Está en la página 1de 33

Universidad Nacional del Litoral

Secretara Acadmica
Direccin de Articulacin, Ingreso y Permanencia
Ao 2014

Biologa
Conceptos bsicos

ISBN en trmite

Unidad 2. La qumica de la vida

Ana Mara Gagneten / Alba Imhof / Mara del Roco Marini / Juan Marcelo Zabala /
Pablo Tomas / Patricia Amavet / Laura Ravera / Nora Ojea

A pesar de la sorprendente diversidad que podemos observar a nuestro alrededor, incluyndonos a nosotros mismos, tambin presentamos una gran uniformidad,
ya que todos los seres vivos estamos constituidos por los mismos tomos y molculas que las cosas inanimadas, y obedecemos a las leyes de la fsica y de la qumica.
Por supuesto que los seres vivos poseemos propiedades particulares, que estn dadas por la composicin y la estructura qumica de las sustancias que nos componen,
y que nos diferencian de lo que no tiene vida.
Todos los seres vivos somos conjuntos de elementos. Los elementos a su vez estn formados por tomos, que son las unidades ms pequeas de la materia que an
conservan las propiedades de ese elemento. Vale decir, podemos romper un pedazo
de aluminio en trozos cada vez ms pequeos y el menor que logremos obtener, aunque sea un solo tomo solitario, sigue siendo el elemento aluminio.
En la Tierra hay 92 elementos naturales, que encontramos enumerados en la tabla peridica de los elementos. Los seres vivos no estn constituidos por todos ellos;
slo algunos forman parte de la enorme complejidad de los seres vivos, incluyendo
tambin a los ms simples seres unicelulares. Seis de estos elementos constituyen
aproximadamente el 99 % del peso de cualquier ser vivo: oxgeno (O), carbono (C), hidrgeno (H), nitrgeno (N), fsforo (P) y azufre (S).
R

Recordemos que..

un elemento es una forma fundamental de la materia que tiene masa y que ocupa
espacio.

Teniendo en cuenta la concentracin relativa en los seres vivos, a estos elementos


podemos clasificarlos en: macroelementos o constituyentes principales, microelementos y elementos traza.
Como su nombre lo indica, los macroelementos son los ms abundantes en cualquier ser vivo y son componentes universales de las sustancias inorgnicas y orgnicas
de importancia biolgica. Ellos son: carbono (C), hidrgeno (H), oxgeno (O) y nitrgeno (N), conocidos por la sigla CHON.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Los microelementos son aquellos necesarios en menor concentracin que los anteriores, entre un 0,05 y un 1 % del peso total. Como veremos luego, tambin cumplen
importantes funciones dentro de los organismos vivos. Entre ellos ubicamos: fsforo
(P), azufre (S), sodio (Na), potasio (K), cloro (Cl), calcio (Ca) y magnesio (Mg).
Los elementos traza, tambin llamados oligoelementos, son necesarios en concentraciones bajsimas, menores al 0,01 %, pero no por eso son menos importantes. Entre
ellos estn: hierro (Fe), cobre (Cu), manganeso (Mn), zinc (Zn), molibdeno (Mo) y otros
presentes slo en algunos seres vivos, como el boro (B) en vegetales. La falta de estos
elementos trazas da origen a serias enfermedades, como por ejemplo la anemia, que
puede producirse en humanos y animales por falta de hierro o de cobre.

2.1. Formacin de molculas: tipos de enlaces qumicos


Todos los tomos de los elementos que acabamos de mencionar se combinan entre s para formar molculas. Estas combinaciones se producen a travs de enlaces
qumicos, que mantienen unidos a los elementos entre s.
La fuerza de un enlace qumico se mide como la energa que se necesita para romperlo. A su vez, nos da idea de la energa liberada en el proceso.

Figura 1. Estructura qumica del ATP, la moneda energtica de las clulas. Los tres enlaces entre los
fosfatos retienen gran cantidad de energa que se libera al romperse cada uno de estos.

Los enlaces pueden ser dbiles o fuertes. Los enlaces dbiles son importantes en la
interaccin de los elementos para formar molculas y tambin en la interaccin de molculas entre s. Si bien al considerarlas individualmente resultan interacciones dbiles,
fciles de romper, en conjunto presentan una fuerza suficientemente importante como
para participar en las uniones entre molculas. Dentro de los enlaces de este tipo podemos considerar:
las interacciones hidrofbicas, generadas por fuerzas de repulsin entre las
molculas. Este tipo de enlace es muy importante en la formacin de las membranas biolgicas;

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

los enlaces puentes de hidrgeno, interacciones entre tomos electropositivos y electronegativos, por atraccin de cargas opuestas. Son importantes en la interaccin de molculas polares, como luego veremos en la molcula de agua (ver Figura 2, 3 y 5). Estos
enlaces se pueden formar entre dos molculas o entre dos partes de la misma molcula;
enlaces inicos, ocurren entre tomos elctricamente cargados llamados iones.
Aportan la fuerza que mantiene unida, por ejemplo, a los iones sodio, cargados positivamente (Na+) y a los iones cloruro, cargados negativamente (Cl-) en la molcula de
sal comn, el cloruro de sodio (ClNa). Estos enlaces son muy fuertes en ausencia de
agua. Si agregamos sal a un recipiente con agua, sta se disuelve en el agua, porque
los iones sodio y cloruro interaccionan con los del agua, y ya no se observan como
cristales de sal comn (ver Figura 5);
las fuerzas de van der Waals, enlaces dbiles que se generan entre tomos ubicados a corta distancia, y que se deben a sus cargas elctricas fluctuantes. Estas fuerzas
se conocen como atracciones de van der Waals. Sin embargo, si los tomos se acercan
demasiado entre s, las fuerzas de atraccin se transforman en fuerzas de repulsin.
Por ltimo, los enlaces fuertes son los responsables de la mayora de las uniones
entre tomos que forman molculas, e incluyen:
enlaces covalentes, formados por pares de electrones (pueden ser uno, dos o tres
pares) que se comparten entre los tomos que constituyen las molculas. Este tipo de
enlace es muy importante en la formacin de molculas orgnicas, que estn constituidas principalmente por tomos de carbono, un macroelemento que es la base estructural de los seres vivos, precisamente porque puede formar enlaces covalentes
con otros cuatro tomos de carbono o con otros, como el hidrgeno, oxgeno, nitrgeno, etc. As, gracias a los enlaces covalentes entre tomos de carbono se forman largas cadenas carbonadas, que constituyen el esqueleto principal de la mayora de los
compuestos orgnicos, como veremos a continuacin.

2.2. Molculas inorgnicas y orgnicas


Teniendo en cuenta principalmente los elementos que constituyen las molculas y la
complejidad estructural de las mismas, podemos clasificarlas en inorgnicas y orgnicas.
Las molculas o compuestos inorgnicos son simples, de pequeo tamao, tales
como el agua, las sales y los cidos y bases simples.
Las molculas o compuestos orgnicos son todas aquellas que poseen el elemento
carbono (C) en su constitucin; en general son grandes, formadas por varios tomos
de carbono, como los hidratos de carbono, los lpidos, las protenas y los cidos nucleicos. Es importante considerar que el dixido de carbono (CO2) es la excepcin a
esta regla, ya que es una molcula inorgnica, simple, que posee carbono.
Empezaremos a considerar las molculas inorgnicas.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

2.2.1. El agua
La ms abundante de las molculas que componen a los seres vivos es el agua,
constituyendo entre el 50 y el 95 % del peso de cualquier sistema vivo.
El agua ha sido desde los remotos comienzos del origen de la vida, un participante
muy activo en la compleja actividad qumica de la cual surgieron los compuestos orgnicos iniciales y, ms adelante, los primeros organismos.
El agua desempea una serie de funciones en los sistemas vivos. La mayor parte de los dems productos qumicos existentes estn disueltos en ella y, necesitan un
medio acuoso para reaccionar uno con otro. Disuelve los productos de desecho del
metabolismo y ayuda a su eliminacin de la clula y del organismo. Adems, tiene
gran capacidad trmica; o sea una gran capacidad para absorber calor con cambios
muy pequeos de su propia temperatura. Esta habilidad del agua para absorber calor
permite a los seres vivos eliminar el exceso de calor evaporando agua.
Cumple la funcin indispensable de lubricante, y se encuentra siempre donde un
rgano se desliza contra otro, formando parte de los lquidos corporales. En las articulaciones, por ejemplo, se encuentra agua formando parte del lquido sinovial, donde
un hueso se mueve sobre otro.
El hecho de que sea el componente ms abundante de la materia viva no parece
resultado de la casualidad. Lo que ocurre es que sus singulares propiedades le han
permitido intervenir en mltiples papeles en el organismo. Veamos cules son esas
propiedades desde el punto de vista qumico.
La estructura molecular del agua
El agua es una sustancia ms compleja de lo que podra suponerse observando su frmula elemental: dos tomos de hidrgeno unidos a un tomo de oxgeno
(HOH). Entre stos se establecen enlaces covalentes simples, donde el tomo de
oxgeno comparte un par de electrones
carga ligeramente negativa
con cada uno de los tomos de hidrgeen este extremo
no. Pero sucede que el tomo de oxgeno, que posee ms masa, ejerce mayor
Las cargas + y - se
atraccin sobre los electrones de los enequilibran mutualaces que los de hidrgeno, y esto genera
mente, de modo que
una distribucin de electrones asimtrica.
la molcula no tiene
en s carga neta
Los electrones de los pares compartidos
permanecen ms tiempo cerca del oxgeno que de cada tomo de hidrgeno.
extremo ligeramente
Como resultado, el oxgeno presenta una
positivo
carga parcial negativa (-) y los hidrgenos tienen cargas parciales positivas.
Figura 2. Estructura molecular del agua (Fuente:
(+). Por eso, aunque la molcula de agua
Starr-Taggart, 2004).

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

no posee carga neta (tiene la misma canEl agua es una molcula dipolar. Presenta zonas de
tidad de protones que de electrones), es
carga positiva y negativa, pero la carga neta es cero
un dipolo elctrico ya que presenta distri(Fuente: Starr-Taggart, 2004).
bucin desigual de cargas (ver figuras 2
y 3).
Cuando dos molculas de agua se aproximan mucho se origina una atraccin electrosttica entre las cargas parciales opuestas de los tomos de las molculas vecinas.
Como consecuencia de ello, se establece un enlace dbil entre el oxgeno de una molcula de agua y el hidrgeno de otra formando un enlace llamado puente de hidrgeno. Debido a la disposicin espacial de las molculas de agua, cada una de ellas puede establecer puentes de hidrgeno con otras cuatro.

Agua (H2O)

Pares no compartidos
de electrones: zonas
ligeramente negativas

Ncleo de oxgeno

Zonas ligeramente
positivas

Figura 3. A la izquierda, la molcula de agua representada segn el modelo atmico orbital que muestra las zonas de la molcula ligeramente positivas y ligeramente negativas. A la derecha, la formacin
de puentes de hidrgeno entre las molculas de agua (Fuente: Curtis y Barnes, 2000).

Seguramente ya conoces algunas de las propiedades del agua, como por ejemplo
que es inodora, incolora e inspida, y su frmula qumica.
Veamos ahora otras propiedades importantes.
Recordemos que la fuerte atraccin entre las molculas debida a los puentes de hidrgeno es responsable de algunas de las propiedades ms caractersticas del agua, como
las siguientes:
Sus puntos de fusin y de ebullicin son ms altos que los correspondientes a compuestos semejantes. Esto determina que, a temperaturas moderadas, se mantenga como
un sistema lquido (propiedad que, entre las sustancias inorgnicas, solo comparte con el
mercurio), que es el ms adecuado para el desarrollo de muchas reacciones qumicas.
Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Su calor de vaporizacin es alto, lo cual indica que debe aportarse gran cantidad de
calor para evaporar una cierta masa de agua. Debido a esto, la evaporacin tiene efectos refrigerantes, y es por eso que la sudoracin de los seres vivos en un da muy caluroso permite eliminar calor corporal. Tengamos en cuenta que el sudor contiene un
99% de agua.
Tambin es alto su calor especfico, es decir que es necesario entregar una gran cantidad de calor para que 1g de agua eleve 1 C su temperatura. El calor especfico del agua
es mucho mayor que el de otros materiales de la biosfera, como las rocas o el aire.
El calor de vaporizacin y el calor especfico altos de la molcula de agua requieren
que se entregue una gran cantidad de calor para que la temperatura del agua suba, y la
extraccin de una gran cantidad para que la misma baje. Estas importantes propiedades
permiten que los medios acuosos puedan mantener una temperatura relativamente constante, lo que evita que los organismos que viven en los ocanos o en los grandes lagos
de agua dulce sean expuestos a bruscas variaciones de temperatura. Tambin permite al
agua comportarse como buen amortiguador de la temperatura de un organismo, disminuyendo los efectos de los cambios de temperatura del medio externo. Este mantenimiento
de la temperatura es de suma importancia para la vida porque las reacciones qumicas de
importancia biolgica slo tienen lugar dentro de estrechos lmites de temperatura.
El agua tiene tambin una gran cohesin interna, es decir, capacidad para resistir a
la ruptura cuando se coloca bajo tensin. Si pensamos en un lago, los numerossimos
puentes de hidrgeno que estn formados ejercen una atraccin continua hacia el interior sobre las molculas de agua que se encuentran en o cerca de la superficie. Estos puentes tambin provocan una elevada tensin superficial, que opone cierta resistencia a la penetracin y se comporta como una pelcula elstica. El ejemplo que nos
permite evidenciar stas propiedades es el de los insectos voladores que aterrizan sobre el agua y flotan sobre ella.
Consideremos ahora lo que ocurre durante la congelacin. Por debajo de 0 C los
puentes de hidrgeno resisten a la ruptura y unen las molculas de agua en un enrejado abierto, que es la estructura que posee el hielo. Al ser menos denso que el agua,
el hielo flota en ella. En invierno, cuando el agua de los lagos, estanques y arroyos se
congela, slo lo hace en la superficie, formando una placa de hielo, y esto asla el agua
lquida que se encuentra por debajo, protegiendo de la congelacin a los peces, ranas
y otros organismos acuticos.
Por qu el agua disuelve sustancias diversas?
El agua puede disolver sustancias diferentes en mayor grado que cualquier otro disolvente. Esta notable capacidad se debe a dos propiedades:
la tendencia a formar puentes de hidrgeno con otras sustancias, no solamente
con otras molculas de agua. Puede formar puentes de hidrgeno con grupos alcohol,
amino, carbonilo (ver Figura 4) de otros compuestos. Las sustancias que presentan
grupos qumicos como los mencionados se disuelven con mayor facilidad en el agua.
Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

enlace puente de H

puente de H

puente de H
Figura 4. Formacin de puentes de hidrgeno entre el agua y otros grupos qumicos.

como ya dijimos, la presencia del agua disminuye la atraccin entre iones de carga opuesta. Gracias a esto, el agua es un buen disolvente de sales inorgnicas, como
el ejemplo que ya vimos de la sal comn. Esto ocurre porque las molculas dipolares
del agua se ordenan alrededor de los cationes Na+ y alrededor de los aniones Cl- formando una nube de hidratacin que los estabiliza y permite su disolucin.

Sal
Agua

Figura 5. Accin disolvente del agua (Fuente: Curtis y Barnes, 2000).

Actividad
Lee los siguientes ejemplos extrados del texto de Biologa de Curtis y Barnes (2000)
y relaciona cada uno con alguna de las propiedades del agua:

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

1. Si observamos el agua que gotea de una canilla, cada gota se adhiere al borde
y permanece suspendida por un momento, unida por un hilo de agua; cuando la fuerza de gravedad la desprende, su superficie exterior entra en tensin, formndose una
esfera al caer la gota.
Si colocamos lentamente una aguja o una hoja de afeitar de plano sobre la superficie
del agua de un vaso, aunque el metal es ms denso que el agua, flotar. Si observamos
un estanque en primavera o verano, podremos ver insectos caminando sobre su superficie, como si sta fuera slida Qu propiedad puedes reconocer en estos ejemplos?
2. Por qu cuando realizamos un ejercicio intenso que nos hace transpirar perdemos calor?

2.2.2. Las sales minerales


Tanto el lquido que hay dentro de las clulas como el que hay entre ellas en organismos pluricelulares, contiene una variedad de sales minerales, que desempean importantes funciones. Cuando estas sales se disuelven en los lquidos corporales, se
disocian en iones, tomos que poseen carga elctrica por prdida o ganancia de uno
o ms electrones. Los iones de carga positiva son llamados cationes, y entre los ms
importantes se encuentran el sodio, potasio, calcio y magnesio. Los iones de carga negativa son llamados aniones, y entre los ms representativos se distinguen el cloruro,
bicarbonato, fosfato y sulfato.
Las sales minerales desempean importantes funciones en procesos tales como la
contraccin de los msculos o la transmisin de los estmulos nerviosos. Los aniones
y cationes disueltos hacen que el grado de salinidad y el pH del medio interno sean
constantes, y estabilicen las soluciones coloidales
En condiciones normales la concentracin de las diversas sales se conserva muy
constante; cualquier desviacin importante de sta ejerce efectos intensos sobre las
funciones celulares, incluso la muerte. A modo de ejemplo, las clulas que por falta de
energa no pueden bombear el sodio desde el interior al medio extracelular, van a hincharse por acumulacin de agua y finalmente, si no obtienen energa para bombear el
sodio al exterior celular, mueren. De este modo, las sales minerales tienen importancia
para conservar las relaciones osmticas entre la clula y el medio que la rodea.
A veces las sales minerales se encuentran en estado slido y aparecen en la estructura de las partes duras de un organismo vivo, como los huesos de los vertebrados y
las valvas de los moluscos.

2.2.3. Aparece el carbono... Los compuestos orgnicos


La importancia del carbono para la vida surge de su capacidad para formar enlaces
covalentes con hasta cuatro tomos, incluso con otros tomos de carbono formanPrograma de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

do largas cadenas carbonadas. Estos enlaces son relativamente estables y pueden


ser simples, dobles o triples, o sea que se pueden compartir uno, dos o tres pares de
electrones respectivamente.
Como ya mencionamos, las molculas orgnicas se clasifican en cuatro grandes grupos:
a) hidratos de carbono;
b) lpidos;
c) protenas y
d) cidos nucleicos.
Estos grupos incluyen sustancias muy dispares. Algunas son pequeas, formadas
por pocos tomos y con estructura ms o menos simple. En el otro extremo del espectro encontramos, en cambio, molculas enormes, con pesos moleculares de hasta varios millones. Estas molculas gigantes, que llamamos macromolculas, tienen
siempre una particularidad: estn armadas por numerosas unidades elementales, las
molculas pequeas que citamos antes, enlazadas en forma repetitiva. Vemoslo en
una representacin grfica

Si se enlazan 100 de estas unidades, se obtienen

Esta cadena, formada por 100 eslabones, representa una molcula. En qumica
tambin se le asigna el nombre de polmero, que significa que est formada por
muchas partes. A cada una de las unidades moleculares que se repiten se la denomina monmero (mono: uno; mero:
porcin).

Una macromolcula es una molcula orgnica gigante, polimrica, con un peso molecular elevado (arbitrariamente, suele considerarse mayor que
10000), constituida por molculas pequeas que
se unen repetitivamente.

Tengamos en cuenta estos conceptos cuando estudiemos cada grupo de molculas biolgicas.
Dentro de estos grupos existen compuestos que slo poseen en su constitucin
tomos de carbono, hidrgeno y oxgeno, por lo que se denominan compuestos orgnicos ternarios. Comprenden a los hidratos de carbono y a los lpidos.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

2.2.3.1. La principal fuente de energa: los hidratos de carbono


Son llamados tambin carbohidratos o glcidos. Constituyen la mayor parte de la materia orgnica de la Tierra, cumpliendo importantes funciones en todas las formas de vida:
sirven como almacn de energa, combustible y metabolitos intermediarios;
los azcares ribosa y desoxirribosa forman parte del armazn estructural del
ARN y ADN;
los polisacridos tambin son elementos estructurales de las paredes celulares
de bacterias y plantas. La celulosa, el constituyente principal de las paredes de las
plantas, es uno de los compuestos orgnicos ms abundantes de la bisfera;
los hidratos de carbono estn enlazados a muchas protenas y lpidos, donde ejercen
funciones clave en las interacciones entre las clulas y otros elementos del entorno celular.
La inmensa posibilidad de diversidad estructural de los hidratos de carbono es una
caracterstica clave en su funcin de mediadores de las interacciones celulares.
Los hidratos de carbono pueden ser molculas pequeas conocidas como azcares, o molculas ms grandes y complejas. De acuerdo con el nmero de molculas
de azcar que poseen, se clasifican en monosacridos, disacridos y polisacridos.
Monosacridos
Los monosacridos poseen una sola subunidad, llamada ms apropiadamente monmero, como ya hemos visto. Este monmero puede tener un nmero de tomos de
carbono que oscila de tres a siete. De acuerdo con ello se denominan triosas (cuando
estn formados por tres tomos de carbono, Figura 6), tetrosas (cuatro tomos de carbono), pentosas (cinco), hexosas (seis) y heptosas (7 tomos de carbono).
En todos los carbonos hay una funcin alcohol (--OH), salvo en uno, que puede presentar:
una funcin aldehdo:
C O

H
en cuyo caso el monosacrido se denomina aldosa; o bien
|
una funcin cetona, C O ;en este caso el monosacrido se denomina cetosa.

|

Gliceraldehdo,
una aldosa

Dihidroxiacetona,
una cetosa

Figura 6. Dos monosacridos constituidos por tres


tomos de carbono, llamados triosas (Fuente: Stryer
et al., 2003).

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

10

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Veamos algunos ejemplos de monosacridos muy importantes para los seres vivos
Algunos monosacridos, como las triosas y tetrosas, son intermediarios de muchos
procesos metablicos. Las pentosas ms importantes son la ribosa y desoxirribosa,
que forman parte estructural de los nucletidos y cidos nucleicos ADN y ARN, que
estudiaremos luego. La ribulosa tambin es una pentosa intermediaria en el proceso
de la fotosntesis. Dentro de las hexosas se encuentra la glucosa, que constituye una
fuente de energa muy importante para las clulas, y es componente de hidratos de
carbono ms complejos como los disacridos y polisacridos. Otras hexosas son la
galactosa, que forma parte del azcar de la leche y la fructosa, que se encuentra principalmente en vegetales y en animales y es un importante combustible celular para los
espermatozoides ( Figura 7).

D- Glucosa

D- Ribosa

D- Fructosa

2- Desoxi-D-Ribosa

Figura 7. Monosacridos de 5 y 6 tomos de carbono (Fuente: Stryer et al., 2003).

Disacridos
Cuando dos hexosas se asocian a travs de un enlace glucosdico, forman un disacrido, molcula constituida por dos monmeros. Los disacridos ms importantes
son la sacarosa o azcar de caa, formada por la unin de una glucosa con una fructosa; la maltosa, por asociacin de dos glucosas, y la lactosa o azcar de la leche, por
asociacin de una glucosa con una galactosa.
Los mono y disacridos, conocidos comnmente como azcares, son molculas
relativamente pequeas, de sabor dulce y son solubles en agua.
Recordemos... Los disacridos y polisacridos, que a continuacin veremos, para ser
utilizados en la clula deben ser desdoblados primero para obtener monosacridos.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

11

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Polisacridos
Cuando gran cantidad de molculas de hexosas se unen a travs de enlaces glucosdicos se forman grandes molculas, constituidas por numerosas subunidades, que
se denominan polmeros. Los polmeros formados por muchos monosacridos se llaman polisacridos. Los ms conocidos sirven como almacn de energa, y por lo tanto
son acumulados tanto en clulas vegetales como animales. Estos son: almidn, que
es el polisacrido de reserva energtica en clulas vegetales, y el glucgeno, polisacrido de reserva en animales. Ambos son polmeros de glucosa.
Otros polisacridos no constituyen fuentes energticas pero son importantes componentes estructurales en los seres vivos. Por ejemplo la celulosa, que es un polmero
de glucosa que constituye la mayor parte de la pared celular de clulas vegetales, brindndole a las plantas rigidez y sostn. Otro ejemplo de polisacrido estructural es la
quitina, un importante componente del exoesqueleto de los insectos y crustceos, y de
las paredes de algunos hongos. La murena tambin es estructural, formando las paredes celulares bacterianas.
Hasta ahora hemos visto los hidratos de carbono clasificados de acuerdo con la
complejidad estructural de la molcula, y algunas de sus funciones, en forma resumida. Veamos ahora otras funciones importantes en los sistemas biolgicos.
Por qu decimos que la membrana celular es asimtrica?
Para pensar
Cuando mencionamos la composicin de la membrana plasmtica hablamos de
una doble capa de fosfolpidos donde se insertan protenas.
Observemos la Figura N 8 del modelo de mosaico fluido.
Qu otro elemento importante constituye las membranas plasmticas?

Los glcidos de la membrana se unen externamente a protenas y lpidos formando glucoprotenas y glucolpidos, constituyendo la cubierta celular o glucocliz. Esta
disposicin asimtrica de los glcidos es la principal responsable de la asimetra de la
membrana y permite que la clula cumpla importantes funciones, ya que actan en los
fenmenos de reconocimiento y la adhesin entre clulas. Por ejemplo, el tejido epitelial, de acuerdo con la funcin que cumple, est constituido por clulas ntimamente
unidas entre s, en las que interviene el glucocliz de las membranas plasmticas de
las clulas. Tambin la deteccin de clulas extraas por el sistema inmunitario es un
fenmeno de adhesin que puede realizarse gracias al glucocliz.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

12

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Glicoprotena

Glicolpido

Protenas
perifricas

Protenas
integrales

Filamento de
actina
Microtbulos

Figura 8. Esquema del mosaico fluido de la membrana celular (Junqueira y Carneiro, 1998). La membrana plasmtica est constituida por una bicapa lipdica con protenas intercaladas. Los azcares en
la membrana slo se encuentran en la monocapa externa.

2.2.3.2. Seguimos con otros compuestos orgnicos ternarios, los lpidos


Esta es una categora que agrupa sustancias que pueden tener estructuras qumicas
muy distintas. Sin embargo, todas las sustancias incluidas aqu comparten una caracterstica fisicoqumica: su solubilidad.
Todos sabemos que no podemos mezclar agua y aceite, y que siempre que lo hagamos, en el recipiente se van a observar
dos fases separadas. En cambio, si coloLos lpidos son solubles en solventes no polares,
camos aceite u otro lpido en un solvente
como benceno, ter, tetracloruro de carbono y clono polar, como el benceno, el ter, el teroformo. En cambio, son insolubles en solventes
tracloruro de carbono o el cloroformo, obpolares, como el agua y las soluciones acuosas.
tendremos una sola fase.
Por lo general, los lpidos no presentan
pesos moleculares muy altos, lo que indica que el tamao de sus molculas no es
demasiado grande, en comparacin con el de las protenas. Tampoco estn constituidos por monmeros que al unirse repetidamente formen molculas polimricas, como
es el caso de los hidratos de carbono, que ya hemos considerado.
Como son muy heterogneos, es conveniente que separemos a los lpidos en distintos grupos teniendo en cuenta las similitudes en la estructura qumica que presentan. As podemos distinguir:
cidos grasos, por ej. palmtico, oleico, linoleico, son un importante combustible
celular (ver Figura 9) y forman parte de los fosfolpidos y triglicridos;
fosfolpidos, como la fosfatidilcolina y fosfatidilserina, constituyen las membranas
celulares (ver Figura 11);

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

13

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

glucolpidos y esfingolpidos, tambin forman parte de las membranas celulares y


estn constituidos por cidos grasos unidos a un grupo azcar, por ejemplo la esfingomielina, que se encuentra en forma abundante en el tejido nervioso;
triglicridos o grasas neutras, molculas de reserva energtica, de acuerdo con su
estado fsico pueden estar como grasas o aceites;
ceras, como las que recubren a algunos frutos y la cera producida por las abejas;
terpenos, como las vitaminas A, E y K;
esteroides, como el colesterol, precursor de muchas molculas de importancia biolgica;
prostaglandinas, derivadas de cidos grasos poliinsaturados.
Veremos las caractersticas de algunos de ellos.
cidos grasos
Los cidos grasos raramente se encuentran libres en los tejidos, pero conviene
considerarlos por separado porque son un elemento constitutivo de varios tipos de lpidos. Por lo general poseen un nmero par de tomos de carbono, y pueden ser saturados (cadenas carbonadas unidas por enlaces covalentes simples) o insaturados
(con dobles y triples enlaces). La longitud y el grado de saturacin de las cadenas
afectan la fluidez de los cidos grasos: mientras ms cortas y ms insaturadas sean
las cadenas, o sea con mltiples dobles y triples enlaces, ms fluidos sern los cidos
grasos a temperatura ambiente.
HO

HO

C=O

HO

C=O

C=O

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H

C H
H

C H
C H
C H
H

C H
C H

Figura 9. Tres frmulas estructurales de cidos


grasos. A la izquierda, el cido esterico,
constituido por una cadena principal de
carbono completamente saturada con tomos
de hidrgeno. En el medio se observa el cido
oleico, que tiene un doble enlace en su cadena
principal, y por lo tanto es un cido graso no
saturado. A la derecha, el cido linolnico,
que tiene tres dobles enlaces, por lo que es
poliinsaturado (Fuente: Starr-Taggart, 2004).

C H
C H
C H
H

Los cidos grasos son importantes combustibles celulares, al igual que la glucosa,
como ya hemos visto. Esto significa que pueden ser degradados con el fin de obtener
parte de la energa qumica contenida en sus enlaces.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

14

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Antes de seguir con el prximo grupo de lpidos, nos detendremos a analizar un aspecto interesante de los cidos grasos.
Los jabones que utilizamos en la higiene diaria son sales de cidos grasos. Estn
formados por un cido graso de cadena larga, que como ya hemos visto, no se solubiliza en el agua, que se une con un in metlico, generalmente el sodio (Na+), el
potasio (K+) o el calcio (Ca++). Estos
iones s pueden solubilizarse en agua,
de manera que las molculas as formadas son de carcter dual, por un extremo hidroflicas (hidro: agua, filia: afn:
que aman el agua) y por el otro hidrofbicas (hidro: agua, fobia: horror: que
odian el agua) y se representan de la
siguiente manera:
Las molculas que poseen estos dos sectores tan dispares se denominan anfipticas, porque uno de ellos es polar e hidroflico (con afinidad por el agua y los solventes
acuosos), mientras que el otro es no polar e hidrofbico (rechaza el agua y es afn con
los solventes como el ter y el cloroformo).
Ahora pensemos...
Qu ocurre cuando las molculas de jabn se ponen en contacto con el agua?
Sus diferentes sectores se orientan en ella de acuerdo con su afinidad: las colas no
polares tienden a agruparse escapando del agua, en tanto que las cabezas polares
se exponen a ella. Una manera de conseguir esta disposicin es formar una esfera,
cuya superficie est constituida por las cabezas hidroflicas y cuyo interior esconda
las colas hidrofbicas de numerosas molculas de jabn. Esto es lo que se llama una
micela (ver Figura 10).
Debido a esta caracterstica los jabones arrastran la suciedad: las molculas
de jabn forman micelas en contacto con
el agua que utilizamos para enjuagar, y la
suciedad o grasitud que se solubiliza en
las colas hidrfobas queda atrapada en
el centro de la micela, siendo barrida de la
superficie que se jabon.
Cuando empezamos a considerar a los
cidos grasos, qued establecido que raramente se encuentran libres en los tejidos.

Figura 10. Esquema de una micela.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

15

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Veremos a continuacin otros lpidos que poseen cidos grasos en su constitucin: fosfolpidos, glucolpidos, grasas y ceras.
Fosfolpidos
Son lpidos que se caracterizan por la
presencia de un grupo fosfato y dos ciCabeza polar
dos grasos. El grupo fosfato le confiere a
esa zona de la molcula la propiedad de
Colas no polares
solubilizarse en agua, mientras que los
cidos grasos no lo hacen. Es por eso
que los fosfolpidos tambin son anfipticos, como los jabones.
Como ocurra con los jabones, los fosfolpidos tambin pueden dispersarse en
agua formando micelas en las cuales las colas hidrofbicas se orientan hacia adentro,
evitando el agua, y las cabezas hidroflicas se ubican en la superficie.
Pero los fosfolpidos suelen adoptar otra disposicin en el medio acuoso: la bicapa
lipdica (vuelve a ver la Figura 8, el esquema del mosaico fluido). Esta estructura se halla integrada por una capa de fosfolpidos ordenados que se ensambla con otra capa
similar, enfrentndose ambas por sus colas hidrofbicas.
La bicapa lipdica es una estructura muy estable, y su importancia biolgica es crtica, ya que constituye la base de las membranas celulares, que se forman espontneamente al colocar fosfolpidos en un medio acuoso, como es el lquido extracelular
que baa a las clulas. Si los fosfolpidos no fueran anfipticos, no formaran bicapas.
Volveremos a retomar el tema cuando estudiemos la membrana plasmtica.

Figura 11. Disposicin de los fosfolpidos en las membranas biolgicas.

Triglicridos o grasas neutras


Como su nombre lo indica, estn constituidos por tres cidos grasos unidos al glicerol, un alcohol de 3 carbonos.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

16

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Como ya hemos dicho cuando hablamos de los cidos grasos, de acuerdo con la
longitud y el grado de saturacin que presentan los cidos grasos que componen la
molcula, los triglicridos pueden presentarse en estado lquido a temperatura ambiente, y en este caso se denominan aceites. Por ejemplo, el aceite de oliva, que est
formado por una molcula de glicerol y tres cidos oleicos (cidos grasos de 18 tomos de carbono, con un doble enlace). Si, por el contrario, son slidos a temperatura
ambiente, se denominan grasas, y son caractersticas de los animales, como el tocino,
que constituye la grasa subcutnea.

Glicerol

Figura 12. Estructura qumica de un triglicrido: a la izquierda, el esquema. A la derecha se observa


la condensacin de cidos grasos con una molcula de glicerol para formar el triglicrido. Observa
que al igual que los fosfolpidos, las colas de cidos grasos no son siempre iguales, y pueden ser
saturadas e insaturadas (Fuente: Starr-Taggart, 2004).

Los aceites y las grasas constituyen reservas energticas que se acumulan en las
clulas de muchos organismos (algas, vegetales, animales).
Cuando se necesita energa, el triglicrido es hidrolizado, es decir, se desdobla
en sus componentes, el glicerol y los cidos grasos. Estos ltimos quedan entonces
disponibles para ser utilizados como combustibles, y suministran energa mediante
su degradacin.
Ceras
Como las ceras estn constituidas por un cido graso unido a un alcohol de muchos carbonos son sustancias slidas, que pueden ablandarse y moldearse mediante
calor. Cumplen diversas funciones:

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

17

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

como cubiertas protectoras, impermeabilizantes o lubricantes, en la piel, el pelo,


las plumas o las cutculas de animales. Por ej.: la lanolina de la lana de ovejas y la pelcula que recubre el exoesqueleto de insectos, o la cera que recubre las plumas de los
patos, que no se mojan;
como cubiertas protectoras en hojas y frutos. Ej.: la cera que recubre la cutcula
de las cerezas, que impide la prdida de agua y es repelente de insectos, y
como sustancias estructurales. Ej.: la cera de abejas, utilizada por estos insectos
para construir sus panales.
Esteroides
Dentro de la diversidad estructural de
los lpidos, el colesterol es el ms diferente desde el punto de vista qumico, y ya no
presenta cidos grasos en su constitucin.
Son derivados de un hidrocarburo
que posee cuatro anillos cclicos. Algunos representantes importantes de este
grupo son:
el colesterol, constituyente de membranas celulares y precursor de otros esteroides, como los citados a continuacin:
la vitamina D (calciferol);
los cidos biliares, que intervienen
en la digestin de las grasas mediante su
capacidad emulsionante o detergente;
las hormonas sexuales y de la corteza suprarrenal.

Figura 13. En (a) Estructura qumica del colesterol; en (b) la testosterona, hormona producida
en el testculo y sintetizada a partir del colesterol
(Fuente: Curtis y Barnes, 2000)

Para resumir la informacin


El estudio de los lpidos tiene especial inters desde el punto de vista biolgico,
pues desempean importantes funciones, que resumiremos brevemente:
son componentes esenciales de los seres vivos, en los que constituyen parte fundamental de todas las membranas celulares, donde cumplen la funcin de barrera de
permeabilidad selectiva;
en los animales forman el principal material de reserva energtica, en forma de
grasas neutras o triglicridos;
desde el punto de vista nutritivo, los lpidos de los alimentos son importantes fuentes
de energa por su alto contenido calrico, y adems vehiculizan vitaminas liposolubles;
con este grupo de compuestos estn relacionadas numerosas sustancias de importante actividad fisiolgica, como algunas vitaminas, hormonas, cidos biliares, etc.
Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

18

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Actividades
Que relacin se puede establecer
Para reflexionar...
entre el comportamiento migratorio de alEntre los seres humanos, las mujeres se caracgunas aves y la reserva de lpidos?
terizan por tener una capa de grasa subdrmica
Qu funcin cumple la grasa acums gruesa que la de los hombres. Esta capacidad
mulada en el tejido subcutneo en anide almacenar grasa, aunque no es muy admiramales que viven en ambientes muy fros?
da en la civilizacin actual, indudablemente fue
Brinda ejemplos.
muy valiosa hace diez mil aos o ms. En esos
Por qu algunos rganos, como por
tiempos, segn sabemos, no exista otra manera
ejemplo los riones, estn rodeados de
de almacenar alimentos, y sta grasa adicional, no
una capa de grasa? (Por razones que an
solamente nutra a la mujer sino, lo que era ms
no se comprenden, estos depsitos de
importante, al feto y al lactante, cuya capacidad
grasa permanecen intactos, aun en estapara ayunar sin peligro es mucho menor que la de
dos de inanicin).
un adulto. As, muchas de nosotras estamos su Por qu los patos, los pinginos y
primiendo penosamente, mediante dietas, la caotros animales de hbitos acuticos no se
pacidad de acumulacin que nos legaron milemojan?
nios de evolucin... (Extrado de Curtis y Barnes,
Vuelve sobre el texto y observa nueBiologa, 6ta edicin, 2000).
vamente el esquema del mosaico fluido.
Qu funcin cumplen los lpidos que all
se encuentran?
Sabas que las hormonas sexuales
masculinas y femeninas son derivadas
del colesterol? Qu funcin cumplen los lpidos en este ejemplo?
Con todos estos ejemplos y las respuestas obtenidas podrs consignar las funciones de los lpidos a partir de conocimientos cotidianos.

2.2.3.3. Ahora se suma el nitrgeno: los compuestos


orgnicos cuaternarios. Las protenas
Las protenas son las macromolculas ms verstiles desde el punto de vista funcional, ya que, como veremos, cumplen gran diversidad de funciones dentro de las
clulas. Adems son el producto final que se obtiene cuando se descifra el mensaje
contenido en el ADN.
Muchas de las protenas intracelulares son enzimas, que aceleran (catalizan) reacciones metablicas que se producen dentro de los seres vivos. Otras protenas permiten que las clulas realicen trabajo, mantengan la rigidez interna y transporten molculas a travs de las membranas. Algunas incluso dirigen su propia sntesis o la de otras
macromolculas.
Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

19

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Las protenas son complejas molculas formadas por subunidades llamadas aminocidos. Por lo tanto, las protenas son polmeros de aminocidos. Los aminocidos
son componentes orgnicos sencillos, y en las protenas naturales se han encontrado
unos 20 tipos de aminocidos diferentes. La gran mayora de las protenas posee entre
100 y 300 aminocidos. Todos los aminocidos presentan la misma constitucin bsica: un grupo cido carboxlico, y un grupo amino, ambos unidos al mismo tomo de
carbono, llamado carbono alfa (C). Los otros dos enlaces de este carbono estn ocupados por un tomo de hidrgeno y en el extremo opuesto un grupo llamado R, que
es la nica porcin que vara para cada uno de los 20 aminocidos, como lo muestra
el siguiente esquema:

Figura 14. Estructura de un aminocido.

En la misma molcula coexisten dos grupos qumicos de comportamiento opuesto:


el grupo carboxilo, de carcter cido, y el grupo amino, de carcter bsico.
La unin entre los distintos aminocidos para formar protenas se produce entre el
grupo amino de un aminocido con el grupo carboxilo del siguiente, y el enlace fuerte
que se forma se denomina enlace peptdico (Figura 15).

MONMERO

Aminocido

POLMERO

Pptido

Figura 15. Formacin de un polmero por enlaces peptdicos (Fuente: Stryer et. al., 2003).

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

20

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Estos polmeros difieren de los polisacridos antes vistos en un aspecto fundamental:


cada tipo particular de protena tiene una secuencia (u ordenamiento) de aminocidos distintos que es exclusiva de ella.
Y es muy importante que se respete este ordenamiento para que la protena pueda
cumplir con su funcin, ya que un aminocido faltante o colocado fuera de lugar dentro de la cadena puede inhabilitar a la protena funcionalmente. Esta larga cadena que
se forma por la unin de sucesivos aminocidos no permanece estirada sino que luego se pliega adoptando una conformacin tambin caracterstica de cada protena, y
que tambin es esencial para su actividad biolgica.
La forma de las protenas est dada por cuatro niveles estructurales:
la estructura primaria de una protena es la disposicin lineal, o secuencia, de restos de aminocidos que constituyen la cadena polipeptdica (Figura 16).

Figura 16. Estructura primaria de una protena: a la izquierda, el extremo amino, a la derecha, el extremo carboxilo.

la estructura secundaria es la organizacin de partes de una cadena polipeptdica,


que puede adoptar distintas disposiciones espaciales. En general, se producen por
enlaces tipo puentes de hidrgeno entre los grupos R de los aminocidos de la cadena polipeptdica (Figura 17);

Figura 17. Estructura secundaria: a la


izquierda, la hlice . A la derecha, la
hoja plegada (Fuente: Lodish, 2002).

la estructura terciaria se refiere a la conformacin global de una cadena polipeptdica, o sea a la disposicin tridimensional de todos los restos de aminocidos. La estructura terciaria se estabiliza mediante interacciones hidrfobas entre las cadenas laterales
de aminocidos no polares, y en algunas protenas, por medio de puentes disulfuro. Este
tipo de organizacin estructural es la que hace a las protenas funcionales (Figura 18);

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

21

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Figura 18. Estructura terciaria de una enzima, la ribonucleasa. Cada crculo representa un aminocido. Se muestran pintados los puentes disulfuro que se forman entre aminocidos
alejados entre s (Fuente: Stryer et l., 2003).

la estructura cuaternaria slo se observa en las protenas que estn constituidas por
ms de una cadena polipeptdica; por ejemplo en las inmunoglobulinas que posee cuatro (dos cadenas livianas y dos cadenas pesadas), o en la insulina que posee dos. Estas cadenas se mantienen unidas mediante enlaces no covalentes (Figura 19).

Figura 19. Los cuatro niveles de organizacin de las protenas (Fuente: Stryer et al. 2003).

Teniendo en cuenta lo anteriormente


expuesto, las protenas pueden adoptar
distintas configuraciones, y pueden ser
alargadas, formando largas fibras, o pueden ser algo esfricas, y la estructura que
poseen est directamente relacionada
con la funcin que cumplen.
As tenemos entonces:
las protenas fibrosas: constituidas
por cadenas ordenadas paralelamente a
lo largo de un eje; el resultado es la formacin de fibras o lminas. Esta disposicin les otorga resistencia e insolubilidad
en agua y solventes acuosos, propiedades que las hacen adecuadas para las
funciones estructurales, como constitucin de esqueletos, cubiertas protecto-

Relacionado con la configuracin, un tema de moda:


las vacas locas.
Lo que acabamos de analizar se relaciona con un
tema de creciente inters en la salud animal y humana: las enfermedades prinicas, tales como la
encefalopata espongiforme bovina o enfermedad de las vacas locas. Si una protena adopta una
conformacin inapropiada pueden producirse situaciones patolgicas. stas se producen cuando una protena cerebral, llamada prin, cambia
su conformacin normal por una alterada. Esta
transformacin anormal tiene la capacidad de autorreproducirse, dando lugar a grandes agregados
de priones alterados.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

22

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

ras, etc. Son protenas fibrosas la queratina de la piel, cabello, uas, plumas, cuernos y
el colgeno de los tendones y de la matriz orgnica del hueso;
las protenas globulares: formadas por cadenas que se pliegan hasta adoptar formas esfricas. Son generalmente solubles en agua y soluciones acuosas. Desempean funciones mltiples, entre las cuales conviene citar, por su importancia:
- la funcin cataltica, que como ya hemos consignado consiste en acelerar la velocidad de las reacciones, para que puedan producirse en el organismo. Esta tarea es
llevada a cabo por protenas especiales que se denominan enzimas;
- el transporte de sustancias, como la hemoglobina, que transporta oxgeno gaseoso en el interior de los glbulos rojos;
- la defensa del organismo, que es llevada a cabo por los anticuerpos (gamma-globulinas) que forman parte del sistema inmunitario;
- la regulacin endocrina, dado que algunas hormonas son de naturaleza proteica,
como la insulina, la hormona del crecimiento y otras hormonas de la adenohipfisis.
Hay algunas protenas con caractersticas de uno y otro tipo; por ejemplo, con estructuras alargadas (como las fibrosas) pero solubles en soluciones acuosas (como
las globulares). En este grupo ubicamos a la miosina, una de las protenas que interviene en la contraccin muscular, y al fibringeno, precursor de la fibrina, que participa
en el mecanismo de coagulacin sangunea.
Es importante destacar que la notable multiplicidad de funciones en las que las protenas estn comprometidas es consecuencia de la gran diversidad de estructuras que
pueden construirse con los distintos ordenamientos de los veinte aminocidos.
Actividades
Para que comprendas que la funcin biolgica de cada protena est determinada
por su estructura, te proponemos que investigues el nivel de organizacin, la funcin y
el lugar donde se encuentran las siguientes protenas: hemoglobina - colgeno - inmunoglobulinas - queratina - miosina - albmina.

Luego de haber analizado los niveles de organizacin proteica nos introduciremos en la


gran diversidad de funciones que cumplen las protenas dentro de los organismos vivos.
Para ello veamos la siguiente figura:

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

23

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Te brindamos a continuacin una serie de ejemplos que te permitirn ampliar


y relacionar la informacin brindada en la
Figura 20.
Los glbulos blancos pueden fagocitar
partculas extraas gracias a la formaCOMPLEJOS SUPRAMOLECULARES
cin de seudpodos. Sabas que estas
prolongaciones se forman por la accin
de los microtbulos, constituidos por una
protena llamada tubulina?
La digestin de los hidratos de carbono que ingerimos con algunos alimentos comienza en la cavidad bucal por accin de una enzima, la amilasa salival. Por
Figura 20. Resumen general de estructura y fun- eso, si masticamos durante mucho tiemcin de las protenas (Fuente: Stryer, 2003).
po un trozo de pan percibiremos un sabor
dulce, debido a la digestin parcial del almidn, obteniendo disacridos.
La glucosa es una molcula grande e hidroflica que no puede atravesar la bicapa lipdica. Ya hemos visto que la glucosa es la principal fuente de energa para
las clulas, por lo que debe estar disponible en el interior de las mismas. La glucosa
atraviesa la membrana plasmtica a travs de una protena, llamada permeasa de la
glucosa, que atraviesa todo el espesor de la bicapa lipdica, y que es especfica para
este monosacrido.
La insulina es una hormona proteica que regula la concentracin de glucosa en
sangre. Qu problemas de salud provoca la deficiencia de esta hormona?
Los filamentos intermedios del citoesqueleto estn constituidos por protenas.
Busca ejemplos.Qu funcin cumple este tipo de protenas en la clula?
Sabas que la acetilcolina liberada en el espacio sinptico es una protena que se
une a un receptor de la membrana post sinptica favoreciendo la transmisin del impulso nervioso?

Otra utilidad ms
Una de los ms actuales usos de las protenas es investigar la evolucin: las relaciones evolutivas se manifiestan en las secuencias de las protenas. El estrecho parentesco entre los seres humanos y los chimpancs, se revela con claridad en la secuencia

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

24

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

de aminocidos de la mioglobina. La secuencia de la mioglobina humana se diferencia


de la del chimpanc nicamente en un solo aminocido en una protena de 153 residuos!
Veamos a continuacin un fragmento de la secuencia de aminocidos de esta protena, escrito en cdigo de una letra, donde se ve el reemplazo de H (histidina) en la
mioglobina humana por Q (glutamina) en la mioglobina del chimpanc:
QSHATKHKIPVKYLEFISECIIQVLHSKHPGDFGADAQGAMNKALELFRK
QSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRK

2.2.3.4. Las macromolculas responsables de la herencia: los cidos nucleicos


Son compuestos cuaternarios que adems poseen P (fsforo) en su composicin,
responsables del control de todas las funciones celulares y, adems, de la transmisin
de la informacin hereditaria a las nuevas generaciones.
Por sus estructuras primarias ambos son polmeros lineales formados por subunidades bsicas que se repiten: los nucletidos.
Los nucletidos entonces son monmeros de cuya polimerizacin resultan los cidos nucleicos. Pero la importancia de los nucletidos no se limita a este papel; algunos estn a cargo de funciones esenciales para el metabolismo celular.
Comencemos, entonces, a analizar su estructura.
Un nucletido es un monmero complejo porque, a su vez, est formado por tres
molculas unidas:

una de cido fosfrico;


una pentosa y
una base nitrogenada.
La pentosa puede ser de dos tipos:
ribosa o
desoxirribosa.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

25

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

La base nitrogenada puede pertenecer a dos categoras:


a) derivadas de la purina, que incluye:
adenina
guanina

b) derivadas de la pirimidina, donde se encuentran:


citosina
timina
uracilo

Con las molculas mencionadas se pueden construir nucletidos de dos tipos: ribonucletidos y desoxirribonucletidos.
Bases
Nucletido

Aldopentosa
Pricas

Pirimdicas

Ribonucletidos

Ribosa

Adenina
Guanina

Citosina
Uracilo

Desoxirribonucletidos

Desoxirribosa

Adenina
Guanina

Citosina
Timina

Grupo
Fosfrico
cido
fosfrico

cido
fosfrico

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

26

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Los ribonucletidos y desoxirribonucletidos son los eslabones que constituyen los


cidos nucleicos pero adems, los nucletidos, sin polimerizarse, pueden intervenir en
otras dos funciones, relacionadas con el metabolismo celular:
a) como molculas especializadas en la transferencia de energa qumica;
b) como parte de molculas que colaboran en la tarea cataltica de las enzimas, las
llamadas coenzimas.
Podemos adelantar algunos detalles
referidos a la molcula que acta como
intermediario energtico ms importante
en todas las clulas: el ATP.
ATP es la sigla con la cual se identifica
a la adenosina - tri - fosfato, un nucletido
constituido por:
adenina;
Figura 21. Estructura del adenosintrifosfato
ribosa y
(ATP) (Fuente: Curtis y Barnes, 2000).
3 grupos de cido fosfrico enlazados consecutivamente (Figura 21).
Los enlaces entre los dos grupos de cidos fosfricos terminales tienen la particularidad de poseer un elevado contenido de energa. Esa alta energa ha sido representada en la frmula anterior mediante el signo ~. El ATP puede ceder con relativa facilidad la energa de ese enlace para las actividades celulares que la requieran. De ese
modo pierde su ltima molcula de cido fosfrico:

ATP ADP + P + energa

De la misma manera, el ADP es un aceptor de la energa qumica proveniente de


otras reacciones; esa energa es utilizada en la creacin de un enlace (~) con un cido fosfrico:

ADP + P + energa
ATP
El adenosintrifosfato (ATP) queda as disponible para su uso posterior.
Muchas de las enzimas conocidas muestran su actividad cataltica solamente cuando cuentan con la colaboracin de otras sustancias, las denominadas coenzimas.
Algunas de las coenzimas importantes son nucletidos o derivados de nucletidos,
por ejemplo:
NAD: nicotinamida-adenina-dinucletido;
FAD: flavina-adenina-dinucletido.
Estas coenzimas son elementos indispensables para la actividad de un grupo de enzimas que catalizan reacciones de oxidorreduccin, y volveremos a verlas ms adelante.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

27

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

cidos Nucleicos
Por ltimo, veamos de qu manera se combinan los nucletidos para formar largos
polmeros que llamamos cidos nucleicos.
En primer lugar, podemos distinguir entre dos tipos de cidos, cada uno derivado
de una sola clase de nucletidos:
ARN = cido ribonucleico, polmero de ribonucletidos;
ADN = cido desoxirribonucleico, polmero de desoxirribonucletidos.
Como ya vimos, los cidos nucleicos son las macromolculas que contienen la informacin que determina la secuencia de aminocidos en una protena y forman las
estructuras celulares que eligen los aminocidos de una cadena proteica y luego los
unen en el orden correcto.
El cido desoxirribonucleico (ADN) y el cido ribonucleico (ARN) tienen grandes semejanzas qumicas, y algunas diferencias (Figura 22).

Figura 22. Diferencias entre el ADN y el ARN


(Fuente: Curtis y Barnes, 2000).

Acido ribonucleico (ARN RNA)


El ARN es una cadena lineal, resultado de la unin entre el grupo fosfrico de un nucletido y la ribosa del siguiente.
As, el ARN puede considerarse como un esqueleto o eje donde se alternan sucesivamente:
cido fosfrico ribosa cido fosfrico ribosa cido fosfrico ribosa
Y una secuencia de bases nitrogenadas que es caracterstica de cada ARN particular:

C- G- G- U- C- C- U-

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

28

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Pueden diferenciarse tres tipos de ARN, muy distintos entre s en cuanto al nmero
de nucletidos que poseen, y a la disposicin espacial de la molcula. Sin embargo,
todos tienen la misma estructura general, y se complementan en la realizacin de una
actividad comn: la sntesis de protenas.
Los tres tipos de ARN son:
ARNm o ARN mensajero;
ARNt o ARN de transferencia y
ARNr o ARN ribosmico.
La sntesis de protenas es un proceso complejo que explicaremos ms adelante.
Una protena tiene una secuencia nica, exclusiva, de aminocidos distintos. Su sntesis exige, por lo tanto, una informacin que indique:
qu aminocidos la componen y
en qu orden o secuencia deben ubicarse.
Slo queremos remarcar aqu algunos puntos de importancia referidos a las funciones de los ARN
Las funciones de los ARN en la sntesis de protenas pueden resumirse como sigue:
el ARNm es portador de un mensaje en cdigo que determina, uno por uno, todos
los aminocidos componentes de una protena;
el ARNt es el encargado de descifrar el cdigo del ARNm y de transportar el aminocido adecuado hasta su sitio especfico en la cadena proteica en formacin;
el ARNr forma parte de un organelo celular, el ribosoma, que interviene a modo de
sealador del sector del mensaje que est descifrando.
Los ARN llevan a cabo una tarea de mxima importancia para el funcionamiento de
la clula. Pero, si bien son indispensables en esa funcin, los ARN son slo operadores que ejecutan rdenes. Como veremos a continuacin, el verdadero archivo de la
informacin celular no reside en ellos sino en el ADN.
cido desoxirribonucleico (ADN o DNA)
El ADN est constituido por dos cadenas lineales, cada una de las cuales resulta de
la unin entre el grupo fosfrico de un nucletido y la desoxirribosa del siguiente. Adems, las dos cadenas estn enfrentadas por sus bases nitrogenadas, entre las cuales
se establecen uniones de tipo puente de hidrgeno (sealadas con lneas de puntos).
La doble cadena se arrolla en forma de hlice alrededor de un eje, como si fuera
una escalera-caracol (Figura 23):

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

29

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

Figura 23. Estructura de la doble hlice


(Fuente: Junqueira y Carneiro, 1998).

Interpretemos esta escalera-caracol.


Los pasamanos seran los esqueletos de los sucesivos ... cido fosfrico - desoxirribosa - cido fosfrico - desoxirribosa.
Cada escaln estara formado por un par de bases nitrogenadas enfrentadas y
unidas. El apareamiento de bases es muy especfico, ya que el espacio en la hlice no
puede ser ocupado por un par cualquiera. Se ha determinado que siempre se enfrentan: adenina - timina y citosina - guanina.
Entre la adenina y la timina se establecen dos puentes de hidrgeno; entre la citosina y la guanina, tres.

Estas restricciones respecto de las bases nos hacen arribar a una conclusin.

El descubrimiento de Watson y Crick del modelo


de la doble hlice, que lleva implcito el mecanismo de la duplicacin exacta del material gentico, es uno de los hitos de la historia de la ciencia,
por el que recibieron el premio Nobel en 1962.

Las dos cadenas de ADN no son idnticas ni en la secuencia de sus bases,


ni en la composicin en bases. Son, en
cambio, cadenas complementarias.
El modelo que explica la estructura
tridimensional del ADN fue propuesto en
1953 por J. Watson y F. Crick. Este mode-

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

30

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

lo result de enorme utilidad. Por un lado, justific muchas de las propiedades fsicas y
qumicas del ADN que se haban comprobado en el laboratorio pero tambin, y por otro
lado, permiti plantear un mecanismo que explicara una de las caractersticas ms sorprendentes de esta macromolcula: su capacidad de duplicacin o replicacin exacta.
Por qu le asignamos una trascendencia especial a la replicacin del ADN?
La respuesta radica en la importancia de la informacin que contiene y hace posible
la organizacin y el funcionamiento de cada clula particular y del organismo completo:
la informacin gentica.

Este contenido tan valioso, almacenado en un lenguaje de cdigos, en la particular


secuencia de nucletidos de cada molcula de ADN, es mantenido dentro del ncleo
de la clula y all es transcripto en las molculas de ARN, como veremos luego.
stas cumplen la tarea de sintetizar las protenas, siguiendo las instrucciones que
copiaron del ARN. Las protenas formadas intervendrn, posteriormente, en muchas y
diversas funciones relacionadas con la estructura y el metabolismo celular.
La informacin gentica que hace posible estos fenmenos es el principal elemento de la transmisin hereditaria, porque proporciona a las clulas hijas (o al organismo
hijo) las mismas aptitudes que posea la clula (u organismo original). La transmisin
de caracteres hereditarios se logra mediante la duplicacin exacta del ADN, y la transferencia de una de las copias a cada clula hija.
Actividad
Observando las figuras y con la informacin brindada en el texto resume en pocas palabras las diferencias estructurales y funcionales entre los dos tipos de cidos nucleicos.

Para saber ms...


Diferencias entre el ADN de procariotas y eucariotas.
El ADN de las clulas procariotas forma en general un cromosoma nico, circular,
que ocupa una regin de la clula denominada nucleoide, y est unido a un punto de
la membrana plasmtica. El cromosoma est constituido por ADN no asociado a histonas, y en E. coli por ejemplo, tiene un grosor de 2 nm y un largo de 1,2 mm. Los filamentos de ADN no sufren el proceso de condensacin que lleva a la formacin de cromosomas visibles al microscopio ptico, durante la divisin celular.
En clulas eucariotas el ADN se encuentra en el ncleo, en cantidades mucho mayores y forma mltiples cromosomas, en nmero caracterstico de acuerdo con la esPrograma de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

31

Biologa. Conceptos bsicos / Unidad 2. La qumica de la vida

pecie. El ADN se combina con protenas, las histonas, que tienen un importante papel
en su organizacin, tanto durante la interfase como en la condensacin de los cromosomas durante la divisin celular.

Como resumen y conclusin de esta unidad, podemos afirmar que, los principales tipos de molculas biolgicas llevan a cabo funciones idnticas en todos los seres vivos:
Lpidos

combustibles celulares, reserva energtica, elementos estructurales

Hidratos de carbono

combustibles celulares, reserva energtica, elementos estructurales

Protenas

actividad cataltica, elementos estructurales, funciones particulares

cidos nucleicos

almacenamiento y transmisin de la informacin gentica, forman


parte de la maquinaria de sntesis de protenas (ARNr y ARNt).

En este captulo hemos conocido los compuestos inorgnicos y orgnicos ms importantes para la vida. Ellos se caracterizan porque adems de ser parte constituyente
del protoplasma celular, intervienen en diferentes tipos de reacciones qumicas fundamentales para que, por ejemplo, la clula, como unidad estructural y funcional de los
seres vivos, lleve a cabo todas sus funciones vitales.
Para comprender qu tipos de reacciones ocurren y cmo se producen te invitamos
a estudiar la Unidad 3 sobre Metabolismo.

Referencias bibliogrficas
Aljanati, D.; Wolovelsky, E. y Tambussi, C.
(1997): Los cdigos de la vida. Biologa III. Ediciones Colihue.
Blanco, A. (1993): Qumica biolgica. 6ta. ed.,
Buenos Aires, El Ateneo.
Curtis, E. y Barnes, S.N. (2000): Biologa. 6ta.
edicin en espaol, Espaa, Editorial Mdica
Panamericana.
De Robertis, E. (h); Hib, J. y Ponzio, R. (2003):
Biologa celular y molecular. 15ta. ed., Buenos Aires, El Ateneo.
Junqueira, L.C. y Carneiro, J. (1998): Biologa
celular y molecular. 6ta. ed., Chile, Mc. Graw- Hill
Interamericana.

Lehninger, A.L. (1998): Principios de Bioqumica.


Barcelona, Omega.
Lodish, H.; Berk, A.; Zipursky, S.L.; Matsudaira,
P.; Baltimore, D. y Darnell, J. (2002): Biologa Celular y Molecular. 4ta. ed., Editorial Mdica Panamericana.
Prociencia-CONICET (1997): Biologa celular.
Ministerio de Educacin y Cultura.
Starr, C. y Taggart, R. (2004): Biologa. La unidad
y diversidad de la vida. 10ma. ed., Thomson.
Stryer, L.; Berg, J. y Tymoczko, J. (2003): Bioqumica. 5ta. ed., Espaa, Revert.

Programa de Ingreso UNL / Curso de Articulacin Disciplinar: Biologa

32