello, P.Q. Tranchida, P. Dugo, G. Dugo, Mass Spectrom. Rev. 27 (2008)
101.

- 76 -

Introduccin
sonlasmsusadas.Lainterfasedefotoionizacinapresinatmosfrica(APPI)
es la mejor seleccin en el caso de analizar compuestos quirales (los cuales
suelen requerir el uso de LC en fase normal) ya que, a diferencia de otras
interfases, no est sujeta a explosiones peligrosas cuando se usan disolventes
inflamablesenlafasemvil.

La LC actual ha evolucionado por un lado al empleo de ultrapresin


(UPLC)paraconseguireficienciasdeseparacinmximasyreducireltiempode
anlisis[233]yporotrolado,alacromatografadeinteraccinhidroflica(HILIC)
paramejorarlaseparacinysensibilidadporMSparacompuestosmuypolares
[234].UPLCusacolumnasconpartculasempaquetadaspordebajode2m.El
incremento de resolucin y estrechez de los picos permite que los analitos
coeluyan con menos interferencias y en caso de combinarse con MS reduce o
evitatotalmentelosefectosmatriz,locualevitalanecesidaddeusarestndares
internosoadicinestndarsimplificandoelprocedimientooperacional.Suuso
encombinacinconMSseestincrementandoenelanlisisambiental.HILICse
est haciendo muy popular para la separacin de compuestos polares como
aminocidos, pptidos, drogas o metabolitos, en columnas polares con fases
mviles acuosasorgnicas con alto contenido en disolvente orgnico. Sin
embargo, las aplicaciones de HILIC en anlisis ambiental son todava muy
escasas.

RecientesavancesenMShanllevadoaldesarrollodeanalizadoresQqQ
denuevageneracineinstrumentoshbridoscomocuadrupolotiempodevuelo
(QTOF), cuadrupolotrampas lineales (QLITs) y trampa inica linealOrbitrap
(LTQOrbitrap). Las ventajas de estos nuevos analizadores en trminos de
velocidad de monitorizacin, exactitud de masa y sensibilidad en el anlisis
ambiental han sido discutidas por Barcel y Petrovic [235]. QLIT MS con
posibilidad de MS3, LITs con alta sensibilidad para experimentos MSn y QTOF
[233] A.B. Lambie, A. Agarwal, H. Fang, A. Hamsher, L. Hong, K. ONeal, X. XU, S.G.
Weber, Trends Anal. Chem. 26 (2007) 445.
[234] P. Jandera, J. Sep. Sci. 31 (2008) 1241.
[235] D. Barcel, M. Petrovic, Trends Anal. Chem. 26 (2007) 2.

- 77 -


MSparamedidasdemasaexactasdelosionesproductosonherramientasmuy
poderosasparaidentificarproductosdetransformacin.

Actualmente,lasinvestigacionesenelreadelaLCMSestnenfocadas
al desarrollo de anlisis multiresiduo de contaminantes [236239] y a la
237,238,239

identificacin y cuantificacin de productos de degradacin y metabolitos


[240,241].LCQqQesporahoralatcnicatandemmsempleadaparaelanlisis
demultiresiduos,yaqueensumodoMRMpermiteladeterminacindeungran
nmero de compuestos con LODs en el rango ng L1. Respecto al anlisis de
metabolitos y productos de degradacin el modo ms fcil e inequvoco de
identificar metabolitos es usando materiales de referencia sin embargo, no
siempreestndisponibles.UnmodoalternativoesempleandoMSenmodofull
scan y aunque los QqQs son la eleccin usual su sensibilidad en fullscan es
inadecuadaloqueestpromoviendoelusodeITMSyTOFMS[242],teniendo
esteltimolaventajaaadidadealtaresolucinquepermitemedidasconalta
exactitud de masa. Seguidamente es necesaria una caracterizacin estructural
para lo cual MSn es indispensable. Los cuadrupolos permiten realizar
identificacin estructural induciendo la fragmentacin en la fuente; sin
embargo, la disociacin inducida por colisin (CID) en QqQ y IT proporciona
mayorselectividad.

[236] I. Senta, S. Terzi, M. Ahel, Chromatographia 68 (2008) 747.


[237] L. Barron, J. Tobin, B. Paull, J. Environ. Monitor. 10 (2008) 353.
[238] A. Greulich, Anal. Bioanal. Chem. 391 (2008) 183.
[239] E. Vulliet, L. Wiest, R. Baudot, M.F. Grenier-Loustalot, J. Chromatogr. A 1210
(2008) 84.
[240] T. Kosjek, E. Heath, M. Petrovic, D. Barcel, Trends Anal. Chem. 26 (2007) 1076.
[241] H.K. Lim, J. Chen, C. Sensehauser, K. Cool, V. Subrahmanyam, Rapid Commun.
Mass Spectrom. 21 (2007) 1821.
[242] H. Gallart-Ayala, E. Moyano, M. T. Galceran, Rapid. Commun. Mass Spectrom. 21
(2007) 4039.

- 78 -

Introduccin

2.4.3. Electroforesiscapilar.

Lastcnicasdeelectroforesiscapilar(CE),tantoenformatotradicional
como en formato chip, se estn haciendo un hueco dentro del anlisis
ambientalgraciasalosrecientesavancesenestembito.

Aunque los mtodos de deteccin pticos siguen siendo los ms


ampliamenteinstaladosenlosinstrumentoscomerciales,lanecesidaddemayor
sensibilidadconestatcnicasiguesiendounaprioridadenlainvestigacincon
CE. Las ltimas mejoras en los sistemas de deteccin, los avances en
preconcentracinoffyonline,losusosmsrecientesdeelectromigracinenel
anlisis por microchip y la utilidad de estas metodologas en el anlisis de
muestrasrealesseencuentranrecogidasenunarevisinbibliogrfica[243].El
intersporotrosdetectorescomoloselectroqumicosestcreciendodebidoa
su bajo coste, alta sensibilidad y excelente capacidad para miniaturizacin.
Asimismo han surgido nuevas tendencias al acoplamiento de las tcnicas de
separacin capilar con MS [244]. El desarrollo de interfases apropiadas que
permitanlacompatibilidaddelbufferdeseparacinenCEconlosprocesosde
ionizacin, sin que conlleve prdidas de sensibilidad, contina siendo un gran
reto para CEMS dado que los lmites de deteccin que se alcanzan son
inadecuados para muchas aplicaciones ambientales. Respecto al uso de CE en
microchips,esttcnicaatraemuchointersactualmenteporlasventajasque
de ella se derivan como es su gran portabilidad y mnimo consumo de
disolventes y reactivos. Una revisin exhaustiva de sus aplicaciones en anlisis
ambientalhasidorealizadaporLiyLin[245]yEscarpaetal.[246].

[243] E. Dabek-Zlotorynska, V. Celo, M. M: Yassine, Electrophoresis 29 (2008) 310.


[244] C.W. Klampfl, W. Buchgerger, Anal. Bioanal. Chem. 288 (2007) 533.
[245] H. Li, J.M. Lin, Anal. Bioanal. Chem. 393 (2009) 555.
[246] A. Gonzlez-Crevilln, M. Hervs, M.A, Lpez, M.C. Gonzlez, A. Escarpa,
Talanta 74 (2007) 342.

- 79 -

PARTEI:SISTEMASSUPRAMOLECULARESPARALASIMPLIFICACINDEOPERACIONESPREVIASENLA
DETERMINACINDECONTAMINANTESENMUESTRASACUOSAS

PARTE I
SISTEMAS SUPRAMOLECULARES
PARA LA SIMPLIFICACIN DE
OPERACIONES PREVIAS EN
LA DETERMINACIN DE
CONTAMINANTES EN
MUESTRAS ACUOSAS

Objeto

OBJETO

Lasimplificacindelasoperacionespreviasdelprocesoanalticoesun
objetivo prioritario en el mbito del anlisis qumico. En este sentido, la
extraccinenfaseslida(SPE)eslatcnicamsrecomendadaparaelanlisisde
muestrasacuosasdebidoasusimplicidadycapacidaddeintegrarlaextracciny
preconcentracin de los compuestos con la limpieza y conservacin de la
muestra.

Porello,esinteresanteyobjetodepartedelasinvestigacionesquese
presentan en el bloque I de esta Tesis Doctoral el desarrollo de nuevas fases
adsorbentes para SPE basadas en sistemas supramoleculares que aporten
alternativas y mejoren las prestaciones de las ya existentes. Los agregados
supramoleculares propuestos para alcanzar este objetivo han sido; (1)
hemimicelas de dodecilsulfato formadas sobre almina como nueva fase
adsorbenteparalaextraccin,concentracinyestabilizacin en faseslidade
tensioactivos de benzalconio y (2) admicelas mixtas de dodecilsulfato y
tetrabutilamoniosobrealminacomonuevafaseadsorbenteparalaextraccin,
concentracinyestabilizacinenfaseslidadedistintasfamiliasdeplaguicidas.

El segundo objetivo de este bloque I es el empleo de la nueva


metodologaextraccinlquidolquidocondisolventesupramolecular(SUPRAS)
con la finalidad de integrar y simplificar las etapas previas del anlisis de
muestras acuosas. El SUPRAS propuesto est constituido por agregados de
micelas acuosas de cido dodecilsulfnico para la extraccin, concentracin y
estabilizacin de hidrocarburos aromticos policclicos y tensioactivos de
benzalconio. Los SUPRASs generados pueden almacenarse en viales de
pequeos tamao por lo que los requerimientos para su transporte y
almacenamientosonmnimos.

El carcter multifuncional de los sistemas supramoleculares permite la


extraccin de contaminantes en un amplio intervalo de polaridad con elevada
eficacia, dado los mltiples enlaces (hidrfobos, inicos, catin, puentes de

- 83 -

ParteI
hidrogeno,agregadosmixtos,etc.)quepuedenestablecerseentrelossolutosy
el extractante. Adems tanto las hemimicelas/admicelas como los disolventes
supramolecularesproporcionanmicroambientesdondelosanalitosseadsorben
o solubilizan evitndose prdidas por degradacin o adsorcin sobre los
contenedoresalolargodeltiempo.

Hay que destacar tambin que los sistemas supramoleculares se


adaptanalosprincipiosdelaqumicaverdeyslorequierenparasuaplicacin
material convencional en el laboratorio. Constituyen por tanto una alternativa
interesantealosdisolventesorgnicosyalosadsorbentesconvencionalespara
suaplicacinenanlisisambiental.

A continuacin se presentan los resultados obtenidos de las


investigacionesrealizadasenesteprimerbloquedelaTesisDoctoral.

- 84 -

Capitulo1
CAPTULO1:Stabilityofbenzalkoniumsurfactantsonhemimicellesbasedsolidphaseextractioncartridges

CAPTULO1

Stabilityofbenzalkoniumsurfactantsonhemimicelles
basedsolidphaseextractioncartridges

JournalofChromatographyA1094(2005)1723.
NoeliaLuque,FranciscoMerino,SoledadRubio,DoloresPrezBendito

Abstract

The capability of hemimicellebased solidphase extraction cartridges for the


preservation of organic compounds after their concentration from water
samples was investigated for the first time. The approach is illustrated by
studyingthestabilityofbenzalkoniumhomologue(C12,C14andC16)surfactants
(BASs) on monolayers of dodecyl sulphate (SDS) hemimicelles formed on
alumina.Thestabilitystudyincludedstorageofcartridgesatroomtemperature,
at4Candat20C,duringaperiodofupto3months.Theinfluenceofwater
matrix components was also investigated from parallel experiments using
spikeddistilled,riverandwastewatersamples.CompleterecoveryofBASswas
obtainedforallstorageconditionstested.Recoverieswereindependentonthe
alkylchainlengthofBAShomologuesandwatermatrix.TheSPEofBASsonthe
SDShemimicelleshadastrongstabilizingeffectforthetargetcompoundsand
their analysis can be accomplished after at least three months without the
necessity of special storage conditions for cartridges. Because of the lack of
data,anadditionalstabilitystudywascarriedoutforBASsinanaqueousmatrix
usingtraditionalpreservationmethodssuchasacidification(pH2)/refrigeration,
addition of formaldehyde (5%)/refrigeration, and freezing (20 C). Only
combinationofchemicaladdition(e.g.nitricacidorformaldehyde)/refrigeration
wasfoundeffectiveto preserveBASsintheshortterm (e.g.for aweek),then
lossesupto40%wereobservedforthesetargetcompoundsafteramonth.

Keywords:Benzalkonium;Cationicsurfactant;Admicelle;Hemimicelle;Stability;
- 85 -

ParteI
storage;SPE.

1.Introduction

Preservation of sample integrity during storage and transport


constitutes an important issue in environmental monitoring programs. The
preservation process encompasses both field and laboratory activities and
includes a variety of techniques including chemical addition, temperature
controlandthechoiceofsamplingcontainers[1].Becausetraceenrichmentisa
necessary step for many pollutant analyses, an interesting alternative to
traditional sample transport and storage has been to use onsite solidphase
extraction (SPE) of pollutants and stabilize organic compounds on the sorbent
cartridge. In this way, environmental monitoring programs can be greatly
simplified.Benefitsofthisstrategyhavebeendiscussedfortheextractionofa
varietyofpollutants(e.g.hydrocarbons[2],pesticides[37], phenols[8],dyes
4567

[9,10], nonionic/anionic surfactants [11]) from environmental water samples,


usingdifferentsorbentmaterials.

Hemimicelles and admicelles have been recently used as sorbent


materialsinSPEfortheextractionoforganiccompounds[1216].

13141516

[1] J. Parr, M. Bollinger, O. Callaway, K. Carlberg, in: L.H. Keith (Ed.), Principles of
Environmental Sampling, American Chemical Society, Washington, 1996. p.267
(Chapter 15).
[2] D.R. Green, D. Le Pape, Anal. Chem. 59 (1987) 699.
[3] S.A. Senseman, T.L. Lavy, J.D. Mattice, B.M. Myers, B.W. Skulman, Environ. Sci.
Technol. 27 (1993) 516.
[4] D. Barcel, S. Chiron, S. Lacorte, E. Martnez, J.S. Salau, M.C. Hennion, Trends
Anal. Chem. 13 (1994) 352.
[5] I. Ferrer, D. Barcel, J. Chromatogr. A 737 (1996) 93.
[6] I. Lika, K. Blikov, J. Chromatogr. A 795 (1998) 61.
[7] I. Ferrer, D. Barcel, J. Chromatogr. A 778 (1997) 161.
[8] M. Castillo, D. Puig, D. Barcel, J. Chromatogr. A 778 (1997) 301.
[9] M.C. Alonso, D. Barcel, J. Chromatogr. A 889 (2000) 231.
[10] M.C. Alonso, D. Barcel, Analyst 127 (2002) 472.
[11] M .Petrovi, D. Barcel, Fresenius J. Anal. Chem. 368 (2000) 676.
[12] T. Saitoh, Y. Nakayama, M. Hiraide, J. Chromatogr. A 972 (2002) 205.
[13] F. Merino, S. Rubio, D. Prez-Bendito, Anal. Chem. 75 (2003) 6799.
[14] F. Merino, S. Rubio, D. Prez-Bendito, Anal. Chem. 76 (2004) 3878.

- 86 -

Capitulo1
Hemimicellesconsistofmonolayersofsurfactantsadsorbingheaddown
on an oppositely charged mineral oxide surface (e.g. alumina, silica, titanium
dioxide, ferric oxyhydroxide). Admicelles are surfactant bilayers formed from
hemimicelles, under addition of more surfactant, by interaction of surfactant
hydrocarbon chains.Amaincharacteristicofthesesorbentsistheirversatility.
On the one hand, the outer surface of the hemimicelle and admicelle is
hydrophobic and ionic, respectively, providing different mechanisms for
retention of organics. On the other hand, the number of surfactants
commercially available is very high, so both the degree of hydrophobicity and
the charge of the sorbent can be easily modified according to the nature of
analytes. As a result, high extraction yields have been obtained for organic
compounds of different nature such as hydrophobics [12,15], ionics [14] and
amphiphilics [13,16].Becausethepotentialofhemimicellesandadmicellesfor
theSPEofpollutants,theirabilitytopreserveorganiccompoundsafteronsite
extractiondeservestoberesearched.

This paper deals with the assessment of the performance of


hemimicellesforthestabilizationofbenzalkoniumsurfactants(BASs)aftertheir
extraction from environmental water samples. These surfactants are used in
large amounts as fabric softeners and disinfectants. The western European
surfactants market is currently estimated at 2.2 M tonnes, of which about 9%
arecationic(mainlyammoniumquaternarysalts)surfactants[17].Mostusesof
BASsleadtotheirreleasetowastewatertreatmentsystemswheretheyadsorb
strongly and rapidly to suspended solids and sludge [18]. As a result, levels of
BASs in surfacewater samples are in the low microgramperlitre range which
compels us to use a preconcentration step prior to chromatographic analysis
[13,19].

[15] T. Saitoh, S. Matsushima, M. Hiraide, J. Chromatogr. A 1040 (2004) 185.


[16] M. Cantero, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1067 (2005) 161.
[17] M. Deleu, M. Paquot, C.R. Chim. 7 (2004) 641.
[18] M.J. Scott, M.N. Jones, Biochim. Biophys. Acta 1508 (2000) 235.
[19] I. Ferrer, E.T. Furlong, Environ. Sci. Technol. 35 (2001) 2583.

- 87 -

ParteI
Different sorbent materials have been proposed for SPE of BASs
[13,19,20]. The use of nonpolar silica sorbents (e.g C18) is not recommended
because the strong interaction of these cationic surfactants with the silanol
groups which results in very broad elution bands. This problem can be solved
usingneutralpolymericsorbents,butBASextractionrecoveriesareabout75%
[19]. The use of sodium dodecyl sulphate (SDS) hemimicelles on alumina has
provedtobeaveryconvenientsorbentforthesesurfactantsbecauseboth,the
high BAS retention, derived from the formation of analyte:extractant mixed
aggregates, and the easy BAS desorption, derived from the fast disruption of
hemimicellesinthepresenceoforganicsolventsandtheelectrostaticrepulsion
between BASs and the positively charged alumina surface [13]. A similar
approach,usingdodecylsulphateattachedtoananionexchangeresinhasbeen
recentlyproposedforextractionofBASs[20].

To our knowledge, no studies concerning the stability of BASs in SPE


sorbents have been described. Known factors affecting BAS stability include
adsorption on containers and microbiological degradation. Significant
adsorptionofBASs(around90%)onglass,polypropyleneandTefloncontainers
havebeenreportedforfilteredwatersamplesstoredat4C[19],howeverno
BASadsorptiononglasscontainersatpH2[13]orunderadditionofacetonitrile
to make a 25% solution [18] has been detected. Studies on aerobic
biodegradability of BASs, using biodegradation tests, have proved that C12 and
C14BAShomologuesundergocompleteprimarybiodegradationinthefirstweek
andareultimatelybiodegradable(i.e.mineralised)with>80%ofCO2releaseon
the 11th day [21]. On the other hand, the extent of primary biodegradation
foundforC16BASwasonly30%,andnonultimatebiodegradationwasobserved
for this homologue [21]. Biodegradation of BASs in river water is considerably

[20] J.K. Autry, E.G. Vaught, E.D. Conte, Microchem. J. 80 (2005) 25.
[21] M.T. Garca, I. Ribosa, T. Guindulain, J. Snchez-Leal, J. Vives-Rego, Environ.
Pollut. 111 (2001) 169.

- 88 -

Capitulo1
reducedbycomplexationwithananionicsurfactant[22],andthisbehaviouris
expectedtobeastabilizingfactorforBASsonSDShemimicellecartridges.

Inthiswork,thestoragestabilityofC12,C14andC16BAShomologueson
SDS hemimicellesalumina cartridges was investigated during a period of 3
months at three different temperatures (20 C, 4C and room temperature).
The influence of light and matrix composition on BAS stability was also
investigated.BecauseofthelackofdataonthestabilityofBASsolutionstreated
with traditional preservation procedures, we also investigated the stability of
BASs under acidification (pH 2)/refrigeration (4C), addition of 5%
formaldehyde/refrigeration (4C), and freezing (20C). The final goal of this
research was to contribute to the knowledge of the ability of supramolecular
sorbents to stabilize organic compounds and to establish preservation
conditionsforBASsinenvironmentalwatersamples.

2.Experimental

2.1.Chemicalsandmaterials

Benzyldimethyldodecylammonium bromide (BDDA), benzyldimethyl


tetradecylammonium bromide (BDTA), benzyldimethylhexadecylammonium
chloride(BDHA)andsodiumdodecylsulfate(SDS)surfactantsweresuppliedby
Aldrich (Milwaukee, WI). Nitric acid, ammonia (30% w/v), formaldehyde (35
40% w/v) and HPLCgrade methanol were obtained from Panreac (Madrid,
Spain).FormicacidwaspurchasedfromMerck(Darmstadt,Germany).BondElut
Jr. cartridge columns filled with 500 mg of acid alumina (particle size 25 m)
wereobtainedfromVarian(Victoria,Australia).

[22] A. Utsunomiya, Y. Mori, K. Hasegawa, Japan. J. Toxicol. Environ. Health 44 (1998)


264.

- 89 -

ParteI
2.2.Stabilitystudies

2.2.1.Samplepreparation

Stability studies were carried out using spiked distilled water. For this
purpose, stock standard solutions of BASs (60 mg L1) were prepared in
methanol.Samples(0.25L)indarkglasscontainerswerespikedtoobtainafinal
concentration of 48 g/l of each surfactant. Then, they were treated with
differentpreservationmethods[hemimicellebasedcartridges,acidification(pH
2)/refrigeration (4C), addition of 5% formaldehyde/refrigeration (4C), and
freezing(20C)],andstoredunderdifferentconditions.Duplicatesampleswere
analysed for each experimental condition studied. Recoveries of BASs a time
zero were established for each preservation method investigated and data on
stabilitywerenormalisedtotheseresults.The matrixeffecton thestability of
BASs preconcentrated on hemimicellebased cartridges was investigated using
riverandwastewatersamples.RiversamplesweretakenfromtheRabanalesin
Crdoba city. Treated sewage samples were collected from the wastewater
treatmentplant(WWTP)ofBailninthesouthofSpain.BailnWWTPreceives
4050%industrialeffluents(mainlyfrombrickworks,andceramicandoliveoil
industries)mixedwith5060%domesticwastewaters.Sampleswerecollected
indarkglasscontainers.Immediatelytheywerefilteredthrough0.45mfilters
(Whatman GF/F, Osmonics, France) in order to remove suspended solids, and
then they were spiked to obtain a final concentration of 48 g L1 of each
surfactant. Blank river and wastewater samples were analysed prior to spiking
BASs.

2.2.2.BASpreservationonhemimicellebasedSPEcartridges

Figure 1 shows the different steps followed to preserve BASs on


hemimicellebasedSPEcartridges.Threekindsofexperimentsweredesignedto
investigate the effect of using (a) different desiccation treatments, (b) dark
conditionsand(c)varioustemperatures,onBASstability.Thecommonprotocol
wasasfollows:spikedwatersampleswereadjustedtopH2bytheadditionof

- 90 -

Capitulo1

BASpreservationanddetermination
HemimicellebasedSPEcartridges

Conventionalprocedures

WatersampleatpH2(0.25L)
(distilled,river,wastewater)

BASPRESERVATION

Distilledwater(0.25 L)

SDS
Alumina
Acidificationat
pH2and
storageat4C

BASPRESERVATION

Sampleloading
+ +

BASs

Additionof
formaldehyde
(5%)andstorage
at4C

Freezingat
20C

SDS
Alumina
AdjusttopH2
withnitricacid

Drying

SDS

Alumina

Storageconditions

Sampleloading

4C

++

BASDETERMINATION


Elution
2mLofmethanol

1.

Scheme

SDS
Alumina

Elution
2mLofmethanol

LC/DADUVdetermination

Figure

BASs

BASDETERMINATION

Room
temperature

20C

LC/DADUVdetermination

of

the

different

stops

followed

for

the

preservation/determination of BAS using hemimicelles-based cartridges and


conventional procedures for storage of samples.

- 91 -

ParteI
nitricacidtoavoidtheadsorptionofBASsonthewallofsamplecontainers[13].
Bond Elut Jr. cartridge columns were conditioned with 5 ml of distilled water
(pH = 2). The hemimicelles were formed on the alumina by passing a 10 mL
solutioncontaining12.5mgofSDSatpH2.Thesorbentwasnotallowedtodry
andthen,0.25Lofthespikedwatersampleswereloadedonthehemimicelles
usingavacuumpump(EyelaA35,RikakikaiCo.,Tokyo),ataflowrateof10mL
min1. Then, the percolated samples were subjected to the three kinds of
experimentsabovespecified:(a)Desiccationstudieswerecarriedoutusingthe
Eyelavacuumpump,fortimesrangingfrom3to5min(thetimenecessaryto
notobservewaterdropsleakingoutthecartridge)to1hour.Wetcartridges(i.e.
withoutdrying)werealsoanalysedatthesametimes.(b)Darkconditionswere
obtained by initially wrapping the cartridges up with aluminium foil. Drying of
thepercolatedsampleswasstoppedwhennotwaterdropswereleakedoutthe
cartridge.Ittookabout35min.Thecartridgescontainingthepreconcentrated
BASs were stored at room temperature for a period of 1 month and BAS
concentrations were determined weekly. Noncovered cartridges were also
analysedatthesametimes.(c)TheeffectofthetemperatureonBASstability
was studied by using noncovered cartridges. After drying the percolated
samplesfor35min,thepreconcentratedBASswerestoredat20C,4Cand
roomtemperatureforaperiodof3months.BASconcentrationswereanalysed
after0.25,0.5,0.75,1,2and3months.Thecartridgesat4Cand20Cwere
broughttoroomtemperaturefor15minand1hour,respectively,priortothe
determinationofBASs.

2.2.3.BASpreservationusingconventionalprocedures

Thestabilityofspikeddistilledwatersamples(0.25L),containedindark
glass bottles, was also studied according to the following conventional
procedures(seeFigure1):

TheywereadjustedtopH2bytheadditionofconcentratednitricacid
andstoredat4C.

- 92 -

Capitulo1

Formaldehydewasaddedtomakeafinalconcentrationof5%andthen,
thesampleswerestoredat4C.

Sampleswerefrozenat20C

Stability measurements were performed at time zero and at each week for a
month.

2.2.4.BASdetermination

ThesequencefollowedforBASdetermination,aftertheirstorageunder
different conditions, is depicted in Figure 1. BASs stored on hemimicelle
cartridges were eluted with 2 mL of methanol and aliquots of the eluate
(typically20L)wereinjectedintoaLC/DADUVsystem.Samplespreservedby
conventional procedures were adjusted at pH 2 and preconcentrated on SDS
hemimicellesbasedcartridgesaccordingtotheprocedurepreviouslydescribed
(section2.2.2).Then,elutionwith2mLofmethanolandinjectionofanaliquot
inthechromatographwasperformed.

Liquid chromatographic analysis was made using a Waters 616


multisolventpumpanda717autosampler.Thestationaryphasecolumnwasa
10cm BDS Hypersil C18 column with 4.6 mm i.d. and 3m particle diameter
(ThermoQuest, San Jos, CA, USA). The mobile phase consisted in an isocratic
mixtureof50mMammoniumformateatpH3.5(5%)andmethanol(95%),ata
flow rate of0.4 mL min L1. The time required to complete the chromatogram
was20min.Measurementswereperformedat210nmusinga996diodearray
detector.Externalcalibrationwasusedforquantitativedetermination.Linearity
wasobtainedforBASconcentrationsbetween2and40mgL1.

- 93 -

ParteI
3.Resultsanddiscussion

3.1.Analyticalperformance

Combination

of

SDS

hemimicellebased

SPE

with

liquid

chromatography/electrospray ionization in positive ion mode/ion trap mass


spectrometry has been previously proposed by our research group for the
quantificationofBASsatthelevelsfoundinenvironmentalwaters(i.e.lowg/L)
without interference of the major surfactants (i.e. anionic and nonionic) and
electrolytes [13]. Recoveries of BAS homologues from SDS hemimicelles were
found quantitative and independent of the alkyl chain length under a wide
range of experimental conditions. The strong retention of BASs was a
consequence of their hydrophobic and electrostatic interactions with the
surfactantcoatingthemineraloxide.

Asimplertechnique(i.e.liquidchromatography/UVdetection)wasused
in this work to control the stability of BASs in SDS hemimicelles since its
performance was enough for this purpose. BASs were monitored at 210 nm
becauseofthiswavelengthprovidedthebestsignaltonoiseratiointherange
210250 nm. Recoveries of BASs from distilled water, river water and
wastewater,spikedwith48gL1ofeachhomologue,wasnearly100%andno
interferencewasdetectedfromthecomponentsofthedifferentmatricesusing
this detection system. No cleanup steps were required to determine
benzalkoniumsurfactantsintheenvironmentalwatersamplesanalysed.

Calibration curves obtained for BAS homologues were linear in the


concentration range 240 mg L1. These calibrations covered the whole
concentration range in which the stability study was carried out taking into
considerationthepossibilityofdiminutionoftheconcentrationofBASsdueto
degradation. The instrumental detection limits were calculated from blank
determinations by using a signaltonoise ratio of 3. They ranged between 0.8
and 1.2 mg L1. The precision of the method was evaluated by extracting 11

- 94 -

Capitulo1
independent spiked (48 g L1) distilled water samples. The relative standard
deviationwasalwaysbetween4and6%.

3.2.Stabilitystudies

3.2.1.StabilityofBASsinwatersamples

TheabilityoftraditionalstabilizationprocedurestopreserveBASsatthe
levelsfoundinenvironmentalwatersampleswasassessed.Inordertodecrease
microbiological degradation the strategies tested always included the use of
refrigeration or freezing (see Figure 1). Adjustment of the pH solution at 2, to
decreaseBASadsorptionontheglasscontainer,andadditionofformaldehyde,
a typical stabilizing agent for organic compounds, were used in combination
withrefrigeration.Allexperimentswerecarriedoutunderdarkconditions.

Figure2showstheresultsobtainedforthestudyofthestabilityofBASs
inspiked(48gL1)distilledwatersamples,foraperiodofamonth,usingthe
three conventional procedures specified in Figure 1. Combination of both
chemical addition (i.e. nitric acid or formaldehyde) and decrease of the
temperaturewastheonlyeffectivewaytopreserveBASsintheshortterm(i.e.
for a week). Then progressive losses of these cationic surfactants, which were
higher as the alkyl chain length increased, were found. Therefore, chemical
addition/refrigeration is not a useful strategy for preservation of BASs in the
mediumlong term. Freezing of samples did not improve the stability of BASs
suggestingthatadsorptiononcontainerswasanimportantissueforthelossof
thesecationicsurfactants.

This study indicates that, before using traditional preservation


proceduresformonitoringcampaignsinvolvingBAS,additionalresearchshould
bedevelopedtoensurethattheintegrityofthesetargetcompoundsiskept.

- 95 -

ParteI

(a)

100
80

1stweek

60

2ndweek

40

3thweek

20

4thweek

0
(b)

100
Recovery(%)

Time0

80
60
40
20
0
100

(c)

80
60
40
20
0
Acidification/
refrigeration

Formaldehyde/
refrigeration

Freezing

Figure 2. Recovery of (a) benzyldimethyldodecyl ammonium; (b)


benzyldimethyltetradecyl ammonium and (c) benzyldimethylhexadecyl
ammonium surfactants from spiked (48 g L-1) distilled water after storage
under different conventional preservation methods.

Because of the convenience of using SPE cartridges to preserve


pollutants in terms of transportation costs and simplicity, we focused in this
researchonthestabilityofBASinhemimicellesandwedidnottrytofindthe
optimalpreservationconditionsforBASusingconventionalprocedures.

- 96 -

Capitulo1
3.2.2.StabilityofBASsonhemimicellebasedSPEcartridges

3.2.2.1. Effect of water removal and dark conditions on BAS stability. Residual
water surrounding the sorbent after sample filtration has been described to
cause hydrolysis of susceptible compounds [23]. So, different desiccation
treatmentshavebeenproposedtoenhancethestabilityofanalytesstoredon
SPEcartridgesordisks[311].Theeffectofwaterremovalafterpercolationof
thesampleonthestabilityofBASswasassessedbydryingthecartridgeswitha
vacuum pump for times ranging between 3 min and 1 h. BAS recoveries
decreasedabout45%aftertheirstorageinwetcartridgesatroomtemperature
for 1 day. Partial drying of cartridges stabilized the target compounds and
recoveries were quantitative after their storage at room temperature for at
leastaweek.NoeffectsofthedryingtimeonBASstabilitywereobserved.So,
dryingofcartridgesfor35minafterpercolationofthesamplewasproposed.

Thestorageofcartridgesunderdarkconditions(i.e.usingaluminiumfoil
wrapped cartridges) was not necessary to achieve BAS stability. Recoveries
obtained for the target compounds from aluminium foil wrapped cartridges
(Table1)andnoncoveredones(topofTable2),storedatroomtemperaturefor
amonth,weresimilar.Therefore,naturalilluminationinthelab(i.e.thatfrom
sunlight) did not affect BAS stability and further experiences were carried out
usingnoncoveredcartridges.

Table1. Mean recoveries (%) of benzalkonium surfactants after storing the SDShemimicelles aluminium foil wrapped cartridges at room temperature.

Storagetime(week)
0
1st
2nd
3rd
4th

BDDA(%)
100
100
106
98
103

BDTA(%)
100
98
96
105
95

BDHA(%)
100
97
96
96
102

[23] S.A. Senseman, T.L. Lavy, J.D. Mattice, Anal. Chem. 67 (1995) 3064.

- 97 -

ParteI
AdjustmentofthepHofsamplesat2preventedtheadsorptionofBASs
onthewallofthematerialsusedintheanalyticalprocess,asitcanbederived
fromthequantitativerecoveriesobtainedforthetargetcompoundsunderthe
differentexperimentalconditionsinvestigated.

3.2.2.2. Effect of the cartridge storage temperature on BAS stability. For this
study, hemimicelllebased SPE cartridges loaded with spiked distilled water
wereanalysedduringa3monthperiod.Afterpreconcentration,thecartridges
were dried and then stored at 20 C, 4 C and at room temperature,
respectively. Before elution, cartridges at 20 C and 4 C were kept at room
temperatureforaperiodvaryingbetween5minand5hoursinordertodefrost
thesampleand/oravoidvariabilityproblems.Itwasfoundthatsorbentsshould
bekeptatroomtemperaturebeforeelutionforatleast15minand1hourwhen
they are brought from storage conditions involving 4 C and 20 C,
respectively,inordertoobtainquantitativeandhighprecisionresults.So,these
timeswereusedthroughthewholeexperiment.

Table 2 shows the recoveries obtained for the three BAS homologues
understudyatthethreetemperaturesexamined.SDShemimicelleshadahigh
stabilizing effect on BASs; the integrity of the target compounds was kept for
thewholeperiodoftimeinvestigated,independentlyonthetemperatureused
forstorageofcartridges.Nodifferencesofrecoverieswerefoundforthethree
homologues, despite C12 and C14 are known to be more easily biodegradable
than C16 [20]. The high stability afforded by BASs after formation of mixed
aggregates with SDS is in agreement with the biodegradation reduction
observed for cationicanionic surfactant complexes in natural environments
[22].ThefactthatBASsarestableatroomtemperatureforatleast3monthsis
an outstanding feature of the stabilizing strategy here proposed since it will
permitaneasytransportationofthesamplespreconcentratedonthecartridges
tolaboratoriesforanalysis.

- 98 -

Capitulo1
Table 2. Mean recoveries (%) of benzalkonium surfactants after storing the
SDS-hemimicelles cartridges at different temperatures values.

Storageconditions
Roomtemperature

Storagetime
(week)
0
1st
2nd
3rd
4th
8th
12th

BDDA
(%)
100
96
97
94
96
101
104

BDTA
(%)
100
97
101
97
101
97
99

BDHA
(%)
100
98
97
99
94
94
97

4C

0
1st
2nd
3rd
4th
8th
12th

100
102
105
114
97
103
99

100
98
104
103
103
98
97

100
100
105
98
103
96
98

20C

0
1st
2nd
3rd
4th
8th
12th

100
105
101
94
95
96
94

100
100
98
97
95
96
94

100
94
94
94
95
95
95

3.2.2.3. Effect of the water matrix on BAS stability. In order to validate the
preservationtechniquewehavetotakeintoaccountthecharacterofsamples
sincematrixcomponentscandegradethestabilityofthetargetcompounds.In
previous studies using SDS hemimicellebased SPE [13], no interference has
been found for BAS determination from alkylbenzenesulphonates and
nonylphenol/alcohol ethoxylates, at the concentration level found in sewage
(mg L1), or from other matrix components. The stability of sorbed BAS was
investigatedusingriverandwastewater(effluent)samples.Sincebothkindsof

- 99 -

ParteI
samples contain nonionic [16] and anionic [24] surfactants and other organic
components (e.g. humic material), they were considered appropriate to this
purpose. The concentration of BASs was undetectable because the practical
detection limit of LC/UV (about 10 g L1) was superior to the concentrations
usually found in these samples (e.g. between 0.1 and 6 g L1, [13,19]). So,
spiked samples were used. The loaded cartridges were kept at room
temperatureand4Cforamonth.Measurementswerecarriedoutweeklyfora
month.Theresultsobtained(Table3)indicatedthatmatrixcomponentshadnot
influence on the stability of BAS homologues, thus confirming the high
resistanceofSDS:BASaggregatestodegradation.

Table 3. Recoveries (%) of benzalkonium surfactants from spiked


environmental water samples alter storing the SDS-hemimicelles cartridges at
4C for a month.

Time

Wastewater(effluent)

(week)

0
1st
2nd
3rd
4th

Riverwater

BDDA(%)

BTDA(%)

BHDA(%)

BDDA(%)

BTDA(%)

BHDA(%)

100
96
104
101
103

100
100
104
102
101

100
96
100
95
94

100
98
100
106
103

100
102
96
97
105

100
94
101
101
104

4.Conclusions

From the results reported in this study, it can be concluded that SDS
hemimicelles onto alumina is a valuable sorbent to stabilize BASs after
preconcentratingthemfromenvironmentalsamples.TherecoveryofBASswas
foundquantitativeandindependentofthealkylchainlengthundertherangeof
temperatures examined (from room temperature to 20 C) for a period of 3
months. No complete removal of water after percolation of the sample was
required for stabilization of BASs; drying the cartridges for 35 min with a
[24] F.J. Ruiz, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1030 (2004) 109.

- 100 -

Capitulo1
vacuum pump achieved the stabilization. Storage of cartridges under dark
conditionswasnotrequired;naturalilluminationinthelab(i.e.sunlight)didnot
affectBASstability.

On the contrary, conventional stabilization procedures, based on


chemical addition/refrigeration, were only effective to stabilize BASs in the
short term (e.g. for a week). So, the use of hemimicellebased cartridges
presentsclearadvantagesovertraditionalstabilizationmethods.Inadditionto
the easy shipping of the disposable SPE precolumns and their easy storage in
the laboratory, the high stability of BASs on the SDS hemimicelles makes
possible to analyse the samples after several weeks without special storage
conditions.

The

results

obtained

open

the

possibility

of

using

hemimicelles/admicelles as stabilizing agents in environmental monitoring


programs thus extending the applicability of SPE for this purpose. Because of
thehighabilityofthesesorbentstoconcentrateavarietyoforganiccompounds
onthebasisofdifferentinteractionmechanisms,thestudyontheircapacityto
stabilize the concentrated compounds is especially interesting in order to use
them to integrate different steps of the analytical process, namely,
concentration/transport/preservation/clean up. Research on this topic is being
carriedoutbyourgroupatthepresent.

Acknowledgements

The authors gratefully acknowledge financial support from MCyT


(Project BQU200201017). They also thank to the Bailn WWTP personnel for
kindlycollectingthesewagewatersamples.

- 101 -

ParteI

CAPTULO2:Extractionandstabilityofpesticidemultiresiduefromnaturalwateronamultifunctionaladmicellarsorbent

CAPTULO2

Extractionandstabilityofpesticidemultiresiduefrom
naturalwateronamixedmodeadmicellarsorbent

JournalofChromatographyA,DOI:10.1016/j.chroma.2012.06.006
NoeliaLuque,SoledadRubio.

Abstract

The suitability of a mixedmode sorbent made up of admicelles of sodium


dodecylsulphate(SDS)andtetrabutylammonium(TBA)toextractandpreserve
pesticidesfromriverandundergroundwaterwasassessed.Pesticidesbelonging
to different structural groups (i.e. triazines, carbamates, phenylureas, anilides,
chloroacetanilides, organophosphorus and phenoxyacids), most of them well
known by their instability, were selected for this purpose. Extraction of
pesticideswiththeadmicellarsorbentwasoptimized.Percolationof250mLof
sample through the SPE cartridge, elution with1 mLofmethanol(neutraland
basicpesticides)or2mLof0.3MNaOH:methanol(90:10v/v)(acidicpesticides)
and direct analysis of the extract by liquid chromatography/UV detection,
permitted to obtain method detection limits in the range 260 ng L1. Their
degradation on the SPE cartridges after sample percolation was investigated
under a variety of experimental conditions, namely darkness, natural
illuminationanddifferenttemperatures(roomtemperature,4Cand20C)for
3months.Underdarkness,mostofpesticideswerestablefor1monthatroom
temperature and 3 months at 4C. Only atriazine and clorfenvinphos did not
follow this general behaviour. No influence of matrix components on the
stabilizationofpesticidesintheadmicellarsorbentwasobserved.Thestabilizing
capabilityofsurfactantaggregatessurpassedthatofC18andblackcarbonand
was similar to that obtained in some polymeric materials, which have the

- 102 -

Captulo2
disadvantage of requiring large volumes of solvents for analyte elution. The
stabilizationofpesticidesontheadmicellarsorbentwaslongenoughtopermit
easyshippingandstorageofthecartridgesinmonitorizationcampaigns.

Keywords:Pesticidemultiresiduedetermination;pesticidepreservation,natural
waters,admicellarsolidphaseextraction;supramolecularsorbents

1.Introduction

Theextensiveuseofpesticidesinmodernagricultureraisesanumberof
environmentalandhealthconcerns.Pesticidesareacommoncauseofsoiland
water pollution [1] and many of them are considered as carcinogenic [2] or
endocrine disrupting chemicals [3]. Their analytical control is mandatory in
differentwaterbodieswithintheEUincludingdrinking[4],groundwater[5]and
surfacewaters[6].

Becauseofthespatialand/ortemporalvariabilityofpesticidesinwater
bodies, their analysis usually requires the processing of a large number of
samples. Field samples are not analysed immediately after collection, rather
theyarestoredforvariableperiodsoftime.Problemsofpesticidedegradation

[1] M. Arias-Estevez, E. Lpez-Periago, E. Martinez-Carballo, J. Simal-Gandara, J.C.


Mejuto, L. Garca-Rio, Agric. Ecosyst. Environ. 123 (2008) 247.
[2] K.L. Bassil, C. Vakil, M. Sanborn, D.C. Cole, J.S. Kaur, K.J. Kerr, Can. Fam. Phys.
53 (2007) 1704.
[3] R. McKinlay, J.A. Plant, J.N.B. Bell, N. Voulvoulis, Sci. Total. Environ. 398 (2008)
1.
[4] Council Directive 98/93 EC of 3 November 1998 on the quality of water intended for
human consumption, Off. J. Eur. Comm., L330, 5.12.98, 32.
[5] Directive 2006/118/EC of the European Parliament and of the Council of 12
December 2006 on the protection of groundwater against pollution and deterioration, Off.
J. Eur. Comm., L 372, 27.12.2006, 19.
[6] Directive 2008/105/EC of the European Parliament and of the Council of 16
December 2008 on environmental quality standards in the field of water policy,
amending and subsequently repealing Council Directives 82/176/EEC, 83/513/EEC,
84/156/EEC, 84/491/EEC, 86/280/EEC and amending Directive 2000/60/EC of the
European Parliament and of the Council. Off. J. Eur. Comm. L348, 24.12.2008, 84.

- 103 -

ParteI
in water samples are wellknown, major transformations being due to
hydrolysis, biodegradation, photolysis and evaporation [713].8 Strategies9
such10 as11 chemical12 addition13 and/or temperature control have been
traditionallyusedtokeepsampleintegrityuntilanalysis.Inthisrespect,addition
of HgCl2 or monochloroacetic buffer at 4C has been proved to inhibit both
chemical and biological degradation [14]. However, the nature of the agent
requiredtostabilizesomecompoundsmayaffectthestabilityofothers[11,15]
ortheperformanceoftheanalyticalprocedure[16,17]andstabilizationisonly
guaranteed for no more than 12 weeks. Stabilization of pesticides in water
samplesisalsoaneedforthedevelopmentofmatrixreferencematerials[13].

In order to reduce effort and cost in environmental monitoring


programs, strategies to avoid the transport and storage of a large number of
refrigerated,highvolumewatersampleshavebeenwidelyinvestigated.Inthis
respect, solid phase extraction (SPE) has become one of the most accepted
alternatives since it has the potential to combine sample treatment (e.g.
extractionandconcentration),preservation,easytransportandconvenientlab
storage [713,1822]. 19Among 20available 21sorbents,22 carbon materials and
[7] C. Crescenzi, A. Di Corcia, M. Diab Madbouly, R. Samperi, Environ. Sci. Technol.
29 (1995) 2185.
[8] S. Lacorte, N. Ehresmann, D. Barcel, Environ. Sci. Technol. 29 (1995) 2834.
[9] C. Aguilar, I. Ferrer, F. Borrul, R.M. Marc, D. Barcel, Anal. Chim. Acta 386 (1999)
237.
[10] T.L. Porter, M.A. Mohamed, H. Ali, J. Agri. Food Chem. 55 (2007) 204.
[11] I. Ferrer, D. Barcel, J. Chromatogr. A 778 (1997) 161.
[12] I. Liska, K. Bilikova, J. Chromatogr. A 795 (1998) 61.
[13] J. Deplagne, J. Vial, V. Pichon, B. Lalere, G. Hervouet, M.C. Hennion, J.
Chromatogr. A 1123 (2006) 31.
[14] D.J. Munch, C.P. Frebis, Environ. Sci. Technol. 26 (1992) 921.
[15] T.C. Mueller, S.A. Senseman, K.H. Carson, A.S. Sciumbato, J. AOAC Int. 84
(2001) 1070.
[16] S.D. Winslow, B. Prakash, M.M. Domino, B.V. Pepich, D.J. Munch, Environ. Sci.
Technol. 35 (2001) 1851.
[17] I. Ferrer, E.T. Furlong, Environ. Sci. Technol. 35 (2001) 2583.
[18] H. Sabik, R. Jeannot, E. Sauvard, Analusis 28 (2000) 835.
[19] L.E. Vera-Avila, J.C. Vzquez-Lira, R. Covarrubias-Herrera, M.P. Garca-Camacho,
A.M. Nuez-Gaytan, Inter. J. Environ. Anal. Chem. 77 (2000) 255.
[20] G.A. Peuela, D. Barcel, J. Chromatogr. A 823 (1998) 81.

- 104 -

Captulo2
highly crosslinked polymeric resins (e.g. styrenedivinylbenzene polymers) are
the best choice for multiclass pesticide SPE because of their potential to
simultaneously extract a wide polarity range compounds. Alkyl (C8 and C18)
bonded silica provides high retention of nonpolar and moderately polar
compounds but it is not appropriate for polar analytes [22]. Preservation of
pesticidesonSPEmaterialsishighlydependentonthestructureofbothanalyte
andsorbent.Asageneralrule,thestabilityofpesticidesincreasesinpolymeric
resinscomparedtoalkylbondedsilicaandcarbonmaterialsbutusuallyitisnot
longerthan12weeksatroomtemperature.Somedrawbacksassociatedtothe
use of these multiclass sorbents are the high solvent volume required to
quantitatively desorb pesticides from polymeric resins (e.g. 515 mL) and the
irreversible adsorptions occurring on carbon materials [23,24]. Frequently,
organic extracts have to be evaporated to increase concentration factors, that
resulting in long analysis times and losses of volatile and thermally unstable
pesticides. So, the search for mixedmode materials with highly preserving
propertiesandeasyelutionforpesticidesisdesirable.

Hemimicelles and admicelles are mixedmode sorbents [25,26] that


have recently proved their suitability for the extraction of pesticide
multiresiduesfromnaturalwaters[27].Hemimicellesconsistofmonolayersof
ionicsurfactantsadsorbedheaddown onanoppositely charged mineraloxide
surfacewhilethehydrocarbonchainsprotrudeintosolutionwithstronglateral
interactions between them, which leads to tepee structures. Admicelles result

[21] C. de la Colina, F. Snchez-Rasero, G. Dios, E. Romero, A. Pea, Analyst 122


(1997) 7.
[22] H. Sabik, R. Jeannot, B. Rondeau, J. Chromatogr. A 885 (2000) 217.
[23] C. Crescenci, A. Di Corcia, G. Passariello, R. Samperi, M.I. Turnes Carou, J.
Chromatogr. A 733 (1996) 41.
[24] A. Di Corcia, M. Nazzari, R. Rao, R. Samperi, E. Sebastin, J. Chromatogr. A 878
(2000) 87.
[25] S. Rubio, D. Prez-Bendito, Anal. Chem. 81 (2009) 4601.
[26] A. Ballesteros-Gmez, S. Rubio, Anal. Chem. 83 (2011) 45679.
[27] A. Moral, M.D. Sicilia. S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 608 (2008)
61.

- 105 -

ParteI
from the adsorption of surfactant molecules to these monolayers through
interactionsamongthehydrocarbonchainsandtheycloselyresembleaqueous
micelles. Their ability to extract analytes in a wide polarity range derives from
thevarietyofinteractionstheyoffer.Thus,hydrophobicsolutesaresolubilised
into the hydrocarbon region of the surfactant aggregates while polar/charged
analytesmaybesolubilisedinthesurfactantheadgroupsthroughelectrostatic,
cation,dipoledipoleinteractions,hydrogenbonds,etc.Elutionofanalytesis
facilitated by disruption of hemimicelles/admicelles in the presence of organic
solvents or by desorption of the surfactant by pH modification. On the other
hand, the ability of micelles and other surfactant aggregates to stabilize
reactants,intermediates,transitionstatesandproductsiswellknownandithas
beenwidelyexploitedinkinetic[28]andequilibrium[29]analyticalmethods.

Research over the last decade dealing with hemimicelle/admicelle


based SPE sorbents was mainly related with the development of new
applications (e.g. extraction of pollutants from environmental waters [3034]),
formats31(e.g.32use33of34magnetic nanoparticles as the mineral oxide [35,36]),
adsorption mode (e.g. chemisorption [37]) and molecules (e.g. some ionic
liquids with surfactant properties [38]). Also, theoretical studies intended for
understanding the mechanisms of interaction governing the SPE process were
performed [39]. However, the potential of these sorbents for stabilizing
[28] M.L. Carreto, S. Rubio, D. Prez-Bendito, Analyst 121 (1996) R33
[29] S. Rubio, D. Prez-Bendito, TrAC Trends Anal. Chem. 22 (2003) 470.
[30] F. Merino, S. Rubio, D. Prez-Bendito, Anal. Chem. 75 (2003) 6799.
[31] F. Merino, S. Rubio, D. Prez-Bendito, Anal. Chem. 76 (2004) 3878.
[32] S. Gangula, S.Y. Suen, E.D. Conte, Microchem. J. 95 (2010) 2.
[33] T. Saitoh, S. Matsushima, M. Hiraide, J. Chromatogr. A, 972 (2002) 205.
[34] M. Cantero, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1067 (2005) 161.
[35] J. Li, X. Zhao, Y. Shi, Y. Cai, S. Mou, G. Jiang, J. Chromatogr. A 1180 (2008) 24.
[36] L. Sun, L. Chen, X. Sun, X. Du, Y. Yue, D. He, H. Xu, Q. Zeng, H. Wang, L. Ding,
Chemosphere, 77 (2010) 1306.
[37] A. Ballesteros-Gmez, S. Rubio, Anal. Chem. 81 (2009) 9012.
[38] Q.L. Zhang, F. Yang, F. Tang, K. Zeng, K.K. Wu, Q.Y. Cai, S.Z. Yao, Analyst 135
(2010) 2426.
[39] A. Garca-Prieto, L. Lunar, S. Rubio, D. Prez-Bendito, Anal. Bioanal. Chem. 388
(2007) 1823.

- 106 -

Captulo2
adsorbed solutes, thus reducing effort and cost in environmental campaigns,
hasbeenhardlyexplored[40].

In this work, we assessed the capability of mixed sodium dodecyl


sulphate (SDS)tetrabutylammonium (TBA) admicellebased SPE to preserve
pesticides after their extraction/concentration from natural environmental
waters.Pesticidesknownbytheirinstabilityandbelongingtodifferentfamilies
and properties were selected for this purpose (Table 1). Preservation under
different operation conditions was investigated. Main results are discussed
below.

Table 1. Molecular structures, octanol-water partition coefficients (Ko/w) and


ionization contants (pKa) of the pesticides investigated.
Pesticidegroup

Compound

Bases/neutrals

Structure

Log
Ko/wa

pKaa

2.6

2.3

2.3

2.7

1.7

12.3;1.5

3.6

13.1;0.6

2.4

14.4;0.1

2.9

15.1;0.8

3.4

13.6;0.9

3.0

1.4

Cl

Atrazine
Triazines

N
CH3 CH2 NH

CH3

NH CH

CH3

Cl

Simazine

N
CH3 CH2 NH

NH CH2 CH3

N
O

Carbofuran

CH3 NH C O

Carbamates

CH3
CH3

Cl

Chlortoluron

CH3

O
CH3 N C NH

CH3

Phenylureas

Isoproturon

CH3
H N C O CH
Cl
CH3

Chlorpropham

CH

O
CH3 N C NH

CH3
CH3

CH3
O

Anilides

NH C CH2 CH3

Propanil
Cl
Cl

Chloroacetanilides

Metolachlor

CH3

Cl CH2 C N CH CH2 O CH3


CH3
CH2 CH3

[40] N. Luque, F. Merino, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1094 (2005) 17.

- 107 -

ParteI
O

Alachlor

Cl CH2 C N C CH2 Cl
CH2 CH3
CH3 CH2

3.1

1.2

4.5

2.4

3.0

Cl

Organophosphorus

Chlorfenvinphos

Acids

CH
O

O CH2 CH3

CH2 CH3

Cl

Cl

H O
O CH C OH

2,4D

Cl
Cl

Phenoxyacids

CH3 O

O CH C OH

Mecoprop

2.6
3.2

a
Octanolwater partition constants and ionization constant were obtained from
ScifinderScholar.
CH3

Cl

2.Experimental

2.1.Chemicalsandmaterials

All chemicals were of analytical reagent grade. Standards of pesticides


were supplied by RiedeldeHaen (Seelze, Germany): alachlor, atrazine,
simazine,

carbofuran,

chlorfenvinphos,

chlorpropham,

chlortoluron,

isoproturon, mecoprop, metolachlor and propanil, and Aldrich (Steinheim,


Germany):2,4D.Stockstandardsolutionsforeachpesticidewerepreparedin
methanolat2gL1,exceptsimazineat0.5gL1andstoredinglassvialsat4Cin
darkness. The stock solutions were stable for at least 3 months. Hydrochloric
acid,isopropanol,HPLCgrademethanol,acetonitrile,tetrahydrofuran(THF)and
phosphoricacidwereobtainedfromPanreac(Sevilla,Spain).Ultrahighquality
waterwasobtainedfromaMilliQwaterpurificationsystem(Millipore,Madrid,
Spain). Tetrabutylammonium chloride (TBA) was provided by Fluka (Buchs,
Switzerland); sodium dodecyl sulphate (SDS) by Aldrich and sodium hydroxide
(NaOH) by Merck (Darmstadt, Germany). An aqueous solution of TBA was
preparedat 0.01M.BondElut JrALAcartridge columnsfilledwith500mgof
alumina were obtained from Varian (Victoria, Australia). Acetylcellulose
membranefilters0.45mHAweresuppliedbyMillipore(Bedford,MA,USA).

- 108 -

Captulo2
2.2.Samplecollectionandpreparation

Extractionandstabilitystudieswerecarriedoutusingdifferenttypesof
waters (distilled, river and underground). River samples were taken from the
Rabanales stream in Crdoba (South of Spain) and underground waters were
drawnfromtwowellsalsolocatedinCrdoba.Allthesampleswerecollectedin
amber glass containers and filtered through 0.45 m acetylcellulose filters in
order to remove suspended solids. Calcium in the samples was removed by
precipitationwithSDS[Ca(DS)2,Ksp=2.14x10 10].Forthispurpose,increasing
volumes (at increments of 0.1 mL) of a 0.1 M SDS solution was added to the
sampleuntilthestartofturbidity.Then,thecalciumcontentinthesamplewas
calculated from the minimum SDS concentration needed for precipitation and
thecorrespondingvolumeof0.1MSDSsolutionrequiredtoreacha[SDS]/[Ca+2]
molar ratio of 2 was added. The precipitate formed was separated from the
samplebycentrifugationat3000rpmfor10min.SampleswereacidifiedatpH2
withhydrochloricacidandstoredat4Cindarkuntiltheiruse.

2.3.ExtractionandpreservationofpesticidesonTBASDSadmicellebasedSPE
cartridges

Solid phase extraction was performed using a Supelco Visiprep


(Belefonte,PE,USA)vacuummanifoldattachedtoaRikakikaiEyelaA35(Tokyo,
Japan) vacuum pump. The vacuum pressure was set at 15 kPa. Alumina
cartridges were conditioned with 10 mL of 0.01 M hydrochloric acid. Then,
hemimicelles were formed on the alumina by passing a 25 mL solution
containing 40 mg of SDS at pH 2 and finally 250 mL of the pretreated water,
containing 30 g of TBA, were loaded on the cartridges at a rate in the range
0.60.8mLmin1.Thesorbentwasdriedundervacuumuntilnodrippingdrops
wereobserved(around5minutes).Inpreservationstudies,thecartridgeswere
stored under different experimental conditions (e.g. natural illumination,
darkness, several temperatures, etc) before analysis. Elution of pesticides was
performedintwosteps.Firstly,basicandneutralpesticideswereelutedwith1
mL of THF and then, acid pesticides were eluted with 2 mL of 0.3 M

- 109 -

ParteI
NaOH:methanol (90:10 v/v) solution. Aliquots of each eluate (20 L) were
analyzedbyliquidchromatographyphotodiodearraydetection(PAD).
2.4.Pesticidesdetermination

The chromatographic system used (LCPAD UV, Water, Milford,


Massachusetts)consistedofa1525binarypump,a717autosampleranda996
photodiodearraydetector.Thestationaryphasecolumnwasa25cmKromasil
C8 with 4 mm internal diameter and 5 m particle diameter (Anlisis Vnicos,
Tomelloso, Spain). The mobile phase used for the separation of basic/neutral
pesticides consisted of water (A) and acetonitrile (B) at 0.9 mL min1. The
gradient profile during separation was: isocratic conditions (90%A10%B) for 1
minandthensuccessivelineargradientsinwhichBwasincrementedasfollows;
15min,from10to25%;511min,from25to36.5%;1130min,from36.5to
37.5%; 3035 min, from 37.5 to 43%; 3550 min, from 43 to 60%; 5055 min,
from60to70%.Fortheseparationofacidpesticides,watercontaining0.015%
ofphosphoricacid(A)andacetonitrile(B)wasemployedataflowrateof0.9mL
min1.Thegradientusedwas:isocraticconditions(90%A10%B)for1min:linear
gradientfrom10%Bto45%Bfor6minandisocraticconditions(55%A45%B)for
18 min. Detection and quantitation of simazine, atrazine, metolachlor and
alachlor was performed at 225 nm, 2,4D and mecoprop at 229 nm,
chlorprophamat239nm,chlortoluron,isoproturonandchlorfenvinphosat245
nm, propanil at 252 nm and carbofuran at 280 nm. External calibration of
standardsinmethanolwasusedforquantitativedetermination.
3.Resultsanddiscussion

3.1.Sorbentdescriptionandselectionofoptimalextractionconditions

Dodecyl sulphate adsorbs onto alumina at pH below the point of zero


charge (pzc = 8.5) of the mineral oxide. At pH 2 the alumina reaches the
maximal positive charge density onto its surface as OH2+, that permitting the
adsorption of great amounts of the surfactant. A picture of the adsorption
isotherm of pure SDS onto alumina and the different types of surfactant

- 110 -

Captulo2
aggregates formed according to the amount of SDS adsorbed is depicted in
Figure1A.

(B)

mixedSDSTBAadmicelles
TBA
SDShemimicelles

mgSDSadsorbed/galumina

(A)

CHC
1000

CMC

Hemimicellarregion Hemimicellar/
Admicellar
region

Admicellar
region

100

10

0.1

10

100

1000

10000

[SDS]aqueous(mg/L)

Figure1. (A) Adsorption isotherm of SDS onto alumina and structure of the
different sorbents produced as a function of the amount of surfactant. (B)
Schematic of the formation of SDS-TBA mixed admicelles from SDS
hemimicelles at the hemimicellar critical concentration (CHC).

- 111 -

ParteI
All these sorbents offer mixedmode mechanisms for solubilisation of
solutes, namely dispersion interactions in the hydrocarbon chain and ionic
interactions in the polar group or the uncovered alumina. Hemimicelles,
althoughpredominantlyhydrophobic,alwayscontainpatchesofadmicelles.

Mostofthepesticidesunderstudy(Table1)wereneutralsatpH2,so
the major interactions expected to drive adsolubilization into the pure SDS
surfactant aggregates were hydrophobic. Having into account that all of them
havearomaticringsintheirstructure,mixedadmicellescontainingammonium
groups were expected to increase extraction yields because of their ability to
establish cation interactions with pesticides. Based on these considerations,
thecapabilitytoextractpesticidesofsorbentsmadeupof80mgSDS/galumina
(i.e.hemimicellesatthecriticalhemimicellarconcentration,CHC,Figure1A)and
different amounts of tetrabutylammonium, was assessed. A likely structure of
these sorbents is depicted in Figure 1B; first, all the alumina surface was
covered by SDS and then mixed SDSTBA admicelles were formed under
addition of the ammonium quaternary salt. This figure, although some
hypothetical,expressesthemaininteractionsexpectedtoberesponsibleofthe
retentionofpesticidesonthesorbent.

Experimentstoassessadsolubilizationwerecarriedoutbypassinga25
mLaqueoussolutioncontaining10gL1ofeachpesticideatpH2throughthe
different sorbents. Table 2 shows the results obtained. Quantitative retention
was achieved for most of the pesticides on pure SDS hemimicelles, however,
phenylureas required the presence of TBA to be quantitatively extracted.
Carbofuran was only partially retained in all the sorbents investigated.
According to these results, the sorbent selected for preservation studies was
madeof80mgofSDSand6x102mgofTBA/galumina.

Breakthroughvolumesweredeterminedbypassingincreasingvolumes
(25500mL)ofhydrochloricacidaqueoussolutions(102M),containing100ng
ofeachofthepesticides,throughthemixedSDSTBAsorbent,anddetermining
the concentration of each analyte in the eluates. The flow rate for sample

- 112 -

Captulo2
percolationwasbelow1mLmin1.Breakthroughwasconsideredtooccurwhen
the recovery decreased about 5%. Quantitative retention on the sorbent was
observed for triazines, anilides, chloroacetanilides, organophosphorus,
phenoxyacidsandchlorprophamatthemaximalpercolatedsamplevolume(500
mL).Breakthroughproblemswereonlydetectedforcarbofuran(e.g.recoveryof
221%using250mLofsample)andphenylureas(e.g.recoveriesof341%for
chlortoluronand513%forisoproturonusing100mLofsample).

Table2. Percentage of adsolubilization (amean value standard deviation) of


bpesticides

on cSDS-TBA admicelles as a function of TBA concentration.

mgTBA/galumina

Bases/Neutral

6x103
Triazines

Atrazine
972
991
Simazine
1001
983
Carbamates

Carbofuran
302
452
Chlorpropham
981
971
Phenylureas

Chlortoluron
601
801
Isoproturon
703
861
Anilides

Propanil
931
992
Chloroacetanilides

Metolachlor
982
971
Alachlor
1001
1002
Organophosphorus

Chlorfenvinphos
992
1001
Acids

Phenoxyacids

2,4D
991
1002
Mecoprop
981
1011
a
n=3
b
25mLofdistilledwater(10gL1eachpesticide)
c
SDS(80mg/galumina)

- 113 -

0.06

981
1042

503
992

861
982

971

1002
1034

983

1012
1031

0.6

991
1001

401
1002

781
871

993

971
1002

994

991
1011

ParteI
Several organic solvents (methanol, isopropanol and tetrahydrofuran)
weretestedaseluentsfordesorptionofpesticides.Basicandneutralpesticides
werequantitativelyelutedin1mLofTHFand2mLofmethanolorisopropanol
while the elution of acid pesticides was negligible in all these solvents. The
stronger solvent (THF, 1 mL) was chosen as eluent of basic and neutral
pesticides.Quantitativeelutionofmecopropand2,4Dwasachievedusing2mL
of0.3MNaOHmethanol(90:10v/v).Undertheseexperimentalconditions,the
chargeofthealuminasurfacechangedfrompositivetonegativewhichcaused
disruption of the TBASDS aggregates. The presence of methanol in the eluent
solution was mandatory to effectively desorb acidic pesticides. Methanol
extracts contained high concentrations of TBA and SDS monomers but their
prompt elution from the chromatographic column prevented them from
interfering in the chromatographic determination of pesticides; both retention
time or peak areas were identical to those obtained from standards in the
absence of TBA and SDS.The flow rate required for quantitative desorption of
pesticidesundertheoptimalestablishedconditionsshouldbebelow2mLmin1,
otherwisetherecoveriesdecreased.

Calcium in the samples caused precipitation of SDS in the admicellar


sorbentandconsequently,blockingofthecartridgeduringsamplepercolation.
PrecipitationofcalciumwithSDS[Ca(DS)2]isawellknownphenomenonandit
has been widely reported in the literature [41]. Calcium was removed in the
sample before SPE by adding SDS at stoichiometric amounts according to the
procedure detailed in section 2.2. Because of the very low solubility of this
precipitate[Ksp=2.14x1010],residualSDSdidnotaffectadmicelleformation
or extraction efficiency. The effect of matrix components on recoveries was
assessedbycomparisonoftheresultsobtainedfrom250mLofspiked(0.2gL
1

)distilled,riverandgroundwater(Table3).

[41] A. Zapf, R. Beck, G. Platz, H. Hoffmann, Adv. Colloid Interface Sci. 100 102
(2003) 349.

- 114 -

Captulo2
Table 3. aMean recoveries (%) and standard deviation of pesticides from 250
mL spiked (0.2 g L-1) distilled and natural waters using mixed TBA-SDS
admicellar-based SPE.

Compound
Atrazine
Simazine
Carbofuran
Chlorpropham
Chlortoluron
Isoproturon
Propanil
Metolachlor
Alachlor
Chlorfenvinphos
2,4D
Mecoprop
a
n=3.

Distilled
991
1022
221
1062
242
383
1035
1041
981
985
993
981

WaterSample
River
Underground
974
1034
983
1014
243
201
984
1013
211
262
392
404
964
993
986
962
1023
991
1007
1003
1044
971
1024
973

It was checked from previous analysis that natural waters were free
from target compounds. Recoveries for fortified river and groundwater were
similar to those found for distilled water, that indicating that no adsorption of
the pesticides on the Ca(DS)2 precipitate occurred and matrix components did
notaffecttheextractioncapabilityofTBASDSadmicelles.

3.2.Analyticalperformance

Liquid chromatography/UV detection was used for the determination


andcontrolofthestabilityofpesticidesinTBASDS.Table4showsthefiguresof
meritobtainedforcalibrationcurvesrunusingstandardsolutionsofbasicand
neutral pesticides and acid pesticides in methanol. Correlation between peak
areasandpesticideconcentrationswasdeterminedbylinearregressionandthe
coefficientsofdeterminationwereintherange0.99910.9999,indicatinggood
fits. Instrumental detection (LODs) and quantitation (LOQs) limits were
calculatedfromthelowerconcentrationsofstandardsgivingasignaltonoiseof
3and10,respectively.MethodLODsandLOQswereobtainedfromthe
- 115 -

- 116 -

153000
203000
103000
22000
22000

Metolachlor

Alachlor

Chlorfenvinphos

2,4D

Mecoprop
0.030.13

0.20.2

0.030.1

0.20.1

0.070.10

0.30.2

0.30.3

0.0080.058
0.20.2
0.040.2

0.060.59

1.90.2

5.560.09

4.90.1

3.10.07

5.090.05

6.40.1

11.70.2

12.30.3

1.810.05
10.20.2
11.80.2

27.30.2

30.20.1

Slopesa
(x104)

0.9999

0.9992

0.9997

0.9999

0.9998

0.9998

0.9994

0.9991
0.9995
0.9995

0.9995

0.9999

13

26

19

60
6
13

10

40

80

60

20

30

180
18
40

10

Method
Method
detection quantitation
limitsb(ngL1) limitsb(ngL1)
c

100

300

300

600

1000

AAEQS
(ngL1)

Standarddeviation.
Calculatedfrominstrumentaldetectionandquantitationlimits,recoveriesandconcentrationfactorsusing250mLofwater
samples.
c
Annualaverageenvironmentalqualitystandards[6].

52000

Propanil

103000
52000
2.52000

Carbofuran
Chlorpropham
Chlortoluron
22000

22000

Atrazine

Isoproturon

2.52000

Simazine

Analytes

Linearrangefor
Interceptsa
instrumental
(x104)
calibration(gL1)

Table4. Analytical figures of merit of the proposed method.

ParteI

Captulo2

245nm

0.0012

0.0008

AU

3
1

0.0004

5
2

0.0000

7
6

10
89

-0.0004

225nm

0.0003

AU

0.0002

0.0001

23 5

0.0000

89

10

-0.0001
5.00

10.00 15.00 20.00

25.00 30.00
Minutes

35.00

40.00 45.00

50.00

55.00

225mn

0.00020

AU

0.00015

0.00010

11

12

0.00005

0.0000
2.00

4.00

6.00

8.00 10.00 12.00 14.00 16.00 18.00 20.00 22.00 24.00


Minutes

Figure 2. Chromatograms obtained from a river water sample fortified with


0.2 g L-1 of each pesticide. Peak identification: (1) simazine, (2) carbofuran,
(3) chlortoluron, (4) atrazine, (5) isoproturon, (6) propanil, (7) chlorpropham,
(8) metolachlor, (9) alachlor, (10) chlorfenvinfos, (11) 2,4-D and (12)
mecoprop.

- 117 -

ParteI
respective instrumental limits taking into account the recoveries and
concentrationfactorsfromtheextractionof250mLofsampleandelutionwith
1 mL (neutral/basic pesticides) or 2 mL (acid pesticides) of solvent. Method
LOQsforpesticidesregulatedintheDirective2008/105/EC[6]werelowerthan
theenvironmentalqualitystandardsestablished.

The precision of the method was evaluated by extracting 11


independent fortified (0.2 g L1) river and underground water samples. The
values, expressed as relative standard deviation (RSD), were between 1 % and
6%foralltheanalytes.

Figure2depictsthechromatogramsobtainedfromaspiked(0.2gL1)
river water sample. No interferences were detected for any of the target
pesticidesundertherecommendedoperationconditions(seesection2.4).

3.3. Stability studies of pesticides on mixed SDSTBA admicellebased SPE


cartridges

Figure3showsthegeneralprocedurefollowedtostudythecapabilityof
SDSTBA cartridges to stabilize pesticides under a variety of experimental
conditions.Cartridgeswerestoredforthreemonthsatthreetemperatures(i.e.
room,4Cand20C)andtheinfluenceofdarknessandnaturalilluminationwas
evaluated. The effect of matrix components, wellknown to affect pesticide
stability,wasinvestigatedusingriverandundergroundwater.Inordertoavoid
hydrolysis of the pesticides in the residual water remaining in the cartridges
after sample percolation, they were subjected to desiccation using a vacuum
pumpfor35minutes.

Table 5 shows the results obtained for cartridges stored into


transparentandopaquebagsatroomtemperatureforthreemonths.Photolysis
clearly caused degradation of triazines and chlorfenvinphos after storage for
two weeks. The results obtained for the rest of pesticides under darkness and
natural light were similar. So, the use of opaque bags is recommended as

- 118 -

Captulo2
admicellarcartridgesarestoredmorethan1weekbeforeanalysistoavoidthe
degradationofthelightsensitivepesticides.Thestrongstabilisingcapabilityof
surfactantaggregatesallowedthepesticidestokeepunalteredfor1(triazines,
phenylureas,

organophosphorus),

(carbamates,

anilides)

or

(chloroacetanilides, phenoxyacids) months at room temperature under


darkness (Table 5). So, shipping of samples from the site to the lab can be
greatlyfacilitated.

84Cartridgesx25mLofdistilledwaterspikedat1g/L

42cartridgesat
roomtemperature

21cartridges
indarkness

21cartridgesat4C

21cartridgesat20C

21cartridgesin
naturalillumination

30Cartridgesx250mLofnaturalwaterspikedat0.2g/L
15riverwatersamples

15undergroundwatersamples

15cartridgesat4C

15cartridgesat4C

Figure 3. Experimental conditions for cartridges storage in the study of


stabilization of pesticides in SDS-TBA admicellar sorbents.

The effect of decreasing the temperature (i.e. 4C and 20C) on the


degradation of the more instable pesticides (i.e. triazines, phenylureas,
organophosphorus,carbamatesandanilides)wasassessedforthreemonths.

- 119 -

2nd

3rd

4th

8th

Storagetime(weeks)
12th

- 120 -

1007 1075 977 1076 1021 8411 784 1054 994 1037 1082 888 793

Isoproturon

1005 971 1073 1125 1123 1048 1005 1003 1055 1081 1064 1081 984

Chloro Metolachlor
acetanilidesAlachlor

1007 882
1008 803

n=3;bNormalizedextractionrates.

Phenoxy 2,4D
acids Mecoprop

Organophos
Chlorfenvinphos 1003 931
phorus

988 6810 3610 344 112 62

954 886 1043 914 993 965 923 914 1024 972 922
903 974 951 1013 923 976 911 1003 972 984 923

933 1015 923 72

1005 1061 965 1097 1065 1105 951 1013 995 1112 1022 1127 982

1004 1033 956 1092 1061 988 872 1014 954 1025 1032 964 902

Anilides Propanil

Phenylureas

1008 1087 926 1007 971 8310 702 1068 944 979 1014 878 733

1002 1001 994 1074 955 1094 928 1014 1014 1102 1161 1096 967

936 592 312 221 81 21

Chlortoluron

Carbamates Chlorpropham

31

984 702 431 352 101 61

12

st

10010 112111061010210 1064 964 808 1066 1044 7810 882 804 844

th

Carbofuran

th

1004 1002 885 944 946 81

th

974 954 896 121 51

rd

Atrazine

nd

Storagetime(weeks)

Naturallight

1003 993

st

Darkness

Storageconditions

Simazine

Pesticide

Triazines

Structural
group

Table 5. Meana recoveriesb (%) and standard deviation of pesticides from 25 mL spiked (1 g L-1) distilled water after storage
on mixed TBA-SDS admicellar-based SPE cartridges at room temperature under natural light and darkness conditions for 3
months.

ParteI

Captulo2
Table6showstheresults obtained. Refrigerationcompletelystabilized
mostofthetargetcompoundsandgreatlyincreasedthestabilityofatrazineand
clorfenvinphoscomparedtoroomtemperature.Completestabilizationofthese
pesticidesforthreemonthswasachievedbystoringthecartridgesat20C.

Table6. Meana recoveriesb (%) and standard deviation for pesticides from 25 mL
spiked (1 g L-1) distilled water after storage on mixed TBA-SDS admicellarbased SPE cartridges at different temperatures.

Structural

4C

20C

group

Pesticide

Storagetime(weeks)

Storagetime(weeks)

th

th

12

th

th

12

Simazine

1003

1023

975

973

1091

1024

1003

Atrazine

1004

1043

743

674

1042

1073

1054

Carbamates

Carbofuran

10010

1028

1022

1106

986

1006

1044

Chlorpropham

1002

1075

1057

984

1111

1084

948

Phenylureas

Chlortoluron

1008

1031

1011

1056

1008

1085

975

Isoproturon

1007

1154

1001

1031

1082

1014

1077

Propanil

1004

1061

1091

1031

1031

1004

994

Chlorfenvinphos

1003

1024

832

805

1052

1041

1004

Triazines

Anilides
Organophosphorus
a

Storageconditions

th

th

n=3.
Normalizedextractionrates.

The presence of matrix components on the stability of pesticides was

investigated by extracting river and underground water and storing the


cartridges at 4C (Figure 3). Table 7 shows the results obtained. Similarly to
those found for distilled water (see Table 6) only atrazine and clorfenvinphos
showedsomedegradationunderrefrigerationconditions,whichindicatedthat
the possible matrix components adsorbed in the cartridges did not affect
pesticidestability.

Comparisonofthestabilityofthetargetpesticidesindifferentsorbent
materialsisshowninTable8.Dataforchlorpyrifoswerealsoincludedbecause
few studies have been previously reported for the structurally analogous
chlorfenvinphos,theselectedpesticideinthisstudy.Comparisonfromthedata

- 121 -

ParteI
in Table 8 becomes a bit difficult because different periods of time were
investigatedinthedifferentreportedstudies.However,onthewhole,SDSTBA
admicelles were clearly superior to C18 or black carbon sorbents in terms of
stabilization at any temperature while they were similar to that in polymeric
materials, the last one with the disadvantage of the need of higher solvent
volume for their elution [23,24]. The ability of micelles and other surfactant
aggregates to stabilize compounds has been widely used in kinetic and
equilibrium analytical methods, as it was stated in the Introduction. Although
there is not a general mechanism to account for this stabilization, the
microenvironments in the aggregates are expected to protect analytes from
externalconditionswhichcausetheirdegradation.

Table 7. Meana recoveriesb (%) of pesticides from 250 mL of spiked (0.2 g L-1)
natural water after storage on mixed TBA-SDS admicelles-based SPE cartridges at
4C for 3 months.
Riverwater

Structural
Group

Pesticide

Undergroundwater

Storagetime(months)
1

st

nd

Simazine
Atrazine
Carbofuran
Chlorpropham
Chlortoluron
Isoproturon

1004
1003
1005
1002
1003
1004

1051
994
1071
994
1005
982

982
776
963
1013
905
1024

936
634
1005
976
973
1016

Anilides

Propanil

1008

999

1017

9810

1007

9310

935

1057

Chloro
acetanilides
Organo
phosphorus

Metolachlor
Alachlor
Chlorfenvin
phos
2,4D
Mecoprop

1007
1004

982
995

968
1023

1058
977

1008
1003

10410
984

10410
1019

1005
962

1008

1038

851

782

1003

994

868

806

1004
1005

986
1036

915
1002

1059
984

1009
1006

959
987

1024
994

1059
1015

Triazines
Carbamates
Phenylureas

Phenoxyacid
a

n=3.
b
Normalizedextractionrates.

- 122 -

rd

st

nd

rd

1004
1006
1006
1002
1005
1006

916
1025
932
984
1003
976

971
804
1016
994
1008
1015

1019
605
1044
996
1103
986

- 123 -

Alachlor
Propanil

Metolachlor

Isoproturon

Chlortoluron

Chlorpropham

Carbofuran

Atrazine

Simazine

<1w[9]
*7w[12]

<1w[18] *3m[9]
*10d[10]

*10d[10]

*2w[43] <1m[13]

*1w[7] *1w[7]

<1m[42]

*1w[7] *1w[7]

*1w[7] *10d[10]
<1m[42]
<1w[18] *7w[12]

*3m[9]
*7w[12]

*1m[18] *1y[13]

*3m[8]

1w[18] *3m[9]
1m[42]

<3d[44]

*3m[9]
2m[42] 1w[18] *1y[13]
*7w[12]

*3m

*3m

1m

*3m

*3m

*3m

1m

*3m

Black Polymeric SDSTBA


carbon
admicelles

*3m
*3m[9]
*2m[18]
[42]
*7w[12]

C18

4C

*Maximumtimeinvestigated Datanotshowninthemanuscripty:year;m:months;w:weeks;d:days

Mecoprop

*3m

1m

2m

*3m

1m

2m

1m

Black Polymeric SDSTBA


carbon
admicelles

*3m[9]
*3m[42] 1m[18] *10d[10]
*7w[12]

C18

Roomtemperature

Chlorfenvinphos 2w[8]
<1w[7]
*1w[7] *10d[10]
Chlorpyrifos
2w[8]
*1w[7] *1w[7] 1w[19]
2,4D

C18

*2m
[18]

*1y[13]

*3w[7]

3m[44] *3w[7]

*8m[8] *3w[7]

2m[42]

1m[42] 1m[18] *3m[9]

<3d[44] *3w[7] *3m[5]

*3m[9]
*1y[13]

*3m[9]

*3m

*3m

*3m

*3m

*3m

*3m

*3m

Black Polymeric SDSTBA


carbon
admicelles

20C

*3m[42] 1m[18]

*3m[42]

Table8. Comparison of the stability of the target pesticides in different sorbent materials.

Captulo2

ParteI
4.Conclusions

A sorbent made up of admicelles of SDS and TBA has been proved to


extract and stabilize pesticides belonging to different structural groups from
riverandundergroundwaters.Themajorbenefitsofthissorbentcomparedto
other previously reported SPEsorbents are: (a) the variety of interactions it
offers(e.g.dispersion,ionic,hydrogenbonding),whichmakesitsuitableforthe
extraction of pesticides in a wide polarity range; (b) its multiligand capacity,
which increases extraction efficiency (recoveries for the more polar pesticides
were similar to those obtained with highly crosslinked polymeric resins and
muchbetterthanalkyl(C8andC18)bondedsilicas);(c)theeasydisruptionof
admicelles in the presence of organic solvents or by pH modification, which
allowsthedesorptionofanalytesusingalowvolumeofeluent.Inthisway,low
detection limits (260 ng L1 for the target pesticides) are obtained without
evaporationoftheextracts,analysesarespeededupandvolatilizationofsome
pesticidesisavoided.Onthecontrary,styrenedivinylbenzenepolymersrequire
high solvent volumes to quantitatively desorb pesticides and irreversible
adsorptions occur on carbon materials [23,24]; (d) High capability to stabilize
pesticides,thisbeingclearlysuperiortoC18orblackcarbonsorbentsandsimilar
topolymericmaterials.

Acknowledgements

The authors gratefully acknowledge financial support from Spanish MICINN


(Project CTQ201123849), the Andalusian Government (Junta de
Andaluca, Spain, Project P09FQM5151) and FEDER. Noelia Luque is also
gratefultoSpainsMECforawardofdoctoralfellowships(GrantsAP20043644).

[42] E. Martnez, D. Barcel, Chromatographia 42 (1996) 72.


[43] A. Di Corcia, M. Marchetti, J. Chromatogr. 541 (1991) 365.
[44] W.G. Johnson, T.L. Lavy, S.A. Senseman, J. Environ. Qual. 23 (1993) 1027.

- 124 -

Captulo3
CAPTULO3:Useofcoacervatesfortheonsiteextraction/preservationofpolycyclicaromatichydrocarbonsandbenzalkoniumsurfactants

CAPTULO3

Useofcoacervatesfortheonsite
extraction/preservationofpolycyclicaromatic
hydrocarbonsandbenzalkoniumsurfactants

AnalyticaChimicaActa,584(2007)181188.
NoeliaLuque,SoledadRubio,DoloresPrezBendito

Abstract

The suitability of coacervates for the preservation of organic pollutants after


their extraction from water samples was investigated for the first time. Acid
induced sodium dodecanesulfonic acid (SDSA) micellebased coacervates were
selectedforthispurpose.Theircapacitytopreservebenzalkoniumhomologue
(C12, C14 and C16) surfactants (BASs) and different polycyclic aromatic
hydrocarbons (PAHs) [benzo(a)pyrene (BaP), benzo(b)fluoranthene (BbF),
benzo(k)fluoranthene (BkF), benzo(ghi)perylene (BghiP), benzo(a)anthracene
(BaA) and indene(1,2,3cd)pyrene (IP)] was investigated. BASs and PAHs were
efficiently extracted by the coacervate by formation of mixed aggregates and
hydrophobic interactions, respectively. Their stability into the coacervate was
investigated under three temperature conditions (room temperature, 4C and
20C)andtwohydrochloricacidconcentrations(3.75Mand4.2M),whichwas
usedtoinducecoacervation.Nolosseswereobservedduringatleast3months
at the different experimental conditions tested. The increase of the
temperature up to 35C for a month did not affect the stability of the target
compounds.Noinfluenceofthewatermatrix(distilled,riverorwastewater)on
thestabilizationofBASsandPAHswasobserved.Thehighstabilizingcapacityof
the coacervate for the target compounds and its low volume make easy the
transportandstorageofanalytes.

- 125 -

ParteI
Keywords: Polycyclic aromatic hydrocarbons; Benzalkonium surfactants;
Preservation;Micellebasedcoacervates;Monitoringprograms.

1.Introduction

European directives and the transpositions in the different countries


bind the member states to establish vigilance and control of pollution in the
aquatic environment to ensure that water quality standards are met. So,
samplingandanalysisofprioritypollutantsisperiodicallycarriedout.Owingto
the low concentrations they are found, the collection of highvolume water
samples is usually required to reach suitable detection limits after an
appropriatepreconcentrationstep.Asaresult,thereductionofeffortandcost
for transport and preservation of such highvolume samples has become an
importanttopicinenvironmentalmonitoringprograms.

Solid phase extraction (SPE) using a variety of sorbents has been


proposedinthelastfewyearsforthepreservationofpollutants[18].234Theuse
of 56 this 7 strategy 8 generally avoids the necessity of using large refrigerated
transportunitsandbecauseofthestabilizingeffectofsorbents,itpermitslong
holdingtimesbeforepollutantdetermination.Inaddition,SPEpermitstheon
site simultaneous extraction/preconcentration of the target compounds, so it
hasbecomeavaluabletoolformonitoringprograms.

Coacervates made of supramolecular assemblies are being increasingly


used for the liquidliquid extraction of organic polutants [9]. They are water
[1] W.G. Johnson, T.L. Lavy, J.A. Senseman, J. Environ. Qual. 23 (1994) 1027.
[2] M. Castillo, D. Puig, D. Barcel, J. Chromatogr. A 778 (1997) 301.
[3] I. Ferrer, D. Barcel, J. Chromatogr. A 778 (1997) 161.
[4] I. Lika, K. Blikov, J. Chromatogr. A 795 (1998) 61.
[5] M. Petrovic, D. Barcel, Fresnius J. Anal. Chem. 368 (2000) 676.
[6] M.C. Alonso, D. Barcel, Analyst 127 (2002) 472.
[7] E. Turiel, A. Martn-Esteban, G. Bordin, A.R. Rodrguez, Anal. Bioanal. Chem. 380
(2004) 123.
[8] N. Luque, F. Merino, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1094 (2005) 17.
[9] S. Rubio, D. Prez-Bendito, Trends Anal. Chem. 22 (2003) 470.

- 126 -

Captulo3
immiscible liquid phases produced in colloidal solutions by the action of a
dehydrating agent (e.g. changes in the temperature or pH of the solution,
addition of an electrolyte or addition of a water miscible solvent in which the
macromolecule has low solubility) [10]. The coacervates are very rich in the
colloid component and have the capacity to solubilize solutes, so they are
suitabletodeveloporganicsolventfreeextractionprocedures.

Applicationofthecoacervationphenomenontoanalyticalprocesseshas
invariablyinvolvedtheuseofaqueousmicellebasedcoacervates(i.e.nonionic
[1113], zwitterionic [14], cationic [15] and anionic [16]). The most used
1213

coacervateshavebeenmadeofnonionicmicelles,whichundergocoacervation
by changes in the temperature of the aqueous solution. The corresponding
methodology has been named cloud point extraction (CPE) and it has been
extensively used for the extraction/concentration of nonpolar and moderately
nonpolar compounds [12,13]. Recently, anionic micelles made up of
dodecanesulfonic acid (SDSA), which undergo coacervation under the addition
ofhydrochloricacidintheconcentrationrangeof2.55M,havebeenprovento
efficiently extract hydrophobic [1618] and amphiphilic [1921], pollutants
17

18

2021

fromenvironmentalwaterandsolidsamples.

Oneofthemostdistinctivefeaturesofsupramolecularassemblybased
[10] IUPAC Compendium of Chemical Terminology 31 (1972) 611.
[11] W.L. Hinze, E. Pramauro, Crit. Rev. Anal. Chem. 24 (1993) 133.
[12] E. Pramauro, E. Pelizzetti, in: S.G. Weber (Ed.), Surfactants in Analytical
Chemistry. Applications of Organized Amphiphilic Media, Elsevier, New York, 1996.
[13] R. Carabias-Martnez, E. Rodrguez-Gonzalo, B. Moreno- Cordero, J.L. PrezPavn, C. Garca- Pinto, E. Ferndez-Laespada, J. Chromatogr. A 902 (2000) 251.
[14] T. Saitoh, W.L. Hinze, Anal. Chem. 63 (1991) 2520.
[15] X. Jin, M. Zhu, E.D. Conte, Anal. Chem. 71 (1999) 514.
[16] I. Casero, D. Sicilia, S. Rubio, D. Prez-Bendito, Anal. Chem. 71 (1999) 4519.
[17] D. Sicilia, S. Rubio, D. Prez-Bendito, N. Maniasso, E.A.G. Zagatto, Anal. Chim.
Acta 392 (1999) 29.
[18] F. Merino, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 962 (2002) 1.
[19] F. Merino, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 998 (2003) 143.
[20] F.J. Ruiz, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1030 (2004) 109.
[21] M. Cantero, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1046 (2004) 147.

- 127 -

ParteI
coacervates is the special structure of the macromolecules making up them.
Micelles have regions of different polarity where analytes of very different
physicalchemical characteristics can be solubilized. A number of interactions
canbeestablishedwithanalytesdependingofthenatureofthepolargroupof
the coacervate (mainly hydrophobic or ionic interactions, formation of mixed
aggregates, hydrogen bonds, etc.). So, they are very versatile extraction
systems. On the other hand, the low volume of the coacervates permits both
theextractionandpreconcentrationofanalytestobesimultaneousperformed.

This research deals, for the first time, with the study of the ability of
coacervates for the preservation of organic compounds. The aim was to
determine

their

applicability

for

the

onsite

extraction/preconcentration/preservation of pollutants in environmental


monitoringprograms.Anionicmicellebasedcoacervates[16]wereusedforthis
purpose.Benzalkoniumsurfactants(BASs)andpolycyclicaromatichydrocarbons
(PAHs)wereselectedasthetargetpollutantsonthebasisofthedifferenttypes
of interactions they establish with the coacervate (formation of mixed
aggregates and hydrophobic interactions, respectively) and the instability
problemstheypresentinenvironmentalwatersamples[2224]. Theirstability
2324

intothecoacervateswasinvestigatedforaperiodof3monthsunderdifferent
experimental conditions. The effect of matrix components on PAHs and BASs
stabilitywasassessedbyusingriverandwastewater.

The main factor influencing the stability of BASs and PAHs in


environmental waters is their adsorption on containers [2224]. Significant
adsorptionofBASs(around90%)onglass,polypropyleneandTefloncontainers
hasbeenreportedforfilteredwatersamplesstoredat4C[23].Ontheother
hand,theextentoftheadsorptionofPAHsoncontainersisdependentonthe
typeofmaterialused;itisquantitativeforpolyethyleneandaround2030%for
[22] M.J. Scott, M.N. Jones, Biochim. Biophys. Acta 1508 (2000) 235.
[23] K. Kummerer, A. Eitel, U. Braun, P. Hubner, F. Daschner, G. Mascart, M. Milandri,
F. Reinthaler, J.Verhoef, J. Chromatogr. A 774 (1997) 281.
[24] L Wolska, M. Rowa-Adkonis, J. Namienik, Anal. Bioanal. Chem. 382 (2005) 1389.

- 128 -

Captulo3
glass [17]. Addition of acetonitrile at concentrations between 25% and 40%
(v/v)hasbeenusedasastrategytopreservebothBASs[25]andPAHs[26,27].
However, this strategy was only successful in preventing losses of the target
compoundsforsomedays.ItalsoproducedadecreaseintherecoveryofBASs
fromSPEcartridges[25].

The solubilizing capacity of aqueous micelles has been exploited as a


valuable strategy to preserve PAHs [17,26,2831] as a prior step to their
29

30

31

extraction and to recover them from humic acids [17,28]. On the other hand,
ourresearchgrouphasrecentlydescribedthepreservationofBASsondodecyl
sulfate hemimicelles adsorbed on alumina [8]. The BASs were stable on these
supramolecularassemblybasedSPEsorbentsatroomtemperatureforatleast
threemonths.So,theknownstabilizingcapacityofsupramolecularassemblies
for BASs and PAHs is exploited here for their simultaneous extraction,
preconcentration and preservation using coacervatebased liquidliquid
extraction.

2.Experimental

2.1.Chemicals

All chemicals were of analytical reagent grade. Analyte standards for


analytes

were

supplied

by

Aldrich

(Milwaukee,

WI,

USA):

benzyldimethyldodecylammoniumbromide(BDDA),benzyldimethyltetradecyl
ammonium bromide (BDTA), benzyldimethylhexadecyl ammonium chloride
[25] I. Ferrer, E.T. Furlong, Environ. Sci. Technol. 35 (2001) 2583.
[26] A. Lpez, E. Blanco, J.I. Garca, A. Sanz-Medel, Anal. Chim. Acta 264 (1992) 241.
[27] R. El Harrak, M. Calull, R.M. Marce, F. Borrull, Int. J. Environ. Anal. Chem. 64
(1996) 47.
[28] C. Garca, J.L. Prez, B. Moreno, Anal. Chem 66 (1994) 874.
[29] V. Pino, J.H. Ayala, A.M. Afonso, V. Gonzlez, J. Chromatogr. A 949 (2002) 291.
[30] W.L. Hinze, H.N. Singh, Z.S. Fu, R.W. Williams, D.J. Kippenber, M.D. Morris, F.S.
Sadek, in: T. Vo-Dinh (Ed.), Chemical Analysis of Polycyclic Aromatic Compounds,
John Wiley & Sons, New York, 1989, p. 151 (Chapter 5).
[31] E.R. Brouwer, A.N.J. Herms, H. Lingeman, U.A.Th. Brinkman, J. Chromatogr. A
669 (1994) 45.

- 129 -

ParteI
(BDHA),

benzo(a)pyrene

(BaP),

benzo(b)fluoranthene

(BbF),

benzo(k)fluoranthene (BbF) and benzo(ghi)perylene (BghiP), and Fluka


(Madrid, Spain): benzo(a)anthracene (BaA), indene(1,2,3cd)pyrene (IP) and
sodium dodecanesulfonic acid. Standard solutions of individual PAHs (100 mg
L1)werepreparedinacetonitrileandamixedsolutionofBASs(1200mgL1of
each homologue) was prepared in methanol. Hydrochloric acid, ammonia,
HPLCgrade methanol and acetonitrile were obtained from Panreac (Madrid,
Spain). Formic acid was purchased from Merck (Darmstadt, Germany). Ultra
highquality water was obtained from a MilliQ water purification system
(Millipore,Madrid,Spain).

2.2.Apparatus

The BASs were separated and quantified by using a liquid


chromatography/electrospray ion trapmass spectrometry system (LC/(ESIIT)
MS) (1100 Series LC/MSD, Agilent Technologies, Waldbronn, Germany),
equipped with an automatic injector. For analysis of PAHs a liquid
chromatographic system (Spectra System SCM 1000, ThermoQuest, San Jose,
CA,USA)consistingofaP2000binarypump,aUV1000absorbancedetector,a
FL3000fluorescencedetectorandaPEEKrheodyne7125NSinjectionvalvewith
a 20 L sample loop was used. The stationary phase column was a 10 cm
KromasilC18 with 4.6 mm i.d. and 5 m particle diameter (Anlisis Vnicos,
Tomelloso, Spain). A centrifuge (Selecta Mixtasel) was employed to accelerate
theseparationofthecoacervatefromthesolution.

2.3.Stabilitystudies

2.3.1.Samplecollectionandpreparation

Stability studies were carried out using different types of samples


(distilledandriverwaterandinfluent/effluentwastewater).Riversampleswere
taken from the Guadalquivir in Crdoba city (Spain). Influent wastewater
sampleswerecollectedfromthreewastewatertreatmentplants(WWTP)inthe

- 130 -

Captulo3
south of Spain: Bailn, Linares and Mengibar. Bailn WWTP receives 60%
industrial effluents (mainly from brickwork, ceramic and olive oil industries)
mixedwith40%domesticwastewater.LinaresWWTPreceivesaboutthesame
levels of domestic and industrial wastewater, and Mengibar WWTP receives
mainlydomesticwastewater.Treatedwastewatersamplesweretakenfromthe
WWTPofBailn.Riverandwastewatersampleswerefilteredthrough0.45m
filters(Millipore,Billerica,MA,USA)toremovesuspendedsolids,acidifiedatpH
2withhydrochloricacidandkeptinamberglasscontainersat4Cuntilspiking.

Distilled water was used to check the stability of BASs and PAHs on
coacervatesfor3monthsatdifferentstorageconditions.Riverandwastewater
(influentsandeffluents)wereusedtoinvestigatematrixeffectsonthestability.
The different influent samples were mixed in order to have a representative
compositionofthewastewater.Oncethesampleswerespikedtoobtainafinal
concentration of 0.19 g L1 of each BASs or PAHs, they were immediately
extracted with the coacervate and stored under a variety of experimental
conditionswhicharedetailinSection2.3.2.

2.3.2.BASandPAHpreservationoncoacervates

To study the influence of different factors on analyte preservation, 25


mLofsampleweremixedinanarrowneck(7mminternaldiameter)centrifuge
tubewithhydrochloricacidandSDSA,inordertoobtainafinalconcentrationof
3.75 M or 4.2 M and 0.25% (w/v), respectively. The mixture was magnetically
stirred for 5 min and then centrifuged at 2200 rpm for 10 min to accelerate
phase separation. The coacervate containing the analytes was at the top. Its
volume was calculated considering a cylindrical form for the neck of the
centrifugetube.Theheightofthecoacervatephaseandtheinternaldiameterof
the tube neck were measured using a digital Vernier caliper. Mean values of
thesevolumeswere495Land430Lforcoacervatesinducedby3.75Mand
4.2 M of HCl, respectively. Then, the coacervate was collected with a
microsyringeandtransferredtoaclipcapvial.Theinfluenceoffourfactorson
the stability of BASs and PAHs in the coacervates was investigated: (a) the

- 131 -

ParteI
concentrationofhydrochloricacidusedtoinducecoacervation(3.75Mand4.2
M),(b)thetemperatureofstorage(35C,roomtemperature,4Cand20C),
(c) the exposition of vials to natural light (noncovered and aluminium foil
wrappedvials)and(d)matrixeffects(usingriverandwastewater).

2.3.3.BASandPAHdetermination

After storage under the different experimental conditions, the


coacervates containing BASs or PAHs were made up to 1 mL with methanol or
acetonitrile, respectively. Coacervates at 4 C and 20 C were gelatinous and
required about 35 min to become liquid. Aliquots of the diluted coacervates
were filtered through 0.45 m nylon membrane filters (Anlisis Vnicos,
Tomelloso, Spain) and 20 L injected into the chromatograph. For the
determinationofBASs,methanoland50mMammoniumformatebuffer(pH3.5)
80:20(v/v)wereusedaseluentsolventfor30minataflowof1mLmin1.The
surfactantanalysiswascarriedoutintheESI(+)mode.Thesetofparameters
used was as follows: capillary voltage, 5.0 kV; capillary exit voltage, 30 V;
skimmer,30V;trapdrive,30;sourcetemperature,350C;dryinggas,10Lmin1;
nebulizer gas, 80 psi; maximal accumulation time, 50 ms. Quantification was
carried out under fullscan conditions by using the extracted molecular ion
chromatogramforeachhomologue(C12atm/z304,C14atm/z332andC16atm/z
360).LinearitywasobtainedforBASsconcentrationsbetween1gL1and100
g L1 with correlation coefficients ranging from 0.9997 to 0.998. For the
determination of PAHs the gradient elution was 035 min from 60:40 (v/v) to
100:0 (v/v) acetonitrile:water at a flowrate of 1 mL min1. Detection was
performed with fluorescence wavelength programming in order to obtain
optimum sensitivity. The excitation/emission wavelengths were set as follows:
286 nm/388 nm at 0 min for BaA, 300 nm/430 nm at 22 min for BbF, BkF and
BaP,and296nm/496nmor290nm/410nmat28mindependingifIPorBghiP
wasdetermined.CorrelationsbetweenpeakareasandPAHconcentrations(0.2
20gL1)weredeterminedbylinearregressionandweretypicallyr=0.9995.A
schemeofthecompleteprocedureusedforstabilitystudiesisdepictedinFig.1.

- 132 -

Captulo3

Figure

1.

Scheme

of

the

different

stops

followed

for

the

preservation/determination of BASs and PAHs using anionic micelle-based


coacervates.

- 133 -

ParteI
3.Resultsanddiscussion

3.1.Analyticalperformance

The separation/quantification of BASs by LC/ion trap MS, after their


extraction from sludge with anionic micellebased coacervates, has been
previously described by our research group [19]. In this work, we investigated
the suitability of these coacervates for BASs extraction from environmental
water samples. Different studies were carried out to determine the best
experimental conditions. The extraction efficiency for the target compounds
wasveryhighinawiderangeofconditions(2.54.5MHCl,2060C,extraction
time 360 min) because of the formation of mixed aggregates between SDSA
and the cationic surfactants. Quantitative recoveries were found for the three
BAShomologuesforSDSAconcentrationsabove0.25%.Theserecoverieswere
independent of the water matrix investigated (distilled, influent/effluent
wastewaterorriver).Nointerferencewasdetectedfromthecomponentsofthe
different matrices using MS. No cleanup steps were required to determine
BASsintheenvironmentalwatersamplesanalysed.Theinstrumentaldetection
limitswerecalculatedfromblankdeterminationsbyusingasignaltonoiseratio
of3.Theywerearound0.2gL1.Theprecisionofthemethodwasevaluatedby
extracting11independentspiked(0.19gL1)distilledandwastewatersamples.
Therelativestandarddeviationwasbetween2%and4%.

The separation/quantitation of PAHs by LC/fluorimetry, after their


extraction from river and underground water using anionic micellebased
coacervateshasbeenpreviouslydescribed[17].Thisglobalprocedure,withthe
modifications specified in Section 2, has been used in this study for the
extraction of PAHs from wastewater. It was checked that recoveries for PAHs
ranged between 84% and 109%, independently of the water matrix
investigated.Theinstrumentaldetectionlimitswerearound0.03gL1andthe
relativestandarddeviationsrangedfromaround3%indistilledwaterto7%in
wastewater.

- 134 -

Captulo3
3.2.StabilityofBASsandPAHsintoSDSAcoacervates

ThefollowingcompoundswereselectedasrepresentativeofBASsand
PAHstoassestheinfluenceofdifferentstorageconditionsontheirstability:C12,
C14andC16BAS,thataretheBAShomologuesusedatthehighestproportionin
commercial formulations, and BaA, BaP and IP, which were considered as
models for PAHs of four, five and six aromatic rings, respectively. All the
experimentsweremadeintriplicate.

Theacidmediumrequiredforcoacervationofthesurfactantdodecane
sulfonic acid was obtained by using hydrochloric acid [16,32]. The use of
oxidizing acids, such as nitric or perchloric was avoided because of the likely
gradualoxidationofthesurfactantinthesemedia.Also,theuseofsulfuricacid
was avoided because its handling usually requires special precautions. The
stabilitystudiesweremadeattwohydrochloricacidconcentrations(3.75Mand
4.2 M). They were selected on the basis that extraction efficiencies for the
targetcompoundsareindependentofHClintheconcentrationrangeinwhich
coacervation is produced (2.54.5 M), and that preconcentration factors
increase as the HCl concentration does. So, we restrict our stability studies at
acid concentrations at which maximum preconcentration was achieved.
Preconcentrationfactorsaround50and60wereobtainedbyusing3.75Mand
4.2MHCl,respectively.TherecoveriesofPAHsandBASswerequantitativeat
thetwoacidconcentrationsinvestigated.

The effect of the natural illumination in the laboratory (i.e. that from
sunlight) on the stability was studied by storage of the coacervates containing
BASsorPAHsintononcoveredandaluminiumfoilwrappedvialskeptatroom
temperature. The coacervates were analysed daily for a period of a week.
Recoveries obtained for the target compounds were similar for both types of
vials.So,wrappingofthesamplesduringstoragewasnotnecessarytoachieve
BASsorPAHsstability.

[32] D. Sicilia, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 460 (2002) 13.

- 135 -

ParteI
To determine the effect of the temperature on BAS and PAH stability,
thecoacervatesproducedattwohydrochloricacidconcentrationswerestored
at room temperature, 4 C and 20 C and analysed weekly during a 3month
period. Table 1 shows some of the recoveries obtained for the target
compoundsandTable2showstheconcentrationsfoundandthecorresponding
standard deviations. Recoveries ranged from 90% to 109%. The integrity of
analytes was kept for the whole period of time investigated, independently of
thetemperatureusedforstorageofthecoacervatesortheacidconcentration
added toinduce coacervation.AlthoughthehydrocarbonchainlengthofBASs
can influence their biodegradability [33], no differences of recoveries were
foundforthethreehomologues.

A common source of instability of analytes is the temperature that


samplescanreachduringstorageinthefieldandtransportinsunnyareas.So,
toassessthisfactor,westoredthecoacervatescontainingtheanalytesat35C
foramonth.Therecoveriesobtainedprovedthatnoproblemsofdegradation
were found for any of the pollutants investigated. Therefore, the coacervates
haveahighstabilizingcapacityforBASsandPAHs.

3.3.EffectofthewatermatrixonBASandPAHstability

SincematrixcomponentscanaffectthestabilityofBASsandPAHs,we
triedthesuitabilityofanionicmicellebasedcoacervatestokeeptheintegrityof
these pollutants after their extraction from wastewater and riverwater. Since
the stability of PAHs wasfound to be independent of the number of aromatic
rings (Table 1), the PAHs selected for this study were those for which the
EuropeanCommunityDirective98/83/CEaboutthequalityofwatersupply[34]
has established threshold values (BaP, BbF, BkF, IP and BghiP). No effort was
made to separate IP and BghiP, which coeluted under the chromatographic
conditionsproposed,sothePAHsanalysedwereBaP,BbF,BkFandBghiP.
[33] J.K. Autry, E.G. Vaught, E.D. Conte, Microchem. J. 80 (2005) 25.
[34] Off. J. Eur. Commu. L 330 of 5th December 1998, p. 32. European Community
Directive 98/93/EC.

- 136 -

Captulo3
Table 1. Meana recoveriesb (%) of benzalkonium surfactants and polynuclear
aromatic hydrocarbons from spiked distilled water (0.19 g L-1 of each analyte)
after storage of the acid-induced SDSA coacervates at different hydrochloric
acid concentrations and temperature values.

Compound

Storage
time
(week)

Storageconditions

4.2M
Room
tempe
rature

4C

20C

BenzalkoniumSurfactants
0
100
100
100
1st
97
99
100
BDDA

8th
92
94
94
108
107
108
12th
0
100
100
100
st
97
100
102
1
BDTA
th

8
92
94
93
th
12
94
101
104
0
100
100
100
st
100
101
103
1
BDHA

8th
94
94
96
12th
101
105
104
PolynuclearAromaticHydrocarbons
BaA
0
100
100
100
1st
103
103
101
8th
103
103
101
102
102
100
12th
0
100
100
100
BaP
95
100
103
1st
8th
98
101
101
96
97
99

12th
IP
0
100
100
100
102
99
102
1st
8th
99
103
100
90
95
94

12th
Rangeforrelativestandarddeviationofrecoveries:24%.
a
n=3.
b
Normalizedextractionrates.

3.75M
Room
tempe
rature

4C

20C

100
93
92
98
100
94
92
95
100
99
95
95

100
96
94
101
100
94
93
95
100
99
99
96

100
94
95
101
100
96
94
95
100
101
96
95

100
100
105
99
100
100
101
97
100
100
104
94

100
108
104
102
100
105
99
99
100
105
102
96

100
108
109
101
100
108
105
100
100
105
107
98

All the experiments were made in duplicate using 4 M of hydrochloric


acid concentration to induce coacervation and the coacervates containing the
analyteswerestoredatroomtemperatureor4Cforamonth.Tables3and4

- 137 -

ParteI
Table 2. Meana concentration (g L-1) of benzalkonium surfactants and
polynuclear aromatic hydrocarbons from spiked distilled water (0.19 g L-1 of
each analyte) after storage of the acid-induced SDSA coacervates at different
hydrochloric acid concentrations and temperature values.
Storageconditions

Storage
Compound

4.2M

time
(week)

Room
temperature

3.75M

4C

20C

Room
temperature

4C

20C

BenzalkoniumSurfactants

0.19190.005

1st

0.1850.001

0.1880.003 0.19150.0005

0.1930.006

0.17990.0008

0.1860.003

0.1830.002

BDDA

8th

0.1760.002

0.1810.003

0.1810.002

0.1780.002

0.1830.006

0.1850.002

12th

0.2090.006

0.2060.009 0.20720.0007

0.2090.006

0.2060.009

0.20720.0007

0.1920.007

BDTA

BDHA

0
1st
8th
12th

0.1900.004

0.18440.0006 0.1890.003 0.19370.0009


0.1740.001
0.1780.009

0.1780.002

0.1800.004

0.1920.009 0.1980.009

0.18010.0008

0.1750.006

0.1830.005

0.1810.007

0.1840.002

0.1790.002
0.1840.004

0.1800.005
0.1820.002

0.1880.006

0.190.01

1st

0.1870.002

0.1890.001

0.1940.004

0.1840.002

0.1840.005

0.1880.003

8th

0.1760.002

0.1770.004

0.1810.004

0.1780.006

0.1840.002

0.1810.005

12th

0.190.02

0.200.01

0.1950.006

0.1790.009

0.1790.004

0.1790.008

PolynuclearAromaticHydrocarbons

0.18710.0008

0.1830.004

1st

0.1920.003

0.1920.002

0.1880.001

0.1870.002

0.1990.002

0.2000.002

BaA

8th

0.1920.004

12th

0.190.01

0.1910.004 0.18850.0001

0.1940.006

0.1910.007

0.2020.002

0.1890.007

0.1830.004

0.1870.001

0.1830.001

0.1860.005

0.1860.004

0.1820.005

1st

0.1760.002

0.1860.002

0.1880.006

0.1830.008

0.19210.0001

0.19810.0004

BaP

8th

0.1830.006

0.1880.001

0.1850.001

0.1840.005

0.1810.004

0.1920.004

12th

0.1790.005

0.1810.004

0.1850.009

0.1780.004

0.1810.003

0.1820.005

0.1920.008

0.1870.004

1st

0.190.01

0.1900.006

0.1950.002

0.1870.005

0.19620.0004

0.1970.001

0.1900.004

0.1970.004

0.1920.002

0.1940.006

0.1890.004

0.2000.004

0.17120.0003 0.1810.007

0.1810.003

0.1750.003

0.1800.001

0.1830.007

IP

8th
12th

n=3.

show some of the recoveries and concentrations found for the target
compounds in the analyses of environmental waters. No influence of matrix
componentsonthestabilitywasdetectedthusconfirmingthehighstabilization
capacity of coacervates for the target pollutants. Fig. 2 depicts two typical
chromatograms obtained in the analysis of BASs and PAHs in influent
wastewater samples. The chromatographic peaks corresponding to BDDA and
BDTAshowedshoulderswhichprobablycorrespondedtobranchedBAS

- 138 -

Captulo3
Table 3. Meana recoveriesb (%) of benzalkonium surfactants and polynuclear
aromatic hydrocarbons from spiked environmental water samples (0.19 g L-1
of each analyte) after storing the acid-induced SDSA coacervates at 4C for a
month.
Time
Wastewater(influent) Wastewater(effluent)
Riverwater
(weeks)
BenzalkoniumSurfactants

BDDA BDTA BDHA BDDA BDTA BDHA BDDA BDTA BDHA


0
100
100
100
100
100
100
100
100
100
4th
91
93
90
89
93
88
94
91
88
Time
Wastewater(influent) Wastewater(effluent)
Riverwater
(weeks)
PolynuclearAromaticHydrocarbons

BbF
BkF
BaP B(ghi)P BbF
BkF
BaP B(ghi)P BbF
0
100
100
100
100
100
100
100
100
100
100
95
84
88
105
93
89
100
93
1st
2nd
93
93
85
104
95
90
89
94
103
96
99
97
102
107
97
89
97
113
3rd
4th
108
102
101
101
100
97
95
105
98
a

n=2.
Normalizedextractionrates.
Rangeforrelativestandarddeviationofrecoveries:BASs(24%);PAHs(610%).

isomers. Branched isomers are always present, at undefined proportion, in


commercialformulationsoflinearsurfactants.

3.4.Practicalconsiderations

The onsite extraction/preservation of environmental water samples


requires the use of rapid and simple sample handling procedures. Before
extraction, a filtration step using 0.45 m filters is mandatory if analysis of
pollutants is to be made in the dissolved fraction. Suspended solid
concentrations(SSC)inriverandwastewaterarehighlyvariable.

- 139 -

ParteI
Table 4. Meana concentration (g L1) of benzalkonium surfactants and polynuclear
aromatichydrocarbonsfromspikedenvironmentalwatersamples(0.19gL1ofeach
analyte)afterstoringtheacidinducedSDSAcoacervatesat4Cforamonth.
Compound

Storagetime
(week)

Wastewater
(influent)

Wastewater
(effluent)

Riverwater

BenzalkoniumSurfactants
0
0.1980.008
0.2080.009
4th
0.1810.002
0.1860.006
0
0.1820.005
0.1880.005
BDTA
4th
0.17020.0004
0.1750.002
0
0.2000.004
0.2000.004
BDHA
4th
0.17910.0009
0.1760.002
PolynuclearAromaticHydrocarbons
0
0.170.02
0.180.02

1st
0.180.01
0.1900.003

2nd
0.1630.004
0.1700.005
BbF
3rd
0.170.02
0.190.02

4th
0.1890.006
0.1800.006
0
0.180.01
0.190.01

1st
0.1690.008
0.1770.006

2nd
0.1650.004
0.1720.005
BkF
3rd
0.1770.003
0.1850.006

4th
0.1830.006 0.18510.0003
0
0.180.01
0.190.01
st
1
0.1500.007
0.1690.003
BaP
2nd
0.1520.004
0.1680.006
3rd
0.17290.0003
0.1690.002
4th
0.1810.003
0.1810.003
0
0.170.02
0.190.02
st
1
0.1500.01
0.1860.003
2nd
B(ghi)P
0.180.01
0.180.02
3rd
0.1750.005
0.1790.005
4th
0.170.02
0.195510.0008
a
n=3.
BDDA

- 140 -

0.2030.007
0.1910.005
0.1860.005
0.170.02
0.1840.004
0.170.002
0.170.02
0.1640.002
0.1810.007
0.19810.0007
0.17160.0005
0.180.01
0.160.01
0.1820.003
0.1880.006
0.180.01
0.180.01
0.160.02
0.1780.002
0.1750.002
0.190.02
0.180.02
0.1740.009
0.1910.003
0.1810.006
0.180.02

Captulo3

X10

BDDA

(A)

BDTA

1.25
Intens

1.00
BDHA

0.75
0.50
0.25
0.00
10

15
min

20

0.25

25
BkF

(B)

mV

0.20
0.15

BaP

0.10

B(ghi)P

BbF
0.05
0.0
5

10

15

20

25

30

min

Figure2. (A) LC-MS extracted ion chromatogram of BASs (BDDA at m/z 304,
BDTA at m/z 322 and BDHA at m/z 360) and (B) LC-fluorescence
chromatogram of PAHs (300 nm/430 nm at 0 min for BbF, BkF and BaP, and
290 nm/410 nm at 28 min for BghiP) obtained from spiked (0.19 g L-1)
influent water sample.

In river, SSC do not usually exceed of 100 mg L1 [35]. In domestic


wastewater,SSCgenerallyrangebetween120and450mgL1[36],althoughSSC
as high as 1100 mg L1 have been found in some wastewaters [37]. So, the
[35] J.R. Gray, G.D. Glysson, L.M. Turcios, G.E. Schwarz, Comparability of suspendedsediment concentration and total suspended solids data, US Geological Survey, WaterResources Investigations Report 00-4191, Reston, 2000.
[36] M. Henze, P. Harremos, J. La Cour Jansen, E. Arvin, in: U. Frstner, R.J. Murphy,
W.H. Rulkens (Eds.), Wastewater Treatment. Biological and Chemical Processes,
Springer, Berlin, 1997.
[37] A. Katsoyiannis, C. Samara, Water Res. 38 (2004) 2685.

- 141 -

ParteI
sample handling will be considerably simplified if low sample volumes can be
treated.

In coacervative extraction, preconcentration factors and recoveries of


analytes are mainly dependent on the concentration of surfactants used for
extractionandnotonthesamplevolumeused.Thus,onceyouhavefixedthe
most appropriate surfactant concentration you can reduce the sample volume
uptoalimitvaluewhichisimposedbypracticalconsiderations(e.g.thevolume
of coacervate should be enough to make two chromatographic injections in a
precise way). Our personal experience indicates that the coacervate volume
obtainedshouldbeatleastaround100Lastheextractioniscarriedoutinthe
batch mode. So, under the experimental conditions we have proposed in this
study we could use around 56 mL of sample. This behaviour of coacervates,
whichisageneralruleofsolventsinliquidliquidextractions,isadefiniteasset
to the onsite simultaneous extraction/preconcentration/preservation of
pollutantsbecauseitpermitsthehandlingoflowsamplevolumes.

Onsite filtration of low sample volumes can be easily carried out by


using 550 mL syringes with a filter unit at the tip and pushing manually the
piston. Filtered samples are extracted by coacervates using stirring and
centrifugationandstoredinsmallvialsfortransportatroomtemperaturetothe
analyseslaboratory.

4.Conclusions

This research proves that anionic micellebased coacervates are a


valuable tool for the onsite extraction/preservation of BASs and PAHs from
environmental water samples (river and influent/effluent wastewater). The
recoveriesofthetargetcompoundswerequantitativeandindependentontheir
alkyl chain length or their number of aromatic rings under the different
experimental conditions examined (from 20C to 35C, natural or artificial
illumination, matrix components, acid concentration, etc). Besides the
stabilizing capacity of coacervates, these supramolecular systems have

- 142 -

Captulo3
additionalfeaturesthatmaketheiruseinterestingformonitoringprograms:(1)
thepreconcentrationfactordoesnotdependonthesamplevolumebutonthe
surfactant concentration, so we can treat low sample volumes which makes
sample handling easy; (2) the extraction is simple and rapid and only low cost
equipmentisrequired;and(3)thelowvolumeofcoacervatespermitstostore
theminvialswhichfacilitatetransportandstorage.

Acknowledgements

TheauthorsgratefullyacknowledgefinancialsupportfromMEC(Project
CTQ200500643). They also thank the Linares, Mengibar and Bailn WWTPs
personnel for kindly collecting the sewage water samples. We specially thank
thepersonnelfromAguasJanCompanyfortheirtechnicalassistance.

- 143 -

PARTEII:NUEVASMETODOLOGASPARAELANLISISDESUSTANCIASPERFLUOROALQUILADASEN
MUESTRASBIOLGICAS

PARTE II
NUEVAS METODOLOGAS PARA
EL ANLISIS DE SUSTANCIAS
PERFLUOROALQUILADAS EN
MUESTRAS BIOLGICAS

Objeto

OBJETO
Ladeterminacindelassustanciasperfluoroalquiladas(PFASs)esobjeto
de estudio por parte de la comunidad cientfica desde que se descubriera su
ubicuidadenelmedioambienteybioacumulacinalolargodelacadenatrfica
hace ya ms de una dcada. El estudio de sus fuentes, rutas y destinos en el
medioambienteylaevaluacindelaexposicinhumanaaestoscontaminantes
son lneas de investigacin sobre las que se est discutiendo mucho en los
ltimosaos.Parallevaracaboestastareassonnecesariasmetodologaspara
el anlisis de las PFASs en los distintos compartimentos ambientales, en los
alimentoscomofuenteprincipaldeexposicinhumanayenmuestrashumanas
comodescriptorintegradodelasdistintasvasdeexposicinalasqueestamos
expuestos. Actualmente no existen niveles mximos permitidos en alimentos
para estas sustancias aunque la Agencia Europea de Seguridad Alimentaria
(EFSA) ha establecido lmites de tolerancia diaria de 1500 y 150 ng kg1 peso
corporalda1paraelcidoperfluorooctanoicoyelperfluorooctanosulfonatoy
harecomendadosuvigilanciaenalimentoscomofuentedeexposicinadichos
contaminantes[1].Porotrolado,lasPFASssehanincluidoenlassustanciasde
relevancia que deben monitorizarse para evaluar el buen estado de las aguas
marinas dentro del descriptor 9 de laDirectiva Marco sobre Estrategia Marina
Contaminantesenpecesymariscoparaelconsumohumano[2].Losmtodos
analticosexistentesparaanalizarmuestrasbiolgicasodealimentosrequieren
un elevado consumo de disolvente orgnico y en muchos casos extracciones
repetitivasyetapasdelimpieza.AdemsproporcionanrecuperacionesdePFASs
muy dependientes del tipo de matriz y analito debido al amplio intervalo de
polaridad de los mismos ya que incluyen sustancias desde 4 a 14 tomos de
carbono.

[1] Opinion of the Scientific Panel on Contaminants in the Food chain on Perfluorooctane
sulfonate (PFOS), Perfluorooctanoic acid (PFOA) and their salts, The EFSA Journal 653
(2008) 1.
[2] Marine strategy framework directive. Task group 9 Contaminants in fish and other
seafood, available at: http://publications.jrc.ec.europa.eu/repository/bitstream/111111111/
13669/1/tg9%20report%20final_vii.pdf

- 147 -

ParteII
As,lasinvestigacionesquesepresentanenestesegundobloquedela
Tesis Doctoral tienen como objetivo el desarrollo de metodologas para la
extraccin y determinacin de PFASs en distintas muestras biolgicas;
concretamente aves marinas, pescados y suero sanguneo que resuelvan los
problemas existentes y ofrezcan una alternativa adecuada a las metodologas
existentesencuantoasimplicidad,rendimientosdeextraccinindependientes
delalongituddelacadenafluorocarbonada,exactitud,precisinysensibilidad.
Lasmetodologaspropuestasparaalcanzaresteobjetivosehanbasadoen;

(1)elempleodemezclastetrahidrofurano(THF):aguaqueposeenunaexcelente
capacidaddesolubilizacinparaloscompuestosanfiflicos,comoeselcasode
estos analitos. Estos disolventes presentan una gran diferencia en los valores
respectivosdelasconstantesdielctricas(agua=80;THF=7,5)yparmetros
de solubilidad de Hildebrand ( agua=23,3 cal1/2 cm3/2; THF=9,5 cal1/2 cm3/2).
Gracias a estas diferencias la mezcla hidroorgnica proporciona un balance de
interacciones (dispersivas, puentes de hidrgeno y polares) adecuadas tanto
para la solubilizacin del grupo polar como de la cadena hidrfoba del
tensioactivo.

(2) el empleo de microextracciones lquidolquido basadas en la formacin de


disolventessupramolecularesdemicelasinversasdecidohexanoico.Elusode
estosSUPRASspresentaungranpotencialalahoradesimplificareltratamiento
demuestrayunagrancapacidaddeextraccinbasadaenlasinteraccionesque
proporcionan; hidrofbicas en la regin exterior hidrocarbonada y puentes de
hidrgenoatravsdelosgrupospolaresenelncleodelasmicelas,locuallleva
alaformacindeagregadosmixtosPFASs:cidohexanoico.

(3)lamejoradelacuantificacindelasPFASstrabajandoenmodoaislamiento
de iones cuando se emplea espectrometra de masas con trampa inica. Este
modo de trabajo evita los problemas de selectividad provocados por el efecto
espaciocarga a la vez que que mantiene la sensibilidad obtenida en modo
barrido.

- 148 -

Objeto
A continuacin se presentan los resultados obtenidos de las
investigacionesrealizadasenestesegundobloquedelaTesisDoctoral.

- 149 -

ParteII
CAPTULO4:Analysisofperfluorinatedcompoundsinbiotabymicroextractionwithtetrahydrofuranandliquidchromatography/ionisolationbasediontrapmassspectrometry

CAPTULO4

Analysisofperfluorinatedcompoundsbymicroextraction
withtetrahydrofuranandliquidchromatography/ion
isolationbasediontrapmassspectrometry

JournalofChromatographyA,1217(2010)37743782.
NoeliaLuque,AnaBallesterosGmez,StefanvanLeeuwen,SoledadRubio

Abstract

An analytical method combining both a simple, fast and efficient solvent


microextraction and a sensitive and selective monitoring mode, based on ion
isolation ion trap mass spectrometry (MS), was developed for analysis of
perfluorinated compounds (PFASs) in biota. The method involved the vortex
shaking of 0.2 g of tissue sample and 800 L of tetrahydrofuran (THF):water
(75:25, v/v) for 7 min, subsequent centrifugation for 13 min and direct
quantitation of PFASs in the extract against solventbased calibration curves.
SelectionofsolventcompositionwasbasedonHildebrandsolubilityparameters
and their components (i.e. dispersion, dipoledipole and hydrogen bonding
forces). Recoveries in samples for PFASs with hydrocarbon chain lengths
betweenC4andC14rangedfrom85to111%,withrelativestandarddeviations
between1and11%.Theionisolationmonitoringmode,proposedforthefirst
time for iontrap MS quantitation, proved to be effective in avoiding space
charge effects caused by coeluting matrix components while keeping the
sensitivityoffullscanMSoperation.Detectionlimitsofthemethodwereinthe
range0.86ngg1forperfluoroalkylcarboxylates(PFCAs)and0.40.8ngg1for
perfluoroalkyl sulfonates (PFSAs) in wet weight samples. The method was
validated using a reference material made up of flounder muscle and by
comparisonwithtriplequadrupoleMSmeasurementsanditwasappliedtothe
determination of PFASs in liver and muscle samples from sea birds and fishes.

- 150 -

Captulo4
Only PFSAs were found in samples at quantifiable levels (2.9 and 13.1 ng g1)
whilePFCAswerebelowtherespectivequantitationlimits.Thismethodallows
quick and simple microextraction of PFASs with minimal solvent consumption,
whiledeliveringaccurateandprecisedata.

Keywords: Perfluorinated compounds; biological samples; microextraction; ion


isolationiontrapmassspectrometry.

1.Introduction

Perfluorinated compounds (PFASs) have been used since the 1950s in


numerous industrial and domestic applications due to their special surfactant
properties.Examplesincludecarpet,leather,textile,paper,foodcontainersand
cooking tools or additives in cosmetics and pesticides. Several PFASs are
resistanttoheat,acidsandbasesandeventobiologicalattackduetothehigh
stability conferred by the strong FC bond [1]. The persistence and
bioaccumulationpotentialprovidedbythesepropertiesexplainstheubiquityof
PFASs in the environment and biota [26] 3 so 4 that 5 thay 6 are present
worldwide,eveninremotelocationssuchastheArtic[4,711].As8oceans9play

[1] E. Kissa, Fluorinated Surfactants and Repellents, CRC Press, Surfactant Science
Series, Vol. 97, 2nd Ed., 2001.
[2] K. Kannan, J. Koistinen, K. Beckmen, T. Evans, J.F. Gorzelany, K.J. Hansen, P.D.
Jones, E. Helle, M. Nyman, J.P. Giesy, Environ. Sci. Technol. 35 (2001) 1593.
[3] M. Houde, J.W. Martin, R.J. Letcher, K.R. Solomon, D.C.G. Muir, Environ. Sci.
Technol. 40 (2006) 3463.
[4] N. Yamashita, K. Kannan, S. Taniyasu, Y. Hori, G. Petrick, T. Gamo, Mar. Pollut.
Bull. 51 (2005) 658.
[5] A. Jahnke, L. Ahrens, R. Ebinghaus, C. Temme, Environ. Sci. Technol. 41 (2007)
745.
[6] C.M. Butt, S.A. Mabury, D.C.G. Muir, B.M. Braune, Environ. Sci. Technol. 41
(2007) 3521.
[7] K. Kannan, S. Corsolini, J. Falandysz, G. Oehme, S. Focardi, J.P. Giesy, Environ. Sci.
Technol. 36 (2002) 3210.
[8] J.W. Martin, M.M. Smithwick, B.M. Birgit, P.F. Hoekstra, D.C.G. Muir, S.A.
Mabury, Environ. Sci. Technol. 38 (2004) 373.
[9] R. Bosi, F.F. Riget, R. Dietz, C. Sonne, P. Fauser, M. Dam, K. Vorkamp, Environ.
Pollut. 136 (2005) 323.

- 151 -

ParteII
10

a11majorroleassinkformanypersistentorganicpollutants(POPs),PFASsare

usually present in many fishes, sea birds and marine mammals, e.g. levels of
perfluorooctanesulfonate(PFOS)intherange0.3173ngg1,11780ngg1and
0.44000 ng g1 respectively, have been reported [11,12]. High levels of PFASs
have been also found in human blood (ngg mL1) [13], being food a possible
primary route for human exposure [14]. These emerging contaminants have
beenrecentlyincludedaspriorityhazardoussubstancesintheEuropeanwater
legislation[15].Althoughnoregulationshavebeensetyetconcerningbiotaand
foodstuff, the development of suitable analytical methods for the routine
control of PFCs in these samples is highly desirable due to their ubiquity and
toxicproperties[16].

Atpresent,liquidchromatography(LC)/negativeelectrosprayionization
(ESI)/triplequadrupole MS/MS is by far the preferred technique for
quantitation of PFASs in environmental and human matrices due to its
sensitivityintheselectivemultiplereactionmonitoring(MRM)mode(limitsof
detection 1100 pg [17]). Monitored product ions for perfluoroalkyl sulfonates
(PFSAs) and perfluoroalkyl carboxylates (PFCAs) are [SO3], m/z 80, and [M
COOH],respectively.AcheaperalternativetotriplequadrupoleMSisiontrap
[10] C.J. Young, V.I. Furdui, J. Franklin, R.M. Koerner, D.C.G. Muir, S.A. Mabury,
Environ. Sci. Technol. 41 (2007) 3455.
[11] C.R. Powley, S.W. George, M.H. Russell, R.A. Hoke, R.C. Buck, Chemosphere 70
(2008) 664.
[12] Appendice 2 in Ecological Screening Assessment Report on Perfluorooctane
Sulfonate, Its Salts and Its Precursors that contain the C8F17SO2, C8F17SO3 or C8F17SO2N
Moiety, available at: htpp://www.ec.gc.ca.ceparegistry/documents/subs_list/PFOS_SAR/
PFOS_A2.cfm
[13] A. Karrman, B. van Bavel, U. Jarnberg, L. Hardell, G. Lindstrom, Chemosphere 64
(2006)1582.
[14] EFSA Perfluorooctane sulfonate (PFOS), perfluorooctanoic acid (PFOA) and their
salts - Scientific Opinion of the Panel on Contaminants in the Food chain. The EFSA
journal 653 (2008) 653 1.
[15] Commission Notice No 2008/C 102 E/02 of 22 May 2007, amendment of annex to
Directive 2000/60/EC, Official J. Eur. Union, C51 (2008) 105.
[16] C. Lau, K. Anitole,C. Hodes, D. Lai, A. Pfahles-Hutchens, J. Seed, Toxicol. Sci. 99
(2007) 366.
[17] U. Berger, I. Langlois, M. Oehme, R. Kallenborn, Eur. J. Mass Spectrom. 10 (2004)
10.

- 152 -

Captulo4
MS[1719].18Iontrap 19analyzerscanalsoperformtandemanalysis,including
MSn experiments,andarebestsuitedforstructureelucidationofPFASsisomers
because their spectra contain very specific product ions [17]. Quantitation of
PFCAs by iontrap MS in the MRM mode is straightforward by measuring the
product ion [MCOOH]. Unfortunately, the fragmentation of PFSAs yields a
numberofspecifichighm/zratioionswithlowintensity,whicharenotsuitable
for sensitive MRM. On the other hand, low m/z ratio ions (e.g. 80) cannot be
monitoredbecauseoftheinherentlowmasscutoffderivedfromthecollision
induced dissociation [17]. As a result, applications involving iontrap
quantitationofPFASsusethesingleMSmodeafterathoroughsamplecleanup
to remove interferences [18,19]. Coeluting interferences often cause space
charge effects, which degrade severely the performance of the ion trap. So,
thereistheneedforsensitiveenough,moreselectiveiontrapbasedmethods
foranalysisofPFASsinordertodevelopalternativestothestraightforward(but
expensive)triplequadrupoleanalyzer.

Analysis of PFASs in biota is highly challenging [20,21]. In addition to


common problems in PFAS analysis (i.e. background contamination from
labwareandinstrumentation,matrixeffectsleadingtoionizationsuppressionor
enhancement, limited availability of mass labeled standards, need for high
qualitystandardsintermsofpurityandisomericcomposition,etc,[22]),sample
extraction and cleanup are key steps for exact quantitation of PFASs in biota.
The wide polarity range of PFASs (i.e. they include ionic, water soluble short
chain and nonpolar long chain compounds) makes solvent extraction
efficiencieshighlydependentonsolventpolarity.Successivepopularextraction
[18] A. Holm, S.R. Wilson, P. Molander, E. Lundanes, T. Greibrokk, J. Sep. Sci. 27
(2004) 1071.
[19] C. Tseng, L. Liu, C. Chen, W. Ding, J. Chromatogr. A 1105 (2006) 119.
[20] J.W. Martin, K. Kannan, U. Berger, P. de Voogt, J. Field, J. Franklin, J.P. Giesy, T.
Harner, D.C.G. Muir, B. Scott, M. Kaiser, U. Jarnberg, K.C. Jones, S.A. Mabury, H.
Schroeder,M. Simcik, C. Sottani, B. Van Bavel, A. Karrman, G. Lindstrom, S. van
Leeuwen, Environ. Sci. Technol. 38 (2004) 248A.
[21] S.P.J. van Leeuwen, A. Karrman, B. van Bavel, F. de Boer, G. Lindstrom, Environ.
Sci. Technol. 40 (2006) 7854.
[22] S.P.J. van Leeuwen, K. Swart, I. Van der Veen, J. de Boer, J. Chromatogr. A 1216
(2009) 401.

- 153 -

ParteII
methodsinthiscontexthavebeenthemethodofHansenetal.[23](extraction
with

methyltertbutylether

(MTBE)

after

ionpairing

with

tetrabutylammonium), the method of Berger and Haukas [24] (extraction with


methanol/water 50:50 v/v; 2 mM ammonium acetate) and the method of
Powley et al. [11] (extraction with acetonitrile and subsequent cleanup with
dispersed graphitized carbon), being the latter the preferred one because
produces the highest recoveries (80110%) and the cleanest extracts. Major
drawbacksoftheformeronesincludemuchhandsontimeduetotheneedof
repetitive washes and evaporationreconstitution steps [23], low recoveries
(<50%) for short [23] or longchain [24] PFASs and strong matrix effects that
result in high recoveries (>200%) [23] or the need for matrixmatched
calibration [24]. Current cleanup methods for biota include filtration, silica
columnfractionation,sulfuricacidtreatmentanddispersedgraphitizedcarbon,
theiruseinvolvingsomeriskforextractcontaminationorPFASlossesduringthe
cleanup procedure [25,26]. Because the trend towards short, low cost,
straightforward and environmentally friendly sample treatments, especially as
complex samples are involved, new methods for PFAS extraction from biota
shouldbeexplored.

This research aims to develop a new method for the simultaneous


monitoring of PFCAs and PFSAs in biota by combining both a fast, simple and
efficient solvent microextraction and a selective and sensitive iontrap MS
quantitation. Mixtures of THF and water were investigated for PFAS
microextractionbecauseoftheirhighdifferenceinbothdielectricconstants()
andHildebrandsolubilityparameters()[27].Thatpermittedustogetsolvent
compositionsinawiderangeofdispersion,dipoledipoleandhydrogenbonding
forces. In this way, the most suitable solvent for PFASs, which are amphiphilic
[23] K. J. Hansen, L. A. Clemen, M. E. Ellefson, H. O. Jonson, Environ. Sci. Technol. 35
(2001)766.
[24] U. Berger, M. Haukas, J. Chromatogr. A 1081(2005) 210.
[25] S.P.J. van Leeuwen, J. de Boer, J. Chromatogr. A 1153 (2007) 172.
[26] A. Jahnke, U. Berger, J. Chromatogr. A 1216 (2009) 410.
[27] J. Burke, in: B. Kanegsberg, E. Kanegsberg, Handbook for Critical Cleaning, CRC
Press, New York, 2000. Chapter 1.2. p 21.

- 154 -

Captulo4
moleculeswithhydrogenbonddonorand/oracceptorgroupsandhydrophobic
perfluorinated alkyl moieties, was determined. The final aim was to provide
guidelinesforPFASextractionbasedontheknowledgeofthedifferenttypesof
intermolecular forces between analytes and solvents in order to avoid that
methoddevelopmentcanbecomealargelyempirical,laborintensiveandtime
consumingtrialanderrorprocess.SelectivityandsensitivityiniontrapMSwas
investigatedbyisolationofthetargetionsbeforedetection.Theobjectivewas
to avoid the possible spacecharge effects caused by coeluting matrix
components while keeping the sensitivity of full scan MS operation. The
complete analysis cycle included the accumulation of the ions in the trap, the
isolationofaspecificordifferentm/zionsandtheproductionofaspectrumby
resonantlyejectingtheionsfromthetraptodetector.Bothextractionandion
trap MS were optimized and the method was applied to the determination of
PFASsinfishandbirdtissues.Methodvalidationwasperformedbyanalysisofa
flounderfilletsample,whichwasusedinthe2ndinternationalinterlaboratory
study on PFASs [22]. The extracts were analyzed by both iontrap and triple
quadrupoleMS.Mainresultsobtainedinthisresearcharedescribedbelow.

2.Experimental

2.1.Chemicals

Potassium perfluorobutane sulfonate (PFBS, 98%), perfluorooctanoic


acid (PFOA, 96%), perfluorodecanoic acid (PFDA, 98%), perfluoroundecanoic
acid (PFUnDA, 95%) and perfluorotetradecanoic (PFTeDA, 97%) were supplied
by Aldrich (Steinheim, Germany). Perfluorohexanoic acid (PFHxA, 97%),
potassiumperfluorohexanesulfonate(PFHxS,98%),potassiumperfluorooctane
sulfonate (PFOS, 98%), and ammonium acetate were purchased from Fluka
(Buchs, Switzerland). Sodium taurodeoxycholate hydrate was obtained by
Sigma.Theinternalstandardperfluorooctanoicacid 13C8(13C8PFOA,99%),was
suppliedbyCambridgeIsotopeLaboratories,Inc.(Andover,MA)asasolutionof
50mgL1inmethanol.LCgradeTHFandmethanolwereobtainedfromPanreac
(Madrid, Spain). Ultrahighquality water was obtained from a MilliQ water

- 155 -

ParteII
purification system (Millipore, Madrid, Spain). Standard solutions (1 g L1) of
individual PFASs were prepared in methanol and stored under dark conditions
at4C.

2.2.Apparatus

The LCMS system used was an Agilent 1100 series Ion TrapSL mass
spectrometer coupled to an 1100 liquid chromatograph with an electrospray
interfaceoperatinginthenegativeionmode.Thestationaryphaseusedwasan
Ascentis C18 column (5 cm x 2.1 mm i.d, 3 m) from Supelco. A Water
SymmetryC18guardcolumn(3.9cmx2.0mmi.d.,5m)wasinsertedbefore
the LC column. A homogenizer UltraTurrax T25 Basic from Ika (Werke,
Germany), a Reax Heidolph vortex (Schwabach, Germany) with an attachment
for 10 test tubes and a High Speed Brushless centrifuge MPW350R (Warsaw,
Poland)wereusedforsamplepreparationandextraction.

2.3. DeterminationofPFASsinbiota

2.3.1.Samplecollectionandpreservation

Different species of fish [i.e. bullet tuna (Auxis rochei rochei) atlantic
pomfret (Brama brama) and mackerel (Scomber scombrus)] and marine birds
[herring gull (Larus michahellis) and northern gannet (Morus bassanus)] were
analyzed. Fish samples were bought in local markets in Crdoba (Spain) while
bothbirdswerekindlyprovidedbytheMigresFoundation.ThisOrganization
was founded at the end of 2003, promoted by the Regional Government of
Andalusia,formonitoringthemigrationofbirdsthroughtheStraitofGibraltar.
Birds had just dead as they were picked up in Tarifa coast (Cdiz, Spain). The
northerngannetwasatwothreemonthsagednativeofNorthernEurope,while
the herring gull was a local individual around one year old, as their feathers
indicated. Birds and fishes were frozen (20 C) until extraction to perform
muscle and/or liver analyses. A sample of flounder fillet, previously used as a

- 156 -

Captulo4
fish material in the 2nd international interlaboratory study on PFASs [22], was
alsoanalyzedforvalidationpurposes.

2.3.2.Samplepreparationandmicroextraction

Liver and muscle samples were obtained after dissection and were
homogenized using an UltraTurrax homogenizer T25 equipped with S25N8g
and S25N25g dispersing elements. Extraction of PFASs was performed by
mixing a sample aliquot [0.2 g, wet weight (ww)], 600 L of THF and 60 L of
water into a 1.5 mL polypropylene centrifuge microtubes. Taking into account
thewatercontentofsamples(70%)[28],thefinalcompositionofthesolvent
mixture was around 25:75 (v/v) water:THF. Four glass balls (3 mm diameter)
were added to the microtubes to accelerate and enhance sample extraction.
The samples were vortexshaken for 7 minutes and then centrifuged (15,000
rpm,10C,13minutes)toclarifythesupernatant.Aliquotsofthissupernatant
(150 L) were transferred to autosampler glass vials with inserts and capped
with aluminum/silicone septum barriers (Supelco, Bellefonte, USA) and they
weresubjectedtoLC/MSanalysis.

2.3.3.QuantitationofPFASsbyLC(ESI)ITMS

Separation and quantification of PFASs was carried out by LC coupled


withanelectrosprayionization(ESI)operatinginthenegativeionmodepriorto
iontrapmassspectrometrydetection.Themobilephaseconsistedofwaterand
methanol(bothcontaining1mMofammoniumacetate)andwasprogrammed
asfollows:lineargradientfrom30%to100%ofmethanolbetween0and27.5
minandthenrevertingtoinitialconditionsallowing12minforstabilization.The
injection volume was 10 L, the flow rate 0.3 mL min1 and the column
temperature40C.OperatingconditionsintheESIsourceandtheiontrapwere:
capillary voltage 2500 V, source temperature 325C, drying gas 9 L min1,
[28] USDA National Nutrient Database for Standard reference available at:
http://www.nal.usda.gov/fnic/foodcomp/search

- 157 -

ParteII
nebulizergas30psi,octopole1.7VexceptforPFTeDA2.1V,ICC(ioncharge
control)30.000andmaximalaccumulationtime100ms.Valuesfortheskimmer
conevoltage,trapdriveandcapillaryexitvoltageforeachofthePFASsanalyzed
areshowninTable1.Quantitationofthetargetcompoundswasperformedby
usingtheionisolationmode,whichisapreviousstagetofragmentationinion
traps, and measuring the peak areas (smoothing with the Gauss function:
width=1points and cycles=1) of [MK] ions for PFSAs and the sum of [MH]
plus [MCOOH] ions for PFCAs (see Table 1 for the corresponding ion m/z).
Solvent based calibration curves were constructed in the PFAS concentration
range0.5150gL1usingstandardsinwaterTHF(25:75,v/v).

Table1. Quantitation ions and MS parameters used in the analysis of the target
PFASs in biota.

PFBS

PFHxA PFHxS

PFOA

PFOS

PFDA

PFUnDA

PFTeDA

[MH]
[MH]
[MK] [MH] [MK] [MH] [MK] [MH]

[MCOOH]
[MCOOH] [MCOOH] [MCOOH]
Quantitation [MCOOH]
m/z
m/z
m/z
m/z
m/z
m/z
m/z
m/z
ions
299 313+269 399 413+369 499 513+469 563+519 713+669

Skimmer
conevoltage 40
(V)

Capillaryexit
150
voltage(V)

40

41.5

40

41.5

41.5

41.5

41.5

150

75

150

100

200

150

150

Trapdrive

49

45

44

45

52

54

54

64

3.Resultsanddiscussion

3.1. Sourcesandcontrolofbackgroundcontamination

One of the problems related to PFASs analysis is the background


contamination coming from a variety of fluoropolymer materials that are
components of LC instruments or labware [4,20]. We investigated for
instrumental sources of PFASs in our lab by injecting blank solutions (10 L of

- 158 -

Captulo4
THF:water 75:25, v/v) in the LC/ESI/ion trap mass spectrometer. Background
signalswerealwaysobservedforPFHxSandPFOAatconcentrationsneartheir
quantification limits (0.5 and 4 g L1, respectively). After replacing the PTFE
septa, which were identified as the instrumental contamination source, by
aluminum/silicone septa, the background signals disappeared. Procedural
contamination was investigated by adding 800 L of a waterTHF (25:75, v/v)
mixture into polypropylene centrifuge microtubes and subjecting them to
extraction (i.e. vortexshaken and centrifugation at variable times). No
contamination was observed for the target PFASs above their detection limits.
Anyway,proceduralblankswereroutinelyinjectedduringsamplesequencesto
checkpossiblecontaminationfromtheLCsystemandsampletreatment.

3.2.Solventextractionmethoddevelopment

3.2.1.Criteriaforsolventselection

AgoodknowledgeoftheinteractionsbetweenthesolventandPFASsis
important for setting up an efficient extraction scheme. PFCAs and PFSAs are
amphiphilic molecules with highly hydrophobic hydrocarbon chains (lengths
betweenC3andC14)duetothepresenceoffluorine.ThepolargroupsofPFCAs
arebothdonorandacceptorhydrogenbondingwhilethoseofPFSAsareanionic
andacceptorhydrogenbonding.ThesepropertiesmakePFASextractiondifficult
becauseofthehighpolarityandnonpolarityofthetworegionspresentintheir
structure. Our initial hypothesis was that a good solvent for PFASs should
provide both polar and nonpolar interactions in a correct balance. For this
purpose, we selected THF and water because of their differences in dielectric
constants(water=80;THF=7.5),whichareameasurementofsolventpolarity,
andHildebrandsolubilityparameters(water=23.3cal1/2 cm3/2;THF=9.5cal1/2
cm3/2),whicharenumericalvaluesthatindicatetherelativesolvencybehaviour
of a specific solvent. They are derived from the cohesive energy density of
solvents,whichinturnarederivedfromvaporizationheats[27].

- 159 -

ParteII
Solubility behaviour can be adequately described using Hildebrand
values, but predictions become more consistent using Hansen parameters,
which are the dispersion (d), hydrogen bonding (h) and dipoledipole (p)
componentsofHildebrandparameters(Total)andrelatetoitthrough[27]:

2Total=2d+2p+2h

Hansen parameters for water and THF are shown in Table 2 and their
values indicate that hydrogen bonding and dispersive forces are the major
components in water and THF, respectively. So, solvents with very different
solvency behaviour can be obtained by simply varying the composition of the
THF:water mixture (the Hildebrand parameter for a solvent mixture can be
easilycalculatedbyaveragingtheircomponents).Inthisway,themostsuitable
solvent for PFAS extraction and guidelines to determine the major forces
involved in PFAS solubility can be found. On the other hand, water is a polar
protic solvent able to provide adequate interactions with the polar groups of
PFASs(i.e.iondipoleinteractionswithPFSAsandhydrogenbondingwithboth
PFCAsandPFSAs).

Table2.Different solubility parameters for various pure solvents.


Solvent

Water
Tetrahydrofuran
Methanol
Acetonitrile

Hildebrand
parameters
(cal1/2cm3/2)
t

Hansen
parameters
(cal1/2cm3/2)
d p
h

Fractionalparameters

100fd

100fp 100fh

23.3
9.5
14.5
12

7.6
8.2
7.4
7.5

7.8
2.8
6.0
8.8

20.6
3.9
10.9
3.0

21
55
30
39

22
19
25
46

57
26
45
15

Aconvenientmethodforwhichsolubilityinformationcanbeillustrated
istheTeastriangulargraph.Thissimpleplanarthreecomponentdatagraphis
based on the hypothetical assumption that all solvents have the same
Hildebrandvalueandsolubilitybehaviourisdeterminedbytherelativeamounts

- 160 -

Captulo4
thatthethreecomponentforcescontributetotheHildebrandparameter.This
allows us the convenience of related percentages rather than unrelated sums.
Tea parameters, also called fractional parameters, are mathematically derived
from Hansen values by calculating the relative amount that each Hansen
parametercontributestothewhole[27].Table2showstheTeaparametersfor
water and THF. These values express that an appropriate combination of both
dispersive and hydrogen bonding forces can be obtained, while keeping
constant the dipoledipole one, by mixing water and THF at different
proportions.BecauseHildebrandvaluesarenotthesameforallliquids,theTeas
graph is an empirical system with little theoretical justification. This lack of
theoretical foundation, however, does not prevent the Teas graph from being
an accurate and useful tool, perhaps the most convenient method by which
solubilityinformationcanbeillustrated[27].

3.2.2.Optimization

Asampleconsistingof12homogenizedbullettunaliverswasusedfor
optimization of solvent extraction efficiency. Sample aliquots (0.10.35 g ww)
werespikedwithanappropriatevolumeofa1mgL1solutionofPFASsinTHF
(spikingrange2040ngg1)twohoursbeforeextraction.Equilibrationbetween
PFASsandlivermatrixforalongerperiodoftime(i.e.overnight)didnotchange
theextractionefficiency.Matrixmatchedcalibrationwasusedforoptimization
until method development was complete in order to ensure accurate
quantitation.

3.2.2.1. Solvent composition. The influence of solvent composition was


investigatedbyusingfreezedriedliversamples(0.2gww)sincethehighwater
content present in biological samples (7075% for muscle and liver [28]) was
expected to be an important contribution to the low solvent volume used in
microextraction. We found that the water content in bullet tuna livers (n=10)
was702%andthisvaluewasconsideredforlatercalculations.Table3shows
the recoveries obtained for the target compounds and the values for the
Hildebrand parameter as a function of the composition of the THF:water

- 161 -

ParteII
mixture.Tohelpdiscussion,theTeasparametersforwater,THFandthemixed
solventattheproportionswiththehighestrecoveries(Table3)aredepictedin
Figure1a.

Table3. Hildebrand parameters (, cal1/2 cm-3/2) and recoveries for PFASs (%)
along with their respective standard deviations (n=3) as a function of solvent
composition.
RecoveriesSD(%)
Solvent
composition
THF:water,
v/v

100:0
85:15
75:25
70:30
55:45
40:60
15:85
0:100

PFBS

9.5
0
11.6 1007
13.0 1051
13.6 1031
15.7 941
17.8 794
21.2 371
23.3 332

PFHxA

PFHxS

0
135
726 1033
942 1031
928
983
1012 984
811
805
361
131
303
131

PFOA

206
897
971
959
976
932
121
101

PFOS

PFDA

256 287
1007 855
1041 1041
1064 927
716 779
718 543
101 101
71
151

PFUnDA PFTeDA

283
816
1051
1041
688
403
61
21

291
706
1061
1055
6811
328
22
21

Sample:0.2g(wetweight)offortified(40ngg1ww)frozendriedbullettuna
Solventvolume:600L

As expected, no extraction at all or very low recoveries were obtained


forPFASsinpureTHForwater(Table3).Thebalancebetweenpolar(i.e.dipole
dipole plus hydrogen bonding) and nonpolar (i.e. dispersion) forces for both
solvents (Figure 1a) were not adequate for PFAS solubilization. Extraction
efficiency greatly increased by mixing both solvents and recoveries were
quantitative at water percentages between 15 and 30% for PFASs and 2030%
forPFCAs.Probably,thestrongiondipoleinteractionbetweenPFSAsandwater
facilitated their solubilization at lower water proportions. A solvent mixture
madeof75:25(v/v)THF:waterwaschosenasoptimalforextraction.

Accordingtotheseresults,solventshavingHildebrandparametervalues
around1214(Table3)andTeasparameterswithpolar(fh+fp)/nonpolar(fd)
forceratiosabout1.2(e.g.amixture25:75ofwater:THF,seeFigure1a)should
- 162 -

Captulo4

(a)

(b)

(c)
Figure 1. Teas graphs for pure solvents and their mixtures at the specified
compositions: (a) THF and water; (b) methanol and water and (c) acetonitrile
and water.

provideefficientextractionsforPFASs.BecauseofthenatureofthePFASpolar
groups, these solvents should be able to provide both donor and acceptor
hydrogenbondingand,probably,extractionisenhancedaspolarforcesmainly
consist of hydrogen bonding (e.g. under optimal conditions, the Teas
parameters with hydrogen boding/dipoledipole ratio was around 1.7, Figure
- 163 -

ParteII
1a). Solvents or solvent mixtures meeting these characteristics can be easily
found from the knowledge of their structure, and their Hildebrand and Teas
parameters,alwaystakingintoaccountthewatercontentinsamples.

For comparison, the Teas graph for two solvents widely used in the
extractionofPFASsfrombiologicalsamples,namely50:50methanol:water[24]
and acetonitrile [11], were constructed. According to the reported procedures
[11,24], calculations were based on 1 g of sample and 3 mL of 50:50
methanol:wateror10mLofacetonitrile,respectively.Thewatercontentofthe
sample(around0.7mL)wasalsoconsidered.Figure1depictsthepercentages
ofthethreeforcescontributingtotheHildebrandparameterforpuresolvents
(waterandmethanolinFigure1bandwaterandacetonitrileinFigure1c)and
the corresponding solvent mixtures (including sample water) proposed for
extraction.SolubilityparametersforwaterandmethanolareshowninTable2.
Hildebrandparametersforthemethanol:waterandacetonitrile:watermixtures
were19.8and12.7cal1/2cm3/2,respectively.

The reported low recoveries for longchain PFASs (<50%) in


methanol:water [24] could be possibly explained from Figure 1b. Although an
appropriate hydrogen bonding/dipoledipoleratio wasobtained(i.e.~2.1),the
polar and nonpolar forces were unbalanced (i.e. ratios of 2.8, far above the
value of 1.2 obtained for water:THF mixtures) and, consequently, dispersion
forces were at an unacceptable low proportion for extraction of the more
hydrophobicPFASs.Ontheotherhand,thebalancedpolar/nonpolarforceratio
obtainedforacetonitrile(~1.6)explainsthegoodrecoveriesobtainedforPFASs
in the whole range. However, the hydrogen boding/dipoledipole ratio was
around 0.4, which possibly explains the higher solvent volume and extraction
timerequiredforquantitativerecoveryofPFASscomparedtothosedemanded
bytheTHF:watermixture.

3.2.2.2.Solventvolume.Oncethecompositionofthesolventwasoptimized,we
evaluated the volume needed for the extraction of PFASs from 0.2 g (ww) of
fortified (40ng g1) sample aliquots previously freezedried. Solvent volumes of

- 164 -

Captulo4
25:75 v/v water:THF mixtures between 250 and 1000 L were tested and
recoveries higher than 90% were obtained for the target compounds in the
whole range. Recoveries kept constant with the amount of sample used for
extraction(rangedtested0.10.35gww)providedthatsolventvolume/sample
amountratioswerewithintheintervalpreviouslytested.

In order to directly extract wet biota samples, the water content in


bullet tuna liver (702%) was considered to get the required final solvent
composition(25:75v/vTHF:water).So,extractionefficiencieswereinvestigated
forfortifiedsamplealiquots(0.2gww)byadditionof600LofTHFand60L
of water, taking into account that 140 L of water came from the sample.
Recoveriesforbothwetandfrozendriedsamplesweresimilar,sowetsamples
wereusedforPFASanalysis.Becauseoftheimportantrolethatwaterplaysin
mostofPFASextractions,westronglyrecommendtohaveitinconsiderationin
relatedextractiondiscussions.

3.2.2.3. Extraction time. The time required to reach equilibrium conditions for
extraction was investigated. For this purpose, samples were vortexshaken in
the interval comprised between 5 and 45 min. Equilibrium conditions were
rapidly achieved, just 5 min, owing to the high solubilising capability of the
solvent mixture used. An extraction time of 7 min was selected because the
precision was slightly improved. Experiments were carried out using both
fortifiedbullettunaliversamplesandaflounderfilletsample,previouslyusedin
the2ndinternationalinterlaboratorystudyonPFASs[22],inordertocheckthat
the method used for sample fortification did not affect the time required for
extraction.

3.3.AnalyticalperformanceofionisolationbasediontrapMSquantitation

Iontrap MS measurements of PFASs in biological samples have been


mainly carried out in the single ion monitoring (SIM) [19] and full scan [18]
modes. Multiple reaction monitoring (MRM) has been also proposed for
quantitationofPFCAs[18].Becauseofboththestrongmatrixeffectscausedby

- 165 -

ParteII
nonrigorouslycleanedupsampleextractsinSIMandFullscanmodesandthe
absence of suitable product ions from PFSAs in MRM, we investigated the
sensitivity,selectivityandprecisionoftheionisolationmodeforquantitationof
PFASs.

3.3.1.Sensitivity

Firstly, the sensitivity (signal intensity for a given concentration) of


differentmonitoringmodesforPFASswascompared,namelyfullscan(rangeof
m/z100750),MRM(onlyforPFCAs)andionisolation(selectedm/zvalues4).
FullscanwaspreferredoverSIMbecause,inpractice,switchingfromfullscanto
SIMontheiontrapeliminatestheinformationavailableinfull scanforonlya
slightgaininsensitivitysinceSIMontheiontrapdoesnotmonitorasinglemass
continuously as in quadrupole mass filters, but only shortens one part of the
scanprogram[29].

Both ESI source and iontrap parameters were optimized to get the
highest sensitivity for PFASs in each of the selected monitoring modes. As
previously reported [1719], PFCAs underwent an inevitable insource
decarboxylation, its extent mainly depending on the voltages applied to the
capillary and capillary exit. Voltages and other instrumental parameters were
selected to give the highest possible amount of the following ions: [MK] for
PFSAs, the sum of [MH]and [MCOOH] for PFCAs in both full scan and ion
isolation modes and [MH] for PFCAs in MRM mode. Optimization of
parameterswascarriedoutbyinjectingstandardsolutionsofanalytes(1mgL1
preparedinthesamesolventcompositionofmobilephasetheyareelutedfrom
theanalyticalcolumn)intheLCiontrapMSsystemusingaKDScientific,model
100,syringepump(NewHope,MN)at300Lh1.ForMS/MSexperiments,[M
H] ions were isolated with the isolation width set at 4 m/z units, and then
[29] N.A. Yates, M.M. Booth, J.L. Stephenson, R. A. Yost in: R.E. March, J.F.J Todd
(Eds), Practical Aspects of Ion Trap Mass Spectrometry. Volume III. CRC Press,
London. 1995, p. 121.

- 166 -

Captulo4
fragmented with the resonance excitation set at the previously optimized
values.

Table 4 shows the figures of merit obtained for calibration curves run
using standard solutions (0.5250 g L1) of PFASs in THF/water (75:25 v/v)
undertheexperimentalconditionsoptimizedforeachofthemonitoringmodes.
Similar sensitivity was achieved by fullscan and ion isolation modes, which
indicated that the latter can be used for sensitive monitoring of PFASs. In
contrast, quantitation of PFCAs by MRM was between 4 and 45fold less
sensitive. This decrease mainly resulted from the insource fragmentation of
parentionsandthelowyieldoftherespectiveionproductsintothetrap.

AtypicalchromatogramobtainedforstandardsolutionsofPFASsunder
the ion isolation monitoring mode is shown in Figure 2a. Chromatograms for
PFCAs show the two monitored ions (i.e. [MH]and [MCOOH]). Correlation
between peak areas and PFAS concentrations (0.0051.5 ng, absolute amount
injected)wasdeterminedbylinearregression.Thecoefficientsofdetermination
were in the range 0.99810.9999, indicating good fits. Instrumental detection
limits(LOD)werecalculatedfromthelowerconcentrationsofstandardsgivinga
signaltonoiseratioof3andtheywerefoundtobe1pgforPFBSandPFOS,3
pgforPFHxAandPFHxS,5pgforPFTeDA,10pgforPFOAandPFUnDAand15
pg for PFDA. So, they were low enough for monitoring PFASs in biological
samples.

3.3.2.Selectivity

Coelutingmatrixcomponentscausetwomajortypesofinterferencesin
ESI/iontrap MS, namely ionization suppression or enhancement in the ESI
source and spacecharge effects in the iontrap. On the other hand, matrix
componentswithinterferingmassesarefrequentlydetectedintheMSanalysis
ofsomePFSAs.Knowninterferencesoriginatedfromthepresenceofbilesalts
inbiota(e.g.birdlivers)interferewithPFOSandendogenoushumanhormones
interferewithPFHxSinhuman(e.g.serum)samples.Thiskindofinterferences

- 167 -

ParteII
Table 4. Figures of merit for quantitation of PFASs under different operation
modes in ion-trap MS.
Analytes Operationmode

Fullscana
Ionisolationb

PFBS

PFHxA

Fullscana

Ionisolationb

MRM

PFHxS

Fullscana
Ionisolationb

PFOA

Fullscana

Ionisolationb

MRM

PFOS

Fullscana
Ionisolationb

PFDA

Fullscana

Ionisolationb

MRM

PFUnDA

Fullscana

Ionisolationb

MRM

Quantitationions

(Slopesc)x103

1053
102.00.7

0.9980
0.9990

[MK]m/z299
[MK]m/z299

[MH]m/z313+
[MCOOH]m/z269
[MH]m/z313+
[MCOOH]m/z269
m/z313>m/z269

[MK]m/z399
[MK]m/z399

[MH]m/z413+
[MCOOH]m/z369
[MH]m/z413+
[MCOOH]m/z369
m/z413>m/z369

[MK]m/z499
[MK]m/z499

[MH]m/z513+
[MCOOH]m/z469
[MH]m/z513+
[MCOOH]m/z469
m/z513>m/z469

[MH]m/z563+
[MCOOH]m/z519
[MH]m/z563+
[MCOOH]m/z519
m/z563>m/z519

r2

37.10.6

392

1.00.3

0.9992

0.9983

0.9974

892
893

0.9982
0.9990

28.00.6

26.80.2

0.620.05

0.9994

0.9999

0.9921

782
752

0.9983
0.9981

14.80.4

14.50.3

1.860.06

0.9984

0.9993

0.9982

21.30.7

18.10.5

0.790.04

0.9983

0.9982

0.9951

Fullscana
[MH]m/z713+
18.60.4
0.9981

[MCOOH]m/z669

Ionisolationb
[MH]m/z713+
0.9993
18.50.4

[MCOOH]m/z669

MRM
0.9903
m/z713>m/z669
1.240.07
a
m/zrange,100750.bselectedm/zvalues4ineverysegment.cStandarddeviation.
PFTeDA

- 168 -

Captulo4

Intens

x10

a)Standardsolution

PFBS

PFHxS

0.8

PFOS

0.6
0.4

PFHxA

0.0
4
x10

Intens

PFDA PFUnDA
PFTeDA

PFOA

0.2

b)Referencematerial
PFOS

0.8
0.6
0.4
0.2

PFOA

0.0
Intens 4
x10

c)Spikedsampleofbullettunaliver

PFDA
PFUnDA

PFHxS

PFOS

PFBS

0.8
0.6

PFHxA

0.4

PFDA
PFUnDA PFTeDA

PFOA

0.2
0.0
4
x10

Intens

d)Sampleofherringgullmuscle

0.8
0.6

PFHxS
PFBS

0.4

PFOS
PFTeDA

0.2
0.0

10

15

20

25

Time(min)

Figure 2. LC-ESI-ion trap-MS selected ion chromatograms of PFASs obtained


from (a) a standard solution of 20 g L-1, (b) the reference material, (c) a spiked
(20 ng g-1) bullet tuna liver sample and (d) herring gull muscle sample.

- 169 -

ParteII
can be solved by using less sensitive interferencefree transitions in MS/MS
(option not available for iontraps because of the low mass cutoff) or using
perfluorinated stationary phases for interference separation [3032].3132Since
mass interferences can be easily solved by using the appropriate
chromatographic column, we only focused in this research on interferences
influencing ionization or producing spacecharge effects. Samples for which
taurodeoxycholicacid(themajormassinterferenceforPFOS)wasdetected(the
m/z and the retention time for PFOS underwent a detectable shift) were
discarded(e.g.liversfromherringgullandnortherngannet).

Ionization and spacecharge type interferences were evaluated by


comparison of the slopes of solventbased calibration curves and matrix
matched calibration curves obtained from different biological blank samples
(0.2gofmuscletissuesofbullettunaandatlanticpomfretandliversofbullet
tuna)fortifiedwithPFASsintherange20800ngg1.Extractionofsampleswas
madeintheentirerangeofsolventvolumesforwhichquantitativerecoveryhad
been checked (2501000 L). Ionization suppression was observed for sample
extract volumes lower than 700 L (e.g. the slopes of calibration curves
decreased around 10% for PFBS, PFHxA, PFHxS and PFOS and 45% for PFOA,
PFDA, PFUnDA and PFTeDA by extracting with 600 L solvent and around 70
95% as 250 L of solvent was used for extraction). Higher volumes were
interferencefree as inferred from the comparison of both slopes by using an
appropriatetstudenttest[33].Thus,thecalculatedtvalueswereintherange
0.062.62 and were below the critical tvalue (3.17), being significance
establishedat0.01levels.Therefore,matrixcomponentswerenotexpectedto
interfere in the determination of the target compounds under the proposed
conditionsandsolventbasedcalibrationcurvesareproposedforquantification.
[30] J.P. Benskin, M. Bataineh, J.W. Martin, Anal. Chem. 79 (2007) 6455.
[31] E. Chan, M. Shandhu, J.P. Benskin, M. Ralitsch, N. Thibault, D. Birkholz, J.W.
Martin, Rapid Commun. Mass Spectrom. 23 (2009) 1405.
[32] L.W.Y. Yeung, S. Taniyasu, K. Kannan, D.Z.Y. Xu, K.S. Guruge, P.K.S. Lam,
N.Yamashita, J. Chromatogr. A 1216 (2009) 4950.
[33] L. Cuadros-Rodriguez, A.M. Garca-Campaa, F. Als-Barrero, C. Jimnez-Linares,
M. Romn-Ceba, J. AOAC Int. 78 (1995) 471.

- 170 -

Captulo4
Formorecomplexsamples(suchasfoodstuffs,e.g.dairies)theinclusionofan
additionalcleanupstepmaybenecessary.

The accuracy of the solventbased calibration curve for quantitation of


the target compounds was also investigated by spiking the same biological
samples with 20 ng g1 of the mass labelled 13C8PFOA internal standard and
permitted to equilibrate the spike in the sample overnight. Recoveries for this
compoundinthemuscletissuesofbullettunaandatlanticpomfretandliversof
bullettunawerebetween96and99%.

Theexpectedhigherperformanceoftheionisolationmonitoringmode
over full scan mode to prevent spacecharge effects was assessed. In the
simplestsense,spacechargeeffectsareaconsequenceofthemutualrepulsion
between particles of like charge and are produced when too many ions are
stored in the trap overfilling it. High ion density causes that the ions in the
centerofthetrapareshieldedbyouterionsanddonotrespondideallytothe
RF field leading to lower mass resolution, mass misassignments and a loss of
sensitivity [29,34]. Space charge effects are more marked on ions with lower
m/zwhicharethefirstonesinleavingthetrap.

Spacechargeeffectswereevaluated,forbothionisolationandfullscan
modes,throughtheanalysisoffortified(80ngg1)bullettunasamplesaccording
to the procedure specified in section 2.3 but varying the maximum
accumulationtimeofionsinthetrapandtheionchargecontrol(ICC)between
100200msand5,00050,000,respectively.Theejectionofmatrixionsfromthe
iontrapduringtheisolationstepoftargetionspreventedsomehowthespace
chargeeffectsonthedetectorandnospacechargeeffectswereobservedatall
usingtheionisolationmonitoringmode.Onthecontrary,spacechargerelated
interferencesweredetectedforalltheanalytesunderfullscanconditions,the
effects being more significant for the lower m/z ions. As an example, Figure 3
compares the mass spectra obtained for the analysis of PFOS in a standard
[34] K.A. Cox, C.D. Cleven, R.G. Cooks, Int. J. Mass Spectrom. Ion Processes 144
(1995) 47.

- 171 -

ParteII
solution(a)andanextractofspikedbullettunaliver(b,c).Spectraobtainedfor
the sample using the ion isolation mode (c) were interferencefree (compare
with the spectrum of the standard in a) while spacecharge effects were
observed for sample extracts analyzed under fullscan conditions (b). The
resonance for ions of each specific m/z value was spread over a range of
frequenciesgivenrisetobroadpeakscenteredatahighermass.

(a)Fullscanmode(standard)
PFOS

(b)Fullscanmode(sampleextract)
PFOS

(c)Ionisolationmode(sampleextract)
PFOS

Figure 3. Ion trap-MS mass spectra obtained for PFOS from a standard
solution of 20 g L-1 when working in full-scan mode (a) and from a spiked
(80 ng g-1) extract of bullet tuna liver when working in full-scan (b) and
isolation MRM (c) modes.

3.3.3.Precision

The precision of the method was evaluated by extracting 11


independentfortified(20ngg1)liverandmuscle(bullettuna,atlanticpomfret,
- 172 -

Captulo4
mackerel and northern gannet) samples. The values, expressed as relative
standarddeviation(RSD),werebetween5%and9%forallthePFASs.

3.4.Methodvalidation

Validation of both the solvent extraction method and the iontrap


monitoring mode here proposed for the determination of PFASs in biota was
validated by analysing a flounder fillet sample, previously used in the 2nd
international interlaboratory study on PFASs [22], according to the procedure
specifiedinsection2.3.PFASsinsampleextractswerealsoquantifiedbytriple
quadrupole MS/MS (6410 series Agilent Triple Quad, Palo Alto, CA) by
monitoringthefollowingtransitions;PFBS,29980;PFHxA,313269;PFHxS,
399 80; PFOA, 413 369; PFOS, 499 80;PFNA, 463 419; PFDA, 513469;
PFUnDA,563519;PFDoDA,613569andPFOSA,49878).Quantification
againstsolventbasedcalibrationcurveswasusedinbothMStechniques.

Table5showsthesummarystatisticsobtainedinthisstudyandFigure
2b shows the corresponding extracted ion chromatogram obtained by ion
isolationiontrapMS.Datareportedforthissamplefromthe2ndinternational
interlaboratorystudyarealsoincludedinTable5[22].Asavailable,theresults
obtainedforPFASsbyionisolationiontrapMSwerealwayswithinthemeanS
values reported for the reference material and they were in good agreement
withthoseobtainedbythemostselectivetandemMS.Theresultsobtainedby
triplequadrupolemeasurementsindicatethattheproposedsolventextraction
methodisalsoarapidandconvenientalternativetoexistingextractionmethods
forthistechnique.

3.5.Analysisofbiotasamples

Muscle and liver samples from a variety of marine animals were


analysed toprove the suitability of the proposedmethod to determine PFASs.
First,thewatercontentofsampleswasdeterminedanditwasalwaysbetween
70and75%,asreportedintheliterature[28].Then,detectionandquantitation

- 173 -

ParteII
Table5. Summary statistics of results obtained in the analysis of a flounder fillet
sample by using ion-trap and triple quadrupole MS and those provided by the
laboratories (n=15) in the 2nd international interlaboratory study (2nd ILS) on
perfluorinated compounds.
Analyte

PFBS
PFHxA
PFHxS
PFOA
PFOS
PFNA
PFDA
PFUnDA
PFDoDA
PFTeDA
PFOSA
a

Spike IonisolationIontrap
1
(ngg )
MS
a
Mean S
RSD

1
(ngg )
(%)

n.d.

n.d.

n.d.

9
22.6
212
145
8
1948
17.2
n.a.

21.9 25.30.1
1
7
17.8
201
20.1
n.a.

n.d.

3.2
n.a.

MRMTriplequadrupole
MS
a
Mean S RSD

1
(ngg )
(%)

n.d.

n.d.

n.d.

18.00.8
5

7
17712
17.71.5
8
21.30.9
5
17.51.3
7
23.00.8
4

n.a.

9
3.10.4

nd

2 Internationalinterlaboratory
b
study
Mean
S
RSD Min
Max
1
1
1
1
(ngg ) (ngg ) (%) (ngg ) (ngg )
n.a.

n.a.
n.a.
n.a.

n.a.
n.a.
n.a.

n.a.
n.a.
18.0
4.1
23
9.2
23.6
150
44.0
29 49.9
230
17.5
4.6
26
8.9
27.3
21.1
4.6
22 12.9
26.7
15.9
4.1
26
9.0
21.0
17.3
5.2
30
8.5
23.6
n.a.

n.a.
n.a.
3.6
1.7
47
1.5
7.5

n=3;n.d.nondetected;n.a.nonanalyzed.
Datatakenfrom[22]

limits of the method for PFASs were determined by analysing sample blanks
(n=11)andconsideringasignaltonoiseof3and10,respectively.MethodLODs
andLOQsforthetargetPFASswerebetween0.4and6ngg1and2and16ngg1
ww,respectively.
Table6liststheconcentrationsfoundforthetargetcompoundsandthe
recoveriesobtainedafterspikingthesamplesatdifferentconcentrationlevels.
Recoveries of PFASs ranged from 87% to 111% (n=9) with relative standard
deviations(RSD)rangingfrom1to11%.

Clean chromatograms, similar to those obtained for standards, were


obtained for all the samples analyzed (e.g. Figure 2 c and d). PFSAs were only
presentatquantifiablelevelsinAtlanticpomfretandherringgullalthoughsome
other PFASs were clearly detected in some samples (e.g. see Figure 2d), but
belowtherespectiveLOQ.

- 174 -

Captulo4
Table 6. Mean concentrations and recoveries and the respective standard
deviations obtained for the target compounds in the analysis of biota samples
using the proposed method.
Samples

ConcentrationsSa(ngg1)andrecoveriesSa(%)
PFBS PFHxA PFHxS PFOA PFOS
PFDA PFUnDA PFTeDA

Bullettunamuscle
Spikedsample

Atlanticpomfretmuscle
Spikedsample

n.d.
957

Herringgullmuscle
Spikedsample

Bullettunaliver
Spikedsample

Atlanticpomfretliver
Spikedsample
a

<LOQ <LOQ n.d.


876 946 876

<LOQ
1059

n.d.
901

n.d.
n.d.
n.d.
1093 10011 946

n.d.
1051

n.d.
942

8.90.3 n.d.
901 853

n.d.
985

n.d.
1005

n.d.
1031

<LOQ
1029

n.d.
971

n.d.
1013

n.d.
974

n.d.
1041

n.d.
1056

<LOQ
1051

<LOQ
1001

n.d.
9810

n.d.
971

n.d.
8811

n.d.
n.d. 13.10.2 n.d.
1031 9010 1041 1041

n.d.
n.d.
1071 11111

n.d.
<LOQ
1097 10611

3.20.6 n.d. <LOQ n.d. <LOQ


973 1056 1113 1058 1105

Northerngannetmuscle
Spikedsample

n.d.
n.d. 2.90.6 n.d.
1056 1001 1057 934

Mackerelmuscle
Spikedsample

n.d. <LOQ <LOQ n.d.


9810 955 936 898

n.d.
n.d. 9.50.5
1073 1031 991

n.d.
1051

n.d.
1061

n.d.
1073

n.d.
991

n.d.
1081

n=3;n.d.nondetected;spikedconcentration:20ngg1ww

4.Conclusions

AsimplemethodhasbeendevelopedfortheanalysisofPFASsinbiota
by combining an efficient microextraction procedure and an ion isolation
monitoring mode in iontrap MS. The mixture 75:25 (v/v) of THF and water
constitutesavaluablealternativetothecurrentsolventsusedfortheextraction
of PFASs. Major benefits of this mixture are the adequate balance between
polarandnonpolarforcesandthepossibilityofestablishingdifferenttypesof
interactions with the polar groups of PFASs (i.e. iondipole and hydrogen
bonding).ThesepropertiesmakeitpossibletoextractionicandnonionicPFASs
with carbon chain lengths between C4 and C14 from biota samples (i.e. muscle
and/orliverofseafishandbirds)usinglowsolventvolumes,whichavoidsthe
commonly required subsequent evaporation. Recoveries in spiked samples
rangedbetween85and111%.Itwasprovedthatthemethodnotonlyworked

- 175 -

ParteII
withiontrapMS,ashereproposed,butalsowithotherMStechniquesastriple
quadrupole. From this study, it can be inferred that Hildebrand solubility
parameters and their components, illustrated by Teas diagrams, may offer a
simplewaytoestablishguidelinesforsolventselectioninextractions.

TheionisolationmonitoringmodeiniontrapMSofferssensitivityand
selectivityenoughtodeterminePFASsintheTHF:waterextractofbiotasamples
withouttheneedofcleanupsteps.Sensitivityofionisolationmonitoringmode
issimilartothefullscanmode,thuspermittingdetectionlimitsforPFASsinthe
range 0.46 ng g1. The selectivity achieved is a consequence of the
reduction/removal of the spacecharge effects caused by matrix components.
Themethod,however,doesnotsolvemassinterferencescausedbybilesaltsin
theanalysisofPFSAsinsomebiotasamplessuchasbirdlivers.So,itisstrongly
recommendedtheuseofperfluorinatedstationaryphasesformassinterference
separation[3032]inordertoextendtheapplicationofiontrapMStoawider
typeofsamples.

Acknowledgments

AuthorsgratefullyacknowledgefinancialsupportfromSpanishMICINN
(Project No CTQ200801068). They specially thank to the staff of Migres
Foundation for kindly providing the sea birds. The two firsts authors
acknowledgetheSpanishMECforthepostgradfellowshipsaward(AP20043644
andAP20054275).

- 176 -

Captulo5
CAPTULO5:Asimpleandrapidextractionmethodforsensitivedeterminationofperfluoroalkylsubstancesinbloodserumsuitableforexposureevaluation

CAPTULO5

Asimpleandrapidextractionmethodforsensitive
determinationofperfluoroalkylsubstancesinblood
serumsuitableforexposureevaluation

JournalofChromatographyA1235(2012)8491
NoeliaLuque,AnaBallesterosGmez,StefanvanLeeuwen,SoledadRubio

Abstract

In this work, we propose a microextraction method based on a new


supramolecular solvent (SUPRAS) made up of reverse aggregates of hexanoic
acid, combined with liquid chromatography/triple quadrupole mass
spectrometry (LC/QQQ MSMS) for the determination of the perfluoroalkyl
substances(PFASs)inbloodserum.ASUPRASisananostructuredliquidmade
up of surfactant aggregates synthesized through a selfassembly process. The
method involved the acidification of 765 L of blood serum (600 mol of
hydrochloricacidpermlofserum)followedbytheadditionofhexanoicacid(97
L) and tetrahydrofuran (THF) (600 L), conditions under which the
supramolecular solvent (360 L) formed in situ after vortexshaking and
centrifugation. Parameters affecting extraction efficiency and concentration
factors were studied. The overall sample treatment took only 20 min and
severalsamples(2030)canbesimultaneouslyanalyzedusingconventionallab
equipments, making additional investments unnecessary. Recoveries for the
internal standards in samples ranged from 75 to 89% with relative standard
deviations between 1 and 15%. Calibration was based on the use of internal
standards.Themethodwasverysensitivewithdetectionlimitsrangingfrom2
to20pgmL1forPFASs.Theapproachdevelopedwassuccessfullyappliedtothe
determinationofPFASsindifferentbloodserumsamples.Theconcentrationof
PFASsfoundinsamplesofanimaloriginrangedbetween17and197.3pgmL1

- 177 -

ParteII
and between 84 and 5168 pg mL1 in samples of human origin. Both the
analytical and operational features of this method make it suitable for the
evaluationofexposuretoPFASs.

Keywords:Perfluoroalkylsubstances;Bloodserum;supramolecularsolvent
basedmicroextraction,Liquidchromatographytandemmassspectrometry.

1.Introduction

Perandpolyfluoroalkylsubstances(PFASs)areemergingcontaminants
that comprise a large group of chemicals [1]. Attention has been focused on
these chemicals due to the discovery of their global biospheric distribution
explained by their persistence and bioaccumulation in biota [23]. The
marketing and use of perfluorooctane sulfonate (PFOS) were restricted by the
Europeandirective2006/122/EC[4].PFOShasbeenincludedintheannexIIIof
theDirective2008/105/ECaspartofthelistofsubstancessubjecttoreviewfor
identification as priority hazardous compounds in the framework of the
European water policies [5]. PFASs have been also listed as contaminants of
relevancetobemonitoredinfishandotherseafoodforhumanconsumptionfor
determininggoodenvironmentalstatusofmarinewatersintheMarineStrategy
Framework Directive [6]. In addition, PFOS, its salts and perfluorooctane
sulfonyl fluoride (PFOSF) have been included in Annex B to the Stockholm

[1] R.C. Buck, J. Franklin, U. Berger, J.M. Conder, I.T. Counsins, P. de Voogt, A.A.
Jensen, K. Kannan, S.A. Mabury, S.P.J. van Leeuwen. Integr. Environ. Assess. Manage 7
(2011) 513.
[2] J.P. Giesy, K. Kannan, Environ. Sci. Technol. 35 (2001)1339.
[3]C.R. Powley, S.W. George, M.H. Russell, R.A. Hoke, R.C. Buck, Chemosphere 70
(2008) 664.
[4] Directive 2006/122/EC of the European Parliament and of the Council, Official J.
Eur. Union, L 372 (2006) 32.
[5] Directive 2008/105/EC of the European Parliament and of the Council, Official J.
Eur. Union, L 348 (2008) 84.
[6] Marine strategy framework directive. Task group 9 Contaminants in fish and other
seafood, available at: http://publications.jrc.ec.europa.eu/repository/bitstream/111111111/
13669/1/tg9%20report%20final_vii.pdf

- 178 -

Captulo5
Conventiononpersistentorganicpollutants(POPs)[7].

The presence of organic fluoride in humans was first reported by over


30yearsago[8]butstudiestodeterminetheconcentrationofPFASsinserum
of workers with an occupational exposure (in the order of 10002000 ng mL1)
and general population (about 100 times lower) did not begin until the 1990s
and 2000s, respectively [9,10]. The exposure to PFASs is likely to occur via
several routes e.g. ingestion (e.g. food, drinking water, dust, etc), dermal
contact and inhalation [11] and they are widely distributed in the body and
especially in blood, liver and kidney [12]. Major PFASs found in human serum
are PFOS, perfluorooctanoic acid (PFOA) and perfluorohexane sulfonate
(PFHxS), although long chain perfluoroalkyl carboxylates (e.g. C9C14) are also
foundinthesebiologicalmatricesatrelevantconcentrations[1316].141516

The determination of PFASs in blood samples (i.e. whole blood, serum


and plasma) is mostly made by liquid chromatography (LC)tandem mass
spectrometry (MS/MS) with negative electrospray ionization (ESI) interfaces
[16,17].ComparisonofextractionandquantitationmethodsforPFASsinhuman

[7] The 9 new POPs under the Stockholm Convention, available at:
http://chm.pops.int/Programmes/New%20POPs/The%209%20new%20POPs/tabid/672/la
nguage/en-US/Default.aspx.
[8] D.R. Taves, Nature 217 (1968) 1050.
[9] F.D. Gilliland, J.S. Mandel, Am. J. Ind. Med. 29 (1996) 560.
[10] K.J. Hansen, L.A. Clemen, M.E. Ellefson, H.O. Johnson, Environ. Sci. Technol. 35
(2001) 766.
[11] Y. Pico, M. Farre, M. Llorca, D. Barcelo, Crit. Rev. Food Sci. Nutr. 51 (2011) 605.
[12] K. Kannan, Environ. Chem.8 (2011) 333.
[13] K. Kannan, S. Corsolini, J. Falandysz, G. Fillmann, K.S. Kumar, B.G. Loganathan,
M.A. Mohd, J. Olivero, N. van Wouwe, J.H. Yang, K.M. Aldous, Environ. Sci. Technol.
38 (2004) 4489.
[14] A.M. Calafat, L.L. Needham, Z. Kuklenyik, J.A. Reidy, J.S. Tully, M. AguilarVillalobos, L.P. Naeher, Chemosphere 63 (2006) 490.
[15] D.J. Ehresman, J.W. Froehlich, G.W. Olsen, S. Chang, J.L. Butenhoff, Environ. Res.
103 (2007) 176.
[16] L.S. Haug, C. Thomsen, G. Becher, J. Chromatogr. A, 1216 (2009) 385.
[17] A. Jahnke, U. Berger, J. Chromatogr. A, 1216 (2009) 410.

- 179 -

ParteII
plasma, serum and whole blood has been reported [18]. Current sample
treatmentsforPFASsanalysisaremostlybasedonionpairextractionemploying
methyltertbutylether after reaction with tetrabutylammonium [10], solvent
extraction with acetonitrile [3,19] or solid phase extraction (SPE), both offline
[15,20,21]orcolumnswitching[16,22,23].Organicsolventvolumesaround10
15 mL [3,13,18] and times between 15 min and 16 h are spent by extraction
[13,18,20,21].Acidification[20,22],alkalinedigestion[21]oradditionoforganic
solvent to samples [3,16,18,23] are usually carried out prior SPE in order to
prevent the clogging of pre/columns caused by the precipitation of blood
proteins. Cleanup strategies include column washing [15,20,22], filtration
[10,20],centrifugation[22],dispersivegraphitizedcarbonwithglacialaceticacid
[3], and Wax SPE of extracts [19], being common the use of multiplesteps
methods. Main drawbacks of these strategies are much handson time due to
theneedforrepetitivewashes[10],lowrecoveriesforlongchainPFASsdueto
coprecipitation with serum protein [16,19], thorough washings of SPE
cartridges after sample percolation [15,19], problems of contamination in the
different procedural steps, lack of enrichment or even dilution of the samples
(only online SPE techniques permit to concentrate them) or the need for
additional column switching equipment investments [16,22,23]. In addition
most of the developed methodologies require matrixmatched calibration for
accurate quantitation of PFASs. Usual detection limits (LODs) are in the range
0.13 ng mL1 [17] although a method allowing PFAS quantification at
concentrations as low as 0.05 ng PFAS mL1 serum has been reported [16].
Accordingtotheabovestatements,thedevelopmentofnewmethodsforexact
[18] W.K. Reagen, M.E. Ellefson, K. Kannan, J.P. Giesy, Anal. Chim. Acta 628 (2008)
214
[19] L.W.Y. Yeung, S. Taniyasu, K. Kannan, D.Z.Y. Xu, K.S. Guruge, P.K.S. Lam, N.
Yamashita, J. Chromatogr. A 1216 (2009) 4950.
[20] A. Krrman, B. van Bavel, U. Jrnberg, L. Hardell, G. Lindsrm, Anal. Chem. 77
(2005) 864.
[21] S. Taniyasu, K. Kannan, M.K. So, A. Gulkowska, E. Sinclair, T. Okazawa, N.
Yamashita, J. Chromatogr. A 1093 (2005) 89.
[22] Z. Kuklenyik, L.L. Needham, A.M. Calafat, Anal Chem. 77 (2005) 6085.
[23] A. Holm, S.R. Wilson, P. Molander, E. Lundanes, T. Greibrokk, J. Sep. Sci. 27
(2004) 1071.

- 180 -

Captulo5
quantitation of PFASs, which feature straightforward and reduced sample
handling(thusreducingriskofcontaminationandlossofanalytes)isnecessary
forlargescalehumanbiomonitoring.Withthisaim,thisarticleinvestigatesthe
potentialofamphiphilebasedsupramolecularsolvents.

Supramolecular solvents (SUPRASs) are waterimmiscible liquids made


up of supramolecular assemblies dispersed in a continuous phase. The
outstanding properties of SUPRASs for extractions derive from their special
structureandthehighconcentrationoftheorderedaggregatesthatconstitute
them,whichprovideahugeamountofbindingsites.SUPRASshaveregionsof
differentpolaritythatofferavarietyofinteractions(e.g.hydrophobic,hydrogen
bonds, iondipole, cation) for the extraction of analytes with a wide polarity
range. These properties permit the development of simple and robust sample
treatment methods for most of the solutes, especially for amphiphilic
compounds which form mixed aggregates with the ordered structures in the
solvents. To date, SUPRASs based on nonionic [24], zwitterionic [25], cationic
[26] and anionic [27] aqueous micelles, reverse micelles [28] and vesicles [29]
have been successfully used for the extraction of pollutants from biological,
food and environmental samples. A review covering progress on both
theoreticalandpracticalaspectsrelatedtotheuseofsupramolecularsolvents
for analytical extractions has been recently reported [30]. Applications have
mainlyfocusontheextractionofpolycyclicaromatichydrocarbons,pesticides,
surfactants, pharmaceuticals, vitamins, drugs, dyes, hormones, bisphenol A,
phenols and toxins mainly in liquids [e.g. 28,3134]32 and33 more34 recently in

[24] R. Carabias-Martnez, E. Rodrguez-Gonzalo, B. Moreno-Cordero, J.L. PrezPavn, C. Garca-Pinto, E. Frnandez_laespada, J. Chromatogr. A 902 (2000) 251.
[25] T. Saitoh, W. L. Hinze, Anal. Chem. 63 (1991) 2520.
[26] X. Jin, M. Zhu, E. D. Conte, Anal. Chem. 71 (1999) 514.
[27] I. Casero, D. Sicilia, S. Rubio, D. Prez-Bendito, Anal. Chem. 71 (1999) 4519.
[28] F. J. Ruiz, S. Rubio, D. Prez-Bendito, Anal. Chem. 79 (2007) 7473
[29] F. J. Ruiz, S. Rubio, D. Prez-Bendito, Anal. Chem. 78 (2006) 7229.
[30] A. Ballesteros-Gmez, M.D. Sicilia, S. Rubio, Anal. Chim. Acta 677 (2010) 108.
[31] A. Garca-Prieto, M.L. Lunar, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 630
(2008) 19.

- 181 -

ParteII
solid samples [3537].36 Supramolecular37 solvents are compatible with LC but
they have to be removed before injection in gas chromatography or capillary
electrophoresis.

Againstconventionalorganicsolvents,SUPRASsarespeciallysuitedfor
the extraction of amphiphilic contaminants such as PFASs since analyte
extractant mixed aggregates are formed through both interactions between
fluorocarbonchainsandpolargroups.TheuseofSUPRASsfortheextractionof
theseemergingcontaminantsisherepresentedforthefirsttime.Withthisaim,
aSUPRASmadeupofhexanoicacidreversemicelleswasheresynthesizedfor
the first time through a selfassembly process, and then characterized and
assessedfortheextraction/concentrationofPFASsfromserumsamplespriorto
LC/Triple quadrupole (QQQ) MSMS determination. The selection of hexanoic
acid(HA)wasbasedonboththedispersionandhydrogenbondinginteractions
theycanestablishwithPFASsanditsshorthydrocarbonchainlengththatallows
an early elution from the chromatographic column thus preventing coelution
with the PFASs usually found in blood (i.e. PFHxS, PFOS, PFOA and C9C14
perfluoroalkyl carboxylates). Carboxylic acids with chain lengths shorter than
hexanoic acid were not employed because of their high water solubility and
accordingly low yield of SUPRAS production under the proper selfassembly
conditions.Parametersaffectingextractionefficiencyandconcentrationfactors
were optimised and the applicability of the proposed method to the
determinationofPFASsindifferentserawasassessed.

[32] A. Ballesteros-Gmez, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1216 (2009)


530.
[33] F.J. Ruiz, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1163 (2007) 269.
[34] F.J. Lpez-Jimnez, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1195 (2008) 25.
[35] M. Cantero, S. Rubio, D. Prez-Bendito, J. Chromatogr. A 1046 (2004)147.
[36] S. Garca-Fonseca, A. Ballesteros-Gmez, S. Rubio, D. Prez-Bendito, J.
Chromatogr. A 1217 (2010) 2376.
[37] E.M. Costi, M.D. Sicilia, S. Rubio, J. Chromatogr. A 1217 (2010) 1447.

- 182 -

Captulo5
2.Experimental

2.1.Chemicals

The seven target PFASs studied were as follows: PFOA,


perfluorononanoic

acid

(PFNA);

perfluorodecanoic

acid

(PFDA),

perfluoroundecanoic acid (PFUnDA); perfluorotetradecanoic acid (PFTeDA),


potassium perfluoro1hexanesulfonate (PFHxS) and PFOS. PFOA, PFNA, PFDA,
PFHxS and PFOS were supplied by Wellington Laboratories and PFUnDA and
PFTeDA were obtained from Aldrich (Schenelldorpf, Germany). Stable isotope
analogues,

18

O2PFHxS (MPFHxS),

13

C2PFDA (MPFDA),

13

C4PFOA (MPFOA),

13

C4PFOS (MPFOS),

13

13

C5PFNA (MPFNA),

C2PFUnDA (MPFUnDA) and

13

C2

perfluododecanoic acid (MPFDoDA), supplied by Wellington Laboratories


(Ontario, Canada), were used as internal standards (ISs) to control potential
lossesofPFASsduringextractionandMSperformance(e.g.ionsuppressionand
enhancement).

Hexanoic acid, sodium taurodeoxycholate hydrate (TDCA) and


ammonium acetate were purchased from SigmaAldrich (Steinheim, Germany)
and LCgrade methanol, tetrahydrofuran (THF) and hydrochloric acid were
obtained from Panreac (Madrid, Spain). Ultrahighquality water was obtained
from a MilliQ water purification system (Millipore, Madrid, Spain). Stock
standardsolutions,eachcontainingamixtureoftargetPFASsormethodISsat
100 ng mL1, were prepared in methanol and stored in closed polypropylene
tubesat4C.Standardswerepreparedbydilutionofthestocksolutionwitha
75:25THF:water(v/v)mixturesolution.

2.2.Apparatusandmaterials

The LCMS system used was an AB Sciex 4000 Qtrap mass


spectrometer (Foster city, California, USA), with a negativeion TurboSpray
interfacecoupledtoanAgilent1200SeriesLCsystem(PaloAlto,CA,USA).The
stationary phase was a SymmetryShieldTM RP 18 column (particle size 3.5 m,

- 183 -

ParteII
i.d. 2.1mm, length 50 mm) from Waters (Milford, MA, USA). A
SymmetryShieldTM RP8guardcolumn(particlesize3.5m,i.d.3.9mm,length
20 mm) was inserted before the analytical column. Coloumetric Karl Fischer
titrator from Metrohm (Herisau, Suize) was used for determination of water
content in the SUPRAS. Two mlmicrotubes SafeLock from Eppendorf Iberica
(Madrid,Spain),glassballs(3mmdiameter)fromAlbus(Crdoba,Spain),aReax
Heidolphvortex(Schwabach,Germany),withanattachmentfor10testtubes,a
High Speed Brushless centrifuge MPW350R (Warsaw, Poland), and a 50L
microsyringe 750 NR from Hamilton (Bonaduz, Switzerland) were used for
sample preparation and extraction. The volume obtained of SUPRASs under
different experimental conditions was measured with a digital calliper from
MedidPrecision,S.A.(Barcelona,Spain).

2.3.SUPRAScharacterization

The composition and volume produced of hexanoic acidbased


SUPRASs,assynthesizedthroughaprocessofselfassemblyoftheamphipilein
mixturesofTHFandwater,weredetermined.Nonlinearregressionwasusedto
fitamodelforthepredictionofthevolumeofSUPRASafterseparationfromthe
equilibriumsolution(n=70).ThestatisticprogramStatgraphicplus3.0wasused
for this purpose. Regarding SUPRAS composition, a variety of solvents were
preparedfrombulksolutionswithconcentrationsofHAandTHFintheranges
of210%(v/v)andof150%(v/v),respectively.Watercontentwasdetermined
byinjectingaliquotsoftheSUPRASsinacoloumetricKarlFishertitratorandTHF
was calculated by weighing after removing water and THF from a certain
amount of SUPRASs (~1 g) by just allowing to stand at room temperature in
open tubes for 7 days, period during which THF and water was completely
evaporated.Waterevaporationwascheckedbycoulometrictitration.

- 184 -

Captulo5
2.4.DeterminationofPFASsinserumsamples

2.4.1.Samplecollectionandpreservation

Animal serum samples (newborn calf, sheep, bovine, horse) were


purchasedfromInvitrogen(Barcelona,Spain)andhumanserum sampleswere
kindly provided by the laboratory of clinical analyses Jos Ortega Cruz
(Crdoba, Spain) from anonymous donors. Samples were stored at 20C until
theiranalysis.

2.4.2.SamplepreparationandSUPRASbasedmicroextraction

Thefrozenserumsampleswereallowedtothawatroomtemperature
andshakenuntilhomogenization.ExtractionofPFASswasperformedbymixing
asamplealiquotof765Lofserum,38LofHCl(12M),97Lofhexanoicacid,
600 L of THF and 18 L of ISs (100 ng mL1 in methanol) into a 2 ml
polypropylenecentrifugemicrotubewith34glassballs(3mmdiameter)atthe
bottom. Glass balls were added to accelerate and enhance sample mixing and
extraction. The mixtures were vortexshaken for 7 min and then centrifuged
(15,000 rpm, 15C, 13 minutes) to achieve the complete separation and
clarificationoftheSUPRAS(i.e.thesupernatant)formedintothebulksolution.
ThevolumeofSUPRAS(360L)wascalculatedbymeasuringitsheightwitha
digitalcalliper.MoreinformationregardingsynthesisofSUPRASsisdetailedin
3.2.1. Finally, an aliquot of SUPRAS was withdrawn with a microsyringe and
transferred to autosampler glass vials with inserts. Samples were capped with
aluminum/siliconeseptumbarriers(Supelco,Bellefonte,USA)andsubjectedto
LC/MS/MSanalysis.

2.4.3.QuantitationofPFASsbyLC(ESI)QQQMS2

The target PFASs were separated and quantified by using LC coupled


with a turbo spray interface operating in the negative ion mode prior to the
Qtrap mass spectrometer. Quantitative analyses were performed on the

- 185 -

ParteII
ScheduledMRMmoderecordingthetransitionsbetweentheprecursorionand
thetwomostabundantproductsions.Table1showsthequantifierandqualifier
ionsusedforeachnativePFASandthequantifierionfortheISs.Thequantifier
andqualifierionsforTDCA(acommoninterferenceforPFOS)arealsogiven.

Table 1. Quantifier and qualifier ion transitions and MS parameters used to


determine PFASs in serum samples.
Targetcompound

MethodISs
Quantifier
Qualifier

transition transition
18
PFHxS
399>119
399>119
O2PFHxS 403>119
13
PFOA
413>369
413>169
C4PFOA 417>372
13
PFOS
499>99
499>99

C4PFOS
503>99
PFNA
463>419
463>219 13C5PFNA 468>423
PFDA
513>469
513>219 13C2PFDA 515>470
PFUnDA 563>519
563>269 13C2PFUdDA 565>520
PFTeDA
713>669
713>369 13C2PFDoDA 615>570
TDCA
498.3>80
(PFOS
498.3>107

interfe
498.3>124
rence)
PFCAsprecursorion[MH],quantifierproduction[MCOOH]
PFHxSprecursorion[MK],quantifierproduction[CF3CF2]
PFOSprecursorion[MK],quantifierproduction[FSO3]
DP;Declusteringpotential
CE;Collisionenergy
CXP;Collisioncellexitpotencial

MSparameters
DP
CE CXP
(V)
(V) (V)
95
48
1
45
16
9
100 72 15
40
16 21
40
16 21
50
22 37
75
16 11
100

72

15

Theinjectionvolumeusedwas10L.Themobilephaseconsistedof2
mMaqueousammoniumacetate(A)andmethanol(B)ataflowrateof0.3ml
min1. The temperature for the analytical column was set at 30 C and the
gradientelutionwasprogrammedasfollows:lineargradientfrom0to100%of
methanolfor50min,andthenrevertingtoinitialconditionsallowing10minfor
stabilization.Theeluatesfromtheanalyticalcolumnweredivertedbyswitching
valvetowastefrom0to 30.5minutesinorder toavoidtheentryofhexanoic
acidandthemostpolarmatrixcompoundsinthemassspectrometer.TheTurbo
spraysettingswereasfollows:curtaingas(N2)30psi;ionsprayvoltage4500V;

- 186 -

Captulo5
temperature450C;nebulizerandturbogas70psi.Declusteringpotential(DP),
collision energy (CE) and collision cell exit potential (CXP) parameters were
optimizedforeachanalyte(Table1).UnitresolutionwasusedforbothQ1 and
Q3quadrupoles.CalibrationcurveswereconstructedatconcentrationsofPFASs
overtherangesstatedinTable2withaconcentrationofthemethodISsof5ng
mL1.

Table 2. Figures of merit of the quantitation of PFASs with the proposed


method.

PFHxS
PFOA

Solvent
Calibration
range
(ngmL1)
0.130
0.0130

PFOS

0.0530

0.9995

36.3

29

10

PFNA

0.0130

0.9996

35.4

PFDA

0.0530

0.9997

37.7

29

10

PFUnDA

0.0530

0.9991

39.1

29

10

PFASs

Correlation
coefficient
(r)

Retention
time
(min)

Method
LOQ
(pgmL1)

Method
LOD
(pgmL1)

0.9997
0.9998

31.6
33.8

59
6

20
2

PFTeDA 0.0530
0.9994
42.7
29
10
n=8;
b
Calculatedonthebasisof80%recoveriesforPFCs(meanrecoveriesfromall
analyzedserumsamples).
a

3.Resultsanddiscussion

3.1.Sourcesandcontrolofbackgroundcontamination

One typical problem in determining PFASs is the background


contaminationarisingfromthepresenceofavarietyoffluoropolymermaterials

- 187 -

ParteII
in the components of LC equipment or labware [38]. As a precautionary
measure, an additional column (Water Symmetry 3.5 m, 4.6 mm 75 mm)
wasinsertedbetweenthepumpandinjectorinordertotrapPFASspotentially
released from the instrument. Contamination arising from labware was
preventedbyusingdisposablepolypropylenetubes,aluminum/siliconesepta,a
glassmicrosyringe,nylonsyringefiltersandglasscoatedroundmagneticstirring
bars. Procedural contamination was investigated by adding distilled water at
different hydrochloric acid concentrations (1501500 mM) into polypropylene
centrifuge microtubes, instead of serum samples, and subjecting them to
different supramolecular microextraction conditions (i.e. several hexanoic acid
and tetrahydrofuran concentrations and vortexshaken and centrifugation at
variable times). No contamination of PFASs was observed above the method
detectionlimits.Appropriatecontrolreagentblankswereroutinelyinjectedinto
the instrument during sample processing sequences in order to check for
potentialproceduralorinstrumentalcontamination.

3.2.DescriptionandcharacterizationofhexanoicacidbasedSUPRASs

3.2.1.Synthesis

SUPRASs were synthesized by adding water to solutions containing


hexanoicacidinTHF.WaterpromotedtheselfassemblyofHAandcausedthe
spontaneous formation of oily droplets (i.e. coacervate droplets) that
flocculatedthroughtheformationofconglomeratesofindividualdroplets.The
overall density of such conglomerates was slightly lower than that of the
solutioninwhichtheywereformed,leadingtocreamingandphaseseparation
(coacervate phase or SUPRAS) from the bulk solution. The term creaming is
defined as the macroscopic separation of a dilute emulsion into a highly
concentrated emulsion, in which interglobular contact is important, and a
continuous phase, under the action of gravity or a centrifugal field. This

[38] N.Yamashita, K. Kannan, S. Taniyasu, Y. Horii, T. Okazawa,G. Petrick,T. Gamo,


Environ. Sci. Technol. 38 (2004) 5522.

- 188 -

Captulo5
separation usually occurs upward, but the term may still be applied if the
relative densities of the dispersed and continuous phases are such that the
concentrated emulsion settles downward [39]. The process occurred from the
protonated hexanoic acid form (pKa 4.80.1), so pH values below 4 were
requiredfortheformationoftheSUPRAS.

Figure1showstherelativeconcentrationsofTHFandhexanoicacidat
whichcoacervationoccurredleadingtotheformationoftheSUPRAS.

%THF(v/v)

100
90
80
70

Hexanoicacidisotropicsolution

60
50
40
Coacervation

30
20
10
1
0

6
8
%Hexanoicacid(v/v)

10

12

Figure1. Phase diagram for the hexanoic acid in mixtures of tetrahydrofuran


and water.

Only concentrations of HA within the range of analytical interest were


investigated(e.g.below~10%).Water,thethirdcomponent,isnotrepresented
in this figure but its concentration can be easily calculated as the difference
[39] IUPAC. Compendium of Chemical Terminology (Gold Book) version 2.3. pp.346,
available at: http://goldbook.iupac.org/PDF/goldbook.

- 189 -

ParteII
between 100 and the sum of the percentages of HA and THF. Above the
coacervationregion,theSUPRASsolubilisedintheTHF:waterbulksolution,the
boundarybeingdependentontheamphiphile(i.e.hexanoicacid)concentration.
Ontheotherhand,theSUPRASwasonlypartiallyformedatpercentagesofTHF
below1%whereamisciblemixtureofhexanoicacidandSUPRASwasobtained.
Itisworthmentioningthebehaviorfoundforthehexanoicacidinmixturesat
relativeconcentrationsof0.5%forHAand0.54.5%forTHF.Inthesesolutions
HA was completely solubilized; however, the SUPRAS started to form at a
concentrationof5%ofTHF,despitethefactofthehighersolubilityofHAinthis
medium.

3.2.2.Composition

Table 3 shows the composition of the SUPRASs obtained from bulk


solutionscontainingTHF,waterandHAatdifferentproportions.Thepercentage
ofHAincorporatedintheSUPRASfromtheamountinitiallypresentinthebulk
solutionisalsoincluded.

The composition of the SUPRAS was THF dependent; the higher the
contentofTHFinthebulksolutionthehigherthepercentagesofTHFandwater
intheSUPRAS,thisleadingtothesynthesisofsolventsprogressivelycontaining
decreased concentrations of HA. On the other hand, the amount of hexanoic
acidremaininginthebulksolutionafterSUPRASseparationwasbothTHFand
HA dependent. Thus, at HA concentrations above approximately 3%, the self
assembly of the amphiphile was favored as the THF in the bulk solution, and
consequently in the SUPRAS, increased. Incorporation of HA tothe coacervate
phasewaspracticallyquantitativeasthepercentageofTHFinthebulksolution
ranged from 30 to 50%. The opposite was found for SUPRAS concentrations
nearly and below 2%; solubilization of the amphiphile in the equilibrium
solutionwasfavoredwithincreasingconcentrationsofTHFanditsincorporation
into the SUPRAS did not exceed the 60% over the range investigated. This
behavior, as it was expected, negatively influenced the extraction processes
since solutes partitioned between the amphiphile in the SUPRAS and the

- 190 -

Captulo5
equilibrium solution. As an example, recoveries for PFASs ranged from 39 to
67%withSUPRASssynthesizedfrom2%ofHAand40%ofTHFandfrom80to
94% with SUPRAS synthesized from 5% of HA and 50% of THF despite the
SUPRAS composition was practically the same (see Table 3). So, only SUPRASs
synthesized at hexanoic acid concentrations above 3% were considered in this
study.

Table 3. SUPRAS compositions and percentage of hexanoic acid (HA)


incorporated into SUPRASs at different initial percentages of THF and HA in
bulk solutions.

94
88
83
79
70
58
37
27
16
11

78
76
81
85
82
81
98
91
95

%ofHAincorporated
inSUPRAS

6
6
7
8
9
9
10
12
15
19

SUPRAS
composition
(w/w,%)

HA

6
10
13
21
33
53
61
69
70

SUPRAS
composition
(w/w,%)

10

water

48
50
53
56
67
56
39
25

%ofHAincorporated
inSUPRAS

95
85
79
67
65
55
33
19
10

HA

5
6
7
8
8
9
10
14
20

water

%ofHAincorporated
inSUPRAS

9
14
25
27
36
57
67
70

SUPRAS
composition
(w/w,%)

THF

HA

0
1
2
3
5
10
20
30
40
50

water

%
THF
(v/v)

THF

%HA(v/v)
5

THF

5
9
10
20
31
48
58
64
67

5
6
6
7
8
9
10
11
12
14

95

89 72
85 75
83 84
72 86
60 83
42 91
31 98
24 104
19 110

3.2.3.Volumeprediction

ThevolumeofSUPRASobtainedthroughtheselfassemblyofhexanoic
acidwasbothTHFandamphiphiledependent.So,aseriesofexperimentswere

- 191 -

ParteII
carriedouttodevelopanequationforthepredictionofthevolumeofSUPRAS
as a function of these components. The aim was to be able to predict the
maximum concentration factor that could be obtained under given
experimentalconditions.Forthispurpose,asetofSUPRASswaspreparedusing
a variety of amphiphile (310%) and THF (150%) concentrations within the
range of analytical interest according to the results obtained in the above
section.

Nonlinear regression was used to fit a model to the data obtained


(n=60). This procedure uses the algorithm Marquardt as an iterative approach
to minimize the sumofsquares of the vertical distances of the experimental
pointstoaproposedcurvebasedonpreliminaryestimates[40].Theproposed
modelforpredictingthe volumeofSUPRASs(y,L)wasy=1 HA+2 HA THF+
e3THF,beingtheamount ofhexanoic acid(HA,mg)andthepercentageofTHF
(v/v) in the bulk solution, the independent variables. The units of the
parameters 1 and 2 wereLmg1,whiletheparameter3wasdimensionless.
Theresultantequationwas

y=0.69HA+0.0761HATHF+e0,1047THF[1]

The asymptotic standard errors of 1, 2 and 3 were 0.05, 0.004 and


0.0006, respectively and the determination coefficient was 99.126 %, thus
indicating a good capability of prediction of this equation. So, the maximum
concentration factors that can be achieved with hexanoic acidbased SUPRASs
under given conditions can be known a priori and this makes easier method
selectionandoptimization.

[40] N.R. Draper, H. Smith, Applied Regression Analysis, third ed., Willey-Interscience,
New York, 1998, 505

- 192 -

Captulo5
3.2.4.Handlingofsupramolecularsolvents

Application of supramolecular solvents to the extraction of analytes


from liquid samples (e.g. urine) always involves their spontaneous formation
into the target sample after the addition of solvent ingredients (e.g. THF and
hexanoicacid).PracticalaspectsrelatedtotheuseofSUPRASfortheextraction
of contaminants on liquid food have been reviewed [30,32]. As extraction of
solid samples is of interest, supramolecular solvents made up of reverse
micelles can be previously synthesized and then aliquots used for extraction
[37].Inthiscase,thesynthesisofSUPRASsisusuallycarriedoutin100mLglass
centrifugetubewhichpermitstoobtainenoughvolumetotreat1020samples.
The SUPRAS is then withdrawn using a 1 mLsyringe, transferred to a
hermeticallyclosedstorageglassvialtoavoidTHFlossesandthenstoredat4C.
Under these conditions, reverse micellebased SUPRAS are stable for at least
onemonth.

3.3.Optimization

Optimization of the microextraction process was carried out by


extracting 622979 l of distilled water or newborn calf serum fortified with 5
gL1ofthetargetPFASsunderavarietyofexperimentalconditions:4.37.5%
(v/v) of hexanoic acid, 1550% (v/v) of THF, 691800 mM of hydrochloric acid
(molesofHClmL1 ofserum);stirringtime040min.Thefinalvolumewas1.5
ml. Extractions were carried out according to the procedure specified in the
section2.4.2andvaryingeachvariableinturnwhilekeepingtheotherconstant.
ISs were added just prior injection in order to correct MS performance and
matrix effects and ensure accurate quantitation during optimization.
Experiments were made in triplicate. Selection of the optimal conditions was
basedontherecoveries(R)andactualconcentrationfactors[ACF=0.01R(%)x
phase volume ratio (PVR)] obtained for PFASs. Phase volume ratios were
calculated as the ratio of sample volume over the SUPRAS volume, so they
represented the maximum ACFs that could be obtained under given
experimental conditions. Two criteria were considered for variable selection,

- 193 -

ParteII
namely the highest possible ACF and recoveries above 75%. The variables
investigated were THF and HA concentrations, pH , analyte concentration and
stirringtime.

Because of the water content of serum, SUPRASs were spontaneously


synthesized in these matrices, in a similar way to that occurring in aqueous
solutions, as hexanoic acid and THF were added to the samples. The SUPRAS
wasclearlyvisibleasanimmiscibleliquidafter centrifugationaccording tothe
procedure in section 2.4.2. The volume of SUPRAS thus obtained fit to the
equation[1]intherangeofhexanoicacidandTHFconcentrationsspecifiedin
the section 3.2.3. Proteins in the serum agglutinated at percentages of THF
below20%(v/v)andstoodasagelatinouslayerbetween theSUPRASand the
serumaftercentrifugation.ProteinsdidnotflocculateatpercentagesofTHFin
therange2550%(v/v)andremainedasadenseprecipitateatthebottom.

The acidity of the medium was found essential to efficiently extract


PFASsfromserum.Onthecontrary,extractionefficiencyforthesesolutesfrom
water(R=90100%)wasratherindependentofthepHintherangeofexistence
ofhexanoicacidbasedSUPRASs(i.e.below4).InteractionbetweenPFASsand
matrixcomponentswereexpectedtobethereasonforthedifferentbehaviour
observedinserumandwater.Table4showstherecoveriesobtainedforPFAS
spikedserumasafunctionoftheconcentrationofhydrochloricacid;theywere
maximalandabove75%fromaround300mMandthentheykeptconstantup
to 1800 mM. Increased acidity possibly favoured the break of PFASmatrix
bonds since the extraction efficiency for PFASs increased when HCl
concentrationdid.AconcentrationofHClof600mM(molofHCl/mlofserum)
wasselectedasoptimalinordertomakethemethodrobustagainstvariations
intheamountofmatrixcomponentspresentinthesamples.

Table5showstherecoveriesobtainedforPFASsinserumasafunction
of both THF and hexanoic acid concentrations. The volume of SUPRAS, and so
concentrationfactors,alsovariedwiththesereagentsaccordingtotheequation
1.Recoveriesabove75%andfluorocarbonchainlengthindependentwere

- 194 -

Captulo5
Table 4. Mean PFAS recoveries and standard deviation (R S, %) from spiked
serum samples as a function of the concentration of hydrochloric acid.

PFTeDA

PFUnDA

PFDA

PFNA

PFOS

PFOA

molof
HCl/ml
ofserum

PFHxS

Analytes(RSa)

69
513 452 643 481 542 543 701
100
502 441 554 472 521 551 674
140
521 474 652 505 553 603 683
164
524 525 654 573 612 663 742
267
703 824 794 812 832 811 842
398
815 863 783 841 842 822 842
792
734 861 831 831 863 831 801
1500
775 822 844 822 811 801 802
1800
735 813 781 801 832 822 831
a
Hexanoicacid=6.5%andTHF=40%;n=3;spikedPFASconcentration=5gL1.

obtained with SUPRASs made from 35% (v/v) of THF and 5.4% (v/v) of HA.
Recoveries increased with the concentration of THF because this solvent
facilitated the rupture of PFASprotein interactions, however SUPRAS volume
alsoincreasedandconsequentlyconcentrationfactorsdiminished.So,valuesof
40% of THF and 6.5% (v/v) of HA were selected as optimal, which provided
recoveries

of

7983%

and

ACFs

of

1.681.76.

Simultaneous

extraction/concentration of PFASs was based on the formation of mixed


aggregatesbydispersionandhydrogenbondanalyte:extractantinteractions.

Recoverieswereintheintervals7390%foralltheanalytesinthewholerange
ofconcentrationassessed(i.e.between0.1and15ngmL1).

Thetimeforextraction(vortexshaking,2.300rpm)wasinvestigatedin
theinterval 040min.Equilibrium conditionswere achievedafter5minowing
tothehighsolubilisingcapabilityoftheSUPRAS.Atimeof7minwasfixedfor
furtherexperimentsinordertogetmaximalreproducibility.

- 195 -

ParteII
Table 5. Mean recoveries and standard deviation (R S, %) of PFASs from
spiked serum samples at 600 moles of HCl/ml of serum as function of the
concentration of hexanoic acid and THF.

THFa
Analytes(RSc)

%(v/v)
PFHxS
PFOA PFOS PFNA
PFDA
25 517
677 551 642
645
30
612
782 734 742
752
35
681
831 811 781
801
40
836
833 794 811
832
45
791
884 822 842
832
50
801
975 925 924
862
HAb

%(v/v)
4.3 611
751 781 781
806
5.4
753
892 861 824
843
6.5
836
833 794 811
832
7.5
773
861 861 861
883
a
Hexanoicacid=6.5%(v/v).
b
THF=40%(v/v).
c
n=3;spikedPFASconcentration=5gL1.

PFUnDA
667
753
811
821
872
922

PFTeDA
712
772
811
832
854
945

816
822
821
883

876
821
832
864

The lack of a masslabelled homologue for PFTeDA led us to examine


thesuitabilityofMPFDoDAasamethodISforthisPFAS.Calfandhuman1sera
samples were subjected to extraction and analysis after fortification with 5 ng
mL1.ofbothmasslabelledandtargetPFASs.PFTeDAwasaccuratelyquantified
withMPFDoDA(recoveriesintherange104106%)duetotheproximityintheir
retention time, similar extraction efficiency and lack of significantly different
matrixeffectsintheelutionwindow.TherestofPFASsrecoverieswereinthe
range95107%.

- 196 -

Captulo5
3.4.Analyticalperformance

3.4.1.Sensitivity

Table2showstheanalyticalfiguresofmeritfortheproposedmethod.
The instrumental limits of quantitation (LOQs) and detection (LODs) were
determinedfromstandardspreparedin75:25THF:water(v/v),containinga5ng
mL1ofthemethodIS,andusingasignaltonoiseratioof10and3,respectively.
Eachcurvepointwasquantifiedusingtheoverallcalibrationcurveandreviewed
foraccuracy.Methodcalibrationaccuracyrequirementsof10025%weremet
forallanalytes.TheLOQsandLODsthusobtainedwere0.1and0.03ngmL1 for
PFHxS;0.05and0.02ngmL1forPFOS,PFDA,PFUnDAandPFTeDA;and0.01and
0.003ngmL1 forPFOAandPFNA;respectively.Correlationbetweenpeakareas
andPFASconcentrationswasdeterminedbylinearregressionand1/xweighted
calibration.Thecorrelationcoefficientswereintherange0.99910.9998forall
analytesindicatinggoodfits.

Duetothelackofblankserumsamples,methodLOQsandLODswere
estimated from the respective instrumental quantitation and detection limits
and the mean actual concentration factor obtained (1.7) considering 80% as
mean recovery for all PFASs (see Table 2). No significant differences in
background noise were observed for serum samples and standards. A typical
chromatogram obtained for a standard solution containing 5 ng mL1 of each
PFASisshowninFigure2a.

3.4.2.Selectivity

AnalysisofPFASsinserumiscommonlyconfrontedwiththepresenceof
coeluting matrix components which can cause ionization suppression or
enhancement in the ESI source and even perfluoroalkyl sulfonic acids (PFSAs)
peak misidentification. Thus, PFSAs have been overreported in serum due to

- 197 -

ParteII
coelutingwithTDCAandsteriodsulfateswhenusingC18columns[19,41].The
masses of these compounds are too close to those of PFHxS and PFOS for
accurate analysis by the oneunit resolution QQQMS and can lead to
overestimationatthe499>80,399>80and399>99transitions.Thisproblemhas
been addressed in various ways including the use of other columns providing
more selective retention mechanisms (e.g. perfluorooctyl, Synergi hydroRP or
ionexchangephasecolumns[19,41,42])ortheuseofmoreselectivebutalso
lesssensitivetransitions(mainly49999and399119[41,42]).Inthisworkwe
quantifiedPFASsinserumusingaC18columnandthemoreselectivetransitions
399>119and499>99topreventPFASmisidentification.Thepresenceofsteroid
sulfates in the human sera analyzed was confirmed by the transition 399>99
whileTDCAisomersweredetectedinallthehumanandanimalserumsamples
at the transitions 498.3>107 and 498.3>80. These interferences coeluted,
therefore using the 399>119 and 499>99 transitions was fundamental to
quantify PFHxS and PFOS properly. Although the use of these transitions
resultedinasomewhatdecreasedsensitivity,theoverallmethodsensitivitywas
sufficient for analysis of human samples. Signal enhancement or suppression
wasestimatedbycomparingtheresponseforISsaddedtotheSUPRASextracts
obtainedafterserumtreatment,justpriorinjection(5ngmL1),totheaverage
response of ISs in the calibration solutions. The serum samples analysed
exhibitedlowsignalsuppression(12%)orenhancement(6%)forallPFASs,
includingPFHxSandPFOS.Therefore,matrixeffectsontheionizationofPFASs
werenegligibleinthismethodandfurthercleanupstepswerenotnecessary.

3.4.3.Precision

The precision of the method was evaluated by extracting 11


independentfortified(5ngmL1)serumsamples(calf,horseandbovine).PFAS

[41] E. Chan, M. Sandhu, J.P. Benskin, M. Ralitsch, N. Thibault, D. Birkholz, J.W.


Martin, Rapid Commun. Mass Spectrom. 23 (2009) 1405.
[42] J.P. Benskin, M. Bataineh, J.W. Martin, Anal. Chem. 79 (2007) 6455.

- 198 -

Captulo5
recoveries ranged between 95 and 111%. The values, expressed as relative
standarddeviation(RSD),werebetween1and6%forallthePFASs.

3.5.Analysisofserumsamples.

Serum samples from animals and humans (n=6) were analyzed in


duplicatetoprovethesuitabilityoftheproposedmethodtodeterminePFASs.
Table 6 lists the concentrations found for the target compounds. Method
recoveriesexpressedasrecoveryforthemethodISs(concentrationlevel;5ng
mL1) ranged between 75 and 89%. Figure 2b shows the selected ion
chromatogramforPFASsextractedfromthesampleofhumanserum1.

Table 6. Mean concentrations (pg mL-1) (n=2) obtained for the target

Simples

PFHxS

PFOA

PFOS

PFNA

PFDA

PFUnDA

PFTeDA

compounds in the analysis of serum samples using the proposed method.

<LOD

14.30.7

197.30.6

233

<LOQ

693

7010

<LOD

171

1562

521

374

724

10813

<LOD

352

<LOQ

452

<LOQ

715

<LOQ

746116

173535

516863

90833

37632

67866

124247

4597171

56533

2615

54823

865

79441

121920

467010

56717

2585

5606

844

Calf
serum
Bovine
serum
Horse
serum
Human
serum1
Human
serum2
Human
serum3

6243

993

No PFHxS neither interferences coming from steroid sulfates were


detectedinthesamplesofanimalorigin;however,interferencescoelutingwith
PFHxS were detected in all the human samples analyzed at the transitions
399>80and399>99,sotheselectivetransition399>119wasemployedfor

- 199 -

ParteII
(a)Standardsolutioncontaining5ngmL1 ofeachPFAS

Intensity,cps

4.1e4_
3.0e4_

PFOA

1700

2.0e4_
1.0e4_
4000.0

0
0

PFNA

PFOS

PFDA

PFHxS
800
0
30

PFUnDA

50

40

10

15

20

Intensity,cps

3.0e4_ (b)Human1serumsample
2.5e4_ 320
2.0e4_
4_

PFHxS

1.0e

30

35

40

45

50

PFOA

160
0
30

PFNA
40

5000.0
0
0

25

PFTeDA

1.5e
4_

PFTeDA

PFHxS PFOS

Waste

10

50

PFDA
PFHxS PFOS PFUnDA
Waste
PFTeDA
35 40
20
25 30
45 50
15
Time,min

Figure 2. LC(ESI)-QQQ MS2 selected ion chromatograms of PFASs obtained


from (a) a standard solution containing 5 ng mL-1 of each PFAS (inset; selected
ion chromatogram of PFHxS and PFOS), and (b) a human-1 serum sample
(inset; selected ion chromatogram of PFHxS and PFTeDA).

quantitation.BilesaltsinterferingwithPFOSweredetectedinbovine,horseand
humansera atthe transition499>80andsothe daughterion99wasusedfor
quantitation.TheconcentrationsofPFASsinanimalsamplesrangedbetween17
and197.3pgmL1 andbetween84and5168pgmL1 inhumansera.RSDswere
between1and15%.ThehighestconcentrationswerefoundforPFOSandPFOA
and both branched and linear PFOS were clearly observed in the
- 200 -

Captulo5
chromatograms for human samples. The presence of longchain PFCAs (PFDA,
PFUnDA and PFTeDA) in human sera highlights the need for their routine
determinationalongwiththemostcommonlyfoundPFOAandPFOS.

4.Conclusions

Asupramolecularsolventconsistingofreverseaggregatesofhexanoic
acid in THF:water mixtures was here described and characterized for the first
time and its suitability as a solvent for the microextraction of PFASs in serum
was proved. The formation of the supramolecular solvent is spontaneous and
requiresminutevolumesofTHF(600Lpersample)thatadditionallyprovokes
the breaking of PFASprotein interactions. The method offers a valuable
alternative to current approaches for the evaluation of human and animal
exposuretothesecontaminants.Themajorbenefitsofthismethodcompared
tootherpreviouslyreportedare:(a)lowervolumeoforganicsolventpersample
extraction(e.g.600LofTHF);(b)shorterextractiontimes(e.g.7minutes);(c)
nocleanuporevaporationofextractsrequired;(d)noneedforadditionalsteps
orreagentsdifferentfromthoseusedfortheextractionsystemitselfforprotein
precipitationandnocontaminationoranalytelossesproducedduringthisstep;
(e) accurate quantitation obtained using IS solventbased calibration; (f) high
sensitivity (e.g.LODs220pg mL1and LOQs659pgmL1).The methodmeets
the analytical and operational requirements to be used in largescale
epidemiologicalstudies.

Acknowledgment

The authors gratefully acknowledge financial support from Spanish


MICINN (Project CTQ201123849), the Andalusian Government (Junta de
Andaluca,Spain,ProjectP09FQM5151)andFEDER.A.BallesterosGmezand
NoeliaLuquearealsogratefultoSpainsMECforawardofdoctoralfellowships
(GrantsAP20054275andAP20043644).

- 201 -


RESUMEN Y DISCUSIN
DE LOS RESULTADOS

Resumenydiscusindelosresultados

1.

INTRODUCCIN

En las investigaciones que se recogen en esta Tesis doctoral se han

desarrollado metodologas analticas para la determinacin de diferentes


contaminantes orgnicos en distintos tipos de muestras ambientales teniendo
como objetivo general la simplificacin, integracin y mejora de las diferentes
etapas del proceso analtico. Estas metodologas pueden englobarse en dos
categoras cada una de las cuales pretende alcanzar unos objetivos ms
especficos; el primer bloque agrupa mtodos para la extraccin,
preconcentracin y estabilizacin de compuestos orgnicos en muestras
acuosas ambientales y el segundo bloque recoge el desarrollo de nuevos
mtodos para la determinacin de sustancias perfluoroalquiladas en muestras
biolgicas, en las que se aborda la mejora de los procesos de extraccin,
deteccin y cuantificacin. Los sistemas extractantes empleados en nuestras
investigaciones

han

sido

adsorbentes

supramoleculares,

disolventes

supramolecularesymezclashidroorgnicas.

EnlaTabla1seresumenlosproblemasanalticosabordadosconcada

sistema extractante, los formatos empleados, las muestras analizadas, los


analitosdeterminadosconsuscaractersticasmsrelevantesparalosprocesos
deextraccinconsideradosylasetapasdelprocesoanalticoqueseintegrano
mejoran con cada metodologa desarrollada. A travs de los diferentes
apartados de esta seccin se pretende ofrecer una panormica general de los
resultados ms relevantes obtenidos en las diferentes etapas del proceso
analtico.

- 205 -

- 206 -

Tipodeinteracciones
posibles

(Pka)

Polaridad
LogKow

6.ANALITOS

5.SISTEMA
EXTRACTANTE

Interaccionescatin,
inicas,dedispersiny
puentesdehidrogeno

(1,5)15,1

1,74,5

Plaguicidas

Interacciones
inicasyde
dispersin

2,94,9

Interacciones
dedispersin

5,76,6

Hidrocarburos
aromticos
policclicos

Micelasacuosas

Microextraccin
lquidolquido

Tensioactivos
de
benzalconio

Hemimicelas/Admicelas

Extraccinenfaseslida

Extraccin,preconcentracin,estabilizacin

3.ETAPASDEL
PROCESOANALTICO
INVESTIGADAS

4.FORMATO

Aguassuperficiales,subterrneasyresiduales

Micelasinversas

Microextraccin
lquidolquido

Extracciny
preconcentracin

Interaccionesdipolo
dipolo,fuerzasde
dispersinypuentes
dehidrgeno

Interaccionesde
dispersiny
puentesde
hidrgeno

(3,6)0,52

1,710,8

Sustanciasperfluoroalquiladas

Tetrahidrofurano:agua
(75:25,v/v)

Microextraccinslido
lquido

Extraccinydeteccin

Tejidosdepescadoyavesysuerosanguneo

Simplificacin de las etapas previas en campaas de Desarrollo de nuevas metodologas para el


monitorizacinambiental
anlisisdesustanciasperfluoroalquiladas

2.MUESTRAS

1.PROBLEMAS
ABORDADOS

Tabla1. Resumen de los objetivos, sistemas extractantes empleados, muestras y analitos analizados.

Resumenydiscusindelosresultados

2.

SISTEMAS SUPRAMOLECULARES PARA LA SIMPLIFICACIN DE

OPERACIONES PREVIAS EN LA DETERMINACIN DE CONTAMINANTES


ENMUESTRASACUOSAS.

Se han desarrollado tres metodologas, basadas en sistemas


supramoleculares, para la simultnea extraccin, preconcentracin y
estabilizacin de distintos tipos de contaminantes orgnicos, con el fin de
integrar y simplificar las distintas etapas de las operaciones previas en los
procesos analticos correspondientes. Los sistemas empleados han sido
disolventes supramoleculares y hemimicelas/admicelas las cuales estn
constituidasporagregadosdetensioactivoquetienenelpotencialdeestablecer
diferentes tipos de interacciones con los analitos/matriz de la muestra y
proporcionanelevadosrendimientosdeextraccindebidoalagrancantidadde
tensioactivoexistenteenlosagregadosporunidaddemasaovolumen.Porotro
lado, estos sistemas supramoleculares presentan ciertas caractersticas
relevantesdesdeelpuntodevistaoperacionalcomoson:segeneranmediante
fenmenos de autoensamblaje al alcance de cualquier laboratorio; estn
constituidos por molculas anfiflicas que son ubicuas en la naturaleza y en la
industria,sonbiodegradables,debajocosteypermitenlasntesisdeagregados
alacarta;presentanbajavolatilidadeinflamabilidad;soncompatiblesconlos
sistemas de separacin y deteccin usados en los procesos analticos; y
estabilizan los compuestos solubilizados permitiendo integrar la recogida de
muestra, transporte, conservacin, extraccin y concentracin de los
contaminantesquesevanadeterminar.

En el primer mtodo se propone la determinacin de tensioactivos de


benzalconio en aguas fluviales y residuales mediante su extraccin,
concentracinyestabilizacinenhemimicelasdedodecilsulfatosobrealmina,
comoadsorbentedeextraccinenfaseslida,ysuposteriorcuantificacincon
cromatografa de lquidos y deteccin fotomtrica. En el segundo mtodo se
proponelaextraccin,preconcentracinyestabilizacindeplaguicidasenaguas
deroypozo,basndosetambinenelusodeunadsorbentesupramolecular,
en este caso constituido por admicelas mixtas de dodecilsulfato y

- 207 -

tetrabutilamonio.Laseparacinanalticaserealizmediantecromatografade
lquidosylacuantificacinsellevoacaboconundetectordediodosenfila.Por
ltimo, en el tercer mtodo desarrollado se emplea un disolvente
supramolecularconstituidopormicelasnormalesdedodecilsulfonatodesodio
para la extraccin, preconcentracin y estabilizacin de los tensioactivos de
benzalconio e hidrocarburos aromticos policclicos en muestras de aguas
fluviales y residuales. La cuantificacin de los compuestos de benzalconio se
realiz con un espectrmetro de masas con trampa inica e interfase
electrospray y los hidrocarburos se cuantificaron mediante deteccin
fluorescente.

LaFigura1resumelosprocedimientosoperacionalesllevadosacaboen
las distintas metodologas y las condiciones de almacenamiento ensayadas en
los estudios de estabilidad de los analitos. A continuacin se presentan los
principales resultados obtenidos en cada etapa del proceso analtico y se
discutenlosaspectosmsrelevantesdelosmismos.

2.1.

Muestrasyanalitos

En el desarrollo experimental de la primera parte de esta Memoria se

abord el anlisis de distintas muestras ambientales acuosas. Los sistemas


acuticosescogidosfueronsistemasdinmicoscongranvariabilidadespacialy
temporaldecontaminantesylasmuestrasobjetodeestudiotuvierondiferente
procedencia; la cuenca fluvial del Guadalquivir a su paso por la ciudad de
Crdoba(rosyarroyos);losinfluentesdelasestacionesdepuradorasdeaguas
residuales(EDARs)deBailn,LinaresyMengibar(Jan)yefluentesdelaEDAR
de Bailn; y aguas subterrneas (pozos) de la provincia de Crdoba. Las aguas
residuales que llegan a las EDARs presentan una composicin variable
dependiendodelasactividadesquesedesarrollenenlazonadondeselocalice
laplantadepuradora.As,losinfluentesquelleganalaEDARdeMengibarson
deorigenprincipalmentedomstico,mientrasqueenBailnyLinaresel50%de
las aguas tratadas tienen procedencia domstica y el otro 50% es de
procedenciaindustrialprincipalmentedelasindustriasdematerialesde

- 208 -

Resumenydiscusindelosresultados

Plaguicidas

PAHs

BASs

1)Formacinde
hemimicelas/admicelas
25mLpH2
1
1,6gL SDS

1)Formacindeldisolventesupramolecular
yextraccindeloscontaminantes
0,1gdeSDSo
12.514mLdeHCl(12M)
25mLdemuestraacuosafortificada
(destiladaoreal)

10mLpH2
1
1,25gL SDS

2)Extraccindelos
contaminantes
25mLdeagua
destilada
fortificadao250
mLdeagua
natural
fortificadaque
contengan
0,03mgdeTBA

250mldeagua
destilada
fortificadao
muestraacuosa
realfortificada
500mgde
alumina

3)Secado

2)Separacindefasesporcentrifugacin

4)Almacenamiento

3)Coleccindeldisolventeformado

Diferentestemperaturas(Tambiente,4Cy
20C)
Diferentescondicionesdeiluminacin(luz
solaryoscuridad)

5)Elucin
Plaguicidas
bsicosyneutros:
1mLde
tetrahidrofurano

Plaguicidas
cidos:2mLde
mezcla0,3M
sosametanol
(90:10v/v)

2mLde
metanol

4)Almacenamiento
Diferentescondicionesdeacidez(3,75y4,2MHCl)
Diferentestemperaturas(35C,Tambiente,4Cy
20C)
Diferentescondicionesdeiluminacin(luzsolary
oscuridad)

6)Determinacin

Cromatografalquidayfotometra

5)Determinacin
Cromatografalquiday
espectrometrademasas
(interfaseelectrospray/
trampainica)

Cromatografa
lquiday
fluorescencia

SDS:dodecilsulfatosdico;TBA:tetrabutilamonio;SDSo:dodecilsulfonatosdico;HCl:cidoclorhdrico

Figura 1. Esquema de las diferentes etapas seguidas para la extraccin,


conservacin y determinacin de los analitos usando fases adsorbentes y
disolventes supramoleculares.

- 209 -

construccin,delaceiteydelautomvil.Enlasaguasnaturales,losfactoresque
condicionanlacomposicindelaguasonmltiples,destacandodenuevoeltipo
deactividad humanaque serealiceenlazonademuestreoylanaturalezade
losmaterialesdelterrenoconlosqueelaguaentraencontacto.Lacuencadel
Guadalquivir est formada por sedimentos terciarios calizos (margas, calizas
margosas,calizasyareniscascalizas)quealsersurcadosporelroGuadalquivir
y sus afluentes, quedaron cubiertos en parte por sedimentos fluviales cuyos
restosformanlasterrazasactuales.Estossuelosestndedicadosprincipalmente
acultivossiendoportantolaagriculturalaactividadquemayorinfluenciatiene
en la calidad de las aguas subterrneas y fluviales a su paso por la ciudad de
Crdoba.

Todas las muestras se filtraron a travs de membranas de nailon o

acetato de celulosa,dependiendodelanaturaleza delosanalitos,de0,45m


detamaodeporoparaeliminarlaspartculassuspendidas.Acontinuacin,el
pHdelasmuestrasseajusta2concidontricooclorhdricoysealmacenaron
enrecipientesdevidriombara4Chastasuanlisis.Puestoquelasmuestras
acuosas se analizaron filtradas, slo los componentes solubles de la matriz
pueden interferir en la extraccin y estabilizacin de los analitos. Aunque la
composicin de las aguas naturales y residuales puede ser muy variable
dependiendo de su naturaleza y localizacin, por lo general los componentes
mayoritarios de las mismas son materia orgnica (cidos hmicos y flvicos,
carbohidratos, grasas, protenas y tensioactivos); coloides inorgnicos (xidos
dehierroymanganeso)ysalesinorgnicas(carbonatos,bicarbonatos,cloruros,
sulfatos,nitratosynitritos,calcio,magnesio,sodioypotasio).Ningunodeestos
componentes afecta a la formacin o propiedades de los adsorbentes y
disolventes supramoleculares utilizados en las investigaciones que se recogen
enestaMemoria[1,2].

[1] A. Garca-Prieto, L. Lunar, S. Rubio, D. Prez-Bendito, Anal. Bioanal. Chem. 388


(2007) 1823.
[2] D. Sicilia, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 460 (2002) 13.

- 210 -

Resumenydiscusindelosresultados
Los contaminantes orgnicos objeto de nuestro estudio se
seleccionaron en base a los problemas de estabilizacin que presentan en las
muestras acuosas ambientales y fueron; compuestos de benzalconio (BASs),
hidrocarburosaromticospolicclicos(PAHs)yplaguicidas.

Los BASs son un grupo de tensioactivos constituidos por sales de

alquilbencildimetilamonio con longitudes variables de la cadena lineal.


Comercialmente se ofrecen como mezclas de homlogos con longitudes de
cadenahidrocarbonadade12,14y16tomosdecarbono.LosBASsanalizados
fueron bromuro de bencildimetildodecil amonio (BDDA); bromuro de
bencildimetiltetradecil amonio (BDTA) y cloruro de bencildimetilhexadecil
amonio (BDHA). Estos compuestos son muy empleados para evitar el
crecimiento bacteriano en un buen nmero de productos de uso domstico
habitual. Su utilizacin provoca la introduccin de estos compuestos en el
ambienteacuticoatravsdelareddesaneamientodelasciudades,sinquelas
EDARs puedan eliminarlos completamente antes de ser vertidos a cauces
fluviales naturales. En el medioambiente, los compuestos de benzalconio son
causantes de efectos ecotoxicolgicos sobre las poblaciones de organismos
acuticos habindose descrito daos incluso sobre mamferos. A pesar de ello
su presencia en aguas naturales no ha sido an legislada. En la Figura 2 se
muestran las estructuras de los BASs estudiados en las investigaciones que
constituyenestaTesis.

CH3
CH3

N+ (CH2)nCH3
CH2

n=11homlogoBASC12(BDDA)
n=13homlogoBASC14(BDTA)
n=15homlogoBASC16(BDHA)

Figura 2. Estructuras de los homlogos del tensioactivo catinico alquilbencil-dimetil-amonio.

- 211 -

La escasa estabilidad de los BASs en muestras acuosas se debe

principalmenteasugrancapacidaddeadsorcin(alrededordel90%)sobrelos
recipientes, independientemente del tipo de material (vidrio, polipropileno o
tefln) [3], siendo necesario la acidificacin del agua a pH 2 o la adicin de
acetonitriloaunaconcentracindel25%(v/v)paraevitardichasperdidas[4,5].
Estudios de biodegradacin aerbica tambin han demostrado que la
estabilidad de los BASs est afectada por la accin microbiolgica. As, los
homlogos BAS C12 y BAS C14 se degradan completamente en una semana
mientras que la degradacin del homlogo BAS C16 es del 30% en el mismo
periododetiempo[6].PuestoquelabiodegradacindelosBASsenlossistemas
acuticossereduceconsiderablementedebidoalaformacindecomplejoscon
tensioactivos aninicos [7], se espera que estos analitos se estabilicen en
cartuchos de extraccin en fase slida (SPE) al adsolubilizarse sobre las
hemimicelasoadmicelasdedodecilsulfatousadascomoadsorbentes.

LosPAHssonungruponumerosodesustanciasderivadasdelbenceno

que se forman cuando la materia orgnica se somete a temperatura elevada


durante un tiempo determinado. Fuentes naturales como las erupciones
volcnicas o los incendios forestales generan PAHs, pero las actividades
humanascomoeltrficointensodevehculos,lascalefaccionesdomsticasolas
plantasindustrialesquedependendelacombustindederivadosdelpetrleoy
del carbn, son fuentes mucho ms importantes. Los PAHs se hallan
omnipresentesenelaire,sueloyaguaysuanlisisqumicoenestasmuestras
es de gran inters debido a que muchos de ellos son considerados agentes
mutgenos y carcingenos. El Benzo(a)pireno es el PAH ms estudiado y es
representativodelosefectosdeloscompuestosdeestegrupo.Estecompuesto,
[3] I. Ferrer, E.T. Furlong, Environ. Sci. Technol. 35 (2001) 2583.
[4] F. Merino, S. Rubio, D. Prez-Bendito, Anal. Chem. 75 (2003) 6799.
[5] M.J. Scott, M.N. Jones, Biochim. Biophys. Acta 1508 (2000) 235.
[6] M.T. Garca, I. Ribosa, T. Guindulain, J. Snchez-Leal, J. Vives-Rego, Environ.
Pollut. 111 (2001) 169.
[7] A. Utsunomiya, Y. Mori, K. Hasegawa, Jpn. J. Toxicol. Environ. Health 44 (1998)
264.

- 212 -

Resumenydiscusindelosresultados
juntoconelBenzo(b)fluoranteno,elBenzo(ghi)perileno,elBenzo(k)fluoranteno
yelIndeno(1,2,3cd)pireno,hasidoincluidosenlalistadesustanciasprioritarias
enelmbitodelapolticadeaguas.LaFigura3muestralasestructurasdelos
PAHsestudiadosenlasinvestigacionesqueconstituyenestaMemoria.

Benzo(a)
antraceno

Benzo(a)
pireno

Benzo(b)
fluoranteno

BaA

BaP

BbF

Benzo(k) Benzo(ghi) Indeno(1,2,3


cd)pireno
fluoranteno perileno
BkF

B(ghi)P

IP

Figura 3. Estructuras de los hidrocarburos aromticos policclicos utilizados


en nuestras investigaciones.

AligualqueocurreconlosBASs,losPAHspresentanbajaestabilidaden

muestras acuosas a causa de la importante adsorcin que se produce en las


paredesdelrecipiente[5].ElporcentajedePAHadsorbidodependedelmaterial
usado, producindose una adsorcin total cuando se usan recipientes de
polietilenoyunasprdidasdealrededordel2030%sielmaterialesvidrio[8].
La adicin de acetonitrilo en una concentracin del 40% (v/v) es una de las
estrategias a las que se recurre para preservar las muestras acuosas, sin
embargo solo evita dichas prdidas durante periodos de transporte y
almacenamiento de pocos das. Otra desventaja que presenta la adicin de
disolventesorgnicosalasmuestrasparasuestabilizacineseldecrecimiento
queprovocaenlasrecuperacionesdelosanalitoscuandoseextraenmediante
SPEdebidoaquesefavorecesuelucin[3].

[8] D. Sicilia, S. Rubio, D. Prez-Bendito, N. Maniasso, E.A.G. Zagatto, Anal. Chim.


Acta 392 (1999) 29.

- 213 -

Los plaguicidas incluyen un elevado nmero de sustancias con gran

diversidad qumica, variabilidad en las propiedades fsicoqumicas y grandes


diferenciasenelcomportamientoambientalytoxicolgico.Actualmente18de
las33sustanciasincluidasenlalistadesustanciasprioritariasenelmbitodela
poltica de aguas son plaguicidas. La Tabla 2 muestra las estructuras de los
plaguicidasestudiadosenlasinvestigacionesqueconstituyenestaTesis.

Tabla2.Estructuras de los plaguicidas investigados.


Familias

Triazinas

Compuestos
Cl

Cl
N

N
CH3 CH2 NH

NH CH

CH3

Atrazina

Carbamatos

CH3
CH3

CH3
H N C O CH
Cl
CH3

H
CH3

N C NH

N C NH

CH3

Clortoluron

CH

Anilidas

CH3
CH3

CH3

Isoproturon
O
NH C CH2 CH3

Cl
Cl

Propanil

CH3

Cl CH2 C N CH CH2 O
CH3
CH2 CH3

Cl CH2 C N C CH2 Cl
CH2 CH3
CH3 CH2

CH3

Metolaclor

Alaclor

Organofosforados

Cl
C
Cl
O

CH
O

Cl

O CH2 CH3

CH2 CH3

Clorfenvinfos

Fenoxiacidos

Clorprofam

Cl
O
CH3

NH CH2 CH3

Simazina
O

CH3

Cloroacetanilidas

CH3 CH2 NH

O
CH3 NH C O

Carbofuran

Fenilureas

CH3

H
O CH

O
C

CH3 O

OH

O CH C OH

Cl

CH3
Cl

2,4D

- 214 -

Cl

Mecoprop

Resumenydiscusindelosresultados
Ladegradacinqueexperimentanlosplaguicidasenlasaguasnaturales
debido a hidrlisis, biodegradacin, fotlisis o evaporacin, es un problema
ampliamente conocido [9] siendo las triazinas, los organofosforados y los
carbamatos los grupos ms afectados. Se han utilizado diferentes estrategias
parasuestabilizacinbasadasenlaadicindecompuestosqumicosyelcontrol
de la temperatura. Sin embargo, el uso de determinadas sustancias qumicas
paraestabilizarunafamiliadeplaguicidaspuedeafectarlaestabilidaddeotros
grupos [10,11] y adems, la estabilizacin slo es efectiva durante 1 2
semanas.

2.2.

Extraccinyconcentracindelosanalitos

Se ha utilizado extraccin en fase slida (SPE) empleando dos tipos de

fases adsorbentes supramoleculares; en una primera aplicacin se extrajeron


losBASsenaguasresidualesyfluvialesmedianteunadsorbentehemimicelarde
dodecil sulfato sobre almina y a continuacin se desarroll una segunda
metodologabasadaenunadsorbentedeadmicelasmixtasdetetrabutilamonio
y dodecil sulfato para la determinacin de plaguicidas en aguas naturales. Por
otro lado, la extraccin de PAHs y BASs se realiz utilizando un disolvente
supramolecularconstituidopormicelasdedodecilsulfonatosdicoapHcido.

[9] D. Barcel, M.C. Hennion, en: Techniques and instrumentation in analytical


chemistry, volume 19: Trace determination of pesticides and their degradation products
in water, Elsevier, Amsterdam, The Netherlands, 2003.
[10] I. Ferrer, D. Barcel, J. Chromatogr. A 778 (1997) 161.
[11] T.C. Mueller, S.A. Senseman, K.H. Carson, A.S. Sciumbato, J. AOAC Int. 84
(2001) 1070.

- 215 -

2.2.1. Sntesis y caractersticas de los sistemas supramoleculares


empleados

a) Fases adsorbentes: hemimicelas de dodecil sulfato y admicelas mixtas de


tetrabutilamonioydodecilsulfatosobrealmina.

Una de las caractersticas que diferencian a las fases adsorbentes


supramoleculares de las tradicionalmente usadas en SPE es la posibilidad de
modificar la naturaleza del adsorbente en funcin de la concentracin de
tensioactivoutilizada.Laisotermadeadsorcindeldodecilsulfatosdico(SDS)
sobre almina a pH 2 nos permite identificar las regiones de formacin de las
diferentesfasesadsorbentes(hemimicelas,hemimicelas/admicelasyadmicelas)
enfuncindelacantidaddetensioactivo.ElpHalqueseproducelaadsorcin
determina la cantidad de tensioactivo que puede adsorberse ya que de este
parmetrodependela densidaddecargadelasuperficie delxidomineral. El
puntodecargacero(pcz)delaalminaesaproximadamente8.5loqueimplica
que la superficie del xido tiene carga positiva a valores de pH inferiores a 7,
siendo pH 2 el utilizado en las metodologas desarrolladas por alcanzarse la
mximadensidaddecarga.LaformacindehemimicelasdeSDSseproducein
situ al filtrar una disolucin del tensioactivo (pH 2) a travs de una tpica
columna de extraccin en fase slida que contiene 500 mg de almina,
previamente acondicionada con una disolucin de cido ntrico 102 M. La
adsorcin de SDS sobre el xido mineral se produce a travs de interacciones
electrostticas,aunquetambinexistenfuertesinteraccionesentrelascadenas
hidrocarbonadas del tensioactivo lo que produce las tpicas estructuras de
tepeeque conformanlashemimicelas.Ademstambinexistelaposibilidad
deformaradmicelasmixtas.Laventajadelosagregadosmixtosesqueaaden
unnuevomecanismoderetencindelosanalitosmedianteelestablecimiento
deinteraccionescatinentreelgrupoaromticodestosyelgrupoamonio
deltetrabutilamonio.

Lascondicionespropuestasparalaextraccindenuestrosanalitosson:
25mgdeSDSabsorbidosporgramodealminaquedanlugaralaformacinde

- 216 -

Resumenydiscusindelosresultados
hemimicelasdeSDSenelcasodeextraccindelosBASs,y80mgdeSDSy0,06
mg de TBA por gramo de almina que originan admicelas mixtas para la
extraccindelosplaguicidas(Figura4).EnamboscasoslaconcentracindeSDS
queseeluirdurantelafiltracindelamuestraserdespreciableyportantose
mantieneconstantelacomposicindeladsorbente.

(B)

HemimicelasdeSDS

mgSDSadsorbed/galumina

(A)

AdmicelasmixtasdeSDSTBA
CHC

1000

CMC

Hemimicellarregion Hemimicellar/
Admicellar
region

Admicellar
region

100

10

0.1

10

100

1000

10000

[SDS]aqueous(mg/L)

Figura 4. (A) Isoterma de adsorcin del SDS a pH 2 y (B) adsorbentes


supramolecures seleccionados para la extraccin de los BASs y plaguicidas.

- 217 -

b)Disolventesupramolecularconstituidopormicelasdecidododecilsulfnico

El disolvente supramolecular (SUPRAS) se forma in situ en la muestra


que contiene los analitos mediante dos procesos secuenciales de
autoensamblaje. Para ello, inicialmente se forman micelas acuosas de
dodecilsulfonatosdicoalaadireltensioactivoalamuestraaconcentraciones
superiores a la concentracin micelar crtica. A continuacin se adiciona cido
clorhdrico, lo que provoca la neutralizacin de las cargas del tensioactivo y
facilita la interaccin entre las micelas, incrementandose su tamao y
produciendo el fenmeno de la coacervacin. La formacin de la nueva fase
lquida, inmiscible con la primera, slo requiere la agitacin de la mezcla
durante 5 minutos. Para acelerar la separacin del disolvente de la mezcla
agua/cidoclorhdricoladisolucinsecentrifugadurante10minutos.Lanueva
faselquidainmiscibleconelaguasesitaenlapartesuperiordeltubolocual
constituyeunaventajaparalamedidadesuvolumenyposteriorrecoleccin.En
laFigura5semuestraeldiagramadefasesdeldodecilsulfonatosdico(SDSA)
en disolucin acuosa donde L indica la regin lquida homognea en la cual
todavanoocurrelaseparacindelasfases;LLeslaregindondeseproducela
coacervacininducidaporelcido;Ecorrespondeaunazonadeemulsin,yS
indicalascondicionesdondeocurrelaprecipitacindeltensioactivo.Laregin
LLeslautilizadaconfinesanalticosyenellaelSUPRASactacomoextractante
y la propia muestra acuosa elimina interferencias al proporcionar una fase
dondeloscompuestosmenoshidrfobosquedansolubilizados.

LascondicionespropuestasparalaextraccindelosBASsyPAHsson25
mLdemuestraacuosaconunaconcentracinfinalde3,75Mo4,2Mdecido
clorhdricoy0,25%(w/v)dedodecilsulfonatosdico.

En estos experimentos se utilizan tubos especialmente diseados por


nuestro grupo de investigacin y fabricados por la empresa Pobel, los cuales
estnbasadosenunconodecentrfugacuyazonasuperiorhasidoestrechada
(7mmd.i.),paraunamejorlecturayrecuperacindelvolumendeldisolvente
supramolecular.

- 218 -

Resumenydiscusindelosresultados

10
8
E

[HCl],M

Regin de formacin del


disolvente
supramolecular
seleccionada

LL

0
0

[SDSA](w/v)

Figura5. Diagrama de fases del dodecilsulfonato sdico (SDSA) en disolucin


acuosa y disolvente supramolecular seleccionado para la extraccin de los
BASs y PAHs.

2.2.2. Extraccinypreconcentracin

a)Plaguicidas.

La capacidad de adsolubilizacin de varias familias de plaguicidas en


adsorbentessupramoleculareshabasidopreviamentedemostradapornuestro
grupo de investigacin [12]. Las investigaciones que se presentan en esta
Memoria demostraron que las admicelas mixtas de SDStetrabutilamonio (80
mg de SDS y 0,05 mg de TBA/g de almina) son el adsorbente ms apropiado
para la extraccin simultnea de distintos grupos de plaguicidas dado que
ademsdelasfuerzasdedispersindelascadenashidrocarbonadasdelSDSe
interacciones inicas del grupo polar del SDS o de la almina sin recubrir
proporciona interacciones catin entre el tetrabutilamonio y los anillos
[12] A. Moral, M.D. Sicilia, S. Rubio, D. Prez-Bendito, Anal. Chim. Acta 608 (2008)
61.

- 219 -

aromticos presentes en todas las estructuras de los plaguicidas investigados


(Figura 4B). El calcio presente en las muestras acuosas debe precipitarse con
SDS antes de su percolacin por los cartuchos ya que los complejos catin
entre el calcio y los plaguicidas desfavorecen las interacciones analitoTBA
afectandoalasextracciones.

Loseluyentestradicionalmenteusadosparaladesorcindelosanalitos
de los adsorbentes supramoleculares son disolventes orgnicos o disoluciones
acuosasaunpHadecuadoquetienenlacapacidaddedestruirlosagregadosde
tensioactivosobreeloxidomineral.Enlaaplicacindesarrolladaseensayaron
losdisolventesorgnicosmetanol,isopropanol,tetrahidrofuranoylamezcla0,3
Mhidrxido sdicometanol(90:10v/v)adiferentesvolmenes,obtenindose
las mejores recuperaciones de plaguicidas bsicos y neutros (carbamatos,
fenilureas,triazinas,anilidas,organofosforadosycloroacetanilidas)con1mLde
tetrahidrofurano. La desorcin de los pesticidas cidos se llev a cabo
empleando una segunda etapa de elucin con 2 mL de la mezcla 0,3 M
hidrxido sdicometanol (90:10 v/v), la cual al percolarse por los cartuchos
cambialacargadelaalminadepositivaanegativacausandolarupturadelos
agregados TBASDS. La pequea proporcin de metanol en la mezcla es
necesariaparaobtenerladesorcindelospesticidascidos.Lasrecuperaciones
de los plaguicidas ensayados fueron cuantitativas a excepcin del carbofuran
(503%).

Losresultadosdelestudiodevolumenderuptura(volumendemuestra
para el cual la recuperacin de analitos disminuye en un 5%) para el mtodo
propuesto mostraron recuperaciones cuantitativas para la mayora de los
plaguicidas con el mximo volumen de muestra ensayado (500 mL). Sin
embargo, las recuperaciones para carbofuran y fenilureas disminuyeron
alrededor de un 50% al percolar 250 mL y 100 mL de muestra acuosa
respectivamente.As,elvolumendemuestrapropuestoparaestemtodofue
de 250 mL como solucin de compromiso. Los factores de preconcentracin
fueron de 250 (250 mL de muestra y 1mL de eluyente) para los plaguicidas
bsicos y neutros y 125 (250 mL de muestra y 2mL de eluyente) para los

- 220 -

Resumenydiscusindelosresultados
plaguicidascidos.Enbaseaestosresultadospodemosdecirqueeladsorbente
admicelar mixto propuesto es una herramienta vlida para la extraccin y
preconcentracin de multiresiduos de pesticidas en base a las diferentes
interacciones que puede establecer con los analitos. Otra caracterstica
destacable del mtodo es el bajo volumen de disolvente orgnico necesario
para la desorcin de los analitos lo cual evita la etapa de evaporacin y
reconstitucindelosextractosquegeneralmenteesnecesariacuandoseusan
adsorbentespolimricosconunelevadogradodeentrecruzamientoodenegro
decarbn.
b)Compuestosdebenzalconio.

La adsolubilizacin de los diferentes homlogos de BASs en las


diferentesregionesdelaisotermadeSDSsobrealminahabasidoinvestigada
pornuestrogrupodeinvestigacin[4].Lasrecuperacionesdeestoscompuestos
catinicos eran cuantitativas independientemente del tipo de fase adsorbente
utilizada (hemimicelas, hemimicelas/admicelas o admicelas) debido a la
formacindeagregadosmixtosconfuertesinteraccionesdedispersineinicas
entrelosgrupospolaresdecargaopuestadelosBASsydelSDS.Sinembargo,la
formacin de admicelas lleva aparejado un reparto de tensioactivo entre el
slido mineral y el tensioactivo en disolucin que tiene como consecuencia la
prdida de tensioactivo, lo que obliga a aadir a la muestra la cantidad
adecuada de SDS para mantener el equilibrio. Debido a ello es preferible
trabajar en la zona hemimicelar en la que no es necesario aadir tensioactivo
durantelapercolacindelamuestra.LacantidaddeSDSseleccionadafuede25
mg/g de almina, despus de comprobar que altas concentraciones de
electrolito(hasta0.2MNaCl)notenainfluenciaenlaadsolubilizacindeestos
compuestosaliniciodelareginhemimicelar.LaelucindelosBASsselleva
cabocon2mLdemetanol.Recuperacionescuantitativasseobtienenalmenos
conmuestrasdehasta1L(noseestudiaronvolmenesmayores),loqueimplica
factores de preconcentracin de 500. Otras fases adsorbentes haban sido
previamente propuestas en bibliografa para la determinacin de BASs, sin
embargolosadsorbentespolimricosneutrosproporcionanrecuperacionesdel
75% [3] y los adsorbentes no polares tipo C18 no se recomiendan debido a las
- 221 -

fuertes interacciones entre los BASs y los grupos silanoles lo que implica la
utilizacindegrandesvolmenesdedisolventeorgnicoparasuelucin[4,13].
Por ello el uso del adsorbente admicelar propuesto en esta memoria supone
unagranventajadebidoasueficaciadeextraccinyfcilelucin.

En las investigaciones que hemos desarrollado en esta Memoria se ha

propuesto tambin la extraccin de los BASs utilizando SUPRASs de micelas


acuosasdecidododecilsulfnico.Elmtododeextraccinpropuestoimplicala
adicin de 0,1 g de dodecilsulfonato sdico y un volumen de 12,5 o 14 mL de
cido clorhdrico (12 M) a 25 mL de muestra acuosa, para dar lugar a una
concentracinfinalde0,25%(w/v)y3,75Mo4,2M,respectivamente.Cuando
se usan estos disolventes supramoleculares el factor de preconcentracin y la
eficacia de extraccin dependen fundamentalmente de la cantidad de
tensioactivoutilizado,yaquestedeterminaelvolumendedisolventeformado.
Cuanto ms disolvente se produzca mayor ser la eficacia de extraccin pero
menor ser el lmite de cuantificacin del mtodo. La concentracin de cido
clorhdrico utilizada tambin influye en el factor de preconcentracin, aunque
en menor medida, ya que cuanto mayor sea la concentracin de cido
empleadaparainducirlacoacervacin,menorcontenidodeaguapresentanlos
disolventesformados.Enestecasolosvolmenesmediosobtenidosfueron430
L y 495 L dependiendo de la concentracin de cido empleada. Debido a la
alta viscosidad y acidez que presentan, estos disolventes se diluyeron con
metanol hasta 1 mL justo antes de su inyeccin cromatogrfica, por lo que el
factor de preconcentracin final fue 25 considerando que las recuperaciones
son cuantitativas para los 3 homlogos (BDDA, BDTA, BDHA). La formacin de
agregadosmixtosentrelosBASsyeldodecilsulfonatoproporcionadostiposde
interaccionesparalasolubilizacindelosanalitos:fuerzasdevanderWaalscon
lascadenashidrocarbonadaseinteraccionesinicasconlosgrupospolaresdel
tensioactivodecargaopuestaqueformalasmicelas.

[13] J.K. Autry, E.G. Vaught, E.D. Conte, Microchem. J. 80 (2005) 25.

- 222 -

Resumenydiscusindelosresultados
c)Hidrocarburosaromticospolicclicos.

En la extraccin de los PAHs con el disolvente supramolecular


constituido por micelas de cido dodecilsulfnico, las interacciones de
dispersin entre los anillos de los PAHs y las cadenas hidrocarbonadas del
ncleodelasmicelassonlasresponsablesdesusolubilizacin.Lascondiciones
experimentalesparasuextraccinfueronlasmismasqueseutilizaronparalos
BASs obtenindose recuperaciones cuantitativas independientemente de su
hidrofobicidad(valoresdelogKowcomprendidosentre5,66,6).

2.3.

Estabilizacindeloscontaminantesenmuestrasacuosas
Dado el gran potencial que presentan las hemimicelas, admicelas y

disolventes supramoleculares para la extraccin de compuestos orgnicos, las


siguientes investigaciones se centraron en confirmar si una vez retenidos los
contaminantes,elmicroambienteproporcionadoporlosagregadoslesconfiere
estabilidad y evita su degradacin. De esta forma se integraran las etapas de
extraccin, preconcentracin y estabilizacin simplificando el procedimiento
para la determinacin de los compuestos orgnicos y evitando transportar
elevados volmenes de agua. Adems, el pequeo volumen que ocupan los
formatosempleadosfacilitasualmacenamientoyrefrigeracinencasodeque
fueranecesarioparalaconservacindelasmuestras.Eneltranscursodeesta
Tesisseinvestigporprimeravezlaestabilidaddelosplaguicidas,BASsyPAHs
(todos ellos analitos con problemas de conservacin) en diferentes tipos de
sistemas supramoleculares y condiciones de almacenamiento; tiempo,
temperatura, luz, acidez y naturaleza de la matriz. La Figura 6 muestra un
esquemaqueresumelasdiferentesexperienciasensayadas.

- 223 -


Compuestosymuestras
BASsenaguadestilada
BASenmuestrasambientales
Plaguicidasenaguadestilada
Plaguicidasenmuestras
ambientales

Condicionesdealmacenamientodelosadsorbentes
hemimicelares/admicelares
Tambiente
4C
20C
Oscuridad Luzsolar
1mes
3meses
3meses
3meses

1mes

3meses
3meses
3meses
3meses

3meses

Compuestosy
muestras
BASsenagua
destilada
BASenmuestras
ambientales
PAHsenagua
destilada
PAHsenmuestras
ambientales

Condicionesdealmacenamientodelosdisolventes
supramoleculares
35C
Tambiente
4C
20C
Oscuridad Oscuridad Luzsolar
1mes

1semana

3meses

3meses

3meses

1mes

1mes

1semana

3meses

3meses

3meses

1mes

Figura 6. Esquema de las diferentes condiciones de almacenamiento ensayadas


en los estudios de estabilidad de los analitos en diferentes agregados
supramoleculares.

2.3.1. Estabilizacinenadsorbenteshemimicelares/admicelares

a)Efectodesecadodeladsorbente

Se sabe que el agua residual que impregna el adsorbente en SPE


despusdelapercolacindelamuestrapuedecausarhidrlisisdelosanalitos
retenidos,porlotantoesimportantesutotaleliminacinparaevitarproblemas
de degradacin. El secado de los cartuchos de SPE, conteniendo BASs
adsolubilizadoseneladsorbentesupramolecularsellevacaboempleandouna
bombadevacodurantediferentesperiodosdetiempo,comprendidosentre3

- 224 -

Resumenydiscusindelosresultados
minutosy1hora.Paralelamente,tambinsealmacenaroncartuchosquenose
haban sometido al proceso de secado del adsorbente. Las recuperaciones de
losBASsenestosltimosdisminuyeronun5%entanslo1da,mientrasque
las recuperaciones de los cartuchos sometidos a secado fueron cuantitativas
despus de una semana para todos los tiempos de secado ensayados. Se
propone por consiguiente, secar siempre los cartuchos durante 35 minutos
paraeliminarelaguaresidualdespusdelapercolacindelamuestra.

b)Efectodelaexposicinalaluzsolar.

Lainfluenciadelaluzsolarsobrelaestabilidaddeloscompuestosenlas
fasesadsorbentesestudiadasseinvestigcomparandolosresultadosobtenidos
con cartuchos expuestos a la luz (iluminacin natural del laboratorio) y
cartuchos almacenados en condiciones de oscuridad (bien envolvindolos en
papeldealuminioobienguardndolosencajasdecartnopacas)duranteuno
o3mesesatemperaturaambiente.EnelcasodelosBASsylamayoradelas
familias de plaguicidas estudiadas (carbamatos, fenilureas, anilidas,
cloroacetanilidas y fenoxicidos) las recuperaciones obtenidas fueron
cuantitativas independientemente de las condiciones de iluminacin; sin
embargo,comosepuedeverenlaTabla3,losplaguicidasorganofosforadosy
las triazinas se degradaron muy rpidamente a partir de la primera semana
cuandosealmacenaronsinproteccindelaluzsolar.

Por lo tanto, la determinacin de multiresiduos de plaguicidas con


adsorbentessupramolecularesrequiereelalmacenamientodeloscartuchosen
bolsasopacascuandosepreveaqueeltiempotranscurridoentrelatomadela
muestra y los anlisis va a ser superior a 7 das. Esta recomendacin puede
obviarseparaelanlisisdelosBASsyaquestosnosedegradanporlaluzsolar
cuando se encuentran en el microambiente proporcionado por el adsorbente
hemimicelar.

- 225 -

Tabla3.Recuperacionesa medias (n = 3; %) de los analitos de muestras de agua


destilada fortificadas (BASs: 48 g L-1 y plaguicidas: 1 g L-1) despus de ser
almacenados en los adsorbentes supramoleculares investigados a temperatura
ambiente y diferentes condiciones de iluminacin durante 1 mes.

BDDA

Condicionesdealmacenamiento
Temperaturaambientey
Temperaturaambientey
Oscuridad
luznatural
Tiempo(semanas)
Tiempo(semanas)
2
3
4
1
2
3
4
0
1
1005 1001 1065 985 1035 961 973 942 965

BDTA

1004

981

962

1056

BDHA

1006

972

961

961 1025

981

972 994 941

Simazina

1003

993

974

954

896

984

702 431 352

Atrazina

1004

1002

885

944

946

936

592 312 221

Compuestos

956

973 1013 973 1013

Carbofuran 10010 11211 10610 10210 1064 1066 1044 7810 882
Clorprofam

1002

1001

994

1074

955

1014 1014 1102 1161

Clortoluron

1008

1087

926

1007

971

1068 944 979 1014

Isoproturon 1007

1075

977

1076 1021 1054 994 1037 1082

Propanil

1004

1033

956

1092 1061 1014 954 1025 1032

Metolaclor

1005

971

1073 1125 1123 1003 1055 1081 1064

Alaclor

1005

1061

965

1097 1065 1013 995 1112 1022

Clorfenvinfos 1003

931

933

1015

2,4D

1007

882

954

886 1043

965

923 914 1024

Mecoprop

1008

803

903

974

976

911 1003 972

Tasasdeextraccinnormalizadas.

923

951

988 6810 3610 344

c)Efectodelatemperatura.

Para este estudio, muestras de agua destilada fortificadas con los


analitos(48gL1paralosBASsy1gL1paralosplaguicidas)sepasaronporlos
cartuchos rellenos con los adsorbentes supramoleculares y estos se

- 226 -

Resumenydiscusindelosresultados
almacenaronadistintastemperaturas(ambiente,4Cy20C)durante3meses.
Antesdelaelucin,loscartuchosconservadosa4Cy20Cdebenmantenerse
a temperatura ambiente durante al menos 15 minutos y una hora
respectivamenteparaevitarvariabilidadenlacuantificacin.

Los BASs no se degradaron a lo largo del tiempo bajo ninguna de las


condiciones de temperatura a las que los cartuchos fueron expuestos
demostrando

la

gran

capacidad

estabilizadora

de

los

agregados

supramoleculares para estos analitos (ver recuperaciones de los BASs en las


Tablas3y4).Debidoalafaltadedatosenbibliografasobrelaestabilidaddelos
BASsenmuestrasacuosasempleandotcnicasdeconservacintradicionales,se
llev a cabo una serie de experiencias para comprobar su estabilidad en agua
destilada bajo diferentes procedimientos durante 1 mes; acidificacin a pH 2
con cido ntrico/refrigeracin a 4C; adicin de formaldehdo a una
concentracin del 5% (v/v)/refrigeracin a 4C; y congelacin de las muestras
acuosas.Lacongelacindelasmuestrasa20Cnomejorlaestabilidaddelos
BASs, probablemente debido a su adsorcin sobre el vidrio, y aunque la
presencia de aditivos qumicos (cido ntrico o formaldehdo), unido a
refrigeracin (4C) de las muestras para inhibir la degradacin microbiolgica,
produjo mejores resultados, estos procedimientos slo son efectivos para
conservar las muestras durante cortos periodos de tiempo ya que pasada una
semana comienza a producirse la degradacin de los BASs con una magnitud
que depende de la longitud de la cadena hidrocarbonada. En base a estos
resultados podemos concluir que el uso de agregados hemimicelares, en
formato SPE, presenta claras ventajas, con respecto a los mtodos
convencionales para la estabilizacin de los homlogos de BAS. As, una vez
adsorbidosenhemimicelas,losBASspermanecenestablesalmenosdurante3
meses a temperatura ambiente, facilitando de esta forma el transporte de las
muestrasencampaasdemonitorizacinsielfiltradodelasmismasserealiza
onsite.

- 227 -

- 228 -

1002

1008

1007

1004

1005

1005

1003

1007

1008

Clorprofam

Clortoluron

Isoproturon

Propanil

Metolaclor

Alaclor

Clorfenvinfos

2,4D

MCPP
911

995

995

883

921

1051

935

1098

1052

1064

996

1085

1106

1062

1072

1122

1094

1042

1066

1091

1126

1082

1061

1053

1043

1052

1112

1001

981

1021

952

853

1032

1056

1092

981

992

9711

1004

904

1051

994

985

1031

1147

931

1014

1024

1064

983

1061

1154

1031

1075

1028

1043

1023

1034

1031

976

964

891

832

1106

967

1091

1001

1011

1057

1022

743

975

966

985

1035

4C
Tiempodealmacenamiento(semanas)

884

913

805

972

945

1031

1031

1056

984

1106

674

973

981

971

993

12

861

985

1022

1042

1021

1075

1078

1077

1052

1142

1152

1112

945

1001

1054

883

941

994

916

1083

976

1056

956

1004

948

983

983

941

982

1013

941

891

1041

1026

1011

1027

1037

949

1001

922

1122

1041

941

971

945

931

1003

1052

1064

1042

1031

1082

1008

1111

986

1042

1091

951

952

951

944

893

1041

1116

1046

1004

1014

1085

1084

1006

1073

1024

951

961

961

951

942

942

12

923

962

1004

993

913

994

1077

975

948

1044

1054

1003

20C
Tiempodealmacenamiento(semanas)

Tasasdeextraccinnormalizadas; 48gL paralosBASsy1gL paralosplaguicidas.

1004

1003

Simazina

10010

1006

BDHA

Carbofuran

1004

BDTA

Atrazina

1005

BDDA

Compuestos

Condicionesdealmacenamiento

Tabla 4. Recuperacionesa medias (n=3, %) de los analitos de muestras de agua destiladas fortificadasb despus de ser
almacenados en los adsorbentes supramoleculares investigados a 4C y -20C durante 3 meses.

Resumenydiscusindelosresultados
Enelcasodelosplaguicidas,latemperaturaafectsuestabilidadenlos
agregadosadmicelares(verTabla3y4).Ningnplaguicidainvestigadomostr
degradacin en 3 meses cuando los cartuchos se almacenaron a 20C. Sin
embargo,atrazinayclorfenvinfoscomenzaronadegradarsea4Capartirdeun
mes mientras que la estabilidad de los analitos a temperatura ambiente
dependidelgrupoestructural.As,laestabilidadfuedeunmesparatriazinas,
fenilureasyorganofosforados,dosmesesparacarbamatosyanilidasy3meses
para cloroacetanilidas y fenoxicidos. De nuevo las triazinas y el clorfenvinfos
fueronlosmsafectadosporlatemperaturaaligualqueocurriconlaluzsolar.

La comparacin de la capacidad del adsorbente admicelar mixto


empleadoenestasinvestigacionesparaestabilizarplaguicidasrespectoalade
otros adsorbentes descritos en bibliografa no es fcil debido a las diferentes
condicionesyperiodosdetiempoinvestigados,peroengeneralpuededecirse
que los adsorbentes admicelares presentan una capacidad estabilizadora muy
similaraladelosadsorbentes polimricosymejorquelosadsorbentesC18o
negrodecarbnacualquiertemperatura.

Por lo tanto, los cartuchos admicelares conteniendo los plaguicidas


pueden transportarse y permanecer sin control de temperatura durante un 1
messinquelaintegridaddeloscompuestosextradosseveaafectada;pasado
ese tiempo deben almacenarse en el frigorfico o congelador dependiendo de
cuandovayanarealizarselosanlisis.

d)Efectodeloscomponentesdelamatriz
Las aguas de los sistemas acuticos naturales y sobre todo las aguas
residualestienenunacomposicinmuyvariableypresentancomponentesenla
matriz que pueden afectar a la estabilidad de los analitos. Por este motivo se
comprob la estabilidad de los analitos en los adsorbentes supramoleculares
almacenados durante 1 mes a 4C empleando diferentes tipos de muestras
acuosas(fluviales,subterrneasyresiduales)conelfindevalidarlaaplicabilidad
de esta metodologa a muestras reales. Los resultados mostraron que los

- 229 -

componentes de la matriz no afectan a la estabilidad de los analitos


confirmando la gran resistencia a la degradacin que presentan en estos
agregados supramoleculares. Los BASC12 y C14 presentaron la misma
estabilidadquesuhomlogoC16enlasmuestrasdeaguaderoyresidualesa
pesar de ser ms fcilmente biodegradables [8]. La formacin de agregados
mixtosentreloscompuestosdebenzalconioyelSDSminimizasudegradacinal
igual que ocurre en las aguas naturales cuando se forman complejos entre
tensioactivosaninicosycatinicos[9].

2.3.2. Estabilizacinendisolventessupramoleculares

El disolvente supramolecular utilizado para la extraccin de los BASs y


PAHs,sesepardelasmuestrasacuosasmedianteunajeringaysedepositaron
los extractos en pequeos viales de vidrio que se almacenaron en diferentes
condicionesparaestudiarlaestabilidaddelosanalitossolubilizados.

a)Efectodelaconcentracindecidoclorhdrico
En primer lugar se comprob si la acidez de los disolventes formados
[inducidos con dos concentraciones de cido clorhdrico (3,75 M y 4,2 M)]
tenaninfluenciaenlaestabilidaddelosBASsyPAHs.Losresultadosmostraron
quenoexistandiferenciasentrelosdostiposdeSUPRASsylasrecuperaciones
fueronsiemprecuantitativasparatodoslosanalitos(verTabla5).

b)Efectodelaexposicinaluzsolar.

Elefectodelaluznaturalenlaestabilidaddelosanalitossolubilizados
enlosdisolventesseestudiexponiendounosvialesalaluzsolaryenvolviendo
otros con papel aluminio durante una semana a temperatura ambiente.
Ninguno de los compuestos analizados mostr degradacin en las condiciones
de almacenamiento ensayadas por lo que no es necesario mantener en
oscuridadlosvialesatemperaturaambiente.

- 230 -

Resumenydiscusindelosresultados
Tabla 5. Recuperacionesa medias (n = 3, %) de los analitos despus de su
extraccin de muestras de agua destilada fortificadas (0,19 g L-1) y
almacenamiento en los disolventes supramoleculares en diferentes de
condiciones de acidez y temperatura durante 3 meses.

Compuestos
BDDA

BDTA

Tiempo
(semanas)

CompuestosdeBenzalconio
Condicionesdealmacenamiento
4,2M
3,75M
T
ambiente

4C

20C

T
ambiente

4C

0
1
8
12
0
1
8
12
0
1
8
12

1003

1004

971
992 1001
931 962
921
942 941
921 943
1083
1074 1081
983 1014
1002

1004

971
1002 1021
941 944
922
941 932
923 931
945
1015 1045
953 952
1001

1004

1001
1011 1032
991 993
BDHA
941
942 962
953 991
1014
1055 1043
955 962
HidrocarburosAromticosPolicclicos
Condicionesdealmacenamiento
Tiempo
4,2M
3,75M
Compuestos
(semanas)
T
T
4C
20C
4C
ambiente
ambiente
0
1001

1002

BaA

1
1032
1031 1011
1001 1081

8
1032
1032 1011
1053 1044

12
1024
1024 1003
992 1021
0
1002

1003

BaP
1
951
1001 1033
1004 1051

8
983
1011 1011
1013 992

12
963
972 995
972 992
0
1004

1002

1
1024
993 1021
1003 1051
IP
8
992
1032 1001
1043 1022
12
a

901

954 942

Tasasdeextraccinnormalizadas.

- 231 -

942 961

20C

941
951
1011

961
943
952

1012
963
954

20C

1081
1091
1011

1081
1052
1003

1051
1072
984

c)Efectodelatemperatura.
La influencia de la temperatura en la conservacin de las muestras
tambinsecomprobguardandolosvialesa35C,temperaturaambiente,4C
y 20C durante 3 meses. La tabla 5 muestra un resumen de los resultados
obtenidos.Lasrecuperacionesdelosanalitosestuvieroncomprendidasentre90
y 109% demostrando que una vez solubilizados en los SUPRASs no
experimentan degradacin, independientemente del nmero de anillos
aromticos presentes en su estructura o la longitud de la cadena
hidrocarbonada. El hecho de que tambin sean estables, independientemente
de las condiciones de acidez e iluminacin, facilita el transporte y
almacenamiento de las muestras durante el trabajo de campo, sobre todo en
zonascalurosasysoleadas.

d)Efectodeloscomponentesdelamatriz

En este caso el efecto de los componentes de la matriz sobre la


estabilidaddeBASsyPAHssecomprobempleandoaguasderoyresidualesy
almacenandolosSUPRASsformadosatemperaturaambientey4Cduranteun
mes. La Tabla 6 muestra algunos de los resultados obtenidos; los analitos
mantienensuestabilidadeneltiempoobjetodeestudio.

Tabla 6. Recuperacionesa medias (n=3, %) de los analitos despus de su


extraccin de muestras de agua residuales y fluviales fortificadas (0.19 g L-1) y
almacenamiento en los disolventes supramoleculares a 4C durante 1 mes.
Compuestosdebenzalconio
Aguaresidual(influente)
Aguafluvial(Guadalquivir)
(das)
BDDA
BDTA
BDHA
BDDA
BDTA
BDHA
0
1004
1003
1002
1003
1003
1002
30
911
931
901
943
917
8810
Hidrocarburosaromticospolicclicos
Tiempo Aguaresidual(influente)

Aguafluvial(Guadalquivir)
(das)
BbF
BkF
BaP B(ghi)P
BbF
BkF
BaP
B(ghi)P
0
10010 1006 1006 10010 1008 1006 1006 10011
30
1083 1023 1012 1019 981 1026 1055
1009
a
Tasas de extraccin normalizadas.
Tiempo

- 232 -

Resumenydiscusindelosresultados
Comoconclusindeesteapartado,sepuedeafirmarquelosagregados
supramoleculares, tanto disolventes como adsorbentes, presentan gran
capacidad de estabilizacin para los contaminantes orgnicos en muestras
acuosasambientales.

2.4.

Cuantificacin
Los extractos supramoleculares son compatibles con cromatografa

lquidaacopladaadistintosdetectores.Enlasinvestigacionesllevadasacaboen
esta Tesis Doctoral, se han empleado absorbancia, fluorescencia y
espectrometrademasas.LosagregadosmicelaresqueconstituyenlosSUPRASs
deSDSAsedestruyencuandoelextractosediluyeconmetanoljustoantesdela
inyeccin cromatogrfica, con objeto de disminuir su viscosidad y acidez,
mientras que los agregados de hemimicelas/admicelas se destruyen por el
disolvente orgnico utilizado para la elucin en SPE. En ambos casos los
extractos adems de contener los analitos poseen una elevada cantidad de
monmerosdetensioactivo.Yaquetantododecilsulfonatocomododecilsulfato
son inicos, eluyen rpidamente en los procesos cromatogrficos y
generalmenteseenvanadesechocuandoCLestacopladaaespectrometrade
masas para evitar que la fuente de ionizacin se ensucie. La gran ventaja de
estostensioactivosconrespectoalosnoinicosdesdeelpuntodevistadela
deteccin, es que los primeros se comercializan como monmeros puros de
estructura definida, mientras los tensioactivos noinicos slo se comercializan
comounamezcladehomlogoseismeros.Estehecho,unidoaquelamayora
de los tensioactivos no inicos presentan estructuras aromticas, y mayores
tiempos de retencin, hace que se obtengan picos cromatogrficos de banda
ancha lo que dificulta o impide la adecuada resolucin cromatogrfica de los
analitospolaresymedianamentepolares(ejemploFigura7).

- 233 -

(a)

TritonX100
0.5UA

BaA
BbF
BkF

ABSORBANCIA

BeP
Py

SDSA

BbF
BaA
0.05UA

(b)

BkF
BeP

Py

10

12

Tiempo (min)

Figura 7. Cromatogramas obtenidos para varios PAHs [Pireno (Py),


benzo[a]antraceno (BaA), benzo[b] fluoranteno (BbF),

benzo[k] fluoranteno

(BkF), benzo[e]pireno (BeP)] extrados por: (a) un disolvente supramolecular


de Triton X-100 y (b) un disolvente supramolecular de cido dodecano
sulfnico (SDSA).

Lacuantificacindelosplaguicidasunavezextradosdelasmuestrasde
aguas naturales mediante SPE con admicelas mixtas se realiz empleando un
cromatgrafo de lquidos acoplado a un detector ultravioletavisible de diodos
enfila,mientrasquelosPAHssolubilizadoseneldisolventesupramolecularse
analizaronenuncromatgrafodelquidosacopladoaundetectorfluorimtrico.
Los BASs se cuantificaron utilizando cromatografa lquida acoplada a dos
detectores distintos dependiendo de la tcnica de extraccin empleada; en el
caso de SPE hemimicelar fue un detector de diodos en fila y en el caso de su
extraccin coacervativa se emple un espectrmetro de masas con trampa
inica. La cuantificacin de los BASs mediante espectrometra de masas es la

- 234 -

Resumenydiscusindelosresultados
opcin ms recomendable siempre que sea posible, en base a los lmites de
cuantificacin instrumentales que presenta (g L1) en comparacin con su
deteccinfotomtrica(mgL1),ysucapacidaddeconfirmacin.

Las curvas de calibrado obtenidas con patrones de los analitos y


extractos de muestras fortificadas sometidas a los procedimientos propuestos
presentaron las mismas caractersticas analticas, lo cual permiti la
cuantificacin de los compuestos usando calibracin externa. Ello fue posible
entreotrosfactoresalaseparacincompletadeltensioactivodelosanalitosen
elsistemacromatogrficoyalaadecuadaselectividadapesardelaausenciade
etapadelimpiezaenlosmtodosdesarrollados.

Los lmites de deteccin del mtodo se calcularon teniendo en cuenta


los lmites de deteccin instrumentales de cada analito, as como las
recuperacionesylosfactoresdepreconcentracin.Lascaractersticasanalticas
delosmtodosdeextraccinenfaseslidaconadsorbentessupramoleculares
semuestranenlaTabla7.

Cabe destacar que los lmites de deteccin y cuantificacin alcanzados


con el mtodo propuesto para la determinacin de los plaguicidas estn por
debajodelasnormasdecalidadambientalparalosplaguicidasreguladoscomo
sustanciasprioritariasyotroscontaminantesporlaDirectiva2008/105/CE[14],
porloquepuedeutilizarseparaelcontroldeplaguicidasenaguassuperficiales.

El anlisis de BASs en aguas naturales no est legalmente regulado ni


existen lmites mximos permitidos para ellos. Los lmites de cuantificacin
alcanzadosconSPEhemimicelarydeteccinfotomtricafueronsuficientespara
estudiar la estabilidad de estos compuestos en los cartuchos, sin embargo las
concentracionesdeBASsenaguasnaturalessuelenserdepocosgL1porlo
[14] DO L 348 de 24.12.2008, p. 84. Directiva 2008/105/CE del parlamento europeo y
del consejo de 16 de diciembre de 2008 relativas a las normas de calidad ambiental en el
mbito de la poltica de aguas, por la que se modifican y derogan ulteriormente las
Directivas 82/176/ CEE, 83/513/CEE, 84/156/CEE, 84/491/CEE y 86/280/CEE del
Consejo, y por la que se modifica la Directiva 2000/60/CE.

- 235 -

Tabla7. Caractersticas analticas de los mtodos basados en extraccin en fase


slida supramolecular.

Analitos
BDDA
BDTA
BDHA
Simazina
Atrazina
Carbofuran
Clorprofam
Clortoluron
Isoproturon
Propanil
Metolaclor
Alaclor
Clorfenvinfos
2,4D
Mecoprop

Intervalodelinealidad
(gL1)
240(x103)
240(x103)
240(x103)
2.52000
22000
103000
52000
2.52000
22000
52000
153000
203000
103000
22000
22000

r
0.9994
0.9992
0.9980
0.9999
0.9995
0.9991
0.9995
0.9995
0.9994
0.9998
0.9998
0.9999
0.9997
0.9992
0.9999

LDMa
(ngL1)
6400
6400
9600
3
2
60
6
13
7
6
19
26
13
3
3

Lmitededeteccindelmtodocalculadoaplicandoelprocesoanalticocompletoa
muestrasreales.

queseaconsejasucuantificacinempleandoSPEhemimicelaryespectrometra
de masas cuyos lmites de cuantificacin del mtodo bajan hasta 2 ng L1. La
determinacindeestoscompuestosusandoespectrometrademasastambin
sellevacaboconlametodologadeextraccincoacervativa.Enestecasolos
lmites de cuantificacin alcanzados para los BASs son de 40 ng L1 debido al
menor factor de preconcentracin del mtodo. La combinacin de estas dos
metodologas,SPEhemimicelaryextraccincondisolventessupramoleculares,
con espectrometra de masas (interfase electrospray/trampa inica) para la
determinacin de estos tensioactivos catinicos haba sido previamente
estudiada por nuestro grupo de investigacin [3,6] comprobndose que los
componentes de la matriz no causaban supresin de la ionizacin ni efectos
espaciocarga.

- 236 -

Resumenydiscusindelosresultados
Las caractersticas analticas de los mtodos desarrollados empleando
disolventessupramolecularessemuestranenlaTabla8.

Tabla 8. Caractersticas analticas de los mtodos basados en extraccin


coacervativa.
LDMa

Intervalodelinealidad

Analitos

(gL1)

(ngL1)

BDDA

11000

0,998

BDTA

11000

0,9996

BDHA

11000

0,9997

BaA

0,0520

0,9996

0,5

BbF

0,220

0,9993

2,5

BkF

0,0520

0,9994

0,5

BaP

0,120

0,9995

IP

0,220

0,9991

2.5

B(ghi)P

0,120

0,9998

Lmitededeteccindelmtodocalculadoaplicandoelprocesoanalticocompletoa
muestrasreales.

ElmtododesarrolladoparalosPAHspermitesudeteccinanivelesde
entre0,5y2,5ngL1,siendosusconcentracionesmximasadmisiblesenaguas
superficiales continentales 0,05 g L1 para el BaP, 0,03 g L1 para la suma de
BbFyBkF,y0,002gL1paralasumadeIPyB(ghi)P.

- 237 -

3.

DESARROLLO

DE

NUEVAS

METODOLOGAS

PARA

LA

DETERMINACIN DE SUSTANCIAS PERFLUOROALQUILADAS EN


MUESTRASBIOLGICAS.

En este segundo bloque se han desarrollado 2 metodologas para


mejorar la determinacin de sustancias perfluoroalquiladas en distintas
muestrasbiolgicasmediantecromatografalquidayespectrometrademasas.
Enamboscasoslainterfaseeselectrosprayenmodonegativo(ESI).Elprimer
mtodo se basa en una microextraccin slidolquido usando una mezcla
hidroorgnica de tetrahidrofurano:agua 75:25 (v/v) que se aplic a msculo e
hgado de diferentes peces y aves marinas. El detector empleado fue una
trampainicaysehapropuestoporprimeraveztrabajarenmodoaislamiento
de iones para mejorar la cuantificacin de estas sustancias en muestras
complejas ya que as se evita el efecto espaciocarga causado por la coelucin
decomponentesdelamatriz,alavezquesemantienelasensibilidaddelmodo
de operacin fullscan. El segundo mtodo desarrollado se propone para
anlisis de suero sanguneo y se emplea por primera vez un disolvente
supramoleculardemicelasinversasdecidohexanoicoparalamicroextraccin
lquidolquido de los compuestos perfluorados. En este caso el detector de
masasfueun4000QTrap trabajandoenmodotriplecuadrupolo.

EnlaFigura8seresumenlosprocedimientosllevadosacaboenlasdos
metodologas desarrolladas y a continuacin se discuten los resultados y
aspectosmsrelevantesdecadaetapadelprocesoanaltico.

- 238 -

Resumenydiscusindelosresultados

1)Homogenizacin
delamuestra

1)Homogenizacin
delamuestra
2)Adicindelos
disolventesyextraccinde
lasPFASs

2)Formacindel
disolventesupramolecular
yextraccindelasPFASs

600LdeTHF
60Ldeagua
200mgdemuestra(pesohmedo)

Teniendoencuentaelcontenidoenaguadela
muestra(70%),lacomposicindeladisolucin
finalesTHF:agua75:25(v/v)

765Ldesuero
38LdeHCl(12M)
600LdeTHF
97Ldecidohexanoico
1
18LdeISs(100ngmL )

3)Separacindefasespor
ultracentrifugacin

3)Ultracentrifugacin

4)Coleccindeunaalcuotade
extracto

4)Medidaycoleccindel
disolventesupramolecular
formado

Volumendel
disolvente360 L
conunacomposicin
del20%decido
hexanoico,14%de
aguay66%deTHF

Volumenfinaldel
extracto800L

5)Determinacin

5)Determinacin
Cromatografalquidayespectrometrade
masas(interfaseelectrospray/trampa
inicaenmodoaislamientodeiones)

Cromatografalquidayespectrometrademasas
(interfaseelectrospray/triplecuadrupolo)

PFASs: sustancias perfluoroalquiladas, THF: tetrahidrofurano, HCl: cido clorhdrico, ISs:


estndaresinternos

Figura8. Esquema de los diferentes pasos seguidos para la microextraccin y


determinacin de las sustancias perfluoroalquiladas usando mezclas
hidroorgnicas de disolventes y disolventes supramoleculares.
- 239 -

3.1.

Muestrasyanalitos

Las sustancias polifluoroalquiladas y perfluoroalquiladas (PFASs) son

contaminantes emergentes cuyo inters surgi en el ao 2.000 debido al


descubrimientodesuubicuidadanivelglobal,incluyendoreasremotascomo
las regiones polares. Las PFASs son un grupo de sustancias que contienen una
cadena alqulica con una longitud de entre 4 y 16 tomos de carbono, la cual
puede estar parcial o totalmente fluorada, y un grupo hidroflico terminal.
Cuando la cadena est totalmente fluorada las molculas se denominan
sustancias perfluoroalquiladas y dentro de este subgrupo de tensioactivos
orgnicos perfluorados destacan por su importancia el perfluorooctano
sulfonato (PFOS) y el cido perfluorooctanoico (PFOA). Las PFASs tienen un
amplio uso en aplicaciones industriales y de consumo que incluyen
revestimientos antimanchas de tejidos y moquetas, revestimientos lipofbicos
destinados a productos de papel aptos para el contacto con los alimentos,
espumas extintoras, tensioactivos para pozos de extraccin minera o
petrolfera, abrillantadores de suelos y frmulas de insecticidas [15,16]. PFASs
como el sulfonato de perfluorooctano y el cido perfluorooctanoico, as como
sus sales y precursores se han detectado en el medio ambiente, los peces, las
avesylosmamferos(porejemplo,PFOSenpeces,avesymamferosmarinosa
concentraciones de 0,3173, 11780 y 0,44.000 ng g1, respectivamente)
[17,18].

Enlaactualidadexisteunagranpreocupacinporlaexposicinhumana

alasPFASs.Losniveleshalladosdeestoscompuestosensuerosanguneoenla
[15] OECD Hazard assessment of perfluorooctane sulfonate (PFOS) and its salts. Report
RNV/JM/RD (2002) 17/FINAL, 2002.
[16] K. Prevedouros, I.T.Cousins, R.C. Buck, S.H. Korzeniowski, Environ. Sci. Technol.
40 (2006) 32.
[17] C.R. Powley, S.W. George, M.H.Russell, R.A. Hoke, R.C.Buck, Chemosphere 70
(2008) 664.
[18] Appendice 2 in Ecological Screening Assessment Report on Perfluorooctane
Sulfonate, Its Salts and Its Precursors that Contain the C8F17SO2, C8F17SO3 or C8F17SO2N
Moiety, disponible en: http://www.ec.gc.ca.ceparegistry/documents/subslist/PFOSSAR/
PFOS A2.cfm.

- 240 -

Resumenydiscusindelosresultados
poblacin general son del orden de ng mL1 [19] y aumenta hasta
concentraciones de g mL1 en personas con exposicin ocupacional [20]. En
2008, la Comisin Tcnica constituida por la Autoridad Europea de Seguridad
Alimentaria (EFSA) para el estudio de contaminantes que afectan a la cadena
alimentaria prepar un informe cientfico en el que se conclua que era poco
probable que el PFOS y PFOA estn teniendo efectos nocivos en la poblacin
general, pero manifestaba ciertas dudas respecto a las repercusiones en el
desarrollodeorganismosvivos.Larecomendacinfinaldeesteestudiofueque
serecogiesenmsdatossobrelosnivelesdesustanciasperfluoroalquiladasen
alimentosypersonas,conelfindedeterminarlastendenciasenlaexposicina
dichassustancias[21].

Aunque no existe an legislacin sobre PFASs en alimentos o medio

ambiente, el PFOS fue incluido en el ao 2.008 en la lista de sustancias


sometidasarevisinparasuposibleidentificacincomosustanciasprioritariaso
sustancias peligrosas prioritarias en el mbito de la poltica europea de aguas
[14] y en 2.010 la comisin europea adopt una recomendacin relativa a la
vigilanciadelassustanciasperfluoroalquiladasenlosalimentosdurante2.010y
2.011 [22] por la que se recomendaba a los Estados miembros el anlisis de
distintos productos alimenticios con el fin de estimar hasta que punto estn
presentesenlosalimentosloscompuestosPFOSyPFOAy,enlamedidadelo
posible,desusprecursores,comosonelperfluorooctanosulfonamida(PFOSA),
el Nsulfonamidoetanol perfluorooctano etlico (NEtFOSE) y el 8:2 alcohol
fluorotelomer, y de compuestos similares alPFOA y PFOS con una longitud de
cadena diferente (C4C15), as como los tensioactivos fosfatos de
[19] K. Kannan, S. Corsolini, J. Falandysz, G. Fillmann, K.S. Kumar, B.G. Loganathan,
M.A. Mohd, J. Olivero, N. van Wouwe, J.H. Yang, K.M. Aldous, Environ. Sci. Technol.
38 (2004) 4489.
[20] G.W. Olsen, J.M. Burris, D.J. Ehresman, J.W. Froehlich, A.M. Seacat, J.L.
Butenhoff, L.R. Zobel, Environ. Health Perspect. 115 (2007) 1298.
[21] Dictamen de la Comisin tcnica de contaminantes de la cadena alimentaria sobre
los sulfonatos de perfluorooctano (PFOS) y el cido perfluorooctanoico (PFOA) y sus
sales, The EFSA Journal 653 (2008) 1.
[22] DO L 68 de 18.3.2010, p. 22 Recomendacin de la Comisin de 17 de marzo de
2010 relativa a la vigilancia de las sustancias perfluoroalquiladas en los alimentos
(2010/161/UE).

- 241 -

polifluoroalquilo (PAPS) como el 8:2 diPAPS y el 8:2 monoPAPS. La vigilancia


debe comprender una amplia variedad de productos alimenticios que reflejen
los hbitos de consumo, entre los que se incluyen alimentos de origen animal
como el pescado, la carne, los huevos, la leche y productos derivados, y
alimentosdeorigenvegetal,parapoderestimarlaexposicindeformaprecisa.

PorotroladoelConveniodeEstocolmosobrecontaminantesorgnicos

persistentes, el cual exige a las partes signatarias que vigilen estos


contaminantes, sus alternativas y los contaminantes que se propone aadir al
Convenio, ha incluido al PFOS, sus sales y el fluoruro de perfluorooctano
sulfonilo(PFOSF)enelanexoB,querecogelassustanciassujetasarestricciones
deproduccinyuso[23].

La Tabla 9 muestra una seleccin de PFASs que se han encontrado en

diversas matrices humanas y ambientales, destacndose en negrita los


compuestosestudiadosenlasinvestigacionesrecogidasenestaMemoria.

Lasmuestrasbiolgicasanalizadasenestasegundapartedelamemoria

se clasificaron en dos grupos: suero sanguneo de humanos y animales, y


msculo e hgado de distintos peces y aves marinas. Las especies de peces y
aves marinas fueron; melva (Auxis rochei rochei), palometa (Brama brama),
caballa (Scomber scombrus), gaviota patiamarilla (Larus michahellis) y alcatraz
(Morus bassanus). Antes de llevar a cabo la extraccin, las muestras se
homogenizaron usando un homogeneizador tipo ultraturrax a potencia
mxima(4.500rpm).Cuandolasmuestrasnoseanalizarondeformainmediata,
estas se congelaron a 20C en porciones de 1 g hasta el momento de su
anlisis.Adicionalmenteyconelfindevalidarelmtodoseanalizunamuestra
defiletedeplatija(Platichthysflesus),quehabasidopreviamenteusadacomo
material de referencia en el 2 estudio interlaboratorio internacional sobre
PFASs. Esta muestra haba sido irradiada con rayos y se mantuvo a
[23] The 9 new POPs under the Stockholm Convention. (Disponible en:
http://chm.pops.int/Programmes/New%20POPs/The%209%20new%20POPs/tabid/672/la
nguage/en-US/Default.aspx).

- 242 -

Resumenydiscusindelosresultados
temperaturaambienteyoscuridadhastasuanlisis.Porotrolado,lasmuestras
sanguneas fueron almacenadas en botes de polipropileno a 20C hasta el
momentodelanlisis.

Tabla 9. Nombres, abreviaturas y frmulas qumicas de una seleccin de


PFASs.

Nombre
cidosperfluoroalquilcarboxlicos

Abreviatura
PFCAs

cidoperfluorobutanoico
cidoperfluorohexanoico
cidoperfluoroheptanoico
cidoperflurooctanoico
cidoperfluorononanoico
cidoperfluorodecanoico
cidoperfluoroundecanoico
cidoperfluorododecanoico
cidoperfluorotridecanoico
cidoperfluorotetradecanoico
cidoperfluoropentadecanoico

Formulaqumica

PFBA
PFHxA
PFHpA
PFOA
PFNA
PFDA
PFUnDA
PFDoDA
PFTrDA
PFTeDA
PFPeDA

cidosperfluoroalcanosulfnicos

PFSAs

Perfluorobutanosulfonato
Perfluorohexanosulfonato
Perfluorooctanosulfonato
Perfluorodecanosulfonato

PFBS
PFHxS
PFOS
PFDS

CF3(CF2)2COOH
CF3(CF2)4COOH
CF3(CF2)5COOH
CF3(CF2)6COOH
CF3(CF2)7COOH
CF3(CF2)8COOH
CF3(CF2)9COOH
CF3(CF2)10COOH
CF3(CF2)11COOH
CF3(CF2)12COOH
CF3(CF2)13COOH

CF3(CF2)3SO3
CF3(CF2)5SO3
CF3(CF2)7SO3
CF3(CF2)9SO3

3.2.

Extraccindelosanalitos

El anlisis de las muestras biolgicas se llev a cabo empleando dos

metodologas diferentes dependiendo del tipo de muestra. La mayora de los


mtodos que se emplean para la extraccin de las PFASs en alimentos y
muestras biolgicas utilizan disolventes orgnicos de polaridad media, tales
comometanolyacetonitrilo.Sinembargo,lasrecuperacionesdelosPFASscon
estos disolventes dependen en gran medida de la longitud de la cadena y los
grupospolaresquepresentenloscompuestos,porloqueestosmtodossuelen
proporcionar recuperaciones bajas para los PFASs inicos de cadena corta

- 243 -

solublesenagua(C45)ascomoparalosnopolaresdecadenalarga(C1314).Con
el propsito de mejorar las recuperaciones de estos compuestos en las
muestras biolgicas, se desarroll un primer mtodo basado en el uso de
mezclas hidroorgnicas de tetrahidrofurano (THF) y agua, disolventes que
presentan constantes dielctricas (agua = 80; THF = 7,5) y parmetros de
solubilidaddeHildebrand(agua=23,3cal1/2 cm3/2;THF=9,5cal1/2 cm3/2)muy
diferentes.As,alirvariandolacomposicindelamezclaTHF:aguaseobtienen
disolventes con muy diferente poder de solvatacin. El segundo mtodo
desarrollado consisti en una microextraccin lquidolquido de los PFASs en
muestrasdesuerosanguneomedianteelusodeundisolventesupramolecular
constituido por micelas inversas de cido hexanoico dispersas en una fase
continuaagua:THF.Eltratamientodemuestrasesimplificconsiderablemente
en comparacin con la mayora de los mtodos empleados para la
determinacin de PFASs en muestras de suero que usualmente requieren de
varias etapas de extraccin y limpieza de los extractos o procedimientos ms
complicadosdeSPEonline.

3.2.1. Sntesisycaractersticasdelossistemasextractantesempleados

a) Mezclahidroorgnicatetrahidrofurano:agua

La extraccin de los PFASs en las muestras biolgicas slidas (distintos

tejidos de aves y peces) se llev a cabo mediante la mezcla hidroorgnica


THF:agua75:25(v/v).Elcontenidodeaguapresenteenestetipodemuestrases
alto (7075%) por lo que esta cantidad debe tenerse en cuenta en la relacin
THF:agua 75:25 (v/v) utilizada para la extraccin. As, el anlisis de 0,2 g de
muestra sin liofilizar requiere la adicin de 600 L de THF y 60 L de agua,
mientrasquelasmuestrasliofilizadasrequieren800Ldelamezcla(600Lde
THFy200Ldeagua).

- 244 -

Resumenydiscusindelosresultados

b) Disolvente supramolecular constituido por micelas inversas de cido


hexanoico.

Estos SUPRASs se forman mediante procesos de autoensamblaje al


aadir agua a la disolucin de cido hexanoico en THF. El agua provoca una
desolvatacinparcialdelasmicelasinversasdecidohexanoicolocualfacilita
la interaccin micelamicela formndose espontneamente gotas de SUPRAS
que van unindose hasta formar un conglomerado de gotas individuales. La
densidad de este conglomerado es menor que la densidad de la disolucin a
partir de la cual se ha formado, observndose por tanto una separacin de
fases.Ennuestrosistemadeextraccin,lapropiamuestra(suerosanguneo)es
elagenteinductordelacoacervacinyaqueel93%desucontenidoesagua.La
nueva fase lquida inmiscible con el suero es menos densa que ste, lo cual
constituye una ventaja para la medida de su volumen y posterior recoleccin.
Dado que las micelas inversas se producen en la forma protonada del cido
hexanoico(pKa4,80,10),lasmuestrasfueronacidificadasconcidoclorhdrico
a un valor de pH por debajo de 4 para la formacin del disolvente
supramolecular.

LaFigura9ilustraeldiagramadefasesdelcidohexanoico(HA)donde
semuestralaregindecoacervacinquepuedeutilizarseconfinesanalticos.
Por encima de la regin de coacervacin, los SUPRASs se solubilizan en la
disolucin THF:agua, mientras que por debajo encontramos mezclas de
SUPRASsycidohexanoico.Merecelapenacomentarelcasoparticulardelas
disoluciones de cido hexanoico a concentracin 0,5 % (v/v) en mezclas
agua:THF (concentraciones de THF entre 0,54,5% v/v) donde el anfifilo se
solubilizacompletamente,sinembargoalaumentarlaconcentracindeTHFal
5% comienza a formarse el SUPRAS a pesar de la mayor solubilidad del HA en
estemedio.

- 245 -

100
80
%THF(v/v)

Regin de formacin del


disolvente
supramolecular
constituido por micelas
inversas de cido hexanoico
seleccionada

Disolucinisotrpica
decidohexanoico

60
40
Disolvente
supramolecular

20
0
0

10

12

%cidohexanoico(v/v)

Figura 9. Diagrama de fases del sistema ternario cido hexanoico: agua:


tetrahidrofurano empleado para la extraccin de los PFASs. El porcentaje de
agua puede calcularse restando a 100 la suma de los porcentajes de cido
hexanoico y THF.

Las condiciones experimentales utilizadas para la produccin del


SUPRASutilizadoenelmtodoanalticopropuestofueron:6,5%(v/v)decido
hexanoicoy40%(v/v)deTHF.LacomposicindelSUPRASgeneradofue:20%
decidohexanoico,14%deaguay66%deTHF.

La composicin del SUPRAS vara principalmente en funcin del


porcentaje de THF utilizado para su formacin; as cuanto mayor es el
porcentajedeTHFmayoreselcontenidodeTHFyaguaeneldisolventeypor
consiguiente menor el contenido de cido hexanoico. Por otro lado, la
incorporacin del anfifilo (HA) en los SUPRASs sigue un patrn muy diferente
dependiendo de la concentracin inicialmente presente en la disolucin.
Concentraciones de HA inferiores al 3% muestran mayor solubilizacin del
anfifilo en la disolucin en equilibrio conforme aumenta la concentracin de
THF; sin embargo disoluciones de HA por encima del 3% presentan un
comportamientoopuesto,incorporndosemsHAenelSUPRASamedidaque

- 246 -

Resumenydiscusindelosresultados
aumentael%deTHFhastallegaraincorporacincuantitativaapartirdel30%
(v/v)deTHF.

Mediante el algoritmo de Marquardt, se desarroll una ecuacin para


predecirelvolumendeSUPRASgeneradoenfuncindelasconcentracionesde
cidohexanoicoyTHFenladisolucin.Elobjetivoespoderconoceraprioriel
factor de preconcentracin que puede alcanzarse bajo unas condiciones
experimentales dadas y simplificar as la seleccin de variables durante la
optimizacindelmtodo.Laecuacinresultantefue:

y=0,69HA+0,0761HATHF+e0,1047THF

ElvalordeyvieneexpresadoenLylosvaloresdeHAyTHFenmgy%
(v/v) respectivamente. Porcentajes de HA por debajo del 3% no cumplen esta
ecuacin, ya que la incorporacin del HA en el SUPRAS en funcin del THF
presenta un comportamiento opuesto al observado en las disoluciones con
concentracionesapartirdel3%.LosporcentajesdeTHFquepuedeaplicarseen
esta ecuacin van desde 1% hasta valores cercanos al lmite superior del
diagramadefases.Elcoeficientededeterminacinfue99,126%locualindica
unabuenacapacidaddeprediccindeestaecuacin.

3.2.2. Extraccinypreconcentracin

a)Muestrasbiolgicasslidas

LaextraccindePFASsenlasmuestrasbiolgicasslidassellevacabo
mediantelaadicindirectade600LdeTHFy60Ldeaguaa0,2gdemuestra
en un tubo de microcentrifuga que se coloca en un agitador tipo vortex
durante 7 minutos a mxima potencia (aproximadamente 2.500 rpm). Para
favorecerelcontactoyladisgregacindeloscomponentes,seaaden4esferas
de vidrio de 3 mm de dimetro. Tras agitar la muestra y extraer las PFASs, el
microtuboseultracentrifugaa15.000rpmdurante13minutosparasepararel

- 247 -

disolvente de la muestra y eliminar las partculas slidas en suspensin.


Alcuotasdeestesobrenadanteserecogenytransfierenavialesdevidriopara
serinyectadasenelsistemacromatogrfico.LasPFASsanalizadasfueronPFCAs
(C6C14)yPFSAs(C4C8).

En la optimizacin del procedimiento de extraccin de las PFASs se


consideraron las siguientes variables: (1) la composicin de la mezcla
hidroorgnica,(2)elvolumendedisolventey(3)losparmetrosoperacionales
relativos a la extraccin. El objetivo de la optimizacin fue conseguir un
tratamiento demuestrasimpleyrpidoconrecuperacionescuantitativas para
las PFASs independientemente de la longitud de la cadena y lmites de
cuantificacinadecuadosalosnivelespresentesenlasmuestras.

(1) Influencia de la composicin de la mezcla hidroorgnica. Los


porcentajes de agua y THF en la disolucin empleada para extraer las PFASs
influyen decisivamente en la eficacia de extraccin de los analitos. Por ello es
necesario un buen conocimiento de las interacciones entre el disolvente y las
PFASsparaestablecermezclashidroorgnicasdeTHF:aguaqueseancapacesde
solubilizaratodoslasPFASsindependientementedelalongituddesucadena.
TantoPFCAscomoPFSAspuedenestablecerpuentesdehidrgenoatravsdel
grupopolareinteraccionesdedispersinatravsdelacadenahidrocarbonada.
Paraquelaextraccinseaeficazesnecesarioqueeldisolventeempleadopueda
establecer un balance adecuado entre las interacciones polares (interacciones
dipolodipoloypuentesdehidrgeno)ylasnopolares(fuerzasdispersivas).En
estainvestigacinseproponeunextractanteconstituidoporlamezcladeTHFy
aguaenbasealasdiferentescapacidadesdesolvatacinquepresentan,como
puedededucirsedelosvaloresdelosrespectivosparmetrosdesolubilidadde
Hildebrand (agua = 23,3 cal1/2 cm3/2; THF = 9,5 cal1/2 cm3/2). El parmetro de
Hildebrand(T)vienedadoporlasumadelasfuerzasdedispersin(d),dipolo
dipolo(p)ypuentesdehidrgeno(h).Losvaloresindividualesdeestasfuerzas
sonconocidoscomoparmetrosdeHansen(cal 1/2cm 3/2)yserelacionancon
elparmetrodeHildebrandmediantelaexpresin:

- 248 -

Resumenydiscusindelosresultados
2
Total
= d2 + p2 + h2

Los parmetros de Hansen para agua, THF y otros disolventes


comnmente empleados para la extraccin de PFASs se muestran en la Tabla
10.

Tabla10.Valores de los parmetros de solubilidad para varios disolventes.

Disolvente

Parmetros
deHildebrand
(cal1/2cm3/2)
t

Parmetrosde
Hansen
(cal1/2cm3/2)
d
p
h

Parmetros
fraccionales

Agua
THF
Metanol
Acetonitrilo

23,3
9,5
14,5
12

7,6
8,2
7,4
7,5

7,8
2,8
6,0
8,8

20,6
3,9
10,9
3,0

21
55
30
39

22
19
25
46

57
26
45
15

100fd

100fp

100fh

SegnlosvaloresdelosparmetrosdeHansen,enelaguapredominan
lasinteraccionesdepuentesdehidrgenomientrasqueenelTHFpredominan
las fuerzas de dispersin, por lo tanto pueden obtenerse disolventes con
diferentescapacidadesdesolvatacinsimplementevariandolacomposicinde
la mezcla THF:agua. Esta informacin puede representarse de modo grfico
mediante el tringulo de Teas. Para ello es necesario convertir los parmetros
de Hansen en parmetros de Teas (tambin conocidos como parmetros
fraccionales) calculando la cantidad relativa que aporta cada parmetro de
Hansenaltotal(Tabla10).EnlaFigura10semuestraunagrficadeTeasenla
que se ilustran los parmetros de Hildebrand (T) y los fraccionales (fh, fd, fp)
paralosdisolventespurosaguayTHFyunamezcladeambos.

La Tabla 11 muestra las recuperaciones obtenidas para las PFASs y los


valores de los parmetros de Hildebrand en funcin de la composicin de las
mezclas agua:THF. La influencia de la composicin del disolvente se estudi
usandomuestrasliofilizadas.

- 249 -

T=23.3
T=13

T =9.5

Figura 10. Grfica de Teas para agua y tetrahidrofurano y su mezcla agua:


tetrahidrofurano a la composicin 25:75, v/v.

Tabla 11. Parmetros de Hildebrand (, cal1/2 cm3/2) y recuperaciones de los


PFASs con sus desviaciones estndar (n = 3) en funcin de la composicin del
disolvente.
RecuperacionesDE(%)
Composicin
del
disolvente
THF:agua,
v/v

100:0
85:15
75:25
70:30
55:45
40:60
15:85
0:100

PFBS

PFHxA

PFHxS

9.5
0
0
135
11.6 1007 726 1033
13.0 1051 942 1031
13.6 1031 928
983
15.7 941 1012 984
17.8 794
811
805
21.2 371
361
131
23.3 332
303
131

PFOA

206
897
971
959
976
932
121
101

PFOS

PFDA

256 287
1007 855
1041 1041
1064 927
716 779
718 543
101 101
71
151

PFUnDA PFTeDA

283
816
1051
1041
688
403
61
21

291
706
1061
1055
6811
328
22
21

Muestra:Melvaliofilizada0,2g(pesohmedo)yfortificada(40ngg1pesohmedo)
Volumendedisolvente:600L.

- 250 -

Resumenydiscusindelosresultados
LaextraccindePFASsenaguaoTHFesmuybajadebidoalinadecuado
equilibrioenestosdisolventesentrefuerzaspolaresynopolares.Laeficiencia
de extraccin aument considerablemente al emplear mezclas de agua:THF,
siendocuantitativaaporcentajesdeaguaentre1530%paralosPFSAsyentre
2030% para los PFCAs. Al ser el agua un disolvente prtico es capaz de
proporcionar interacciones indipolo con los grupos polares de los PFSAs y
puentesdehidrgenoconlosgrupospolaresdelosPFCAsylosPFSAs.Segnlos
datos de las recuperaciones, disoluciones con valores de Hildebrand
comprendidos entre 1214 y valores de Teas con una relacin entre fuerzas
polares(fh+fp)/nopolares(fd)dealrededorde1,2sernlasidneasparauna
adecuadasolubilizacindelasPFCAs,independientementedesuestructura.La
mezcla 75:25 (v/v) THF:agua se escogi como ptima para la extraccin de las
PFASssiendosurelacinfh/fp =1,7,delocualsededucelaimportanciadelos
puentes de hidrgeno en este disolvente. Este mtodo cumple la
recomendacindelaComisinEuropearelativaalavigilanciadelassustancias
perfluoroalquiladasenlosalimentos(2010/161/UE)dondeseestablecequelos
porcentajesderecuperacindebenestarcomprendidosentreel70%yel120%
[22].

En los disolventes comnmente empleados para extraer PFASs,


metanol:agua(50:50v/v)yacetonitrilo,larelacinentrefuerzaspolares(fh+fp)
y no polares (fd) es de 2,8 y 1,6, respectivamente. En el caso del metanol la
proporcindefuerzasdedispersinesdemasiadobajalocualexplicalasbajas
recuperaciones de PFASs de cadena larga obtenidas con este mtodo y en el
caso del acetonitrilo aunque su balance de fuerzas polares/no polares es
adecuado y esto proporciona buenas recuperaciones para las PFSAs de C812 y
los PFCAs de C612 , su relacin de fh/fp = 0,4 es muy baja lo cual sea
posiblemente la causa de que este mtodo requiera elevado volumen de
disolventeorgnicoyunlargotiempodeextraccinsisecomparaconlamezcla
agua:THFpropuestaenestainvestigacin.
(2)Influenciadelvolumendedisolvente.Elvolumendedisolventeusado
(2501000 L) para la extraccin de las PFASs no afect a la eficiencia de
extraccinenmuestrasliofilizadassiendolasrecuperacionessuperioresal90%.
- 251 -

Seseleccioncomoptimounvalorde800Lyaqueseobservsupresinde
la ionizacin de las PFASs en extractos inferiores a 700 L. Tambin se
comprobquelaeficienciadeextraccinenmuestrashmedaseraequivalente
a la obtenida con muestras liofilizadas, por lo que se propone trabajar con
muestrassinliofilizarperoteniendoencuentasucontenidoenagua(7075%)en
larelacinagua:THF(25:75v/v)yenelvolumenfinaldedisolvente.
(3) Influencia de los parmetros operacionales. Los parmetros
operacionalesseoptimizaronconelfindeminimizareltiemporequeridopara
alcanzar el equilibrio de extraccin y asegurar una completa separacin del
extractoobtenidodelamatrizdelamuestra.Elequilibriodedistribucindelas
PFASsentrelasmuestrasyeldisolventeseestablecirpidamente(7min)yel
tiempodecentrifugacinsefijen13minutosa15.000rpm.

b)Muestrasdesuerosanguneo
Durante la extraccin de las PFASs en las muestras de suero sanguneo el
disolvente supramolecular acta como extractante mientras que la disolucin
de equilibrio (THF:agua) incorpora una etapa de limpieza simultnea al
proporcionar un medio donde los compuestos hidroflicos de la matriz son
solubilizados. El mtodo de extraccin propuesto consiste en la adicin en un
microtubo de centrfuga de 18 L de una disolucin de patrones internos
marcadosisotpicamente(ISs)enmetanoldeconcentracin100ngmL1,765L
de suero, 38 L de cido clorhdrico (12 M), 600 L de THF y 97 L de cido
hexanoico para dar lugar a una concentracin final de 6,5 % (v/v) de cido
hexanoico y un 40% (v/v) de THF, condiciones bajo las cuales se forma
espontneamentealrededorde360LdeSUPRAS.LaadicindelosISsdesdeel
principioesfundamentalparacorregircualquierprdidaduranteelprocesode
extraccinyelposibleefectomatriz.Laextraccinrequiereagitacinconvortex
durante 7 minutos a mxima potencia (aproximadamente 2.500 rpm) y
ultracentrifugacin a 15.000 rpm durante 13 minutos. Se aaden 3 bolitas de
vidrio de 3 mm de dimetro para facilitar la homogenizacin de la mezcla
durante la agitacin ya que las protenas del suero sanguneo precipitan

- 252 -

Resumenydiscusindelosresultados
despus de la adicin del cido clorhdrico y el disolvente orgnico. La
extraccin de los PFASs se basa en la formacin de agregados mixtos
analito:cidohexanoicomediantefuerzasdedispersinypuentesdehidrgeno.
La Figura 11 representa esquemticamente las interacciones que se producen
en la formacin de agregados mixtos. Alcuotas del disolvente supramolecular
formadoserecogenysetransfierenavialesdevidrioparaserinyectadasenel
sistemacromatogrfico.LasPFASsanalizadasfueronloscidosperfluorados(C8
C14)ylossulfonatosperfluorados(C6C8).

Agregadosmixtosentre
PFASsycidohexanoico
Puentesdehidrogeno
~360L

Interaccioneshidrofbicas
PFASs
cidohexanoico

Figura11. Representacin de los agregados mixtos PFASs y cido hexanoico


y las interacciones implicadas en su formacin.

En la optimizacin del procedimiento de extraccin se consideraron las


siguientes variables: (1) concentracin de cido clorhdrico, (2) la composicin
deldisolventesupramoleculary(3)losparmetrosoperacionales.
(1)

Influencia de la acidez. Durante el proceso de optimizacin se

observqueelrendimientodeextraccindelasPFASsenlasmuestrasdesuero
dependan de la acidez del medio. La ruptura del enlace de las PFASs con las

- 253 -

protenas es incompleta cuando la concentracin de cido clorhdrico en el


medio es inferior a 267 mM. Las recuperaciones aumentaron hasta 80% y se
mantuvieron constantes en el intervalo 4001800 mM de HCl, por lo que se
seleccionunvalorde600mMparaelprocesodeextraccin.

(2)

Influencia de la composicin del disolvente supramolecular. La

composicin del disolvente supramolecular vara con el porcentaje de THF y


cido hexanoico presente en la disolucin a partir de la cual se genera. En la
tabla 12 se muestran los resultados obtenidos para la extraccin de PFASs en
funcindelaconcentracindeTHFycidohexanoicoutilizadoparalasntesis
del disolvente supramolecular. La recuperacin de PFASs aument en funcin
delporcentajedeTHFyaqueestedisolventefacilitalarupturadelainteraccin
PFASprotena y por lo tanto la precipitacin de las mismas. Se obtuvieron
mximasrecuperacionesparaporcentajesdeTHFdel50%(v/v),sinembargoen
esascondicionesnoseconseguapreconcentracinalgunaporloqueseescogi
elvalorde40%deTHFcomoptimoenbasealosfactoresdepreconcentracin
alcanzados (1.681.76). El porcentaje de cido hexanoico seleccionado fue un
6.5%(v/v)obteniendorecuperacionesparalosanalitosentreel79yel83%.

El porcentaje de cido hexanoico incorporado en el SUPRAS bajo las


condicionesseleccionadasesdel91%,locualexplicalasbuenasrecuperaciones
obtenidasyaquelaformacindeagregadosmixtosPFCs:cidohexanoicoenla
disolucin en equilibrio es mnima. Un ejemplo de cmo la incompleta
incorporacindelHAalSUPRASpuedeinfluirnegativamentealasextracciones
eselcasodelasrecuperacionesobtenidasconSUPRASsgeneradosapartirde
un2%deHAy40%deTHFolosgeneradosapartirdeun5%deHAyun50%de
THF. En ambos casos la composicin del SUPRAS es prcticamente la misma
(70%deTHF,20%deaguay10%deHA)peroelgradodeincorporacindeHA
es muy diferente; siendo de un 25% en el primer caso con recuperaciones de
PFASs entre el 39 y 67% y de un 95% en el segundo caso con recuperaciones
entreel80y90%.

- 254 -

Resumenydiscusindelosresultados
Tabla12.Recuperaciones de las PFASs con sus desviaciones estndar (n=3) en
funcin de la concentracin de tetrahidrofurano y cido hexanoico.
Analitos
%
RDE(%)
(v/v)
a
THF PFHxS
PFOA
PFOS
PFNA PFDA PFUnDA

25 517
677
551
642 645 667
30 612
782
734
742 752 753
35 681
831
811
781 801 811
40 836
833
794
811 832 821
45 791
884
822
842 832 872

50 801
975
925
924 862 922
b

HA
4.3 611
751
781
781 806 816
5.4 753
892
861
824 843 822
6.5 836
833
794
811 832 821
7.5 773
861
861
861 883 883
Muestrasfortificadasa5ngmL1y600molesdeHCl/mldesuero.
a
6.5%(v/v)decidohexanoico.
b
40%(v/v)deTHF.

PFTeDA
712
772
811
832
854
945

876
821
832
864

(3) Influencia de los parmetros operacionales. Los parmetros


operacionalesseoptimizaronconelfindeminimizareltiemporequeridopara
alcanzar el equilibrio de extraccin y asegurar una completa separacin del
disolventesupramolecularobtenido deladisolucinenequilibrio.Elequilibrio
de distribucin de las PFASs entre la muestra y el disolvente se estableci
rpidamente (7 min) y el tiempo de centrifugacin se fij en 13 minutos a
15.000rpm.

3.3.

Cuantificacin
La cuantificacin de las PFASs se realiz empleando cromatografa

lquida acoplada a dos tipos de analizadores de espectrometra de masas; una


trampainica(IT)yuntriplecuadrupolo(QqQ).Nodebemosolvidar,comoya
secomentanteriormente,quecuandosetrabajaconmetodologasbasadasen
sistemassupramolecularesencombinacinconespectrometrademasasdebe

- 255 -

tenerse en cuenta queelflujoprocedentedelacolumna cromatogrficadebe


enviarseadesechoduranteeltiempoenqueeltensioactivoseeluye,yaqueno
es aconsejable la introduccin de altas concentraciones de tensioactivos en el
espectrmetro de masas. La ventaja de usar un disolvente supramolecular de
cidohexanoicoesquedebidoasucortacadenapresentamayorpolaridadque
los PFASs de C6C14 lo cual permite el anlisis de las mismas sin problemas de
coelucin.

El instrumento estndar para la cuantificacin de las PFASs es


LC/ESI/triple cuadrupolo MS/MS debido a los lmites de deteccin que
proporcionaenmodomultiplereactionmonitoring(MRM)(1100pg)[24].Otra
alternativamsbarataalQqQeseldetectordetrampadeionesconcapacidad
para trabajar tambin en modo MSn y recomendado para la elucidacin de
estructura de los ismeros de PFASs ya que sus espectros proporcionan iones
producto muy especficos [25,26]. Sin embargo, el empleo de este detector
presentaunaseriedeinconvenientesquedebentenerseencuenta.Enprimer
lugar,losionesproductodelasPFSAsmssensibles;[SO3]y[FSO3]conm/z80
y m/z 99 respectivamente, no pueden monitorizarse por IT debido al cutoff a
masas bajas propio del detector de trampa inica. Y en segundo lugar, la
coelucin de interferencias con los analitos puede provocar efectos espacio
carga en la trampa de iones que impiden el correcto funcionamiento de este
analizador.

Debidoalosproblemascausadosporefectoespaciocargaenelanlisis
de extractos de muestras que no se han sometido a una severa etapa de
limpieza cuando se trabaja en modo single ion monitoring o barrido y a la
imposibilidad de determinar las PFSAs en MRM por la ausencia de iones
producto adecuados, se investig la posibilidad de cuantificar las PFASs
trabajando en modo aislamiento de iones. El modo aislamiento de iones
[24] U. Berger, I. Langlois, M. Oehme, R. Kallenborn, Eur. J. Mass Spectrom. 10 (2004)
10.
[25] A. Holm, S.R. Wilson, P. Molander, E. Lundanes, T. Greibrokk, J. Sep. Sci. 27
(2004) 1071.
[26] C. Tseng, L. Liu, C. Chen, W. Ding, J. Chromatogr. A 1105 (2006) 119.

- 256 -

Resumenydiscusindelosresultados
consiste en trabajar en MRM sin llegar a fragmentar los iones precursores
despus de su aislamiento en la trampa. A continuacin se comentan las
caractersticas analticas de los dos mtodos desarrollados; en el primero las
PFASssedeterminaroncontrampainicaenmodoaislamientoyenelsegundo
contriplecuadrupolo.

3.3.1. Sensibilidad

La sensibilidad obtenida para las PFASs empleando IT en modo


aislamiento de iones (valores de m/z seleccionados4) se compar con los
modosconvencionalesdetrabajodeesteanalizador;barridoyMRM.Debidoa
lainevitablefragmentacinenfuentequeexperimentanlosionesprecursores
de los PFCAs antes de llegar a la trampa, todos los voltajes y parmetros
instrumentalesenlosmodosbarridoyaislamientoseoptimizaronparaobtener
la mxima sensibilidad de los iones [MK] en el caso de los PFSAs y como la
sumadeiones[MH]+[MCOOH]enelcasodelosPFCAs.Lafragmentacin
delosPFCAs[2426]sedebealadescarboxilacindelosmismosenlainterfase
del cromatgrafo de lquidos y espectrmetro de masas. En modo MRM los
parmetros se optimizaron para conseguir la mxima cantidad de iones
precursores [MH] para fragmentar en la trampa. Las curvas de calibrado
empleando disoluciones patrn (0,5250 g L1) obtenidas en modo barrido y
modo aislamiento presentaron las mismas caractersticas analticas para todos
los analitos, demostrando que el modo aislamiento puede usarse para
monitorizarlasPFASssinperdersensibilidad.Sinembargo,lacuantificacinde
losPFCAsenmodoMRMfueentre4y45vecesmenossensible,dependiendo
de los analitos, debido a que el nmero de iones precursores que llegan a la
trampaparaserfragmentadosesdrsticamentemenorcomoconsecuenciade
la fragmentacin en fuente. Los lmites de deteccin instrumentales en modo
aislamientoestuvieronenelintervalode13pgparalosPFSAsyentre315pg
paralosPFCAs.

En el anlisis de las muestras de suero, la sensibilidad alcanzada

empleando el analizador 4000 QTrap en modo Scheduled MRM fue


- 257 -

considerablementemejorgraciasasufuentedeionesTurboVqueconsigue
unaexcelentedesolvatacindelflujoprovenientedelcromatgrafoeintroduce
un mayor nmero de iones en el analizador. Adems, presenta la ventaja de
trabajar en modo Scheduled MRM que programa al instrumento para
monitorizarcadainsloduranteunapequeaventanadetiempoalolargodel
cromatogramaenfuncindeltiempoderetencinesperadoparacadaanalito.
El dwell time se ajusta automticamente para cada transicin y mejora la
sensibilidad.Loslmitesdedeteccininstrumentalesenpatronesbajarona0,2
0,3pgparalosPFSAsy0,030,2pgparalosPFCAs.

Independientemente del tipo de analizador empleado, la sensibilidad


delmtodopuedeverseafectadaporlacoelucindecomponentesdelamatriz
queprovocansupresinoincrementodelaionizacinenlainterfaseESI.Enel
casodelanalizadordetrampainicalasupresinoincrementodelaionizacin
secomprobcomparandolaspendientesdecurvasdecalibradoconpatronesy
curvas de calibrado asociadas a la matriz de la muestra. Los extractos
fortificados se obtuvieron a partir de muestras blanco (0,2 g) empleando
diferentesvolmenes(2501000L)demezclahidroorgnicaqueproporcionan
recuperaciones cuantitativas y se observ que las PFASs experimentaban
supresin de la ionizacin en extractos obtenidos con volmenes inferiores a
700L(extractosde600Lprovocabaunasupresindel1045%yaumentaba
hastael7095%enextractosde250L).Laspendientesderectasobtenidasa
partir de extractos superiores a 700 L no mostraban diferencias significativas
cuandosecomparabanconlarectapreparadaendisolventemedianteuntest
detstudent(valoresdetcalculadosestuvieronentre0,06y2,62siendoelvalor
de t crtico 3,17, nivel de significancia 0,01). La Figura 12 compara el
cromatograma obtenido mediante LCIT MS en modo aislamiento de iones de
unpatrnde20gL1coneldeunamuestradefiletedemelvafortificadacon
80ngg1yextradacon800Ldemezclahidroorgnica.

Adicionalmentesefortificaronmuestrasconelpatrninterno13C8PFOA
y se calcul su recuperacin mediante calibracin externa. Las recuperaciones
estuvieron comprendidas entre el 9699% demostrando la ausencia de efecto

- 258 -

Resumenydiscusindelosresultados
matriz y la exactitud conseguida con el mtodo mediante calibracin con
patronesendisolventehidroorgnico(25:75agua:THF).Puededecirseportanto
queloscomponentesdelamatrizdeestetipodemuestrasnointerfierenenla
determinacin de las PFASs en las condiciones de trabajo propuestas en esta
metodologa.

x105 (a)Patrnde20gL1
1.0
0.8

PFHxS

PFOS

PFBS

0.6
0.4

PFHxA

Intens.

0.2

PFOA

PFDA
PFUnDA

0.0
x105 (b)Muestradefiletedemelvafortificada(80ngg1)
1.0
PFOS
PFHxS
0.8
PFBS

PFTeDA

0.6
0.4

PFHxA

0.2
0.0
0.0

5.0

10.0

15.0
Tiempo(min)

PFOA

20.0

PFDA
PFUnDA
PFTeDA
25.0

Figura12. Cromatogramas obtenidos empleando IT en modo aislamiento de


iones a partir un patrn de 20 g L-1 y una muestra de filete de melva
fortificada con 80 ng g-1.

Elestudiodelasupresinoincrementodelaionizacinenelsegundo
mtodo desarrollado se llev a cabo comparando la seal de los patrones
internos marcados isotpicamente (ISs) aadidos justo antes de la inyeccin a
losSUPRASobtenidosdemuestrasdesueroconlasealdelosISsobtenidaen
patrones preparados en THF:agua de la misma concentracin (5 ng mL1). Los

- 259 -

componentesdelamatriznointerfirieronsignificativamenteenlasealdelos
ISs,siendolasupresindelaionizacindel12%yelincrementodelamismadel
6% en el peor de los casos, por lo que los lmites de deteccin en muestras
realesnosevieronafectados.Adems,estametodologaempleaISsparacada
analito que corrigen las pequeas variaciones en la seal asegurando una
correcta cuantificacin. Los lmites de cuantificacin del mtodo estuvieron
comprendidos entre 6 y 59 pg mL1. La tabla 13 muestra un resumen de las
caractersticas analticas de los dos mtodos desarrollados para el anlisis de
PFASsenmuestrasbiolgicas.

Tabla 13. Resumen de las caractersticas analticas de los dos mtodos


desarrollados.

Analitos

Intervalodelinealidad
(ngmL1)

Coeficientedecorrelacin
(r)

LOQdelmtodo

IT
(ngg1)
2

QqQ
(pgmL1)

0,9983

0,9990

0,9997

59

0,0130

0,9999

0,9998

12

0,5250

0,0530

0,9981

0,9995

29

PFNA

0,0130

0,9996

PFDA

4250

0,0530

0,9993

0,9997

16

29

PFUnDA

3250

0,0530

0,9982

0,9991

12

29

PFTeDA

1,5250

0,0530

0,9993

0,9994

29

IT

QqQ

IT

QqQ

0,5250

0,9990

PFHxA

1250

PFHxS

1250

0,130

PFOA

3250

PFOS

PFBS

3.3.2. Selectividad

Las principales interferencias conocidas para la cuantificacin de las


PFASs son las hormonas endgenas humanas (sulfatos esteroides) y las sales

- 260 -

Resumenydiscusindelosresultados
biliares (ismeros del cido taurodeoxiclico) que coeluyen con el PFHxS y el
PFOSrespectivamentecuandoseusanfasesestacionariasC18.Poseenm/zmuy
parecidas a las de los analitos e incluso comparten los iones producto ms
intensoscomnmenteempleadosparacuantificarlossulfonatosentandemMS
(i.e. 499>99 para PFOS y 399>99, 399>80 para PFHxS), lo cual ha llevado en
numerosas ocasiones a una sobreestimacin de las concentraciones de los
PFSAs en muestras biolgicas. Actualmente este problema puede resolverse
usando columnas analticas con mecanismos de retencin ms especficos que
separan estas interferencias de los analitos de inters (por ejemplo, columnas
perfluoradas, de intercambio inico o tipo Synergi hydroRP) o empleando las
transicionesmsselectivasaunquemenossensibles499>99y399>119cuando
sedeterminanportandemMS/MSconQqQ[2729].28La29estrategiaempleada
paraevitarunaidentificacinincorrectadelPFHxSyPFOSdurantelosanlisisde
PFASsenlasmuestrasdesuerosanguneofueemplearlastransiciones399>119
y 499>99 ya que la columna analtica empleada fue una C18. Las muestras de
sueroanimalanalizadasnopresentaroninterferenciasprocedentesdesulfatos
esteroides aunque s se detectaron sales biliares en el suero de oveja y de
caballoalmonitorizarlatransicin499>80.Lastresmuestrasdesuerohumano
analizadaspresentaroninterferenciascoeluyendoconelPFHxSyelPFOSenlos
cromatogramas obtenidos en las transiciones 399>80, 399>99 y 499>80,
demostrandolaimportanciadecuantificarempleandolastransiciones399>119
y499>99paraobtenerselectividad.

Sin embargo, cuando se emplea IT la opcin de cuantificar los PFSAs


mediantelastransicionesselectivasnoesvlidadebidoalproblemadecutoff
que presenta este tipo de detector y que se ha comentado anteriormente. Ya
que el problema de este tipo de interferencias es de fcil solucin usando
columnasanalticasmsapropiadas,nuestrainvestigacinsecentrenotrode
[27] L.W.Y. Yeung, S. Taniyasu, K. Kannan, D.Z.Y. Xu, K.S. Guruge, P.K.S. Lam, N.
Yamashita, J. Chromatogr. A 1216 (2009) 4950.
[28] J.P. Benskin, M. Bataineh, J.W. Martin, Anal. Chem. 79 (2007) 6455.
[29] E. Chan, M. Sandhu, J.P. Benskin, M. Ralitsch, N. Thibault, D. Birkholz, J.W.
Martin, Rapid Commun. Mass Spectrom. 23 (2009) 1405.

- 261 -

los problemas de selectividad que los componentes de la matriz de muestras


biolgicas puede provocar en este analizador; los efectos espaciocarga. El
efecto espaciocarga ocurre cuando demasiados iones son confinados en la
trampa y su consecuencia es que las trayectorias ideales de los iones se ven
alteradasacausadelasrepulsionesentreellos,loquefinalmenteconllevaauna
asignacin incorrecta de masas y prdida de sensibilidad [30,31]. Los efectos
espaciocarga se evaluaron comparando los espectros de masa de los analitos
en un patrn (20 g L1) y en dos tipos de muestras; filete e hgado de melva
fortificadas (80 ng g1) obtenidos en modo barrido con los obtenidos en modo
aislamiento de iones. Los resultados demostraron la ventaja de trabajar en
modoaislamientodeionesyaqueproporcionespectrosdemasacorrectossin
prdida de sensibilidad en ninguno de los casos debido a la expulsin de los
ionesdelamatrizdurantelaetapadeaislamientoevitandoaslosproblemasde
espaciocargaeneldetector.Porelcontrario,losespectrosobtenidosenmodo
barridopresentaronproblemasdeselectividad,siendomayorelefectoespacio
cargaparalosionesconmenorm/zquesonlosprimerosensalirdelatrampa.
LaFigura14comparalosdiferentesespectrosdemasasdelPFOSobtenidosdel
anlisisdeunadisolucinpatrn(a)yunextractodemuestraenmodobarrido
(b)ydelmismoextracto demuestraenmodoaislamiento deiones(c).Puede
observarse cmo los componentes de la matriz de la muestra no afectan a la
resolucin del analizador cuando se trabaja en modo aislamiento de iones,
mientras que en modo barrido proporciona espectros con asignacin de m/z
desplazada.Lam/zdelanalitoaparececomounintervalodem/zentornoauna
m/zmayordelaqueverdaderamentecorrespondealPFOS(498,9),locuallleva
asociado a su vez prdida de sensibilidad. Estos problemas no desaparecieron
enmodobarridoapesardemodificarlosparmetrosquecontrolanelnmero
deionesqueentranenlatrampa;controldecargadeiones(ICC)entre5.000y
50.000ytiempomximodeacumulacinentre100200ms.

[30] K.A. Cox, C.D. Cleven, R.G. Cooks, Int. J. Mass Spectrom. Ion Processes 144
(1995) 47.
[31] N.A. Yates, M.M. Booth, J.L. Stephenson, R.A. Yost, en: Practical Aspects of Ion
Trap Mass Spectrometry, vol. III, p. 121, CRC Press, London, 1995.

- 262 -

Resumenydiscusindelosresultados

(a)Modobarrido
(patrn)

(b)Modobarrido
(extractodemuestra)

PFOS

PFOS

(c)Modoaislamientodeiones
(extractodemuestra)
PFOS

Figura 13. Espectros de masa obtenidos con trampa de iones de (a) una
disolucin de PFOS de 20 g L-1 trabajando en modo barrido, (b) un extracto
de muestra de hgado de melva fortificada a 80 ng g-1 trabajando en modo
barrido y (c) un extracto de muestra de hgado de melva fortificada a 80 ng g-1
trabajando en modo aislamiento de iones.

3.3.3. Controldelacontaminacin

Elproblemadelacontaminacindefondoprovenientedelmaterialde
laboratorioydeloscomponentesdelLCMSfabricadosconfluoropolmeros[29]
se monitoriz constantemente durante el desarrollo de las metodologas, ya
que puede conducir a cuantificacin inexacta de las PFASs. Una de las fuentes
decontaminacinidentificadasfueronlosseptadeTeflon/gomadelostapones
delosviales,porloquestossesustituyeronporseptadealuminio/siliconatras
lo cual la seal de fondo observada para el PFHxS y el PFOA en inyecciones
- 263 -

blanco (10 L de disolucin THF:agua 75:25) en el LCMS/IT desapareci. Esta


sustitucin no fue suficiente para eliminar la contaminacin de fondo en las
inyecciones blanco realizadas en el LCMS/QqQ por lo que se insert una
columnaadicional(SymmetryShieldTMRP8guardcolumn,3.5m,3.9mm20
mm) entre la bomba y el inyector de modo que las PFASs provenientes del
instrumentoquedaronretenidastemporalmenteendichacolumnaevitandoas
su coelucin con las PFASs presentes en la muestra. Asimismo, aunque no se
observ contaminacin aportada por el material de laboratorio empleado en
ninguno de los dos procedimientos, se inyectaron blancos reactivo control
rutinariamente durante las secuencias cromatogrficas como medida de
precaucin.

3.3.4. Veracidad

LaveracidaddelmtododesarrolladoparaanlisisdePFASsenbiota,se
evalumedianteelanlisisdelmaterialdereferencia(MR)empleadoenel2
estudiointerlaboratoriointernacionalcuyocontenidoenPFASsseespecificaen
laTabla14.LosextractosseanalizaronconITenmodoaislamientodeionesy
conQqQenmodoMRMempleandolassiguientestransiciones;PFBS,299>80;
PFHxA, 313>269; PFHxS, 399>80; PFOA, 413>369; PFOS, 499>80; PFNA,
463>419; PFDA, 513>469; PFUnDA, 563>519; PFDoDA, 613>569 y PFOSA,
498>78.LaseparacincromatogrficadelosanlisisrealizadosenQqQsellev
a cabo con una columna FluoroSep para evitar problemas de interferencias ya
que como se coment en el apartado 3.3.2. las transiciones escogidas en este
casoparacuantificarlosPFSAssonlasmsintensasperonolasmsselectivas.
Losresultadosobtenidos,expresadoscomovalormedio(n=3),semuestranen
la Tabla 14. La veracidad expresada como porcentaje [(concentracin
detectada/concentracinaseguradaporelMR)x100)estuvoenelintervalo80
130%paratodoslasPFASsdemostrandolabuenaconcordanciaconlosvalores
delMRindependientementedeltipodeMSempleadoparasucuantificacin.

AlnodisponersedeMRparalasPFASsensuerosanguneo,laveracidad
delsegundomtododesarrolladoseevalumedianteelanlisisdemuestrasde
- 264 -

Resumenydiscusindelosresultados
Tabla 14. Resultados obtenidos del anlisis del MR del 2 estudio
interlaboratorio internacional sobre PFASs mediante el mtodo desarrollado
empleando IT y QqQ para su cuantificacin.
Analitos

Concentracinenel
MR(ngg1)

PFBS
PFHxA
PFHxS
PFOA
PFOS
PFNA
PFDA
PFUnDA
PFDoDA
PFTeDA
PFOSA
n.d.,nodetectado
n.a.,noanalizado

22.6
145
17.2
21.9
17.8
20.1

3.2

ConcentracinDE
(ngg1)
Trampainicaen
Triplecuadrupolo

modoaislamiento
enMRM
n.d.

n.d.
n.d.

n.d.
n.d.

n.d.

212
18.00.8

1948
17712
n.a.

17.71.5

25.30.1
21.30.9

201
17.51.3
n.a.

23.00.8
n.d.

n.a.
n.a.

3.10.4

suerodeternerafortificadasconlosanalitos(5ngmL1).Debidoalaausenciade
muestrasblancoparatodoslosanalitoselporcentajederecuperacinsecalcul
como100*(x2 x1)/xfortificado;siendox1 elvalormedido enblancoyx2 elvalor
medidoenlaporcinenriquecida.Lasrecuperacionesobtenidasvariaronentre
el 79 y el 83%, considerndose valores aceptables. Estas pequeas prdidas
ocurridasduranteelprocesodeextraccinsecorrigierongraciasalempleode
patrones internos (ISs) en las muestras, obtenindose valores de recuperacin
entre95107%yasegurndoseportantounacuantificacinexactayprecisa.

3.3.5. Precisin

La precisin de los mtodos se evalu mediante el anlisis de 11


muestras fortificadas, en el caso de muestras de hgado y filete de pescado a
una concentracin de 20 ng g1 y en las muestras de suero a 5 ng mL1. Las
desviaciones estndar relativas obtenidas de los anlisis de muestras slidas y
- 265 -

muestras de suero estuvieron comprendidas entre 111% y entre 16% para


todoslasPFASs,respectivamente.

3.3.6. Anlisisdemuestras

Finalmente la aplicabilidad de los mtodos propuestos se demostr


determinando las PFASs en muestras fortificadas y sin fortificar de diferentes
pescados,avesysueros.Elniveldefortificacinfue20ngg1enlasmuestrasde
hgado y msculo obtenindose recuperaciones entre el 87 y 111%. La
composicindelamatriznotuvoinfluenciaenlaextraccincuantitativadelas
PFASs con diferente longitud de cadena, siendo la principal diferencia el
contenido en lpidos que variaba entre el 1% en la platija y el 15% en las
caballas.Porotrolado,lasrecuperacionesenlasmuestrasdesueroestuvieron
entre el 75 y 89%, expresadas como recuperacin de los ISs del mtodo (5 ng
mL1). La Tabla 15 muestra las concentraciones de analitos encontradas en las
muestrasanalizadas.ElPFOSestuvopresenteentodaslasmuestrasdepecesy
aves marinas aunque slo pudo cuantificarse en los hgados de melva y
palometa a concentraciones de 14,30,7 y 9,50,5 ng g1, respectivamente.
Niveles cuantificables de otros PFSAs tambin se encontraron en msculo de
gaviota(3,20,6ngg1dePFBS),hgadodepalometa(8,90,3ngg1dePFBS)y
filetedepalometa(2,90,6ngg1dePFHxS).Elrestodeanalitosdetectadosen
las muestras slidas estuvo por debajo de su lmite de cuantificacin. Las
muestrasdesueroanalizadaspresentaronPFASsentre171y197,30,6ngmL
enelsueroprocedentedeanimalesyentre844y5.16863ngmL1ensuero

de humanos. PFOS y PFOA presentaron las mayores concentraciones,


independientementedelaprocedenciadelamuestra,seguidosdelPFHxSenlas
muestras de suero humano. Sin embargo este analito no se encontr en
ningunadelasmuestrasdesueroanimal.LapresenciadePFASsdecadenalarga
en todas las muestras de suero analizadas pone de manifiesto la necesitad de
monitorizar estos analitos de manera rutinaria junto con el PFOS y PFOA. La
Figura 14 muestra el cromatograma obtenido para la muestra de suero
humano1sinfortificar.

- 266 -

n.d

Hgadodemelva

- 267 -

n.d.

2,90,6

n.d.

<LOQ

n.d.

n.d.

<LOQ

n.a.
n.a.
n.a.
n.a.
n.a.

n.a.
n.a.
n.a.
n.a.
n.a.

Suerobovino

Sueroequino

Suerohumano1

Suerohumano2

Suerohumano3

n.a.;noanalizado
n.d.;nodetectado

n.a.

n.a.

n.d.

n.d.

79441

67866

746116

n.d.

n.d.

n.d.

n.d.

<LOQ

<LOQ

<LOQ

n.d.

PFHxS

PFHxA

Suerovacuno

Msculodealcatraz

Msculodegaviota

Filetedecaballa

Hgadodepalometa

n.d.

8,90,3

n.d.

3,20,6

n.d.

n.d.

Filetedemelva

Filetedepalometa

PFBS

Muestras

1.21920

1.24247

1.73535

352

171

14,30,7

n.d.

n.d.

n.d.

n.d.

n.d.

n.d.

n.d.

PFOA

4.67010

4.597171

5.16863

<LOQ

1562

197,30,6

<LOQ

<LOQ

<LOQ

9,50,5

13,10,2

<LOQ

<LOQ

PFOS

56717

56533

90833

452

521

233

n.a.

n.a.

n.a.

n.a.

n.a.

n.a.

n.a.

PFNA

2585

2615

37632

<LOQ

5606

54823

6243

715

724

693

<LOQ
374

n.d.

n.d.

n.d.

n.d.

n.d.

n.d.

n.d.

PFUnDA

n.d.

n.d.

n.d.

n.d.

n.d.

n.d.

n.d.

PFDA

(expresadas en ng g-1 en las muestras slidas y en pg mL-1 en las muestras de suero).

844

865

993

<LOQ

10813

7010

n.d.

n.d.

n.d.

n.d.

<LOQ

n.d.

n.d.

PFTeDA

Tabla 15. Concentraciones medias de PFASs encontradas en las muestras biolgicas analizadas

Resumenydiscusindelosresultados

PFOA
4_

Intensidad

2.5e

320

4_

2.0e
1.5e4_
1.0e4_
5000.0

0
0

PFHxS
PFTeDA

160

PFNA

0
50
40
30
Envioadesecho
5

10

15

20

PFHxS
30
25
Tiempo(min)

PFDA
PFOS PFUnDA
PFTeDA
35

40

45 50

Figura14. Cromatograma obtenido a partir de una muestra de suero humano


mediante QqQ. Insertado en la figura aparece una ampliacin del
cromatograma con los analitos de menor intensidad.

- 268 -

CONCLUSIONES

Conclusiones
LasinvestigacionesqueserecogenenlaMemoriadeestaTesisDoctoral
handemostradolacapacidadquepresentanlossistemassupramolecularespara
integrarysimplificarlasetapasdelprocesoanalticoenelanlisisdemuestras
acuosas y biolgicas. Esto ha permitido desarrollar mtodos que extraen,
preconcentranyestabilizancontaminantesorgnicosenunasolaetapagracias
alempleodediferentesagregadossupramoleculares.Adems,sehanpuestoa
punto dos nuevas metodologas para la determinacin de sustancias
perfluoroalquiladas y se ha mejorado su cuantificacin cuando se emplea
espectrometra de masas con trampa inica. A continuacin se resumen las
principalesconclusionesobtenidasencadaunadelasPartesdeestaMemoria.

PARTE I: SISTEMAS SUPRAMOLECULARES PARA LA SIMPLIFICACIN DE


LAS

OPERACIONES

PREVIAS

EN

LA

DETERMINACIN

DE

CONTAMINANTESENMUESTRASACUOSAS.

Los sistemas supramoleculares empleados para la extraccin,


preconcentracin y conservacin de los contaminantes (tensioactivos de
benzalconio, PAHs y plaguicidas) analizados en muestras acuosas han sido
adsorbentes hemimicelares de dodecilsulfato sobre almina, adsorbentes
admicelares mixtos de dodecilsulfato y tetrabutilamonio sobre almina y
disolventes supramoleculares (SUPRASs) constituidos por micelas normales de
cido dodecilsulfnico en mezclas cido clorhdrico/agua mediante un proceso
deautoasociacin.

Las principales ventajas de las metodologas desarrolladas empleando


estosagregadosson:

1)

Simplicidad. Las etapas de extraccin, preconcentracin, limpieza y


conservacinseintegraenunasimpleetapa.

2)

Graneficaciadeextraccingraciasalaaltacapacidaddesolubilizacinya
los diferentes tipos de interacciones que proporcionan los sistemas
supramoleculares; fuerzas dispersivas, interacciones inicas, puentes de

- 271 -


hidrgenoeinteracciones catinparalaextraccindelos compuestos
orgnicos.

3)

Elevados factores de preconcentracin sin necesidad de evaporacin de


losextractos.Enelcasodelosadsorbentessupramoleculares,lasfuertes
interaccionesqueseestablecenentrelosagregadosyloscontaminantes
permiten utilizar volmenes de muestra de 0,25 L y 1L para la
determinacin de los plaguicidas y los compuestos de benzalconio,
respectivamente,locualunidoalpequeovolumendeeluyentenecesario
para la desorcin de los analitos (12 mL) permite alcanzar factores de
preconcentracin suficientemente elevados (25500) para obtener la
sensibilidadrequeridaparaelcumplimientodelalegislacin.Elempleode
bajos volmenes de disolvente orgnico para la elucin es una
caractersticadiferencialdelosadsorbentessupramolecularesrespectoa
otrosadsorbentescomolospolimricos.

4)

Enelcasodelasextraccionescondisolventessupramoleculares,lafaseen
equilibrio obtenida despus de la formacin del SUPRAS constituye un
medio donde se retienen las interferencias ms polares actuando como
etapadelimpiezasimultneaalaextraccin.

5)

Grancapacidaddeestabilizacindeloscontaminantes.Unavezretenidos
los analitos, el microambiente proporcionado por los agregados
supramoleculareslesconfiereestabilidadyevitasudegradacin.Adems,
el pequeo volumen de los formatos empleados; cartuchos de SPE y
pequeosvialesparalosSUPRASs,facilitasutransporte,almacenamiento
yrefrigeracinsifueranecesaria.

PARTE II: NUEVAS METODOLOGAS PARA EL ANLISIS DE SUSTANCIAS


PERFLUOROALQUILADASENMUESTRASBIOLGICAS.

Se ha sintetizado un nuevo disolvente supramolecular constituido por


micelasinversasdecidohexanoicoenmezclasTHF/aguamedianteunproceso

- 272 -

Conclusiones
de autoasociacin. Es la primera vez que se propone un disolvente con una
cadenahidrocarbonadatancortayelestudiorealizadohademostradoquesu
comportamiento es diferente en algunos aspectos a los disolventes
supramoleculares sintetizados a partir de cadenas hidrocarbonadas de mayor
longitud. As, debido a la gran solubilidad en agua de cido hexanoico, se
requieren porcentajes de ste y THF de al menos 4% y 30% (v/v),
respectivamente,paralacompletaincorporacindeltensioactivoenelSUPRAS,
lo cual es clave para conseguir rendimientos cuantitativos de extraccin. El
mecanismo de extraccin se basa en la formacin de agregados mixtos
HA:PFASsdadaslassimilitudesestructuralesentrelosanalitosyelextractante.
Porotrolado,laconcentracindeHAenelSUPRASeselevada(0,25mg/L),lo
cual posibilita llevar a cabo microextracciones lquidolquido con pequeos
volmenesdeSUPRASdebidoalelevadonmerodecentrosactivospresentes.
ElvolumendeSUPRAS generadopuedepredecirseyesfuncin delacantidad
deHAyporcentajedeTHFpresentesenlamezcladeproduccindeldisolvente.

El conocimiento de los mecanismos que llevan a la formacin de los


agregados inversos de cidos carboxlicos en mezclas THF y agua ha permitido
aplicar este concepto a ladeterminacin de PFASs utilizando mezclas de estos
dos disolventes que presenten un balance de fuerzas polares/apolares de 1,2.
As, dentro de las investigaciones incluidas en este bloque se ha desarrollado
otromtodoparalamicroextraccindePFASsenmuestrasbiolgicas(pescado
yavesmarinas)basadoenlaformacindeagregadosinversosdelosanalitosen
un mezcla de THF y agua. Tambin se ha mejorado la cuantificacin de estos
compuestos mediante espectrometra de masas con trampa inica trabajando
enmodoaislamientodeiones.Estemododetrabajomantienelasensibilidad
alcanzadatrabajandoenmodofullscanalavezqueevitaelindeseadoefecto
espaciocarga que suelen afectar a la selectividad y sensibilidad de las
determinacionesrealizadascontrampadeiones.

Las principales ventajas de los mtodos desarrollados para la


determinacindelasPFASsson:

- 273 -


1)

La elevada eficacia de extraccin para todos los PFASs (80100%),


independientemente de la longitud de su cadena fluorocarbonada, en
diferentesmuestrasbiolgicas(pescado,avesmarinasysuerosanguneo).

2)

Lasimplicidaddetratamientodelamuestra.Lasextraccionessellevana
cabo en una nica etapa. No se requiere precipitacin adicional de las
protenas ni etapas de limpieza y la presencia de efecto matriz es
despreciable.

3)

Laelevadafrecuenciademuestreo.Laextraccindelosanalitosserealiza
en 20 minutos y dada la simplicidad de los procedimientos analticos
utilizadosesposibletratarvariasmuestrassimultneamente.

4)

Elbajovolumendedisolventeorgnicoempleadoenlasextracciones(0,6
mL de THF por muestra) en comparacin con otras metodologas
comnmenteutilizadas.

5)

Elevada sensibilidad. Los lmites de cuantificacin alcanzados para el


anlisisdepecesyaves(216gkg1)permitenlamonitorizacinrutinaria
deestoscompuestosenmuestrasbiolgicas.Asimismo,elmtodoparala
determinacindelasPFASsenmuestrasdesueroesmuysensible(lmites
decuantificacinentre6y60pgmL1)permitiendoestudiarlaexposicin
humana a PFASs incluso para los cidos perfluoroalquilcarboxlicos de
cadenasuperiora8tomosdecarbonoquesuelenencontrarseensangre
amuybajasconcentraciones.

- 274 -

APNDICES

Apndices

APNDICES A. PUBLICACIONES CIENTFICAS DERIVADAS DE LA TESIS


DOCTORAL

1.

Stabilityofbenzalkoniumsurfactantsonhemimicellebasedsolidphase
extractioncartridges.
Noelia Luque, Francisco Merino, Soledad Rubio, Dolores PrezBendito.
JournalofChromatographyA,1094(2005)1723.
(Factor de Impacto 2011: 4.531; Posicin: Primer decil)

2.

Use of coacervates for the onsite extraction/preservation of polycyclic


aromatichydrocarbonsandbenzalkoniumsurfactants.
NoeliaLuque,SoledadRubio,DoloresPrezBendito.
AnalyticaChimicaActa584(2007)181188.
(Factor de Impacto 2011: 4.555; Posicin: primer decil)

3.

Analysis of perfluorinated compounds in biota by microextraction with


tetrahydrofuranandliquidchromatography/ionisolationbasediontrap
massspectrometry.
Noelia Luque, Ana BallesterosGmez, Stefan van Leeuwen, Soledad
Rubio.
JournalofChromatographyA1217(2010)37743782.
(Factor de Impacto 2011: 4.531; Posicin: Primer decil)

4.

A simple and rapid extraction method for sensitive determination of


perfluoroalkyl substances in blood serum suitable for exposure
evaluation.
Noelia Luque, Ana BallesterosGmez, Stefan van Leeuwen, Soledad
Rubio.
JournalofChromatographyA1235(2012)8491.
(Factor de Impacto 2011: 4.531; Posicin: Primer decil)

5.

Extractionandstabilityofpesticidemultiresiduesfromnaturalwateron
amixedmodeadmicellarsorbent
NoeliaLuque,SoledadRubio.
- 277 -


JournalofChromatographyA,DOI:10.1016/j.chroma.2012.06.006
(Factor de Impacto 2011: 4.531; Posicin: Primer decil)

- 278 -

Apndices

APNDICESB.COMUNICACIONESACONGRESOS

1.

Stability of benzalkonium surfactants on dodecylsulfate hemimicelles


coatedaluminacartridges.
Pster
NoeliaLuque,FranciscoMerino,SoledadRubio,DoloresPrezBendito.
29th International Symposium on High Performance Liquid Phase
SeparationsandRelatedTechniques,Estocolmo,Suecia(2005).

2.

Stability of amphiphilic and hydrophobic pollutants in anionic micelle


basedcoacervates.
Pster
NoeliaLuque,SoledadRubio,DoloresPrezBendito.
34thInternational Symposium on Environmental Analytical Chemistry,
Hamburgo,Alemania(2006).

3.

Extraccinyestabilizacindeplaguicidasmediantesorbentesadmicelares
mixtos.
Pster
NoeliaLuque,SoledadRubio,DoloresPrezBendito.
GRASEQA 2008; XI Reunin del Grupo Regional Andaluz de la Sociedad
EspaoladeQumicaAnaltica,Huelva,Espaa(2008).

4.

Tcnicas integradassimplificadas en las etapas previas del anlisis


ambientalconelusodeagregadossupramoleculares.
Comunicacinoral.
NoeliaLuque,SoledadRubio.
I Congreso Cientfico de Investigadores en Formacin, Crdoba,Espaa
(2009).

5.

Analysisofperfluoroalkylcompoundsinbiotabysolventmicroextraction
and liquid chromatography/ion isolationbased ion trap mass
spectrometry.

- 279 -


Pster
Noelia Luque, Ana BallesterosGmez, Stefan van Leeuwen y Soledad
Rubio.
4thInternationalSymposiumonRECENTADVANCESINFOODANALYSIS,
Praga,RepblicaCheca(2009).

6.

Stability of amphiphilic and hydrophobic pollutants in nanostructured


liquidsbasedonanionicmicelles.
Pster
NoeliaLuque,SoledadRubio.
II Encuentro sobre Nanociencia y Nanotecnologia de investigadores y
tecnlogosdelaUniversidaddeCrdoba.Crdoba,Espaa(2010).

7.

Analysis of perfluorinated compunds in blood serum by supramolecular


solventbased microextraction and liquid chromatography/ion isolation
basediontrapmassspectrometry.
Pster
Noelia Luque, Ana BallesterosGmez, Stefan van Leeuwen y Soledad
Rubio.
Dioxin;30thInternationalSymposiumonHalogenatedpersistentorganic
pollutants(POPs).Texas,USA(2011)

8.

Anlisis de compuestos perfluorados en suero sanguneo mediante


microextraccin con disolventes supramoleculares y cromatografa
lquida/espectrometrademasascontrampainica.
Pster
NoeliaLuque,AnaBallesterosGmezySoledadRubio.
III Encuentro sobre Nanociencia y Nanotecnologia de investigadores y
tecnlogosAndaluces.Crdoba,Espaa(2011).

9.

Urine Bisphenol A levels in different pregnancy trimesters and in 4 year


oldchildrenaretheycorrelated?
Pster

- 280 -

Apndices
MaribelCasas,NoeliaLuque,AnaBallesterosGmez,MarietaFernndez,
MonicaGuxens,HolgerKoch,MichelleMndez,SoledadRubioyMartine
Vrijheid.
Child Health and Environment. INMA projectEnvironment and
Childhood.ConfernciesCientfiques.Barcelona,Espaa(2011).

- 281 -