Está en la página 1de 297

Psicologa del desarrollo

Volumen 1
Desde el nacimiento
a la primera infancia
Psicologa del desarrollo
Volumen 1
Desde el nacimiento
a la primera infancia
Coordinadoras
Marta Gimnez-Das
Sonia Mariscal Altares
MADRID BOGOT BUENOS AIRES CARACAS GUATEMALA LISBOA MXICO
NUEVA YORK PANAM SAN JUAN SANTIAGO SO PAULO
AUCKLAND HAMBURGO LONDRES MILN MONTREAL NUEVA DELHI PARS
SAN FRANCISCO SIDNEY SINGAPUR SAN LUIS TOKIO TORONTO
www.facebook.com/descargarlibrosmedicina
PSICOLOGADELDESARROLLO.Volumen1:Desdeelnacimientoalaprimera
infancia
No est permitida la reproduccin total o parcial de este libro, ni su tratamiento
informtico, ni la transmisin de ninguna forma o por cualquier medio, ya sea
electrnico,mecnico,porfotocopia,porregistrouotrosmtodos,sinelper miso
previoyporescritodelostitularesdelCopyright.
DERECHOS RESERVADOS 2008, respecto a la primera edicin en espaol, por
McGRAW-HILL/INTERAMERICANADEESPAA,S.A.U.
EdifcioValrealty,1.planta
Basauri,17
28023Aravaca(Madrid)
ISBN:978-84-481-6870-4
Depsitolegal:M.
Editor:CristinaSnchezSinz-Trpaga
Tcnicoeditorial:MaraLenAlonso
Preimpresin:NuriaFernndezSnchez
Compuestoen:GrfcasBlanco,S.L.
Impresoen:
IMPRESOENESPAA-PRINTEDINSPAIN
Autores
v
AntonioCorraligo
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
BegoaDelgadoEgido
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
MarangelesGarcaNogales
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
MartaGimnez-Das
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
SoniaMariscalAltares
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
Contenido
vii
Presentacin......................................................................................................................... xiii
Bloque I
Introduccin al estudio del desarrollo humano
Captulo 1. Los fundamentos de la Psicologa del Desarrollo............................... 3
Esquemaresumen............................................................................................................ 4
Objetivos.......................................................................................................................... 5
Introduccin..................................................................................................................... 5
1. Lospresupuestostericosquesubyacenalestudiodeldesarrollohumano............ 5
2. Elmtodohipotticodeductivo................................................................................ 6
3. Losenfoquesseexpresanenteoras........................................................................ 7
4. Eldesarrollohumanoensuconjunto....................................................................... 9
5. Lateoradelaevolucinylapsicologaevolutiva.................................................. 13
6. Lanocindeemergencia.......................................................................................... 15
Lecturascomplementarias............................................................................................... 18
Actividades...................................................................................................................... 18
Solucionesalasactividades............................................................................................ 19
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget.... 21
Esquemaresumen............................................................................................................ 22
Objetivos.......................................................................................................................... 23
Introduccin..................................................................................................................... 23
1. SobrelabiografadeJeanPiaget:juventudyformacin........................................ 24
2. Principalesconceptosdelateorapiagetiana........................................................... 26
2.1. Losfactoresdeldesarrollo.............................................................................. 26
2.2. Losmecanismosdeldesarrollo....................................................................... 27
2.3. Elconceptodeesquema.................................................................................. 28
3. Losperodosdeldesarrollo...................................................................................... 30
3.1. Caractersticasgenerales................................................................................. 32
3.1.1. Elconceptodeoperacinmental....................................................... 32
3.1.2. Ladiferenciaentreelpensamientoconcretoyelpensamientoformal 34
4. AlgunascrticasalateoradePiaget....................................................................... 35
4.1. Elconceptodeperododeldesarrollo............................................................ 36
4.2. Launiversalidaddelosperodosdeldesarrollo............................................. 37
viii Contenido
5. ImplicacionesdelateoradePiagetsobreeldesarrollosocialylaeducacin...... 39
Lecturascomplementarias............................................................................................... 40
Actividades...................................................................................................................... 40
Solucionesalasactividades............................................................................................ 42
Captulo 3. Principales teoras sobre el desarrollo (II): el modelo de L. S.
Vygotski......................................................................................................................... 45
Esquemaresumen............................................................................................................ 46
Objetivos.......................................................................................................................... 47
Introduccin..................................................................................................................... 47
1. SobrelabiografadeLevS.Vygotski..................................................................... 48
2. Principalesconceptosdelapropuestavygotskiana................................................. 49
2.1. Lamediacin................................................................................................... 52
2.2. La ley general del desarrollo cultural o ley de la doble formacin de las
funcionespsquicassuperiores........................................................................ 53
2.3. Elprocesodeinternalizacin.......................................................................... 54
3. Lasrelacionesentredesarrolloyaprendizaje.......................................................... 54
4. Eldesarrollonormalyalterado................................................................................ 55
5. ImplicacionesdelmodelodeVygotskisobreeldesarrollosocialylaeducacin.. 57
Lecturascomplementarias............................................................................................... 58
Actividades...................................................................................................................... 58
Solucionesalasactividades............................................................................................ 58
Bloque II
El desarrollo temprano
Captulo 4. El desarrollo prenatal y el recin nacido............................................... 63
Esquemaresumen............................................................................................................ 64
Objetivos.......................................................................................................................... 64
Introduccin..................................................................................................................... 65
1. Algunasnocionesgenticasbsicas......................................................................... 66
1.1. Estudiossobrelaherenciaderasgos.............................................................. 67
1.2. Qusehereda?.............................................................................................. 69
1.2.1. Rasgosfsicos..................................................................................... 70
1.2.2. Rasgospsicolgicos:inteligenciaytemperamento........................... 70
1.2.3. Alteracionesfsicas............................................................................. 74
1.2.4. Alteracionespsicolgicas:esquizofrenia,depresinyautismo........ 74
2. Eldesarrolloprenatal................................................................................................ 76
2.1. Etapasdeldesarrolloprenatal......................................................................... 76
2.2. Lavidadelembrinyelfeto.......................................................................... 78
2.3. Apuntessobreteratologa............................................................................... 80
3. Elrecinnacido........................................................................................................ 81
3.1. Estadosyritmos.............................................................................................. 83
3.2. Sistemaspararecibirinformacin:lossentidos............................................. 84
3.3. Sistemasparaactuarenelmundo:losrefejos............................................... 85
3.4. Sistemasparatransmitirinformacin:elllantoylasonrisa.......................... 87
3.5. Elcerebrodelrecinnacido........................................................................... 88
Lecturascomplementarias............................................................................................... 90
Actividades...................................................................................................................... 91
Solucionesalasactividades............................................................................................ 93
Contenido ix
Captulo 5. Los inicios de la inteligencia..................................................................... 95
Esquemaresumen............................................................................................................ 96
Objetivos.......................................................................................................................... 96
Introduccin..................................................................................................................... 97
1. Lascapacidadesperceptivasdelbeb...................................................................... 98
1.1. Lapercepcinvisual....................................................................................... 98
1.2. Lapercepcinauditiva.................................................................................... 105
1.3. Elolfato,elgustoyeltacto............................................................................ 107
1.4. Lapercepcinintermodal............................................................................... 109
2. Laexplicacinpiagetianadelperodosensoriomotor............................................. 111
3. Lanocinpiagetianadeobjetopermanente............................................................. 119
3.1. Primerysegundoestadio................................................................................ 119
3.2. Tercerestadio.................................................................................................. 119
3.3. Cuartoestadio................................................................................................. 121
3.4. Quintoestadio................................................................................................. 121
3.5. Sextoestadio................................................................................................... 121
4. LaevolucindelaimitacinsegnPiaget............................................................... 122
4.1. Primerestadio.................................................................................................. 122
4.2. Segundoytercerestadio................................................................................. 123
4.3. Cuartoyquintoestadio................................................................................... 123
4.4. Sextoestadio................................................................................................... 124
Lecturascomplementarias............................................................................................... 125
Actividades...................................................................................................................... 126
Solucionesalasactividades............................................................................................ 127
Captulo 6. Los inicios de la comunicacin y el lenguaje....................................... 129
Esquemaresumen............................................................................................................ 130
Objetivos.......................................................................................................................... 131
Introduccin..................................................................................................................... 131
1. Comunicacinylenguaje......................................................................................... 131
1.1. Defnicindeconceptos.................................................................................. 131
1.2. Componentesdellenguaje.............................................................................. 133
2. Desarrollotempranodelacomunicacin:delnacimientohastalos18meses....... 134
2.1.Cundocomienzalacomunicacinintencional?Requisitoscognitivosyso-
ciales............................................................................................................... 134
2.2. El papel del adulto: sobreinterpretacin de las actividades del nio como
conductasgenuinamentecomunicativas......................................................... 138
2.3. Principaleshitoseneldesarrollocomunicativoduranteelprimeraoyme-
diodevida....................................................................................................... 140
2.3.1. Faseneonatalycomunicacindeafectos(2-3meses)...................... 140
2.3.2. Lamitaddelprimerao:conductasanticipatorias............................ 141
2.3.3. Elperodode8a12meses:eliniciodelaconductaintencional..... 142
2.3.4. El perodo de 12 a 18 meses: gestos comunicativos y vocaliza-
ciones................................................................................................... 143
3. Desarrollotempranodellenguaje:delnacimientohastalos3aos....................... 144
3.1. Atencintempranaallenguaje....................................................................... 145
3.2. Lapercepcininicialdelhabla....................................................................... 146
3.3. Hacialasprimeraspalabras............................................................................ 148
3.4. Eliniciodeldesarrollogramatical.................................................................. 151
x Contenido
4. Existe continuidad entre la comunicacin prelingstica y el lenguaje?: se abre
lapolmica................................................................................................................ 152
Lecturascomplementarias............................................................................................... 154
Actividades...................................................................................................................... 154
Solucionesalasactividades............................................................................................ 156
Captulo 7. Desarrollo afectivo, emocional y social................................................. 159
Esquemaresumen............................................................................................................ 160
Objetivos.......................................................................................................................... 161
Introduccin..................................................................................................................... 161
1. Aproximacinhistricaalestudiodelapego........................................................... 162
1.1. Lainvestigacinconanimalesyladeprivacinafectiva............................... 162
2. Formacindelapego................................................................................................ 164
2.1. Laorientacinsocialyemocionaldelbebenelmomentodelnacimiento... 165
2.1.1. Lasprimerasexpresionesemocionalesdelbeb............................... 166
3. Desarrollodelapego................................................................................................. 169
4. Tiposdeapego.......................................................................................................... 171
5. Factoresqueafectanalaformacindelvnculodeapego...................................... 173
6. Loselementosdelvnculodeapego........................................................................ 174
7. Estabilidaddelvnculodeapego.............................................................................. 175
Lecturascomplementarias............................................................................................... 177
Actividades...................................................................................................................... 177
Solucionesalasactividades............................................................................................ 178
Bloque III
La primera infancia: de los tres a los seis aos
Captulo 8. El desarrollo del pensamiento.................................................................. 183
Esquemaresumen............................................................................................................ 184
Objetivos.......................................................................................................................... 184
Introduccin..................................................................................................................... 185
1. ElniopequeoenlateoradePiaget..................................................................... 186
1.1. Losrasgosdelpensamientopreoperatorio..................................................... 187
1.2. AlgunaslimitacionesdelateoradePiaget................................................... 193
2. ElniopequeoenlateoradeVygotski................................................................ 195
3. Lateoradelamente................................................................................................ 198
3.1. Laatribucindecreenciasfalsas.................................................................... 199
3.2. Habilidadesmentalistasanterioresalacomprensindecreenciasfalsas..... 203
4. Conclusiones............................................................................................................. 204
Lecturascomplementarias............................................................................................... 204
Actividades...................................................................................................................... 205
Solucionesalasactividades............................................................................................ 206
Captulo 9. El desarrollo del lenguaje oral................................................................. 209
Esquemaresumen............................................................................................................ 210
Objetivos.......................................................................................................................... 211
Introduccin..................................................................................................................... 211
Contenido xi
1. Eldesarrollodelaformadelenguajedurantelaprimerainfancia......................... 212
1.1. Desarrollofonolgico:cmosevacompletandolaadquisicindelsistema
defonemas....................................................................................................... 212
1.2. Desarrollodelvocabularioydesarrollogramatical........................................ 214
2. Eldesarrollopragmticoylashabilidadesparanarrar............................................ 217
3. Lasrelacionesentreelpensamientoyellenguajedesdelaperspectivaevolutiva... 221
4. Cmoseexplicalaadquisicindellenguaje:modeloslingsticosinnatistasyex-
plicacionesconstructivistas...................................................................................... 223
5. Aprenderellenguajeencontextosbilinges........................................................... 226
5.1. La importancia de los perodos crticos: por qu es mejor aprender las
lenguasdesdepequeos?................................................................................ 228
5.2. Ventajasdelbilingismo:enqucondicionestieneconsecuenciaspositivas
paraeldesarrollogeneral?.............................................................................. 229
Lecturascomplementarias............................................................................................... 232
Actividades...................................................................................................................... 233
Solucionesalasactividades............................................................................................ 234
Captulo 10. El mundo social........................................................................................... 237
Esquemaresumen............................................................................................................ 238
Objetivos.......................................................................................................................... 239
Introduccin..................................................................................................................... 239
1. Eldesarrollodelyo................................................................................................... 240
2. Elmundoemocionalyafectivo................................................................................ 243
3. Lasrelacionesconlosdems................................................................................... 246
3.1. Lafamilia........................................................................................................ 246
3.1.1. Losestiloseducativos......................................................................... 246
3.2. Losamigos...................................................................................................... 248
3.2.1. El ajuste en las relaciones sociales: nios queridos y nios recha-
zados................................................................................................... 251
4. Eljuego..................................................................................................................... 254
5. Laidentidaddegnero............................................................................................. 257
6. Elpensamientomoral............................................................................................... 260
6.1. Laintencionalidadylaresponsabilidadobjetiva........................................... 261
6.2. Lamentira....................................................................................................... 262
6.3. Lajusticiainmanenteyretributiva................................................................. 262
Lecturascomplementarias............................................................................................... 263
Actividades...................................................................................................................... 264
Solucionesalasactividades............................................................................................ 265
Referencias............................................................................................................................ 269
Presentacin
xiii
Psicologa del desarrollo: desde el nacimiento a la primera infancia constituye el primer
volumen de una obra cuyo objetivo es ofrecer al lector-alumno un panorama actual, pero
a la vez comprensible, sobre la evolucin psicolgica del ser humano desde su nacimien-
to (o incluso antes) hasta la primera infancia.
La Psicologa evolutiva es una disciplina compleja que pretende abarcar los principa-
les procesos de desarrollo que tienen lugar durante todo el ciclo vital, del nacimiento
hasta la muerte. En los ltimos cincuenta aos, la evolucin de esta disciplina ha sido
espectacular, no slo desde el punto de vista de sus aportaciones tericas, sino por la
multitud de informacin sobre los procesos de desarrollo que han ido proporcionando los
distintos investigadores en esta rea. Una de las consecuencias de este crecimiento tan
importante se ha materializado en el estudio del desarrollo escindido o dividido en las
reas que tradicionalmente lo componen (esto es, desarrollo intelectual o cognitivo, lin-
gstico, afectivo y social). De este modo, cada investigador tiende a especializarse en
una faceta del desarrollo o incluso en problemas concretos dentro de un mismo proceso
evolutivo.
Ante este panorama, y cindonos en este volumen al periodo que abarca hasta la
primera infancia, se han tenido que adoptar dos decisiones importantes de cara a la se-
leccin de los contenidos a ofrecer a nuestros lectores. En primer lugar, se ha optado por
una organizacin evolutiva de los contenidos y no por temas o reas de desarrollo. Es
decir, no se presenta el desarrollo cognitivo-lingstico por un lado y el desarrollo emo-
cional y afectivo por otro, como es habitual en muchos de los manuales de Psicologa del
Desarrollo. El lector encontrar el contenido organizado en dos bloques relativos a las
primeras etapas del desarrollo: el desarrollo temprano (del nacimiento hasta los 2 aos
aproximadamente) y el desarrollo en la primera infancia (de los 3 a los 6 aos). Dentro
de cada bloque evolutivo s se han diferenciado por captulos los distintos procesos de
desarrollo (cognitivo, lingstico, afectivo y social). El objetivo es que tras la lectura y
estudio de los temas, el lector sea capaz de elaborar cmo cursa el desarrollo en sus dis-
tintas facetas dentro de cada etapa y, sobre todo, sea capaz de encontrar las relaciones
entre unas y otras. En este sentido, se ha hecho un esfuerzo especial por conectar unos
procesos de desarrollo con otros mediante el uso de referencias cruzadas entre los distin-
tos captulos y la presentacin de ejemplos y datos que revelan esas interconexiones.
La segunda decisin importante relativa a qu contenidos presentar se relaciona con
los modelos tericos sobre el desarrollo. Como apuntbamos ms arriba, el panorama
terico dentro de la Psicologa del Desarrollo es muy variado y complejo. Dado el tipo
xiv Presentacin
de lector a quien va dirigida la obra, nos ha parecido ms conveniente presentar en un
primer bloque de contenidos las teoras clsicas sobre el desarrollo y prescindir de las
aportacionesmsrecientes.Poresoendichobloquesepresentanlosdosmodelos tericos
mselaboradosyconmayorimpactoennuestrareahastalafecha:lateoradeJ.Piaget
cuyospresupuestosfundamentalesanseencuentranplenamenteenvigor,apesarde
lascrticasamuchosaspectosconcretosdelateoraylapropuestadeL.Vygotskiysu
escuela que ha dado lugar a toda una corriente terica posterior y a elaboraciones
mucho ms profundas de las esbozadas por su iniciador. Posteriormente, dentro de
cadacaptuloconcretosemencionandistintasexplicacionesyteorasmsrecientes,pero
mscircunscritasareasespecfcasdeldesarrollo(porejemplo,lateoradelamente,o
lasaproximacionesinnatistassobreeldesarrollodellenguaje).
Enrelacinalapresentacinconcretadeloscontenidos,sehapretendidotenersiem-
pre presente la condicin del alumno de la UNED, que suele organizar su estudio de
forma individual y con el manual de la asignatura como referente bsico. No obstante,
cualquier lector puede benefciarse del estilo del texto y de las ayudas proporcionadas.
Lainclusindeejemplosycasosprcticos,decuadros,esquemasyfgurascomplemen-
tariossehaconsideradounaherramientafundamentalparahacermscomprensibleslos
contenidosymotivarallectorasuestudioydisfrute.Enespecial,loscuadrosquehemos
denominadoConlospiesenlatierraconstituyenaplicacionesoejemplosprcticosde
lascuestionestericasreferidaseneltexto.Todosloscaptulosestnorganizadossegn
un mismo esquema que incluye los siguientes apartados: Ttulo, ndice de contenidos,
esquema-resumen,objetivos,textodelcaptulo,lecturascomplementarias,actividadesy
solucinalasmismas.Enlamedidaenqueellectorseacapazdeconstruirsuspropias
elaboracionesdelostemas,conectarunoscontenidosconotros,hacersepreguntasapar-
tirdeltexto,buscaralgunasrespuestasporsucuenta,etc.,elresultadodesuestudioser
mssignifcativo,profundoyduradero.
Laintencindelosautoresdeestevolumenhasidoladeproporcionarunavisindel
desarrollohumano,desusprimerasetapas,quesirvacomobaseparaentendercmoso-
mos,cmonosconstituimosycmoesteconocimientoesunaclavebsicaparacualquier
intentodeintervenir,educarofomentarundesarrolloajustado.
INTRODUCCIN
AL ESTUDIO
DEL DESARROLLO
HUMANO I
BLOQUE
En este bloque se van a abordar cuestiones tericas sobre el estudio del desarrollo humano.
El objetivo es introducir nuestra disciplina a partir de los conceptos bsicos que la ordenan,
de las races loscas que se pueden encontrar a lo largo de la historia y de los dos grandes
marcos tericos que se suelen emplear para explicar el desarrollo humano. Hemos escogido
las teoras de Piaget y Vygotski porque consideramos que constituyen las dos grandes guras
de la psicologa del desarrollo. Por descontado, existen otros muchos autores que han pro-
puesto teoras sobresalientes pero si tuviramos que elegir los ms importantes estos son,
sin duda, Piaget y Vygotski. Sus teoras se explican con detenimiento en los Captulos 2 y 3
y las referencias a sus formulaciones sern constantes a lo largo de todo el libro.
SUMARIO
CAPTULO 1. Los fundamentos de la Psicologa del Desarrollo
1. Los presupuestos tericos que subyacen al estudio del desarrollo humano
2. El mtodo hipottico deductivo
3. Los enfoques se expresan en teoras
4. El desarrollo humano en su conjunto
5. La teora de la evolucin y la psicologa evolutiva
6. La nocin de emergencia
CAPTULO 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget
1. Sobre la biografa de Jean Piaget: juventud y formacin
2. Principales conceptos de la teora piagetiana
2 Bloque I. Introduccin al estudio del desarrollo humano
3. Los perodos del desarrollo
4. Algunas crticas a la teora de Piaget
5. Implicaciones de la teora de Piaget sobre el desarrollo social y la educacin
CAPTULO 3. Principales teoras sobre el desarrollo (II): el modelo de L. S.
Vygotski
1. Sobre la biografa de Lev S. Vygotski
2. Principales conceptos de la propuesta vygotskiana
3. Las relaciones entre desarrollo y aprendizaje
4. El desarrollo normal y alterado
5. Implicaciones del modelo de Vygotski sobre el desarrollo social y la educacin
Los fundamentos
de la Psicologa
del Desarrollo
3
1
ANTONIO CORRAL IGO
Esquema resumen
Objetivos
Introduccin
1. Los presupuestos tericos que subyacen al estudio del desarrollo humano
2. El mtodo hipottico deductivo
3. Los enfoques se expresan en teoras
4. El desarrollo humano en su conjunto
5. La teora de la evolucin y la psicologa evolutiva
6. La nocin de emergencia
Lecturas complementarias
Actividades
Soluciones a las actividades
4 Bloque I. Introduccin al estudio del desarrollo humano
Esquema resumen
1. Los presupuestos tericos que subyacen al estudio del desarrollo humano
Hay tres grandes marcos generales de carcter losco que inspiran el estudio del de-
sarrollo humano: el racionalismo, de carcter innatista; el asociacionismo, de carcter
empirista y ambientalista y, por ltimo, el constructivismo, que se centra en los procesos
del propio sujeto que evoluciona.
2. El mtodo hipottico deductivo
El estudio del desarrollo humano trata de seguir el mtodo cientco. Eso exige: 1) la
formulacin de hiptesis; 2) la deduccin de consecuencias observables a partir de esas
hiptesis, y 3) la contrastacin emprica de las hiptesis y de sus consecuencias.
3. Los enfoques se expresan en teoras
A partir de los marcos generales de carcter losco y sirvindose del mtodo cient-
co se construyen y se elaboran teoras que tratan de, por una parte, describir el desa-
rrollo humano, y, por otra, explicar las causas y predecir los hechos principales del de-
sarrollo humano.
4. El desarrollo humano en su conjunto
El desarrollo humano se estudia atendiendo a sus tres facetas principales: 1) lo cogni-
tivo o intelectual; 2) el mundo afectivo, emocional y volitivo y, nalmente, 3) el com-
ponente interpersonal y social. No obstante el ideal al que aspira nuestra disciplina,
an no conseguido, es lograr una descripcin y explicacin de conjunto de todo el de-
sarrollo.
5. La teora de la evolucin y la psicologa evolutiva
La psicologa del desarrollo humano est muy inuida por la teora de la evolucin me-
diante seleccin natural. Sin embargo, hay que tratar de distinguir, por una parte, el
hecho aceptado de que todo evoluciona de, por otra parte, la teora que trata de expli-
car esta evolucin mediante el mecanismo de la adaptacin al medio de los ms aptos
y la eliminacin de los menos aptos.
6. La nocin de emergencia
Cada vez se ve con ms urgencia la necesidad de incorporar nuevos conceptos para
entender mejor el desarrollo humano: la complejidad, la no linealidad y la nocin de
emergencia. Parece que el todo es ms que la mera suma de las partes, incluso, que es
distinto a la mera adicin de sus partes constituyentes. La nocin de emergencia viene
a superar las explicaciones reduccionistas que pretenden entender los fenmenos des-
componindolos en sus partes constituyentes.
Captulo 1. Los fundamentos de la Psicologa del Desarrollo 5
Objetivos
Distinguir con claridad los distintos enfoques tericos y epistemolgicos que com-
piten en la explicacin del desarrollo a lo largo de todo el ciclo vital.
Ser capaz de determinar desde qu enfoque se ha realizado una investigacin.
Distinguir entre los hechos y los datos, es decir, 1) el nivel descriptivo y la inter-
pretacin de esos hechos y esos datos, esto es, 2) el nivel explicativo.
Formular con precisin los problemas que plantea la comprensin del desarrollo
humano y el modo de abordarlos.
Conectar las distintas dimensiones del desarrollo humano: desarrollo cognitivo o
intelectual, desarrollo afectivo y emocional y desarrollo social.
Captar la importancia de la metodologa experimental y distinguir entre una me-
todologa de tipo transversal y otra de tipo longitudinal.
Conocer las etapas fundamentales en las que se subdivide el desarrollo hu-
mano.
Introduccin
LaPsicologadelDesarrollooPsicologaEvolutivaesunadisciplinacomplejaquetrata
deestudiareldesarrollohumanoensuconjunto,aunqueensusorgenessloseocup
delestudiodelainfanciaylaadolescencia.Elobjetivodeestecaptuloinicialesesbozar
losfundamentosdeestadisciplina.Enprimerlugarseplantearnlasdistintasconcepcio-
nesepistemolgicas(racionalismo,empirismoyconstructivismo)quesubyacenalestu-
diodeldesarrollohumanoycmodichasconcepcionesseexpresanenteorasymodelos
quehanidocambiandodesdeelorigendeestadisciplina.Tambinsevercmoestudiar
cientfcamentelascuestionesqueinteresanalaPsicologaEvolutiva.Finalmente,sehar
alusinalanecesidaddeincorporarnuevosconceptosparaentendereldesarrollohuma-
noysuperarlosreduccionismosqueanamenazanyrestringenlacomprensindelos
procesosevolutivos.
1. Los presupuestos tericos que subyacen al estudio
del desarrollo humano
Haytresconjuntosdepresupuestos,tresmodosdistintosdeexplicareldesarrollohuma-
nodesdeelnacimientoalolargodetodoelcursodelavidaociclovital:racionalismo,
asociacionismoyconstructivismo.
Racionalismo. Primaloinnato,elbagajeconelquevenimos,tantoelgeneral,propio
detodoslossereshumanos,comoelparticular,queeslaexpresindelogeneralenel
casoconcretodecadacual.
Asociacionismo. Prima lo adquirido, el medio ambiente, tanto natural como social,
elcontextoolascircunstanciasenlasqueeldesarrollotienelugarylasinfuenciasque
recibimos.
6 Bloque I. Introduccin al estudio del desarrollo humano
Constructivismo. Tratadeponerelacento,msqueenlaherencia(racionalismo)o
enelmedioambiente(asociacionismo),enlapropiapersonaqueconambosingredientes
tienequeconstruirsupropiodesarrollo.Esteenfoquetratadeirmsalldelosdospri-
merosydehacerjusticiaalomejordecadauno.Alolargodeestemanualintentaremos
seguiresteenfoquegeneral.
Como puede verse falta un enfoque integrado del desarrollo; en su lugar, conviven
distintosparadigmasydistintosprogramasdeinvestigacin.Endefnitiva,cadaunode
losenfoquesgeneralessealadosdalugaraunprogramadistintodeinvestigacin.
2. El mtodo hipottico deductivo
Todos estos enfoques dicen, sin embargo, seguir el siguiente procedimiento, comn a
todas las ramas del conocimiento que pretenden emplear el mtodo cientfco: he-
chos-teora-prediccin-hiptesis-experimentos-resultados-refnamiento-teora.
Ante unos determinados hechos (por ejemplo, todos los nios logran adquirir su
lenguamaternaenunperodocortodetiempoyhacialos5aosdominantodoloesen-
cial de ella) se propone una teora que explique este hecho (por ejemplo, una teora
innatista,quesostienequelalenguamaternaeslaexpresindeunacapacidadlings-
ticaqueestinscritaennuestroADNocidodesoxirribonucleico).Estateora,asuvez,
dalugaraciertaspredicciones(losprimatessuperioresnosernnuncacapacesdeapren-
derunsistemadecomunicacinsemejantealhumano).Esaprediccindebeformularse
comounahiptesiscontrastable,nocomounameraespeculacin,ydebepodersome-
terseaunapruebaobjetiva,repetibleyqueayudeadecidirsilateorapuedeonopue-
de sostenerse (por ejemplo, por mucho que queramos ensear una lengua similar a la
lengua materna humana a un primate superior no humano no lo conseguiremos). Los
resultadossoninterpretablesycasinuncacierrandefnitivamenteelproblema.Eneste
caso,parecequeloschimpancspuedenaprenderunsistemadecomunicacindecier-
ta complejidad e incluso enserselo a su prole, pero, por ejemplo, parece que nunca
hansidocapacesdeemplearestesistemadesignosparahacerunapregunta,mientras
que los nios en cuanto pueden no dejan de hacer preguntas sobre los ms variados
asuntos.
Losresultados(enrealidad,sonnuevoshechosquehemoshechoaparecerpuesesos
hechosnosedanespontneamenteenlanaturaleza)obliganaperflaryaafnarlateora.
Estosrefnamientosdarnlugaraunateora(enestecaso,todoslosprimatessuperiores
compartenunacapacidadprelingsticacomnquesurgienelcursodelaevolucin,el
llamado desarrollo flogentico). Esta teora deber someterse a nuevas contrastaciones
experimentalesparaponerapruebasuvirtualidad.
Estoesloqueseconocecomoelmtodohipottico-deductivo.Ahorabien,hayque
tenerencuentaquenohayhechoscientfcamenteneutralesopuros,todosestnsituados
enalgnmarcointerpretativootericoprevio.Poresohemosempezadoporsealarlos
tresmarcospreviosenlosquesebasantodoslosestudiososdeldesarrollohumano.Ya
ellosvolvemos.
Captulo 1. Los fundamentos de la Psicologa del Desarrollo 7
3. Los enfoques se expresan en teoras
Elracionalistaestconvencidodequeloshechosrefuerzansuenfoquedequehaycapa-
cidadesinnatas.Elasociacionista,dirquetodo,sisehacedelamaneraadecuada,pue-
deserenseadoyaprendido.Elconstructivista,porsuparte,dirqueniloinnatonilo
adquiridopuedenexplicarporseparadoeldesarrollohumanoeinsistir,adems,enque
nosetratameramentedesumarodemultiplicargenesporambiente(genesambiente),
sino que la actividad constructiva de la propia persona es esencial y defnitiva para dar
cuenta de las cosas esenciales, valga la redundancia, que subyacen al desarrollo hu-
mano.
Nunca hemos de olvidar que hay una continua interaccin entre presuposiciones,
enfoquesymarcosgeneralesteorashechos.
Vamos a ver un ejemplo de presupuestos generales que pueden infuir, y de hecho
infuyen,enelmodoenelquesecaracterizaeldesarrollohumano:laconsideracindel
sujeto como activo o pasivo y del medio como activo o pasivo. En la siguiente tabla,
propuestoporK.Riegel(2007),podemosvercmolamayoradelosestudiososdelde-
sarrollohumanosonunilateralesenelmododeverlosdosaspectosdelproblema:slo
consideranactivounaspecto;elotroloconsiderancomopasivo.Tanslodospensadores
dialcticos(Marx,conescasainfuenciaenlapsicologayRubinstein,unflsofoypsi-
clogosovitico,yafallecido,sinapenasinfuenciatampoco)seavienenaverlarelacin
entrminosdinmicos,dialcticoseinteractivos:
Tabla 1.1. El papel del medio y de la persona en la explicacin del desarrollo segn K. Riegel
Medio
Persona
Pasiva Activa
Pasivo Locke,Hume/Ebbinghaus Piaget/Chomsky
Activo Vygotski/Skinner Marx/Rubinstein
Lo que Riegel quiere decir es que est por hacer una teora del desarrollo humano
quetengaencuentaquetantolapersonacomoelmedioambientesonactivosydesen-
cadenancambiosunoenelotro.
Tenemos,pues,unaposicinracionalista,quesemanifestaenelcampodelestudio
del desarrollo humano como innatismo. Por ejemplo, Chomsky, afrma la naturaleza
generativadellenguaje.Igualmente,enelestudiodelapercepcinenbebs,losautores
innatistassostienenquehayrestriccionesinnatas(vase Captulo 5).Noesquenieguen
la infuencia del medio, pero lo consideran un mero desencadenante de lo innato. Las
capacidadesinnatas,potenciales,antesdeseractualizadas,debenmadurar.Esunatesis
maduracionista,enlaqueelmedioslotieneunpapelpasivo.
Frenteaestospresupuestossealza,porejemplo,laperspectivaecolgicadeGibson:
elambientenaturalofrecemuchasposibilidadesdeinteraccin;suriquezaestructurales
mayordeloquesehabasospechado.Elmedionoseraunmerodesencadenante;todo
locontrario,seraungranprovocador.
8 Bloque I. Introduccin al estudio del desarrollo humano
Elasociacionismosebasaenunaafrmacintansencillacomolasiguiente:lascosas
queocurrenjuntasoquevanunadetrsdeotraenlanaturalezaocurrirnjuntasoirn
unadetrsdeotraenlamente.Esteenfoquedarlugaralempirismo:elconocimiento
procededelaexperiencia.
El neoasociacionismo, que es el asociacionismo clsico puesto al da o renovado,
acepta,adems,asociacionesentreacontecimientosmentales.Enestecasoest,porejem-
plo,unenfoquenuevoquesedenominaconexionismo.Tieneencuentaquelainforma-
cinconlaquelosorganismostienenquebregaresunainformacinpobre,aveces,in-
cluso,laspropiasestructuraspuedenestardaadas.Y,sinembargo,elorganismoescapaz
de superar esos hndicaps y avanzar. Propone un procesamiento en paralelo: hacemos
muchascosasperononecesariamenteunasdetrsdelasotras,muchasveceslashacemos
alavez.Sostieneunarepresentacindelosconocimientos,lasinformaciones,lasestra-
tegias o las capacidades no local, sino mltiple, masiva y distribuida. El conocimiento
estalojadoenlasinterconexiones(excitacineinhibicin)entrelasneuronas.Esasredes
se conectan entre s y las redes aprenden. Surgen en ellas propiedades emergentes, es
decir,queeltodoesmsquelasumadelaspartesquelocomponen.Cerebroesmente
ylamenteescerebro;escomounaReddeRedes(nounamerasumaderedes:red+red+
+red+...).Unaunidaddeunaasambleacelularpuedeperteneceraotraasambleadis-
tinta;deestaformacadaunidadneuronalesmultiusoporquedebeinterpretarelcontex-
toysabrintegrarseenunooenotrosistemasegnconvenga,o,trabajarenunauotra
direccinsegnconvenga.Hay,portanto,solapamientoy,adems,hayintegracinentre
distintasconfguraciones.
Salida
Capa
oculta
Capa
de entrada
Entrada 1
Entrada 2
Entrada 3
Entrada n
Capa
de salida
...
...
1
1
2
3
n
1
2
m
Figura 1.1. Ejemplo de una red conexionista.
Elconstructivismo,porsuparte,vienedeKant:esunintentodesntesisentreracio-
nalismo y empirismo.Veamos con algn detalle la flosofa kantiana porque, an hoy,
sigueinfuyendodecisivamenteeneldesarrollodelpensamientocientfco.
Elconocimientoseconstruyeapartirdelaexperienciasensorial(loemprico)ylas
categorassintticas a priori (loracional).
Captulo 1. Los fundamentos de la Psicologa del Desarrollo 9
Losjuiciosanalticos(enlosqueelpredicadoestcontenidoenelsujeto,porejem-
plo:eltringuloesunafguradetreslados)sontodosa priori.Sonobvios,secaptan
intuitivamente.
Losjuiciossintticos(enlosqueelpredicadoesajenoalsujeto)puedensera priori
(7 + 5 = 12; todo tringulo equingulo es equiltero) o a posteriori (la nieve es
blanca).Nosonobvios,hayquellegaraellos.
Losjuiciossintticosa priorisonlgicamenteindependientesdelosjuiciosquedes-
cribenimpresionessensibles;notienenalternativaposibleysunegacinnoescontradic-
toria. No son lgicamente necesarios ni empricos. Son los ms interesantes.Antes de
Kantnadiehabaconsideradoestetipodejuicios.
EjemplosdeteorasinspiradasenlaflosofakantianasonlasteorasdePiaget,Bru-
neryVygotski.Lasrepresentacionesinternassederivandelasaccionesenelmundoy
no se registran pasivamente. Los conceptos se consideran como alguna representacin
general(esquema)construidaapartirdelaexperiencia.Unejemploeselesquemamotor
de la frma personal de cada uno. La podemos ejecutar en una hoja de papel o en una
pizarra,engrandescaracteres.Esunmismoesquema,aunqueseexpreseconmovimien-
tosmuscularesdistintos.Cuandofrmamosenunahojadepapelpequealosmovimien-
tosmuscularesnosonlosmismosquecuandolohacemosenunapizarragrandeconuna
tiza grande. Sin embargo, la estructura de la frma es inconfundible.Viene del mismo
esquemainterno.
Lasteorasquesebasanenelesquemapartentodasdelaconsideracindequeexis-
teunarepresentacinmuygeneraldeacontecimientosydegruposdeobjetosrelaciona-
dosentres.
Cadalectordeberbuscaralolargodellibrolafliacintericadelosdistintosas-
pectostratados.Yanalizarsicompartenalgnpresupuestoypreguntarseculesson,si
esquelostengo,mispropiospresupuestostericos.Porotraparte,esdegranimportan-
cia leer directamente a los autores que son referencias importantes en nuestra disci-
plina.
4. El desarrollo humano en su conjunto
DecaAgustn de Hipona: Qu es el tiempo? Si nadie me lo pregunta, lo s, pero si
tratodeexplicrseloaquienmepregunta,nolos.Algosemejantepodramosdecirdel
desarrollohumano.
Cadacaptulodeestevolumenrespondeapreguntasdistintas.Aquvamosaintentar
tratarlasenconjunto.Enprimerlugar,hayquetenerencuentalaevolucindelapropia
disciplina.
En sus comienzos, la Psicologa del Desarrollo slo se preocupaba del desarrollo
humanoenlainfanciayadolescencia.Parecacomosieldesarrollosedetuvieraah.Sin
embargo, con el paso del tiempo, hubo una conciencia creciente de que era necesario
considerareldesarrollohumanoalolargodetodalaexistencia,detodoelciclovital,de
todoelcursodelavida,desdeelnacimientohastalamuerte.Nosimportamuchosaber
qu ocurre despus de la adolescencia: en la juventud, durante las primeras fases de la
vidaadulta,enlamadurezy,porsupuesto,enlavejez.Pero,incluso,hahabidoqueam-
pliarelarcomsacdelnacimiento:alavidaintrauterina.Cuntascosasnosocurrenen
10 Bloque I. Introduccin al estudio del desarrollo humano
elsenomaternoantesdenacer.Enesapocaseformaunaurdimbrebsicadelaqueno
guardamos memoria consciente, pero que nuestro cuerpo s mantiene de alguna forma,
hoyporhoy,enigmtica.
Ennuestradisciplinaincidenotrascomolabiologa,laetologa,laecologa,laan-
tropologa,lasociologa...Eslgicoquelapsicologaevolutivaseapliqueasmisma
elcuentoyseexpliquesegnlasdistintasfaseshabidasensuconstitucin.
Vemos,pues,queestadisciplinaesuncrucedecaminos,delneas,unpuntodein-
terseccin,unasingularidad,quetodava,pordesgraciaestlejosdealcanzarlamadurez
requerida. Cmo sabemos que no hemos alcanzado la madurez todava? Por algo que
difcultaelprogresoentodadisciplinacientfca:losllamadosdualismos,lasoposiciones
quenoalcanzanlasntesisylaintegracin.Esosdualismosllevanamovimientospen-
dularesyamodaspasajerasoinfructuososeclecticismos,quenosonverdaderassntesis:
se pasa de un lado al otro sin solucin de continuidad. Son los dualismos debidos a la
inmadurezdelapropiadisciplina.
Helosah:laherenciayelmedioambiente(quinfuyemseneldesarrollo,nuestros
genes o las condiciones materiales donde tiene lugar el desarrollo); el desarrollo y el
aprendizaje(quocurreantes,eldesarrolloquepermiteelaprendizajeoelaprendizaje
queimpulsaeldesarrollo);lainteligenciageneralylainteligenciaemocional(quesms
importanteparalograrunavidaplena,sabermanejarlosafectosoconducirsesegnlos
presupuestos de la racionalidad clsica); lo individual y lo social (debemos primar las
relacionesinterpersonales,grupales,socialesalahoradedescribireldesarrolloo,porel
contrario,dejarquellevenlainiciativaeneseprocesolosfactoresindividualeseidiosin-
crsicos).
Lapsicologaevolutivaestmuyinfuidaporlarevolucincognitivaquetuvolugar
enlapsicologageneralenlosaossesentadelsigloXX.Enesemomentoseprodujoun
girocopernicanoenlaconsideracindelascaractersticasgeneralesdelaparatocogniti-
Figura 1.2.
La Psicologa del Desarrollo abarca el estudio del
desarrollo humano a lo largo de todo el ciclo vital.
Captulo 1. Los fundamentos de la Psicologa del Desarrollo 11
vohumano.Conelconductismosehabanprimadolosaspectosexternosyobjetivosde
la conducta humana y se haba intentado prescindir de las variables internas, de lo no
observable.Enesemomentoestabaentodosuapogeolacibernticaylabsquedadela
inteligenciaartifcial(IA).Irrumpecontodasufuerzaenelsenodelapsicologalame-
tfora del ordenador. La consideracin de la mente humana como un procesador de
informacin simblica, con sus representaciones internas. Surgen nuevas analogas: el
cerebroeselhardwareylamenteelsoftware.
Dentrodeesemarco,noobstante,notodospiensandelamismaforma.Hayteoras
queinsistenenloscambioscualitativosyglobales,generalesensuma,ylasteorasmo-
dularesqueaboganpordesarrollosenreasespecfcas.
Aesarevolucincognitiva,ciberntica,delossistemasartifcialeshavenidoasumar-
se,msrecientemente,laneurociencia.Conlaaparicindenuevastcnicasyprocedi-
mientosparaelestudiodelaactividadcerebralemergeconnuevosbroslabsquedade
las misteriosas relaciones entre la mente y el cuerpo. La bsqueda de las propiedades
emergentes del cerebro en accin.Ahora estamos en pleno asentamiento de este nuevo
paradigmatericoyexperimental.
Pero no todos los investigadores consideran que el mejor modo de conocer la con-
ductahumanaesatravsdelavadelascienciasnaturales.Esms,piensanqueelser
humano al ser eminentemente social, cultural e histrico se entiende mejor a travs de
una aproximacin no naturalista.Ven las caractersticas generales de la mente humana
comounproductodeunsistemasocial.Alaculturaylahistoriacomoforjadorasdelo
humano.Insistenenlaimportanciadelosotrosynoslodelosobjetosfsicososimb-
licos.Laclaveestenlaactividadmediadaporsmboloscreadosporlasdistintassocie-
dadeshumanasenelcursodelahistoria,enlaquelainteraccininterpersonalysocial
pasaporelfltrodelosotros.Porejemplo,laexploracindelmundoporpartedelnio
sehaceenunmundosocialdeobjetosypersonas,noslodeobjetospormuycomplejos
questossean.Aquellenguajejuegaunpapelprimordialenlaconstruccindelashe-
rramientasdepensamiento.Lapalabracomoherramientamaterial.Peronounlenguaje
enelqueloprioritarioeslafraydescarnadasintaxis,sinounlenguajedondelasintaxis
(estructura)nopuededarsesinsemntica(contenido)ysinpragmtica(contexto).
Alapsicologadeldesarrollonoleinteresaloqueunnio,unadolescente,unjoven,
unadultoounviejohaganenundeterminadomomento,sinoloquepotencialmentepue-
de ser capaz de hacer. Piaget (1896-1980), como veremos en el Captulo 2, contribuy
decisivamentealaconsolidacindenuestradisciplinaporquesuperlamerapsicologa
delostestsdeinteligencia,dondeloqueprimaeslapuntuacinquealguienobtienecon
respectoaalguien,peronadanosdicedelosverdaderosprocesosdelpensamientodeese
alguien.Vygostki(1896-1934)acueltrminodezonadedesarrolloprximo(vase
Captulo 3)parareferirseaesafranja,vitalparatodosnosotros,enlaquenosjugamos
nuestro destino, el espacio que media entre nuestras potencialidades, lo que seramos
capaces de hacer si nos quitan los obstculos o si nos encauzan debidamente y lo que
hacemos,oqueactualizamos,dejadosanuestrapropiasuerte.EnestoPiagetyVygotski
estabantotalmentedeacuerdo,noquerancatalogar,puntuar,jerarquizar,numerar,sino
entender.DecaVygotskisiemprebajoelinfujodeSpinoza:Procurarnoasombrarse,
norerse,nollorar,sinocomprender.
Esobvioqueennuestrocasolavariableedadesunavariableclave.Todoloqueha-
remossercompararloquesehaceonosehacesobrelosmsdistintosparmetrosen
12 Bloque I. Introduccin al estudio del desarrollo humano
funcin de la edad. Pero hay que tener en cuenta que la edad, en s misma, no explica
nada, pues una cosa es describir, que es importante, pero otra mucha ms necesaria es
explicar. Fundamentalmente utilizaremos dos tipos de herramientas metodolgicas: los
diseostransversalesylosdiseoslongitudinales.Mediantelosdiseostransversales
comparamosloquehacenpersonasdedistintaedadenundeterminadoaoomomento
temporal. Mediante los diseos longitudinales examinamos lo que un mismo grupo de
personashacealolargodeltiempo,delosaos;esunseguimientodeunadeterminada
cohortedepersonasalolargodeltiempo.Enlosdiseostransversalessemezclanper-
sonasdedistintageneracin,mientrasqueenloslongitudinalesseestudiaapersonasde
lamismageneracin.Comovemos,lomejorserautilizarmtodosquerenanlasven-
tajas de ambos pero que eliminen sus desventajas. En los transversales confundimos
generacin y edad, es decir, podemos atribuir el cambio observado a la edad, cuando
podradebersealadistintageneracindelaqueprovienenlosparticipantes;enloslon-
gitudinales, al estudiar el cambio en personas de la misma generacin no sabemos si
podemosgeneralizarloatodaslasgeneraciones.
Enotroordendecosas,lapsicologadeldesarrollotienedosvertientes:porunlado,
elestudiodeloquenoshacesemejantes,locomnatodos,lomsabstractoogeneral,
y,porotrolado,debeabordarlasdiferenciasindividuales,lascaractersticaspropiasde
cadapersona.Debeestudiarloquehacenlaspersonasrealmente.
Enlosltimostiemposgozadeunaparticularatencinelestudiodelestadoinicial,
podamosdecir,lapsicologadelrecinnacido(vase Captulo 4).Porqu?Alosin-
natistaslesinteresasabercmovenimosalmundoparapoderdemostrarquecasitodose
encuentraenciernes,yaenelestadoinicial.Quierendemostrarexperimentalmenteque
lamentenaceyamuyenriquecidayquetodoloquequedaserdesarrollarla,peroque
lobsicoyaestahalnacer.Lacantidaddeestudiosquesehacenparavercmoelre-
cin nacido y los bebs de pocos das, meses o aos se conducen son verdaderamente
interesantes.Indudablementehabamscosasdelasquenuncahubiramossospechado,
perodeahaafrmarquetodoestyaprotoformadohayunsaltodemasiadolargo.Alos
constructivistastampocolesvienemalconocerelestadoconelquevenimosequipados
parahacerfrenteaunlargoylentoprocesodeadaptacin.Adaptacinaunmedioque
nosofrecemltiplesoportunidadesdeinteraccin.Estosestudiosdelestadoinicialson
una fuente de conocimiento de la gnesis de la relacin fundamental persona-medio a
travsdelaaccin.Delosrecinnacidosseestudia,conprocedimientosmuyingeniosos,
lapercepcin,perolointeresantenoeshacerlodeunmodopuramentetcnico,puesla
percepcinloesdeunserenelmundo.Surgedenuevolanocindezonadedesarrollo
prximopropuestaporVygotski.
Una caracterizacin del desarrollo humano desde el punto de vista psicolgico no
estaracompletasinunareferenciaalostrastornosdeldesarrollo,comotendremosopor-
tunidad de ver en algunos de los captulos del segundo volumen de este manual. Des-
graciadamentenotodaslaspersonaslogranundesarrollopleno.Ylosproblemasdeesas
personasponenmsderelieve,sianfueranecesario,lacomplejidadinauditadelpro-
cesomedianteelcuallapersonanace,sedesarrollaymuere.Unejemplo,comoveremos
msendetalleenelCaptulo13(Volumen 2),eselautismoCuleslarelevanciadel
autismo?Unniodefcientementalestretrasadoconrelacinaunnionormal,esun
problema,pues,msomenoscuantitativo.Peroelautismoesunacuestincualitativa.
Lateoradelamentetratadeexplicarqueloquefallaenlaspersonasconautismoes
Captulo 1. Los fundamentos de la Psicologa del Desarrollo 13
la imposibilidadde captar los estados internosajenos (vase Captulo 8). La teora de
la mente podra explicar la defciencia que se observa en las personas con autismo en
algunosdominiospsicolgicosperonoenotros.Elsndromeesmuycomplejoyafecta
a una amplia variedad de aspectos psicolgicos, en suma, a toda la persona.Veremos,
pues,distintasaproximacionesalciclovitalconsideradoentodasuamplitud.Loimpor-
tanteescaptarquelapersonanodejadeevolucionaralolargodetodasuvida.Elser
humano es un sistema dinmico incluido en otros sistemas dinmicos. Lo mismo que
las sociedades cambian a lo largo del tiempo, tambin lo hacen los individuos. Los
individuos promueven cambios sociales y las sociedades promueven cambios indivi-
duales.
5. La teora de la evolucin y la psicologa evolutiva
Eluniverso,decaArthurEddington,noessimplementemsextraodeloquenosima-
ginamos:esmsextraodeloquepodemosimaginar.
Elserhumanoestodava,yloserpormuchotiempo,ungrandesconocidoparal
mismo. La Psicologa del Desarrollo se acerca a ese extrao desde el punto de vista
evolutivo,loobservacomounserendesarrollo.Poreso,lateoradelaevolucinhasido
unafuentecontinuadeinspiracineneseacercamiento.Lateoradelaevolucinestu-
dialanaturalezaylosorganismosquelahabitandesdeelpuntodevistadesuevolucin.
Mientras que la teora de la evolucin centra su atencin en los procesos flogenticos
(laevolucindelasespecies),lapsicologadeldesarrollolohaceenlosprocesosonto-
genticos(laevolucindelosorganismosindividuales).Hayunpuntodecontactoentre
ambas aproximaciones: aqul en el que la ontogenia recapitula la flogenia. Eso quiere
decir, por ejemplo, que cada ser humano individual, en tanto que perteneciente a una
especiesurgidadeotrasanterioresalolargodeuncomplejoprocesoevolutivo,recapi-
tulara,dealgunamanera,ensudesarrolloembrionario,todoeseprocesoevolutivo.Ms
quecomounhecho,estaposibilidadladebemostomarcomounametfora,loquenos
permiteprestaratencinaciertasanalogasquesepuedenproducirentrelaflogeniayla
ontogenia.Contodo,elproblemadetodateoraevolutivaesexplicarcmoseadquieran
capacidades(seanestructurasofunciones)mscomplejasqueaqullasdelasquesedis-
pone.Esmuyfcilcaerenrazonamientoscircularesdeltipodepresuponerqueelorga-
nismonecesitaposeerunacapacidadmssofsticadaquelaqueesobjetodeadquisicin,
osea,quelaquetienequealcanzar.Dichodeotromodo,sepostulaunacapacidadprevia,
queesmscomplejaquelanuevacapacidadcuyaconstruccinseestintentandoexpli-
car.Hay,pues,dosproblemas:
1. Cmounaestructurageneraotraestructuramscomplejaqueellamisma?
2. Cmopuedeexplicarseeldesarrollodeestructurasyfuncionescomplejasatra-
vsdemecanismosquenoseanellosmismosmuycomplejosoestnricamente
dotadosdecomplejidad?
Responderaesaspreguntasnoesnadafcil.Desgraciadamente,aveces,comodice
elprofesordebiologaAntonioAmorim(UniversidaddeOporto),lateoradelaevolu-
cinexplicatodoynoexplicanada.Todospiensan,contina,queparahablardeevolu-
14 Bloque I. Introduccin al estudio del desarrollo humano
cinesprecisocitaraDarwin.Yestonoesas:nadieniegalaevolucin,perounaexpli-
cacin global y totalitaria, como la que pretenden los darwinistas, desprecia la
complejidadmltiplequeenvuelvelaevolucindelasespecies.Darwinhablabadeuna
seleccin natural de los individuos ms aptos, pero si aceptamos dogmticamente esta
idea,ladequesobrevivenlosmsaptos,losmejores,acabamosentrandoenuncrculo
viciosoyseconvierteenunameratautologa.Quinessobreviven:losmsaptos;quines
sonlosmsaptos:losquesobreviven.Seracomocontrarrestarlacalifcacindeperso-
na loca para quien afrma haber visto espritus puros, diciendo que, precisamente, por
habervistoalosesprituspuroslapersonasehavueltoloca.Elrazonamientoestancir-
cularquenoadmiteserpuestoaprueba.Nosquedamossinsaberlarealidaddelosesp-
rituspuros.
Laevolucinexisteyesnecesarioobservarlosdatos.Tenemosqueexplicarladiver-
sidadylacomplejidadusandolosmediostcnicosycientfcosdenuestrapoca.Pero
hacemos ms frgil el hecho obvio de la existencia de la evolucin con la camisa de
fuerzadelateoradarwinistaquenorespondealasnecesidadesdelacienciamodernay
debesersuperada.LaideadeDarwindequeexistenunosindividuosmejoresqueotros,
quesereproducenmsymejor,quevandestruyendoalosmsdbilesyqueassurgen
loscambiosysegeneranlasnuevasespeciesesunmodeloqueyanoesvlido.Aeste
respectoelPremioNobeldefsicaRobertLaughlinobservaque:
Gran parte del conocimiento actual en biologa es ideolgico. Un sntoma clave
del pensamiento ideolgico es la existencia de explicaciones que carecen de
consecuencias y no pueden ponerse a prueba. A esos callejones sin salida los
denomino antiteoras, porque son exactamente lo contrario de las verdaderas
teoras: en lugar de estimular el pensamiento, lo frenan. La evolucin a partir de la seleccin
natural, por ejemplo, que Darwin concibi como una gran teora, se ha convertido en una
antiteora a la que se convoca para ocultar defciencias experimentales y legitimar descubri-
mientos cuestionables o, en el peor de los casos, que ni siquiera estn mal. Una protena
desafa la ley de accin de masas? La evolucin lo ha hecho posible! El producto de un
conjunto complejo de reacciones qumicas no es el esperado? La culpa es de la evolucin!
El cerebro humano funciona segn principios lgicos que ninguna computadora puede emu-
lar? Es por la evolucin! Las teoras son necesarias para idear experimentos. Las antiteo-
ras buscan escaparse de la exigencia de coherencia lgica, cosa necesaria para descartar
lo falso. Hoy en da nos preguntamos si la evolucin es un ingeniero o un mago alguien
que descubre principios fsicos preexistentes y se vale de ellos o un hacedor de milagros,
aunque no deberamos dudar. En el primer caso es una teora, en el segundo, una anti-
teora.
Laideologacierraelpasoalosdescubrimientos.Todostenemoslatendenciaano
verelmundocomoesenrealidad,sinocomoqueremosquesea;espartedenuestrana-
turaleza,peronodebemosperderdevistaquesetratadeundefectodelamentehu-
mana y que hay que luchar contra l. La misin de la ciencia consiste en detectar la
existencia de las ideologas y desenmascararlas. En verdad, sa es la misin de la vida
intelectualengeneral.
Captulo 1. Los fundamentos de la Psicologa del Desarrollo 15
6. La nocin de emergencia
Enlosltimosaosseestplanteandolanecesidaddeincorporarnuevosconceptos,proce-
dentesdeotrossectoresdelaactividadcientfca,paraentendermejoreldesarrollohuma-
noysuperarlasexplicacionesreduccionistasdelmismo;entreellosseestabriendopaso
lanocindeemergencia.SeguimosglosandoelpuntodevistadelcitadoPremioNobel:
Fenmenos de organizacin primitivos, como el clima, dicen algo muy impor-
tante sobre otros fenmenos ms complejos, entre los que se incluye el ser hu-
mano. La naturaleza primitiva del clima nos permite demostrar con total certe-
za que este tipo de fenmenos estn gobernados por leyes microscpicas, pero
tambin, por ms paradjico que resulte, sus aspectos ms sofsticados son insensibles a los
detalles de esas leyes. Podemos probar que la organizacin puede adquirir un signifcado y
una vida propios y trascender las partes que la conforman.
Elconceptoclaveeslanocindeorganizacin.Elpostuladodequeeltodoesms
quelasumadelaspartesnoesunametfora;esenrealidadunfenmenofsico.Esel
fnal del reduccionismo, entendido ste como la creencia de que todos los fenmenos
incluido el desarrollo humano en cualquiera de sus facetas se clarifcan cuando se
losdivideencomponentescadavezmspequeos.Nopodemoscomprendertodoslos
fenmenosporlavareduccionista,esdecir,dividindolosensusconstituyentes.Lana-
turalezasehaceporsmismacadavezmscomplejaapesarderesponderaleyessim-
ples.Parececomosilamismaorganizacinnaturalfueracapazdeoriginarlasleyesyno
alainversa.Esdecir,lasleyesnaturalessonprocesosemergentes.Unaleyemergente
eslaexpresindeunmundoregidoporunaevolucinjerrquicaordenada.Heaquun
bellopoemaquenosacercaintuitivamentealncleodelaactividadinvestigadora:
Who has seen the wind?
Neither you nor I:
But when the trees bow down their heads,
The wind is passing by
1
.
(C.G.ROSSETTI)
Desdeelpuntodevistadelreduccionismo,lasleyessonloquedanimpulsoaluni-
verso,noprovienendeningunaparteytodosederivadeellas.
Desdelaperspectivadelemergentismo,lasleyessonreglasdecomportamientoco-
lectivo que se desprenden de reglas de conducta ms primitivas y que tienen poder de
prediccin en ciertas circunstancias, no en todas. Fuera de esas circunstancias se ven
reemplazadasporotrasquesederivandeellasyjuntasformanunajerarquaordenadade
leyes.ComodijoFrancisBaconlanaturalezaesmuchomssutilquelossentidosyque
elintelecto.
1
Quinhavistoelviento?/Nitniyo/Perocuandolosrbolesinclinansuscabezas/Esqueelviento
estpasando.
16 Bloque I. Introduccin al estudio del desarrollo humano
Lavidaeselcasodeemergenciamsextremo.Dehecho,lanocindeemergencia
fueconcebidaporbilogos.Peroelcasomsrepresentativoeselfuncionamientodelos
organismos superiores como el hombre. La idea clave a retener es la complejidad que
surgedeloprimitivo,queemergedesdeelnivelelemental.
Laemergenciaeslaestructuradeorganizacincomplejaquepartedeleyessimples.
La emergencia es la inevitabilidad estable de la forma que adoptan ciertos fenmenos.
Signifcaqueesimposiblepredecirloscambioscualitativosquecausarnhechosmeno-
resenotrosdemayorenvergaduraeimplicalaimposibilidaddecontrolarlosfenmenos.
Esunaleynaturalalaqueestnsupeditadosloshumanos.Laconductahumanasease-
mejaalanaturalezaporqueformapartedeellayserigeporsusmismasleyes.Nospa-
recemosalascosasmsprimitivasporquesassonlascosasdelasqueestamoshechos.
Lanaturalezasenosrevelaahoracomounaenormetorredeverdades,cadaunadelas
cualessederivadeunaanteriorylatrasciendeamedidaquevaaumentandolaescalade
lasmediciones.Elmitodequeelcomportamientodelconjuntosesiguedelaleyes,en
realidad,exactamentealrevs:laleysesiguedelcomportamientocolectivo,ylosfen-
menosquesurgendealltambin.
En el siguiente cuadro Con los pies en la tierra veremos con un ejemplo lo que
signifcaunprocesoemergenteincrebley,acontinuacin,ilustraremosestemismocon-
ceptoconotroejemplotomadodirectamentedelestudiodeldesarrolloinfantil.
EnelmbitodelaPsicologaEvolutiva,algunosautores(porejemplo,Theleny Smith,
1994)estnproponiendounnuevomarcoconceptualparaestudiarloscambiosqueacon-
tecenduranteeldesarrollo.SetratadelaTeoradelosSistemasDinmicosqueenfatiza
precisamentelaideadequeeldesarrolloeselproductodelainteraccindemltiplesfac-
tores,ynodecausasnicas,quedanlugaralaemergenciadeconductasyestructurasde
nivelesdecomplejidadcadavezmayor.Estasautorasestudiaroneldesarrollodelamarcha
enlosnios,especfcamenteelcambiodelasconductasrefejasquepresentanlosrecin
nacidos(vase Captulo 4)hastaelmomentoenquelosniosdansusprimerospasosy
comienzanaandar.Tradicionalmentesehabapropuestoqueeldesarrollodelamarchaen
elniodependalinealmentedeunnicofactor:lamaduracincerebral.Alprincipio,en
el recin nacido, el refejo de la marcha estara controlado por estructuras subcorticales.
Posteriormenteesterefejodesapareceraydespus,comoproductodelamaduracince-
rebral que se produce durante el primer ao de vida, los movimientos requeridos para
andarpasaranasercontroladosporlacorteza;entonceslosprimitivosmovimientosrefe-
jossetransformaranenintencionadosypermitiranalniocaminarvoluntariamente.
EstherThelenyLindaSmithllevaronacaboingeniososexperimentosqueleslleva-
ronadarotraexplicacinalsurgimientodelamarcha.Porejemplo,sedieroncuentade
quesumergiendolaspiernasdebebsde3mesesqueyahanperdidoaparentemente
laconductarefeja,estosempezabanarealizarlosmovimientostpicosdelamarcha.
Adems,sicolocabanabebsqueannocaminaban(de7meses)sostenindolossobre
unacintaenmovimiento,estosempezabantambinalternarelmovimientodesuspies.
Incluso,losbebs,comolosadultos,ajustabanelritmodesuspasosalavelocidaddela
cinta.Porlotanto,modifcacionesenlasituacinoelcontextoenquesecolocabaalos
bebsdabanlugaralsurgimientodeunaconductaqueaparentementeestabayaex-
tinguida. Pareca como si variando las condiciones externas se mostraba alguno de los
componentesnecesariosparacaminar,aunquenotodosporquedehecholosniosan
noandabanporsmismos.
Captulo 1. Los fundamentos de la Psicologa del Desarrollo 17
El fsico Juan Manuel Rodrguez Parrondo ha encontrado que dos cosas negativas, con-
tra todo pronstico, pueden dar una cosa positiva.
En una entrevista en un medio impreso, que se puede consultar en Internet, el pro-
pio Parrondo se explica as:
Pregunta. Explique un poco ms
cmo son los juegos.
Respuesta. Hay un juego, el A,
que consiste en tirar una mo-
neda trucada para que una
cara salga menos, y el juego B
se juega con dos monedas: la
2 que es muy mala un dci-
mo de probabilidad de ganar
y nueve dcimos de perder
y la 3, que es una moneda ga-
nadora, pierde con una proba-
bilidad 1/4 y gana con
probabilidad 3/4. La regla del
juego B es que se usa la mo-
neda 2 si lo que llevo ganado
es mltiplo de 3 y la moneda
3 si no lo es. Como slo uno
de cada tres nmeros es ml-
tiplo de 3, el B tambin es
un juego perdedor. Pues si
jugamos al juego A o al juego B todo el tiempo, hay alguien que siempre tiene una
probabilidad muy grande de perder. Pero, si jugamos una vez al A y otra al B, el que
antes perda ahora gana. sa es la paradoja. Es un juego de azar simple.
P. Esas reglas del mltiplo de 3, etc. Se pueden cambiar?
R. Se pueden cambiar algunas cosas, pero no todas. Hay matemticos que estudian
ahora las posibles alteraciones.
P. Se puede aplicar la paradoja a cualquier cosa? No parece muy sencillo.
R. Se puede generalizar bastante. La esencia de la paradoja es que en el juego B hay
una moneda buena y una mala y entonces, cuando juegas al B solamente, el efec-
to de la moneda mala vence a la buena pero, cuando lo combinas con el A, ese
juego hace que intervenga ms la moneda del B: cambia la frecuencia con la que
juegas la buena y la mala. Es algo que s pienso que tiene aplicaciones ms genera-
les. T tienes una tendencia positiva y una negativa, y la negativa vence a la positi-
va. Juntndolas a una tercera negativa, aunque lo es, de alguna forma inuye en
las otras dos y hace que la positiva juegue un papel mayor. S creo que puede tener
aplicaciones ms generales. Tambin puede ser til para quienes hacen modelos
probabilsticos. Es un efecto curioso, antiintuitivo, y conviene que tengan en la ca-
beza que puede ocurrir eso. Tienes dos cosas negativas y, si las juntas, piensas in-
tuitivamente que tambin va a ser negativo el resultado. Pero puede no ser as. Los
juegos te dicen existe esto, ten cuidado.
CONLOSPIES
ENLATIERRA La paradoja de Parrondo
La paradoja de Parrondo
Tenemos dos juegos (A y B) y sus conbinaciones. Una dinmica que es
desfavorable (1 y 2) contiene ciertos elementos favorables. Al combinarse
con otra dinmica desfavorable, sta puede reforzar
la influencia de esos elementos favorables, dando lugar
a una dinmica global favorable (3, 4, 5 y 6).
Manera de jugar.
3 veces el juego A
y 2 el juego B
2 veces el juego A
y 2 el juego B
Aleatoriamente
A y B
4 veces el juego A
y 4 el juego B
Slo el juego A
Slo el juego B
2,0
1,5
1,0
0,5
0
0,5
1,0
1,5
0 20 40 60 80 100
EL PAS
1
6
5
4
3
2
Juegos jugados
V
i
c
t
o
r
i
a
D
e
r
r
o
t
a
18 Bloque I. Introduccin al estudio del desarrollo humano
Sinentrarentodoslosdetallesdelosestudiosllevadosacaboporelgrupodeinves-
tigacin de E. Thelen, su explicacin al proceso de desarrollo de la marcha es sta: la
habilidaddeandaresunaconductamultidimensionalqueseproduceporlainteraccin
de un conjunto de componentes: la conducta motriz que tienen los recin nacidos, la
fuerzamuscularparamantenerseerguidoysostenerelpesocorporalfrentealagravedad,
las caractersticas de las superfcies sobre las que apoyarse, etc. De la interrelacin de
todos estos componentes emerge la posibilidad de caminar que, aunque se produce en
todoslosniosconundesarrollonormal,tambinestsujetaamltiplesvariacionesy
diferenciasindividuales.
Enesencia,lapropuestageneraldelosmodelosdinmicosaplicadaalestudiodela
PsicologaEvolutivanoesotraqueladeexplicarloscambiosqueseobservanenelde-
sarrollohumanoylasnuevasconductasqueemergenapartirdeotrasmselementales.
La tarea no es tanto explicar cmo el todo puede emerger a partir de las piezas que lo
componen, sino entender cmo las distintas piezas se relacionan e interactan para dar
lugar a las conductas ms complejas. En este sentido, los modelos dinmicos no estn
tanalejadosdelaspropuestasdelosdosautoresclsicosporexcelenciaenPsicologadel
Desarrollo,J.PiagetyL.S.Vygotski,delosquenosocuparemosenlosdossiguientes
captulos.
Lecturas complementarias
Delval,J.(1994).El desarrollo humano.Madrid:SigloXXI.
Richardson,K.(2001).Modelos de desarrollo cognitivo.Madrid:AlianzaEditorial.
Enesco,I.(2003).El desarrollo del beb. Cognicin, emocin y afectividad.Madrid:AlianzaEdi-
torial.
Garca,R.(2006).Sistemas complejos. Conceptos, mtodo y fundamentacin epistemolgica de la
investigacin interdisciplinaria.Barcelona:Gedisa.
Actividades
1. Aplicando teoras
Imaginemos una persona ciega de nacimiento. Su problema no es cerebral. Tiene una
serie de lesiones oculares que en el momento de nacer no tienen posible cura. Sin em-
bargo, cuando llega a la vida adulta las tcnicas han avanzado lo suciente como para
permitir que tras una intervencin de ciruga ocular recobre la capacidad de ver. Qu
dira un racionalista innatista, un asociacionista ambientalista y un constructivista sobre
la experiencia visual de la persona ciega despus de la operacin?
Se considera que las personas no tenemos memoria autobiogrca sobre los dos
primeros aos de vida. Sin embargo, un clebre personaje ruso estudiado por el psic-
logo Luria deca conservar recuerdos de su etapa preverbal: Todava no haba cumplido
el ao. Aparece en mi memoria muy claramente el ambiente. Mi mam me saca de mi
cama y me pone boca abajo. Yo siento el movimiento. Tengo una sensacin de calor
agradable y otra desagradable de fro. Recuerdo brillantemente la luz. En el da era as,
despus as. Era el crepsculo, luego, la luz de la lmpara se volva as. Por qu
esta experiencia es tan poco corriente? Qu nos ensea sobre los orgenes mentales
Captulo 1. Los fundamentos de la Psicologa del Desarrollo 19
del ser humano? Este caso qu expectativas viola de cada uno de los enfoques tericos
considerados?
El lsofo e historiador de la ciencia Rusell Hanson crea que toda experiencia est
cargada de teora. Y lo explicaba as: El nio y el profano pueden ver: ellos no son
ciegos. Pero ellos no pueden ver lo que ve el fsico: ellos son ciegos con respecto a lo
que ste ve. Nosotros podemos no or que el oboe est desanado, aunque esto sea
dolorosamente obvio para un msico. Hay un nmero indenidamente grande de ma-
neras de ver constelaciones de lneas, formas, manchas. Comente este texto desde el
punto de vista racionalista, empirista y constructivista.
2. Qu tienen en comn las siguientes explicaciones?
Psicoanlisis. Cmo sabemos que este nio tiene el complejo de Edipo? Porque odia
a su padre. Por qu este nio odia a su padre? Porque tiene el complejo de Edipo.
Teora de Piaget. Por qu este nio no comprende que cuando una bola de plasti-
lina cambia de forma no cambia, sin embargo, la cantidad de plastilina? Porque no ha
adquirido el esquema lgico de la reversibilidad. Cmo puedo saber si un nio ha ad-
quirido el esquema lgico de la reversibilidad? Si declara que la cantidad de plastilina
no cambia aunque cambiemos la forma de la plastilina.
Teora de la evolucin por seleccin natural. Por qu ha surgido evolutivamente
esta especie natural? Porque ha sido seleccionada por la naturaleza. Cmo puedo sa-
ber si una determinada especie ser seleccionada por la naturaleza? Si se da en la na-
turaleza es que ha sido seleccionada por la naturaleza.
Teora marxista. Cmo podemos entender cualquier fenmeno social, cultural o
ideolgico? Todo fenmeno histrico es la expresin de las relaciones de poder econ-
mico que se dan en la sociedad. Qu tipo de ideas, valores, leyes, costumbres, institu-
ciones promover una sociedad con unas determinadas relaciones de poder econmico?
Aqullas que apuntalen, justiquen y deendan el poder econmico vigente y sus pro-
pios privilegios.
Soluciones a las actividades
1. Aplicando teoras
El racionalista innatista podra decir que al recuperar su capacidad de ver la persona
anteriormente ciega vera aunque, quizs, con alguna leve dicultad al principio pero
subsanable en poco tiempo. El asociacionista, ambientalista o empirista dira que la
persona ciega tendra que aprender a ver, pasando por un proceso semejante al de una
persona vidente desde el nacimiento. Tendra, por ejemplo, que aprender a asociar la
forma elefante con el concepto elefante. El constructivista dira que la persona se
encontrara en un caos de sensaciones a las que no podra dar ninguna interpretacin.
Al no haber percepcin pura, ni cognicin pura, pues lo que vemos es una construccin
entre nuestras formas intelectuales a priori y los estmulos de la realidad, el proceso
sera largo y costoso. Adems el constructivista mantiene que el conocimiento de cual-
quier tipo no es una mera asociacin entre estmulos.
Lo que ocurre en realidad se parece bastante a lo que dira un constructivista. Pero
es todava ms dramtico. La persona sufre un inerno de estmulos sin sentido y pre-
20 Bloque I. Introduccin al estudio del desarrollo humano
ere volver a su estado de ceguera. Eso no le pasa a alguien que nace vidente, pero que
por un accidente desgraciado deja de ver.
Es un caso rigurosamente documentado y able. Luria fue un psiclogo, discpulo
de Vygotski, de la mxima solvencia. Estos recuerdos sensoriomotores de los que
ninguno guardamos memoria pondran de maniesto que no venimos al mundo vacos
o con la mente en blanco. Nuestra vida mental no es una tabla rasa ni una pgina en
blanco sobre la que el medio ambiente escribe. Nuestra mente est ya estructurada de
una determinada manera porque el desarrollo ya tiene lugar en el seno materno. Este
caso tambin plantea los lmites de nuestro conocimiento sobre la naturaleza del desa-
rrollo humano desde el punto de vista individual. Podemos dar cuenta, tan slo, de las
lneas generales.
El racionalista clsico considera que hay una separacin tajante entre, por una par-
te, los hechos, los datos de la experiencia y, por otra, las teoras, las leyes, los principios.
Eso quiere decir que para el racionalista los hechos permanecen, son los mismos para
todos, mientras que las teoras pueden variar. Un racionalista antiguo cuando ve una
puesta de sol, cree que el sol gira en torno a la tierra. Un racionalista moderno ve la
misma puesta de sol pero cree que el movimiento del sol es aparente y que lo que se
mueve es la tierra en torno al sol. El asociacionista, por su parte, cree que las teoras
son generalizaciones o procesos inductivos que se producen a partir de los datos sen-
soriales. No cree que las teoras o las concepciones previas orienten nuestra bsqueda
de la verdad. Sostiene que hay hechos puros que deben asociarse o encadenarse a otros
hechos todas las veces que haga falta para llegar as al conocimiento adecuado. El cons-
tructivista cree que no hay hechos puros ni teoras puras. Todo est entremezclado. Los
hechos ya estn cargados de teoras, o de concepciones previas, y las teoras surgen a
lomos de los hechos.
2. Qu tienen en comn las siguientes explicaciones?
Todos son ejemplos de explicaciones circulares o tautolgicas. En la ciencia hay que
evitarlas porque tan slo aparentemente explican los fenmenos. Para ver que en
la verdadera ciencia no se dan este tipo de explicaciones pensemos en el caso de una
enfermedad muy grave ante la cual los investigadores razonaran de este modo. Por
qu esta persona tiene estos determinados sntomas en la piel? Porque tiene el virus X.
Cmo podemos saber si una persona tiene ese virus? Porque tiene esos sntomas en
su piel. En la ciencia verdadera hay que encontrar el virus. No vale ampararse para ex-
plicar algo en, precisamente, lo que hay que explicar. El crculo vicioso slo lo puede
romper la evidencia de que hay un virus que produce esos sntomas y que, incluso, pu-
diera estar el virus en el cuerpo y no aparecer, por lo que sea, los sntomas. El virus no
slo explica de verdad los sntomas sino que permite predecir lo que ocurrir en el cuer-
po de la persona infectada que aparentemente est libre del virus porque no muestra
los sntomas cuando el virus haga su trabajo, aunque de momento no se haya
manifestado. La diferencia entre un programa cientco y un programa metafsico estri-
ba en que en la ciencia se va a las causas de los fenmenos y en la metafsica tan slo
se aventuran interpretaciones de los fenmenos ms o menos verosmiles. Las explica-
ciones circulares se autoprotegen, se blindan, se fortican contra todo intento de refu-
tacin. La verdadera ciencia tiene que ser capaz de proponer su propia refutacin. No
parece ser ese el caso ni del darwinismo simple, ni del marxismo estricto, ni del psicoa-
nlisis ortodoxo ni de algunas propuestas no de todas piagetianas. Sin embargo,
a pesar de todo, qu grande es su atractivo!
Principales teoras sobre
el desarrollo (I): la teora
de J. Piaget
21
2
SONIA MARISCAL ALTARES
MARTA GIMNEZ-DAS
Esquema resumen
Objetivos
Introduccin
1. Sobre la biografa de Jean Piaget: juventud y formacin
2. Principales conceptos de la teora piagetiana
2.1. Los factores del desarrollo
2.2. Los mecanismos del desarrollo
2.3. El concepto de esquema
3. Los perodos del desarrollo
3.1. Caractersticas generales
3.1.1. El concepto de operacin mental
3.1.2. La diferencia entre el pensamiento concreto y el pensamiento
formal
4. Algunas crticas a la teora de Piaget
4.1. El concepto de perodo del desarrollo
4.2. La universalidad de los perodos del desarrollo
5. Implicaciones de la teora de Piaget sobre el desarrollo social y la educacin
Lecturas complementarias
Actividades
Soluciones a las actividades
22 Bloque I. Introduccin al estudio del desarrollo humano
Esquema resumen
1. Sobre la biografa de Jean Piaget: juventud y formacin
El clima intelectual que vivi Piaget durante su infancia y juventud inuy enormemen-
te en el desarrollo de su teora sobre la construccin del conocimiento.
Su formacin biolgica junto con sus intereses epistemolgicos dieron lugar a la
Epistemologa Gentica: la explicacin del conocimiento a partir de su gnesis y poste-
rior evolucin.
2. Principales conceptos de la teora piagetiana
La adaptacin al medio es el principal motor del desarrollo, tanto biolgico como inte-
lectual. En este proceso de adaptacin el sujeto asume un papel activo; no slo percibe
y reacciona ante los objetos del medio, sino que acta sobre ellos, los transforma y a su
vez se transforma.
Los factores que explican la construccin del conocimiento son la maduracin bio-
lgica, la interaccin con el mundo fsico y social y la equilibracin.
A pesar del nfasis en la construccin activa del conocimiento, Piaget reconoce el
importante papel de los condicionantes heredados. Denomin invariantes estructurales
y funcionales a dichos condicionantes.
Los invariantes funcionales la asimilacin y la acomodacin permiten la adap-
tacin y son mecanismos que se complementan mutuamente.
El concepto de esquema es central en la teora de Piaget. Constituye la unidad psi-
colgica bsica de funcionamiento. Los esquemas cambian y se reorganizan durante el
desarrollo mediante la asimilacin y acomodacin.
La asimilacin se produce cuando el sujeto incorpora informacin del medio a
partir de los esquemas de los que ya dispone.
La acomodacin supone la modicacin de los esquemas previos para hacerlos
consistentes con las nuevas experiencias.
3. Los perodos del desarrollo
El desarrollo se organiza en perodos caracterizados por el empleo y la organizacin de
unos esquemas determinados.
Piaget describi tres perodos: sensoriomotor, operaciones concretas que incluye
el subperodo pre-operacional y el de operaciones formales.
El orden de adquisicin de los esquemas correspondientes a los tres perodos no
vara, aunque las edades sean slo aproximadas.
El perodo sensoriomotor supone el trnsito desde la actividad reeja hasta la cons-
truccin de los primeros esquemas de accin, la coordinacin de estos y las primeras
conductas intencionales.
El perodo preoperacional se caracteriza por la utilizacin de esquemas representa-
cionales o simblicos. El pensamiento del nio est an muy ligado a los aspectos gu-
rativos y superciales de la realidad.
El nio del perodo operatorio ya puede utilizar operaciones mentales (acciones in-
ternas y reversibles) y combinarlas, pero an es incapaz de razonar sobre aspectos ms
abstractos o alejados del aqu y ahora.
El pensamiento formal se caracteriza por un tipo de razonamiento hipottico-de-
ductivo que conlleva la capacidad de considerar e imaginar lo posible. Segn Piaget este
tipo de pensamiento constituye la cima del desarrollo de la inteligencia.
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 23
4. Algunas crticas a la teora de Piaget
A pesar de los mritos e impacto de la teora piagetiana, sta ha recibido importantes
crticas.
Las dos crticas principales se reeren a los conceptos de perodo del desarrollo y a
la universalidad de los mismos.
5. Implicaciones de la teora de Piaget sobre el desarrollo social
y la educacin
Dados los intereses especcos de Piaget sobre la explicacin del desarrollo de la inte-
ligencia, este autor no se ocup especcamente del desarrollo social, aunque recono-
ci el impacto de la interaccin social sobre la construccin de todo tipo de conoci-
miento.
El marco constructivista en el que se sita la teora de Piaget s tiene importantes
implicaciones para la educacin y para denir el papel del profesor ante el desarrollo de
nios y adolescentes.
Objetivos
Conocer la gura de Piaget y su trayectoria intelectual para poder situar sus apor-
taciones sobre el desarrollo infantil.
Asimilar los principales conceptos de la teora piagetiana. Distinguir y comparar
los factores del desarrollo y los mecanismos que lo posibilitan.
Comprender el concepto de esquema y la evolucin de los esquemas a lo largo
del desarrollo.
Obtener una visin general de los perodos del desarrollo planteados por Piaget.
Comprender y valorar algunas de las principales crticas que se le han hecho a la
teora de Piaget.
Conocer algunas implicaciones del modelo piagetiano sobre el desarrollo social y
la educacin.
Introduccin
Jean Piaget sigue siendo la fgura ms relevante que existe en el panorama terico del
desarrollocognitivo.Apesardelasnumerosascrticasqueharecibidosuteoraydelos
cambiosquesehanproducidoenlasltimasdcadas,suexplicacinacercadeldesarro-
llodelpensamientosiguesiendolamscompletayestructuradaquenuncasehayafor-
mulado en esta disciplina. En este captulo vamos a exponer de manera resumida sus
principalesaportacionestericasyalgunasdelascrticasrecibidas.Antesrealizaremos
unbreverepasoaciertosaspectosdesubiografaqueayudanaentendersuvisinsobre
eldesarrollo.
24 Bloque I. Introduccin al estudio del desarrollo humano
1. Sobre la biografa de Jean Piaget:
juventud y formacin
JeanPiagetnaciel9deagostode1896enNeuchtel,unapequeaycultaciudadsuiza
dehablafrancesa.Fueelmayordetreshermanosyelnicovarn.Supadreeraunres-
petadohistoriadorqueletransmitielgustoporelconocimientoylarefexin.Sumadre
eraunamujerexcntricaqueavecesdifcultabalanormalidaddelavidafamiliar.Este
rasgodelapersonalidaddesumadrehizo,segnreconocielpropioPiaget,queaban-
donara pronto las actividades ldicas y se dedicara a otras tareas ms serias (Piaget,
1952).Adems, la complicada relacin con su madre despert en l un inters por el
psicoanlisisylellevaosmstardeasometerseaunanlisis.
ElclimaintelectualdeNeuchtelhizomellaeneljovenPiagetyallcomenzare-
correrelcaminoqueculminaramuchotiempodespusconlaformulacindesuteora
sobreeldesarrollodelpensamiento.Alosdiezaos,PiagetempezatrabajarenelMu-
seo de Historia Natural de Neuchtel como ayudante del director, Paul Godet (Vidal,
1994).AtravsdelasexplicacionesdeGodetempezainteresarseporlosmoluscosy
aprendi a conocerlos y clasifcarlos. Paul Godet fue una fgura importantsima en la
evolucin posterior de Piaget. Este le introdujo en un mundo nuevo y le aliment una
pasin que Piaget cultivara durante muchos aos, dando como fruto su tesis doctoral
presentadaen1918.
AlostreceaosPiagetpronunciundiscursoparaingresarenelClubdelosAmigos
delaNaturaleza,queeralaramajuvenildelaSociedaddeCienciasNaturalesdeNeu-
chtel.Estassociedadeseducativas,queestabandirigidasporlaspersonalidadesacad-
micasdelaciudad,tenanunadoblemisin:porunaparteseencargabandelaformacin
tericaycientfcadelosjvenesy,porotra,deinculcarlosvaloresmoralesdelapoca.
El Club de losAmigos de la Naturaleza organizaba salidas a la montaa en las que se
observabanyrecogandatossobreciertosfenmenosbotnicosozoolgicos.Posterior-
menteseorganizabansesionesenlasquelosdiferentesmiembrosdelclubpresentaban
losresultadosmsrelevantesdesusinvestigaciones.Aunquelamayorpartedelosmiem-
bros eran adolescentes que an no tenan una formacin acadmica rigurosa, las tareas
quellevabanacaboerantomadasmuyenserioysepublicabanenlarevistadelasocie-
dad(Vidal,1994).
Figura 2.1. Jean Piaget.
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 25
ConquinceaosPiagetentraformarpartedelaSociedaddeCienciasNaturalesy
empezaestablecercontactoconalgunosdeloscientfcosmsrelevantesdelapoca
en Suiza. En este momento comenz una intensa actividad cientfca que se tradujo en
numerosaspublicacionesacercadelosmoluscosyenunprogresivodescubrimientode
otrascuestionesquemarcaranelrestodesutrayectoriaintelectual.Enlasreunionesde
la Sociedad de Ciencias Naturales se trataba a menudo cuestiones relacionadas con la
flosofaylametafsica,ascomoaspectosvinculadosconlaevolucin.Lasideassobre
latransmisindecaracteresadquiridosdeLamarck(1815-1822),laformulacindelas
leyes de Mendel que se publicaron en 1865 pero no llegaron a ser conocidas por la
comunidadcientfcahasta1900ylapublicacindeEl origen de las especiesdeDa-
rwin(1859),constituantemasdeimportantediscusinparalosnaturalistas.
A travs de estas sesiones y de su continua formacin, Piaget descubri a Henry
Bergson, uno de los flsofos que marcaron profundamente su pensamiento posterior.
Piaget adopt las ideas de Bergson sobre el conocimiento, la vida y la metafsica y se
lanzaldescubrimientodelaflosofa.Medianteestembitodeconocimientobuscaba
respuestaaunadesusmayorespreocupacionesdelapoca:cmoreconciliarsuprofun-
do sentimiento cristiano con el saber cientfco. Piaget recibi una educacin religiosa
quemarcsusinquietudesjuveniles.Comoconsecuenciadelplanteamientodeproblemas
religiososaparecieronenplenaguerramundialdosimportantespublicaciones:La misin
de la idea(1915)ylanovelaautobiogrfcaRecherche(1918).Enambasaparececomo
telndefondounaEuropadestrozadaporlaguerrayPiagetdacuentadesusprimeros
sistemastericosmezcladosconsuscrisisreligiosas.Enelmismoaodelapublicacin
deRecherche,PiagetfnalizasusestudiosuniversitariosdeCienciasNaturalesrealizados
enlaUniversidaddeNeuchtelconladefensadesutesisdoctoralsobrelavariabilidad
yclasifcacindelosmoluscos.
DespusdepasarunsemestreenlaUniversidaddeZrich,setrasladaParsdonde
trabajdurantedosaosenellaboratoriodeBinetycontinusuformacinenlaUni-
versidaddelaSorbona.DuranteesteperododetiempoPiagetestudilgicayflosofa
delacienciayseinteresporelpsicoanlisis(Harris,1997).Eltrabajoenellaboratorio
de Binet le puso en contacto, por primera vez, con nios de carne y hueso (Piaget,
1959)ylepermitiestablecerlauninentrelasformasdevidasobrelasqueyahaba
teorizadoylasformasdepensamientoreales.EnestelaboratorioPiagettenacomomi-
sinestandarizarlostestderazonamientodeBurtenunamuestradeniosfranceses.Al
pasarestaspruebas,Piagetseinteressobretodoporloserroresquecometanlosnios,
esdecir,lellamaronlaatencinlosimpedimentoscognitivosquetenanlosniospara
resolver determinadas tareas aparentemente simples para los adultos. A partir de este
momento,Piagetsededicaestudiareldesarrollodelpensamientodesdeelnacimiento
hastalaedadadulta.
En1921PiagetregresaSuizaparatrabajarcomodirectordelosproyectosdeinves-
tigacin de los alumnos del Instituto Jean Jacques Rousseau. Desde entonces, pas la
mayorpartedesuvidaenGinebradandoclases,entreotrascosas,depsicologa,socio-
logayflosofadelaciencia.En1955fundelInstitutoInternacionaldeEpistemologa
GenticaenGinebraysededicainvestigaryperfeccionarlaformulacindesuteora
hastasumuerteel16deseptiembrede1980.Durantesulargacarreraprofesionalrecibi
numerosos premios como reconocimiento fue nombrado Doctor honoris causa por
treinta y una universidades, entre ellas La Sorbona, Harvard y Cambridge. Como fruto
26 Bloque I. Introduccin al estudio del desarrollo humano
desuintensaactividad,Piagetdejunlegadodemsde50librosy500artculosyuna
teoraquesigueconstituyendolaprincipalreferenciacuandosetratadeexplicareldesa-
rrollodelconocimientohumano.
2. Principales conceptos de la teora piagetiana
Lainfuenciadelaspreocupacionespropiasdelabiologasemanifestaclaramenteenla
teoradePiagetsobreelconocimiento.Lasteorasbiolgicastienencomoobjetivoex-
plicarlaexistenciadelasdiversasformasorgnicasysuadaptacinalmedio,mientras
queelobjetivodelasteorasepistemolgicasesexplicarcmoseadaptanlasformasde
pensamientoalarealidad.Deestaforma,lamisindelasestructurasbiolgicaseinte-
lectualeseslamisma:adaptarsealmedioenelqueviven.Piagetencontrunaestrecha
relacin entre estas dos ramas del conocimiento e intent unirlas en un marco terico
comnquedenominepistemologagentica.Elobjetivoprincipaldelaepistemologa
genticaeraestudiareldesarrollodelconocimientoepistemologadesdesupropia
gnesis.Enestesentido,eltrminogenticoserefereaqualorigenyformacindel
conocimiento,asugnesis,ynoalosprincipiosbiolgicosquepuedanregularelcono-
cimiento.
Creemos que toda investigacin, en psicologa cientfca, debe partir del desarro-
llo y que la formacin de los mecanismos mentales en el nio es la que mejor
explica su naturaleza y funcionamiento en el propio adulto. La fnalidad esencial
de la psicologa del nio nos parece, pues, ligada al hecho de que sta constituye
un mtodo explicativo para la psicologa cientfca en general, con otras palabras, creemos que
procura la dimensin gentica indispensable a la solucin de todos los problemas mentales.
(Piaget,1964/1985,pp.165-166.)
LapropuestatericaelaboradaporPiagettiene,comounadesusprincipalesaporta-
ciones, el reconocimiento del carcter activo del sujeto en la elaboracin de su propio
conocimiento.Elorganismointeractaconelmedioygraciasalasaccionesquerealiza
sobre l puede conocerlo. De este modo, a travs de la accin se conectan las formas
biolgicas los organismos y las epistemolgicas el conocimiento. Para que un
organismo se desarrolle intelectualmente necesita construir y reelaborar la informacin
quecaptadelmedio,deformaqueelconocimientonuncaestaracompuestoporasocia-
cionessimplesentreelementos,niporrepeticionesycopiasidnticasdeloqueseperci-
be a travs de los sentidos. Esta postura epistemolgica, en la que el conocimiento del
mundo depende de cmo el sujeto interiorice y elabore la informacin que recibe, dio
lugar a un enfoque ya clsico dentro de las explicaciones sobre el desarrollo humano
denominadoconstructivismo.
2.1. Los factores del desarrollo
Como ya hemos visto, el constructivismo constituye una posicin intermedia entre el
innatismoyelempirismo(vase Captulo 1).Poreso,aunqueponeelnfasisenlaaccin
delpropiosujeto,intentaconciliarloselementosbsicosdecadaunadelasposturasen
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 27
unacomplejateoradeldesarrolloquepostulalaexistenciadefactoresinnatosydelme-
dio y, sobre todo, de un elemento de coordinacin. Segn la teora piagetiana existen
cuatrofactoresqueposibilitanyexplicanlaadquisicindelconocimiento.Estossonla
maduracin,lainteraccinconelmundofsico,lainteraccinsocialylaequilibra-
cin.Lamaduracinsereferealaherenciagentica,alosaspectosbiolgicosquecon-
dicionannuestroconocimientoydesarrollo.Apartirdeestaestructuraheredada,elsuje-
tocomienzaarealizaraccionessobreelmundofsicoysocial.Medianteestosdostipos
deinteraccinseponedemanifestoelpesodelaaccincomomotordeldesarrollo,es
decir, las acciones que el sujeto realiza sobre el medio fsico el mundo material y
lasinteraccionesquellevaacaboconlosdems,seconviertenenfactoresfundamentales
enlaexplicacindelconocimiento.
Porltimo,segnlateorapiagetiana,aunquelatendencianaturaldelorganismoes
elequilibrio,lainteraccinconelmedioprovocaenelorganismounaseriededesequi-
librios.Pararesolverestosdesequilibriosylograrlaadaptacin,Piagetpostulalaexis-
tencia de un cuarto mecanismo denominado equilibracin que coordina el resto de los
factores.Laequilibracinsuponeunelementodeauto-regulacindelpropiosujetoque
tiendeadotaratodoelsistemadeequilibrioparalograrlaadaptacin.Enseguidavol-
veremossobreesteasunto.
2.2. Los mecanismos del desarrollo
A pesar del nfasis que la teora piagetiana otorga a la construccin activa del conoci-
miento,comoacabamosdever,Piagetnonegelpapelquedesempealaherenciacon-
siderando la maduracin uno de los factores fundamentales de su modelo terico.As,
defnidostiposdecondicionantesheredadosdenominadosinvariantesestructuralese
invariantesfuncionales.Losinvariantesestructuralessereferenalascaractersticasque
tiene nuestro organismo principalmente nuestros sentidos y que nos imponen una
seriederestriccionesenelconocimiento.Porejemplo,nuestrossistemasvisualyauditi-
vopercibenondasdeunadeterminadalongitudyfrecuencia,locualhacequenopoda-
mosconocerdirectamentelostomos,losrayosultravioletasocmorebotanlossonidos.
Losinvariantesfuncionalessonlosmecanismosdefuncionamientoqueposeeelorganis-
moparallevaracaboesaconstruccindelconocimiento.Entrelosinvariantesfunciona-
lesseencuentranlaasimilacinylaacomodacin,doselementoscentralesenlateora
piagetianaqueexplicamosacontinuacincondetalle.Tantolosinvariantesestructurales
como los funcionales son de naturaleza biolgica y, por tanto, comunes a toda la es-
pecie.
Lacontinuainteraccindelsujetoconelmedioenelqueviveprovocadesequilibrios.
Puestoque,comoyahemosvisto,lafnalidaddelorganismoesadaptarsealmedio,sus
accionesvanaestarencaminadasaeliminarlosdesequilibriosquesurgenalinteractuar
con el medio. Por ejemplo, un beb recin nacido necesitar que su mano adopte una
posicindeterminadaparalograragarrarunsonajero.Unavezquehayaconseguidorea-
lizarestaaccin,podrcogerotrosobjetossimilaresyconocersuscaractersticas.Sola-
mente a travs de esta simple interaccin con los objetos, el beb estara empezando a
construirsuconocimientosobreelmundoyadesarrollarsuinteligencia.Sinembrago,
cuandoestemismobebpretendacogerunobjetoconunaformadiferenteporejem-
plo, una pelota tendr ante s un problema que resolver, un desequilibrio. Para re-
28 Bloque I. Introduccin al estudio del desarrollo humano
solverlonecesitaradoptarunanuevaformadeagarrequelepermitacogerlapelota,es
decir,modifcarlaposicindelosdedosparaadaptarlaaotrotipodeobjetos.Atravs
deesteejemplo,seponendemanifestolosdosmecanismosfuncionalesbsicos,alos
queantesaludimos,queinteractandeformacomplementaria:laasimilacinylaaco-
modacin.Mediantelaasimilacinelsujetopuedeintegrarconocimientosnuevosenun
esquemayacreado.Mediantelaacomodacin,elsujetopuedemodifcarlasestructuras
de conocimiento. Siguiendo el ejemplo anterior, el beb asimila informacin a una es-
tructura ya creada cuando, una vez que sabe cmo agarrar el sonajero, puede coger e
inspeccionarotrosobjetosrealizandolamismaaccin,esdecir,aplicandoelmismoes-
quema.Perorealizaunaacomodacincuandosuformadecogeryanolesirveparaaga-
rrarunnuevotipodeobjetolapelota.Enestecaso,tendrquecrearunnuevoesquema
deaccinquelepermitaalcanzarsuobjetivo.
Laasimilacinylaacomodacinsonmecanismosqueseempleanalolargodetoda
lavidaparaconstruirelconocimiento.Igualquelosbebs,losniosylosadultoscon-
tinanasimilandoyacomodandoesquemas.Losadultostenemosteorasimplcitassobre
cmofuncionaelmundo,esdecir,construimosesquemasquenosayudanacomprender,
predeciryactuar.Porejemplo,tenemosciertasideasacercadelcomportamientodelos
objetosennuestromediosupeso,sucada,etc.quenosayudanaactuardeforma
adecuada.Sinembargo,endeterminadascircunstanciasnuestrasprediccionesfallan.As,
determinadosobjetosnocaensinoquefotanenelaguayfueradenuestraatmsferatodo
quedasuspendidoenelaire.Cuandonosencontramosconelementosquenoencajancon
lasteorasqueyatenemosnosencontramos,igualquelosbebs,anteundesequilibrioy
pararesolverloponemosenmarchalosmismosmecanismosconlosquecuentanlosre-
cinnacidos.Tendremosqueasimilarlanuevainformacinacomodandonuestrosviejos
esquemas.Entonces,existealgunadiferenciaentreelpensamientoinfantilyelpensa-
mientoadulto?Evidentementes,pero,segnPiaget,estanoseencuentraenelpropio
mecanismodeconstruccindelconocimiento,sinoeneltipodeoperacionesquelossu-
jetossoncapacesderealizarylaorganizacinqueimponenalpropioconocimiento.
2.3. El concepto de esquema
Paraentendermejorlosconceptosdeasimilacinyacomodacinhayquerelacionarlos
con el concepto de esquema. Para Piaget los esquemas son las unidades psicolgicas
bsicas de funcionamiento. El conocimiento est organizado en esquemas que con el
desarrollo se pueden modifcar, combinar, reorganizar o coordinar. En cada uno de los
perodosdeldesarrolloseconstruyenesquemasdeconocimientodiferentes.As,losre-
cin nacidos vienen dotados nicamente con una serie de esquemas refejos, como la
succinolaprensin,quelespermitenrealizaraccionessimplessobrelosobjetos.Ms
tardepodrncoordinarestassecuenciasdeaccionesyconstruirnlosprimerosesquemas
simples,denominadosesquemasdeaccin.Porejemplo,elbebqueantesqueracoger
unsonajerovienealmundoconelesquemarefejodeprensinypodrrealizarlaaccin
decogersinqueseanecesariouncontrolvoluntario.Sinembargo,abasedecogerpodr
encadenarlasdiferentesaccionesquerealizacuandocogealgolaposicindelosdi-
ferentesdedos,lapresinquerealizacadaunodeellos,etc.enunesquemadeaccin
controladodeformavoluntaria,apartirdelcualpodrempezaraasimilarnuevainfor-
macinyacomodarsupropioesquemadeaccin.
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 29
Laaccinsobrelosobjetoseslanicafuentedeconocimientoposibleparalosbebs
y, de acuerdo con esto, los esquemas les permiten organizar el conocimiento que van
adquiriendo a partir de las acciones que realizan sobre los objetos. Ms tarde, hacia el
ao y medio aproximadamente, los sujetos podrn construir otro tipo de esquemas que
sedenominanesquemasrepresentacionales.Estoocurrecuandolosniossoncapaces
deformarrepresentacionesmentales(vanse Captulos 5 y 8).Alolargodeldesarrollo,
se van creando esquemas cada vez ms complejos y abstractos de forma que el pensa-
mientotambinsevahaciendocadavezmscomplejoyabstracto.Elnivelintelectual
deunapersonadependerdelnmerodeesquemasquehayaconstruido,desunaturale-
zaydecmolosorganiceycombine.Mediantelaconstruccindeesquemasdeconoci-
mientoPiagetconsigueenlazarlosrefejosconelpensamientoabstracto.Esdecir,ape-
landoalosmismosmecanismos,creaunaformulacinquepartedeelementostansimples
comolosrefejosylaaccinsobrelosobjetos,peroqueterminaexplicandocmosurgen
las formas ms sofsticadas del pensamiento adulto. Esta unin constituye, entre otras,
unadelasgenialesaportacionesdePiaget.
La inteligencia verbal o refexiva reposa sobre una inteligencia prctica o sen-
soriomotriz, que se apoya a su vez sobre los hbitos y asociaciones adquiridos
para combinarlos de nuevo. stos suponen, por otra parte, el sistema de los
refejos, cuya conexin con la estructura anatmica y morfolgica del organis-
mo es evidente. Por consiguiente, existe una cierta continuidad entre la inteligencia y los
procesos puramente biolgicos de morfognesis y de adaptacin al medio.(Piaget,1936/2003,
p.12.)
Cuando un organismo se encuentra ante un desequilibrio intenta en un primer mo-
mento resolverlo mediante la asimilacin, es decir, intenta incorporar la informacin
nuevaqueselepresentaaunesquemaqueyaposee.Estaes,quizs,lasolucinmenos
costosaperonosiemprefunciona.Cuandolameraasimilacindelainformacinnosir-
vepararesolverelconfictocognitivo,entonceselorganismoacomodasuesquemacrean-
dounonuevoparaquepuedaasimilardichainformacin.Aunquehaysituacionesenlas
quepredominalaasimilacinyotrasenlasquepredominalaacomodacin,sinembargo,
Figura 2.2. A partir del reejo de prensin, el beb ira acomodando y asimilando su esquema
de accin hasta que pueda coger los objetos de forma intencional.
30 Bloque I. Introduccin al estudio del desarrollo humano
ambosmecanismossedandeformasimultnea.Porunaparte,cuandoseasimilainfor-
macinnuevasueleproducirsealavezciertaacomodacindelosesquemasdeconoci-
mientoy,porotra,cuandoseacomodanlosesquemasdeconocimiento,alavez,seest
asimilandoinformacinnueva.Aspues,sepuededecirquelaasimilacinylaacomo-
dacintrabajandeformaconjuntapararesolverdesequilibriosylograrlaadaptacindel
organismo.EnpalabrasdelpropioPiaget:
La asimilacin jams puede ser pura, porque al incorporar los elementos nuevos
a los esquemas anteriores, la inteligencia modifca sin cesar estos ltimos para
ajustarlos a los datos nuevos. Pero, a la inversa, las cosas jams son conocidas
en s mismas, puesto que este trabajo de acomodacin no es nunca posible ms
que en funcin del proceso inverso de asimilacin.(bid,p.17.)
El desarrollo se concibe, segn Piaget, como una sucesin de diferentes estadios o
perodoscaracterizadosporelempleoylaorganizacindeunosesquemasdeterminados.
Piagetdescribitresperodos:elsensoriomotor,eloperatorioconcretoyelformal.Estos
perodosrespondenadiferentesformasdeorganizacinmental,utilizanunasestructuras
generalesdepensamientoysonmomentosdeequilibrioenlosqueelsujetoutilizaesas
estructurascognitivas.Entreunosperodosyotroshaydiferenciascualitativas,esdecir,
eltipodeestructurasqueseempleanenunosyotrossoncualitativamentediferentes.As,
lasestructurasqueseutilizanencadaunoimponenunadeterminadavisinsobreelmun-
do,unaformaparticularderelacionarseconlyunacomprensinsobrelascosascuali-
tativamente diferente. Por ejemplo, durante el perodo sensoriomotor el sujeto emplea
esquemasdeaccinyserelacionaconelmundoapartirdeestaestructuracognitiva.Los
niosdeestasedadesnotienenunavisindelmundoentrminosabstractos,puesto
quenopuedenmanejaresetipodeesquemasdeconocimiento.Alcontrario,losadultos
manejamosesquemasrepresentacionalesycuandoalcanzamoselperodoformalpode-
mos,entreotrascosas,razonaracercadehiptesis.Lautilizacindeestetipodeesque-
masnosabreaunmundodiferenteynosofreceunavisincompletamentedistintaque
los nios pequeos no pueden tener. Segn esta teora, no es slo la acumulacin del
conocimientoloquenoshaceentenderelmundodeunaformadeterminada,sinoprinci-
palmente, el tipo de estructura mental que utilicemos para analizarlo. A continuacin
describimoslosrasgostpicosdecadaunodelosperodosdeldesarrolloylasvisiones
particularesdelmundoalasquedanlugar.
3. Los perodos del desarrollo
Comodestacbamosenelapartadoanterior,lagenialidaddelateorapiagetianaradica
enrelacionarlosrefejosdelrecinnacidoconlainteligencialgica,atravsdeunateo-
raquepretendeexplicareldesarrollodelainteligenciahumana.Esdecir,paralateora
dePiagetexisteunaverdaderainteligenciapreviaalaaparicindellenguajeydelpen-
samientolgico.O,dichodeotramanera,eltipodepensamientoquecaracterizaalser
humanoadultohundesusracesenlaaccin;primeroenlosrefejosconlosqueviene
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 31
equipadoelrecinnacidoy,msadelante,enlasprimerasaccionesintencionalesdelbeb
humano,menorde2aos(Figura2.3).
LateoradePiagetsearticulaentornoatresestadiosevolutivosoestructurascuali-
tativamente distintos. Cada uno de ellos supone una forma diferente de aproximarse y
entender el mundo. En concreto, Piaget distingue tres perodos principales: el perodo
sensoriomotor, el perodo de operaciones concretas (dividido, a su vez, en perodo
preoperatorio y operatorio concreto, propiamente dicho) y perodo de las operaciones
formales.
Tabla 2.1. La teora de Piaget: perodos del desarrollo de la inteligencia
Perodo del desarrollo Edades aproximadas
Perodosensoriomotor Delnacimientohastalos2aos
Perododeoperacionesconcretas:
Perodopreoperatorio
Operacionesconcretas
De2a5/6aos
De5/6aoshastaadolescencia
Perododeoperacionesformales Desdelaadolescencia(11/12aos)
Tal y como aparece en la tabla anterior, las edades que se corresponden con cada
perodosonsloaproximadas.Algunosniospuedenpasardeunperodoaotroantesde
lomarcadoenesosmrgenesdeedad,sinembargo,loimportanteesquelasecuenciadel
desarrolloessiemprelamisma.Todoslosnios,ensudesarrollointelectual,handepa-
sarsegnPiagetporlostresperodosanteriormentereseados.Esdecir,elpensamiento
sensoriomotor,porejemplo,siempredesembocaenelperodopreoperatorio;ningnnio
podrasaltardelperodopreoperatorioaldeoperacionesformales,sinhaberatravesa-
dolafasedeoperacionesconcretas.Endefnitiva,elordendeadquisicindelasdistin-
tas habilidades intelectuales sensoriomotriz, operacional concreta y operacional for-
maleslobsicoenelesquemapiagetiano,nolaedad.
Porotraparte,comoanticipbamosalcomienzodeesteepgrafe,cadaperodoposee
unconjuntoderasgosyunaestructuraquelodefne.Adems,loslogrospropiosdeun
estadioseintegranenelsiguiente,alavezquesesuperan;esdecir,losperodosdelde-
sarrollodelainteligenciatienenuncarcterintegrador.Piagetdecidiutilizarellengua-
Recin nacido: reflejos Adolescente: inteligencia lgica
Figura 2.3. El desarrollo de la inteligencia por J. Piaget.
32 Bloque I. Introduccin al estudio del desarrollo humano
je matemtico para caracterizar la estructura subyacente a cada perodo, pero en esta
introduccinalateoraevitaremosestaterminologa.Elalumnodebeconocernicamen-
te las principales caractersticas que cada perodo imprime al tipo de relacin del nio
conlarealidadcircundante.
Comosealbamosantes,elprincipalrasgodelateoradePiageteslacontinuidad
entrelosdistintosperodos,msalldelasedadesenquesesitecadauno.Sinembargo,
lointeresanteespoderexplicarqucambiadeperodoaperodo.Esdecir,latransicin
deunperodoalsiguientesuponelaaparicindecaractersticascualitativamentediferen-
tes, y por tanto, de discontinuidades en el desarrollo. La teora piagetiana pretende dar
cuentadeestasdosdimensionesoaspectosinextricablementeunidosaldesarrollo,lasdi-
mensionesdecontinuidadydiscontinuidadentrelosperodosdiferenciadosporesteautor
ensuteoradeldesarrollodelconocimiento.EnlosCaptulos5,8,11y14seirndeta-
llandolascaractersticasconcretasdeestosperodosevolutivos.Acontinuacinvamosa
presentarlosbrevementeensuconjuntoyadescribirsuscaractersticasmsimportantes.
3.1. Caractersticas generales
RecordandoelcontenidodelaTabla2.1,soncuatrolosperodosdescritosporPiageten
su modelo sobre el desarrollo de la inteligencia: el primero, el perodo sensoriomotor,
constituyeunviajeevolutivoqueconducealbebhumanodesdelaactividadrefeja,
conlaquevieneequipadotrassunacimiento,hastalaconductaintencionalmstem-
pranaylacapacidadsimblica.Veamosaqunosreferimosconalgomsendetalle.
Elbebrecinnacidoposeeunaseriedeconductasfjasquenodependendelaex-
periencia, son los denominados refejos del recin nacido (vanse Captulos 4 y 5).
Estasconductasrefejassevanmodifcandoyadaptandoalolargodelosprimerosmeses
devidamediantelaaplicacindelosmecanismosdeasimilacinyacomodacin.Loque
enprincipiosonhabilidadesinnatasinternassevanmodifcando,adaptndosealascon-
diciones externas. De este modo se van construyendo esquemas de accin que van ha-
cindose ms complejos a medida que avanza el perodo sensoriomotor. Este perodo
culminaentornoalos18-24mesescuandoelbebpasadeutilizarlosmencionadoses-
quemasdeaccinexternaaemplearnuevosmedios,internos,paraconseguirlosfnesque
sepropone.Esdecir,elbebpuedecomenzarausarrepresentacionesmentalesosm-
bolos.EnelCaptulo5sedetallarnlasdistintasfasesoestadiosquecomponenelpe-
rodosensoriomotoryelcambiocualitativotanimportantequesuponelaconstruccinde
lacapacidadsimblica,quedapasoalperodosiguiente,eldeoperacionescon cretas.
Msadelanteseexplicaendetalleenquconsisteelpensamientooperatorio(vase
Captulo 8).Aquslosealaremos,amododeintroduccin,culessonlosprincipales
rasgosdelmododefuncionamientointelectualdelosniosentrelos2y7aosaproxi-
madamente.Paraelloesnecesarioexplicarquesunaoperacinmental.
3.1.1. El concepto de operacin mental
Piagetdefniunaoperacinmentalcomounaaccininternaquepermitealsujetorea-
lizartransformacionesmentalesconlosobjetosseanestosdeltipoquesean,como
por ejemplo, reordenarlos, combinarlos, invertirlos etc. Es evidente que la capacidad
simblicaorepresentacionalesunrequisitonecesarioparapoderllevaracabooperacio-
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 33
nesmentales,dadoelcarcterinternodeestas.Porotraparte,paraPiagetelconceptode
operacinmentalestligadoalanocindereversibilidad,unconceptopropiodellen-
guajematemticoqueimpregnagranpartedelaformulacintericapiagetiana.
Una accin es reversible cuando puede volver a su estado o condicin inicial. Por
ejemplo,sitomamosunaboladeplastilinaycambiamossuformaredondeadaporotra
alargada,tendremoslamismacantidaddeestasustanciaenlosdosestadosypodremos
volveratransformarcuantasvecesqueramoslaformadeestacantidaddemateria.Para
Piagetunaoperacinmentalesunaaccinquecombinalasdospropiedadesqueacaba-
mosdemencionar;es,portanto,accininteriorizadayreversible.
Siguiendoelejemploqueponamosanteriormente,cuandounnioescapazdeantici-
parydereconocerqueunaboladeplastilinasigueteniendolamismacantidaddemateria
adoptestaunaformaredondeada,setransformeenunasalchichaalargadaosedivida
enpequeostrocitos,entoncesesunnioqueestmanejandooperacionesmentales;esun
niooperatorio,capazdemanejaraccionesbasadasenrelacioneslgicasentrelosfen-
menos,nobasadasenaspectossuperfcialesodependientesdelaaparienciaexterna.
Sinembargo,elabandonodelperodosensoriomotornoconducedirectamenteal
nio de aproximadamente 2 aos al pensamiento de tipo operatorio que acabamos de
defnir.Piagetanalizdetenidamenteeltipodepensamientoquesubyacaalasactivida-
des de los nios entre 3 y 6 aos y encontr una serie de limitaciones en su modo de
razonar,quelosalejabandelosrequisitosdelpensamientooperatorio.Poresoestableci
ladiferenciaentreunsubperodopreoperatorio(2a6/7aos)yeldeoperacionescon-
cretas propiamente dichas (6/7 a 11/12 aos aproximadamente). El nio del perodo
preoperatorioesunnioanatrapadoporlosrasgossuperfcialesoperceptivosdela
realidad,loquelimitamuchoeltipoderazonamientosqueescapazdehacer.
Si utilizamos nociones propias de la Psicologa del Pensamiento y de la Lgica en
general, podemos decir que el nio preoperatorio no puede utilizar an plenamente un
razonamientodetipoinductivoquevadeloparticularalogeneral,ypermitegene-
ralizar a partir de una serie de hechos que comparten un conjunto de caractersticas o
propiedades,nidetipodeductivovadelogeneralaloparticular,ypermiteatribuir
a hechos particulares caractersticas de la generalidad a la que pertenecen, sino que
utilizaunrazonamientodetipotransductivo,queestablecerelacionesentreloparticular
yloparticular.
Imaginemos la siguiente situacin: se va la luz y un padre trae velas; al rato su hijo en-
ciende el interruptor y, casualmente, vuelve la luz. Otro da ocurre lo mismo, pero al
tocar de nuevo el interruptor la luz no vuelve. Ante esta situacin un nio operatorio
puede sorprenderse inicialmente, para luego establecer la falta de relacin entre uno y
otro hecho. Puede darse cuenta de que la primera vez la accin de tocar el interruptor
fue independiente o se relacion casualmente con la aparicin de la luz. Contrariamen-
te, el nio preoperatorio no se sorprende ante la diferencia entre las dos situaciones; no
establece nexos causales, ya que para l ambas situaciones o circunstancias pueden
coexistir sin ms (adaptado de Corral y Pardo, 1997).
CONLOSPIES
ENLATIERRA
Un ejemplo de razonamiento
de tipo transductivo
34 Bloque I. Introduccin al estudio del desarrollo humano
Sin entrar en ms detalles, el pensamiento que caracteriza al nio preoperatorio es
andetipoprelgico,intuitivoofgurativo.Apartirdelos6o7aos,sinembargo,se
apreciauncambiocualitativoimportanteenlaactividadintelectualyderazonamientode
los nios. Estos comienzan a resolver un conjunto de tareas que interesaron mucho a
Piaget:tareasdeconservacin,deseriacin,deinclusindeclases,declasifcacin,etc.
Nonosdetendremosahoraenellas,tanslosealaremosqueestetipodetareasrequieren
lautilizacindeoperacionesmentalesenlostrminosdefnidosanteriormente.
Para concluir el viaje evolutivo por la teora piagetiana, es necesario plantearse el
siguienteinterrogante:sielniode6o7aosyaescapazderealizaroperacionesmen-
tales,qulediferenciadeladolescente?Haciadndeevolucionaeldesarrollointelec-
tual a partir de este momento? Estas preguntas nos conducen al establecimiento de las
diferencias entre el pensamiento operatorio y del de tipo formal, que ya constituye un
perododistinto,lacimadeldesarrollodelainteligenciaparaPiaget.
3.1.2. La diferencia entre el pensamiento concreto y el pensamiento formal
Simplementedetenindonosenlaterminologautilizadaporelautorginebrinopensa-
mientoconcretofrenteapensamientoformalpodemosatisbarunaprimerarespuestaa
lacuestindelasdiferenciasentreambosperodos.Elpensamientopropiodelniode
6/7 a 11/12 aos an est demasiado ligado a los aspectos concretos de la realidad, y
necesitaliberarsedeestaligazn,hacersemsabstractooformal.Elniodelperodo
deoperacionesconcretassloescapazdepensarsobrelosaspectosdeunproblematal
ycomoselepresentan;seplanteaslocuestionesrelativasalosdatosconcretos,presen-
tesoreales,sinsercapazandeconcebirloposible.Enalgncasopodrallegaracon-
Como acabamos de ver, Piaget elabor una teora sobre el desarrollo del pensamiento
principalmente a partir de las numerosas entrevistas y dilogos que mantuvo con nios
y adolescentes. Para llevar a cabo sus investigaciones Piaget invent un sistema propio
de indagacin que denomin mtodo clnico-crtico aunque nos solemos referir a l
como mtodo clnico. Mediante esta forma de trabajar, Piaget planteaba unas veces
problemas concretos que los sujetos deban resolver y otras simples cuestiones acerca
del mundo. A travs de las respuestas de los nios, Piaget intentaba averiguar hasta qu
punto sus creencias o sus formas de pensamiento eran slidas. Para ello empleaba las
denominadas contrasugerencias, que eran argumentos contradictorios con la respuesta
ofrecida por el nio. Si ante estas refutaciones los nios mantenan sus respuestas ori-
ginales justicando an ms su postura, Piaget conclua que su sistema de pensamien-
to estaba bien establecido. Al contrario, si los nios o adolescentes cambiaban de opi-
nin era porque no tenan todava clara la explicacin sobre el fenmeno estudiado. En
realidad, lo que Piaget pretenda era entablar un dilogo o una conversacin con el
sujeto a travs de la cual poder conocer sus operaciones mentales y su visin y explica-
cin del mundo. A travs de este mtodo tan particular, Piaget logr caracterizar las
visiones del mundo que elaboramos a lo largo del desarrollo.
CONLOSPIES
ENLATIERRA Cmo trabajaba Piaget?
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 35
cebir situaciones posibles adicionales, pero siempre restringidas a una prolongacin de
loreal,realizandoalgunostanteosempricos.
Podramos plantear la diferencia entre el pensamiento concreto y el formal en los
siguientestrminos:paraelprimeroloposiblesesubordinaaloreal,mientrasquepara
el segundo lo real se subordina a lo posible. Utilizaremos esta ltima caracterizacin
comopuntodepartidaparadescribirelperododeoperacionesformales(vase Captu-
lo 14).Finalizaremosesteepgrafeconlasiguientefguraquepretendeserunresumen
grfcodelmodelodedesarrollopropuestoporPiaget.
Reflejos
y acciones
Capacidad
simblica
Operaciones
Razonamiento
formal
Nacimiento
a 14/18 meses
1. infancia
2 a 6/7 aos
Aos escolares:
6/7 a 11/12 aos
Adolescencia a edad adulta:
11/12 a 15/16 en adelante
Operaciones formales
Operaciones concretas
P. preoperacional
P. sensoriomotor
P
e
r

o
d
o
Tiempo
Figura 2.4. El desarrollo de la inteligencia segn la teora de Jean Piaget: un esquema grco.
4. Algunas crticas a la teora de Piaget
ApesardelagenialidaddelateoradePiaget,suobraharecibidoalolargodelosaos
numerosascrticas.Enesteapartadoresumiremoslasprincipalesparaqueellectorcom-
prenda dnde estn sus mayores debilidades.Antes de pasar a las crticas es necesario
36 Bloque I. Introduccin al estudio del desarrollo humano
sealarqueaunqueciertosaspectosfundamentalesdelateorapiagetiananoseconside-
ranhoyvlidosparaexplicareldesarrollo,siguesiendolaformulacintericamsmen-
cionaday,sobretodo,aquellaapartirdelacualsehanconstruidoelrestodelasexpli-
caciones.Enestesentido,elmarcopiagetianosigueconstituyendolaclaveparaentender
lapsicologadeldesarrolloactual.
LascrticasmsimportantesqueharecibidolateoradePiagetsereferenadosas-
pectos:porunaparte,elpropioconceptodeperododeldesarrolloy,porotra,launiver-
salidaddeesosperodos.
4.1. El concepto de perodo del desarrollo
Comohemosvistoenelapartadoanterior,elconceptodeperodoimplicaunaimportan-
te coherencia en el pensamiento. Segn Piaget, alcanzar un perodo determinado del
pensamientosignifcainterpretar,analizaryconocerlarealidaddeunamaneraparticular
quetienequeverconlasoperacionespropiasdedichoestadio.Estaconcepcinsupone
queunsujetoquehayaalcanzadounniveldeterminadoaplicarlasmismasestructuras
depensamientopararesolvercualquiertipodeproblema.Esdecir,unbebqueesten
el perodo sensoriomotor emplear estructuras de pensamiento sensoriomotrices tanto
paraatraparobjetoscomoparacomprendersuentornosocial.Asimismo,unniopreope-
ratorioentenderelmundofsicoysocial,segnPiaget,siempredesdesupropiopunto
devista,mientrasqueunnioenedadescolarhabryasuperadoestalimitacinyapli-
carlasoperacionesconcretasparasolucionarlosproblemasdematemticasenelcole-
gioojugarconsusamigos.
A pesar de la sensatez de esta idea, poco a poco, diferentes estudios fueron encon-
trando datos que no encajaban bien con este principio. Por una parte, se hall que un
mismosujetonoresolvadiferentestareasconunaestructurasimilaryquerequeranuna
mismaoperacin.Porotra,sevioquesujetosqueestabanendiferentesperodosdaban
lasmismasrespuestasadeterminadastareas.Enelprimercaso,sehabladeundesfase
horizontalyenelsegundo,deundesfasevertical.Ambostiposdedesfaseshansupues-
toungraveproblemaparaelconceptodeperododeldesarrolloylaideasubyacentede
estructuradeconjunto.Porejemplo,enrelacinalosdesfaseshorizontalesseconstat
queunmismoniopodaresolverlatareadelaconservacindelacantidadperonola
delpeso,dostareasqueenprincipiorequierendelamismaoperacin(vase Captulo 11
paraunadescripcindeestastareas).DesdeelpuntodevistadelateoradePiaget,este
datoesdifcildeexplicarpuestoquesieseniodisponeyadelasoperacionesnecesarias
paraentenderlaconservacindelacantidaddebera,igualmente,aplicarlasalaconser-
vacindelpeso.Enotraspalabras,elcontenidodelatarealacantidadoelpesono
tendra por qu infuir en el resultado si la estructura y la operacin requerida son las
mismaslacomprensindelaconservacin.Noobstante,multituddedatosmuestran
queelcontenidodelapropiatareainfuyeencmoelsujetolaresuelve.Aspues,este
tipodedesfasesponendemanifestoque,enrealidad,noactuamosdelamismamanera
cuando nos enfrentamos a tareas semejantes pero con contenidos diferentes y que, por
tanto,nosiempreaplicamoslasupuestaestructuradeconjuntoquecaracterizacadauno
delosperodos.
EstetipodecrticashizoquemuchosautoressefjaranenlaclasedetareasquePia-
gethabadiseadoparaaplicarlasconlosniosyelaborardespussuteora.Almodif-
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 37
car el contenido se encontr que, en muchas ocasiones, los nios actuaban de manera
diferentealoquePiagetsostenaresolviendolastareasaedadesmstempranas.Deeste
modo,aparecilaideadequelaactuacindeunsujetonotenaporqusersimilaren
todaslastareasdeunmismonivelyquelasoperacioneslgicasoestructurasdepensa-
mientoqueseactivanpararesolverunproblemadependendeldominioalqueelproble-
maserefera.Laposturapiagetianasehadenominadodedominiogeneralporquepos-
tulaquelasoperacionesdelpensamientoseaplicandeformageneral,esdecir,atodos
losmbitosdelpensamientoodelconocimiento.Estaotraposturaalternativaqueacaba-
mosdeexplicarsehadenominadodedominioespecfcoporquesostienequelaresolu-
cindeunproblemaounatareadependerdeculseasucontenido,esdecir,lasestruc-
turas de pensamiento se movilizarn en funcin de cul sea el contenido del problema
planteado.Segnlosenfoquesdedominioespecfco,hayproblemasqueresolvemoscon
msfacilidadporque,seguramente,tenemosmsconocimiento.As,unmatemticoex-
perto resolver mejor un problema de matemticas que uno de lengua, aunque los dos
tenganlamismacomplejidad.Chi(1978)realizunestudiocuyosresultadosilustranesta
cuestin.Escogiungrupodeniosdediezaosqueeranexpertosjugadoresdeajedrez
y compar su actuacin a la hora de jugar con un grupo de adultos pero novatos en el
juego. Como es esperable, los nios actuaron mucho mejor que los adultos, a pesar de
ser nios, simplemente porque cuando se trataba de jugar al ajedrez disponan de unas
estrategiasmselaboradasquelosadultos.Aspues,alcontrariodeloqueafrmabaPia-
get, parece posible aplicar estructuras de pensamiento ms complejas para problemas
concretossobrelosquesetieneexperienciaquenosegeneralizanalrestodelosmbitos
deconocimiento.
Lasposturasdedominioespecfcohandadolugaraunagrancantidaddeinvestiga-
ciny,demomento,constituyenunabuenaexplicacinalosdesfasesqueantesdescri-
bimos.Noobstante,muchosautorespiensanquejuntoconciertasestructurasdedominio
especfco,existentambinalgunosmecanismosdedominiogeneral.Porejemplo,Kar-
miloff-Smith(1992)hapropuestounmecanismoqueactaporigualantecualquierdo-
minioyquedeterminaelgradodesofsticacindelconocimiento.Estemecanismode-
nominado redescripcin representacional es comn a todos los mbitos pero no
impidequeseapliquedeunaformamsintensaenaquellosdominiosdeconocimiento
en los que ms profundizamos, dando lugar a estructuras de pensamiento ms com-
plejas.
4.2. La universalidad de los perodos del desarrollo
Una de las caractersticas ms importantes de los perodos, segn Piaget, es que son
universales.Estosignifcaquelosperodossesucedenentodaslaspersonas,integrn-
doseunosenotrosenunordenconstante.As,tantouneuropeocomounpigmeoatra-
vesarn los mismos estadios en el mismo orden, aunque su momento de adquisicin
pueda variar. La manera de comprobar esta hiptesis es simple: habr que comparar
individuosquepertenecenaentornosculturalesdiferentesparaversi,efectivamente,se
reconocen las mismas caractersticas en su pensamiento y el mismo orden de adquisi-
cin.
En este sentido, se han realizado multitud de estudios transculturales en los que se
aplicanlasmismastareasagruposdeniosoadultospertenecientesaentornosmuydi-
38 Bloque I. Introduccin al estudio del desarrollo humano
ferentes.Engeneral,todosestostrabajosmuestranquesibienexistendiferenciasenel
momentodeadquisicindelasoperacionesmentales,elordendesucesinesconstante
ysimilarentodoslosentornos.Asimismo,existensiemprediferenciasindividualesrela-
cionadas con el contexto pero que no anulan la idea, ms general, de los perodos del
desarrollopiagetianos.
La mayor difcultad que la universalidad de los perodos ha encontrado, tiene que
verconelperododelasoperacionesformales.Recordemosquesetratadelltimoes-
tadiopostuladoporPiaget,elmscomplejoyelquealcanzantodoslosadultos.Segn
laformulacintradicional,apartirdelosonceodoceaoslossujetosempiezanamos-
trarunpensamientoabstractoquelespermiteresolverproblemascomplejos,formular
hiptesisyverifcarlas,etc.Sinembargo,algunostrabajoshanencontradoquelasope-
raciones formales no son tan generales como Piaget pensaba. En muchos grupos de
adolescentes parece que el pensamiento formal no est todava presente y, por tanto,
fracasanalahoraderesolvertareasquenecesitandedichasoperaciones.Porejemplo,
Dulit(1972)comparlaactuacindesujetosde14,16,17,20y25aosendostareas
querequeranpensamientoformal.Enunadeellas,sloel33%delgrupodelosma-
yores, el 50% de los de 16 y 17 aos y ninguno de los ms jvenes logr resolver la
tarea.Enlaotra,losporcentajesderespuestascorrectasnosuperaronenningngrupo
el 28%. No obstante, estas mismas tareas fueron realizadas con un pequeo grupo de
adolescentesde16y17aosconaltoscocientesdeinteligenciayqueasistanaunco-
legioconungranniveldeexigencia.Enestegrupodesujetoslosporcentajesdereso-
lucin correcta fueron mucho mayores en comparacin con el resto de la muestra. En
resumen,aunquesparecequeelordenenelquesesucedenlosestadiosesconstante,
suadquisicinporlomenosenelcasodelpensamientoformalnoesautomticani
universalysenecesitanciertosrequisitosqueayudanalsujetoaalcanzaresenivelope-
racional.
Comoapuntaelestudioqueacabamosdemencionar,existenciertosaspectosligados
al entorno y la cultura que tienen repercusin en la adquisicin de las operaciones for-
males.As, la escolarizacin propia de las sociedades occidentales parece infuir en la
adquisicindeestasoperaciones,deformaquelosadultosdeotrasculturasquenohan
recibidoestetipodeentrenamientointelectualtansistemticoydemandante,nodesarro-
llanestashabilidadesdelpensamiento.DouglasyWong(1977)compararonlaactuacin
entareasformalesdeadolescenteschinosynorteamericanosde13y15aos,encontran-
doqueelgrupodelasmujereschinasde13aoseraelquepeoresresultadosobtena.
Una explicacin que tenga en cuenta el contexto en el que se desarrollan las nias en
Chinapodra,seguramente,explicaresteresultado.Igualmente,otrosautoreshancom-
parado la actuacin de adolescentes y adultos occidentales con otros pertenecientes a
sociedadesmenosdesarrolladascomoRwandaoNuevaGuinea(LaurendauyBendavid,
1977).Engeneral,estostrabajoshanencontradograndesdiferenciasentreambostipos
depoblacionesyunaescasaonulapresenciadelpensamientoformalenlossujetosper-
tenecientesasociedadesmenosdesarrolladas.
Alaluzdeestosresultadosdebemosconcluirque,alcontrariodeloqueenunprin-
cipio defendi Piaget, el pensamiento formal no es un pensamiento universal, es decir,
quenotodoslossujetosvanapoderalcanzarestetipodepensamiento.As,senecesita
queelmediosocialylaexperienciaproporcionentantolasherramientascognitivascomo
laincitacinintelectualnecesariasparapoderpensardemaneraformal.
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 39
5. Implicaciones de la teora de Piaget
sobre el desarrollo social y la educacin
OtradelascrticasfrecuentesalateoradePiagetserefereaquedichoautorsecentr
exclusivamenteenelestudiodelacognicinfra;esdecir,laimagenqueseproyecta
del nio piagetiano es la de un nio aislado en cierto modo del mundo social.Autores
comoLabouvie-Vief(1992)planteanquePiagetignor el hecho de que la realidad in-
fantil es primariamente social por naturaleza,cuandosabemosqueelapegoylasrela-
cionessocialessonaspectosfundamentalesparaeldesarrollocognitivo.
Piagettambinhasidocriticadodesdelasteorassocioculturales,comolateorade
Vygotskiysusdesarrollosposteriores,porquedesdeestasperspectivastericaselcon-
texto social es fundamental para el desarrollo de las funciones psicolgicas superiores
(vase Captulo 3). Frente a este planteamiento Piaget parece haberse centrado ms en
lasrelacionessujeto-objetoqueenlasrelacionesentreelsujetoyotrossujetos.
Anreconociendoesterelativodesdnporlainfuenciayfuncindelcontextosocial
sobreeldesarrollodelconocimiento,hayquemencionarafavordelateorapiagetia-
naquelosinteresesintelectualesdePiagettenanqueverconcuestionesepistemol-
gicascomomencionamosenlosprimerosapartadosdeestecaptulo.Enestesentido,su
modelo trataba de abarcar aquellos factores que podan ser sufcientes para explicar el
desarrollodenuevasformasdeconocimiento,ynotantolosfactoresnecesariosparaello.
Efectivamente,Piagetnoespecifcculeseranloscontextossocialesnecesariosparaque
seprodujeranlosdistintosavanceseneldesarrollo,peroesenoerasuobjetivo.Lafalta
denfasisdePiagetenlosfactoressocialessloparecerefejarculeserassuspriorida-
des a la hora de plantear su programa de investigacin, pero no puede considerarse un
dfcitdesuteoraens(Carpendale,1997).
EnalgunosescritosdePiaget(1965/1995)menosconocidos,losdenominadosEstu-
dios sociolgicos,esteautordecacosascomoquela vida mental es construida conjun-
tamente con el grupo; el conocimiento humano es esencialmente colectivo y la vida
social constituye un factor esencial en la creacin y crecimiento del conocimiento, tanto
pre-cientfco, como cientfco.
DesdeelmarcoconstructivistaenelquesesitalateoradePiaget,todoelconoci-
miento, del tipo que sea, es construido activamente por el nio a medida que acta e
interactaconlaexperiencia.Enprincipiounateoraconstructivistapodraexplicartan-
toeldesarrollodelconocimientosocialcomonosocial,puestoquelosmecanismosde
construccinseranlosmismos.Lonicoquevariaraseraelcontenidodedichoscono-
cimientos.
Esjustamenteesteaspectogeneraldelmarcopiagetianoelquehaejercidounanota-
ble infuencia sobre cmo plantear la educacin y organizar las actividades educativas.
ComonosrecuerdanLacasayGarcaMadruga(1997),elrasgoprincipaldelaconcep-
cineducativapiagetianaeslaconcepcindelalumnocomosujetoactivoqueelaborala
informacinyalhacerloprogresaenlaformacindesuspropiosesquemasdeconoci-
miento. Esta concepcin supone que el profesor o el educador tiene que fomentar este
papelactivodelaprendizyqueelpropioprocesoeducativosetienequeadecuaralnivel
alcanzadoporlosalumnosencadamomentodeldesarrollo.Enesteltimoaspecto,las
implicacionesdelateorapiagetianacoincidenparcialmenteconlasderivadasdelmode-
40 Bloque I. Introduccin al estudio del desarrollo humano
lodeVygotskiqueseabordaenelsiguientecaptulo.Enlveremoscmootrasaporta-
cionesdelautorrusodiferensignifcativamentedelmodelodedesarrollodePiagetque
hemosrevisadoensusaspectosgeneralesenestecaptulo.
Lecturas complementarias
Piaget,J.(1936).El nacimiento de la inteligencia en el nio.Barcelona:EditorialCrtica,1985.
Piaget,J.(1937).La construccin de lo real en el nio.BuenosAires:Proteo,1965.
Piaget,J.(1937).La formacin del smbolo en el nio.Mxico:FCE,1961.
Piaget,J.(1964).Seis estudios de psicologa.Barcelona:Planeta-Agostini,1985.
Inhelder,B.yPiaget,J.(1955).De la lgica del nio a la lgica del adolescente. BuenosAires:
Paids,1972.
Direcciones de Internet de inters
http://www.piaget.org.staeslapginawebquetienelaSociedad Jean Piaget.Enellasepuede
encontrarinformacinsobreelautorascomodiferentesartculossobresutrabajo.
http://www.unige.ch/piaget/. sta es la pgina de los Archivos Jean Piaget, una institucin que
dependedelaUniversidaddeGinebrayquerecogetodaslaspublicacionesdelautorjuntocon
otrostrabajosrealizadosporlaescueladeGinebra.
Actividades
1. Complete las siguientes armaciones:
De acuerdo con Piaget, .............. son estructuras psicolgicas que organizan la expe-
riencia.
El trmino ............. signica modicacin de esquemas en funcin de la experiencia del
sujeto.
El punto culminante del desarrollo sensoriomotor tiene lugar, cuando los nios comien-
zan a utilizar ..............
2. Conteste a las siguientes preguntas:
Seale cules de los siguientes elementos son en la teora de Piaget invariantes funcio-
nales:
a) La interaccin con el mundo fsico y social.
b) La asimilacin y la acomodacin.
c) Los sentidos y su progresiva maduracin.
Una de las principales crticas que se ha hecho a la teora de Piaget tiene que
ver con:
a) El orden de sucesin de los perodos del desarrollo.
b) La ausencia de desfases en los diferentes perodos.
c) La universalidad del perodo de las operaciones formales.
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 41
Cuando Piaget planteaba diferentes tareas a los nios y adolescentes para ver cmo
razonaban, utilizaba:
a) El mtodo clnico.
b) La observacin.
c) La experimentacin.
3. La inuencia del contenido y la familiaridad en el pensamiento
Como hemos visto en el ltimo apartado del captulo, una de las crticas que se le ha
hecho a la teora piagetiana tiene que ver con cmo inuye el contenido de una tarea
al razonar. Para que pueda comprobar esto, le proponemos que realice usted mismo o
a otra persona la siguiente tarea.
Presente estas cuatro tarjetas y plantee la siguiente situacin:
Aqu tiene cuatro tarjetas. Siempre que hay una letra por una cara, por la otra hay
un nmero. Teniendo esto en cuenta, debe decir qu tarjetas levantara para poder es-
tablecer si la frase en todas las tarjetas en las que hay una E en una cara, hay un 4 en
la otra es verdadera. Debe intentar resolverlo levantando el menor nmero de tarjetas
posible.
E

D

4

7
A continuacin presente estas otras cuatro tarjetas:
20

14

Vino

Leche
En este caso, las tarjetas que tienen una cifra por un lado tienen una bebida por el
otro. La regla que los sujetos deben comprobar es una persona que bebe alcohol debe
tener ms de 18 aos. Al igual que en la tarea anterior, deben vericar si la regla es
cierta levantando el menor nmero de tarjetas posibles.
Compare los resultados de ambas tareas e intente explicar los resultados. Encuen-
tra alguna diferencia en cmo razonan los sujetos ante la primera y la segunda tarea?
A qu pueden deberse estas diferencias?
42 Bloque I. Introduccin al estudio del desarrollo humano
Soluciones a las actividades
1. Armaciones
Los esquemas.
Acomodacin.
Smbolos.
2. Preguntas
Para la primera pregunta la respuesta correcta es b). La asimilacin y la acomodacin
son los dos invariables funcionales mientras que el resto de los elementos que aparecen
en las otras alternativas son factores del desarrollo (la interaccin con el mundo fsico y
social y la maduracin) o invariantes estructurales (los sentidos).
Para la segunda pregunta la respuesta correcta es c). Por una parte, el orden de
sucesin de los diferentes perodos s parece corresponderse con el que Piaget describi
y, por otra, la presencia de desfases en algunos perodos (y no la ausencia) es precisa-
mente una de las principales crticas que se le ha hecho a esta teora. Lo que no se ha
conrmado es que el perodo de las operaciones formales se alcance por todos los su-
jetos y en cualquier condicin. Al revs, se necesitan ciertos requisitos para que los
adolescentes y adultos puedan utilizar operaciones formales.
En la tercera pregunta la respuesta correcta es a). El mtodo que Piaget invent y
que utilizaba de manera sistemtica para todas sus investigaciones era el mtodo cl-
nico.
3. La inuencia del contenido y la familiaridad en el pensamiento
Para solucionar la primera tarea hay que levantar dos tarjetas: E y 7.
Por qu hay que levantar la E?
La tarjeta que contiene una E es necesario levantarla para ver si detrs hay un 4. Si
hubiera otro nmero, la frase sera falsa y habramos terminado la tarea. Si hubiera un 4,
de momento la frase sera verdadera pero no hemos terminado de comprobar que se
d en todos los casos.
Por qu hay que levantar el 7?
La tarjeta que tiene un 7 puede tener por la otra cara una E o cualquier otra letra.
Si hubiera una E tendramos que concluir que la frase es falsa y si hubiera cualquier otra
letra, tendramos que concluir que la frase es verdadera. As, necesitamos levantar esta
tarjeta porque es la nica manera que tenemos de comprobar la falsedad de la frase.
Por qu no es necesario levantar ni el 4 ni la D?
Por la otra cara del 4 puede haber una E o cualquier otra letra pero esta informacin
no es relevante para establecer la verdad o falsedad de nuestra frase, que se limita slo
al condicional si hay una E, entonces hay un 4. La mayor parte de los sujetos arman
que es necesario levantar esta tarjeta para vericar si por la otra cara hay una E pero,
en este caso, lo que se est vericando es un bicondicional del tipo siempre que hay
una E por una cara hay un 4 por la otra y siempre que hay un 4 por una cara hay una
E por la otra. Sin embargo, nuestra frase no se reere a esta doble regla y por eso, es
irrelevante la letra que haya detrs del 4. De forma automtica se asume que la frase
es bicondicional y se piensa que esta es la forma ms evidente de resolverla.
Captulo 2. Principales teoras sobre el desarrollo (I): la teora de J. Piaget 43
Igualmente, la informacin que nos proporcione la tarjeta de la D es irrelevante para
nuestra frase. Detrs de esta letra puede haber cualquier nmero pero no nos sirve para
determinar la veracidad o la falsedad de nuestra frase.
La tarea en la que hay que determinar si los menores beben alcohol es mucho ms
fcil escoger la tarjeta que tiene el 14. Parece claro que es la manera de establecer si
hay algn menor que est bebiendo alcohol luego esa tarjeta, junto con la que pone
vino, son las dos que hay que levantar para saber si la frase es verdadera o falsa. A
pesar de que ambas tareas tienen exactamente la misma estructura, la actuacin de los
sujetos es mucho mejor en la segunda. El contenido de la tarea puede, de este modo,
facilitar o dicultar la actuacin aunque la operacin que los sujetos tienen que emplear
sea la misma en ambos casos.
Principales teoras sobre
el desarrollo (II): el modelo
de L. S. Vygotski
45
3
ANTONIO CORRAL IGO
Esquema resumen
Objetivos
Introduccin
1. Sobre la biografa de Lev S. Vygotski
2. Principales conceptos de la propuesta vygotskiana
2.1. La mediacin
2.2. La ley general del desarrollo cultural o ley de la doble formacin de las
funciones psquicas superiores
2.3. El proceso de internalizacin
3. Las relaciones entre desarrollo y aprendizaje
4. EL desarrollo normal y alterado
5. Implicaciones del modelo de Vygotski sobre el desarrollo social y la educacin
Lecturas complementarias
Actividades
Soluciones a las actividades
46 Bloque I. Introduccin al estudio del desarrollo humano
Esquema resumen
Estamos ante un psiclogo del desarrollo con una fuerte formacin humanstica (habla-
ba varias lenguas, conoca muy bien la literatura clsica y tena una slida formacin
losca) que intent provocar un cambio radical en la psicologa de su tiempo. La
psicologa del desarrollo de Vygotski sita los procesos psicolgicos superiores en el
marco de la historia, de la cultura y de la sociedad. No vea el desarrollo humano desde
un punto de vista meramente individualista, sino en su contexto social, histrico y cul-
tural.
1. Sobre la biografa de Lev S. Vygotski
Vivi entre 1896 y 1934. Padeci la dictadura estalinista pero, junto con un pequeo
grupo de amigos que se consideraban discpulos suyos, logr que sus ideas traspasaran
las rejas de la crcel sovitica y llegaran a Europa y Amrica. Estuvo toda su vida muy
inuido por el pensamiento de Spinoza, del que se consideraba heredero.
2. Principales conceptos de la propuesta vygotskiana
La idea ms general en la que se basa todo su pensamiento podra cifrarse en el inten-
to de superacin de todo tipo de dualismo y en el logro de una sntesis adecuada entre
descripcin (materialista y concreta) y explicacin (interna, social, cultural e histrica).
La mediacin
Todos los procesos psicolgicos estn mediados por procesos sociales, culturales e his-
tricos. El ser humano alcanza sus nes slo a travs de la elaboracin compartida de
todo tipo de herramientas: fsicas, simblicas y psicolgicas, todas construidas en el
marco de un proceso social e histrico.
La ley general del desarrollo cultural o ley de la doble formacin de las funciones
psquicas superiores
Frente a la idea de que los procesos cognitivos tienen un carcter puramente biolgico
y, por tanto, universal, con independencia de la cultura, la sociedad y la historia en la
que tienen lugar, Vygotski plantea que lo que ocurre es todo lo contrario: son productos
de procesos sociales e histricos concretos y especcos, que adoptan distintas formas
en funcin de los sucesivos estadios del desarrollo social e histrico. El desarrollo his-
trico es la continuacin del desarrollo logentico por otros medios y segn otras
reglas.
El proceso de internalizacin
El desarrollo psicolgico individual es un complejo proceso en el que las personas, y
particularmente los nios, se van apropiando de las conquistas acaecidas en el marco
del desarrollo histrico de la especia humana.
3. Las relaciones entre desarrollo y aprendizaje
Desde la ptica de Vygotski entre el desarrollo espontneo y el aprendizaje forzado se
dan complejas relaciones de carcter dialctico. La idea fundamental es que no hemos
de buscar lo que el nio sabe o no sabe hacer l solo, sino lo que podra llegar a ser
capaz de hacer con la ayuda de otro ms capaz que l. Lo que importa es el desarrollo
potencial. Lo que est a punto de nacer. Lo que est entre la potencia y el acto.
Captulo 3. Principales teoras sobre el desarrollo (II): el modelo de L. S. Vygotski 47
Objetivos
Conocer las inuencias de la losofa racionalista y dialctica en la gestacin de
la psicologa del desarrollo de Vygotski.
Apreciar las ntimas conexiones que se producen entre el marco losco en
el que se inserta Vygotski y sus aportaciones tericas a la psicologa del desa-
rrollo.
Conocer los principales conceptos de la propuesta vygotskiana.
Comprender las implicaciones del concepto de zona de desarrollo prximo pro-
puesto por Vygotski para interpretar las relaciones entre desarrollo, aprendizaje y
educacin.
Conocer las principales aportaciones de Vygotski y su posible complementariedad
con las ideas de otros psiclogos como Piaget.
Introduccin
Enestecaptulovamosatratardeunautorrusocuyaobratienemuchascosasqueense-
arnos.Vygotski,quenacielmismoaoquePiaget,1896,esunodelosautoresclsi-
cosdelaPsicologadelDesarrollo.Aunquemurimuyjoven,enelao1934,laproyec-
cindesusaportacionesllegahastanuestrosdas.Tambinesautordeunamonografa
sobrelatragediadeHamlet,PrncipedeDinamarca,y,sussugerentesideassobrelacon-
cienciaylapsicologadelospersonajesliterariosnohanperdidoactualidad.
EsmuyinteresanteobservarlainfuenciaqueunflsoforacionalistadelsigloXVII,
Spinoza,ejercisobreVygotski.Estainfuenciaespatenteenelmododetratarlapro-
blemticadelasemociones.Escuriosocmounneurocientfcoactual,AntonioDamasio
(Damasio,2005),seorientadenuevohaciaSpinoza,alejndosedeldualismocartesiano,
oseadeDescartes.
4. El desarrollo normal y alterado
Un asunto al que Vygotksi tambin dedic atencin es al estudio de la educacin del
nio que no sigue un desarrollo normal. Este autor defendi que la psicologa de los
nios que presentan problemas de desarrollo deba estar incluida tambin en una teora
general del desarrollo humano, idea coherente con su concepcin del mismo como
proceso dialctico, complejo y variable.
5. Implicaciones del modelo de Vygotski sobre el desarrollo social y la
educacin
La teora histrico-cultural de Vygotski le llev a considerar la educacin desde un punto
de vista sociocultural; las creaciones colectivas (arte, ciencia, instituciones) realizadas en
el medio social y construidas a lo largo de la historia son recreadas, reconstruidas, luego,
por los individuos en el proceso educativo. Por eso la educacin es tan importante. Per-
mite a los individuos, en muy pocos aos, apropiarse, de un modo activo, de los avances,
las conquistas y los logros realizados por la humanidad en el curso de su historia.
48 Bloque I. Introduccin al estudio del desarrollo humano
Vygotski era un pensador muy audaz y siempre dese impulsar una ciencia nueva.
QuerasuperarlosfalsosdualismosheredadosdelaflosofadelsigloXVIIyencaminar-
sehaciaunapsicologadialcticaquefueracapazdesuperaresasestrilesoposiciones.
LapsicologadeldesarrollodeVygotskisitalosprocesospsicolgicossuperioresen
elmarcodelahistoria,delaculturaydelasociedad.Noveeldesarrollohumanodesde
unpuntodevistameramenteindividualista,sinoensucontextosocial,histricoycultural.
LasideasclavesdeVygotskiseresumenmuybienensunocindelazonadedesarrollo
prximo. La zona de desarrollo prximo ha sido una idea muy frtil que ha inspirado
muchostrabajosenPsicologaEvolutiva.Igualmente,laideadelainterrelacinentrelos
procesosinternos,intrapsquicos,ylosprocesosexternos,interpsquicos,permiteexplicar
muchos fenmenos del desarrollo. El inters porVygotski reside en que desarroll sus
ideassobrelanaturalezahistrico-culturaldelserhumanodesdeunaperspectivaindita.
1. Sobre la biografa de Lev S. Vygotski
Lev Semionovich Vygotski ha tenido una enorme infuencia en la psicologa y en las
cienciassociales,engeneral.Sufrilarepresinylacensuradesupensamientoamanos
deladictadurasovitica.Sinembargo,eraprofundamentedialctico,loquevuelvean
msirritantesucaso.Esdecir,quenoeraenabsolutoreaccionario,sinotodolocontrario:
profundamente revolucionario y radical en su forma de afrontar la comprensin de la
naturalezahumana.Murialaedadde38aos,porloquepodemosimaginarquesi,a
pesardesutempranamuerte,suinfuenciahasidomuyintensa,qunohubierasidode
haberpodidocompletarsuprogramadeinvestigacin.
Vygotski tena un conocimiento muy profundo de las obras literarias en las que se
planteanproblemasexistencialesfundamentales.Noobstante,seinclinporlaPsicologa
ynoprosiguiahondandoenelsignifcadosocialehistricodelasobrasliterarias.Enlos
aosnoventa,autoresnorteamericanosintentaronrelacionarsuPsicologa del Arte(1932)
consusobraspsicolgicas(vase Cuadro 3.1),yelaborarunasntesisentrelas aportaciones
deambaslneasdepensamiento,perohastalafechanadielohaconseguidoplenamente.
Cuadro 3.1. Las obras de Vygotski.
VYGOTSKI ESCRIBI
La Psicologa del Arte(1925).
La conciencia como problema para la Psicologa de la Conduc-
ta (1925).
Psicologa Educativa(1926).
El signifcado histrico de la crisis en Psicologa (1927).
El problema del desarrollo cultural del nio (1929).
Problemas fundamentales de la Defectologa(1929).
La transformacin socialista del hombre(1930).
El hombre primitivo y su conducta(1930).
Pedagoga del adolescente(1931).
Sobre el problema de la psicologa del trabajo creativo del ac-
tor(1932).
El juego y su papel en el desarrollo mental del nio(1933).
Pensamiento y lenguaje(1934).
El problema de la consciencia(1934).
Captulo 3. Principales teoras sobre el desarrollo (II): el modelo de L. S. Vygotski 49
Hay que sealar que un pensador que infuy mucho en toda la peripecia vital de
VygotskifueelflsofoSpinoza.Noesesteellugarparaapreciarlosparalelismosylas
posiblesconexionesentreestasdosformasdinmicasydialcticas,probablementecom-
plementarias,depensarlosasuntoshumanos.PeroquienquieraentenderaVygotskien
profundidad, debe conocer su fuerte atraccin por Spinoza, judo expulsado de la sina-
gogaporsusideasheterodoxas,pantesta,materialistay,sinembargo,mstico.Vygotski
aunquemarxista,lofuedeunmodolibreyheterodoxo.Asusmsprximoslesconfe-
sara:
Mi pensamiento ha ido formndose bajo el signo de las palabras de Spino-
za. [Nadie ha determinado hasta el presente lo que puede el Cuerpo]. Y siem-
pre como l ha procurado no asombrarse, no rerse, no llorar, sino com-
prender.
PoresosiguilcaminodelaPsicologadelDesarrollo.Estuvosiempreafavorde
lainnovacin.Pensabaquesinunartenuevonohabraunhombrenuevo.Escribira:
(...) y las posibilidades del futuro no se pueden prever tanto para el arte como
para la vida; porque insista como dijo Spinoza: Nadie ha determinado
hasta el presente lo que puede el cuerpo.
HastaelfnaldesusdasVygotskiestudiaSpinoza,alcualestconsagradasul-
timamonografasobreelafectoylacognicin.Efectivamente,enlosltimosaosdesu
vidaseinteresporlosproblemasdelaestructuradelapersonalidadydelacorrelacin
entreelintelectoyelafectoyempezatrabajarsobreunlibrodedicadoaladoctrinade
laspasionesbajolainspiracindirectadedichoautor.Pocoantesdemorirhabacomen-
zadoaestudiarelproblemadeladisgregacindelasfuncionespsicolgicassuperiores,
tantoenlaafasiacomoenlaesquizofrenia.Lonicoqueconocemosdeestetrabajoes
unextractoquellevaporttuloLa teora de las emociones de Spinoza a la luz de la Psi-
coneurologa contempornea.
2. Principales conceptos de la propuesta vygotskiana
Unpensamientocadavezmspotentequenoslleveaconocerenquconsisteelser
humanonospermitiralcanzarunamejoracontinuadenuestrascondicionesdevida.
Elconocimientoescondicinimprescindibleparaacabarconlasinjusticias.Deahque
seatrascendentalasegurarsedelaadecuacindeltipo(sistema,mtodo,enfoque,princi-
pios)depensamientoelegido,puesslounabuenaeleccinnospermitirvermsall
detodaslasfalsasapariencias,y,nosabrirelcaminoparaunamejoradelascondicio-
nes de vida de la humanidad. En Leningrado (1924),Vygotski exigi vehementemente
la creacin de un mtodo nico de investigacin de la conducta del hombre y, por con-
siguiente, de una disciplina cientfca nica.
50 Bloque I. Introduccin al estudio del desarrollo humano
LaideamsgeneralquecabeatribuiraVygotskiesqueaborrecalosdualismoses-
triles; as, busc decididamente las unifcaciones creativas que no anulaban, sino que
potenciaban, las dos partes constituyentes (necesarias ambas, pero insufcientes por s
solas)decadaidea.Heaqualgunasanttesisconlasqueseenfrentconlaintencinde
lograrunasntesissuperior:refexologa/psicologa;pensamiento/lenguaje;cerebro/pen-
samiento; cognicin/afecto; psicologa explicativa/psicologa descriptiva; desarrollo/
aprendizaje.Vygotskiquera,porejemplo,enlazarynoescindirelconceptoyelafecto.
Ya hemos dicho que en la correlacin entre intelecto y afecto trabajaba cuando muri.
Pero ya antes, al estudiar la importancia del juego en el desarrollo de los nios (1933)
dejescrito:
As pues, el atributo esencial del juego es una regla que se ha convertido en
deseo. La nocin de Spinoza acerca de una idea que se ha convertido en deseo,
un concepto que se ha transformado en pasin, encuentra su prototipo en el
juego, que es el reino de la espontaneidad y la libertad.
1
Aunquenoalcanzarasusltimosobjetivos,enesadireccinparecimoverse,enEl
ser y la conciencia,otropsiclogoruso,Rubinstein:
Todo acto psquico concreto, toda unidad de conciencia comprende ambos
componentes: uno intelectual o cognoscitivo y otro afectivo (no tal como lo en-
tiende la psiquiatra moderna, sino en el sentido de la flosofa clsica del siglo
XVII, por ejemplo en la de Spinoza).
Vygotskiconsiderabaquelapsicologatenadostareascientfcasdiferentes.Cuando
elprejuiciocientfcodominanteesqueconcumplirunadeestasdostareasyaessu-
fciente,entonceslonaturalesqueunospsiclogoscultivenslounadeesasformasde
psicologa y olviden la otra, mientras que otros psiclogos hacen lo inverso. Tambin
puedeocurrir,fnalmente,queambasformassemezclenenunaimaginariaunidadpero
conunadistribucinproporcionalarbitrariaoenunainterconexinincompleta.Esoeslo
que le ocurra, en opinin deVygotski, a la psicologa de las emociones de su tiempo.
Porunaparte,existaunapsicologadescriptivayporlaotraunapsicologaexplicativa,
queintentabanestudiarlasemocionessuperiores.Cadaunadeellasrespondedeforma
distintaalaspreguntasfundamentalesquepodemosformularnosenestareadeconoci-
miento. Por ejemplo, ante la pregunta de por qu Scrates permaneci en la prisin de
Atenas,acepttomarlacicuta,ynoirsedelaciudad,lateoraexplicativa(James-Lange)
respondeentrminosdecontraccinyrelajacindemsculosyencogimientodemiem-
bros.Esesaviejaidea,untantoextraadequenomeroporqueestoyalegre,sinoque
estoyalegreporquemero.Loprincipaleselmecanismo,laconducta,nolamente.
Lapsicologadescriptiva(Scheler,Dilthey),porsuparte,diraqueScratesperma-
neci en la prisin para satisfacer una emocin de valor superior. Es decir, es la vida
mentallaquerigenuestrasacciones.
1
EnEl papel del juego en el desarrollo del nio.
Captulo 3. Principales teoras sobre el desarrollo (II): el modelo de L. S. Vygotski 51
Vygotskisostuvoqueambasteorasestabanlejosdeofrecerunarespuestagenuina-
mentecientfcayningunadirigalaatencinalacausaverdadera:enelcasodelapsi-
cologaexplicativa,sta,leresultabaindiferenteolacontemplababajolapticadeuna
causalidadmecanicista,y,enelcasodelapsicologadescriptiva,seofrecaunaexplica-
cinteleolgica.Esdecir,explicalaconductaenfuncindelafnalidadquepersiguela
mente.
Vygotski estaba a favor de un determinismo natural, materialista y una explicacin
causaldelaspasioneshumanas;dehecho,luchcontraunaexplicacinilusoriabasada
enobjetivosofnes.Peroqueraestablecerunaautnticapsicologacientfca,explicativa
delhombre.Luchcontraeldualismo,contralaescisin.Buscabadescribir(Scratesse
qued)yexplicar(Scratessequedporalgo,nosloporquesucuerponosemovi).
LapsicologacontemporneahereddeDescarteselprincipiodeinterpretacinna-
turalistaymecanicista.Elmecanicismocartesiano,elautomatismoyeldualismosonla
verdadera base de la hiptesis de Lange y James (por ejemplo, la de la psicologa des-
criptiva).DeahqueVygotskiconcuerdeconquienconsideraqueDescarteseraelver-
daderopadredetodalapsicologareactolgicacontempornea.Oseadelaexplicacin
delaconductaentrminosdeloexterno,deloquesepuedeobservar.
Sloquienseejercitaentodoslosmodosdeconocimiento,sinexcluirninguno,pue-
de llegar a desentraar la autntica naturaleza de las cosas. Pero dejemos hablar aVy-
gotski:
Nuestro resumen fnal es necesariamente desconcertante en su complejidad.
Vemos que las lneas del pensamiento de Spinoza encuentran su continuacin
histrica tanto en Lange como en Dilthey, tanto en la psicologa explicativa
como en la descriptiva. Cada una de estas teoras en conficto contiene algo de
la teora de Spinoza. Al luchar por una explicacin cientfca de las emociones, natural y
causal, la teora de James-Lange resuelve uno de los problemas centrales de la psicologa
materialista y determinista de Spinoza. Pero, a su vez, la psicologa descriptiva, al poner
nfasis en el problema del sentido y signifcado vital de las emociones humanas, intenta re-
solver el problema fundamental y central de la tica.
Vemos,pues,cmoVygotskiintentresolverunproblemadeunmodounitario:el
de la explicacin determinista y causal de los elementos superiores en la vida de las
pasioneshumanas.Alhacerlo,suteoracontiene,porunlado,unapsicologaexplicati-
va que preserva la idea de una explicacin causal y tambin contiene una psicologa
descriptivaqueconservaelproblemadeloselementossuperioresdelaspasioneshuma-
nas. En su ncleo ms profundo e interno, la teora de Vygotski contiene lo que ha
desaparecidoenlasdospartesdisociadasdelapsicologacontemporneadelasemo-
ciones:contieneenarmonalaexplicacincausalyelproblemadelsignifcadovitalde
laspasioneshumanas,esdecir,alavezlasdospsicologas:ladescriptivaylaexplica-
tiva.
VygotskiestabaconvencidodelanecesidaddesuperarlaherenciadeDescartes.La
psicologa contempornea de las emociones, dividida en dos partes irreconciliables y
antagnicas,representaparalelsinodelpensamientoflosfcodeDescartes.Yestose
vemsclaroenelproblemadelaexplicacincausaldelasemocioneshumanas.
52 Bloque I. Introduccin al estudio del desarrollo humano
2.1. La mediacin
Alparecer,segncuentaA.R.Luria,unodesusmejoresamigos,aVygotskilegustaba
mucho un aforismo de Roger Bacon: Nec manus nuda, nec intellectus sibi permissus
multum valent, instrumentis et auxilibus res perfcitur... (Ni la mano por s sola, ni el
intelectoporsmismotienenmuchopoder.Losresultadosseobtienenconinstrumentos
yayuda,quesontannecesariosperaelentendimientocomoparalamano.)
LaideaprimeraylamsimportanteparaentenderaVygotskieselorigensocialy
laestructuramediadoradelosprocesospsicolgicossuperiores(laatencinconscien-
te,elrazonamiento,elpensamiento,etc.).Estosprocesossoncomplejasformasdeac-
tividad, todos de origen histrico, que implican la construccin de todo tipo de herra-
mientas y recursos tcnicos, mediante los cuales se acta en el medio ambiente. Las
accioneshumanasexternastienenlugarmedianteelempleodesofsticadossistemasde
herramientas.
La idea de la naturaleza social de los fenmenos ms ntimos de la mente tuvo un
papeldecisivoensupensamiento.Esoquieredecirque,asujuicio,pararesolverelpro-
blemadelosmecanismosntimosdelamentehumana,einclusodesunaturaleza,sedebe
salirfueradelorganismoyhallarlasfuentesdeestosprocesosensusformassocialesde
existencia.Elhombreesunsersocial.Supremisafundamentalesquesomosseresso-
ciales,quesomosunproductodelahistoriasocialysomos,adems,sujetosactivosen
lasrelacionessociales.Larelacinsocialhumanaeselorigendelasmselevadasformas
deconducta,notansloporloqueserefereasucontenido,sinotambinporloquese
refere a su estructura y a su complejidad formal. Un ejemplo de la importancia de la
mediacin social en la constitucin de las funciones psicolgicas es la explicacin del
propioVygotskidelaaparicinenelniodeungestoprototpicamentehumano,elges-
todesealarparacomunicarseconlosotros(vase tambin Captulo 6):
El nio intenta asir un objeto alejado de l, tiende sus manos en direccin del
objeto, pero no lo alcanza; sus brazos cuelgan en el aire y los dedos hacen mo-
vimientos indicativos (...). Cuando la madre acude en ayuda del nio e interpre-
ta su movimiento como una indicacin, la situacin cambia radicalmente. El
gesto indicativo se convierte en un gesto para otros. En respuesta al fracasado intento de asir
el objeto se produce una reaccin, pero no del objeto, sino por parte de otra persona. Son
otras personas las que conferen un primer sentido al fracasado movimiento del nio. Tan
slo ms tarde, debido a que el nio relaciona su fracasado movimiento con toda la situacin
objetiva, l mismo empieza a considerar su movimiento como una indicacin. Vemos, por
tanto, que se modifca la funcin del propio movimiento: de estar dirigido al objeto pasa a
ser dirigido a otra persona, se convierte en un medio de relacin; el apresamiento se trans-
forma en indicacin. (Vygotski,1931/1995.)
Laanteriorcitaponeclaramentedemanifestocmounaconductameramenteinstru-
mental,elintentodelnioporcogeroagarrarunobjeto,setransformagraciasalainter-
pretacin(porejemplo,alamediacin)delamadreenungesto,unaherramientasimb-
lica,paralacomunicacinconelotro.
Captulo 3. Principales teoras sobre el desarrollo (II): el modelo de L. S. Vygotski 53
Vygotskienunprincipiodenominasuformanuevadehacerpsicologa,psicologa
culturaly,posteriormente,psicologahistrica.Aesterespectoseorganizunaexpe-
dicin especial aAsia Central para demostrar que todos los procesos cognitivos, que
alegremente se supone que tiene carcter universal, con independencia de la cultura, la
sociedadylahistoriaenlaquetienenlugar,enrealidad,sonproductosdeprocesosso-
cialesehistricosconcretosyespecfcos,queadoptandistintaformaenfuncindelos
sucesivosestadiosdeldesarrollosocialehistrico.
2.2. La ley general del desarrollo cultural o ley de la doble
formacin de las funciones psquicas superiores
Vygotskipensabaqueeldesarrollonoeslineal,nisumativooacumulativo.Porelcon-
trario,eldesarrolloavanzanoencrculosinoenespiral,atravesandosiempreelmismo
puntoencadanuevarevolucin,mientrasavanzahaciaunestadiosuperior.Enelmodo
enelqueexplicaelpapeldellenguajeseadvierteconclaridadcmoesteautorconceba
eldesarrollodelasfuncionespsicolgicassuperiores:comounprocesosegnelcualen
el desarrollo del nio toda funcin aparece primero en el plano social, y despus en el
psicolgico.Vemosloatravsdelaspalabrasdelpropioautorqueenlasiguientecita
planteaunaexplicacinabsolutamenteoriginalalsurgimientodelpensamientoverbala
partirdelusodellenguajeencontextossociales(vase tambin Captulo 9).Dicenuestro
autor:
La funcin primaria de las palabras, tanto en los nios como en los adultos, es
la comunicacin, el contacto social. Por tanto, el primer lenguaje del nio es
esencialmente social, primero es global y multifuncional; ms adelante sus fun-
ciones comienzan a diferenciarse. A cierta edad el lenguaje social del nio se
encuentra dividido en forma bastante aguda en habla egocntrica y comunicativa. Las dos
formas, tanto la comunicativa como la egocntrica son sociales, aunque sus funciones dife-
ren. El nio, como sabemos, tiende a transferir a sus procesos interiores los patrones de
comportamiento anteriormente sociales: el pequeo comienza a conversar consigo mismo
como lo ha estado haciendo con otros. El lenguaje egocntrico, extrado del lenguaje social
general, conduce a su debido tiempo al habla interiorizada, que sirve tanto al pensamiento
privado como al simblico. El lenguaje egocntrico como forma lingstica propia y diferen-
ciada es un eslabn gentico sumamente importante en la transicin desde la forma verbal
a la interiorizada, una etapa intermedia entre la diferenciacin de las funciones del lengua-
je verbal y la transformacin fnal de una parte de ste en lenguaje interiorizado. Este papel
transicional del habla egocntrica es el que le confere tan gran inters terico. La concep-
cin total del desarrollo del lenguaje difere profundamente de acuerdo a la interpretacin
que se le d al papel del lenguaje egocntrico. Hasta ese punto nuestro esquema de desarro-
llo (primero social, luego egocntrico, ms adelante lenguaje interiorizado) contrasta tanto
con el tradicional esquema conductista (lenguaje oral, cuchicheo, lenguaje interiorizado)
como con la secuencia de Piaget (desde el pensamiento privado, no verbal, al lenguaje so-
cializado y al pensamiento lgico a travs del pensamiento y lenguaje egocntricos). En
nuestra concepcin la verdadera direccin del desarrollo del pensamiento no va del indivi-
dual al socializado, sino del social al individual.
54 Bloque I. Introduccin al estudio del desarrollo humano
AjuiciodeLuria,eldescubrimientodequeelsentidodelapalabrasufreciertaevo-
lucinyqueelprocesonoseexplicaporlasimpleadquisicindenuevasasociaciones,
sinoquetieneuncarctercualitativoyconduceanuevasformaspsicolgicasdeconduc-
tahumana,fueunodelosmsimportantesdescubrimientosrealizadosporVygotski.Es
decir,quenopodemosentendernadadelanaturalezahumanasinolaconceptualizamos
delmodoadecuado.Yestemodoadecuadonoesotroquesucarctersocial,culturale
histrico,talycomoseexpresaenlaleygeneraldeldesarrollocultural.
2.3. El proceso de internalizacin
Comovenimossealando,Vygotskitratdereunirenunasntesisdialcticasuperiorlos
aspectos internos (madurativos, innatos) y los externos (culturales, sociales, histricos,
adquiridos).Llaminternalizacinalareconstruccininternadeunaoperacinexterna.
Elprocesodeinternalizacin,comoserecogeenlacitadelapartadoanterior,consisteen
unaseriedetransformaciones:a)unaoperacinqueinicialmenterepresentaunaactividad
externa se reconstruye y comienza a suceder internamente; b) un proceso interpersonal
quedatransformadoenotrointrapersonal.Eneldesarrolloculturaldelnio,todafuncin
aparecedosveces:primeroanivelsocial,ymstarde,anivelindividual;primeroentre
personas (interpsicolgica), y despus, en el interior del propio nio (intrapsicolgica).
Estopuedeaplicarseigualmentealaatencinvoluntaria,alamemorialgicaoalafor-
macindeconceptos.Todaslasfuncionessuperioresseoriginancomorelacionesentre
seres humanos, y c) la transformacin de un proceso interpersonal en un proceso in-
trapersonaleselresultadodeunaprolongadaseriedesucesosevolutivos.Lainternali-
zacin de las actividades socialmente arraigadas e histricamente desarrolladas es el
rasgo distintivo de la psicologa humana, la base del salto cualitativo de la psicologa
animalalahumana.
Esladiferenciafundamental,ajuiciodeVygotski,entrelosanimalesyelserhuma-
no.Enlosanimalesnoseproduceningnprocesodeinternalizacin.
3. Las relaciones entre desarrollo y aprendizaje
Sobrelasrelacionesentredesarrolloyaprendizaje,Vygotskisedistanciclaramentede
Piaget.Considerabaquetodaslasconcepcionescorrientesdelarelacinentredesarrollo
yaprendizajeenlosniospuedenreducirseesencialmenteatresposicionestericasim-
portantes.Laprimeradeellassecentraenlasuposicindequelosprocesosdeldesarro-
llodelniosonindependientesdelaprendizaje.Lasegundaposicintericamsimpor-
tanteesqueelaprendizajeesdesarrollo.Laterceraposicintericarespectoalarelacin
entreaprendizajeydesarrollotratadeanularlosextremosdelasanterioresafrmaciones
combinndolasentres.Aunquerechazalastresposicionestericasdiscutidas,suanli-
sisnosllevaaunavisinmsexactadelarelacinentreaprendizajeydesarrollo.Yaqu
vieneunadelasgrandesaportacionesdeVygotski.
Tenemosquedelimitarcomomnimodosnivelesevolutivos.Elprimerodeellospo-
dra denominarse nivel evolutivo real, es decir, el nivel de desarrollo de las funciones
mentalesdeunnio,establecidocomoresultadodeciertosciclosevolutivosllevadosa
Captulo 3. Principales teoras sobre el desarrollo (II): el modelo de L. S. Vygotski 55
cabo. Cuando determinamos la edad mental de un nio utilizando tests, tratamos casi
siempreconelnivelevolutivoreal.Elotronivelnoslomuestraelconceptodelazona
dedesarrolloprximo.Noesotracosaqueladistanciaentreelnivelrealdedesarrollo,
determinadoporlacapacidadderesolverindependientementeunproblemayelnivelde
desarrollopotencial,determinadoatravsdelaresolucindeunproblemabajolagua
deunadultooencolaboracinconotrocompaeromscapaz.
Entonces,quesloquedefnelazonadedesarrolloprximo,determinadaporlos
problemasquelosniosnopuedenresolverporssolos,sinonicamenteconlaayuda
dealguien?Dichazonadefneaquellasfuncionesquetodavanohanmadurado,peroque
sehallanenprocesodemaduracin,funcionesqueenunmaanaprximoalcanzarnsu
madurezyqueahoraseencuentranenestadoembrionario.Elniveldedesarrolloreal
caracteriza el desarrollo mental retrospectivamente, mientras que la zona de desarrollo
prximocaracterizaeldesarrolloprospectivamente.Aspues,lazonadedesarrolloprxi-
monospermitetrazarelfuturoinmediatodelnio,ascomosuestadoevolutivodin-
mico, sealando no slo lo que ya ha sido completado evolutivamente, sino tambin
aquello que est en curso de maduracin. El estado del desarrollo mental de un nio
puede determinarse nicamente si se lleva a cabo una clarifcacin de sus dos niveles:
del nivel real de desarrollo y de la zona de desarrollo prximo.As pues, la nocin de
unazonadedesarrolloprximonosayudaapresentarunanuevafrmula,asaber,que
elbuenaprendizajeessloaquelqueprecedealdesarrollo.Loquecrealazonadede-
sarrollo prximo es un rasgo esencial de aprendizaje; es decir, el aprendizaje despierta
unaseriedeprocesosevolutivosinternoscapacesdeoperarslocuandoelnioesten
interaccinconlaspersonasdesuentornoyencooperacinconalgnsemejante.Una
vezquesehaninternalizadoestosprocesos,seconviertenenpartedeloslogrosevoluti-
vosindependientesdelnio.Aspues,elaprendizajeesunaspectouniversalynecesario
del proceso de desarrollo culturalmente organizado y especfcamente humano de las
funcionespsicolgicas.
ElrasgoesencialdelahiptesisdeVygotskieslanocindequelosprocesosevolu-
tivosnocoincidenconlosprocesosdeaprendizaje.Porelcontrario,elprocesoevolutivo
vaaremolquedelprocesodeaprendizaje;estasecuenciaesloqueseconvierteenlazona
dedesarrolloprximo.
4. El desarrollo normal y alterado
OtroaspectoimportanteparaentenderelenfoqueeducativodeVygotskieselconcepto
de lucha y conficto. l entiende que la contradiccin y el choque entre lo natural y lo
histrico,loprimitivoylocultural,loorgnicoylosociales,engranmedida,eldrama
delosprocesoseducativos.
UnasuntoalqueVygotskidedicatencinesalestudiodelaeducacindelnioque
nosigueundesarrollonormal.Plantecrticamentequetodoelaparatoculturalest
pensadoparasereshumanosnormales,porloquecuandohayunnioquesedesva
deltipohumanonormal,laconvergenciaquesedaraenlossereshumanosnormaleses
sustituidaporunaprofundadivergenciaodisociacinentrelaslneasdedesarrollonatu-
ralycultural.Parasolucionaresteproblema,lasinstitucioneseducativashandebidocrear
ciertastcnicasculturalesartifciales,queconsistenenmanerasdiferentesoespeciales
56 Bloque I. Introduccin al estudio del desarrollo humano
formasderepresentarlossignosylossmbolos,adaptadasalaspeculiaridadespsicof-
siolgicasdelosnioscondiscapacidad.
VygotskitrabajenelInstitutodePsicologadeMoscjuntoaLuriayLeontiev,
amigosydiscpulos,quieneseranunpocomsjvenesquelyque,posteriormente,
tambinadquiriranreconocimientoanivelmundial.Ellosbuscabanreformularlateo-
rapsicolgicatomandocomobaselamiradamarxista,inventandoestrategiaspedag-
gicas que permitieran luchar en contra del analfabetismo y de la defectologa, condi-
cin atribuida, en esa poca, a aquellos nios considerados como anormales o
difciles,dentrodelacualseincluansituacionescomoserzurdooretrasadomental.
En1925,VygotskicreunLaboratoriodePsicologaparalaInfanciaAnormal,trans-
formadoluegoenelInstitutodeDefectologaExperimentaldelaComisaradelPueblo
para la Educacin, que l tuvo la misin de presidir. En la primavera de 1925 fue el
delegadoenelCongresoInternacionalsobrelaEducacindeSordo-mudosqueselle-
vacaboenInglaterra.AprovechlaocasinparavisitarAlemania,losPasesBajos,
yFrancia.
Vygotski seal tres tipos fundamentales de defectos: la afeccin o defecto de los
rganosreceptores,laafeccinodefcienciadelaspartesdelaparatoderespuestadelos
rganosdetrabajoyeldefectooafeccindelSistemaNerviosoCentral.Losseguidores
deVygotskiplanteanqueeltrabajocorrectivo-compensatoriodebaserlavaparaque,
apartirdeldefecto,segeneraralapotencialidad.Potencialidadesquedesdeelpuntode
vistapsicofsiolgicotieneelSistemaNerviosoCentralysobretodoelcerebrohumano,
yqueenlasprimerasedadessecaracterizaporunaplasticidadenorme.
Vygotski propuso el concepto de estructura del defecto, como enfoque organizador
queorientaraensuestudio,anlisisyatencin.Setratabadeorganizarlaatencinpeda-
ggica y fundamentalmente el trabajo correctivo-compensatorio sobre la base de este
postulado,demodoquelaatencinpedaggicaseadecuaracadavezmsacadanioen
particular.Paraloseguidoresdeesteenfoque,eldefectonoesslodebilidad,sinotam-
binfuerza.Enestaverdadpsicolgicaseencuentraelalfayelomegadelaeducacin
socialdelosniosconproblemaseneldesarrollo.Elorganismoactaenlosmomentos
depeligrocomountodonico,movilizandolasreservasocultasdelasfuerzasacumula-
das.Deestamaneraelorganismonoslocompensaelperjuiciocausado,sinoquesiem-
preproduceunexceso,unasuperioridadanteelpeligro,quelollevaaunestadomsalto
deproteccinqueaquelquetenaantesdelsurgimientodelpeligro.
ParaVygostkilosprimerosaosdevidaconstituyen(...) el perodo ms saturado y
rico en contenido, ms denso y lleno de valor del desarrollo en general.Porloquesera
fundamental disponer de un diagnstico de los problemas lo ms pronto posible para
poderactuardesdeelprimermomento,cuandoelcerebrogozadelamayorplasticidad
ytienelamximacapacidadcompensatoria.Pero,porotrolado,laintervencintieneque
integrarse tambin en la esfera de lo que l denomin la pedagoga social (Vygotski,
1929)enundoblesentido:enprimerlugarnoolvidandoqueunapersonaciega,sorda,
defcienteoconotrotipodeproblemases,sobretodo,unapersonaconintereses,deseos,
motivaciones y necesidades como cualquier otra; en segundo lugar, teniendo en cuenta
queelobjetivodelaeducacinsocialnoconsistesloenintervenirenloscasosindivi-
dualesdelossujetosconalteracionesdeldesarrollo,sinoeducaralosvidentes,oyentes
e inteligentes para producir cambios en sus actitudes y comportamientos respecto a
ellos.
Captulo 3. Principales teoras sobre el desarrollo (II): el modelo de L. S. Vygotski 57
5. Implicaciones del modelo de Vygotski
sobre el desarrollo social y la educacin
Comoyasehamencionado,Vygotskisufrilainfuenciadelateoramarxistadelahis-
toriaydelmaterialismodialctico.Elmaterialismohistricoestudialoscambioshist-
ricosqueseproducenenlasociedad,ascomoloscambiosenlanaturalezahumanala
conciencia,laconductadesdeunpuntodevistaconcretoycrtico.Elhombreescapaz
detransformarlanaturalezay,alhacerlo,setransformaasmismo.Esteenfoqueesdia-
lctico,enelsentidodequepostulaquetodoslosfenmenosdebenserestudiadoscomo
procesosenconstantemovimientoycambio.Elreferentematerialistadialcticoleper-
mitiaVygotskiexplicarlaevolucindelosprocesospsicolgicossuperiores,propios
slo del ser humano, en relacin con los procesos de transformacin socioculturales e
histricos.Propusolaexistenciadeunvnculoentrelosprocesospsicolgicosindividua-
lesylasformasculturalescreadasenunlargoycostosoprocesohistrico.Yconcibisu
mtodoevolutivo,comoelanlisisdelprocesodemaduracindelindividuoenelmar-
codelosprocesossocioculturales.
Vygotskicreunateorahistrico-socialquediferaenormementedelasteorascon-
ductistas.Elsujetoparticipaensupropioprocesodeaprendizajeytieneunaparticipacin
interactiva con el objeto de conocimiento, lo que le permite ir construyendo su propio
conocimiento,siempreenelcontextodelasociedadenlaquevive.Elaprendizajeesla
reorganizacindeexperienciashechadeformasistemticaysignifcativa,conlaayuda
delmediosociocultural.
La teora histrico-cultural deVygotski le llev a considerar la educacin, pues,
desdeunpuntodevistasociocultural;lascreacionescolectivas(arte,ciencia,institucio-
nes)realizadasenelmediosocialyconstruidasalolargodelahistoriasonrecreadas,
reconstruidas, luego, por los individuos en el proceso educativo. Por eso la educacin
estanimportante.Permitealosindividuos,enmuypocosaos,apropiarse,deunmodo
activo, de los avances, las conquistas y los logros realizados por la humanidad en el
curso de su historia. El proceso de educacin es la recapitulacin, en un espacio de
tiempo relativamente breve, de prolongadsimos procesos socioculturales e histricos.
LaLeydeladobleformacindelosprocesospsicolgicosproporcionaunaexplicacin
de las funcionespsicolgicas superiores del individuo en un momento histrico deter-
minado.Comoveamosenelapartado2.2,loqueapareceprimeroenuncontextosocial
pasa,despus,alosindividuos.Elconocimientoseconstruyecolectivamenteyelindi-
viduo,atravsdeprocesospsicolgicos,nocompletamenteconocidos,lointernaliza,lo
hacesuyo,esdecir,seloapropia.Eselprocesodeinteriorizacindelosproductoscul-
turales.
Perotambinelindividuopuedecontribuiratransformarlasociedad,sinoselimita
sloaapropiarsedeloyaconstruidosocialmente,yseembarca,juntoconotraspersonas,
enprocesoscreativosparaconstruirnuevosconocimientos.Esoesloquehacenlosartis-
tas,laspersonasdedicadasalasmsdiversascienciasylosreformadoressociales,reli-
giososopolticos.
58 Bloque I. Introduccin al estudio del desarrollo humano
Lecturas complementarias
Rivire,A.(1984).LapsicologadeVygotski:Sobrelalargaproyeccindeunacortabiografa.
Infancia y Aprendizaje,27-28.
Vygotski,L.S.(1990-1996).Obras escogidas. Vol.I,II,IIIyIV.Madrid:Visor.
Vygotski,L.S.(1979).El desarrollo de los procesos psicolgicos superiores. Barcelona:Crtica.
Direcciones de Internet de inters
http://www.marxists.org/archive/vygotsky/index.htm.Enestapginasepuedeencontrarinforma-
cinacercadelautorascomoenlacesamuchosdesusescritos.
Actividades
1. Cmo podramos caracterizar a Vygotski desde el punto de vista epistemo-
lgico: racionalista, empirista o constructivista?
2. Piaget defendi que el habla privada de los nios, lo que denominamos el
habla egocntrica, se deriva de su propia autonoma cognitiva y desaparece
cuando se socializa. Qu crea Vygotski, a diferencia de Piaget, sobre este
asunto?
3. En la novela de Tolstoi, Ana Karenina, dos personajes consiguen comunicar-
se escribiendo simplemente las iniciales de las palabras de las frases. Por
ejemplo: C r e n e p, q d e o n. (Cuando respondiste eso no es posible, que-
ras decir entonces o nunca?). Este ejemplo de condensacin del lenguaje
externo y su reduccin a predicados maravillaba a Vygotski. Cmo explica-
ran este asunto el propio Vygotski y otros autores?
Soluciones a las actividades
1. Podramos caracterizar a Vygotski como un constructivista dialctico y social.
El crea que la construccin predominante o primordial se hace a un nivel
social e histrico y que luego el individuo a travs de las herramientas cultu-
rales y de las instituciones reconstruye esa inicial construccin, es decir, vuel-
ve a construir, por s mismo, si bien en una forma abreviada, el proceso social
e histrico. Su racionalismo era dialctico y se alejaba claramente del empi-
rismo dominante en la psicologa sovitica que le toc padecer.
2. Vygotski replic que debido a que los nios son inicialmente sociales y deben
aprender a ser individuos, su habla privada no es egocntrica sino esencial-
mente social. l observ que los nios muy pequeos emplean el habla pri-
vada en presencia de otros nios de su edad, pero no cuando estn solos, y
as sus dilogos privados preservan las condiciones sociales del dilogo. Lo
contrario es cierto para los adultos, quienes utilizan el habla privada a solas
porque, a diferencia de los nios pequeos, ya han internalizado el dilogo
y, por ello, no tienen necesidad de recurrir al grupo social. Es ms, el habla
privada no desaparece sino que discurre de manera oculta durante el desa-
rrollo, resurgiendo en el nio y el adulto en funcin de la tarea pertinente.
Captulo 3. Principales teoras sobre el desarrollo (II): el modelo de L. S. Vygotski 59
3. Ejemplos como ste demuestran claramente que cuando los pensamientos
de los interlocutores son los mismos, el papel del lenguaje se reduce a un
mnimo. Tolstoi, escribe Vygotski, seala que entre gente que vive en estre-
cho contacto psicolgico, la comunicacin a travs de formas abreviadas de
lenguaje es ms bien una regla que una excepcin. Una sintaxis simplicada,
la condensacin y un nmero de palabras ampliamente reducido caracteri-
zan la tendencia a la predicacin en el lenguaje externo cuando las partes
saben lo que est pasando. El lenguaje interiorizado tiene una sintaxis pe-
culiar, parece desconectado e incompleto. Tiende hacia la abreviacin, la
omisin del sujeto de la oracin y de todas las palabras conectadas y relacio-
nadas con l, en tanto se conserva el predicado. Si los pensamientos de dos
personas coinciden, se puede lograr un entendimiento perfecto mediante el
uso de simples predicados. Los que estn acostumbrados a un pensamiento
independiente y solitario no entienden fcilmente el de los dems y son muy
parciales respecto al propio; pero los que viven en estrecho contacto apren-
den las complicadas inferencias de uno y otro mediante una comunicacin
lacnica y precisa a travs de un mnimo de expresiones. Esto sera un ejem-
plo perfecto de que la conciencia es conciencia social, compartida, no idn-
tica ni autocompleta porque, efectivamente, no es que seamos capaces de
hablar con los otros porque seamos capaces de hacerlo primero con nosotros
mismos, sino justamente al revs: somos capaces de dirigirnos a nosotros
mismos porque antes lo hacemos con los otros.
El desarrollo prenatal
y el recin nacido
61
4
MARTA GIMNEZ-DAS
EL DESARROLLO
TEMPRANO II
BLOQUE
En este bloque vamos a tratar los inicios del desarrollo en el ser humano, perodo que se
extiende desde la concepcin hasta los 2 aos. Comenzaremos tratando algunos aspectos
bsicos del desarrollo prenatal y exponiendo una caracterizacin general del estado y las
capacidades del recin nacido. A partir de ah, comenzaremos a estudiar cmo progresan las
habilidades cognitivas, comunicativas y afectivas a lo largo de los dos primeros aos de vida.
A travs de estos temas, el lector ver cmo los bebs empiezan a experimentar el mundo
y las personas que tienen a su alrededor y cmo esta interaccin, guiada siempre por los
adultos, le dota de los primeros instrumentos para pensar y relacionarse. El captulo sobre la
comunicacin y el lenguaje constituye un puente de unin entre los aspectos cognitivos y
afectivos aunque, como ya hemos mencionado, no se debe olvidar que el beb es un ser
integrado, en el que lo cognitivo y lo emocional se funden.
SUMARIO
CAPTULO 4. El desarrollo prenatal y el recin nacido
1. Algunas nociones genticas bsicas
2. El desarrollo prenatal
3. El recin nacido
CAPTULO 5. Los inicios de la inteligencia
1. Las capacidades perceptivas del beb
2. La explicacin piagetiana del perodo sensoriomotor
3. La nocin piagetina de objeto permanente
4. La evolucin de la imitacin segn Piaget
62 Bloque II. El desarrollo temprano
CAPTULO 6. Los inicios de la comunicacin y el lenguaje
1. Comunicacin y lenguaje
2. Desarrollo temprano de la comunicacin: del nacimiento hasta los 18 meses
3. Desarrollo temprano del lenguaje: del nacimiento hasta los 3 aos
4. Existe continuidad entre la comunicacin prelingstica y el lenguaje?: se abre la
polmica.
CAPITULO 7. Desarrollo afectivo, emocional y social
1. Aproximacin histrica al estudio del apego
2. Formacin del apego
3. Desarrollo del apego
4. Tipos de apego
5. Factores que afectan a la formacin del vnculo de apego
6. Los elementos del vnculo de apego
7. Estabilidad del vnculo de apego
El desarrollo prenatal
y el recin nacido
63
4
MARTA GIMNEZ-DAS
Esquema resumen
Objetivos
Introduccin
1. Algunas nociones genticas bsicas
1.1. Estudios sobre la herencia de rasgos
1.2. Qu se hereda?
1.2.1. Rasgos fsicos
1.2.2. Rasgos psicolgicos: inteligencia y temperamento
1.2.3. Alteraciones fsicas
1.2.4. Alteraciones psicolgicas: esquizofrenia, depresin y autismo
2. El desarrollo prenatal
2.1. Etapas del desarrollo prenatal
2.2. La vida del embrin y el feto
2.3. Apuntes sobre teratologa
3. El recin nacido
3.1. Estados y ritmos
3.2. Sistemas para recibir informacin: los sentidos
3.3. Sistemas para actuar en el mundo: los reejos
3.4. Sistemas para transmitir informacin: el llanto y la sonrisa
3.5. El cerebro del recin nacido
Lecturas complementarias
Actividades
Soluciones a las actividades
64 Bloque II. El desarrollo temprano
Esquema resumen
1. Algunas nociones genticas bsicas: genotipo, fenotipo y canalizacin
El genotipo se reere a la dotacin gentica que hereda un individuo y el fenotipo a la
expresin concreta de dicha herencia. A travs de ambos conceptos se recoge el eterno
debate herenciamedio. Hoy en da se acepta de forma general que el ser humano es
una combinacin de herencia y medio, pero en funcin del polo que se enfatice vara
la concepcin genetista o ambientalista.
La canalizacin indica el grado en que un rasgo concreto est determinado genti-
camente o est abierto a inuencias ambientales.
Algunos rasgos fsicos vienen jados desde el nacimiento y son inmodicables,
mientras que otros estn sujetos a modicaciones ambientales. Las caractersticas psi-
colgicas son, ms bien, predisposiciones que necesitan de un ambiente concreto para
desarrollarse.
2. El desarrollo prenatal
El desarrollo prenatal se divide en cuatro fases: la concepcin, el cigoto, el embrin y el
feto.
La concepcin se produce cuando un espermatozoide consigue perforar la capa que
rodea al vulo y lo fecunda dando lugar a una nueva clula llamada cigoto.
El cigoto es la primera etapa del perodo prenatal y se extiende desde la concepcin
hasta la segunda semana de edad. A travs de la divisin celular el cigoto se convierte
en mrula y con la diferenciacin, unas clulas darn lugar a la placenta y otras al em-
brin.
La fase del embrin se extiende desde la tercera hasta la novena semana. En este
perodo se forman los rganos vitales del beb y los soportes necesarios para su desa-
rrollo durante el embarazo.
La fase del feto dura desde la novena semana hasta el nacimiento (semana 38).
Durante este perodo el feto debe principalmente aumentar de peso y tamao y aanzar
las estructuras que ya posee. El feto tiene un elevado nivel de actividad movimientos
reejos, funcionamiento de sistemas sensoriales y de mecanismos cognitivos bsicos y
muchas de las acciones que realiza comienzan en perodos tempranos de la gestacin.
Los teratgenos son factores externos, no genticos, que pueden afectar negativa-
mente el desarrollo del embrin y el feto y son estudiados por la teratologa.
3. El recin nacido
El recin nacido es un ser organizado con ritmos y estados determinados y que posee
sistemas para actuar, recibir y transmitir informacin. A travs de estos sistemas y de la
interaccin con el medio ir desarrollando estructuras cada vez ms complejas.
Objetivos
Comprender y diferenciar los conceptos de genotipo y fenotipo.
Entender el concepto de canalizacin y sus repercusiones en el desarrollo.
Describir y comparar los diferentes tipos de estudios que pueden realizarse para
determinar la carga gentica y ambiental de los rasgos fsicos y psicolgicos.
Conocer los principales rasgos y alteraciones fsicas y psicolgicas que pueden
heredarse as como los datos ms relevantes conocidos sobre esta herencia.
Captulo 4. El desarrollo prenatal y el recin nacido 65
Introduccin
Lacreacindeunanuevavidadependedelacombinacinadecuadadedosclulasre-
productorasquecontienenensuncleolainformacingenticanecesaria.Mientrasque
las clulas corporales tienen en el ncleo 46 cromosomas organizados en 23 pares, las
clulasgerminaleselvuloyelespermatozoideslotienen23cromosomassimples.
Alproducirselafecundacinsecombinanlos23cromosomasdelvuloconlos23del
espermatozoide,dandolugaraunanuevacluladenominadacigotoencuyoncleohabr
46cromosomasorganizadosen23pares.Puestoquelasposibilidadesdecombinaciones
diferentesdelmaterialgenticosonprcticamenteinfnitas,cadaorganizacinespecfca
dalugaraunosrasgosqueconviertenalindividuoenunsernico.Slocuandoelvulo
yafecundadosedivideformandodosclulasidnticasaparecenseresidnticosquecom-
partenlatotalidaddelmaterialgenticoysuorganizacin.Enelrestodeloscasos,in-
clusocuandoelmaterialgenticoeselmismo,lascombinacionesespecfcasdanlugar
aseresdiferentes.
Pero,culessonlosrasgosquesetransmitenyquedanfjadosgraciasalacombi-
nacindelmaterialgenticodenuestrosprogenitores?Setrataderasgosfsicosopsi-
colgicos?Infuyeelambienteenesosrasgosovienentotalmentedeterminadosdesde
el nacimiento? Los debates y conjeturas acerca de la contribucin de la herencia y el
ambienteenelserhumanohansidoinnumerablesenpsicologaylamayoradelaspro-
puestasactualesqueintentanexplicareldesarrollosiguencondicionadasporelgradode
ambientalismo o innatismo que cada uno concede a la naturaleza humana. Para aclarar
estedebatelasaportacionesrealizadasdesdembitosdeconocimientocomolagentica
han sido fundamentales. El comienzo de la gentica moderna, situado en 1865 cuando
Mendel propuso su teora acerca de la herencia basndose en observaciones realizadas
conplantasdeguisantes,diolugaraunnuevocampodeconocimientocuyascontribu-
cioneshansidofundamentalesparasaberquseheredayquseaprende.Alolargode
estecaptuloveremoscmosehanestudiandoestascuestionesyqusesabehoyacerca
delaherenciadealgunosrasgosfsicosypsicolgicosconcretos.Acontinuacinveremos
cmoseformaunanuevavidahumana,lasprincipalesfasesporlasquepasaylospeli-
grosprovenientesdelexteriorquepuedeencontrar.Porltimo,completaremosestavi-
sin del desarrollo ms temprano con una descripcin del recin nacido en la que se
ponenderelievelosmecanismosbsicosconlosquellegaalmundoyqueleayudana
sobrevivir.
Describir las etapas del desarrollo prenatal con sus principales caractersticas.
Conocer los sistemas que se encuentran activos durante la vida prenatal y sus
repercusiones en el desarrollo postnatal.
Denir la teratologa y conocer los efectos de los principales teratgenos durante
el embarazo.
Entender cmo llega el recin nacido al mundo y los sistemas de los que dispone
desde el primer momento para comunicar sus estados y recibir informacin.
Conocer algunos aspectos bsicos sobre cmo es y cmo se desarrolla el cerebro
del recin nacido.
66 Bloque II. El desarrollo temprano
1. Algunas nociones genticas bsicas
Hoyenda,lamayorpartedelosinvestigadoresaceptanquelossereshumanossonuna
combinacindeherenciayambiente.Esdecir,grancantidadderasgosvienendetermi-
nados por nuestra herencia gentica pero, a la vez, necesitan del medio para llegar a
confgurarse. No obstante, se siguen encontrando ciertos matices diferentes y posturas
algoencontradasenfuncindelelementosobreelcualsepongamayornfasis.Porejem-
plo, los genetistas conductuales se centran en estudiar cmo la combinacin nica de
genes que cada persona tiene puede determinar los rasgos que le diferencian, mientras
queotrosenfoquesconcedenunmayorpesoalasinfuenciasambientales.Paralagen-
ticaconductual,elgenotipoyelfenotiposondosconceptosfundamentales.Elprimero
sereferealadotacingenticaqueheredaunsujetoyelsegundoalaexpresinconcre-
tadeesaherenciaatravsderasgosobservables.As,elfenotiporecogelainfuenciaque
sobre la herencia tienen las variables ambientales que inciden desde el momento de la
concepcin. Un mismo genotipo puede dar lugar a diferentes fenotipos, puesto que la
incidenciadelasvariablesambientalesysuinteraccinconlaherenciagenticapuede
traducirsedemuydiversasmaneras.Asporejemplo,ciertosrasgosfsicoscomolaes-
tatura, que tienen un fuerte componente gentico, pueden variar de forma considerable
de una generacin a otra en funcin de los hbitos de nutricin de las poblaciones. La
segunda generacin de nios japoneses que crecieron en Estados Unidos, debido a la
migracin de sus antepasados tras la Segunda Guerra Mundial, aumentaron su estatura
enalgomsdedocecentmetroscomparadosconsumismageneracincrecidaenJapn
(CeciyWilliams,1999).
Comovemos,lasvariablesambientalespuedeninfuirenlamaterializacinderasgos
conunaltocomponentehereditario,peroademshayquesealarquelaherenciagen-
ticatambinpuedeinfuirsobreelambiente.Segnlagenticaconductual,porunapar-
te,laspredisposicionesgenticasdecadaunoinfuyenenelcomportamientodelosde-
msy,porotra,laspersonasbuscanlosambientesquemejorpermitenlaactualizacin
desuspredisposicionesgenticas(Shaffer,2000).Porejemplo,haybebsquedesdemuy
tempranopreferenestarconpersonasajugarconobjetosyrespondenmejoralasinte-
raccionesconlosdems.Estastendenciasbsicasquenosoncomparablesconlaper-
sonalidaddeunindividuoqueseformaralolargodelosaosyllegaraseralgomu-
chomscomplejotienenunabasehereditariayproporcionanunapautaapartirdela
cual estructurar el ambiente.As, los bebs que preferen el contacto social provocarn
una mayor atencin por parte de los dems y buscarn un entorno social ms rico que
otrosbebsmspasivosomenossociables.
Paraentenderlainteraccinentrelaherenciayelambienteesnecesariotenerpresen-
tequeciertosrasgosestnmsdeterminadosqueotrosporlaherenciagentica.Elcon-
ceptodecanalizacinformuladoporWaddingtonesenestesentidoclarifcador(Wadding-
ton,1975).Lacanalizacinsedefnecomolacapacidad de producir un resultado fnal
defnido a pesar de cierta variabilidad tanto en la situacin inicial de la que parte el
desarrollo como en las condiciones que encuentra durante su curso evolutivo(Enesco
yDelval,2006,p.295).SegnWaddington,cadaunodelosrasgosqueseheredanposee
ungradodecanalizacin.Cuantomscanalizadoestunrasgomenorsersuvariabili-
dad,esdecir,menosafectadoestarporelentorno.Elbalbuceoinfantiloeldesarrollo
motor,quesiguenunasecuenciafjaycuyoshitossuelenapareceraedadessimilaresen
Captulo 4. El desarrollo prenatal y el recin nacido 67
todoslosnios,seranejemplosderasgosaltamentecanalizados,esdecir,muycontro-
ladosporfactoresgenticos.Alcontrario,hayotrosrasgosmuchomsvariablesparalos
quesesuponequelasecuencianoesttancontroladaysobreloscualeselmediotiene
unagraninfuencia.Porejemplo,lainteligencia,lapersonalidadolaadopcindedeter-
minados roles sexuales estn ms infuidos por el medio y pueden variar considerable-
mente de un individuo a otro. El nivel de canalizacin difere en funcin de los rasgos
perotambinenfuncindelmomentodeldesarrollo.Elmismorasgopuedeestarmuy
canalizadoenlasprimerasetapasdeldesarrolloydejardeestarlodespus.Engeneral,
cuantomsinmaduroeselindividuomayorniveldecanalizacinsedaentodossusras-
gos.Losrecinnacidostienenunasecuenciabastantemarcadadehitosmotores,cogni-
tivosysocialesquenormalmentevancumpliendo.Amedidaquevancreciendo,elen-
tornoproporcionacadavezmsposibilidadesdeaccin,pensamientoyrelacin,esdecir,
vaofreciendoalserhumanomayorriquezaycomplejidad.Esposiblequeunavezque
lagenticahaterminadosuprincipaltareadotaralsujetodelosinstrumentosbsicos
quegarantizanlasupervivenciaelprogramaserelajeparadejaralindividuotomar
lasriendasdesupropiodesarrollo.Estaoportunidaddecontroljuntoconlasrepercusio-
nesquetieneparaelindividuo,esquizunadelascaractersticasquemejordiferencian
alhombredeotrasespecies.
Aunquelaherenciagenticacontrolaciertasconductas,rasgosysecuenciasdeuna
formamuchomsmarcadaqueotras,elambienteejerceunpapeldeterminanteparaque
todas ellas se puedan desplegar. Cuando existen condiciones que impiden el desarrollo
normalesaprogramacingenticapuedeversealterada.Porejemplo,losniosquepasan
lamayorpartedeltiempoenbrazosoalosquenoselesdejaunespaciofsicoamplio
para explorar, no aprendern a gatear. Del mismo modo, nios criados en condiciones
extremasdeaislamientonoestablecernunvnculoafectivonitendrnundesarrolloso-
cialnormal.Noobstante,encuantolascondicionesambientalessenormalizan,dejando
queeldesarrollopuedaseguirsucurso,comienzaunprocesoderecuperacinacelerado
quepuedeterminarporigualarelniveldedesarrollo.Estatendenciaacorregirlasdes-
viacionesdeldesarrolloesloqueWaddingtondenomintendenciaalaautocorreccin
yconstituyeelmejorcomplementoparagarantizareldesarrollonormalcuandolascon-
dicionesambientalesnosonlasptimas.Encontradeloquesehapensadodurantemu-
cho tiempo, hoy parece demostrada la capacidad de recuperacin del ser humano en
muchosmbitostrasunaccidenteounperododeprivacin,siemprequelascondiciones
adversasnoseanextremas.Algunosautoresdenominanmetafricamenteestacapacidad
resiliencia,tomandocomoimagenlafacultaddealgunosmaterialespararecobrarsu
formaoriginaldespusdehaberrecibidoungolpe(Cyrulnik,2001).
1.1. Estudios sobre la herencia de rasgos
Determinarhastaqupuntounrasgoesheredadonoestareafcil.Cuandounapersona
esmuyinteligenteomuyintrovertida,podemosafrmarquesedebeaunacontribucin
genticaomsbienqueesunefectodelambienteenelquehavivido?Elprincipalin-
convenientequeencontramosalahoradecontestarestaspreguntasesquenoesposible
separarlainfuenciagenticadelaambientalparadeterminarsuscontribucionesrelati-
vas.Parapoderllevaracaboestaseparacinhabraque,porejemplo,aislaraunaperso-
na desde su nacimiento de forma que todos los logros alcanzados seran efecto de la
68 Bloque II. El desarrollo temprano
herenciagentica.Comoestetipodeexperimentosnosepuedenrealizarporcuestiones
ticasobvias,lospsiclogosinteresadosenestetemahanbuscadootrasmanerasdein-
tentarcontrolarlacontribucinrelativadelaherenciayelambiente.Losgenetistascon-
ductuales, que son quienes intentan establecer la heredabilidad de un atributo, realizan
estudioscomparativosenlosquevaranelgradoderelacingenticadelaspoblaciones
ydelasinfuenciasambientalesquecomparten.Antesdeexplicarcmosediseanesas
comparacionesylasdifcultadesquetienen,veamoslosdiversosgradosdesimilitudge-
nticaquesedanenlaspoblacionesdemaneranatural.
Normalmente, como hemos visto en el apartado anterior, el material gentico que
heredanhermanosnacidosdelosmismospadrestieneunaorganizacindiferente,locual
repercuteenlasdiferenciastantofsicascomopsicolgicasquetodosloshermanosmues-
tran.Sinembargo,hayhermanosquesonidnticosporqueseformanapartirdeunni-
cocigotoqueposteriormentesedivide.Estoshermanos,denominadosgemelosidnticos
omonocigticos,compartenexactamenteelmismomaterialgentico.Enotrasocasio-
nes,cuandolasmujeresproducendosvulosquesonfecundadospordosespermatozoi-
des, los hermanos gemelos se forman a partir de dos cigotos genticamente diferentes.
Estos hermanos, denominados gemelos fraternos o dicigticos, comparten la misma
cantidaddematerialgenticoqueloshermanosnacidosenmomentosdiferentes.As,a
diferenciadelosgemelosidnticos,notienenporquparecersefsicamentenipertenecer
almismosexo.
Partiendodeestosgradosdesimilitudgenticaydeambientecompartidosepueden
realizar diversos tipos de comparaciones. Para determinar si la gentica contribuye al
desarrollodealgunosrasgossepuedecompararungrupodegemelosidnticoscriados
juntosconungrupodegemelosfraternoscriadosjuntos.Ladiferenciaentreambosgru-
posestenelnivelenquecompartensumaterialgentico.As,silaherenciagentica
infuyeenalgunosrasgos,losgemelosidnticosdeberanparecersemsquelosfraternos
puesto que comparten el 100% de su material gentico. No obstante, para estar seguro
de esta afrmacin es necesario controlar que el ambiente, incluso intrauterino, ha sido
realmentesimilarenambosgrupos.
Otrotipodecomparacininteresantesepuederealizarentregemelosidnticoscria-
dos separadamente y hermanos o gemelos fraternos criados juntos. En este caso, si los
gemelosidnticosseparecenmsentresqueloshermanostambinsepuedepensarque
la herencia tiene un papel relevante. Por el contrario, si los gemelos idnticos diferen
Figura 4.1. Los gemelos idnticos comparten entre s el 100 % de su material gentico mien-
tras que los hermanos comparten slo el 50 %. Los nios adoptados comparten
con sus padres adoptivos el 0 % de su material gentico.
Captulo 4. El desarrollo prenatal y el recin nacido 69
msqueloshermanoshabraquepensarenlosfactoresambientalescomomoldeadores
deciertosrasgos.Igualmente,lascomparacionesentregemelosidnticoscriadossepara-
damenteygemelosidnticoscriadosjuntospuedenrevelardatosinteresantes.Puestoque
la herencia es exactamente la misma para los dos, las diferencias debern atribuirse a
factoresambientales.As,siporejemploloscriadosjuntosfueranmsparecidosenalgn
rasgoqueloscriadosenambientesdiferentes,habraqueconcluirqueelambientetiene
unpapelimportantealahorademoldeareseatributo.
Untipodeestudioquehastaahoranosehamencionadoeselquesellevaacabocon
niosadoptados.Estoscasosresultaninteresantespuestoqueconsuspadresbiolgicos
slo comparten la herencia gentica y con sus padres adoptivos slo comparten el am-
bienteenelqueviven.Lascomparacionesenalgunosatributosdeestosnios,comola
inteligencia o la personalidad, con sus padres adoptivos y biolgicos constituyen una
buenamaneradeaproximarsealproblemapuestoqueaqusaparecenambasinfuencias
claramenteseparadas.Siestosniosseparecenasuspadresbiolgicoseninteligenciao
personalidad, aun cuando no han sido educados por ellos, podemos concluir que la in-
fuencia hereditaria contribuye a la determinacin de esos rasgos. Por ltimo, otro tipo
deestudiosqueayudanasabersialgunosrasgossonhereditariossonlosqueatravsde
losrbolesgenealgicosreconstruyenlapresenciaoausenciadeenfermedadesocarac-
tersticasespecfcas,comoporejemplolasaptitudesmusicales.
1.2. Qu se hereda?
CuandoMendelllevacabosusobservacionesconguisantessediocuentadequecier-
tascaractersticascomolatexturalisafrentealarugosadelasvainasdelosguisan-
tes,aparecanenladescendenciadelassemillascruzadasconmayorfrecuencia.Alos
rasgosquepredominabanlosllamdominantesyalosotrosrecesivos.Graciasaeste
descubrimientohoysabemosqueexistenalgunosrasgoscuyaexpresindependeslode
un par de genes rasgos monognicos. Cada uno de los miembros que forman el par
degenessedenominaaleloylosrasgosdominantesslonecesitanunaleloparamani-
festarse.Porejemplo,elpelorubioomorenodeunnionoesunamezcladelosgenes
delpadreydelamadre,sinoqueunodeellosdominasobreelotro.As,elniotendr
elmismocolordepeloqueeldelprogenitorquetengaelgendominanteenelcolorde
pelo.Paraesterasgosesabequeelpelomorenoesdominantesobreelrubio.Poreso,
cuando el padre es rubio y la madre morena el nio hereda un tono de pelo moreno,
puestoquesloconlapresenciadelalelodelamadreelcolorestyadeterminado.Para
queunnioheredeelcolordepelorubionecesitaqueambosalelostransmitantambin
elrasgorubio.
Hayotrosrasgosquesonmuchomscomplejosyportantosuexpresindependede
varios pares de genes. Estos rasgos se denominan polignicos e incluyen tanto rasgos
fsicosporejemploelcolordepielcomoconductualeslainteligenciaylaperso-
nalidad.Paraestosatributostancomplejosparecequesonlasinteraccionesentregenes
las que determinan su aparicin, ms que la presencia del gen en s. Por ejemplo, para
obtenerunaaltapuntuacinenunapruebadeinteligencianobastaconheredarungen
delainteligencia,sinoqueseheredandiferentesparesdegenesquealinteractuarentre
sdeterminarnunapredisposicinaserinteligente.Estapredisposicinseexpresaro
noenfuncindelasexperienciasambientalesquevivaelsujeto.
70 Bloque II. El desarrollo temprano
Hayotrosrasgosqueaunquedependenslodeunpardegenes,envezdetransmi-
tirseenfuncindeladominanciadeunodeellos,lleganaunaespeciedecompromiso.
El grupo sanguneo es un ejemplo de este tipo de herencia llamada codominante. Los
alelos que determinan este atributo son igual de expresivos y ninguno domina sobre el
otro.LaspersonasqueheredanunalelodesangretipoAyotrotipoBtienenungrupo
sanguneoABporquetienenlamismaproporcindeantgenosAyBensangre.
Por ltimo, existen rasgos cuya herencia est ligada al sexo porque sus genes se
encuentranenloscromosomassexuales.Lacegueraalcolorrojoyverde,queimpidela
diferenciacinentreamboscolores,esunejemplodeellos.Estacaractersticadelavisin
es recesiva y se transmite slo en los cromosomas X, es decir, para ser ciego al color
rojo/verdehayquerecibirdosgenesquecontenganesterasgo.Puestoqueestacaracte-
rsticaslosetrasmitemedianteloscromosomasX,losvaronestienenmsprobabilida-
desdepadecerlaquelasmujeres.UnvarnrecibeunsolocromosomaXdesumadrey
uncromosomaYdesupadre.Sisumadreletransmitieralacegueranotendrotroalelo
que contrarreste, puesto que su otro cromosoma es unY heredado de su padre. Si una
mujerrecibieraungenquetransmitelaceguera,podracontrarrestarsuinfuenciaconel
alelodesuotrocromosomaX.
Hastaahorahemosvistolostiposderasgosqueexistenyalgunosmecanismosbsi-
cosdeherenciapero,qurasgosseheredan?Podemosafrmarquelosrasgosdeper-
sonalidadsonheredados?Existealgngradodeherenciaenalgunosdesrdenespsico-
lgicos como la depresin?A continuacin veremos qu tipos de rasgos se heredan y
cmoinfuyeenelloselambiente.
1.2.1. Rasgos fsicos
Lamayorpartedelosrasgosfsicosqueconstituyennuestraaparienciaestndetermina-
dosgenticamente.Elcolordelosojosydelapiel,latexturadelpeloolacomplexin
fsica vienen dados desde el nacimiento. Dentro de estos rasgos los hay polignicos
comolacomplexinfsica,monognicoscomoelcolordepeloydominantes
orecesivos.Laestaturayelpesoparecequevienensobretododeterminadosgentica-
mente pero, como ya hemos visto, la infuencia del ambiente los puede modifcar. Por
ejemplo,ladesnutricinquesufrenalgunosniosdurantelasetapasfundamentalesdel
crecimientopuedeprovocarquesuestaturaysupesosemodifquenparaelrestodesu
vida.
1.2.2. Rasgos psicolgicos: inteligencia y temperamento
Llegarasabersilainteligenciayeltemperamentoposeenuncomponentegenticooson
rasgosmoldeadossobretodoporelambientehasidounimportanteretodelapsicologa.
Estasconcepcionesnoslosonimportantesdesdeunpuntodevistaterico,sinoquehan
determinadoideologaspolticas,socialesyeducativasquehantenidodecisivasrepercu-
sionesalolargodelahistoriareciente.Porponerunejemplo,laconcepcindelainte-
ligencia como un rasgo heredado permiti durante el siglo XIX justifcar desigualdades
socialesentrepoblacionesdeblancosynegros.
Lamedidadelainteligenciaserealizaatravsdepruebasestandarizadas,denomi-
nadastestsdeinteligencia,queevalandiferentesaspectoscomohabilidadesnumricas,
Captulo 4. El desarrollo prenatal y el recin nacido 71
fuidez verbal, razonamiento espacial, etc. Como ya hemos visto, para saber hasta qu
puntoexisteuncomponenteheredadoenlainteligenciasellevanacabocomparaciones
entrepoblacionesmsomenosrelacionadasgenticamenteyseestablecencorrelaciones
entresuspuntuacionesenpruebasdeinteligencia.Acontinuacinsemuestranlascorre-
lacionesobtenidasendiferentescomparacionessegnsecompartagradodeparentesco
yambientedecrianza.
Tabla 4.1. Correlaciones promedio al comparar puntuaciones en pruebas de inteligencia en
funcin del parentesco y del ambiente de crianza. Adaptado de Schaffer (2000)
Criados juntos Criados separados
Hermanosquenotienenningnparentescogentico +0,34 0,01
Padreadoptivoehijoadoptivo +0,19
Hermanosporpartedeunodelosprogenitores +0,31
Hermanosporpartedeambosprogenitores +0,47 +0,24
Padreehijobiolgicos +0,42 +0,22
Gemelosfraternos +0,60 +0,52
Gemelosidnticos +0,86 +0,72
Comoseobservaenlatabla,amedidaqueaumentaelgradodeparentescoaumenta
tambinlacorrelacin.Lascomparacionesentrepersonasquenotienenningunarelacin
genticayquenohancompartidoelmismoambientedanlugaracorrelacionesnegativas,
locualindicaquenohayningunarelacinentresuspuntuacionesenlaspruebasdein-
teligencia.Elcasoenelqueseencuentrancorrelacionesmsaltaseseldelosgemelos
idnticos que viven juntos.Aqu se supone que se comparte el material gentico en su
totalidadyqueelambientedecrianzaeselmismo,luegoexistemucharelacinentrelas
puntuacionesobtenidasporamboshermanosenpruebasdeinteligencia.Paraelrestode
loscasos,enlosquesecompartelamitadomenosdelmaterialgentico,seestimaque
lacontribucindelaherenciaalainteligenciaesmoderada.Adems,hayqueteneren
cuentalasdiferenciasqueexistenentrelascorrelacionescuandoelmismoparcomparte
onounambientedecrianza.Estasdiferenciasseexplicanenfuncindelacontribucin
delmedioyalcanzan,exceptoenelcasodelosgemelos,aproximadamentelos20puntos.
Endefnitiva,podemosconcluirquelainteligenciatieneuncomponentegenticomode-
radoyqueelambientepuedemodifcaresecomponenteentre20y25puntos.Sepuede
decirlomismodelosrasgosdepersonalidad?
El temperamento ha sido defnido como un estilo de interaccin con el entorno que
guarda una constancia, es decir, un conjunto de reacciones emocionales y conductuales
relativamenteestablesqueaparecenprontoenlavidayqueenparteestninfuidasporla
constitucingentica.Siobservamosungrupodebebsalpocodenacerpodemosdarnos
cuentadequeseltemperamento.Desdemuytempranopodemosverquehaybebstran-
quiloseinquietos,bebspasivosyactivos,bebsqueseadaptanaloscambioscon facilidad
72 Bloque II. El desarrollo temprano
frenteaotrosquetoleranmalloscambios,etc.Estasdiferenciastanprimitivasdepautas
dereaccinconformaneltemperamento.ThomasyChess(1977)describieron,enfuncin
deestaspautasdereaccin,tresperflesdiferentesquepermitanclasifcaralosbebs:
Bebsfciles:secaracterizanporsertranquilos,desinhibidos,conpautasregulares
ycuriosos.
Bebslentosdeactivar:muestranunciertodesasosiego,soninhibidosyevitanlas
aproximacionesantelodesconocido.
Bebsdifciles:setratadebebsirritables,pocoregularesensuspautas,alosque
lescuestamuchoadaptarsealoscambiosyqueevitantodoloquenolesresulta
familiar.
A pesar de estas descripciones y muchos de los intentos que se han realizado por
establecerperflesbsicosdereaccin,hoyendaparecemscorrectohablardelaexis-
tenciadesesgosotendenciasconunabasefsiolgicaperoquenodeterminanrasgos.En
realidadsetratamsdepredisposicionesquefacilitanlamanifestacindealgunosrasgos,
peroquenotienenporquaparecer.Enestesentido,lacontribucindelambientepare-
ceaqufundamentalparaterminardemoldearloqueenunprincipioaparececomouna
simpletendencia.
Msalldeestastendenciasbsicasderespuesta,existenestudiosinteresadosende-
terminarhastaqupuntoalgunosrasgosdepersonalidadmscomplejostienenunabase
hereditaria.Evidentemente,lapersonalidadesalgomuycomplejoformadopornumerosos
componentesymuchosmaticesquelaconviertenenunconstructodifcildeestudiar,pero
parecequesehanpodidoestableceralgunasdimensionesbsicasque,aunquenodefnen
la personalidad de alguien de forma completa, permiten hacerse una idea bastante fel.
McCraeyCosta(1990)defnieroncincograndesdimensionesdelapersonalidadapartir
de la propuesta de Eysenck (1990). Estas dimensiones son: extroversin introversin,
estabilidadinestabilidademocional,amabilidadoposicionismo,responsabilidadfal-
ta de responsabilidad y abierto cerrado a la experiencia. Considerando estas grandes
cincodimensionesalgunosautoreshanrealizadocomparacionesparaversiexistealgn
tipodevariacin.Porejemplo,enladimensinextroversinintroversinyenlacapa-
cidad emptica se observan correlaciones similares a las de la inteligencia que hacen
pensar en una base heredada (Shaffer, 2000). Como es lgico, el compartir un mismo
entornodecrianzatienemuchoqueverconlosrasgosdepersonalidadquesedesarrollan.
Los padres transmitirn a sus hijos los mismos valores personales, sociales, polticos o
religiososeinclusopuedenmodelarformasdereaccinemocionalantelosacontecimien-
tos.Enestesentido,queloshermanosseparezcanensuformadesernoesextrao.
Noobstante,entrehermanostambinexistengrandesdiferenciasquesedebenalasde-
nominadas experiencias no compartidas dentro del hogar. Hay ciertos factores que
determinan cmo los padres tratan a sus hijos. Por ejemplo, ser varn o mujer o ser el
primognito,elmedianooelpequeo,condicionaeltratamientodelospadresprovocan-
doqueloshijosvivansituacionesnicasquemarcansupersonalidad.Aspues,lasexpe-
rienciascompartidasdentrodelmbitofamiliarsonrelevantesparaexplicarlassimilitudes
queexistenentrehermanosylasnocompartidasayudanadarcuentadelasdiferencias.
Desdeelpuntodevistadelagenticaconductual,semantienequeelgenotipoest
relacionadoconlosambientesenlosquenosdesarrollamos,esdecir,quenuestracarga
Captulo 4. El desarrollo prenatal y el recin nacido 73
gentica condiciona o moldea nuestro ambiente (Scarr y McCartney, 1983). Por una
parte, los padres disponen de un genotipo que condiciona el ambiente que crean para
educarasushijos.Estospuedenheredaresegenotipooimpregnarsedelalcrecerenel
ambientedispuestoporlospadres.Porejemplo,imaginemosunospadresmuycreativos
y que conceden mucha importancia a que sus hijos tambin lo sean. Los hijos pueden
heredarunadisposicinalacreatividadoincorporarlaatravsdelambientequesuspa-
dres crearn para fomentarla. Este tipo de interaccin se denomina correlacin pasiva
genotipo/ambiente. Por otra parte, nuestras predisposiciones temperamentales y ms
tardedepersonalidadinfuyenenlasreaccionesdelosdems.Comoyahemosvisto,los
bebspuedensertranquilosoirritables,pasivosoactivos,buscarlanovedadopreferir
loconocido.Estasdisposicioneshacenqueelrestodelambientereaccionedeunauotra
manera.Porejemplo,unbebsociablequebusquelanovedadprovocarquelosadultos
interaccionenmuchoconlyleofrezcanmsestmulosnuevosqueexplorar.Alcontra-
rio,unbebquenobusquelaproximidadconlosotrosyestmsinteresadoporloco-
nocido, pasar ms tiempo solo y tendr menos oportunidades para explorar objetos
nuevos. Este tipo de interaccin se denomina correlacin provocadora genotipo/am-
biente.Porltimo,escogemoslosambientesquemejorseadecuananuestraspredispo-
sicionesgenticas.Porejemplo,unapersonaconunatendenciaalasociabilidadpreferi-
rrealizaractividadesquelemantenganencontactoconotraspersonas,mientrasqueuna
personamsintrovertidaencontrarmssatisfactoriaslasactividadesquepuedarealizar
solo.Deestaforma,personascongenotiposdiferentesescogenambientesyactividades
tambin diferentes que pueden tener, a su vez, importantes efectos en sus patrones de
conducta,reaccionesemocionalesypautascognitivas.Estetipodeinteraccinsellama
correlacinactivagenotipo/ambiente.
Al principio de la vida las correlaciones pasivas son las ms importantes y las que
mejorexplicanlaformadeserylassimilitudesentrepadresehijosohermanos.Ame-
didaquelosniosvancreciendo,vanganandoautonomaparaelegirlosambientesque
mslessatisfacen.Enesteperodo,quesesitadurantelaedadescolar,lascorrelaciones
activascobranunagranimportancia.Lascorrelacionesprovocadorasparecequeinfuyen
a lo largo de todo el ciclo vital sin que exista un perodo ms relevante que otro. Las
diferenciasysimilitudesencontradasentrehermanosygemelosidnticoseninteligencia,
personalidadyconductaseajustanaestapautaevolutiva.Loshermanosmuestranduran-
telaprimerainfanciaunmayorparecidoentrespero,amedidaquevancreciendo,van
apareciendomsdiferencias.Alfnaldelaadolescencialoshermanosseparecenrelati-
vamentepocoenpersonalidad,conductaeinteligencia.Alcontrario,losgemelosidnti-
cosguardanunparecidomuysimilaralolargodetodasuvida.Esposiblequesusge-
notiposlesllevenaelegirlosmismostiposdeambienteyquesuscaractersticaspropias
provoquen el mismo tipo de reaccin en los dems, de forma que su confguracin sea
similar.Al contrario, los hermanos que no poseen el mismo genotipo podran escoger
ambientesdiferentesqueasuvezlesmoldeandemaneradiferenteyprovocarreac-
cionesdiferentesenlosdems,deformaquesuconfguracinsealeje.
Aunque la gentica conductual ha logrado explicar ciertas cuestiones, el estudio de
lainteraccinentreelambienteylaherenciagenticadebetodavaaclararsemucho.Por
una parte, cuando se habla del ambiente se hace de una manera muy vaga. No se sabe
muybienqueselambienteniaqusituacionesespecfcasnosreferimoscuandoha-
blamossimplementedelambiente.Porotra,elestudiodelagenticanonosaclaraen
74 Bloque II. El desarrollo temprano
qumedidasustanciasbioqumicaspuedendeterminaraspectoscomolainteligenciaola
personalidadnicmoinfuyenenlaseleccindesituaciones.
1.2.3. Alteraciones fsicas
Dentrodeloquesonlasalteracionesfsicas,podemosdistinguirentrelasalteraciones
estructuralesylashereditarias.Lasprimerassereferenadefectosenlaestructuraoel
nmerodecromosomasylassegundassonanomalasgenticasquesetransmitenatra-
vsdegeneraciones.EnlaTabla4.2apareceunresumendelasmsfrecuentes.
1.2.4. Alteraciones psicolgicas: esquizofrenia, depresin y autismo
Paraalgunosdesrdenespsicolgicossehaestablecidolaexistenciadeunapredisposi-
cinhereditaria.Laesquizofreniaesunodelosquemssehaestudiadoysehanesta-
blecido correlaciones de 0,46 para gemelos idnticos y 0,14 para gemelos fraternos
(Shaffer,2000).Esdecir,laprobabilidaddequeungemeloidnticopadezcalaenferme-
dadcuandoelotrogemelolapadeceesdel46%.Cuandolosgemelosnosonidnticos,
estaprobabilidaddesciendeal14%.Elriesgodedesarrollarlaenfermedadparaloshijos
deesquizofrnicosesdel13%yparaloshermanosdeesquizofrnicosdel10%.As,a
medidaqueelniveldeparentescodesciende,tambindesciendeelriesgodedesarrollar
laenfermedad.Estosdatoshacenpensar,pues,queexisteciertapredisposicingentica
perodejanunampliomargenaotrosfactoresquetienenmuchoqueverconlaaparicin
delaenfermedad.Enrealidad,lasexperienciasvividasporcadapersonadesempeanun
papelfundamentalenlamanifestacindeuntrastornodeestetipo.Enmuchoscasos,la
vivenciadeunacontecimientomuyestresanteylafaltaderecursosodeapoyoparama-
nejarlopuedenconstituireldesencadenantedelaenfermedad.Portanto,lossucesosque
ocurrenalolargodelavida,lapropiamaneradeenfrentarlosyelapoyosocialconel
quesecuentesonfactoresdirectamenterelacionadosconlaaparicindelaesquizofrenia.
Existeademsunaclarapruebaafavordelainfuenciaambiental:silaherenciagentica
fueraelnicodeterminante,lascorrelacionesentregemelosidnticostendranqueserde
1yentregemelosfraternosde0,50.
Otrosdelostrastornosqueparecentenerunabasehereditariasonladepresinma-
yoryeltrastornomanacodepresivo.Ambossontrastornosdelestadodenimopero
elltimosecaracterizaporlaalternanciadeestadosdenimoeufricosconotrosdepre-
sivos.Algunosestudioshanhalladoconcordanciasdeentreel65%yel71%entrege-
melosidnticosyentreel21%yel19%entregemelosfraternos.
Porltimo,elautismo,unodelostrastornosdeldesarrolloquemssehaestudiado
en los ltimos tiempos, tambin parece tener un origen biolgico. Como veremos ms
adelanteenprofundidad,estetrastornosecaracterizaporunaalteracindelainteraccin
ylacomunicacin,laaparicindepatronesdecomportamientoeinteresesrepetitivosy
restringidos,retrasointelectualyalteracionesenellenguajeylaimaginacin(vase Ca-
ptulo 13).Aunquesucausaestodavaunmisterio,parecequeagentesneuroqumicos,
vricosogenticospodranprovocarunaalteracineneldesarrollodelsistemanervioso
dandolugaralcuadro.Losdatossobreconcordanciasonenestecasomenosalentadores
porquedejanunmenormargendemaniobraalosfactoresambientalescuandolaheren-
cia gentica es idntica.As, la concordancia entre gemelos idnticos es del 96%, del
Captulo 4. El desarrollo prenatal y el recin nacido 75
Tabla 4.2. Resumen de las alteraciones fsicas ms frecuentes (adaptado de Vasta, Haith y
Miller, 1996 y Schaffer, 2000)
Alteraciones estructurales
Asociadosacromosomasautosmicos(estasalteracionessedanenloscromosomasnosexuales):
SndromedeDown.Sedebealapresenciadeuncromosomaextraenelpar21(trisomadelpar21)
yocurreporunaformacinimperfectadelvulo,elespermatozoideoelcigoto.Sehacomprobadoque
existeunarelacinconlaedaddelamadrey,portanto,elenvejecimientodelosvulos.
Labioleporino.Sedebealapresenciadeuncromosomaextraenelpar13(trisomadelpar13).Tam-
bintienerelacinconlaedaddelamadreyprovocaanormalidadesfsicasyretrasomental.
Sndromedelcri du chat.Enestecaso,eslaausenciadeunapequeapartedematerialgenticoenel
cromosoma15loquecausalaalteracin.Provocaretrasomental,problemasneuromuscularesyuntipo
dellantoparecidoalmaullidodelosgatos,deahsunombre.
TumordeWilms.Sedebealafaltadematerialgenticoenunadelasdoscopiasdelcromosoma11.
Losniosnacensinirisytienenmayoresprobabilidadesdepadecercncerderinenlaprimerain-
fancia.
Asociadosacromosomassexuales(estasalteracionessedanenloscromosomasquedeterminanelsexo,
esdecirenelcromosomaXquetransmitelamujeroenelcromosomaXoYquetransmiteelhombre):
SndromedeTurner.Slosedaenmujeresysedebeaunacarenciadehormonasqueprovocanuna
faltademaduracinsexual.Noseadquierenlosrasgossexualessecundarios.Noafectaalainteligencia
nialaidentidadsexual.
SndromedeKlinefelter.SlosedaenvaronesysedebeaunnmeroexcesivodecromosomasX.En
comparacin con el sndrome de Turner, hay ms probabilidades de sufrir problemas conductuales y
retrasointelectual.
Alteraciones hereditarias
La expresin de estas alteraciones depende de si se trata de genes recesivos o dominantes. Cuando son
recesivos,elgendelotroprogenitorsueleasumirunfuncionamientonormalylapersonaseconvierteen
portadoraperonopadecelaenfermedad.Lasalteracionesasociadasarasgosdominantessuelendesapa-
recerporquequieneslaspadecennosuelenllegarareproducirse.
Rasgosdominantes
CoreadeHuntington.Semanifestahacialos30o40aosy,portanto,constituyeunaexcepcin(per-
mitelareproduccinylatransmisinalasiguientegeneracin).Provocaunadegeneracinrepentinadel
sistema nervioso que da lugar a movimientos bruscos y alteraciones de las funciones cerebrales.
Rasgosrecesivos
Diabetes.Elnionotienelahormonaqueseencargademetabolizarelazcar.Setratamedianteinsu-
linayunadietaespecial.
Fibrosisqustica.Sedebealaausenciadelaenzimaqueevitaquelasmucosidadesobstruyanlospul-
mones.Haproducidomuchasmuertesinfantilesaunquelostratamientospermitenquehoyvivanhasta
laedadadulta.
Hemoflia. Est vinculada con el sexo. Se debe a la ausencia de la sustancia que coagula la sangre.
Puedeprovocardesangramientohastalamuerte.
Enfermedad de Tay-Sachs. Se debe a la falta de una enzima que disuelve las grasas en las clulas
cerebralesyproduceladesintegracindelcerebro.Losniossonnormalesalnacerperoalos8meses
sevuelveninactivos,alaosequedanciegosysuelenmorirhacialos6aos.
Fenilcetonuria.Sedebealacarenciadeunaenzimaqueconviertelafenilalaninaendesecho.Lafeni-
lalaninaesunasustanciaqueseencuentraenlalecheyenmuchosalimentos.Lacarenciadelaenzima
provocalaacumulacindelasustanciaenlasangreproduciendolesionesenelsistemanerviosoyre-
trasomentalalpocotiempodenacer.Sepuededetectardesdeelnacimientoyevitarsusconsecuencias
medianteunadietasinfenilalanina.
Anemiafalciforme.Losglbulosrojostienenunaformaanormalquedifcultaladistribucindeox-
geno y provoca dolor, infamacin de los rganos y susceptibilidad a las enfermedades respiratorias.
76 Bloque II. El desarrollo temprano
24%engemelosfraternosydel2%enhermanos.Adems,del4%delosgemelosidn-
ticosquenosufreeltrastornoel82%presentandefcienciamentalytrastornosdellen-
guaje(citadoenBrioso,2001).
Como hemos podido ver, en general, los datos sobre concordancia indican que la
herenciadealgunostrastornosnoescompletainclusoenelcasodelautismo,lacon-
cordanciaengemelosfraternosesslodel24%yque,portanto,existenmuchosotros
factoresqueincidenenlaaparicindeunaenfermedadotrastornopsicolgico.Aspues,
anteestosdatosdebemosconcluirqueloqueseheredanoeseltrastornoens,sinouna
mayoromenorvulnerabilidadapadecerlo.
2. El desarrollo prenatal
Eldesarrolloprenatalserefereatodoloqueacontecedesdelafecundacinhastaelna-
cimiento.Antes de que se pudiera observar mediante microscopio cmo el vulo y el
espermatozoideseunenformandounanuevaclula,lasteorasqueintentabanexplicar
laformacindenuevosserespostulaban,porejemplo,queelnuevoserseencontrabaya
formadoperoenminiaturadentrodelespermatozoideodelvulo.Graciasalaobserva-
cinrealizadahacealgomsdecienaosporunzologosuizo,quienvioporprimera
vez con un microscopio cmo un espermatozoide entraba en un vulo, estas creencias
pudieron desecharse. Desde entonces, las tcnicas desarrolladas han permitido conocer
muchasmscosassobrecmoeslavidaprenatalysobrelainfuenciaqueelmediotie-
neyaenestasprimerasetapasdelaformacindeunnuevoser.Hoyendaeldesarrollo
prenatal se considera una fase vital del desarrollo humano en la que el beb crece res-
pondiendoaunaseriedefactoresinternosyexternosparticulares.
Estaetapadelavidapuededividirseencuatrofases:laconcepcin,elcigoto,elem-
brinyelfeto.Acontinuacindescribiremoscadaunadeellassealandoloshitosms
importantesqueseproducen.
2.1. Etapas del desarrollo prenatal
Unavezcada28dasseproduceenlasmujereslaovulacin.Estosignifcaqueunvu-
locomienzaadesplazarsedesdelastrompasdeFalopiohaciaeltero.Enesteperodo
esposiblequeunodelosmillonesdeespermatozoidesqueproduceunhombreentreen
elvuloalmantenerunarelacinsexualylofecunde.Enrealidad,losespermatozoides
disponen de entre 24 y 48 horas para fecundar un vulo, ya que este es el tiempo que
duraelrecorridoquerealizaelvulodesdelasalidadelovario.Siningnespermatozoi-
de consigue durante estas horas fecundar al vulo, ste ser expulsado junto con otras
sustanciasenlasiguientemenstruacindelamujer.Noobstante,lafecundacinnotiene
porquproducirseenelmomentoenquesemantienelarelacinsexualpuestoquelos
espermatozoidespuedenvivirhasta5dasenlavaginadelamujer.Duranteestetiempo
losespermatozoidestienenquesuperarmuchasetapasantesdepoderalcanzaralvulo:
tendrn que recorrer una distancia de aproximadamente 30 centmetros a razn de un
centmetroporminuto,lucharcontralosglbulosblancos,noquedarseatrapadosenlas
paredesdelespacioqueatraviesanoenelcuellodelteroyelegirelovariocorrectodel
cual se desprende el vulo. De los centenares de millones de espermatozoides que se
Captulo 4. El desarrollo prenatal y el recin nacido 77
liberanenlaeyaculacinslounos500encuentranalvuloydeellos,slounolograr
atravesarlamembranaquelorecubre.
Laconcepcinseproducecuandoslounodelosespermatozoidesconsigueperforar
lacapaquerodeaalvulo.Apartirdeestemomento,lamembranadelvulosevuelve
impenetrable para los dems espermatozoides que se van desprendiendo y tienen lugar
unaseriedecambiosqumicosquepermitenlafusinentreelvuloyelespermatozoide
elegido.Apesardeloscambiosqueimpidenqueotroespermatozoidepenetre,losrecha-
zadossiguenmerodeandodurantevariosdas.Hastahacerelativamentepocosecreaque
eracuestindesuerteoazarelqueundeterminadoespermatozoideconsiguierapenetrar
enelvulo.Sinembargo,parecequeelvuloemiteunassealesqumicasquesirvende
guayayudanaseleccionaraquellosespermatozoidesqueestnmejorpreparadospara
llevaracabolafecundacin.
Durantelashorasquesiguenalapenetracindelespermatozoide,elmaterialgen-
ticodeambasclulassecombina.Recordemosqueelvuloyelespermatozoidesonlas
dos clulas del cuerpo humano que constan cada una de 23 pares de cromosomas.Al
unirseformanunanuevaclulade46paresdecromosomasquecontienetodalainfor-
macinnecesariaparadarlugaraunnuevoser.Estanuevaclulaqueformanelvuloy
elespermatozoidesedenominacigoto.Elcigotoeslaprimeraetapadelperodoprenatal
yseextiendedesdelaconcepcinhastalasegundasemanadeedad.
Muy pronto empieza un proceso a travs del cual el cigoto se divide, aproximada-
mentecada20horas,primeroendosclulas,luegoencuatro,despusenocho,etc.Al-
rededorde4dasdespusdelaconcepcin,cuandoladivisinalcanzamsomenoslas
16clulas,elcigotoseconvierteenunamrula,esdecir,enunamasacompactadefor-
maparecidaaunamora.LamruladebeirpasandoporlatrompadeFalopiohastallegar
alterodondeseimplantar.Unavezquelamasadeclulashaalcanzadoelteroco-
mienzaladiferenciacin,unprocesoporelcuallasclulasdelamrulaqueerantodas
idnticas,comienzanadiferenciarse.Estosignifcaqueempiezanaadquirirrasgospro-
pios que las hacen distintas de las dems y con una funcin especfca. El centro de la
mrula se hunde dando lugar a una esfera hueca llamada blstula y las clulas que la
componen se separan en dos grupos distintos: las exteriores formarn la placenta y las
interioresdarnlugaralembrin.
Elembrinconstituyelasegundaetapadelperodoprenatalyseextiendedesdela
tercerahastalanovenasemana.Estafasecomienzacuandosehalogradolaimplantacin
eneltero,esdecir,elengancheenlaparteinternadelteroylaconsecucindeunen-
tornoquepermitaelalimentoycrecimientodurantelosmesessiguientes.Laimplantacin
produceunaseriedecambioshormonalesenlamujercomolaretiradadelamenstrua-
cin,elaumentoderiegosanguneoenlospechosoelaumentodelatemperatura corporal.
A partir de la tercera semana, las clulas interiores de la blstula se diferencian en
tres capas de clulas que darn lugar a los rganos y estructuras vitales. En un primer
momentoseformanelectodermoyelendodermo.Lasclulasdelectodermo,quefor-
man la capa exterior, darn lugar al cerebro, la mdula espinal, el sistema nervioso, la
pielylosrganossensoriales.Lasclulasdelendodermoseencargarndelaformacin
de glndulas y rganos internos como el estmago y los intestinos. Entre ambas capas
surgeunaterceradenominadamesodermoquedarlugaralasvsceras,elcorazn,los
msculos,loshuesosycartlagos.Alfnaldeestatercerasemanaapareceryaunpeque-
ocoraznqueseconectaalasvenas.Hacialacuartasemanaempezaralatirformando
78 Bloque II. El desarrollo temprano
elprimersistemaorgnicofuncional.Tambinenlacuartasemanaseempiezanadesa-
rrollarlacabeza,losrganossensorialesyunosbultosqueluegoformarnlosbrazosy
laspiernas.Hacialaoctavasemanasehanterminadodedesarrollarlosbrazos,laspiernas
ylosdedosmientrasquetodoslosrasgosdelacaraestnyaformados.Aquelembrin
pesa aproximadamente un gramo y mide 2,5 centmetros y exceptuando los rganos
sexuales, ya cuenta con todos los rganos y caractersticas propias de un ser humano.
Todaestasecuenciadecrecimientotanbienorquestadaestbajocontrolgenticoyde-
pendedeunosgenes,denominadoshometicos,queatravsdelaformacindeprotenas
comunicanlapartedelcuerpoquesehadefabricar.
Duranteestetiempotambinlasclulasexterioresdelablstulahancreadolosso-
portesnecesariosparaelcrecimientoyalimentacindelembrin.Estasclulasdanlugar
aestructurasvitalescomoelsacoamnitico,laplacentayelcordnumbilical.Elsaco
amniticoesdondeelfuturobebsevaaalojardurantelosnuevemesesdelembarazo.
Setratadeunamembranallenadeunlquidollamadolquidoamniticoquerecubre
al embrin protegindolo y manteniendo una temperatura adecuada. La placenta es el
tejidoatravsdelcualseproduceelintercambiodenutrientes,oxgenoydesechos.Ade-
mssirvedefltroyalgunassustanciasperjudicialesparaelembrinquedanretenidas.
Por ltimo, el cordn umbilical es el conducto que une el embrin a la placenta y por
dondepasantodosloselementosqueseintercambian.
El perodo del feto dura desde la novena semana hasta el nacimiento (semana 38).
Duranteesteperodoelfetodebeprincipalmenteaumentardepesoytamaoyafanzar
lasestructurasqueyaposee.Duranteeltercermesseterminandeformarrganoscomo
elestmago,losriones,elcoraznylospulmones.Tambinalostresmeseslosfetos
tragan,digierenyorinanellquidoamnitico.Unodelosavancesquemsllamalaaten-
cines,quiz,quealfnaldeestemeselfetoyapuedemoverseyempiezaadarpatadas,
puede cerrar los ojos, fruncir el ceo y chuparse el pulgar. Durante el cuarto, quinto y
sextomesseformanelpelo,lasuasylosdientes.Ellatidodelcorazndehacemucho
msfuerteylossistemasdigestivoyexcretorempiezanafuncionarnormalmente.Elpeso
del feto aumenta mucho en estos meses y el cerebro multiplica por seis su tamao, de
formaqueyaseempiezaaobservarunaactividadelctricaparecidaaladelrecinnacido.
Enelltimotrimestredelembarazoelfetoyatienetodoslosrganosnecesariospara
sobrevivir.Enestostresltimosmesesseproduceunamaduracindelasestructurasque
ya estn creadas y han empezado a funcionar.As, aumenta la actividad cerebral y se
distinguenmomentosdesueoydevigilia.Tambinseejercitanlospulmonesyelsis-
temacardiovascular,seaumentaconsiderablementedepesoyseformaunacapadegra-
sa que proteger ante los cambios de temperatura. Se produce un almacenamiento de
alimentosyvitaminasqueayudarnalbebdurantelosprimerosdasfueradelcuerpo
delamadrehastaquelastomasdelecheseestablezcandeformaregular.Estasltimas
semanas son, sobre todo, una acumulacin de seguros para la supervivencia y la salud
durantelaprimerainfancia.
2.2. La vida del embrin y el feto
Durantemuchotiempoydadoquelaobservacindelavidaprenataleraimposible,se
pens que slo a partir del nacimiento los bebs desplegaban todas sus capacidades y
que la vida intrauterina era una especie de largo sueo interrumpido slo por algunos
Captulo 4. El desarrollo prenatal y el recin nacido 79
movimientos.Aunquecontamosconreferenciassobrelosmovimientosfetalesdesdeel
principiodelostiemposinclusoenlaBibliaaparecenreferenciasdeestetipo,has-
tafnalesdelsigloXXnosehandispuestolastcnicasnecesariasparallevaracaboun
estudio cientfco de la vida intrauterina. Gracias a las tcnicas de ultrasonido hoy sa-
bemos, por ejemplo, que la actividad del feto durante el ltimo perodo de gestacin
esmuysimilaraladelrecinnacidoyqueestaactividadcomienzaenetapasmuytem-
pranas.
Lasprincipalesobservacionesqueserealizanenlosfetostienenqueverconlosmo-
vimientoscorporales,latasacardiacaylarespiracin.Tambinhayestudiosenlosque
elfetoesestimuladoyseobservasureaccin.Losmovimientoscorporalesreferidos
alacabeza,eltroncoylasextremidades,comienzanentrelas8y9semanasdegestacin.
Enestemomentolosfetospermanecenactivosunapequeapartedeltiempo:sobreuna
horaslosemuevenun14%deltiempo.Entrelassemanas14y19devienenmuyactivos
yalobservarlosduranteunahoraproducenmovimientosduranteel90%deltiempo.En
las fases sucesivas de la gestacin el ritmo de actividad decrece y el nmero de movi-
mientossevahaciendomenor.Haciaelfnalparecequelosfetosdesarrollanunapauta
propia de actividad y que sigue decreciendo el nmero de movimientos (Kisilevsky y
Low,1998).Laspautasdeactividadincluyendiversosestadoscomoperodosdesueo,
otrosdemuchaactividadconmovimientosdetodoelcuerpoyperodosdemovimientos
regulares.
Peroqutipodemovimientosrealizaelfeto?Setratademovimientoscontrolados
yvoluntariosomsbiendemovimientosrefejos?Algunosautoreshanmantenidoque
losprimerosmovimientosdelembrinyposteriormentedelfetosonunrefejodelaac-
tividadneuronal.Noobstante,todavanosehanidentifcadolasestructurasneuronales
subyacentesqueposibilitandichosmovimientosnisesabeconexactitudsufuncionali-
dad.Unaposiblehiptesisacercadelafuncionalidadespensarquegraciasalosmovi-
mientosqueserealizanenestaetapa,lasestructurassedesarrollancorrectamente.Esta
hiptesis permite establecer una doble direccin entre el rgano y la funcin. Es decir,
porunaparte,elrganodebedesarrollarsedeunadeterminadamaneraparaquepueda
darselafunciny,alavez,lafuncinpermitequeelrganosedesarrollecorrectamente.
Apesardelaescasacertezaconquesecuenta,sehanestablecidoenembrionesyfetos
dostiposdemovimientos:losmovimientosespontneosylosmovimientosrefejos.Los
primerossonmovimientosquenorespondenaunaestimulacinyestnasociadosala
funcionalidaddelasestructuras.Lossegundosaparecencomorespuestaaalgnestmu-
lo,estnasociadosalasupervivenciaenelnacimientoyalgunosdeellossemantienen
alolargodetodalavida.Apartirdelsegundomesdegestacinyaseobservanmovi-
mientos espontneos como sobresaltos, sacudidas de las extremidades, estiramientos,
movimientosdelosdedos,movimientosdemandbulaymsadelantemovimientosr-
pidosylentosdeojos.Entrelosprincipalesmovimientosrefejosaparecenlarotacinde
cabeza,elhipo,larespiracin,lasuccinyladeglucinoelbostezo.Lamayorpartede
ellostambinempiezanaproducirseapartirdelosdosmesesdegestacin.
Laobservacindelarespiracinresultainteresanteporqueponedemanifestohasta
qupuntolaactividaddelfetoestinfuenciadaporlosestmulosambientales.Lospri-
meros movimientos respiratorios se observan a partir de las 10 semanas y varan a lo
largodelagestacinenfuncindelamaduracindelospulmonesydeloscentrosdel
sistemanerviosocentralqueregulanelsueoylarespiracin.Adems,comoacabamos
80 Bloque II. El desarrollo temprano
demencionar,sehanobservadocambiosenfuncindealgunosestmulosexternos.Por
ejemplo,sehaobservadoundescensoenlatasarespiratoriatraslaingestadealcoholpor
partedelamadreyunaumentocuandoseproduceunexcesodedixidodecarbonoen
la sangre, un aumento de glucosa o se ingiere caf (Kisilevsky y Low, 1998).Tambin
enanimalessehanobservadovariacionesenfuncindelapresenciadealgunasdrogas
ymedicamentoscomobarbitricos,anestesia,etc.Porltimo,latasaderespiracinest
infuida por el parto.Tres das antes de que se vaya a producir el parto se observa una
disminucinenlatasarespiratoriaydurantelasfasesactivasdelpartounaausenciade
respiracin.
Ademsdelosmovimientosdelfeto,algunossistemassensorialescomienzanafun-
cionarmuchoantesdelnacimiento.Estoscanalespermitenalgunacomunicacinentrela
madreyelbebascomoentreelbebyelmedioexterior.Apartirdelasptimasema-
naeltactoyaparecefuncionarcomocanalsensorial.Mstarde,hacialaundcimasema-
na,elgustoyelolfatoseactivanyelbebpercibesaboresyolorescuandotragalquido
amnitico.Entrelas23y25semanasdegestacin,losbebspercibensonidosaunqueno
estdeltodoclaroculeselumbralmnimoquenecesitanparapercibirlospareceque
enelmediointrauterinoelsonidoseatenaentre20y70decibelios.Lasinvestigaciones
realizadasponendemanifestounaumentoderespuestasantesonidosdesdeun30%de
losfetosalas24semanasaun97%alas37semanas.Esdecir,tras37semanasdeges-
tacinenlamayorpartedelosfetosseobservanaceleracionesdelatasacardiacaomo-
vimientoscorporalescomorespuestaaunestmuloauditivo.
Lapuestaenmarchadelsistemaauditivohapermitidorealizarunaseriedeexperi-
mentosquehanmostradoquedurantelagestacinelsistemacognitivodelfetotambin
esactivo(vanse Captulos 5 y 6).Mediantelastcnicasdepreferenciasyhabituacin,
quedescribiremosenelcaptulosiguiente,algunostrabajoshanencontradoquefetosde
entre26y34semanaspuedendiscriminarsonidosformadosporseriesdevocalesycon-
sonantescomobabiybiba.As,lastasascardiacasvaranenfuncindequeelfeto
escuche un sonido al que ha sido habituado frente a uno desconocido (Lecanuet et al.,
1989,citadoenKisilevskyyLow,1998).Deigualforma,recinnacidosdepocosdas
discriminanlavozdesumadrefrenteaotrasvocesdesconocidasypreferenescucharun
relatoledoporsumadredurantelasltimassemanasdegestacinfrenteaotrodesco-
nocido(DeCasperyFifer,1980;DeCasperySpence,1986).Estasmanifestacionescog-
nitivastempranasindicanquehaciaelfnaldelagestacinlosfetosyadisponendeal-
guna capacidad, aunque sea muy rudimentaria, de atencin y percepcin selectiva, de
memoriaacortoplazoydeaprendizaje.
2.3. Apuntes sobre teratologa
Apesardelaproteccinquerganoscomolaplacentaproporcionanalembrinyalfeto,
elcrecimientodeunserhumanoestafectadodesdeelinicioporfactoresexternos.Al-
gunos,comolaalimentacindelamadre,sonimportantsimosparaeldesarrollo.Otros
sonelementostxicosovirusquelaplacentanoescapazdedetenerypuedencondicio-
narlasaluddelbeb.Losfactoresnogenticosquepuedenalterareldesarrollodelem-
brinyelfetosedenominanteratgenosysonestudiadosporlateratologa.Aconti-
nuacin presentamos un resumen de los principales teratgenos que se conocen y los
efectosquecausaneneldesarrolloprenatal.
Captulo 4. El desarrollo prenatal y el recin nacido 81
Tabla 4.3. Efectos de los principales teratgenos (adaptado de Vasta, Haith y Miller, 1996)
Teratgeno Efectos potenciales
Condicionesdelamadre
Edad AumentodeprobabilidaddesndromedeDown.Adolescentesymayo-
resde35aossuelentenerbebsconmenospeso.
Diabetes Triplica las posibilidades de todo tipo de alteraciones, incluyendo el
nacimientosincerebro,espinabfdaydefectosenelcorazn.
Malnutricin Aumenta la probabilidad de retraso en el crecimiento, prematuridad,
problemasdeatencinypocacapacidaddeinteraccinsocial.
Fenilcetonuria Retrasodelcrecimientodelacabezayelcerebro.Retrasomentalyde-
fectosenelcorazn.
Enfermedadesinfecciosas
Sida Deformacionescongnitas.Vulnerabilidadatodotipodeinfecciones.
Rubola Retrasomental,daoenlosojos,sordera,defectosenelcorazn.
Sflis Retrasomental,aborto,ceguera,sordera,muerte.
Toxoplasmosis Anomalasenelcrecimientodelacabezayelcerebro.Retrasomental.
Herpes Retrasomental,daoenlosojos,muerte.
Medicamentos
Aspirina Engrandescantidadesprovocaaborto,hemorragias,problemasrespira-
toriosenelrecinnacido.
Barbitricos Problemasrespiratoriosenelrecinnacido.
Talidomida Miembrosdeformes,dfcitssensoriales,defectosenrganosinternos,
muerte.
Tetraciclina Manchasenlosdientes.Puedeinfuirenelcrecimientodeloshuesos.
Drogas
Tabaco Retrasoenelcrecimiento,prematuridad.
Alcohol Daos en cerebro y corazn, retraso en el crecimiento, retraso mental,
sndromedelalcoholfetal.
Cocanaycrack Retrasoenelcrecimiento,prematuridad,irritabilidad,sntomasdeabs-
tinencia.
Heronaymetadona Retrasoenelcrecimiento,prematuridad,irritabilidad,sntomasdeabs-
tinencia,muertesbita.
LSDymarihuana Probableretrasoenelcrecimientoynacimientoprematurosiseconsu-
memucho.
Medioambientales
Plomo Aborto,anemia,retrasomental.
Mercurio Crecimientoanormaldecabezaycerebro,faltadecoordinacinmotriz
yretrasomental.
Radiaciones Leucemia,crecimientoanormaldecuerpoycerebro,cncer,alteracio-
nesgenticas,abortoynacimientodelniomuerto.
3. El recin nacido
Entrelasemana38y40degestacinseproduceelnacimientollamadoatrmino.Este
eselperodoqueseconsideranormalparaqueunbebnazca,puestoquehaalcanzado
elgradodemadureznecesarioparasobrevivirfueradeltero.Parecequeelpropiobeb
82 Bloque II. El desarrollo temprano
es quien provoca su nacimiento liberando una hormona en la sangre de la madre que
desencadenaelprocesodelparto.Amenudoesteprocesohasidodescritocomotraum-
tico para el beb. En realidad, el nacimiento es ms intenso para el beb que para la
madrepuestoquesoportaaltsimosnivelesdeadrenalina.Ademselbebsevesometi-
El 10 % de los bebs que nacen en Espaa son prematuros. Segn los criterios de la
OMS, un beb se considera prematuro cuando nace antes de la semana 37 de gesta-
cin. No obstante, dentro de esta etiqueta se agrupan casos muy dispares que presen-
tan rasgos especcos que los hacen incomparables. As por ejemplo, no tiene nada que
ver un beb prematuro nacido en la semana 26 de gestacin con un peso de 600 gra-
mos con otro nacido en la semana 36 con un peso de 2 kilos.
Algunos trabajos se han dedicado a establecer las consecuencias que tiene el naci-
miento prematuro en diversos mbitos del desarrollo. En lo que respecta al desarrollo
cognitivo, parece que la consecuencia ms importante tiene que ver con la integracin
de informacin compleja, el razonamiento lgico y la capacidad para orientarse en el
espacio. El problema de la integracin de informacin suele ir unido a un problema de
dcit de atencin aunque no parece que los nios prematuros sean hiperactivos.
Desde el punto de vista de la personalidad, los nios prematuros parecen tener un
temperamento ms frgil, sobre todo durante el primer ao de vida. Esto signica que
tienen ms dicultades para adaptarse a los cambios, tienen peor humor, son ms agi-
tados y menos regulares en sus ciclos de actividad y reposo. Estos rasgos de personalidad
pueden dicultar el establecimiento de una relacin satisfactoria con los padres. Por otra
parte, hay que sealar que los nacimientos prematuros suelen generar estrs y angustia
en ambos padres y, especialmente, un sentimiento de culpa en la madre. Estos factores
originan en muchas ocasiones una depresin postparto en la madre lo que, a su vez,
puede dicultar el establecimiento del vnculo afectivo. Algunos estudios sealan que
durante las primeras interacciones con sus bebs, estas madres detectan peor las sea-
les emitidas por el beb provocando menos vocalizaciones, miradas y sonrisas que las
madres de bebs nacidos a trmino. No obstante, estas diferencias en las primeras in-
teracciones van disminuyendo con el tiempo, de forma que a los 9 meses ya no se
encuentran discrepancias entre las madres de bebs prematuros y las de bebs nacidos
a trmino.
Desde el punto de vista del contexto social, los nios prematuros parecen ser ms
sensibles a los cambios que se producen en su entorno por ejemplo, divorcios, cam-
bios de cuidadores, nacimiento de hermanos o cambios de residencia. Tambin parecen
tener ms dicultades para establecer relaciones con los dems y, sobre todo, para
construir una visin positiva sobre s mismos. A pesar de todos estos problemas, hemos
de terminar esta breve visin de los nios prematuros de forma positiva. Por una parte,
estos problemas de relaciones sociales y autoestima ya no se detectan en la edad adul-
ta. Por otra, algunos de los adultos que fueron bebs prematuros se perciben como
personas excepcionalmente fuertes puesto que, a pesar de las desventajas con las que
nacieron, han conseguido superar las dicultades y llevar una vida completamente nor-
malizada en una sociedad que pone a su disposicin una gran cantidad de recursos para
su cuidado y educacin. Quiz habra que estudiar si el nacimiento prematuro tiene
consecuencias en sociedades que no disponen de tantos recursos para compensar todas
estas desventajas.
CONLOSPIES
ENLATIERRA
Bebs prematuros: consecuencias
a corto, medio y largo plazo
Captulo 4. El desarrollo prenatal y el recin nacido 83
doaimportantesvariacionesfsicas.Enprimerlugar,pasadeunmediooscuro,lquido,
atemperaturaconstanteyconsonidosamortiguadosaotroluminoso,conaire,msfro
yruidoso.Porotraparte,apartirdelnacimientoelbebdeberalimentarseyrespirarpor
ssolo,dostareasparalasquedurantenuevemesesharecibidounimportanteapoyo.
Ladesaparicindeelementoscomolaplacenta,elcordnumbilicalyellquidoam-
niticoponenporprimeravezenmarchaalgunosdelosrganosfundamentalesparala
vida.Elbebexpulsarenelcanaldelpartoellquidoamniticoqueinundasuspulmo-
nes.Elprimerllantoserunademostracindequeelairehaentradohastalospulmones
ysehaexpulsadoporlanarizylaboca.Alcortarelcordnumbilicalelsistemacircu-
latorioempezarafuncionarporssolo.Estoprovocaunaumentodelapresinsangu-
neaqueseestabilizarslovariosdasmstarde.Alavezlatemperaturaexteriordismi-
nuye respecto de la del tero en ms de diez grados y el beb tendr que controlar y
mantener su temperatura corporal de manera autnoma. La poca grasa subcutnea del
recinnacidohacequeestatareasupongaundesgastedeenergaadicional.Porltimo,
a partir de ahora el beb necesitar alimentarse y eliminar desechos. Para alimentarse
cuenta un movimiento fundamental para su supervivencia: el refejo de succin. Ms
adelanteveremoslosrefejosconlosqueelrecinnacidollegaalmundoyquelesirven
comogarantadesupervivenciaenlosprimerosmomentosdevida.SiguiendoaDelval
(1994), a continuacin vamos a describir al recin nacido enfatizando sus capacidades,
esdecir,lossistemasconlosquecuentadesdeeliniciodelavidapararelacionarsecon
elmedioexterior.
3.1. Estados y ritmos
Alobservarunrecinnacidopodramospensarquesetratadeunserpocoorganizado,
querealizamovimientosdescontroladosyquenorespondeacasiningnestmuloexter-
no.Estaideaes,sinembargo,falsa.Elrecinnacidosuelellegaralmundomuydespier-
to.Lasdosotreshorasquesiguenalpartoconstituyenunperodoenelqueelbebest
muyatentoaloqueocurreasualrededor.Desdeestemomento,sesucedernenelbeb
diferentesestadossujetosaritmosnaturalesqueirnvariandoconeltiempoygenerarn
pautasdesueo,vigilia,actividadyalimentacin.Sehandescritoenelrecinnacidoseis
posiblesestados:sueotranquilooprofundo,sueoligerooactivo,somnolencia,alerta
inactiva,alertaactivayllanto.
Aunquelosritmosdelbebenunprincipionocoincidenconlosdeladulto,pocoa
pocosevansincronizando.Enelinicio,elciclodesueotranquiloyactivoserepitecada
50o60minutosylosciclosdevigiliasedancada3o4horas.Entrelos3y4mesesla
pautadesueonocturnoyvigiliadiurnasueleestarestablecidaconclaridadyaunqueel
bebduermelasmismashoras,lohacedeformaseguidadurantelanoche.
Los estados de sueo tambin van cambiando con el tiempo. Las ondas cerebrales
que produce un feto a las 29 semanas de gestacin, al comparar los perodos de sueo
tranquiloyactivo,sonmuysimilares.Alostresmesesdeedad,losbebsmuestranpau-
tasdeondascerebralesmuydiferenciadasparacadatipodesueo.Elsueoactivoesel
denominado sueo REM, en el que se producen movimientos corporales irregulares y
movimientosdelosojos,larespiracinesirregularylosadultossoamos.Elsueotran-
quiloeselllamadosueonoREM,querepresentael80%delsueototaleneladultoy
enelquelaactividadesmsbajasinproducirsemovimientosoculares.Eltiempodeuno
84 Bloque II. El desarrollo temprano
uotrotipodesueotambinsemodifcaconlaedad(vaseFigura4.2).Mientrasqueun
feto de 25 semanas casi slo tiene fases de sueo activo, el recin nacido distribuye la
mitad del tiempo de sueo en activo y la otra mitad en tranquilo.A los tres meses el
tiempodesueotranquilodoblaaldesueoactivoy,comoacabamosdemencionar,en
el adulto el sueo tranquilo representa el 80% del sueo total.As pues, a lo largo del
desarrolloseproduceunadisminucinprogresivadelsueoactivo.Estepredominioen
lasfasestempranashallevadoapensarqueelsueoactivocumplealgunafuncinenel
desarrollocerebral.Aunquenopodemossabersilosbebssuean,sparecequedurante
elsueoactivoserealizanconexionesneuronales.Adems,estaactividadpodrasuplir
la escasa estimulacin externa que el beb recibe en los primeros momentos de vida
manteniendo el sistema nervioso en activo. De acuerdo con este planteamiento, parece
quelosbebsquetienenperodosdevigiliamslargos,yportantorecibenmayoresti-
mulacin externa, tambin tienen perodos de sueo activo ms cortos (Vasta, Haith y
Miller,1994).
0
2
4
6
8
10
12
14
16
18
1
-
1
5

a
s
3
-
5

m
e
s
e
s
6
-
2
3

m
e
s
e
s
2
-
3

o
s
3
-
5

o
s
5
-
9

o
s
1
0
-
1
3

o
s
1
4
-
1
8

o
s
1
9
-
3
0

o
s
3
3
-
4
5

o
s
5
0

o
s
9
0

o
s
Edad
H
o
r
a
s

d
e

s
u
e

a
l

a
HorassueoREM
HorassueonoREM
Figura 4.2. Las horas de sueo activo (REM) representan la mitad de las horas de sueo de
un recin nacido y van sufriendo un continuo descenso a lo largo del ciclo vital
(adaptado de Roffwarg, Muzio y Dement, 1966).
3.2. Sistemas para recibir informacin: los sentidos
Comohemosvistoenelapartadodedicadoaldesarrolloprenatal,algunossentidosestn
yaenfuncionamientodurantelavidaintrauterina.Elodo,eltacto,elolfatoyelgusto
empiezanarecibirestmulosmuchoantesdelnacimientodelbebyconstituyenunmodo
deinteractuarconelmedio.Elodoestcasitandesarrolladoenelmomentodenacer
Captulo 4. El desarrollo prenatal y el recin nacido 85
comoeldeladultoyelrecinnacidosercapazdereconocersonidoscomolavozdela
madre o tranquilizarse con sonidos rtmicos que le recuerden el latido del corazn que
escuch durante meses.Adems, en muy poco tiempo los bebs podrn diferenciar su
lenguamaternafrenteaotrosidiomasaunque,evidentemente,noentiendanellenguaje
(vase Captulo 6).Estadiferenciacinponedemanifestounatempranacapacidadpara
registrarelritmo,laentonacinyelfujodepalabras.
Elsentidoqueseencuentramenosdesarrolladoenelmomentodenacereslavista.
Esposiblequeelmediolquidoyelpocoespaciodequedisponeelfetonolepermita
practicarconestesentido.Lavisindelrecinnacidoesmuyborrosa:porunaparte,
nopuedesuperponerlasimgenesdelasdosretinasyverdobledurantealgntiempo.
Por otra, no puede enfocar los objetos que se encuentran a ms de 20 centmetros de
distancia. Para llegar a tener una visin adecuada, los msculos de los ojos necesitan
trabajardeformaaceleraday,dehecho,alastressemanasdevidasonlosmsactivos.
Aunquelavisindelbebesdemomentopococlara,sinembargotambinpresentaal-
gunas ventajas. La capacidad de enfocar a distancias tan cortas le permite observar el
rostrohumano,principalmenteelrostrodelamadremientraslealimenta.Comoveremos
en el prximo captulo, los recin nacidos parecen preferir las caras humanas frente a
cualquierotrotipodeestmulovisualylossonidosdevoceshumanasfrenteacualquier
otro tipo de sonido. Esta predisposicin hacia lo humano puede constituir un seguro
devidaqueayudealasupervivenciayenelcasodelavista,estaraadecuadamenteajus-
tadoaltipodeestmuloquesedebepercibir.Porotraparte,elrecinnacidoaprecialos
contrastesmsmarcadosysienteatraccinporlosobjetosquesemueven.Deigualfor-
ma,estapreferenciaporelmovimientopudoconstituirunelementodeseguridadfrente
aalgunospeligroscomolospredadoresyayudaadesarrollarlasreasvisualesdel
cerebro.
Endefnitiva,aunqueelprincipalsistemasensorialporelqueelserhumanorecibe
informacinsobreelmundotardaruntiempoenajustarse,elrecinnacidocuentacon
unaseriedesistemasquelepermitenrecibirinformacindelmundoenelquevive.Esta
recogidadeinformacinesbsicaparaeldesarrollodelcerebro,paraempezaraestable-
cerrelacionessocialesyparaconocerelcontextoenelqueelbebaprenderavivir.
3.3. Sistemas para actuar en el mundo: los reejos
Ademsdelossentidospararecibirinformacin,elrecinnacidocuentaconunaserie
derespuestasinvoluntariasprogramadasparaactivarseanteciertosestmulos.Estasres-
puestasdenominadasrefejasconstituyenlaformadeactuarsobreelentornoconlaque
elbebvienealmundo.Losrefejosdaninformacinsobreelestadodelsistemanervio-
so y del recin nacido en general cuando nace. Las pruebas que se les realizan en los
minutosquesiguenalnacimientotienencomoobjetivocomprobarsidisponendetodo
elrepertorioderefejos.Algunosdelosrefejossonfundamentalesparalasupervivencia
eldesuccinyelrespiratorio,porejemplomientrasqueotrosindicanunbuenes-
tadoalnacercomoelrefejodenatacinoeldelamarcha.
Losrefejosqueposeeelbebsepuedenclasifcarentresgrupos(vaselaTabla4.4
paraunadescripcindecadauno).Unos,comoelrespiratoriooelparpadeo,permanecen
alolargodetodalavida.Otros,losquemshaninteresadoalospsiclogosevolutivos,
sepierdenunosmesesdespusdelnacimientoysevuelvenaaprendermstardedefor-
86 Bloque II. El desarrollo temprano
mavoluntaria.Porejemplo,elrefejodelamarchadesaparecealostresocuatromeses
yelnioaprenderaandardeformavoluntariahaciaelaodevida.Igualmente,elre-
fejodenatacinqueelbebposeeenelmomentodenacersepierdealosseismesesy
el nio tambin aprender a nadar aos ms tarde. La funcin de estos refejos no est
nadaclaraperosesuponequesonrestosdenuestropasadoanimalquehansobrevivido
alolargodemillonesdeaos.Eltercergrupoderefejossonaquellosquesemanifestan
en el nacimiento y desaparecen a los pocos meses sin volver a aparecer nunca ms. El
refejo de Babinsky, el refejo del Moro o el de prensin plantar forman parte de este
grupo.
Tabla 4.4. Algunos reejos del recin nacido
Reejo Estimulacin Respuesta
Succin Introducirunobjetoenlaboca. Movimientosdesuccinrtmicos.Accinvoluntariaa
los4-6meses.
Bsqueda Contactoconlamejilla. Movimientodecabezaparasituarenlabocaelobjeto
estmuloeiniciodemovimientosdesuccin.Desapa-
recehacialos3-4meses.
Prensin Contacto con la palma de la
mano.
Cierra la mano con prensin del objeto, si es posible.
Desaparecehacialos3-4meses.
Prensi n
plantar
Contactoenlabasedelosdedos
delpie.
Flexindelosdedosconprensindelobjeto,siespo-
sible.Desapareceentrelos8-12meses.
Marcha Sostenido verticalmente con los
piessobreunasuperfciedura.
Inicia movimientos de marcha. Desaparece hacia los
2-3meses
Ascensin Sostenido verticalmente frente a
unobstculo,comounescaln.
Levantaelpie,confexinderodilla,comoparasalvar
unobstculo.Desaparecehacialos2-3meses
Reptacin Apoyado sobre el vientre y con
unaresistenciaenelpie.
Inicia movimientos coordinados de brazos y piernas
parareptarsobreelsuelo.Desaparecehacialos4meses.
Natacin Sostenidohorizontalmentesobre
elestmagoenelagua.
Movimientossincronizadosdebrazosypies.Desapa-
recehacialos6meses.
Babinski Presinsuavesobrelaplantadel
pie,deltalnhacialosdedos.
Extensin de los dedos del pie en forma de abanico,
seguidadefexindelosdedos.Desaparecehacialos
12meses.
Parpadeo Luzfjasobrelosojos. Cierredelosojos.Permanecetodalavida.
Patelar Golpedebajodelarodilla. Extensin de la pierna hacia delante. Permanece toda
lavida.
Cervical Tendidobocaarribasegiralaca-
bezahaciaunlado.
Extensin del brazo y pierna de ese lado y fexin de
los otros dos. Los ojos siguen la direccin del brazo
extendido.Apareceyaeneltero;desaparecealos3-4
meses.
Moro Sonido intenso, prdida de sus-
tentacin,golpesobrelasuperf-
ciedeapoyodelnio.
Aperturayluegocierredebrazosypiernas,concierre
demanossobrelalneamediadelcuerpo.Desaparece
hacialos6meses.
Captulo 4. El desarrollo prenatal y el recin nacido 87
Lasuccinesunodelosrefejosmsimportantesqueposeeelrecinnacido.Gracias
aestaconductaautomtica,elbebpodralimentarsesuccionandoelpezndelamadre
olatetinadelbibern.Noobstante,alcabodeunosmeses,elbebsehabrconvertido
enunexpertosuccionadorysercapazdeadaptarelmovimientoalosdiferentestipos
deobjetosquequierechupar.Lasuccinseconvierteasenunmecanismoatravsdel
cualexplorarlosobjetosysuspropiedades.Comoveremosenelsiguientecaptulo,Pia-
getprestunagranatencinaestaconductavoluntariapuestoquesetratadelaprimera
accincomplejaqueelbebpuedeadaptaralasvariacionesquepresentanlosobjetos.
Laprensin,queenunprincipiotambinsemanifestacomounarespuestarefejacuan-
dounobjetopresionalapalmadelamanodelbeb,seconvierteenunaconductavolun-
tariayadaptadaalascaractersticasdelobjetoquesequiereagarrar.Comoveremosms
adelante,elesquemadeprensindelbebvaracuandocogeunsonajeroocuandocoge
unapelota.Estosrefejostransformadosenaccionesvoluntarias,controladasyadaptadas
sonlasquepermitencomenzaraexplorarelmundoyapartirdelascuales,segnalgunas
teoras,seconstruyentodoslosesquemasdepensamientoquedarnlugaralasmodali-
dadesderazonamientomscomplejasquemuestraelserhumano.Aspues,venirdota-
dodeestasconductasinvoluntariasesesencialparapoderllevaracabolagranempresa
queconstituyeeldesarrollodelpensamiento.
3.4. Sistemas para transmitir informacin: el llanto y la sonrisa
Elllantoesunapotentearmaconlaqueelbebllegaalmundo.Paraunadultoesmuy
difcilquedarseindiferenteanteelllantodeunbeby,normalmente,sedesplieganuna
seriedeconductasencaminadasacalmarlo.Adems,elllantoprovocainclusorespuestas
fsiolgicasenlamadrecomounaumentodelritmocardiacoyunaumentodelasegre-
gacindeleche.Dadoqueeladultosueleresponderdeformacasiinmediataalllantodel
beb, ste aprende pronto que dispone de un instrumento que le permite controlar su
medio. Por otra parte, el llanto constituye un mecanismo de aprendizaje.A travs del
llanto el beb consigue que el adulto le acerque el mundo cuando l todava no puede
desplazarseporsmismoparaexplorarlo.
Enunprincipioelllantoqueemitenlosrecinnacidosesmuybsicoypresentaca-
ractersticastpicasderitmoygrado.Cuandoexistenalteracioneslosbebspuedenemi-
tirtiposdellantodiferentes.Porejemplo,losbebsconproblemascerebrales,desnutri-
dosyprematurospuedenproducirllantosdefrecuenciamsaltayconritmosanormales;
tambin los recin nacidos con sndrome de Down suelen emitir llantos atpicos y los
bebsconelsndromedelcri du chat o grito del gato secaracterizan,entreotrascosas,
porque su llanto recuerda al de los gatos (Vasta et al., 1996).As pues, el llanto es un
indicadordelfuncionamientodelsistemanerviosocentral.
Muyprontolosbebsseespecializaneneltipodellantoqueemitenysusignifcado
vara.Engeneral,sedistinguentresocuatrotiposdellanto:elllantodehambre,elllan-
todedolor,elllantoquereclamaelcontactohumanoyeldemiedooenfado.Estosllan-
tosvaranenintensidad,ritmoentrelossollozosymaneradecomenzarylosadultosson
capacesdereconocerlosbasndoseenestasdiferencias.
Lasonrisaesotroinstrumentoquelosbebsaprendenamanejarmuypronto.Enun
principio,lasonrisadelosrecinnacidosesungestoinvoluntarioqueslorefejabien-
estar,perohacialosdosmesesapareceladenominadasonrisasocialqueconstituyeuna
88 Bloque II. El desarrollo temprano
pautaaprendida.Estenuevogestoseaprendealasociarseconunarespuestaexternapo-
sitiva,esdecir,conlareaccindeadmiracinyalegraqueexpresanlosadultoscuando
venaunbebsonrer.Apartirdeah,elbebaprenderquecuantomssonremsre-
fuerzorecibe.Apartirdelostresacuatromeseslassonrisassehacenmsampliasylos
bebsempiezanarer,sobretodoensituacionesdeinteraccinsocial.Estaspautas,que
parecenseruniversales,soneliniciodelavidaemocionalquelosbebsdesplieganprc-
ticamentedesdeelnacimiento.
Figura 4.3. Los recin nacidos sonren de forma reeja mientras que al cabo de dos o tres
meses sonren de forma voluntaria para establecer contacto y relacionarse con los
dems.
3.5. El cerebro del recin nacido
Elcerebrohumanoestalprincipiomsdesorganizadoqueeldecualquierotraespecie.
Estosignifcaqueaunquealnaceryadispongadeloscienmilmillonesdeclulasner-
viosas,todavafaltanporestablecerselamayorpartedelasconexionesquesernvitales
paraeldesarrollo.Estadesorganizacininicialpodrapareceruninconveniente,puesto
quenecesitadeunperododedesarrollopostnatalmuchomslargo.Sinembargo,cons-
tituye una ventaja porque permite un desarrollo mucho ms fexible, es decir, mucho
menossujetoaladeterminacingenticaymuchomsabiertoalaexperiencia.Lasex-
perienciasquelosbebsvanregistrandoapartirdelnacimientosonlasqueconformarn
granpartedesusconexionesneuronalesylaenormevariedadyespecifcidaddeviven-
ciasexplicaquelaconfguracindecadacerebrohumanoseanica.
A pesar de la plasticidad y fexibilidad que acabamos de mencionar, el cerebro hu-
manonoposeeestructurasopartesdiferentesdelasencontradasenotrasespecies,espe-
cialmente en los primates.As, las principales diferencias entre nuestro cerebro y el de
losprimatessonsumayorvolumensobretodoenlacortezacerebral,sulentodesa-
rrolloyeldisfrutardeunlargoperododeplasticidadpostnatal.
El cerebro comienza a formarse durante la vida intrauterina. La mayor parte de las
neuronasseproducenentrelassemanas12y28degestacin.Laproduccindeneuronas
esenunprincipioexcesivaymstardeelpropiocerebroseencargardeajustarsun-
mero.Todaslasneuronasseproducencercadelcentrodelcerebroyluegodebenemigrar
Captulo 4. El desarrollo prenatal y el recin nacido 89
haciaelexterior.Aunquesedesconoceelmecanismoporelqueseproduceestefenme-
nomigratorio,ssesabequefnalizahacialossietemesesdegestacin.Unavezquelas
neuronashancompletadolamigracinempiezanaformarconexionesconotrasneuronas.
Elprocesodeestablecimientodeconexionesconotrasneuronasdenominadassinap-
sisquecomienzaenlasfasesdedesarrolloprenatalseprolongaalolargodemuchos
aos y se producen muchas ms conexiones de las que luego se mantienen en la vida
adulta.Lassinapsisqueseestablecendurantelaetapaprenatalsedebenaunaactividad
cerebralgeneradadeformaintrnsecayespontnea,mientrasqueeneliniciodelavida
postnatallaactividadcerebralserealizagraciasalainformacinrecibidamediantelos
sentidosylaactividadmotora.
Nervios
craneales
Cerebro medio
Cerebelo
Cerebelo
Cerebelo
Cerebelo
Cerebro anterior
Cerebro
anterior
Mdula espinal
Cerebro
medio
Cerebro
anterior
Cerebro
anterior
Cerebro medio
(escondido)
Mdula
11 semanas Nacimiento
7 semanas 3 semanas
Figura 4.4. Evolucin del cerebro en distintos momentos del embarazo.
Sibienlaactividadcerebralyaexistedurantelagestacin,esdurantelosdosprime-
ros meses de vida cuando el cerebro alcanza su mayor nivel de actividad. Durante los
doce primeros meses el cerebro crece ms rpido que cualquier otro rgano y llega a
alcanzarlostrescuartosdeltamaodeuncerebroadulto.Entreelnacimientoylavida
adulta, el tamao del cerebro se habr cuadruplicado. El desarrollo del cerebro no se
producedeformauniformealolargodeltiempo,sinoqueexistenperodosdeunaacti-
vidadespecialysecorrespondenconlosdenominadosaceleronesdeldesarrollo.Estos
aceleronesdeldesarrollotienenqueverconmomentosenlosqueseobservancambios
conductualesyenelrazonamientoquemarcanetapascualitativamentediferentes.Sehan
observado acelerones del desarrollo entre los 3 y los 10 meses, hacia el ao y medio,
90 Bloque II. El desarrollo temprano
entrelos2ylos4aos,entrelos6ylos8,entrelos10ylos12yentrelos14ylos16
aos(Corral,2001).Muchosdeestosmomentoscoincidenconloscambiosdeperodo
queobservPiaget(vase Captulo 2),locualponedemanifestolarelacinqueexiste
entremaduracinneurolgicaycambioconductual.
Otroacontecimientoligadoalamaduracindelcerebrotienequeverconelproceso
de mielinizacin. La mielina es una sustancia que recubre una parte de las neuronas y
facilitalaconduccindelimpulsoelctrico.Adems,lamielinizacinesunodelosfac-
tores que contribuyen al aumento del volumen del cerebro que se observa durante el
desarrollo.Mientraselcerebrosiguemadurandotambinsigueproduciendomielina,de
formaqueestaproduccinvaraenfuncindelasreascerebrales.Porejemplo,lasreas
que controlan la adecuacin de los movimientos motores siguen produciendo mielina
hastalos4aos,mientrasquelasqueregulanlaatencinylaconciencialosiguenha-
ciendohastalapubertad.
Comohemosmencionadoantes,elcerebrohumanorealizamuchasmssinapsisde
lasqueluegoconserva,observndoseperodosdeestablecimientosdesinapsisyotrosde
prdidas de sinapsis. Estas prdidas se traducen en una disminucin de la densidad si-
npticayseproducen,sobretodo,hacialapubertad(vase Captulo 14).Elprocesode
prdida de sinapsis comienza en las reas sensoriales. El cortex visual se iguala al del
adultohacialos11aosmientrasqueelcortexfrontal,queseocupadelaplanifcacin
delasacciones,lashabilidadesintelectualesmscomplejasylainhibicindeconductas
inapropiadas,lohacehacialos16.Laexperienciaesloquedeterminaqueciertassinap-
sis se conserven y otras se pierdan.As, las sinapsis que no se utilizan son las que se
pierdenylasqueresultantilesparanuestravidasemantienen.Unejemplorelacionado
conellenguajepuedeilustrarbienestemecanismo.Hastalosseismeseslosniospueden
discriminar cualquier sonido perteneciente a diferentes lenguas. Los bebs nacidos en
nuestropasyqueescuchanespaol,discriminansonidoscomoeldelaesesonoraque
noexistenennuestralengua.Igualmentelosbebsjaponesessoncapacesdediscriminar
laerresimpledenuestralenguaquenoexisteenjapons.Apartirdelosseismeses,los
niosquesloescuchenyaprendanespaolempezarnaperderlacapacidadparadis-
criminarlaesesonoraylosniosjaponesesquenoaprendanespaoltampocopodrnya
discriminarlaerre.Esdecir,elcerebrovieneenunprincipiopreparadoparaqueapren-
damoscualquierlenguaynospermitediscriminarcualquiersonido.Unavezquenuestra
lengua materna empieza a instaurarse, el resto de sonidos que podramos discriminar
resultanenrealidadintilesy,portanto,sepierdelacapacidadparadiferenciarlos.
Lecturas complementarias
Field,T.(2004).Primera infancia.Madrid:Morata.
MacFarlane,A.(1998).Psicologa del nacimiento.Madrid:Morata.
Rochart,P.(2004).El mundo del beb.Madrid:Morata.
Captulo 4. El desarrollo prenatal y el recin nacido 91
Actividades
1. Conteste a las siguientes preguntas
A partir de las observaciones que se han realizado con fetos humanos podemos concluir
que:
a) Hacia el nal de la gestacin disponen de ciertas capacidades cognitivas.
b) Slo realizan movimientos cuando reciben estimulacin del exterior.
c) Presentan principalmente fases de sueo tranquilo cuando duermen.
Imagine que queremos comprobar la hiptesis de que la inteligencia tiene un com-
ponente hereditario. Para ello, realizamos un estudio escogiendo ciertos grupos de per-
sonas y comparando sus puntuaciones en pruebas que miden la inteligencia. Cul de
los siguientes resultados tendramos que encontrar para poder armar que nuestra hi-
ptesis es correcta?:
a) Las puntuaciones de un grupo de nios adoptados son ms similares a las de
sus padres adoptivos que a las de sus padres biolgicos.
b) Las puntuaciones de un grupo de gemelos idnticos criados juntos son ms
similares que las de un grupo de gemelos idnticos criados por separado.
c) Las puntuaciones de un grupo de gemelos idnticos criados por separado son
ms similares que las de un grupo de hermanos criados juntos.
2. Comentario de texto
A continuacin aparece un texto que relata, dados los avances de la ciencia en la repro-
duccin humana, cmo podra ser el proceso de tener un hijo dentro de 20 aos. La-
lo con atencin y reexione sobre las cuestiones que se plantean al nal.
Clara, nacida en 2005, tiene hoy 25 aos. Tiene una buena situacin, aca-
ba de casarse y ha decidido tener un hijo. Para ello, decide pedir cita con
un equipo de especialistas de la procreacin. [...] Primera etapa: Clara
debe aportar una muestra de ovocitos. [...] Una vez que Clara est lista,
hace producir in vitro unas decenas de embriones. Aprovecha para decidir que su futu-
ro hijo ser una nia mediante una seleccin previa de los espermatozoides. Desde el
primer estadio del desarrollo el ncleo de una clula de cada embrin se somete a un
examen gentico completo [...]. Por supuesto, los embriones portadores de genes sus-
ceptibles de desencadenar enfermedades genticas, desde el autismo a la mucoviscido-
sis, son eliminados de entrada. [...] Los embriones que han superado esta primera se-
leccin son sometidos a un anlisis ms fno. Clara podr apartar los que tengan riesgo
de dar un nio sordo, obeso, enclenque, demasiado grande o demasiado pequeo, agre-
sivo, torpe, tmido, depresivo... [...]
Una vez terminada la seleccin de los indeseables, se pasa a la seleccin positiva.
Los embriones preseleccionados se comparan a perfles tipo establecidos gracias a las
bases de datos que contienen millones de mapas genticos individuales. Segn sus pre-
ferencias, Clara buscar un embrin cuyo perfl se acerque al de un campen deportivo,
de un premio Nobel, de una modelo, de un poeta, de un director de empresa, de un
monje, de un violinista virtuoso... Si sus ambiciones son modestas, podra detenerse aqu
e implantarse el embrin ms efciente entre los que la naturaleza le ha otorgado. Pero
si ninguno de ellos le satisface pasara al estadio superior, es decir, a la manipulacin
gentica de uno de sus embriones. Los mdicos intentaran primero inhibir los genes
92 Bloque II. El desarrollo temprano
Reexione sobre las siguientes cuestiones:
Es lgico que la reproduccin humana permita la seleccin de rasgos fsicos y
de personalidad?
Existe algn caso para el que la seleccin gentica de rasgos debera no slo
permitirse sino implantarse como una tcnica comn?
Cree que existe algn peligro en la realizacin de esta seleccin de rasgos?
3. Comentario de texto
A continuacin tiene un texto que plantea la controversia entre las inuencias genticas
y ambientales en el desarrollo de las personas. Lalo con atencin y reexione sobre las
cuestiones que se plantean al nal.
Algunos autores defenden que los seres humanos han evolucionado en
formas que los hacen sensibles a una amplia gama de ambientes y que:
1. Dentro del amplio rango de los ambientes familiares tpicos, los nios
exhiben patrones adaptativos de desarrollo normal.
2. Las prcticas particulares de crianza de los nios no infuyen en grado consi-
derable en los resultados del desarrollo.
3. Slo aquellos ambientes familiares muy alejados del rango normal (por ejem-
plo, aquellos en los que los padres son violentos, abusivos o negligentes) es probable
que restrinjan en forma notable el desarrollo y produzcan resultados desadaptativos.
Por supuesto, desde estas posturas se supone que nios diferentes responden en
formas algo distintas ante el ambiente familiar tpico (o deseable promedio) debido,
en gran parte, al hecho de que tienen genes diferentes. Adems, el desarrollo de un nio
o adolescente es infuenciado tanto por las reacciones que provoca en otras personas
que no son sus padres como por los nichos ambientales que construyen las prcticas
paternas de crianza aunque stas tienen poco efecto sobre el desarrollo siempre que
sean lo bastante buenas (es decir, que estn dentro del rango de lo que podra consi-
derarse normal para los seres humanos). Desde este punto de vista, los padres slo
necesitan proporcionar un ambiente deseable promedio a fn de fomentar un desarro-
llo sano y satisfacer su propia funcin como guardianes efectivos.
Shaffer,D.Psicologa del desarrollo: Infancia y adolescencia.
portadores de rasgos no deseables y estimular los genes con potenciales prometedores
pero que son poco activos. A partir de ahora sabemos cambiar el comportamiento de
un gen sin tocarlo, actuando a travs de la qumica sobre los sistemas de autorregula-
cin y comunicacin naturales de la clula.
Para ir an ms lejos, habr que intervenir con ciruga en uno o varios de los 23
pares de cromosomas que contienen los 20.000 genes del genoma humano. El objetivo
ser introducir variantes de genes que ni Clara ni su marido poseen. Desde hace varios
aos sabemos quitar de la clula los genes portadores de anomalas graves y rempla-
zarlos por genes sanos fabricados en laboratorio.
Le Monde,6-8-05.
Captulo 4. El desarrollo prenatal y el recin nacido 93
Le parece que un ambiente deseable promedio es suciente para que los nios
desplieguen sus potencialidades? Busque algn argumento que contradiga la
postura expuesta en el texto.
Cree que estas ideas pueden tener algn efecto en las pautas educativas que
los padres emplean con sus hijos?
En cuanto a las polticas sociales de un pas, podran estas ideas perjudicar a
ciertos sectores de la poblacin? Si cree que s explique a cules y por qu.
Soluciones a las actividades
1. Preguntas
Para la primera pregunta la respuesta correcta es la a). Como se describe en el texto,
desde muy temprano los bebs recin nacidos discriminan sonidos como la voz de la
madre. Esta capacidad para distinguir estmulos pone de maniesto que al menos hacia
el nal de la gestacin el beb puede percibir, recordar y aprender aunque sea de forma
limitada. La alternativa b) es falsa puesto que se observan tambin movimientos espon-
tneos que no responden a ningn estmulo. La alternativa c) tambin es falsa puesto
que el sueo del recin nacido y el del feto es en su mayor parte sueo activo o sueo
REM.
En la segunda pregunta la respuesta correcta es la c). Si el grupo de los gemelos
idnticos posee puntuaciones ms similares no puede ser gracias al medio puesto que
se han criado por separado. La explicacin para la comparacin con los hermanos cria-
dos juntos tiene que ser la herencia, lo cual apoya la hiptesis de partida. Las otras dos
alternativas favorecen la hiptesis contraria, es decir, que el medio tiene un papel expli-
cativo en el desarrollo de la inteligencia. La alternativa a) es falsa porque si los nios
adoptados se parecen ms a sus padres adoptivos en inteligencia slo puede ser gracias
al medio. La alternativa b) es falsa porque si las puntuaciones de los gemelos idnticos
criados juntos son ms parecidas que las de los gemelos idnticos criados por separado,
una vez ms, sera gracias al medio que comparten. Dado que en este ltimo caso la
herencia es la misma para los dos grupos, la diferencia de puntuaciones slo podra
deberse al medio.
2. Comentario de texto
Actividad libre.
3. Comentario de texto
Estas posturas ms inclinadas hacia el innatismo han sido enormemente criticadas. Mu-
chos autores piensan que dentro de lo que se puede considerar un rango de paternidad
sucientemente buena se producen grandes diferencias en el desarrollo de los nios
y los adolescentes. As por ejemplo, se ha encontrado que los padres muy demandan-
tes y sensibles tienen hijos con un mejor desempeo acadmico y se adaptan mejor al
entorno social que los hijos de padres moderadamente sensibles y demandantes, que
entran dentro del rango normal en estas dimensiones de paternidad. Por otra parte,
desde algunos foros se ha expresado preocupacin por el efecto que puede tener en
los padres las pautas sucientes de crianza. Esa idea podra desmotivar a muchos
padres y provocar un menor compromiso a la hora de estimular y desarrollar las capa-
94 Bloque II. El desarrollo temprano
cidades de sus hijos. Por ltimo, tambin se ha sealado el efecto de estas premisas en
las polticas sociales y las repercusiones que pueden tener a la hora de elaborar planes
de intervencin para las poblaciones ms desfavorecidas. Pensar que poner mucho
empeo en estimular y desarrollar las capacidades de los nios tiene el mismo efecto
que cuando slo se alcanzan niveles aceptables, puede provocar el abandono por par-
te de polticos y profesionales de la implantacin de programas de prevencin e inter-
vencin que, denitivamente, han mostrado su ecacia en numerosos mbitos del
desarrollo.
Los inicios
de la inteligencia
95
5
MARTA GIMNEZ-DAS
BEGOA DELGADO EGIDO
SONIA MARISCAL ALTARES
Esquema resumen
Objetivos
Introduccin
1. Las capacidades perceptivas del beb
1.1. La percepcin visual
1.2. La percepcin auditiva
1.3. El olfato, el gusto y el tacto
1.4. La percepcin intermodal
2. La explicacin piagetiana del perodo sensoriomotor
3. La nocin piagetiana de objeto permanente
3.1. Primer y segundo estadio
3.2. Tercer estadio
3.3. Cuarto estadio
3.4. Quinto estadio
3.5. Sexto estadio
4. La evolucin de la imitacin segn Piaget
4.1. Primer estadio
4.2. Segundo y tercer estadio
4.3. Cuarto y quinto estadio
4.4. Sexto estadio
Lecturas complementarias
Actividades
Soluciones a las actividades
96 Bloque II. El desarrollo temprano
Esquema resumen
1. Las capacidades perceptivas del beb
A pesar de que durante mucho tiempo se pens que el mundo perceptivo del recin
nacido era un caos, gracias a las nuevas tcnicas de investigacin, hoy sabemos que los
bebs perciben el mundo con un cierto orden. Algunos sentidos como el odo, el olfato
y el gusto funcionan prcticamente de forma similar a los del adulto mientras que la
vista, dada la complejidad del propio sistema, necesita unos meses para equipararse.
2. La explicacin piagetiana del perodo sensoriomotor
Piaget propuso dentro del marco de su teora, una primera etapa en el desarrollo huma-
no basada en la accin. Dentro de este perodo describi 6 estadios caracterizados por:
Estadio 1: Ejercicio de los reejos.
Estadio 2: Primeras adaptaciones; reacciones circulares primarias.
Estadio 3: Reacciones circulares secundarias.
Estadio 4: Coordinacin de esquemas secundarios; conducta intencional.
Estadio 5: Reacciones circulares terciarias.
Estadio 6: Inicio de la capacidad simblica.
3. La nocin piagetiana de objeto permanente
Segn Piaget, los bebs no saben que los objetos permanecen siempre en algn lugar.
A lo largo del perodo sensoriomotor irn construyendo la nocin de objeto permanen-
te, es decir, la idea de que independientemente de la percepcin, los objetos siguen
existiendo. Esta construccin se har al comps del desarrollo cognitivo descrito en el
apartado anterior.
4. La evolucin de la imitacin segn Piaget
La imitacin constituye un importante mecanismo de aprendizaje. Los bebs son capa-
ces de imitar desde el primer momento de la vida aunque de forma automtica. Piaget
plantea la evolucin de la imitacin como una progresiva diferenciacin de los mecanis-
mos de asimilacin y acomodacin aunque implica el predominio de la acomodacin.
Al igual que la nocin de objeto permanente, la imitacin evoluciona siguiendo los mis-
mos seis estadios del perodo sensoriomotor.
Objetivos
Comprender cmo estn organizados los sistemas perceptivos en el recin nacido,
de qu capacidades dispone desde el nacimiento y cmo evolucionan a lo largo
de los primeros meses de vida.
Entender la explicacin que proporcion Piaget sobre cmo conoce el mundo el
beb.
Diferenciar los seis subestadios del perodo sensoriomotor y comprender sus ca-
ractersticas.
Comprender y diferenciar los conceptos de reaccin circular, conducta intencional
y esquema sensoriomotor.
Conocer la secuencia propuesta por Piaget sobre la adquisicin de la nocin de
objeto permanente.
Conocer y entender la evolucin de la imitacin segn los estadios piagetianos.
Captulo 5. Los inicios de la inteligencia 97
Introduccin
A fnales del siglo XIX los estudiosos del desarrollo humano crean que el entorno era
percibidoporelrecinnacidocomounautnticocaos.Segnestasconcepciones,elbeb
noeracapazdeimponerunaestructuraalosestmulosypercibafragmentosvisuales,
sonoros, olfativos, gustativos o tctiles desordenados.A partir de la dcada de 1960 y
graciasalasnuevastcnicasempleadasparaestudiaralosbebs,estaconcepcincambi
radicalmente.Hoyendasabemosquelosbebsposeendiversosrecursosquelespermi-
ten estructurar el medio y que vienen al mundo con potentes capacidades perceptivas
fundamentalesparallevaracabodichaestructuracin.
Lainvestigacinsobrelascapacidadesdelosbebssehaconvertidoenuntemaimpor-
tantsimoennuestradisciplinaynumerososautoressededicanaestudiarlas.Noobstante,
lasinterpretacionesquesepuedenhacerapartirdelasconductasquerealizanlosbebsno
son unvocas y han creado mucha polmica.As, algunos autores piensan que los bebs
vienendotadosderepresentacionesmentales,mientrasqueotrosmantienenunavisinms
conservadoraysiguendefendiendoqueesatravsdelainteraccinconelentornocomo
seadquiereelconocimientosobreelmundo.Eldebatesobreelinnatismosiguesiendoel
telndefondodeestasdiscusionesqueseremontanalosiniciosdelpensamiento.
A lo largo de este captulo pretendemos ofrecer una visin del desarrollo cognitivo
temprano partiendo de los elementos bsicos que inciden en l la percepcin para
describirdespuslaprincipalteoraexpuestasobreesteperodo.Porcuestionesdeespa-
cioydeorganizacindeloscaptuloshemos,as,reunidoenelmismotemadoscuestio-
nesquesesuelentratardeformaseparada:porunaparte,lapercepcinenelrecinna-
cido y, por otra, la explicacin piagetiana del perodo sensoriomotor junto con la
permanenciadelobjetoylaimitacin.Evidentemente,tantounaspectocomootrome-
recenuncaptuloentero.Lacantidaddedatosquehageneradolainvestigacin,laspos-
turastericasalrespectoylasdiscusiones,endefnitiva,sobrelanaturalezadelconoci-
mientohumano,sonmuyimportantesennuestradisciplina.Noobstante,ydadoqueel
futuro educador tampoco necesita ser un experto en desarrollo cognitivo temprano, no
podemosextendernoscomoquisiramosentodasestascuestiones.Aspues,comenzare-
mosdandounavisinbsicayresumidadelascapacidadesperceptivasdelrecinnacido.
Estascapacidadessuponenlabaseapartirdelacualelbebiraconociendosumundo
puestoquelossentidosconstituyenlafuenteprimeradelconocimiento.Suestadoalna-
cerysuajusteenlosprimerosmesesdevidavanacondicionarlaformadever,escuchar,
acariciar,saborearyolfatearlosobjetosylaspersonasqueconformannuestromundo.
Unavezquesepamoscmovienepreparadoelrecinnacido,pasaremosaexponer
la teora ms completa y minuciosa que se ha formulado sobre los avances del pensa-
mientodurantelosdosprimerosaosdevida.LateoradesarrolladaporPiagetsobreel
perodosensoriomotorconstituyeunodelospilaresbsicosdentrodelapsicologaevo-
lutiva.Adems de la explicacin de los seis subestadios, Piaget abord dos cuestiones
fundamentalesparaeldesarrollocognitivoenestaetapa:lacomprensindequelosob-
jetossonpermanentesylacapacidaddeimitar.Ambostemasserntratadosenlosdos
ltimos apartados. Dado que, como ya hemos mencionado, no disponemos de mucho
espacio, al fnal del captulo el lector interesado encontrar diferentes lecturas comple-
mentarias que podrn completar la informacin aqu presentada. Comencemos, pues,
viendoqucapacidadesperceptivasposeeelrecinnacido.
98 Bloque II. El desarrollo temprano
1. Las capacidades perceptivas del beb
1.1. La percepcin visual
Los datos que se poseen en la actualidad acerca de la percepcin visual en bebs son
innumerables. No obstante, antes de pasar a exponer cmo ven los recin nacidos, es
necesario explicar brevemente las tcnicas ms utilizadas en la investigacin que han
permitidoaclararalgoestascuestiones.Enelsiguientecuadropresentamosunresumen
dedichastcnicas.
1
1
Eltrminopreferenciadebeentendersecomounamuestradeintersodeatencinprestadaaunest-
mulo,yaquelosinvestigadoresnoutilizaneltrminoatribuyendogustosalbeb.Enestesentido,sielbeb
miramsunestmuloqueotrohemosdeinterpretarqueunodeellosatraemssuatencinoleinteresams.
Dado que los bebs slo expresan de forma rudimentaria aspectos bsicos sobre s mis-
mos como malestar o bienestar, resulta muy complicado saber con detalle cmo se
sienten, cmo perciben el mundo o qu cosas conocen. Los investigadores que se de-
dican a explorar el mundo del beb han inventado algunas tcnicas que, aunque en su
mayora requieren inferencias e interpretacin del resultado o de la conducta que reali-
za el beb, nos acercan su experiencia.
Podemos dividir estas tcnicas en dos grandes grupos. Por una parte, las medidas
psicosiolgicas y, por otra, las medidas conductuales. Las medidas psicosiolgicas
tienen en cuenta aspectos del sistema nervioso central y autonmico. Por ejemplo, mi-
den cmo van madurando los sistemas sensoriales, cmo es la actividad elctrica del
cerebro o qu seales emiten algunos rganos cuando se presentan ciertos estmulos
(p. ej., la dilatacin o contraccin de la pupila y la aceleracin o desaceleracin del ritmo
cardaco). Aunque hay muchas investigaciones que emplean estas medidas, no nos va-
mos a detener en su explicacin. Las medidas conductuales han proporcionado intere-
santes resultados y han suscitado grandes debates sobre las capacidades de los bebs
y, por tanto, vamos a dedicarles ms atencin. Existen tres tcnicas principales dentro
de las medidas conductuales: la de preferencia, la de habituacin y el condicionamiento.
La tcnica de preferencia es la ms sencilla. Consiste en presentar dos estmulos dife-
rentes de forma simultnea al beb y registrar el tiempo de jacin visual ante cada uno
de ellos. Si el beb mira durante ms tiempo uno de los estmulos, se supone que per-
cibe las diferencias entre ambos y preere mirar uno de ellos
1
. Pero, qu ocurre si
no hay diferencias entre los dos estmulos? Podemos concluir que el beb no los dis-
crimina o no le interesan? Evidentemente, no. Cuando el beb mira por igual los dos
estmulos puede que o bien no discrimine o bien discrimine, pero ambos le gusten o le
aburran por igual. En este caso no podremos saber cul de las dos opciones es la co-
rrecta.
La tcnica de habituacin se ha empleado en muchas ocasiones. Consiste en pre-
sentar un estmulo hasta que el beb se acostumbra a l y a continuacin presentar otro
distinto para ver si recupera la atencin y, por tanto, lo diferencia del anterior. Veamos
un ejemplo: imaginemos que queremos saber si los bebs perciben los colores y vamos
CONLOSPIES
ENLATIERRA
Cmo se estudian las competencias
de los bebs?
Captulo 5. Los inicios de la inteligencia 99
A continuacin, vamos a ofrecer una sntesis de los datos ms relevantes sobre la
percepcinvisual,comenzandoporlosdenominadosprocesosvisualesbsicos.Dentro
deestosprocesosseencuentranlaacomodacinvisual,laagudezavisualylasensibilidad
alcontraste.Laacomodacinvisualtienequeverconlacapacidaddeenfocar.Cuando
seutilizanestmulosadecuadosentamaoycontraste,losbebssoncapacesdeenfocar
desdelosprimerosdasdevida.Esteenfoqueserealizaalprincipiosloadeterminadas
distancias. Como vimos en el captulo anterior, los recin nacidos enfocan los objetos
situadosamenosde20centmetros,peroaloscuatromeseselojodelbebseacomoda
yaigualqueeldeladulto.
a empezar nuestro estudio viendo si son capaces de distinguir el color rojo del color
naranja utilizando la tcnica de la habituacin. Para ello, presentaremos a los bebs en
primer lugar una pantalla de color rojo. Generalmente, los bebs miran un tiempo los
estmulos nuevos y cuando ya los han explorado, dejan de mirarlos. Es decir, exploran
lo novedoso hasta que deviene conocido y por aburrimiento o desinters buscan otra
nueva fuente de atencin. As, una vez que el beb deja de mirar la pantalla roja porque
se ha habituado a ella, presentaremos la pantalla de color naranja. Si el beb recu-
pera la atencin y mira atentamente la nueva pantalla, podemos suponer que discrimi-
na entre el rojo y el naranja. Si, por el contrario, no mira la pantalla naranja podemos
pensar que no se da cuenta de la diferencia de color y trata el naranja como si fuera
rojo.
Por ltimo, la tcnica de condicionamiento refuerza algunos movimientos volun-
tarios del beb (como mirar, chupar o girar la cabeza) para ver si discrimina entre est-
mulos diferentes. Por ejemplo, mediante un dispositivo inventado para tal efecto, el
beb puede aprender que si gira la cabeza al escuchar un sonido determinado (por
ejemplo, la slaba /pa/), aparece una bonita imagen. Una vez que el beb ha compren-
dido la relacin entre el sonido, su movimiento y la aparicin de la imagen, el investi-
gador puede manipular el sonido para ver si el beb lo discrimina. As, podra presentar
la slaba /ba/ y observar si el beb gira o no la cabeza. Si girara la cabeza, podramos
pensar que no percibe diferencia entre los sonidos /pa/ y /ba/, es decir, trata el sonido
/ba/ como si fuera /pa/ y espera que su movimiento produzca el mismo resultado (la
imagen).
A pesar de que la utilizacin de estas tcnicas ha arrojado interesantes datos sobre
las capacidades y la percepcin del beb, no podemos dejar de mencionar brevemente
los problemas a los que se enfrentan. En primer lugar, la utilizacin de diversas tcnicas
para evaluar la misma capacidad ha dado lugar a resultados diferentes. Por ejemplo,
como veremos ms adelante, los resultados sobre la permanencia del objeto varan en
funcin de la tcnica empleada. En otras ocasiones se ha utilizado la misma tcnica pero
no se ha logrado replicar resultados anteriores. Est claro que en estos casos factores
como los propios sesgos de los investigadores o las variaciones introducidas en el m-
todo, desempean un papel fundamental. Por ltimo, dado que las conductas y las
medidas tomadas necesitan ser interpretadas, el mismo resultado puede tomarse como
evidencia de diferentes procesos o mecanismos. As por ejemplo, para algunos autores
cuando los bebs miran ms tiempo un estmulo nuevo lo interpretan como un signo
de inteligencia los bebs ms inteligentes miraran ms los estmulos nuevos, mien-
tras que para otros signica todo lo contrario los bebs ms inteligentes son ms
ecaces en el procesamiento de la informacin y, por tanto, necesitan menos tiempo
para extraer la informacin novedosa. El que miren ms tiempo un estmulo novedoso
se interpreta, pues, como un ndice de menor inteligencia.
100 Bloque II. El desarrollo temprano
Laagudezavisualeslacapacidadquetieneelojodepercibirdetalles.Losresultados
delostrabajosqueevalanlaagudezamediantemedidascerebralesindicanquelosre-
cinnacidospercibenmuypocosdetalles,perohayunrpidoincrementoalasseisse-
manasdevidaysealcanzaunnivelsimilaraladultoalosseismeses.
Porltimo,lasmedidasdesensibilidadalcontrastesehanestablecidomediantela
presentacindeunapantallaenlaquevanapareciendobarrasnegras,alprincipiomuy
fnasyprogresivamentemsgruesas,quelosbebsmirancuandoelcontrastelespermi-
tevisualizarlas.Cuandolasbarrassonmsbienlneasfnaslosbebsdeunmesnolas
perciben.Duranteesteprimermeslavisindelosbebsseparecealavisinnocturna
quetenemoslosadultosyslovenlosobjetosgrandesyconmuchocontraste.Estasen-
sibilidadalcontrastemejorarpidamenteyalosseismesesalcanzanivelescomparables
alosdeladultoaunquetodavaalgoinferiores(Figura5.1).
Unodeloselementosdelapercepcinvisualquehadadolugaraoriginalesestudios
tienequeverconlapercepcindelaprofundidad.Elsistemavisualhumanodisponede
ciertos indicios para percibir la profundidad. Hay indicios que se pueden captar con un
soloojomonoculares,indiciosquesecaptanconlosdosojosbinocularesyotros
quedependendelmovimientocinticos.Sinentrarenlosdetallesdelostrabajosque
sehanllevadoacabo,parecequelasensibilidadalosindiciosmonocularesybinoculares
apareceentrelos5ylos7meses.Dentrodeloreferidoalasclavescinticas,unodelos
estudiosmsimportantesrealizadoshasidoeldelabismovisual(GibsonyWalk,1960).
Enestetrabajo,losautoresdisearonunamesadecristalcuyamitadestabacubiertapor
unasuperfciecondibujosblancosynegros.Laotramitaddelamesadejabaelcristalal
descubierto,locualpermitaverenelsuelolamismasuperfciededibujosblancosyne-
groscreandounefectodeabismo(vaseFigura5.2).
Elobjetivodelestudioeradeterminarsilosbebspercibenlaprofundidadyreaccio-
nandealgunaformaanteelabismovisualcreado.Paraello,dejabanalbebenlaparte
con la superfcie blanca y negra y observaban si se asomaba al abismo, se atreva a
cruzarlo,etc.Lamadredelosbebsestabasituadaenelotroextremoyllamabaalbeb
con un juguete en la mano, de tal forma que el beb deba atravesar la parte de cristal
el abismo si quera reunirse con ella y alcanzar el juguete. Los investigadores
pensaban que los bebs que percibieran la profundidad no cruzaran el abismo, ya que
sentiranmiedoantelaposiblecada.Alcontrario,losbebsqueatravesaranlasuperfcie
loharanporquenotendranencuentaelabismo,esdecir,nopercibiranlaprofundidad.
Delos36bebsde6mesesenadelantequefueronevaluados,slo3atravesaronelabis-
Figura 5.1. Simulacin de la visin de un recin nacido entre el nacimiento y los seis meses
(tomado de Vasta et al., 1992).
Captulo 5. Los inicios de la inteligencia 101
mo gateando. Parece, pues, que la mayor parte de los bebs que ya gatean perciben la
profundidadyademsreaccionanconmiedoanteellaevitandocruzarelabismo.
Estudiosposterioresevaluaronlareaccindebebsentre2y5meses,quetodavano
gatean,mediantelamedidadelritmocardaco.Cuandolosbebsestabansobreellado
profundo de la mesa su ritmo cardaco disminua, lo cual indica inters y atencin. La
mismamedidaconbebsqueyagateanmuestraunaaceleracindelritmocardaco,lo
cual indica miedo o estrs. Estos resultados pueden interpretarse como que los bebs
perciben la profundidad desde temprano, pero no sienten miedo hasta que son capaces
demoverseporsmismosalrededordelos6mesesy,portanto,elabismoseconvierte
enunasituacinpotencialmentepeligrosa.
Otro de los aspectos ms estudiados en percepcin con bebs tiene que ver con la
percepcindelaforma.Parecequelosbebstienenpreferenciasalahorademirarob-
jetosoestmulos.Asporejemplo,preferenobjetosmoderadamentecomplejoscomo
eldibujodeunacaraaotrosmssimplescomounalminadecolorlisa.Adems
inspeccionanlasformasdeunamaneraparticular:duranteelprimermesdevidamiran
casi exclusivamente los contornos de las fguras y a partir de los dos y tres meses van
inspeccionandomselinterior.
Unodeloselementosquemsinvestigacinhagenerado,dentrodelapercepcinde
la forma, tiene que ver con la percepcin del rostro humano. Como anunciamos en el
captulo anterior, el beb desde prcticamente el comienzo de la vida prefere mirar el
rostrohumanofrenteaotrotipodeobjetos.Fantz(1961)presentdiferentesestmulosa
bebsde4mesesyutilizandounatcnicadepreferencia,observquemirabanmstiem-
poeldibujodelacarahumanaqueningnotroestmulo(vaseFigura5.3).Enalgunos
casossehaobservadoestapreferenciaalos2meses.
Enlamismalnea,JohnsonyMorton(1991)presentaronalosbebsdibujosdecaras
normalesfrenteacarasdescolocadasconojos,narizybocafueradelugarydi-
bujosgeomtricosorganizadosdemodosimilaracmoseorganizanloscomponentesde
lascaras.Losbebspreferanlosdibujosdelosrostros,seguidosdelosdibujosgeom-
tricossimilaresalascarasy,enltimolugar,losdibujosdelascarasdescolocadas.
Figura 5.2.
Reconstruccin del abismo
visual utilizado por Gibson
y Walk para estudiar la
percepcin de la profundidad
en bebs (tomado de Vasta
et al., 1992).
102 Bloque II. El desarrollo temprano
Algunos autores han interpretado estas preferencias como una prueba a favor de la
existencia de un esquema innato sobre el rostro humano en los bebs. Es decir, si los
bebspreferenlacarafrenteaotrotipodeestmuloses,segnestalgica,porquedis-
ponen de un dispositivo innato que les permite atender y orientarse hacia ese estmulo
frenteaotros.Enestesentido,elbebnotendraqueaprendercmosonlascarashuma-
nas. Estudios posteriores han encontrado resultados que matizan notablemente estas
ideas.Porunaparte,noesttanclaroquelapreferenciaseainnatayanmenosquese
debaalaexistenciadeunarepresentacinprevia.Alosdosmeseslosbebshanmirado
yamuchosobjetosyhanpodidoaprenderapreferirelrostrohumano.Porotra,lasca-
ractersticasdelosrasgospropiosdelacarahumanapuedenestarenelorigendelapre-
ferenciamostradaporlosbebs.As,elmovimientoyelbrillodelosojosylabocason
caractersticasmuyllamativasquepuedenexplicaresapreferencia.Entodocaso,laes-
pecialatencinquelosbebsprestanalascarashumanas,seainnataodebidaasusras-
gosespeciales,podraconsiderarsecomounapreadaptacinquefacilitaralasprimeras
relacionessociales(vase Captulo 6).
Losadultospercibimoslosobjetoscomounidadescompletas,separadasdelrestoy
ocupandounlugarenelespacio,algoquenospermitecomprendermejorelmundoen
elquenosmovemos.Pero,percibenlosbebslosobjetosigualquenosotros?Entien-
denquesetratadeobjetosseparadosaunqueestn,porejemplo,parcialmenteocultos?
Lapercepcindelosobjetosenbebsconstituyeuninteresantetemadeinvestigacin
quehageneradomuchosestudios.KellmanySpelke(1983)idearonuningeniosodispo-
sitivo para aclarar algunas de estas cuestiones. Habituaron a bebs de 4 meses a mirar
unabarrainclinada,parcialmenteocultaporunbloque(vaseFigura5.4).Unavezque
losbebssehabituaronalestmulopresentado,selesmostrarondosestmulosdiferen-
tes:unabarrapartidayunabarracompleta.Esteexperimentoincluyademsunavaria-
36
32
28
24
20
16
12
8
4
0
T
i
e
m
p
o

d
e

f
i
j
a
c
i

n

v
i
s
u
a
l

(
e
n

%
)
Cara Crculos Letras Blanco Amarillo Rojo
ms su atencin
, este resultado
ujo cuando el n
o en movimiento
. Cuando se mo
e o el bloque y la
Figura 5.3. Tiempo de jacin visual ante distintos estmulos en bebs. Como se observa en
la longitud de las barras, el estmulo que ms miran es el de la cara humana y el
que menos un color liso.
Captulo 5. Los inicios de la inteligencia 103
blerelacionadaconelmovimientodelabarrayelbloque.Enunoscasos,nosemova
ningunodeloselementos,enotrossemovaslolabarra,enotrossloelbloqueyen
otroslabarrayelbloque.Sinentrarenlosdetallesdecadacondicinexperimentalpo-
demos decir que, de forma general, los bebs de 4 meses miraron ms tiempo la barra
partida,algoquelosautoresinterpretancomounindiciodequelosbebspercibenlos
objetoscomounidades.Esdecir,miranmslabarrapartidaporque,igualquelosadultos,
hancomprendidoquesusdospartesestn,enrealidad,unidasysetratadeunsoloob-
jeto.Alinferirestaunidad,losbebstratanlavisindelabarrapartidacomounestmu-
loinesperadoynovedosoqueatraemssuatencin.Noobstante,esteresultadoslose
produjocuandoelnicoelementoenmovimientoeralabarra.Cuandosemovaelbloque
o el bloque y la barra a la vez o cuando ninguno de los elementos se mova, los bebs
mirabanporiguallabarrapartidaylabarracompleta.Enestecasodebemosdecir,pues,
queelmovimientofavorecelapercepcindelosobjetoscomounidades.Elmismoestu-
diorealizadoconbebsde7mesesmostrqueentodaslascondiciones,esdecir,haya
onomovimientodeloselementos,losbebsmiranmslabarrapartida.Aestaedadya
parecequelosbebs,igualquelosadultos,percibenlosobjetoscomounidadesindepen-
dientementedesumovimientoyapesardequeestnparcialmenteocultos.
Manteniendolacondicinexperimentalenlaqueslolabarrasemueve,otrosauto-
reshanencontradoquealaumentareltamaodelabarralosbebsdeincluso2meses
miranmslabarrapartida.Noobstante,reconocenquepercibirlosobjetoscomounida-
desdependedemuchosotroselementosvisuales,talescomolatexturadelfondo,elta-
maodelobjeto,elmovimientodelaspartes,etc.(JohnsonyAslin,1995,1996,citado
porCorralyPardo,2002).
Figura 5.4. Estmulos utilizados por Kellman y Spelke para estudiar la percepcin de los ob-
jetos. La barra y el bloque forman el estmulo de habituacin, es decir, el que se
presenta hasta que el beb se acostumbra. Las barras, partida o continua, son los
estmulos de deshabituacin.
104 Bloque II. El desarrollo temprano
Encualquiercaso,eindependientementedeaquedadexactalosbebscomienzan
a percibir los objetos como unidades, parece que esta forma de percibir aparece muy
pronto.Estosresultados,juntoconotrosderivadosdediferentesestudiosquenopodemos
detallaraqu,hanllevadoaalgunosautoresaplantearlaposibilidaddequeexistanunos
principiosinnatosquedirijanelanlisisperceptivodelosbebs.Siestofueracierto,los
bebs sabran desde muy temprano que, por ejemplo, un objeto se mueve en una sola
trayectoria en el espacio y el tiempo, que los planos pertenecen al mismo objeto y las
cosassemuevenjuntasslosiestnconectadasyqueunobjetopuedemoversesiotro
lo empuja, pero no antes de que se pongan en contacto. Estos principios actuaran de
formaautomticacadavezqueelbebobservay,mstarde,aprenderaautilizarotros
indicios como el color, la textura, etc. para juzgar dnde comienzan o acaban los
objetos.
En realidad, la existencia de estos principios se ha postulado porque los bebs han
miradodurantemstiempoendiferentesexperimentosciertassituacionesimposibles,
esdecir,presentacionesvisualesquenoconcuerdanconlasleyesqueguanlapercepcin
delosobjetosenlosadultos.Comohemosvistoconlasbarras,estostiemposdemirada
mslargossehaninterpretadocomosituacionesinesperadasparaelbebquerompenlas
expectativas derivadas de la aplicacin de las leyes ordinarias.As pues, si el beb se
sorprendeantedeterminadaspresentacionesvisualesdebeserporqueyatieneintegrados
unaseriedeprincipiosqueguansupercepcin.Loquetodavanoestclaroessiesos
principiossoninnatos.Todosestosestudiosypropuestastericashansuscitadomuch-
simodebateacercadelascapacidadesdelrecinnacidoyelbebyhansidonumerosos
losautoresquesemuestranendesacuerdoconlaconcepcindeunsuperbeb llenode
ideas, principios y teoras innatas sobre el mundo. Desde esta otra perspectiva se argu-
menta que la experiencia de los bebs con los objetos y las personas es muy intensa
desdeelnacimiento.Losestadosyritmosdelrecinnacidomuestranquedesdeelprin-
cipiolosbebssonseresmuyactivosquebuscaninformacinsobreelcontexto.Desde
aproximadamente los tres meses, los bebs pasan la mayor parte del tiempo de vigilia
observando y manipulando todo lo que cae en sus manos, es decir, aprendiendo sobre
cmosonlascosasquetienenasualrededor.Aunqueparecerazonablepensarqueelser
humano nace con ciertas predisposiciones que le hacen atender de una forma especial
ciertosestmulosfrenteaotrosporejemplo,elrostroolavozhumanafrenteaotros
estmulosvisualesoauditivos,postularlaexistenciadeprincipiosquefacilitanoguan
el conocimiento supone creer en principios innatos cuya existencia no ha sido, de mo-
mento,claramentedemostrada.
Antesdefnalizaresteapartado,vamosareferirnosbrevementealapercepcindel
color.Veelrecinnacidoelmundoencoloroenblancoynegro?Losestudiosquese
hanllevadoacaboponendemanifestoquedesdeelprimeroelsegundomeslosbebs
percibenydiscriminanloscolores.Susconductashacenpensarquelosbebsyadisponen
de las clulas encargadas de la percepcin del color y las vas de transmisin neuronal
propias del ojo humano adulto (Lcuyer, Pcheux y Streri, 1994).Adems, aunque la
preferenciaporloscoloresesunacuestinsubjetivaeinclusocultural,sehaobservado
quedesdelasprimerassemanasdevidalosbebspreferenmirarlosdenominadoscolo-
resbsicoscomoelverde,elazuloelrojofrenteaotroscomoelnegroyelamari-
llo(Lcuyeret al.,1994).
Captulo 5. Los inicios de la inteligencia 105
1.2. La percepcin auditiva
Comoyahemosvistoalhablardelavidadelfeto,diferentestrabajoshanmostradoque
elsistemaauditivocomienzaafuncionarduranteelperododegestacin.Cuandoelfeto
estdentrodeltero,percibelosruidosinternosdelamadre,comoellatidodelcorazn
ytambinsuvoz.Aunqueelmediolquidoenelqueseencuentraatenamucholosso-
nidos,parecequelasfrecuenciasbajassetransmitenmejorquelasaltas.Peroanms
queelmerohechodepercibirsonidos,elrecinnacidoparecereconocerypreferirde-
terminadossonidos.As,lasvoceshumanasolamsicaparecenestmulosprivilegiados
frente a otro tipo de sonidos. La preferencia por la voz materna no se ha encontrado
cuandosecomparanlavozdelpadreconlavozdeotroshombres,locualindicaquela
preferenciasedebealaexperienciaintrauterina.
Ademsdelreconocimientoypreferenciaporlavozdelamadre,losrecinnacidos
parece que ya distinguen entre diferentes sonidos del habla. Sin entrar en los detalles
procedimentales del experimento, los estudios ya clsicos de Eimas y colaboradores
(1971)pusierondemanifestoquelosbebsdetanslounmesyadiferenciabanentre
elsonido/p/yelsonido/b/.Estosdossonidossonmuyparecidos,perosediferencian
en el tiempo que tarda en expulsarse el aire que hace vibrar las cuerdas vocales. Esta
mnimadiferenciadetiempoespercibidaporlosadultos,deformaqueambossonidos
se procesan como diferentes y no se confunden palabras como por ejemplo par y
bar.
Comoadelantamosenelcaptuloanterior,otrosestudiosencontraronqueenmuchos
casosbebspertenecientesacomunidadeslingsticasdiferentesdistinguenlosmismos
sonidosaunquenoestnpresentesensulengua,algoquelosadultosnosomoscapaces
dehacer.Estacapacidaddediscriminacinfonolgicasemantieneduranteunosmeses
yluegosepierde(vase Captulo 6).Laprincipalhiptesisparaexplicarestosresultados
Cmo se ha investigado? Mediante el estudio del ritmo cardiaco en fetos se ha
comprobado que ante un acontecimiento o estmulo nuevo los fetos y recin nacidos
experimentan una deceleracin inicial del ritmo cardiaco que luego vuelve a la norma-
lidad.
Procedimiento. La madre est tumbada tranquila; se registra el ritmo cardiaco del
feto. En cierto momento la madre comienza a dirigirse al feto en lenguaje maternal. Le
dice por ejemplo: hola beb! Cmo ests hoy? Durante la emisin de la madre se
realiza un segundo registro del ritmo cardiaco del beb.
Qu se observa? Deceleracin del ritmo cardiaco al comienzo de la emisin verbal
de la madre. El ritmo cardiaco no se altera cuando la madre permanece en silencio o
susurra. Este tipo de medidas tambin se han tomado ante estmulos musicales obser-
vndose las mismas respuestas.
Conclusin. Los resultados muestran que los fetos atienden a los sonidos de la voz
de la madre y a estmulos musicales.
CONLOSPIES
ENLATIERRA Qu se escucha desde el tero?
106 Bloque II. El desarrollo temprano
esquellegaunmomentoenqueloquenoresultatilsepierde.Setrata,portanto,de
economizarespacioenelcerebroyguardarloparaloquesresultarelevante.
Todos estos resultados han sido interpretados desde algunas perspectivas tericas
comoevidenciasdequelosbebsvienenalmundodotadosdemecanismosespecfcos
para procesar y aprender el lenguaje. Dichos mecanismos permitiran que el beb se
oriente de forma preferente hacia la voz humana, que discrimine los sonidos del habla
desdemuytemprano,quepuedadiscriminarinclusolosquenopertenecenasulengua
maternayque,fnalmente,pasadountiempopierdaestaltimacapacidadcuandoyano
resultatilninecesaria.Apesardelaaparentearmonaentretodosestosdatosotroses-
tudioshanvenidoacuestionarlos.Porunaparte,algunostrabajosnohanencontradolos
mismosresultadosrespectoaladiscriminacindesonidosy,porotra,esacapacidadse
haobservadoenotrosmamferos,comolaschinchillasylosmacacos,quenodesarrollan
lenguaje(citadoenEnescoyGuerrero,2003).Elqueotrosmamferostambinperciban
deformacategricalossonidosdelhablaapoyalaideadequeestacapacidadconstituye
msbienunlegadoflogentico,apartirdelacualelhombrehapodidoelaborardespus
uncdigofontico.Enelcaptulosiguienteseretomarnestosaspectossobrelapercep-
cindellenguajeyseprofundizarenotrosmscomplejos.
Vamosaterminaresteapartadoconunabrevereferenciaacercadecmopercibenlos
bebslascomposicionesmusicales.Dadoquelamsicaconstituyeunaproduccinexclu-
sivamentehumanayquehasidountemainvestigadoenlosltimosaos,vamosaofrecer
unpequeoresumendelosdatosmsrelevantes.Desdeeltercertrimestredevidaintrau-
Se han realizado experimentos con bebs de 72 horas a los que se presentan muestras
de habla emitidas por sus madres y por otras mujeres.
Cmo se ha investigado? Mediante la tcnica de preferencia, el beb es expuesto
a los estmulos de inters y a la vez succiona un chupete conectado a un ordenador que
registra la tasa de succin.
Procedimiento. El beb escucha una serie de slabas (pat-pat-pat) previamente
grabadas por un investigador y succiona. Despus se presenta una grabacin con la voz
de su madre. Posteriormente, se le presenta otra serie de slabas diferente (pst-pst-pst)
mientras succiona y a continuacin una grabacin con la voz de otra mujer que no es
su madre.
Qu se observa? En la fase experimental se presenta de nuevo al beb otra serie de
slabas. La comparacin crtica es la siguiente: succionar ms el beb cuando oiga la
serie de slabas que preceda a la voz de la madre o a la voz de la otra mujer?
Resultados. Los bebs succionan ms ante la serie de slabas que se asoci con la voz
de la madre.
Conclusin. Por una parte, el beb es capaz de aprender la asociacin entre estmulos
(la serie de slabas precede la voz de la madre) y, adems, preere claramente la voz de
la madre.
CONLOSPIES
ENLATIERRA Preeren los bebs la voz de sus madres?
Captulo 5. Los inicios de la inteligencia 107
terina,losbebsdistinguenentretonosagudosygraves,discriminandomejorstoslti-
mos.Apartirdelosseismesesestapautaseinvierteypreferenydiscriminanmejorlos
sonidosagudos.Igualmente,desdetempranoparecensersensiblesalasmelodasyreco-
nocenlevesmodifcacionesdetonosenmelodasconocidas.Estosdosaspectos,latona-
lidadylameloda,parecenserimportantestambinparalaadquisicindellenguaje.
Losestudiosrealizadossobrelapercepcindelasescalasylosestilosmusicalesin-
dicanqueladiscriminacinesmsfnacuandolamsicaqueseescuchaeslapropiadel
ambiente,esdecir,alaqueseestacostumbrado.As,cuandobebsoccidentalesescu-
chenmsicahindpercibirnmenosdetallescomocambiosdeescalaotonosdesaf-
nadosquecuandoescuchenmsicaoccidental(Ilari,2002).Tambinsehaestudiado
si los bebs pueden almacenar composiciones musicales en la memoria a largo plazo.
Cuandolosbebssehabitanapiezasmusicalesparecenreconocerlasinclusohastatres
semanasmstarde.Noobstante,alosseismesesnoreconocenlapiezacuandoseinter-
pretaconotrotimbreoconotrotempo(Ilari,2002).
Lamaneraenquelospadresymadrescantanasusbebsesotraformadeconocer
la msica. Esta forma de cantar tiene elementos particulares que la distinguen de cual-
quier otra interaccin: un tono alto, un tempo lento y una expresividad a la vez que se
canta.Algunosautoreshanencontradoquelosmodosdecantardepadresymadresson
diferentes. Las madres parecen cantar ms a menudo, pero interpretan melodas ms
simplesyestereotipadas;lospadrescantanmelodasmscomplejas,nonecesariamente
orientadas hacia el beb y a menudo inventadas. No obstante, ambos tienen en comn
quecuandocantanenpresenciadelbebaumentansuexpresividad,algoquenorealizan
cuandoelbebnoestpresente.Escuriosocmoestetipoderasgospropiosdelcanto
de los adultos se encuentran tambin cuando los propios nios cantan a compaeros o
amigos.Comosealamosantes,lamelodaylatonalidadparecenserelementosimpor-
tantesenlaadquisicindellenguaje,perotambinenlacomunicacinafectivayenel
establecimientodelapego.
1.3. El olfato, el gusto y el tacto
Estos otros sentidos han recibido mucha menos atencin que la vista y el odo, quizs
porquelascapacidadesdelrecinnacidoyelbebenestosmbitosestnmsclarasy
suscitanmenosdebate.Comoyahemosvistoenelcaptuloanterior,desdemuytempra-
noenelperododegestacinlosfetospuedendetectaroloresysaboresatravsdell-
quido amnitico.Adems, las expresiones faciales y la orientacin hacia determinados
oloresysaborespermitensuponerqueambossistemastransmiteninformacinyfuncio-
nanyadeformasimilaracomolohaceneneladulto.
Enloreferentealolfato,enlosrecinnacidosseobservangirosdecabezaymuecas
deascocuandoselespresentanoloresdesagradables.Tambinparecenapreciarlosolo-
resagradablesconexpresionesfacialespositivasyausenciademovimientosderechazo.
Algunostrabajossehanpreguntadosiademsdedetectarolores,losrecinnacidoseran
capacesdereconoceroloresconocidos.Porejemplo,algunosinvestigadoreshancoloca-
do dos algodones, uno impregnado del olor de la madre y otro del olor de otra mujer,
cercadelasmejillasderecinnacidosdeunasemana.Apartirdelsextodaobservaron
quelosbebssegirabanconmayorfrecuenciahaciaelalgodnconelolordesumadre.
Este reconocimiento pone de manifesto que el sistema olfativo de los bebs funciona
108 Bloque II. El desarrollo temprano
desdemuytempranoy,adems,quelosprocesosdememoriayreconocimientodeest-
mulosseaplicanadiferentesmodalidadessensoriales.
Para saber si los bebs distinguen los sabores se ha procedido de manera similar a
comosehatrabajadoconelolfato.Esdecir,seleshadadoaprobarsolucionesconsabor
dulce,salado,amargoycido.Alaspocashorasdenacerlosbebsrealizanmuecasfa-
cialesdiferentesalprobarlossaboresdulce,amargoycido.Cuandopruebansoluciones
dulceschupanconmayorintensidad,consumenmsysecalmanantescuandolloran.La
Figura5.5muestralasmuecasdeunbebalprobarunasolucincidayotraamarga.A
travs de estas imgenes podemos deducir que el beb detecta el sabor y lo encuentra
desagradable. Los datos acerca del sabor salado no estn muy claros.Algunos trabajos
encuentranqueelrecinnacidonodetectaelsaladohastalos4meses,mientrasqueotros
encuentran un rechazo de este sabor desde el nacimiento hasta los 4 meses (citado en
EnescoyGuerrero,2003).
Paraterminarconesteapartado,simplementeharemosexplcitoquelosrecinnaci-
dos ya perciben sensaciones tctiles y dolor. As por ejemplo, las reacciones ante los
pinchazos ponen de manifesto el funcionamiento de este sentido desde el inicio de la
vida.Seguramente,elfetotambinpercibesensacionesdeestetipoantesdenacer.
Figura 5.5.
Muecas realizadas por un recin
nacido al probar una solucin cida
(arriba) y otra amarga (abajo)
(tomado de Vasta et al., 1992).
Captulo 5. Los inicios de la inteligencia 109
1.4. La percepcin intermodal
Ademsdelestudiodelosdiferentessentidosquehemosidoviendo,algunosinvestiga-
dores se han preguntado si los bebs pueden conectar los estmulos que provienen de
diferentesmodalidadessensoriales.Losadultosasociamosunacaraconunavozyreco-
nocemosalgunosobjetosmedianteeltacto.Estosprocesossonposiblesporqueconecta-
mos las entradas que provienen de dos o ms modalidades sensoriales diferentes para
representarnosoconocerlamismapersonauobjeto.Lacuestintieneunagranimpor-
tanciaysehaplanteadodesdelosorgenesdelestudiodelconocimiento.Lacapacidad
pararelacionarmodalidadessensorialespermitedotaralentornodeestabilidadyunidad,
independientementedelasdistintasfacetasdelosestmulosquenospresentanlasdiver-
sasmodalidadessensoriales.As,alintegrarlatextura,laimagenyelsonidoqueprodu-
ceunobjeto,entendemosquesetratadeunosoloyelmismoynotresobjetosdiferentes.
Pero,puedenlosbebstambinrealizarestasasociacionesosetratademecanismosque
seactivanmstardealolargodeldesarrollo?Silosrecinnacidosyadisponendeeste
mecanismo,podemospensarquepercibenelmundoconciertaunidadyquenonecesitan
aprenderquelosobjetostienenpropiedadesvisuales,auditivas,tctiles,etc.,queseinte-
gran.Alcontrario,siestacapacidadseadquieremediantelaexperienciaconlospropios
objetos,entonceselbebdeberaprenderquelasdistintasentradassensorialesproceden-
tesdeunmismoobjetopertenecenenrealidadalmismo.
Losestudiosllevadosacabohaninspeccionadolaconexinentrealgunasmodalida-
dessensorialescomolavistayeltacto,lavistayelodoolavistaylapropiocepcin.
Enloquesereferealacoordinacinentrelavistayeltacto,MeltzoffyBorton(1979)
idearonunexperimentoenelquebebsdeunmeschupabanunchupetequenohaban
vistoantes.Unodelosgruposchupabaunchupetelisoyelotrounchupeteconprotu-
berancias (vase Figura 5.6). Una vez que los bebs lo haban explorado mediante el
tacto,presentabanlasimgenescorrespondientesaamboschupetes.Aspues,cadabeb
veaunaimagenquecoincidaconelchupetequehabaexploradoconlabocayotrade
unchupetediferente.Losbebsmiraronmstiempolaimagendelchupetequecoincida
Figura 5.6. Chupetes liso y con protuberancias empleados por Meltzoff y Borton para estudiar
la percepcin intermodal.
110 Bloque II. El desarrollo temprano
conelquehabanexplorado,mostrandocapacidadparaemparejarambosplanosdeles-
tmulo.
Lahabilidadpararelacionarunacontecimientovisualconunosonorotambinhasido
estudiadaconbebs.Desdeelnacimientolosbebslocalizanlossonidosgirandolaca-
bezaylosojosenladireccinenqueseproducen.Aunqueestacapacidadestpresente
desdeelnacimiento,parecequeapartirdeloscuatromesessevuelvemsefcazycon-
trolada. Igualmente, otros aspectos de la coordinacin entre la vista y el odo aparecen
deformaclaraaloscuatromeses.KuhlyMeltzoff(1982)presentarondosvdeossimul-
tneos en los que se vea una persona pronunciando una a en una de las imgenes y
una i en la otra. El sonido que escuchaban los bebs corresponda a uno de los dos
fonemas.Desdeloscuatromeseslosbebsmiraronmslaimagenquesecorresponda
conelsonidoqueescuchaban.Estemayortiempodemiradaseinterpretcomolaprue-
badequeexistaunacapacidadparaestablecercorrespondenciaentreunestmuloaudi-
tivoyunovisual.Enestemismosentido,haytrabajosquemuestranqueapartirdelos
cuatro meses los bebs tambin preferen mirar la imagen de una persona cuyos movi-
mientoslabialescoincidenconelsonido,frentealadeunapersonacuyosmovimientos
estn desajustados con el sonido.A los adultos nos resulta muy desagradable observar
desajustesentreelsonidoylosmovimientoslabialescuando,porejemplo,unapelcula
estmaldoblada.Tomandoestaintegracinqueseproduceeneladulto,losestudioscon
bebs muestran que desde muy temprano los bebs tambin son sensibles a estos des-
ajustes.
Unaltimamodalidaddeconexinentrediferentessentidosalaquevamosareferir-
noseslaimitacindegestos.Laimitacindegestosobservadosenunmodelonecesita
delacoordinacinentrelavisinylapropiocepcin.Asporejemplo,siunbebobser-
va a un adulto sacar la lengua y consigue imitar el gesto, est poniendo en relacin lo
percibidomediantelavistaconlaejecucinensupropiocuerpodelmovimientoaimi-
tar
2
.LostrabajosdeMeltzoffyMoore(1983),quemostraronquerecinnacidosdedos
semanasdeedadeinclusodeunosminutosdevidaerancapacesdeimitargestosfaciales,
produjeronungranimpactoenlosdebatessobrelascapacidadesdelrecinnacidoyla
aparicindelarepresentacin.Paraestosautores,elquelosrecinnacidospudieranre-
producirelgestodeabrirycerrarlabocaosacarymeterlalengua,constituaunaprue-
badelaexistenciadeunacapacidadrepresentacionalinnataquepermitalaintegracin
deestasmodalidadessensoriales.As,elbebpodarepresentarselainformacinvisual
ylapropioceptiva,compararlasyejecutarunaaccin.Estasconclusionesibanencontra
delateoraformuladaporPiagetsobreelperodosensoriomotor,quienpensabaquela
capacidad para manejar y producir representaciones apareca bastante ms tarde en el
desarrolloapartirdelaoymedio.Msadelantevolveremossobrelaimitacin,pero
valgalainformacinhastaaqupresentadacomomuestradelaintegracindeotrasmo-
dalidadessensoriales.
Aunquelosdatosquehemosofrecidohastaelmomentoparecenindicarquelosbebs
puedendesdemuyprontorelacionarinformacinsensorialdediversasmodalidades,es
necesario aclarar que una cosa es relacionar eventos por ejemplo, visuales y auditi-
2
Dadoquelaimitacinhasuscitadomuchapolmicaysetratadeuntemafundamentaleneldesarrollo
temprano,msadelantelotrataremosenprofundidad.Aquvamossolamentearealizarunbreveesbozodela
capacidaddesdeelpuntodevistadelacoordinacinentrediferentesmodalidadessensoriales.
Captulo 5. Los inicios de la inteligencia 111
vosyotraintegrar informacin recibidamediantediferentessentidosparaidentifcar
objetos. Existen dos limitaciones que imponen un ritmo a esta integracin de informa-
cin:lamaduracindelossistemasperifricoycentralyelejerciciodeambossistemas
mediantelainteraccinconelentorno.Estasdoslimitacionessehanreveladoalobser-
varsequelastransferenciasdeinformacinentremodalidadessensorialesnosonrever-
siblesduranteelprimerao.Porejemplo,bebsdedosmesespuedenreconocermedian-
telavistaunobjetoquehanmanipulado,peronopuedenreconocermedianteeltactoun
objetoantesvisto.Locontrarioocurrealoscincomeses:elbebreconocemedianteel
tactounobjetoquehavistoantes,peronolograreconocermediantelavistaunobjeto
inspeccionadopreviamentemedianteeltacto(Streri,1987;StreriyMolina,1994;Streri
y Pecheux, 1986, citados en Lcuyer et al., 1994). Podemos, as pues, concluir que la
unidaddelossentidosnoesinnataniaprendida.Porunaparte,elbebestablecerelacio-
nesentreeventosprocedentesdediversasmodalidadessensorialesdesdemuytemprano
pero,porotra,necesitadelamaduracindelsistemaylainteraccinconelentornopara
que esa integracin sea completa y efcaz para todas las modalidades y en todas direc-
ciones.
2. La explicacin piagetiana del perodo
sensoriomotor
Comoanunciamosenlaintroduccin,unavezresumidaslascapacidadesperceptivasdel
recin nacido nos vamos a adentrar en la teora que formul Piaget sobre el desarrollo
cognitivodurantelosdosprimerosaosdevida.Estafase,quePiagetdenominperodo
sensoriomotor, constituye un viaje evolutivo que conduce al beb humano desde la
actividadrefeja,conlaquevieneequipadotrassunacimiento,hastalaconductainten-
cional ms temprana y la capacidad simblica. Veamos a qu nos referimos ms en
detalle.
Elbebrecinnacidoposeeunaseriedeconductasfjasquenodependendelaex-
periencia,sonlosdenominadosrefejosdelrecinnacido(vase Captulo 4).Entrelos
refejosmsconocidosestnelrefejodeprensin,eldelamarchay,porsupuesto,elde
succin.Recordemoscmoestasconductasrefejassevanmodifcandoyadaptandoalo
largodelosprimerosmesesdevida.Porejemplo,elrefejodesuccinesbsicoparala
supervivenciadelbeb,poresotodoslosbebssuccionannadamsnacer.Sinembargo,
el pezn de cada madre tiene una estructura particular, igual que los diversos tipos de
tetinas con los que se alimenta a los bebs. Por eso los nios realmente aprenden a
mamar,odichoentrminospiagetianos,seacomodanasusfuentesdealimentacin,a
lavezqueasimilanelpecho/bibernasuesquemainnatodesuccin.Enestebaileasi-
milacin-acomodacinlogranperfeccionarelrefejodesuccinconelquevienenequi-
padosalnaceryseconviertenensuccionadoresexpertos;esdecir,elrefejodesuccin,
queconstituyeenprincipiounahabilidadinternaalnio,semodifcaadaptndosealas
condicionesexternas,seadaptaalmundoexterior.
Igualquesucedeconelrefejodesuccinsucedetambinconeldeprensin.Eneste
caso,laconductarefejadeagarreevolucionahastalaconductaintencionaldecogerun
objeto.Paraelloelniohadeasimilarlosobjetosasualcance,peroalavezadaptarsu
conductarefejaalascaractersticasdecadaunodeellos(vase Captulo 2).
112 Bloque II. El desarrollo temprano
Piagetdiferenci6estadiosdentrodelperodosensoriomotor.Comodecamosan-
tes,atravsdeestosestadiosofaseselbebhumanorealizaelviajedesdeelejercicio
de los refejos hasta el inicio de la conducta, primero intencional y luego simblica.
Antes de pasar a caracterizarlos en detalle, vamos a detenernos en explicar cul es el
ncleodecadaunodeellos.Paraestoesnecesariodefnirlossiguientesconceptospia-
getianos,quemarcanlatransicindeunosestadiosaotros,dentrodelperodosensorio-
motor.
Tabla 5.1. Resumen de conceptos piagetianos
En el perodo sensoriomotor son importantes
Reaccincircularprimaria(RC1.)
Reaccincircularsecundaria(RC2.)
Intencionalidadoconductaintencional(CI)
Reaccincircularterciaria(RC3.)
Iniciodelacapacidadsimblica(ICS)
Lasreaccionescircularesprimariasconsistenenlarepeticindeaccionessobreel
propiocuerpoqueconducenaunresultadointeresante.Porejemplo,cuandoelbebmuy
pequeoencuentraporazarsudedopulgarjuntoasubocaycomienzaachuparlounay
otravez.
Las reacciones circulares secundarias son acciones orientadas hacia el exterior,
hacialosobjetosexternosyqueproducen,aligualquelasRC1.,resultadosinteresantes
oatractivosparaelbeb.Porejemplo,unbebde4mesesquetieneunmvilcolgando
desucunalogolpeaunayotravezproduciendoelmovimientodeste.
Elconceptodeintencionalidadoconductaintencionalsereferealabsquedade-
liberadadeunametapormediodeunaseriedecomportamientossubordinadosaella.La
intencionalidad es una caracterstica bsica de la conducta inteligente. Por ejemplo, un
bebde9meses,queannogatea,veunjugueteinteresantesobresualfombradejuegos,
peronopuedealcanzarlodesdedondeseencuentra.Entoncesseleocurretirardelaal-
fombrahaciasparacogerelobjeto.
Elconceptodereaccincircularterciariasuponelabsquedadeunefectointere-
sante o resultado atractivo para el sujeto, mediante la variacin y experimentacin de
distintasaccionesqueconduzcanatalefecto.Porejemplo,pensemosenunbebde15
mesesfascinadopordejarcaerunayotravezunjuguetedesdedistintasposicionespara
vercmosuena,dndecae,etc.
Enelestadio6elbebpasadeutilizaresquemasdeaccinexternaautilizarnuevos
medios,internos,paraconseguirelfnqueseproponga.Esdecir,elbebpuedecomenzar
ausarrepresentacionesmentalesosmbolos.Vamosadetenernosenesteconcepto,el
concepto de smbolo, ya que la capacidad simblica constituye un logro fundamental
eneldesarrollodelainteligencia.
Lacapacidadsimblicasuponeunlogrocrucialeneldesarrollointelectual(vasela
obra original de Piaget, La formacin del smbolo en el nio (1937/1961)). Permite al
niopoderanticiparlasconsecuenciasdesusacciones,planifcarlasmismasyllegara
pensarorepresentarsenoslolarealidadpresente,sinotambinlapasada,lafutura,la
Captulo 5. Los inicios de la inteligencia 113
imaginableolaposible.Suponeuncambiocualitativoimportantequemarcalatransi-
cindeunmododerelacinconlarealidadsensoriomotorabasadoensensacionesy
acciones externas a un modo simblico o representacional, caracterstico ya de un
nuevo tipo de inteligencia, la inteligencia operacional (vase Captulo 11). Veamos a
continuacin, de forma ms detallada, la caracterizacin de los 6 estadios del perodo
sensoriomotor,planteadosporPiaget.
ESTADIO1:Elejerciciodelosrefejos(0-1mesaproximadamente)
Desdeelcomienzodelavida,elbebhumanoponeenprcticaelconjuntoderefejos
conelquevieneequipado.ComoplanteaelpropioPiagetenEl nacimiento de la inteli-
gencia en el nio (1936/1985), respectodecadaconductarefejaorefejo:
... por muy implantado que est en cuanto mecanismo fsiolgico hereditario y
por muy fjado que parezca en su automatismo inmutable, no por ello deja de
necesitar un cierto ejercicio para adaptarse verdaderamente, ni es menos sus-
ceptible de acomodacin gradual a la realidad exterior (p.37).
Elejerciciodelosdistintosrefejoslesirvealbebhumanocomopuntodearranque
parasudesarrollopsicolgico.Losrefejosdelrecinnacido,porejemplo,eldesuccin
oeldeprensin,experimentanenesteprimerestadiopequeasadaptacionescombi-
nacindeasimilacinyacomodacin,yenesteejerciciosemodifcan,constituyn-
doseentoncesenconductascadavezmsalejadasdelopuramentebiolgico-hereditario
y acercndose gradualmente a lo que constituyen las primeras conductas adquiridas,
propiasyadelsegundoestadio.Veamosunadetalladaobservacinrealizadaporelpro-
pio Piaget en relacin a este tipo de actividades que ocupan a los bebs menores de
2meses:
Los smbolos son cualquier tipo de estmulo o cdigo que representa otra cosa (objeto,
persona...). El ejemplo prototpico de smbolo son las palabras; por ejemplo, la palabra
pelota no es ms que un conjunto de sonidos (fonemas) que en lengua espaola li-
gamos inmediatamente con el objeto redondo que sirve para jugar en distintas moda-
lidades (ftbol, baloncesto, etc.). Los smbolos tienen por tanto dos planos distintos: el
llamado plano del signicante o forma (en el caso de la palabra, sera el conjunto de
fonemas que la forman: /p-e-l-o-t-a/ en espaol, /b-o-l/ en ingls, etc.), y el plano del
signicado o realidad a la que representan. Pero las palabras, el lenguaje, no agotan
toda la realidad simblica. Tambin encontramos en otros mbitos o actividades la pues-
ta en funcionamiento de la capacidad simblica; en concreto, en el llamado juego sim-
blico, en el dibujo y en la imitacin diferida.
CONLOSPIES
ENLATIERRA Qu es un smbolo?
114 Bloque II. El desarrollo temprano
Observacin 10: A los 0;0 (25)
3
Laurent se encuentra tendido boca arriba, sin
demasiado apetito (no ha llorado desde su ltima toma) y establecemos un con-
tacto entre el pezn y su mejilla derecha. Se gira hacia el lado correcto pero
apartamos el seno hasta unos 5-10 cm. Se orienta durante algunos segundos
hacia la direccin correcta, pero luego renuncia. Tras unos instantes (contina, pues, acos-
tado boca arriba, con su cara mirando el techo), comienza a mover la boca aunque dbil-
mente, ya que la cabeza oscila a la izquierda y a la derecha para acabar orientndose fnal-
mente hacia el lado incorrecto. Breve bsqueda en esta direccin, seguida de una mmica de
llanto, y nueva detencin. Despus de unos momentos, nueva bsqueda en la direccin inco-
rrecta. Le tocamos el centro de su mejilla derecha: ninguna reaccin. Solamente cuando el
pezn le roza la piel a 1 cm aproximadamente de sus labios es cuando se gira y lo coge.
Parecera, al leer esta descripcin, que todo el ejercicio de las ltimas semanas ha sido
vano.... Pero al repetir al da siguiente la misma experiencia se obtienen unos resultados
exactamente contrarios, como seguidamente vamos a ver.
A los 0;0 (26) Laurent se encuentra tumbado boca arriba dando muestras de gran ape-
tito. Le toco el centro de la mejilla con mi dedo ndice replegado, tan pronto en el lado de-
recho como en el izquierdo: a cada ocasin se vuelve inmediatamente hacia el lado correcto.
Luego, mientras sigue recostado boca arriba, siente el pezn en el centro de su mejilla dere-
cha. Pero cuando intenta cogerlo, se lo apartamos unos 10 cm. Estira entonces el cuello,
siempre hacia el lado correcto, y busca de un modo claro. Cansado por el esfuerzo, descan-
sa un instante, siempre con el rostro orientado hacia el techo; luego su boca reemprende la
bsqueda y su cabeza se orienta inmediatamente hacia el lado idneo. En esta ocasin, se
adelanta hasta tocar el pezn, primero con la nariz, luego con la regin intermedia entre los
orifcios nasales y la comisura de los labios. Entonces repite en dos ocasiones y de manera
muy precisa el gesto anotado en 0;0 (24). (Ibd.,pp.35-36.)
LaimportanciatericadestayotrasobservacionesquePiagetofreceensuestudio
del perodo sensoriomotor permiten comprender cmo un sistema de puros refejos se
constituyeenconductapsicolgica,adaptndosepasoapasoalarealidadexterior.
ESTADIO2:Lasprimerasadaptacionesadquiridasylasreaccionescirculares
primarias(1-4mesesaproximadamente)
3
Duranteestesegundoestadioaparecen,porquesehanidogestandodesdeelnacimiento,
lasprimerasconductasadquiridasyloquePiagetdenominreaccionescircularespri-
marias.Lamejormaneradeapreciardequtipodeactividadeshablamosescitandode
nuevootradelasobservacionesdelautor:
3
EnelsistemadenotacinutilizadoporPiagetlaedaddelosniosdesusobservacionessecodifcaen
aos (primer dgito), meses (segundo dgito) y das (tercer dgito, entre parntesis). De modo que 0;0 (25)
correspondealaedadde25das,y1;2(10)corresponderaa1ao,2mesesy10das.
Observacin 17: A los 0; 1 (2) Laurent grita de hambre en su cuna. Se le coge
mantenindole en posicin casi vertical. Su comportamiento pasa entonces por
cuatro fases sucesivas que se distinguen con bastante nitidez. Comienza por
calmarse e intenta mamar girando la cabeza a izquierda y derecha mientras que
Captulo 5. Los inicios de la inteligencia 115
Despus, la observacin 20 nos proporciona un claro ejemplo de reaccin circular
primaria,cuandoLaurentsechupaeldedopulgar:
A los 0; 0 (17), en cambio, me lo encuentro chupndose el pulgar, a pesar de
hallarse tumbado. [...] El pulgar, despus de haber salido de la boca, vuelve a
ella en una serie de ocasiones. (Ibd,p.59.)
Lasreaccionescircularesprimariassonyaconductasadquiridasqueselogranme-
diantelarepeticindeaccionessobreelpropiocuerpo,accionesenlasquesevenim-
plicados claramente los mecanismos de asimilacin por ejemplo, asimilacin al es-
quema refejo de succin y acomodacin por ejemplo, al dedo que se chupaba
Laurent.
ESTADIO3:Reaccionescircularessecundariasyprocedimientosdestinados
aprolongarespectculosinteresantes(4-8mesesaproximadamente)
Lasreaccionescircularessecundarias,comodetallbamosmsarriba,implicanyaob-
jetosexternosalpropiocuerpo,portanto,estamosanteunbebqueseinteresaporlos
efectosqueprovocansuspropiasacciones:tirar,empujar,golpear,agitar,etc.Noobstan-
te,hayquerecordarqueenesteestadiolacapacidadintencionalnohahechosuaparicin
en el escenario psicolgico, por tanto, las actividades tpicas del mismo no son conse-
cuenciasplanifcadasobuscadas,sinoefectosprocedentesdedescubrimientosazarosos
queserepitenporelplacerqueproporcionanalbeb.LasiguienteobservacindePiaget
recogelascaractersticasdeestosprocedimientos:
sus brazos se mueven al azar. Despus (segunda fase), los brazos, en lugar de describir unos
movimientos de envergadura mxima, parecen aproximarse hacia la boca. En varias ocasio-
nes, una y otra mano rozan los labios; la mano derecha se pega a la mejilla del nio y la
estrecha durante unos segundos. Durante todo este juego, la boca permanece completamen-
te abierta e intenta sin cesar aferrar algo. Entonces queda atrapado el pulgar izquierdo y los
dos brazos se inmovilizan de pronto, el brazo derecho queda doblado sobre el pecho, debajo
del brazo izquierdo, que est a su vez retenido por la boca. En una tercera fase los brazos
recorren de nuevo el espacio desordenadamente, una vez que el pulgar izquierdo haba sali-
do de la boca despus de algunos minutos. Durante este tiempo, el nio se agita por la c-
lera, con la cabeza tirada hacia atrs y sus gritos alternan con los intentos de succin. Fi-
nalmente se inicia una cuarta fase durante la cual las manos se aproximan de nuevo a la
boca; sta intenta en todo momento alcanzar los dedos que le rozan. Estos ltimos intentos
no consiguen ningn resultado positivo y el llanto se reanuda defnitivamente.
Podemos hablar en esta ocasin de coordinacin? ... La sucesin de estas cuatro fases
parece indicar un comienzo de relacin entre los movimientos de los brazos y los intentos de
succin. (Ibd.,pp.57-58.)
116 Bloque II. El desarrollo temprano
Observacin 105: Desde 0; 4 (19), Laurent, como hemos visto (observacin
103), sabe golpear con la mano intencionalmente los objetos colgados. Ahora
bien: a los 0; 4 (22) sujeta un palo, con el cual no sabe qu hacer y que se va
pasando lentamente de una mano a otra. El palo roza por casualidad un sona-
jero colgado de la capota: Laurent interesado en el acto por este efecto inesperado, mantie-
ne el bastn derecho en la posicin que acaba de ocupar y lo acerca visiblemente al sonaje-
ro. Lo roza as por segunda vez. Hace retroceder el palo, pero alejndolo lo menos posible,
como para intentar de nuevo la posicin favorable, y luego lo acerca al sonajero, y vuelve a
empezar cada vez ms rpidamente. (Ibd.,p.172.)
ESTADIO4:Lacoordinacindelosesquemassecundariosysuaplicacin
anuevassituaciones(8-12mesesaproximadamente)
A diferencia del estadio anterior, en el estadio 4 se observan ya conductas claramente
intencionales(CI).Estanuevaconquista,laintencionalidad,selograapartirdequeel
bebcoordinadosesquemasdistintosyunodeellossesubordinaalotroalesquema
queconstituyeelfnuobjetivodelaconducta.Porejemplo,elesquemadetiraroarras-
trar en el caso que utilizbamos al defnir CI se subordina al esquema de alcanzar un
juguete.VeamosenlasiguienteobservacindePiaget,consuhijaJacqueline,estetipo
decoordinaciones:
Observacin 129: a los 0; 9 (24), Jacqueline est sentada e intenta coger su
pato, colocado cerca de sus pies. Como no lo consigue, lo acerca con su pie
derecho. No he podido ver si haba todava algn tanteo o si la reaccin era
inmediata. A los 0; 11 (21), en cambio, deja caer al suelo, del columpio en que
se balancea, un cisne de celuloide: como no consigue recogerlo, lo desplaza inmediatamen-
te con los pies y se lo aproxima. (Ibd.,p.217.)
Estetipodeconductasyaintencionalescoincideneneldesarrolloconlosprimeros
indicios de anticipacin por parte del nio. Por ejemplo, el beb que se encuentra en
esteestadioanticipaquesumadrevaasalirdecasacuandolaveponindoseelabrigo.
Esdecir,sedaunreconocimientodequealgovaasuceder,perosiempreenelcontex-
to de acciones rutinarias que no implican an capacidad representacional. Hemos de
esperaranalestadio6paraobservaraccionesquerequieranelusodeestetipodeca-
pacidad.
ESTADIO5:Lareaccincircularterciariayeldescubrimientodelosnuevos
mediosmedianteexperimentacinactiva(12-18mesesaproximadamente)
Enesteestadionosencontramosdenuevoconreaccionescirculares,esdecir,actividades
queseiniciandemanerafortuitayqueserepiten;sinembargo,enestecasolareproduc-
cindelaaccinoelfenmenodalugaraunaverdaderaexperimentacin.Yanoesmera
repeticinper se,porelplacerqueprovocaelresultado.Enestecasoelniovamsall
Captulo 5. Los inicios de la inteligencia 117
yvara,grada,cambialigeramentesusmodosdeaccinobservandolasconsecuencias
queprovocan.Veamosmsclaramenteestetipodeactividadmedianteunejemplo:
Observacin 141: Un primer ejemplo nos permitir comprender la transicin
entre las reacciones secundarias y las reacciones terciarias: consiste en esta
conducta perfectamente conocida por medio de la cual el nio explora el espa-
cio alejado y construye su representacin del movimiento, la conducta de soltar
o de arrojar los objetos para intentar seguidamente recogerlos.
Recordemos (obs. 140) cmo Laurent a los 0; 10 (2) descubri explorando un estuche
de jabn, la posibilidad de soltar este objeto y de dejarlo caer. Ahora bien, lo que le interes
inicialmente fue, no el fenmeno objetivo de la cada, es decir, la trayectoria del objeto, sino
ms bien el acto mismo de soltar. Para comenzar, se limit a reproducir sin ms el resultado
observado fortuitamente, lo que constituye todava una reaccin secundaria, derivada, es
cierto, pero de estructura tpica.
En cambio a los 0; 10 (10), la reaccin cambia y se convierte en terciaria. En efecto, ese
da Laurent manipulaba un trozo de miga de pan (sin ningn inters alimentario: no lo haba
probado todava y no tiene idea de comerlo) y lo suelta continuamente. Llega incluso a des-
gajar unas migajas que luego deja caer unas tras otras. Contrariamente a lo que suceda en
das precedentes, no presta ninguna atencin al acto de soltar, mientras sigue con la mirada
con gran inters el mvil: en particular, lo mira durante largo rato una vez cado, y lo vuel-
ve a recoger cuando puede. A los 0; 10 (11), Laurent est recostado sobre su espalda pero
reanuda sin embargo su experiencia de la vspera. Coge sucesivamente un cisne de celuloide,
una caja, etc., extiende el brazo y los deja caer. Va variando claramente las posiciones de la
cada: tan pronto alza el brazo verticalmente como lo sostiene oblicuamente, hacia delante
o hacia atrs respecto de sus ojos, etc. Cuando el objeto cae en una posicin nueva (por
ejemplo, sobre su almohada), lo vuelve a dejar caer dos o tres veces en el mismo sitio, como
para estudiar la relacin espacial; despus modifca la situacin. (Ibd.,p.257.)
Mediante las reacciones circulares terciarias, el nio provoca situaciones nuevas,
acomodndosealosdistintosobjetosyluegolasrepitecomponentedeasimilacin.Su
actividadexperimentadoralellevaadescubrirnuevosmediosparaconseguirlosfnes
quesepropone.Noobstante,estaexperimentacintienelugaranenelplanodelaac-
cin sensoriomotriz, no en el de la representacin. Hemos de esperar hasta el prximo
estadio, el estadio 6, para observar cmo la experimentacin se traslada al plano de la
representacinmental.
ESTADIO6:Lainvencindenuevosmediosmediantecombinacionesmentales
(18-24mesesaproximadamente)
Comoanticipbamosantes,elestadio6constituyeelpuntodetrnsitodelperodosen-
soriomotoraldeoperacionesconcretas.Eliniciodelacapacidadsimblicaorepresen-
tacionalconstituyeunhitoimportantsimoeneldesarrollodelainteligencia,quesupone
uncambiocualitativoenelmismo.Sematerializaenelpasodelainteligenciasensorio-
motriznosimblica,norepresentacionalalainteligenciaoperatoria,primeroalas
operacionesconcretasyluegoalasoperacionesformales.
118 Bloque II. El desarrollo temprano
Pero veamos, mediante un ejemplo, cmo el nio inventa nuevos medios mediante
combinaciones,yanomaterialesofsicas,sinomentales;esdecir,cmoplanifcasu
accinantesdellevarlaacabofsicamente.
Observacin 179: Un ejemplo ms complejo es el de la cadena del reloj que
ha de hacerse penetrar en el orifcio de 16 34 mm. Recordemos tambin en
este caso, los tanteos de Jacqueline. Lucienne, en cambio, resolvi el problema
mediante una brusca invencin. A los 1; 4 (0), sin haberlo visto nunca antes,
Lucienne mira la caja que le acerco y que vuelvo sin que haya podido ver el contenido: la
cadena cae y se extiende en el suelo, y la nia intenta inmediatamente volverla a meter. Em-
pieza por meter sencillamente un extremo de la cadena en la caja y trata de hacer seguir el
resto, progresivamente. Este procedimiento que es el primero que emple Jacqueline, sale
bien por casualidad durante la primera prueba (el extremo introducido en la caja se queda
casualmente enganchado), pero fracasa por completo en la segunda y tercera tentativas. En
la cuarta prueba, Lucienne empieza como antes, se interrumpe y, tras un breve momento de
deteccin pone ella misma la cadena en una repisa cercana (el experimento se lleva a cabo
sobre un chal), hace una bola con ella intencionadamente, toma la bola entre los dedos y la
introduce de una vez en la caja. A la quinta vez, la prueba empieza por un regreso muy bre-
ve al primer procedimiento. Pero Lucienne se interrumpe inmediatamente y vuelve al mtodo
correcto. Sexta prueba: xito inmediato. (Ibd.,p.320.)
Adiferenciadelasaccionesqueseobservabanenelestadioanterior,lasconductas
propiasdelestadio6noparecenoperaryamediantetanteoenelplanodelaaccin,sino
medianteinvencin;adems,labsquedadelasolucinofndelaaccinestdeal-
gunamaneracontroladaporelnioa priori,mediantecombinacionesmentales.Elnio
prev,anticipaqumaniobrashadellevaracaboparaconseguirloquequiere.
Estacapacidaddeanticipacinoprevisin,deplanifcacinendefnitiva,esunlogro
devitalimportanciaeneldesarrollointelectualdelnio,quemarcaelfndelainteligen-
ciasensoriomotriz,propiadelosprimerosmesesdevidadelbeb.
Tabla 5.2. Sntesis del perodo sensoriomotor
ESTADIO 1 (0-1 mes) Ejerciciodelosrefejos.
ESTADIO 2 (1-4 meses) PrimerasadaptacionesyRC1.
ESTADIO 3 (4-8 meses) RC2.aplicacinesquemassensoriomotoresaobjetosexternos.
ESTADIO 4 (8-12 meses)
Coordinacin de esquemas secundarios y aplicacin a situaciones
nuevas[CI].
ESTADIO 5 (12-18 meses) RC3.repeticindeunaconductaconvariaciones.
ESTADIO 6 (18-24 meses) Experimentacininterna[ICS].
Captulo 5. Los inicios de la inteligencia 119
3. La nocin piagetiana de objeto permanente
Vamosahoraatratarunodelosaspectosmscuriososyrelevantesdeldesarrolloenlos
dos primeros aos de vida. Se trata de conocer cmo adquiere el nio una visin del
mundo en la que l mismo se site como un objeto ms entre los dems, un logro que
comoveremosnoesnadasencillo.
Debemos empezar por decir que en el mundo de los bebs los objetos no tienen la
permanenciaquelesotorgamoslosadultos.Piagetpensabaqueelbebnosabequelos
objetos siempre permanecen en algn lugar.Aunque no los vea ni tenga ninguna otra
constanciaperceptivadeellos,asujuicio,paraelbeblosobjetosseencuentranenun
continuo juego de apariciones y reapariciones. Como podemos sospechar, si nunca ad-
quirisemoslapermanenciadelosobjetos,estaramoscondenadosavivirenunmundo
tanimpredeciblequenosesinclusodifcildeimaginar.
Lapermanenciadelosobjetoses,portanto,unrequisitobsicoparaeldesenvolvi-
miento en el medio. El nio debe saber que los objetos pueden verse afectados por las
acciones,peroquesuexistenciaesesencialmenteindependientedeellas.ParaPiageteste
problemaepistmicoseencuentraenlamdulamismadeldesarrollointelectual.
LanocindeobjetopermanentefueestudiadaporPiagetensulibroLa construccin
de lo real en el nio (1937).Ajuiciodelautor,solamentecuandoelbebseinteresapor
buscarobjetosdesaparecidosdemuestracomprenderqueelobjetopermaneceenalguna
parte mientras no est bajo su percepcin inmediata. La nocin de permanencia es tan
esencialquealgunosautoresdefendenqueestpresentedesdemuchoantesdelsegundo
aodevida.Noobstante,antesdeocuparnosdeesedebateentrepsiclogosevolutivos
vamosaconocerlavisindePiagetsobresuadquisicinalolargodelosseisestadios
deldesarrollosensoriomotor.
3.1. Primer y segundo estadio
En los primeros estadios el beb reconoce bastantes objetos, discriminando cules de
ellosson,porejemplo,succionables,comoelpezn,elchupeteosudedopulgar.Pero
Piagetinsisteenqueestereconocimientoesslounreconocimientodeloquelllama
cuadrosyantelosqueelbebponeenmarchadeterminadosesquemassinqueningu-
no de esos cuadros tenga una existencia independiente del beb. Por ejemplo, si el
chupetedesaparecedesuvistanotratardebuscarlo,siacasocontinuarrealizandolos
movimientos acomodativos previos como si el objeto pudiese resurgir o emanar de la
propia accin. En defnitiva, para Piaget en esta etapa hay una ausencia total de toda
conductaefcazrelativaalosobjetosdesaparecidos.Elcuadroqueseeclipsaesolvidado
obiendeseadoyesperado,perolaesperanzadehacerloreaparecersloesapoyadapor
larepeticindelasacomodacionesanteriores.
3.2. Tercer estadio
Elacercamientoalosobjetosatravsdelasreaccionescircularessecundariaspermiteal
nioimportantesadelantosenelconocimientodesuscaractersticas,acercndoleunpoco
ms al concepto de objeto permanente. Veamos estos avances siguiendo el criterio de
complejidadpropuestoporPiaget.
120 Bloque II. El desarrollo temprano
a) Acomodacinvisualalosmovimientosrpidosyprensininterrumpida
Elcontroldelavisinpermitequeantelacadadeunobjetolosbebsreaccionenanti-
cipandosupuntodellegadaymirandoenellugarmsomenosexactodelacada,en
otras palabras, que anticipen la existencia del objeto en una posicin futura. De modo
similar, si el beb pierde un objeto de su mano repetir sus movimientos de prensin
comosiesperasequeelobjetosubsistieseenalgnlugarcercano.
Noobstante,ypesealosignifcativodeestasconductas,elobjetosigueteniendo
unaexistenciasubordinadaalaaccindelnio.ComoPiagetdeca,elobjetoanesta
disposicindelaaccin;losbebsnobuscanactivamenteunobjetoperdidodesusma-
nos,sencillamenterepitenlosmovimientosdeprensinprevios.
b) Lasreaccionescircularesdiferidas
Losbebsdeltercerestadiosoncapacesderecuperarunobjetoquenoven,perosloa
condicindequelaaccinnecesariaparaelloformepartedeunareaccincircularque
sehainterrumpido.Vemosloenunejemplo:
Jacqueline, a los 0;9 (3), intenta tomar de atrs de su cabeza una manta que
quiere para balancearla. Yo la distraigo presentndole un pato de celuloide. Lo
mira, despus trata de tomarlo, pero bruscamente se interrumpe para volver a
buscar detrs de ella la manta que no vea. (Piaget,1937/1969,p.34.)
Piagetinsistienqueenestaetapaelobjetoancontinaadisposicindelaacti-
vidad. En su opinin el comportamiento de Jacqueline no implica la bsqueda de un
objetodesaparecidosinomsbienlarecuperacindeunaactividadprevia,setratadeuna
vueltaalaactividadcircularmsquedeunavueltaalobjetomismo.
c) Lasreconstitucionesdeuntodono-visibleapartirdeunafraccinvisible
ylasupresindeobstculosqueimpidenlapercepcin
Estasconductasapuntanunacercamientonuevoymsprximoalobjetocomoentidad
permanente.Anteunobjetosemicubiertoelnioreaccionacomosisetratasedelobjeto
completo,identifcandolapartecomountodoymostrandoalegrasielobjetolegusta,
inclusopuedeintentarapartarlapantallaquelocubreparatomarlo
4
.Tambinsercapaz
deliberarsedeunpao,uncojnocualquierotroobstculoquesepongasobreelrostro
impidindole ver. No obstante, cualquiera de estas acciones, aunque complejas, siguen
vinculandolaexistenciadelobjetoalapropiapercepcin.Lapruebaesquesielobjeto
seocultatotalmenteelnionomuestraningunareaccin.
4
Enestaltimaconducta(apartarparacoger)elnioseestaraadelantadohastaelcuartoestadioensu
desarrollointelectual.
Captulo 5. Los inicios de la inteligencia 121
3.3. Cuarto estadio
A partir de este estadio los nios comienzan a buscar los objetos que desaparecen por
completotrasunapantalla,unamanoocualquierotroobstculo.Acontinuacinsemues-
traunejemplo:
Jacqueline a los 0;10 (3) [...], mira su papagayo apoyado sobre sus rodillas.
Pongo mi mano sobre el objeto: la levanta y toma el papagayo [...]. (Ibd.,
p.55.)
Sinembargo,labsquedadelobjetodesaparecidopermanecerestringidaaunanica
ubicacin:elprimerlugardondefueescondidoyvueltoaencontrar.Estapeculiarlimi-
tacinenlabsquedaseconocecomoreaccintpicaysegnPiagetponedemanifes-
toqueelvnculoconelobjetosiguepasandoporelfltrodelaaccin:losobjetosexisten
enlugaresprivilegiadosdeterminadosporlarelacindelnioconelobjetoynoporre-
lacionesespacialesobjetivas.Veamoscmoacabaelepisodioanterior:
[] Lo vuelvo a tomar (refrindose al papagayo) y, ante su vista, lo alejo muy
rpidamente para ponerlo debajo de una alfombra, a 40 centmetros de all.
Durante este tiempo vuelvo a poner mi mano sobre sus rodillas. Desde que
Jacqueline deja de ver el papagayo, vuelve a llevar su mirada sobre sus rodillas,
levanta mi mano y busca debajo. La reaccin es la misma durante tres ensayos sucesivos.
(Ibd.,p.54.)
3.4. Quinto estadio
Eliniciodeesteestadiovienemarcadoporlacapacidaddelnioparabuscarelobjeto
enelltimolugarenelquefueescondido.Ahorabien,signifcaraestelogroqueelnio
tieneporfnunanocindelosobjetossimilaraladelosadultosbuscndolostraspan-
tallasquelosocultanyesperandoqueaparezcanenelltimolugarenquefuerondeja-
dos?Casi,perono.
Elnioannoharotoelltimolazoquevinculalaexistenciadelobjetoasupropia
informacinperceptiva.Porello,siqueremosquebusqueelobjetoensultimoescon-
ditedeberverclaramenteeldesplazamiento.Volviendoporltimavezalejemploante-
rior predeciramos que, si en el desplazamiento hacia la alfombra el objeto es cubierto
conunpao,elniodelquintoestadioignorarelcambiodelugarybuscarelobjeto
enlamanodeladulto.
3.5. Sexto estadio
Essloenesteestadiocuandoelniotomaencuentalosdesplazamientosnovisiblesdel
objeto.Subsquedadenotaquelosobjetossehanliberadotantodelapercepcincomo
delapropiaaccinparaobedeceraleyesdedesplazamientototalmenteautnomas.
122 Bloque II. El desarrollo temprano
SegnPiaget,larepresentacinverdaderacomienzaaoperarcuandoelnioescapaz
dededucirlosdesplazamientosdelosobjetos.Ensuopinin,hastaahoraelnioseha
guiadonoderepresentaciones,sinodendices.Porejemplo,enelcuartoestadiolapan-
tallatraslaqueseocultaunobjetoesndiceoindicadordelapresenciadelobjetotras
des.Ahorabien,cuandonoslolaubicacindelobjeto,sinotambinsusdesplazamien-
tosdebenserreconstruidos,elautorafrmaquelaactuacindelnioslopuedeexpli-
carseapelandoalmanejointernoderepresentaciones.
La objetivacin del objeto al fnal del perodo sensoriomotor va unida a los logros
conseguidosenelterrenodelaimitacinyenlacomprensindelasrelacionesespacio-
temporales.TodosestosavancesposibilitanloquePiagettachderevolucincopernica-
naenelnioyquenoesotracosaquesuubicacineneluniversodeobjetoscomouna
realidadmsynocomosuepicentro.Losobjetostienenporfnunaidentidadindepen-
diente de las acciones que se efectan sobre ellos, y con esta conquista intelectual el
perodosensoriomotorrompelabarreramssignifcativadelegocentrismointelectual
(vase Captulo 8).
4. La evolucin de la imitacin segn Piaget
Laimitacinesunodelosmecanismosdeaprendizajemspotentesyarcaicosdecuan-
tosposeemos,poresoesprcticamenteimposiblehablardedesarrollosinmencionarla.
Lasconductasdeimitacinaparecenligadasaldeseoinconscienteyprofundamentehu-
manodeidentifcacinconelotro.Cuandounbebimitalaconductadeunmodelolo
hacesintomarencuentalosobjetivosdesuaccin,sinsaberhaciadndelelleva;pare-
cieraque,sencillamente,imitadejndosellevar.
ParaPiagetlaimitacineselrecursodeaccindesdeelquegerminarnmstarde
lasimgenesmentales.QuizsobredeciraestasalturasquePiagetatribuyealasrepre-
sentaciones,yalasimgenescomoejemplosparticularesdeestas,unpapelcrucialenel
razonamiento.Sinrepresentacioneslaraznslopodraserprcticaeinmediata(senso-
riomotora). Es la capacidad de representarnos la realidad lo que nos permite inventar,
planifcar,soar,recordaryendefnitivamanipularloshechosinternaynoslomecni-
camente.Unlogroque,comosabemos,paraelautorseproduceenelltimotramodel
desarrollosensoriomotor.
EnsulibroLa formacin del smbolo en el nio,Piagetsostienequelaimitacinno
tienenadadeautomticaoinvoluntaria.Alcontrario,laimitacinesunamanifestacin
msdelainteligenciasensoriomotoraycomotalmanifestacin,sedesarrollasiguiendo
susmismosseisestadios.Laevolucindelaimitacinpuede,portanto,plantearsecomo
la progresiva diferenciacin de los mecanismos de asimilacin y de acomodacin que
participanencualquierotraconductaadaptativa,sibien,mientraselactointeligentebus-
caelequilibrioentreambosmecanismos,laimitacintienecomofnelpredominiode
laacomodacin.
4.1. Primer estadio
EnelprimermesdevidaPiagetpreferehablardesimpledesencadenamientorefejode
la conducta por efecto de un excitante externo. Este mecanismo refejo explicara, por
Captulo 5. Los inicios de la inteligencia 123
ejemplo,eldesencadenamientodelllantocomorespuestaalllantodeotrosnios.Pero
ensentidoestrictoparaPiagetestoscontagiosconductualesnoformanpartedelaimita-
cinyaquenoexisteunesfuerzodeacomodacin.
4.2. Segundo y tercer estadio
Enestosdosestadioselbebimitalasaccionesconocidasquerealizaunmodelo,pero
noimitaconductasqueseannuevasparal.Estacircunstanciahacedifcildistinguirla
imitacindelaasimilacinquePiagetdenominrecognoscitiva.Veamosunejemplo:
Antes de imitar el movimiento de mis manos J. y T., posean un esquema pre-
ciso, tanto manual como visual: juntar o separar las manos y mirarlas actuar
as. Consecuentemente cuando el nio mira mis propias manos que se dedican
a este mismo movimiento, al acomodar su mirada a los desplazamientos los
asimila al esquema ya conocido [...] La imitacin del movimiento de las manos no es pues
sino una prolongacin de la acomodacin debida al hecho de que el modelo es asimilado a
un esquema ya constituido. (Piaget,1946/19,pp.31-32.)
Enestasetapasanteunmodeloquerealizaconductasnovedosaselniosueleperma-
necerindiferenteobienaplicarlosesquemasyaconquistados.
4.3. Cuarto y quinto estadio
ParaPiagetlaimitacinpropiamentedichacomienzaenelcuartoestadiodeldesarrollo
sensoriomotorcuandoelnioescapazdeimitarconductasnovedosas,enestemomento
laimitacinsehaespecializadoenlaacomodacin.
Elprogresodelaimitacinvieneapoyadoporlacapacidadpropiadeesteestadiopara
combinar diferentes esquemas de accin entre s. Segn Piaget, la acomodacin a un
modelonuevoexigeciertaductilidaddelosesquemas,lacual,necesariamente,marchara
parejaconsucoordinacin.Porotrolado,elhechodequeenestasetapasseconstruyan
lasprimerasformasdelobjetoascomounaprimeraobjetivacindelespacioylacau-
salidadcontribuyeaquealnioimiteconductasquenopuedeversobresmismo.
De los 0; 10 a los 0; 11 el gesto de abrir y cerrar los ojos no ha desencadena-
do en L ninguna reaccin. Pero a los 0; 11 (5), cuando abro y cierro los ojos
frente a ella, comienza a abrir y cerrar sus manos, lenta y sistemticamente.
Despus abre y cierra la boca con igual lentitud, diciendo tata. Por el con-
trario al 1; 0; (14), el mismo modelo da lugar a dos reacciones: primero guia los ojos al
abrir y cerrar la boca como si le costara trabajo distinguir entre estos dos esquemas desde
el punto de vista motor y quinestsico; despus toma una almohada con la cual se cubre la
cara para levantarla enseguida y volver a hacerlo apenas yo cierro los ojos. [...] No es has-
ta el 1; 2 (7), es decir, en el curso del quinto estadio, cuando L. imit en forma clara y def-
nida este gesto, sin cubrirse ya el rostro con un objeto cualquiera [...]. (Ibd.,pp.59-60.)
124 Bloque II. El desarrollo temprano
Comoseobservaenelejemplo,laniadelcuartoestadioantitubeaintentandoco-
ordinarsusesquemas(tantoprimarioscomosecundarios)paraencontrarlaconvergencia
conelmodelo.Encambio,apartirdelestadioquintolaimitacinsevuelvemsprecisa
ylospequeossoncapacesdeactuardeunmodosistemticocombinandounosyotros
esquemasmotores.
Enelcuartoestadiocobranespecialimportancialosndices.Paralaniadelejemplo,
la conducta del modelo es ndice de abrir y cerrar algo, por eso, aunque yerre en sus
primeros intentos, sus errores son inteligentes en el sentido de que se dirigen hacia el
meollodelaaccinpropuestaporelmodelo.Aestetipodeimitacinseleconocecomo
imitacinrepresentativayserelantecesorinmediatodelarepresentacinmentaluna
vezqueseinterioriceypierdasumanifestacinexterna.Sinembargo,nisiquieraenla
quintaetapaelniosercapazdeimitarlaconductadeunmodeloausente.Estaimita-
cinexigeelempleodeunaimagen-recuerdoyestelogrosloserposibleenelsexto
estadio.
4.4. Sexto estadio
Al fnal del segundo ao de vida la capacidad imitativa alcanza su cenit. El nio imita
inmediatamenteysintitubeoslasconductasnovedosasdeunmodelo,einclusoimitalas
accionesdeunmodeloausente.
Al 1; 4 (0); J. me mira cuando cruzo y descruzo rpidamente los brazos y me
golpeo los costados con la mano (gesto de recalentarse). Hasta ahora no ha
intentado imitar este movimiento que le propongo como modelo por segunda o
tercera vez. Sin embargo, inmediatamente consigue una imitacin correcta. Su
gesto es un poco torpe pero reproduce el modelo cabalmente. A continuacin sucede lo mis-
mo con diversos movimientos complicados de los brazos y de las manos; describir una cruz,
poner los brazos encima y detrs de la cabeza, etc. (Ibd.,p.86.)
Elejemplomuestraquelaimitacinesinmediata,comosilaacomodacinalmode-
lo se hubiese efectuado interiormente, sin necesidad de ensayar los intentos de adapta-
cin. Ms asombroso an es el hecho de que el pequeo, sin haber imitado nunca un
movimientoosonido,lopuedareproducirporprimeravezenausenciadelmodelo.En
estecasopareceevidentequelaimitacinseapoyaenunrecuerdooimagen,endefni-
tiva,quesehaliberadodelasexigenciasdelaaccininmediataypuedeahorafuncionar
interiormente.DeestemodoPiagetunalasimgenesalaaccin;elorigendestasno
eraotroquelaimitacininteriorizada.
LaposturasostenidaporPiagetrelativaalapermanenciadelobjetoylaaparicin
de la imitacin ha sido muy criticada.Actualmente no hay acuerdo unnime en situar
ambascapacidadesalfnaldelsegundoaodevida.Losresultadosdetrabajosrealiza-
dos desde otras perspectivas han abierto un enconado debate sobre las capacidades de
los bebs. Actualmente son bastantes los autores que estn de acuerdo en atribuirles
mayorescapacidadesderazonamientoaedadestempranasytambinunamayorcapa-
cidad de aprendizaje a partir de la observacin directa. Baillargeon (1993) concluy
Captulo 5. Los inicios de la inteligencia 125
abiertamente que la capacidad para representarse objetos ocultos aparece al inicio del
perodosensoriomotorynoalfnal,[] contrariamente a lo que Piaget ha propuesto,
bebs tan jvenes como los de 3 meses y medio se representan la existencia de objetos
ocultos(p.308-309).
Aunquenopodemosentraraexponerydebatirlasdiferentesposturasqueactualmen-
tesedefenden,queremostransmitirlaideadequehoyendaasistimosaunimportante
debateentornoalasverdaderascapacidadesdelosbebsenelqueseestnmanejando
diferentes argumentos desde unos y otros puntos de vista. La pregunta que centra este
debateesenqumomentoevolutivoaparecenlasrepresentaciones.Setratadeaveriguar
siesnecesariasuparticipacinenlosprimerosrazonamientososi,talycomosostuvo
Piaget, las representaciones mentales slo aparecen al fnal de un perodo en el que el
razonamientodelniosebasanicamenteenesquemassensomoriomotores.
Los extraordinarios datos sobre imaginera y razonamiento en bebs han llevado a
muchosautoresaproponerlaexistenciadediferentesmecanismosodispositivosinnatos
quefacilitaranlacomprensinyadaptacinalmedio,enunmovimientoqueseconoce
comoneonativismo.Aunquecomoyahemossealado,lostrabajosbasadosentestsvi-
sualestienenladesventajaderealizarungransaltoinferencialparaidentifcarunproce-
socognitivo,internoycomplejodesdelasolaconductavisualdelbeb,hoyhaycierto
acuerdoenquelosbebstienenmscapacidadesdeadaptacinalmediodelasquePia-
getsupuso,aunqueannopodamosdeterminarconcertezaculessonyhastaqupun-
to infuyen en nuestro desarrollo. Nuestro conocimiento sobre las capacidades y herra-
mientas de conocimiento en los bebs es an incompleto, pero en esta labor de
investigacin se hace necesario valorar con prudencia los resultados de las diferentes
aproximacionesmetodolgicassinoqueremosinfravalorarlascapacidadesdelosbebs,
perotampocosobreinterpretarlas.
Lecturas complementarias
Piaget,J.(1936).El nacimiento de la inteligencia en el nio.Barcelona:EditorialCrtica,1985.
Piaget,J.(1937).La construccin de lo real en el nio.BuenosAires:Proteo,1965.
Piaget,J.(1937).La formacin del smbolo en el nio.Mxico:FCE,1961.
126 Bloque II. El desarrollo temprano
Actividades
1. Conteste a las siguientes preguntas.
Imaginemos a un beb que jugando con el sonajero lo ha arrojado fuera del alcance de
su mano e intenta cogerlo tirando de la manta sobre la que ha cado. Este es un ejem-
plo de:
a) Una conducta claramente intencional.
b) Una reaccin circular secundaria.
c) Una conducta preoperatoria.
A un grupo de recin nacidos se les muestran dos tipos de estmulos visuales: unos
son dibujos de rostros humanos esquemticos y otros son dibujos con los mismos rasgos
faciales pero colocados de forma desordenada. Midiendo el tiempo de jacin visual se
observa que los bebs miran ms al primer tipo de dibujos. Qu tipo de mtodo se ha
utilizado en este experimento?
a) Habituacin.
b) Preferencia.
c) Deshabituacin.
2. Comentario de texto
Lea el siguiente texto de Mehler y Dupoux (1990) y reexione sobre las cuestiones que
se plantean a continuacin:
Imaginmonos un mundo trastocado, en el que los granos de arena pro-
dujeran un estruendo espantoso y los bloques de granito cayeran al suelo
con un soplo apenas perceptible. Imaginmonos que el agua resonara como
la madera, y que una tela satinada rechinara. [] Un adulto, frente a este
extrao mundo, se considerara sumergido en un mal sueo, o transportado a un uni-
verso poblado de imgenes sintticas aberrantes. Todo aquello a lo que, segn l, se
habra habituado tras largos aos de interaccin con el mundo fsico real, le parece-
ra de pronto trastocado. Pero el beb slo tiene una experiencia muy reducida de lo
que constituye el mundo circundante de los adultos. An no ha aprendido casi nada
y, sin embargo, un cambio en la congruencia de los datos perceptivos elementales le
perturba tanto como al adulto. El mundo no es, pues, para l un caos indistinto y con-
fuso, donde todo es posible y frente al cual l es un ser inocente, incapaz de verse sor-
prendido dado que carece de expectativas. Al contrario, lo que ve y oye tiene que res-
petar ciertas restricciones que no tienen nada de arbitrario, sino que son la expresin
cognitiva del patrimonio gentico propio de la especie humana. (pp.123-124).
Qu concepcin del conocimiento y la percepcin del beb deenden los
autores?
Es una postura congruente con la visin de Piaget?
Con cul de las dos posturas est ms de acuerdo? Reexione acerca de la cues-
tin exponiendo argumentos a favor y en contra.
Captulo 5. Los inicios de la inteligencia 127
Soluciones a las actividades
1. Preguntas
Para la primera pregunta la respuesta correcta es la a). El beb que se describe quiere
recuperar el sonajero y por tanto realiza una conducta intencional. La alternativa b) es
falsa porque la reaccin circular secundaria, aunque implica acciones con objetos, no
incluye la intencionalidad. Se trata ms bien de conductas azarosas que el beb repite
por placer, pero no con una intencin. Por ltimo, la alternativa c) es falsa puesto que
se trata claramente de una actividad sensoriomotora, basada en la accin y no preope-
racional.
Para la segunda pregunta la respuesta correcta es la b). Se utiliza un mtodo de
preferencia porque a los bebs se les exponen ambos estmulos a la vez y se observa
cul de los dos preeren mirar. La alternativa a) es falsa puesto que no se trata de
una habituacin. No se presenta un primer estmulo hasta que el beb se cansa de mi-
rarlo y despus otro para ver si recupera la atencin. La alternativa c) es falsa puesto
que la deshabituacin no existe.
2. Comentario de texto
La visin que deenden estos autores es innatista y, por tanto, contraria a la piagetiana.
Para Mehler y Dupoux el beb llega al mundo con una serie de principios que guan el
conocimiento y la percepcin. En este sentido, el beb no necesita demasiada experien-
cia para percibir los ejemplos de mundo trastocado que mencionan en el texto sino
que, al contrario, el beb dispone de ciertos principios que proporcionan orden al mun-
do y rpidamente generan expectativas. Como arman en el texto este conocimiento
es la expresin cognitiva del patrimonio gentico propio de la especie humana. Esta
perspectiva es totalmente contraria a la defendida por Piaget quien propuso una visin
constructivista del conocimiento. Segn Piaget el beb conoce el mundo actuando sobre
l. Gracias a esta actuacin directa con los objetos y las personas, el beb ir constru-
yendo distintos esquemas de accin que le permitirn actuar cada vez de forma ms
sosticada. No obstante, la capacidad para elaborar representaciones sobre los objetos
y las personas no aparecer hasta los 18 meses. As pues, para Piaget, ni el orden ni las
expectativas acerca de cmo deben comportarse los objetos proceden del patrimonio
gentico de la especie.
Los inicios
de la comunicacin
y el lenguaje
129
6
SONIA MARISCAL ALTARES
Esquema resumen
Objetivos
Introduccin
1. Comunicacin y lenguaje
1.1. Denicin de conceptos
1.2. Componentes del lenguaje
2. Desarrollo temprano de la comunicacin: del nacimiento hasta los 18 meses
2.1. Cundo comienza la comunicacin intencional? Requisitos cognitivos y
sociales
2.2. El papel del adulto: sobreinterpretacin de las actividades del nio como
conductas genuinamente comunicativas
2.3. Principales hitos en el desarrollo comunicativo durante el primer ao y
medio de vida
3. Desarrollo temprano del lenguaje: del nacimiento hasta los 3 aos
3.1. Atencin temprana al lenguaje
3.2. La percepcin inicial del habla
3.3. Hacia las primeras palabras
3.4. El inicio del desarrollo gramatical
4. Existe continuidad entre la comunicacin prelingstica y el lenguaje?: se abre la
polmica.
Lecturas complementarias
Actividades
Soluciones a las actividades
130 Bloque II. El desarrollo temprano
Esquema resumen
1. Comunicacin y lenguaje
Comunicacin y lenguaje no son sinnimos.
El lenguaje implica el uso de un sistema de smbolos convencional (lengua).
Diferenciacin lenguaje-lengua-habla.
Componentes del lenguaje: fonolgico, lxico-semntico, gramatical y pragmtico.
2. Desarrollo temprano de la comunicacin: del nacimiento hasta los 18 meses
El problema de la intencionalidad: los actos comunicativos como conductas intenciona-
les e intencionadas.
Perspectivas tericas sobre el estudio de la comunicacin: modelos cognitivos y mo-
delo funcional-interactivo.
Concepto de intersubjetividad primaria y secundaria.
El papel del adulto en el desarrollo de la comunicacin: sobreinterpretacin de con-
ductas del nio como genuinamente comunicativas desde el comienzo. Funcin no slo
activante, sino formante de este desarrollo.
Principales hitos en el desarrollo comunicativo durante el primer ao y medio:
Fase neonatal (pre ferencias por el rostro y voz humanos) y comunicacin de
afectos (2-3 meses); aparicin de la sonrisa social, protoconversaciones.
La mitad del primer ao: conductas anticipatorias, an no intencionales.
El perodo de 8 a 12 meses: atencin conjunta, referencia social, protoimperativos
y protodeclarativos.
El perodo de 12 a 18 meses: gestos comunicativos y vocalizaciones.
3. Desarrollo temprano del lenguaje: del nacimiento hasta los 3 aos
El desarrollo del lenguaje comienza mucho antes de que los nios empiecen a decir sus
primeras palabras.
Atencin temprana al lenguaje:
Anlisis perceptivos del habla desde antes del nacimiento. Experimentos con be-
bs dentro del tero y recin nacidos.
Percepcin inicial del habla:
El desarrollo de las habilidades perceptivas durante el primer ao; diferenciacin
de lenguas en funcin de las caractersticas prosdicas.
Segmentacin y extraccin de las primeras palabras:
El problema de la segmentacin inicial de las palabras.
Hacia las palabras:
Precedentes evolutivos de las primeras palabras: vocalizaciones prelingsticas
juego voclico, balbuceo cannico y modulado, jerga.
Gestos comunicativos y simblicos y primeras palabras.
El inicio del desarrollo gramatical: adquisiciones ms all de las palabras aisladas
conocimiento morfosintctico.
4. Existe continuidad entre la comunicacin prelingstica y el lenguaje?: se
abre la polmica
Desacuerdos en torno a la continuidad entre la comunicacin anterior al lenguaje y la
comunicacin lingstica.
Captulo 6. Los inicios de la comunicacin y el lenguaje 131
Introduccin
Sihayunahabilidadquecaracterizadeformamuyespecfcaalosmiembrosdelaespe-
ciehumanaessucapacidadparacomunicarse,ascomolosdiversosmodosdecomuni-
cacinqueutilizanenlaprctica.Antesdeadentrarnosenelterrenodeldesarrollodelas
habilidadescomunicativaslingsticasynolingsticasconvienehacerunaseriede
precisionessobrequeslacomunicacinyqudiferenciashayentrelenguajeycomu-
nicacin.Porotraparte,parapoderentendereldesarrollodellenguajeesnecesariotener
presentelacomplejidaddeste;esdecir,qucomponentestieneellenguajeycmose
relacionanentreellos.Veamosunoaunoestosaspectos.
1. Comunicacin y lenguaje
1.1. Denicin de conceptos
Comunicacinylenguajenosonsinnimos.Sondostrminosconceptualmentediferen-
tes, pero adems su distincin es crucial para poder entender el proceso de desarrollo
ontogenticonormalyalterado,paraestudiarlasdiferenciasentrelasdiversasespecies
Objetivos
Diferenciar comunicacin y lenguaje.
Distinguir comunicacin prelingstica y lingstica.
Revisar los principales componentes del lenguaje.
Identicar los principales criterios que denen la comunicacin intencional.
Conocer los requisitos cognitivos y sociales de la comunicacin y los modelos
explicativos propuestos en relacin a unos y otros.
Establecer cul es el papel que tienen los adultos en el desarrollo comunicativo
de los nios.
Describir las principales fases de la comunicacin prelingstica.
Describir las principales fases y procesos implicados en el desarrollo temprano del
lenguaje, en la vertiente perceptiva y productiva.
Conocer algunos mtodos de investigacin de las habilidades perceptivas tem-
pranas.
Diferenciar las explicaciones continuistas y no continuistas sobre la relacin entre
la comunicacin prelingstica y el lenguaje.
Modelo funcional-interactivo: apoyo a la hiptesis de la continuidad.
Modelos lingsticos: apoyan slo una continuidad funcional, no formal.
Aplicaciones del Modelo Natural de Adquisicin: los programas de estimulacin del
lenguaje antes de los 3 aos.
132 Bloque II. El desarrollo temprano
animalesincluida,porsupuesto,lahumana,paradisearestrategiasefcacesdein-
tervencinenestosdominios,etc.
Para distinguir ambos conceptos, vamos a acudir al reino animal. Pensemos en los
primates; uno de los rasgos principales de estos animales es que normalmente forman
grupossocialescomplejos.ComoapuntaGmez(2004),cuandounprimatequierehacer
algoconunobjetolotocayefectaunactomecnicoconlcomoagarrarlo,llevarloa
laboca,etc.Sinembargo,siquierehaceralgoconotroprimate,porejemplojugar,tiene
queactuardeformamuydiferente:tienequeproducir seales comunicativas,talescomo
modifcar la direccin de su mirada, cambiar la expresin de su cara o realizar ciertas
posturasygestos,conelfndetransmitirasucongneresuobjetivo.
Parececlaroqueningunadelasaccionesanterioressonconductaslingsticas,aun-
quescomunicativas.Sinembargo,tambinenelreinoanimalencontramosconductas
msdifcilesdecategorizar.Porejemplo,losmonosvervet,parientesbastantelejanosdel
homo sapiens,producenunconjuntodevocalizacionesqueusanencontextosbiendife-
renciadosydefnidos.Cuandovenundepredadorefectanemisionesvocalesdistintassi
se trata de un guila, de un leopardo o de una serpiente. Es decir, tienen al menos tres
tiposdevocalizacionesrelacionadascontresreferentesdistintos.Noestnestasvocali-
zacionesmsprximasalaspalabrasqueutilizamosloshumanos?
Porotraparte,siobservamosaunbebhumanode6o7mesesdifcilmenteescucha-
remosalgunapalabrareconocible.Emitirsonidosvocales,peronounidadeslingsticas.
Sin embargo, si preguntamos a sus padres si su beb se comunica de algn modo con
ellos, su respuesta ser afrmativa sin duda. Cuando ese nio ya hable habr ampliado
considerablemente su capacidad comunicativa mediante el uso del lenguaje. Si el nio
fuera sordo podra aprender el lenguaje, pero utilizando otra modalidad distinta de la
vocal:lamodalidadgestualquecaracterizalaslenguasdesignos.
La consideracin de los ejemplos anteriores nos permite ubicar correctamente los
conceptosdecomunicacin,lenguajeyhabla.Comunicacinestodoprocesodetrans-
misindeinformacindeunemisoraunreceptor/esatravsdesistemasdesealesol-
fativas,visuales,etc.ysignosmuydistintosdesarrolladosespecfcamenteparacomu-
nicarsevocalizaciones,palabras,gestos.
Eltrminolenguajesereferealacapacidaddecomunicacinotransmisindein-
formacin mediante signos arbitrarios, sonidos verbales o gestos manuales, que tienen

COMUNICACIN
LENGUAJE
LENGUAS
Oral (HABLA)
Escrita
Signos manuales
Figura 6.1. Relaciones comunicacin-lenguaje-lengua.
Captulo 6. Los inicios de la comunicacin y el lenguaje 133
unaformaconvencionalyunsignifcado,ysecombinansiguiendounasreglasdetermi-
nadas. El lenguaje es una capacidad especfcamente humana, que se materializa en el
conocimientoyusodelasdiversaslenguasconstruidasalolargodelahistoria.Eltr-
minohablaslohacereferenciaalalenguaoral,frentealaescritaosignada.
Portanto,enelreinoanimalseencuentrandistintossistemasdecomunicacin,pero
lacomunicacinhumanaeslanicaqueincluyesistemasnolingsticosysistemaslin-
gsticos lenguas. El esquema siguiente pretende refejar las relaciones entre estos
conceptos.
1.2. Componentes del lenguaje
Generalmentenosreferimosallenguajecomounafacultadohabilidadunitaria.Sinem-
bargo,ellenguajeconstituyeunsistemamuycomplejo,integradopordistintoscompo-
nentesosubsistemas,ycuyodominioimplicahabilidadesmuydistintasydemuydistin-
tos tipos. Pensemos qu es necesario para comprender la simple frase Hoy hace sol
cuandoalguienlapronunciaenvozalta.Porunaparte,esnecesariodisponerdeunsis-
tema auditivo quefuncionecorrectamenteyqueseacapazdetransmitirelmovimiento
delaspartculasdeairequeproducelavibracindelascuerdasvocalesstaeslade-
fnicinfsicadecualquiersonidodelodoalcerebro,concretamentealreaauditiva
primariadelacortezacerebral.
La audicin es un mecanismo muy variado. Comienza como un proceso
acstico, con la llegada de la onda sonora al odo externo; se convierte des-
pus en un proceso mecnico, cuando esta onda se transforma en movimiento
de los huesecillos en el odo medio; luego se transmuta en un proceso hidru-
lico, en la cclea, cuyo medio acuoso cambia los movimientos anteriores en ola; por fn,
en su etapa ms compleja, lo encontramos en forma de impulso nervioso, electroqumico,
a su paso desde el rgano de Corti por el nervio auditivo hasta la corteza cerebral. (Ma-
rrero,2000,p.99.)
Ademsdelossistemasauditivoynervioso,esnecesariodisponerdeunconjuntode
sistemas de conocimiento o representaciones relativos a: 1) los sonidos lingsticos
componente fonolgico, 2) el vocabulario de una lengua componente lxico-
semntico,3)lasreglasdecombinacindelaspalabrasparaformarfrasescompo-
nentegramaticaly,4)elusodelaspalabrasyexpresionesenfuncindelcontextoe
interlocutorcomponentepragmtico.Elfuncionamientoeinteraccindetodosestos
componentesesnecesarioparapodercomprenderelsignifcadodecualquierexpresin.
Siloquequeremosesproduciresamismaemisinlingstica,alashabilidadesan-
terioresfonolgicas,lxico-semnticas,morfosintcticasypragmticashayqueaa-
dirlacapacidadparaarticular,esdecir,realizarlosmovimientosdelosrganosarticula-
torios necesarios para pronunciar esas palabras. La actividad articulatoria implica una
complejacoordinacinneuromuscularyrespiratoria.
Aunquemuchosautoresalolargodelahistoriahansealadoquelosniosaprenden
el lenguaje sin esfuerzo, hay mltiples estudios que ponen en cuestin este aserto.
134 Bloque II. El desarrollo temprano
Especialmentedesdeunmarcotericoconstructivista,ellenguajeseconsiderasujetoa
uncomplejoprocesodeadquisicinoaprendizaje,quecomienzacomoveremosenel
Apartado 3 antes del nacimiento y se extiende prcticamente hasta el fnal del ciclo
vital.
2. Desarrollo temprano de la comunicacin:
del nacimiento hasta los 18 meses
Comoveamosenelapartadoanterior,losbebsson,comoloschimpancsydemsan-
tropoides,seresquepuedencomunicarse,peronodemodolingstico.Hastaelaode
edadaproximadamentelosniosnoempiezanaemitirsusprimeraspalabras.Pero,pue-
den comunicarse desde el momento del nacimiento? Qu habilidades son necesarias
paracomunicarse?Dequtiposondichashabilidades:cognitivas,socio-emocionales?
Apartirdequmomentosetransformanlosbebshumanosensereslingsticos?De-
sarrollaremoslasrespuestasalasprimeraspreguntasenlostressiguientessubapartados.
EnelApartado3nosocuparemosdelaltimapregunta.
2.1. Cundo comienza la comunicacin intencional?
Requisitos cognitivos y sociales
Enunsentidomuygeneralsepodraconsiderarquelacomunicacincomienzadesdeel
nacimiento.Elbebhumanopuederealizarconductascomollorar,expresarconelrostro
algunasemociones(vase Captulo 7)yemitiralgunossonidosvocalesdesdequenace.
Dichasmanifestacionestienenunclarovalorcomunicativoparasuspadres.Puestoque
sonconductasinnatas,elllantoylaexpresinemocionalnoseaprenden;constituyenun
legadodelabiologaquepermitealnioexpresarestadosemocionalesbsicosynece-
sidadesdediversostipos.Perosonrealmenteconductascomunicativas?
Cuandolosinvestigadoreshantratadoderesponderaestacuestin,siempresehan
topadoconelproblemadelaintencionalidad.Unacosaesemitirunaconductaexpre-
sivadeunestadocualquierayotrabiendistintaemitirdichaconductavocal,gestual,
etc.conelobjetivoclarodequeotroorganismosehagaconscientedeesasealyel
propsitoligadoaella.Losbebsrecinnacidosemitenconductasexpresivasqueson,
comoveremos,sobreinterpretadasporeladulto,peronosonconductasdirigidasacomu-
nicaralgoaalguien.
Lamayoradelosinvestigadoresestndeacuerdoenconsiderarqueunaconductaes
verdaderamentecomunicativacuandoesintencionadamentecomunicativa;esdecir,slo
cuandoelniomanifestaquetieneintencinopropsitodecomunicarse.Pensemosen
otro ejemplo relacionado con el llanto: un nio de 4 o 5 meses llora insistentemente;
llegasumadre,lesacadelacunaycesadellorar.Enesteejemplo,sepuedeconsiderar
que el llanto es una conducta comunicativa? Desde luego no se trata de una conducta
prototpicaoclaramentecomunicativa,sinomsbienborrosa.Elniopuedehabersen-
tidoincomodidad,queexpresallorando,yslodejadellorarcuandocambialasituacin;
oelniopuedehaberaprendidoaasociarsullantoalallegadademam,sinms.Pare-
ce,pues,quecomunicarserequierelautilizacindeunaaccingesto,vocalizacindel
Captulo 6. Los inicios de la comunicacin y el lenguaje 135
tipoquesea,movimientoparatransmitirinformacindeformaintencionadaacerca de
algo. Tcnicamente, esto es equivalente a plantear que la conducta comunicativa lo es
porquetambinesintencional.
Tabla 6.1. Rasgos de las acciones o conductas comunicativas
Las acciones comunicativas son:
Intencionadas:sonactividadesconpropsito;porejemplo,muevolamanoconelpropsitode
llamarlaatencindealguien(intencincomofnalidad).
Intencionales:sonacercadealgo;esdecir,sonactividadesmentalesquetienencontenido(por
ejemplo:piensosobre algo,adivinoalgo,creoalgo,etc.)
Serealizanmediantesignos(semiticas);lossignospuedentenerdistintosgradosdearbitrariedad
(desdelosndicesosealeshastalaspalabras).
Como vemos en la tabla anterior, al carcter intencionado e intencional, hay que
aadirelsemitico.Esdecir,unaconductacomunicativaloesporquetieneelcarcter
de smbolo o signo para otra persona. Est en lugar de algo, remite a otra cosa. En el
caso de las palabras es claro su valor semitico; pero tambin un gesto con la mano
puedeserunsignocomunicativo,desaludoporejemplo,ounamiradaunidaaunason-
risa en el marco de una interaccin entre dos personas puede querer decir algo para
ambos.
Siguiendo con este planteamiento, en la bibliografa (Bates, Camaioni y Volterra,
1975;Bates,Benigni,Bretherton,CamaioniyVolterra,1979;Camaioni,VolterrayBa-
tes,1976;entreotros)sehasealadoquelacomunicacinintencionalapareceentrelos
8y10meses,coincidiendoconelmomentoevolutivoenelquelosniossoncapacesde
coordinar los esquemas de accin dirigidos a los objetos con los esquemas dirigidos a
personaspararesolverunproblema(vase Captulo 5).Esdecir,segnestemodelocog-
nitivo,lacomunicacinesunaconductaintencionadaquerequierelautilizacinycoor-
dinacindeesquemasqueseusancomomediosparaconseguirunametacoordinacin
medios-fnes. Por ejemplo, cuando un nio seala un juguete con el dedo para que su
padreseloacerqueestutilizandounmedioelgestodesealarparaconseguirun
fneljuguete.
Pero,bastaconlaexplicacincognitivaanteriorparapodercomprenderqusucede
entornoalos8-10mesesparaqueelniorealiceaccionescomunicativas?Essufcien-
teeldesarrollosensoriomotorparaexplicareldesarrollodelacomunicacin?Rotunda-
mente,no.
Lacomunicacinesuntipodeaccinentredosomsorganismosopersonasaun-
quetambinunopuedecomunicarseconsigomismo,obviaremosdemomentoestetema.
Portanto,eltrminointeraccinesmsapropiadoparareferirsealasaccionescomuni-
cativas.
ComovimosenelCaptulo4,elrecinnacidoyadisponedesistemasparaexpresar
estados.Desdeelnacimientoelnioestinmersoenunmundosocialformadoporper-
sonasque,comoacabamosdever,interpretandemodoinevitablesusacciones,susges-
tos, incluso sus sonidos vegetativos. Esta experiencia, tal y como puso claramente de
manifestoVygotski,noesbalad.
136 Bloque II. El desarrollo temprano
Nadel y Camaioni (1993), reco-
giendo tambin las aportaciones de
otros autores que se alinean con un
modelo funcional-interactivo
1
, plan-
tean que la comunicacin, como pro-
cesoinsertoenuncontextodeinterac-
ciones sociales, es ms que la mera
transmisindeinformacindeunemi-
soraunreceptor.Utilizanlametfora
de una orquesta como analoga de lo
queimplicaunprocesocomunicativo.
En primer lugar, no hay un intrprete
individual,sinoquedistintaspersonas
intervienen, pero no como elementos
aislados, sino interdependientes. En
segundolugar,lamsicaresultante
no se puede separar del proceso mis-
mo de interpretacin.Y, en tercer lu-
gar,aligualqueenlosgruposdejazz,
no hay una partitura cerrada o prede-
terminada desde el comienzo que sea
transmitida de persona a persona/s.
Del mismo modo que en este tipo de
orquestas la msica es un logro con-
junto y emerge en el proceso mismo
de interpretacin, la comunicacin
tambinsellevaacaboconjuntamen-
te. Los procesos comunicativos no
existenslocomoprocesosmentales/
representacionales independientes de
lainteraccinmisma.Endefnitiva,lacomunicacinnoesunprocesoqueseencuentra
sloenlamentedelemisorqueplanifcaelmensaje,sinoqueesmuchomsdinmico.
Adoptando esta metfora, el desarrollo de la comunicacin constituye un proceso
evolutivo que requiere de la participacin de habilidades cognitivas y sociales, algunas
tanbsicasqueconstituyenpredisposicionesinnatasdetipoperceptivo.Estaspredispo-
sicionesopreferenciasperceptivascontribuyenaquelosbebs,desdesunacimiento,se
encaminenporlasendadelainteraccincomunicativaconlosotros.
Recordemosalgunasdelaspreferenciasyrespuestasatencionalesqueelbebmani-
festadesdequenace(vase Captulo 5):
La fuerte orientacin hacia la voz humana. Los bebs preferen escuchar la voz
humanaaotrossonidosdelambiente(Friedlander,1970).
Identifcacintempransimadelavozdelamadre,queeslaqueprefereentreotras
voces.
1
Otrosautoresutilizaneltrminosocioconstructivistaparareferirseaestosplanteamientostericos.
Figura 6.2. La comunicacin cara a cara es tpica
de las interacciones con bebs desde
su nacimiento.
Captulo 6. Los inicios de la comunicacin y el lenguaje 137
Preferencia por rostros humanos frente a otros estmulos visuales prcticamente
desdeelnacimiento.
Emparejamiento rostro-voz: los bebs miran ms a caras parlantes que silen-
ciosas;lesinteresanmsyaqueremitenauncontextosocialdeinteraccin.
Recordemosasimismoqueademsdeestaspreferenciasperceptivo-atencionales,los
recin nacidos tambin estn adaptados para actuar y captar la atencin de los otros.
Comovimosenelcaptuloanterior,eldatomssorprendenteenestesentidovinodela
manodeMeltzoffyMoore(1977),quienesmostraronensusexperimentoscmorecin
nacidoserancapacesdeimitaralgunosgestosquerealizabaunadultofrenteaellos(van-
se Captulos 4 y 5).Sibienestetrabajohadadolugararosdetintayainterpretaciones
enfrentadas, lo cierto es que la capacidad de imitacin temprana es una herramienta
muy til para la interaccin comunicativa. Imitar a otro es algo as como decirle: soy
capazdeestarenlomismoquet;eseestarenlomismoesunrequisitofundamental
detodaaccincomunicativa.Elhechodequelasimitacionestempranasseanmsfciles
deelicitarensituacionesexperimentalesenlasqueelmodeloadultoseimplicaensitua-
ciones de interaccin afectiva, y mucho ms difciles de provocar en situaciones en las
quetanslosepresentanlosestmulosexperimentalessinms(Kugiumutzakis,1993),
apoyaestarelacinimitacin-comunicacin.
Trevarthen(1982)tambinapoyalahiptesisdelaintersubjetividad,peropostulaque
losniosnacenyaconunamotivacinyunasociabilidadlatentes,quedenominacapa-
cidades de intersubjetividad primaria. Estas capacidades impelen a los neonatos a
buscarcontactosocialparacompartirafectoyatencin.Segnesteautor,sucapacidad
decomunicarsesedesarrollaconeltiempoencuantoasucomplejidadeintencionalidad,
perolosbebsyanacenconlaposibilidaddeexpresarintenciones,entreotras,lasinten-
ciones comunicativas. Este autor prefere usar el trmino motivos para referirse al
componenteinnatoyeltrminointencionesparalaelaboracindeestosmotivospri-
migenios gracias a la experiencia. Los motivos comunicativos seran sencillamente la
necesidadoelimpulsodebuscarcompaayenrolarseenintercambiosafectivo-comu-
Adulto
Nio Objeto
Figura 6.3. Triangulacin de las relaciones nio-objeto-adulto, base de la intersubjetividad
secundaria.
138 Bloque II. El desarrollo temprano
nicativos; no se refere en ningn caso a acciones dirigidas a otros para conseguir, por
ejemplo,confortoaliviarelhambre.
Alrededordelos9-10meses,laedadmgica,elbebempiezaasercapazdeinte-
grardosmanerasdeactuarquehastaesemomentopermanecenseparadas:lainteraccin
socialdirigidaapersonasylaaccindirigidaaobjetos.Trevarthendenominaaestaca-
pacidadintersubjetividadsecundaria.
Si bien el planteamiento deTrevarthen parte de un presupuesto innatista, no niega
el papel de la experiencia social y de la interaccin con los adultos en el proceso de
desarrollo comunicativo. En este sentido, coincide con los planteamientos funcional-
interactivosqueveamosantes.Dedicaremoselsiguientesubapartadoarevisarcules
el papel del adulto y a dirimir si su carcter es activante o formante en el desarrollo
comunicativo.
2.2. El papel del adulto: sobreinterpretacin
de las actividades del nio como conductas
genuinamente comunicativas
Yahemosmencionado,desoslayo,quelosadultos,deformainevitable,ademsdecon-
templaralosbebs,interpretanconstantementecualquiermirada,sonido,sonrisa,gesto
facialomovimientodelosmismos.Tiendenadarunvalorintencionadoycomunicativo
aalgoqueestrictamentehablandosonsloconductasexpresivo-emotivas.Sinembargo,
esestaactividaddesobreinterpretacinreiterada,deatribucindeintencionalidad,laque
ir constituyendo el andamiaje
2
necesario para que poco a poco el beb humano vaya
siendo capaz, por s mismo, de realizar actos intencionales. Veamos cmo se expresa
Rivire(1986)sobreestefenmeno:

Su delicada estrategia de crianza (de los padres) les convierte en el paradigma
de los psiclogos naturales de los que habla Humphrey; seres que asignan
intenciones, predicen conductas, reconstruyen empticamente el mundo expe-
riencial de sus bebs y cooperan con ellos de forma peculiar. Adems, no dan
la misma signifcacin intencional a todas las conductas del nio, sino que se la atribuyen
sobre todo a sus proto-gestos y esquemas de persona, por ejemplo, a las conductas que
los bebs producen caractersticamente ante los estmulos sociales y no ante los fsicos [...].
Precisamente porque las madres atribuyen signifcado a las conductas de sus bebs, stas
llegan a constituirse en acciones signifcativas de los propios bebs.
2
Eltrminoandamiaje(scaffolding)fueutilizadoporprimeravezporBrunerenelsiguientesentido
metafrico:aligualquelosalbailesalconstruirunacasanecesitanprimerolevantarandamiosdeunaaltura
mayor que la que tiene la incipiente construccin, y trabajando en ese espacio es cmo pueden levantar el
edifcio,aslasmadresofgurasdecrianzasitansusaccioneseinterpretacionesenunnivelalgomayorque
lasdelnio,ayudandodeestemodoaldesarrollodelmismo.Alfnaldelprocesodeconstruccindeledifcio,
seretiranlosandamios.Astambin,unavezfnalizadoelprocesodeconstruccindeunafuncinpsicolgi-
caseretiranlasayudasexternasylaconstruccinsesostieneporsmisma.Larelacinentreesteconcep-
todeandamiajeyeldeZonadeDesarrolloPrximoesevidente(vase Captulo 3).
Captulo 6. Los inicios de la comunicacin y el lenguaje 139
Lacitaanteriorponederelieveunaexplicacinmuyvygotskianasobreeldesarrollo
comunicativo: los nios llegan a tener intenciones comunicativas porque los adultos se
lasatribuyenantesdequepuedantenerlasrealmente.
Existenalgunosfenmenosrelacionadosconestosmodosespecialesdeinteraccin
bebs-adultos:
La sobreinterpretacin de miradas, sonrisas y vocalizaciones: los adultos ante la
mirada del beb tendemos a inferir que quiere algo, que busca algo y que nos
pidequemiremosdondelmiraparacomentarsobreello,cogerlo,etc.Delmis-
momodo,interpretamoslassonrisasomuecasdesonrisadesdemuytempranamen-
te,aunqueannotengancarctersocial(vase Captulo 7).Encuantoalasvoca-
lizaciones, tambin se les atribuye un valor comunicativo, aunque no simblico.
Con todo ello, los adultos les van enseando a los bebs qu temas se pueden
compartirycmoexpresarlos.
Lasprotoconversaciones:talcomosealSnow(1977)lasinteraccionesverbales
quelosadultosestablecenconlosbebsposeen,desdeelprincipio,unformatode
conversacin; es decir, los adultos ayudan a construir y mantener una estructura
cclicadealternanciadeturnos,aunquelosbebsannopuedanrellenarconpa-
labras sus intervenciones. Inicialmente, la madre u otro interlocutor sustituye las
carenciascomunicativasdelniorespondindoseasmismayaceptandotodotipo
deconductasdelbebsonrisas,gestos,gorjeos,inclusoeructos.Alprincipiono
seintercambiainformacin,sinoafectos.Progresivamente,lasconductasinfantiles
aceptablessonslovocalizacionesygestossusceptiblesdeserinterpretadoscomu-
nicativamente. De este modo los adultos seleccionan los medios comunicativos
vlidos, a partir de las diversas posibilidades expresivas del beb. La Tabla 6.2
muestralaestructuratpicadeestosintercambios.
Tabla 6.2. Ejemplo y estructura de una protoconversacin
Estructura de una protoconversacin
1. El beb vocaliza
2. El beb sonre
3. La madre sonre y acaricia
al beb



la madre responde vocalizando
la madre habla, sonre o re
el beb sonre o vocaliza
Incluso en situaciones como la de alimentacin, la madre y el beb establecen este
tipodepautasdeinteraccinqueKaye(1982)describidetalladamente.As,cuandoel
niocome,hacefrecuentespausasquealparecernotienenunafuncionalidadfsiolgica,
esdecir,nolesirvenparafacilitarladeglucin,nilarespiracin;sinembargo,lamadre
aprovechaesaspausasparahablarle,estimularleloslabiososonrerlehastaqueelnio
iniciaotroturnodesuccin.Seconstituyeas,conunaseriedeajustes,unaespeciede
dilogooconversacincorporal,quepermiteestarenlomismo.Comoveremosms
adelante,estetipodeintercambiosnoslofavoreceneldesarrollodelacomunicacin,
sinotambineldellenguaje.
140 Bloque II. El desarrollo temprano
Elpapeldeladultoenestetipodeinteraccines,sobretodoalcomienzo,muyactivo.
Eseladultoquienllevaelpesodelainteraccin.Sinembargo,elbebponetambinen
marchadesdemuytempranounrepertorioconductualquelepermiteengancharseen
estosepisodios.Elpapeldeladultonoparecesloactivanteoreforzante.Segnelmar-
coexplicativofuncional-interactivoosocioconstructivista,deudordelplanteamientoini-
cialdeVygotski,estetipodeactuacinayudaaldesarrollodeintencionescomunicativas
enelnio.Tieneunpapelformante,puespropicialaformacinoconstruccindeinten-
cionescomunicativasenelpropionio.
Enelsiguienteapartadovamosapresentarunpanoramaevolutivodelosprincipales
momentoseneldesarrollocomunicativo.Estapresentacinserdescriptivayesquem-
tica,yaquehemosidodesglosandolosdosprincipalesplanteamientosexplicativosenlos
apartadosanteriores(2.1.y2.2.):laexplicacincognitivayelenfoquesocioconstructi-
vista.
2.3. Principales hitos en el desarrollo comunicativo durante
el primer ao y medio de vida
SiguiendoaReddy(1999),vamosadividirencincofaseselperododelacomunicacin
prelingstica,queabarcadesdeelnacimientohastalos12-18meses:lafaseneonatal,el
perododelos2-3meses,lamitaddelprimerao,elperodode8a12mesesylos12-18
meses.Estadivisinsehahechoenfuncindeloshallazgosempricossobreeldesarro-
llo comunicativo temprano; sin embargo, hay que sealar que se han realizado ms in-
vestigacionessobrelasdosprimerasylaltimafase,queenelperododelos5alos11
meses.Veamosacontinuacinunacaracterizacindecadaunaparaobtenerunpanorama
del desarrollo comunicativo que tiene lugar durante el primer ao y medio de vida del
nio.
2.3.1. Fase neonatal y comunicacin de afectos (2-3 meses)
Como acabamos de sealar, los bebs recin nacidos vienen dotados de programas de
sintonizacinyarmonizacindelapropiaconductarespectoaladelosotros,queinclu-
yentodaslaspreferenciasperceptivasyconductasexpresivasquepermitensuvinculacin
consuscongneres.Estosprogramas,alintersectarconlospropiosmecanismosdesin-
tonizacinenlamadreofgurasdecrianza,permitendarlugarymantenerunarelacin
que optimiza el desarrollo y que asegura las condiciones para la construccin mutua y
progresivadelarelacincomunicativo-afectivaentreelbebylosotros.
Si bien, como sealamos en elApartado 2.1, los bebs presentan preferencias y un
interspeculiarporlavozyelrostrohumanodesdeelnacimiento,lociertoesquehasta
las4-6semanaslosbebsanpermanecenpocoactivosensusinteraccionesconeladul-
to.Sinembargo,entornoalos2mesesvanconfgurndoseconductasquefavorecenla
interaccincomunicativadeunmodomsactivo.Nosreferimosalasonrisasocial(va-
se Captulo 4)yalautilizacindemovimientos,vocalizacionesymiradasdemodoms
coordinado y activo en los intercambios con los adultos. La sonrisa social ya no es la
muecaqueslosuperfcialmentesepareceaunasonrisa,sinoqueesunaconfguracin
facialclaramenteindicativadeplacerobienestarqueseproducenicamenteanteotras
personas;esdecir,enuncontextodeinteraccinsocial.
Captulo 6. Los inicios de la comunicacin y el lenguaje 141
Losintercambiosqueseproducenentreelbebylosotrossonmsdetipoafectivo-
expresivo.Elbebanteeladultoyasonre,vocaliza,semueve,iniciandodeestemodo
ciclosinteractivosenlosqueseintercambianafectos,perotodavanoinformacin.Las
protoconversacionesquemencionbamosantessonmarcosoformatostpicosparaestos
intercambios.
Tabla 6.3. El concepto de formato
Qu es un formato?
ElconceptodeformatofueelaboradoporBruner(1982).Esteautorsealaqueun formato supone una
interaccin contingente entre al menos dos partes actuantes, contingente en el sentido de que puede
mostrarse que las respuestas de cada miembro dependen de una anterior respuesta del otro.Seobservan
formatos en las rutinas de interaccin que se establecen entre nios pequeos y adultos en situaciones
cotidianas:juego,comidas,bao.Enellasadultoyniohacencosaselunoparaelotroyentres,yestas
accionesestnpreviamentereguladasodefnidasporreglas.Porejemplo,alahoradelbaounbebysu
madrejueganarersecuandoestatapaydestapasucaraconlatoalla.Estetipodejuegoscircularesde
relacinexpresiva,queyaseobservanenelestadio2delmodelopiagetiano,sonejemplostempranosde
estosformatos,queluegosehacenmscomplejosyserellenandepalabrasenmomentosposteriores
deldesarrollo.
Entrminospiagetianos,aunqueelpropioPiagetnoabordestetema,sepodrade-
cirquelosjuegoscircularescaraacaraseranproductodelaasimilacinrecprocade
losesquemasdedosomspersonas.Veamoslanarracindeunadeestassituacionesde
lamanodeSchaffer(1989):
La madre mira atentamente al nio con la cara inmvil y espera. La cabeza
del nio se vuelve hacia un lado y su mirada se aparta. Despus de un rato se
vuelve hacia la madre e inmediatamente entra en juego el repertorio de conduc-
tas de ella especfcas para con el nio: recibe la atencin de este con gran
alegra, aproxima su cara a la de l, le toca y vocaliza de ese modo que le est especialmen-
te destinado. El nio observa al principio en silencio; despus, tambin l entra en accin,
sonriendo y murmurando y poniendo las cuatro extremidades en movimiento. Puede que muy
pronto mire de nuevo hacia otra parte, aunque tal vez slo durante una fraccin de segundo
antes de volver a atender a las gracias de su madre. Finalmente, mirar a otro lado durante
bastante tiempo, como si, por el momento hubiese roto el contacto. Tambin la madre se
calma entonces; sigue vigilando, sin embargo, preparada para el siguiente episodio (p.64).
2.3.2. La mitad del primer ao: conductas anticipatorias
Entornoalos6-7meseslosbebsparecendirigirmssuatencinalosobjetosyeven-
tosdelambiente.Denuevo,noeslsoloelquedescubrelosobjetos,sinoqueeladul-
to los va introduciendo en su relacin con el nio, se los muestra, los utiliza, hacin-
doselos atractivos (Rodrguez y Moro, 1998). El inters del beb viene reforzado
ademsporlamejoraensusdestrezassensoriomotoras,queaplicaalosobjetosexter-
142 Bloque II. El desarrollo temprano
nos(vase en Captulo 5 el estadio 3 del perodo sensoriomotor).Laexperienciacon
elmundofsicoysocialpermitequeelniopuedayairanticipandolassituacionesen
lasquehaparticipadorepetidasveces.Deestemodo,cuandolamadreporejemplose
aproximaalbebtendindolelosbrazos,lanticipaquelevanacogerytiendetambin
lossuyos.
Lacrecienteparticipacindelosbebsenjuegosinteractivoscomolosqueseal-
bamosenlafaseanteriorlespermitepoderiniciaryaestetipoderutinas.Porejemplo,
trasjugarrepetidasvecesaaproximarlacabezaaladultoychocarcabezaconcabeza,el
bebpuedebuscaractivamentequeeladultorepitaunciclomsdeaproximaciones.Sin
embargo,laconductadelbebenestoscasosesanticipatoria,peroannointencionalen
sentidoestricto.Elniosloescapazdeutilizarsusesquemasanticipatorioseninterac-
cionesqueyahansidoiniciadasporeladulto.Enelejemploanterior,elbebaproximan-
dosucabecitaaladultoleindicaquequiereseguirjugando,peronoescapazdeprovocar
porsmismomedianteconductascomunicativasel nacimiento en el compaero de re-
lacin de intenciones que ste no poseyera previamente, sino que inserta sus primeros
esquemas interactivos en escenarios defnidos por la intencin previa del adulto (Ri-
vire,1986,p.132).
La creacin de rutinas interactivas es pues importante no slo para regular al beb,
sino para permitirle que vaya extrayendo constancias y regularidades que van a ser de
vital importancia, no slo desde un punto de vista cognitivo, sino especialmente desde
unpuntodevistasocial.Constituyenlasbasessobrelasquesevaconstruyendoelpro-
cesodecomunicacinconlosotros.
2.3.3. El perodo de 8 a 12 meses: el inicio de la conducta intencional
Antesdepodercoordinarlainteraccinconpersonasylaaccinsobreobjetos,losbebs
manifestanunconjuntodeconductasquesegnalgunosautoresapoyanlacontinuidad
deldesarrollocomunicativoysuprogresinhacialaconquistadelacomunicacininten-
cional.Estasconductasestnrelacionadasconsituacionesdeatencinconjunta.Atender
aunmismoobjeto/eventoalavez,buscaryprovocarestassituacionespareceunrequi-
sitodelacomunicacin.
Desde los 2 o 3 meses los bebs llegan a ser capaces de llamar la atencin de los
adultoshaciaellosllorando,utilizandosonidosvocalesdellamada,respondiendocon
sonrisasalosotros,peroapartirdelos8-11mesesrealizanotrasaccionesqueyama-
nifestan ms claramente su deseo de compartir la atencin con el adulto en relacin a
objetososituacionesexternas.Estasaccionesincluyendarobjetosalosotros,seguirla
miradadelosotros(Butterworth,1991)paraaveriguarculessuobjetodeinters,rea-
lizaraccionesprovocativasporejemplo,accionesprohibidascomotocarlasplantas
paraasegurarsequeeladultoatender.Elfenmenoconocidocomobsquedaderefe-
rencia social en el que el nio mira la expresin del adulto, buscando informacin en
ella,cuandoencuentraunapersona,situacinuobjetoambiguoynosabecmoactuar
antel,tambinconstituyeunaconductadeatencinconjunta.
Alfnaldelprimeraodevidaseproduceunhitomuyimportanteeneldesarrollo
comunicativo del beb. Este va a ser capaz de coordinar los esquemas de accin con
objetosylosesquemasdeinteraccinconpersonas,enloquesedenominaunesquema
tridiconico.EltringuloderelacinqueincluimosenlaFigura6.3esquematizaba
Captulo 6. Los inicios de la comunicacin y el lenguaje 143
esta nueva situacin, que presupone claramente atencin conjunta sobre un objeto ex-
terno.
El empleo de protoimperativos y protodeclarativos constituye la materializacin
deesteprocesodetriangulacinyesreconocidoporlacomunidadcientfcacomondi-
cedeunaautnticacomunicacinintencionalporpartedelnio.
Tabla 6.4. Conductas protoimperativas y protodeclarativas
Conductas protoimperativas y protodeclarativas
Bates,CamaioniyVolterra(1975)enuntrabajoyaclsicosealaronquedosdelosgestoscomunicativos
(intencionales,portanto)msimportantesson:
Los protoimperativos: gestos mediante los cuales el nio utiliza al adulto para conseguir algo. Son
peticiones de objetos, ayuda, acciones, etc., que los nios realizan utilizando medios no lingsticos
an.
Los protodeclarativos: gestos que utiliza el nio para compartir la atencin del adulto respecto a un
objetooeventoalqueseala.
La conducta de sealar (extender el dedo ndice hacia algo) puede ser utilizada como un protoimperativo
(porejemplo:elniosealaunagalletaparaquesumadreselad)ocomounprotodeclarativo(porejemplo:
el nio seala un coche que pasa por la calle para que su madre repare en l, comente sobre l, etc.)
2.3.4. El perodo de 12 a 18 meses: gestos comunicativos
y vocalizaciones
Eliniciodelasconductasdesealarconfnesprotoimperativosyprotodeclarativos(va-
se Figura 6.4.)puedeobservarseapartirdelos9o10meses;sinembargo,lamayora
de los nios no exhiben este tipo de conductas hasta pasados los 12 meses (Franco y
Butterworth,1988).Pareceadems,quelosprotoimperativosantecedenalosprotodecla-
rativos.Realmente,lossegundosconstituyenuntipodeconductamscomplejaquelos
primeros.Unniopuedesealarparaqueledenunjugueteyellonoimplicanecesaria-
menteunaconductaintencional,sinounactoinstrumentalparaconseguirlodeseado;en
gorilasychimpancscriadosencautividadtambinseobservaestetipodeacciones,y
sin embargo no se observan protodeclarativos. Esta misma disociacin tambin se pro-
duceenniosautistasquepuedensealaroconducirlamanodeladultohaciaelobjeto
deseado,peronoparecensealarparacompartirsuintersconotroentornoaunobjeto
osituacindeterminada.
Lacaracterizacindeestosdostiposdeconductasesantemadedebateentredis-
tintosinvestigadores(vaseporejemplo,Gmez,SarriyTamarit,1993;Reddy,1999).
Deloquenocabedudaesdequelasactividadesdeinteraccinyatencinconjuntaque
seobservanyevolucionanalolargodelprimeraodeedadpreparanelterrenoparael
establecimiento de los signifcados compartidos, piedra angular de la comunicacin
lingstica.Lasprimerasprotopalabrasemergenenelcontextodelasactividadescomu-
nicativasquehemosestadoabordandoalolargodeesteapartado.Ademsestasprimeras
palabrasconvivencongestossimblicosorepresentacionales,quesonmovimientosdel
cuerpo,generalmentedelasmanos,querepresentanoseasocianconsignifcadosdeter-
144 Bloque II. El desarrollo temprano
minados,msomenosconvencionales.Porejemplo,elgestodeadisconlamanooel
gestofacialacompaadodelsonidoaummmparaindicarcomida.
Enelsiguienteapartadoentraremosdellenoeneldesarrollodelacomunicacinlin-
gstica,querequierelaconjuncindesignifcadoygestosvocalesomanualescon-
vencionales.Nosreferiremosalosprimerospasosquesesucedenhastaaproximadamen-
telostresaosdeedad.
3. Desarrollo temprano del lenguaje:
del nacimiento hasta los 3 aos
Esinnegablequeelintersquemuestranlosbebsdesdeelcomienzoporcomunicarse
con las personas que les rodean constituye un motor para el desarrollo del lenguaje, al
igualquelaparticipacinactivadedichaspersonas.
Sinembargo,adquirirellenguajequees,entreotrascosas,uninstrumentoprivilegia-
doparalacomunicacin,implicairmsalldedichashabilidadescomunicativas.Apren-
der una lengua, como vimos en elApartado 1.2, es aprender muchas cosas diferentes,
aunquerelacionadas:lossonidosquelaforman,cmoseagrupandichossonidosenpa-
labras,qusignifcanlaspalabras,qutiposdepalabrashay,cmosecombinanparadar
lugarafrasesqueexpresanideassobrelosobjetos,laspersonas,loquesucedeosucedi,
etctera.Ytodoestoconstituyelatareaalaqueseenfrentaunniodesdequenace...o
quizsdesdeantes.
Figura 6.4. Nia de 14 meses utilizando un gesto protodeclarativo.
Captulo 6. Los inicios de la comunicacin y el lenguaje 145
Pensemos en un recin nacido...
Figura. 6.5. El proceso de adquisicin del lenguaje comienza antes de emitir las primeras pa-
labras.
Esevidentequeunbebmuypequeoannocomprendeellenguajeni,porsupues-
to, produce nada que se parezca al lenguaje. La nica actividad vocal que manifesta
desdequenaceeselllantoyalgunossonidosvegetativos.Engeneral,losnioscomien-
zanadecirsusprimeraspalabrasalrededordelao.Perohoysabemosqueestonosig-
nifcaquehastaentoncesnohayanaprendidonadasobrelalenguamaterna.Veamosqu
sucedealolargodeldesarrollotempranodelnio.
3.1. Atencin temprana al lenguaje
Comencemoscondospreguntas:Cundoempiezalaadquisicindellenguaje?Qu
sabenlosbebssobreellenguajeantesdedecirlasprimeraspalabras?Lasrespues-
tasaestaspreguntasconstituyentodaunreadeinvestigacin,relativamentereciente,
peromuyproductiva,quenoshapermitidocomprobarcmolosbebsmanifestancla-
ramenteunaatencintempranaallenguaje.Estaactividadsilenciosa,peropresen-
te desde muy pronto constituye la base sobre la que se asienta todo el aprendizaje
lingsticoposterior,elqueyaobservamoscuandolosnioscomienzanadejardeser
silenciosos,produciendosusprimeraspalabrasyavanzandoeneldesarrolloposterior
dellenguaje.
Enquconsisteestaatencinactivaallenguaje?Enprimerlugar,recordemosque
losestudiosrealizadosconfetosde6o7mesesdeedadgestacionalhanmostradoque
desdeaproximadamenteelsptimomesdeembarazoelniorespondealossonidosque
lellegandesdeelexterior.Estoesposibleporquelasvasauditivasylacortezatemporal
yasonfuncionalesaesaedad.Mltiplesexperimentosrealizadosconfetosdeesasedades
hanmostradoquestospuedenresponderasonidosexternoscomolavozhumanayso-
nidosmusicales(vanse Captulos 4 y 5).Sielbebdetectadealgunamaneraelsonido
delavoz,puedecomenzaraalmacenarestainformacinycrearrepresentacionesevi-
dentemente muy limitadas de dicho estmulo. Pero, qu oyen realmente los bebs
dentrodeltero?,o,cmoseoyeloqueoyenlosbebs?Algunosinvestigadoresutilizan
lametforadeunapiscinaparaexplicarqueloqueoyenlosbebsenelmedioacuoso
enelqueseencuentranessimilaralaexperienciaauditivaquetenemosalsumergirnos
enunapiscina.Losbebsoyenlossonidosfsiolgicosdelamadre,entreelloselbombeo
delcorazn.Estossonidosconstituyenunabaseconstantedebajasfrecuenciasquecon-
trastanconlossonidosexteriores,enespeciallosdefrecuenciasaltas,comoelruidode
la sirena de una ambulancia, la msica y la voz humana. En condiciones intrauterinas,
146 Bloque II. El desarrollo temprano
quehanpodidoinvestigarsemediantelautilizacindemicrfonosresistentesalagua,se
pierdetodalainformacinfonticadellenguaje,ysemantienenicamentelainforma-
cin prosdica: la entonacin y el ritmo. En el siguiente apartado veremos cul es la
relacin entre este dato y los procedentes de experimentos de percepcin con bebs ya
nacidos.
3.2. La percepcin inicial del habla
Enlosdoscaptulosanterioressemencionabanlasfnascapacidadesdediscriminacin
quepresentanlosrecinnacidosenrelacinasonidosfonemasprocedentesdedis-
tintaslenguas.Laevidenciaempricaacumuladahastahoypermiteconcluirquelosbebs
menoresde6mesespuedendistinguirlalenguamaternadeotraslenguas.Enelsiguien-
tecuadroserecogeunodelosprimerosexperimentosqueaportarondatosenestesen-
tido.
Cmo se ha investigado? Mediante el paradigma de habituacin-deshabituacin en
el que se utiliza como medida o variable dependiente la tasa de succin no nutritiva
(Mehler, Jusczyk, Lambertz, Halstead, Bertoncini y Amiel-Tison, 1988).
Procedimiento: Se presentaban grabaciones en la lengua materna (francesa) a nios
recin nacidos. Una vez habituados, se les presentaban grabaciones en otra lengua
(ruso).
Qu se observa? Al escuchar las grabaciones en ruso, los nios aumentaban la tasa
de succin signicativamente.
Conclusin: Bebs de 4 das!! de madres francesas, discriminan francs-ruso aunque
preferan escuchar la lengua materna.
CONLOSPIES
ENLATIERRA Discriminan los bebs entre lenguas?
Otrosestudiosposteriores(Moon,Panneton-CooperyFeifer,1994)encontraronre-
sultados similares a los de Mehler y col., contrastando las lenguas espaola e inglesa.
Asimismo,Nazzi,BertonciniyMehler(1998)comprobaronquebebsrecinnacidosno
sloerancapacesdediferenciarsulenguamaternalaquehablansusmadresyuna
segundalengua,sinoquepodandiferenciardoslenguasnomaternas;porejemplo,bebs
francesesdistinguanlaslenguasinglesayjaponesa.
Quiereestodecirquelosbebshumanosrecinnacidossonalgoascomopequeos
polglotas en potencia? Los investigadores han sido especialmente cuidadosos al inter-
pretarestosdatosaparentementetansorprendentes.Qudistinguenrealmentelosneo-
natos?Culeselorigendeestastempransimashabilidadesdiscriminativas?
Como anticipbamos en el apartado anterior, los bebs no discriminan los detalles
fonticos, sino la informacin suprasegmental o prosdica entonacin, ritmo de las
lenguas.Estolosabemosapartirdeexperimentosquehanutilizadotcnicasdefltrado
delasmuestrasdehabla.Sinentrarendetallestcnicosprecisos,medianteestastcnicas
Captulo 6. Los inicios de la comunicacin y el lenguaje 147
se consigue manipular las grabaciones de habla de modo que se eliminan los detalles
fonticos;esdecir,lasemisionesfrasessintetizadasporordenadortraselfltradono
se entienden, aunque pueden reconocerse los patrones de entonacin y las estructuras
rtmicas.Presentandoemisionesdeestetipoalosbebs,estossiguendiferenciandoentre
sulenguamaternayunasegundalengua,especialmentesiestaltimasediferenciades-
deelpuntodevistaprosdicodelalenguamaterna.
Retomandolapreguntaporelorigendeestashabilidadesdediscriminacintempra-
na,sepuedesuponerquelaexperienciaintrauterinadelbebconstituyeunaprimerabase
de conocimiento, muy poco analtica, pero sufciente para que se inicie el proceso de
discriminacin prosdica temprana. Hemos visto que los sonidos y el lenguaje que le
lleganalbebnosonidnticosalosqueomoslaspersonasqueestamosenelexterior.
Todaestainformacinauditivalellegaalniofltradaoatenuada,puesentreelmundo
yelfetoseinterponeunabarrerafsica:elvientredelamadre(recurdeselametfora
delapiscina).Elbebnooyenipercibebienlosdetallesdelossonidos,nidelaspala-
bras, pero s puede comenzar a percibir algunos de los aspectos ms importantes del
lenguaje:laentonacinyelritmo.
Lasdistintaslenguastienenentonacionesyritmosdiferentes.Pensemosenlaento-
nacintpicadelidiomaalemnodelchinoyensusdiferenciasconlaentonacinespa-
ola.Sielbeb,apartirdelsptimomesdeembarazo,tienesusistemaauditivoenfun-
cionamiento,puedecomenzaraaprenderalgosobrecmosuenalalenguamaterna.Por
eso,alnacerreconocecomofamiliarlavozylalenguadelamadre,prefereestossoni-
dos a otros, y es capaz de darse cuenta de que esta lengua suena de modo diferente a
otras.Enlasiguientetablaseexponenlasprincipalesfasesenlaevolucindelashabili-
dadesperceptivo-discriminativasalasquenosestamosrefriendo.
Tabla 6.5. Evolucin de las habilidades de percepcin del habla
Edades aproximadas Habilidades de percepcin
6-7mesesdeedadgestacional Respuestaantelavozhumana,medidaatravsde
ladeceleracindelritmocardiaco.
Nacimientohasta6meses Discriminacinentrelalenguamaternayuna
segundalengua.
Discriminacinentredoslenguasnomaternas.
Desdelos6meseshastalos12 Sielbebestexpuestoaunasolalengua,
comienzaaperderlashabilidadesde
discriminacintempranaentrelenguasno
familiares.
Como introdujimos en el Captulo 4, el proceso de prdida de habilidades que se
observa a partir de los 6 meses constituye un proceso adaptativo que permite iniciar el
caminohacialaespecializacinoconvergenciaconlascaractersticasdelalenguama-
terna. Es decir, en un ambiente monolinge lo adecuado es aprender las caractersticas
fonolgicasdelalenguamaterna.
En este sentido, investigaciones ms detalladas (Kuhl, 1991, 1998, 2000) han mos-
tradoquelosbebsalrededordelos5o6mesescomienzanapercibirelsistemavocli-
codesulengua.Esdecir,sibienyanodiferenciancontrastesdesonidosfonemas
148 Bloque II. El desarrollo temprano
quenopertenezcanasulenguamaterna,sempiezanapercibirclaramenteculessonlos
sonidosvoclicosdeesta.Despus,entornoalos12meseslosbebsyaparecenhaber
descubiertomuchasdelascaractersticasfonotcticasdesulengua.Estasconstituyen
unconjuntodereglasimplcitas,clarosobrequsonidossecombinanconquotros
encadalengua.Porejemplo,enespaolnotenemospalabrasqueempiecenporsba,
peroenrusos.Estetipodeconocimientofonticoesimportanteparapoderaprenderlas
palabras que pueden formar parte del vocabulario de una lengua. Es alrededor de esta
edad,los12meses,cuandocomienzanlosprocesosdesegmentacinyextraccindelas
primeraspalabras(vase siguiente apartado),procesosquevemosmaterializadosenla
produccindelprimerlxicoinfantil.
Recapitulandohastaaqu,elconjuntodepreferenciasquemuestranlosbebshacia
la voz humana y los sonidos de las lenguas sirven para orientar su atencin hacia los
mismos.Constituyensesgosatencionales,naturalesennuestraespecie,queestncontri-
buyendoainiciarelprocesodeadquisicindelhablaydellenguaje,procesoquecomo
hemosvistotienesuorigenenlaexperienciaintrauterina.
EstetipodesesgossoncoherentesconloqueJusczyk(1997),autorqueharealizado
mltiples investigaciones en percepcin temprana del habla, denomina un proceso de
aprendizaje innatamente guiado. Para l, la adquisicin del lenguaje como proceso
complejopartedelaspreferenciasinnatasquehemossealado,peroconstituyeunproce-
sodeaprendizajeens.Esdecir,elconocimientosobrelavertienteperceptivadellengua-
je, de las lenguas concretas, se construye en interaccin con la experiencia lingstica.
Perolanaturalezaseaseguradequeencondicionesnormalesesteprocesoarranquede
formatemprana,implementandodemanerainnataunconjuntodepreferenciasquease-
gurenlaatencinyanlisisdelainformacinrelevanteparaadquirirellenguaje.Esain-
formacinrelevanteesladelasvoceshumanasquehablanalbebyalrededordelbeb.
En el siguiente apartado nos ocuparemos de forma resumida de los procesos que
conducenalaproduccindelasprimeraspalabrasalrededordelfnaldelprimeraode
vidayalaevolucinposteriordelprimervocabulario.
3.3. Hacia las primeras palabras
Todalaactividaddeanlisisperceptivoquellevanacabolosbebsqueannohablan
duranteelprimeraodevidatieneimportantesrepercusionesdecaraalaidentifcacin
de las primeras palabras y a su produccin. Identifcar las palabras que constituyen el
lenguajeadultonoestareanadafcil.Elprocesodeidentifcacindeloslmitesdelas
palabrasdondeempiezayterminaunapalabraconstituyeeldenominadoproblema
delasegmentacindelhabla.
Para comprender en qu consiste partamos de un ejemplo. Intentemos ponernos en
unasituacinsemejantealadeunnio.Pensemosenunapersonaquehablarusoyse
dirigeanosotrosquenoentendemosabsolutamentenadadeesalengua.Sealaporla
ventana y dice algo: Smatretumashinu. Nosotros miramos por la ventana y vemos
rboles, la calle, gente paseando, coches, etc.Ante esta situacin: cuntas palabras ha
dichoestapersona?Habremosodounasecuenciadesonidos,peroesrealmentedifcil
saber dnde empieza y acaba una palabra, cuntas palabras ha dicho, etc. Es decir, es
difcilsegmentarenunidadesconsentidoporejemplo,palabraslasemisioneslin-
gsticas,yaqueestasconstituyensecuenciasdesonidoscasicontinuas,quenoaparecen
Captulo 6. Los inicios de la comunicacin y el lenguaje 149
separadasporpausasqueindiquendndeempiezayterminacadauna.Podemossegmen-
tar correctamente una emisin cuando ya conocemos previamente las palabras que la
integran;peroasnocomienzanlosnios.
Lasnumerosasinvestigacionesrealizadasentornoalproblemadelasegmentacindel
hablaporbebsindicanquestosutilizanunconjuntodeclavesinformativasoindicios
quelesayudanairidentifcandolaspalabrasenellenguajequeledirigenlosadultos.Los
niosutilizaninformacinperceptiva,primeroprosdicayluegofontica,comobasepara
apoyarseenesteproceso.Perotambin,comosealanKellyyMartin(1994),losbebs
exhibenuna sensibilidad muy fna hacia los patrones probabilsticos del ambiente.Es
decir,soncapacesdedarsecuentadequestmulosenelcasodellenguaje,qufone-
mas,slabas,etc.tienenmsprobabilidaddeaparecerjuntosy,portanto,extraenregu-
laridades del ambiente lingstico.Aplicando esta sensibilidad al lenguaje, los bebs se
aprovechandelasregularidadesestadsticasdesulenguafonotcticas,entreotraspara
poderhacerprediccionessobredndeempiezayacabaunapalabra.Sinembargo,extraer
las palabras utilizando nicamente informacin fonolgica prosdica y fontica es
posible,perodifcil.Cuandoseanalizanlasprimeraspalabrasdelosniosseconstataque
estassonpalabrasdeusomuyfrecuentequeaparecenreiteradamenteenellenguajeque
selesdirige(vase Tabla 6.9 ms adelante);portanto,sedanencontextoscotidianosy
signifcativos para estos, cargados de funcionalidad.Y muchas de ellas se producen de
formaaislada,loquefacilitaenormementesusegmentacinyalmacenamiento.
Hastaaquhemosrevisadofundamentalmenteelprocesodeadquisicinperceptivo,
alquesededicanlosbebsdesdemuytemprano.Acontinuacinvamosaadentrarnosen
laproduccindellenguaje.Enestesentido,elhechodequenooigamosdecirlasprime-
ras palabras del beb hasta los 12-15 meses aproximadamente no quiere decir que ste
seaunsersilencioso,lingsticamentehablando.Duranteelprimerao,losbebsnoslo
lloran, sino que emiten diversos tipos de vocalizaciones, y alrededor de los 6-8 meses
comienzanabalbucear.Elbalbuceoevolucionahacindosepocoapocomscomplejoy
seproduceentonceslatransicinhacialasprimeraspalabras.Lasiguientetablarecoge
lasprincipalesproduccionesvocalesdesdeelnacimientohastadichatransicin.
Tabla 6.6. Precedentes evolutivos de las primeras palabras
Edad Producciones vocales del nio
I)0a6semanas
II)6a16semanas
III)16a30semanas
IV)6a10meses
V)10a14meses
VI)14a18meses
VII)18-20meses
Vocalizacionesrefejas;sonidosvegetativos;llanto.
Sonidosdearrullosyrisas.
Juegovoclico;ruidosconsonnticoscon/x
3
/,/g/...(p.ej.,ajo,ago,ag).
Balbuceoreduplicadoocannico(porejemplo:tt,mm).
Balbuceonoreduplicadoovariado(porejemplo:a-ba-t,e-bbi)yjergao
balbuceomodulado(produccindeemisionesininteligiblesperoinsertasen
gruposdeentonacinreconocibles;danlaimpresindeserfrases).
Jerga.Protopalabras.
Transicin a la palabra.
Primervocabularioinfantil.
3
Esteeselsmbolodelfonemaquesecorrespondeconelgrafemag/jenpalabrascomojota,genio.
150 Bloque II. El desarrollo temprano
Enlatablaanteriorseapreciaelprocesoevolutivoqueconducealbebhumanodes-
delaproduccindesonidosdeorigenorgnicohastalaemisindelasprimeraspalabras.
Enesteprocesodestacanfenmenosbienconocidoscomoeldelbalbuceoreduplicado
ocannicoquesedefnecomolaproduccindeseriesdeslabasconestructuradecon-
sonante-vocal[CV]comoporejemplo,tatatata.
Tabla 6.7. Funciones del balbuceo
Para qu sirve el balbuceo?
Balbucearnoeshablar,perotampocoesunaactividadintil.Repetirunaslabaunayotravez(ba-ba-
ba,ga-ga-ga)tienealmenostresfunciones:
Experimentarconlossonidosquesepuedenhacer.
Practicarmovimientosrelacionadosconelhabla.
Darsecuentadelarelacinentrelosmovimientosquesehacen(articulacin)ylossonidosalos
quedanlugar(informacinauditiva).
Ademsdelbalbuceocannico,entornoalaolosniosempiezanaproducirsus
primerosgestoscomunicativos.Alcomienzoelbalbuceoylosgestossemantienenin-
dependientes.Algomsadelante,seproducelauninentrevocalizacionesygestos.Las
emisiones orales son ya claramente comunicativas, aunque su contenido segmental
sea ininteligible por estar integrado, por ejemplo, por jerga o balbuceo variado (vase
Tabla 6.6).
En torno a los 14-18 meses, aunque vara de nio a nio, se produce la transicin
hacialasprimeraspalabras.Seregistrandosnovedades:1) Losgestosreferencialeso
simblicos:produccionesgestualesquerepresentanalreferente.Porejemplo,elniose
sientaenelsueloyconlapalmadelamanogolpeaasuderechaparaquesesienteall
eladulto.2) Lasprotopalabras:expresionesarticuladasqueocurrenencontextosdef-
nidos y que no son imitaciones. Se caracterizan por su funcionamiento referencial a
unasituacincorrespondeunaprotopalabra,susignifcatividadsepuedenreconocer
por cualquier persona relacionada con los nios y su dependencia del contexto y de
gestosacompaantesconlamano,lacaraoelcuerpo.
Tabla 6.8. Ejemplos de protopalabras
Protopalabras son
Unniodiceaba?alavezquemuestraaladultoalgoquequiereabrir:caramelos,unfrasco...
Cuandounnioquierecomersealaendireccinalacocinaydiceaat.
Esdifcildarsecuentacundoproduceelniosuprimerapalabra.Lasprimeraspa-
labrastienenunaestructuramuysimple(CVCV)yaparecenligadasasituacionesycon-
textosmuyconcretos,sereferenapersonasyobjetoscotidianoseincluyenexpresiones
frecuentesytiles,quelessirvenparapedircosas,parapreguntar,etc.Peroantesdeque
produzcasusprimeraspalabrasreconocibleselnioyacomprendemucholenguaje,aun-
Captulo 6. Los inicios de la comunicacin y el lenguaje 151
que tenga que apoyarse tambin en la informacin presente en el contexto en que se
producen las palabras y frases que entiende. Por tanto, la comprensin se adelanta a la
expresindellenguaje.Porejemplo,segndatosobtenidosenespaolmediantelosIn-
ventariosMacArthur(LpezOrnat,Gallego,Gallo,KarousouyMariscal,2005)losnios
de10mesescomprendenunamediade39palabras,perosloproducenunamediade1
palabra.Losde14mesescomprendenunamediade121palabrasyproducen11palabras.
Amedidaqueaumentalaedadeldesequilibrioentrecomprensinyproduccinsehace
mayor.
Tabla 6.9. Ejemplos de primeras palabras
Las primeras palabras de Alberto
LasprimeraspalabrasdeAlberto,unniodeunafamiliaespaola,fueronestas:
papparasealarollamarasupadre.
mamparasealarollamarasumadre.
baparapediraguacuandotienesed.
nneparasealaraotrosniosonias.
yatparaindicarquehaterminadooquierequeterminealgo(comida,veruncuento...).
pineselnombredeunmuecoconelquejuega(Milupn).
Aprenderunasolapalabraimplicamuchosprocesosdistintosysuponeanlisissobre
el lenguaje nada desdeables, aunque las condiciones en que aprende el nio son muy
especiales.Despusdelaproduccindelasprimeraspalabras,elniovaincorporando
nuevosvocablosasuvocabulario.Elvocabulario,especialmenteapartirdelos2aos,
crece rpida y exponencialmente, como veremos en el Captulo 9. Sin embargo, este
componentedellenguajeeselquepermanecemsabiertodurantetodoeldesarrollo;de
hechopodemosestaraprendiendonuevaspalabrasdurantetodanuestravida.
3.4. El inicio del desarrollo gramatical
Adquirirvocabularioyaprenderausarellenguajesonhabilidadesbsicas.Peroelnio
hadeaprendertambinahablardeformamscompleja.Esdecir,tienequeaprendera
utilizarlosdistintoselementosgramaticalesdequeconstadichalenguamorfemasde
gnero, nmero, persona; artculos y otros determinantes, preposiciones, conjunciones,
etctera,ascomodominarlasreglasdecombinacinentreunoscomponentesyotros
porejemplo,hayquesaberqueenmuchasocasionesesobligatorioponerunartculo
delantedelnombreparaformarelSintagmaNominalenfrasescomoenlapiscina,etc.
Endefnitiva,elniotienequeadquirirlagramticadesulengua.
Quizelmejormododevalorarlaenormetareaquesuponeconstruirlagramticade
unalenguaseapensandoennosotrosmismoscomoaprendiceso,almenos,aspirantes
aaprendicesdeunasegundalengua,uobservandoapersonasextranjerasqueintentan
aprenderacomunicarseennuestralengua.Esrealmenteunprocesocostosoyqueexige
unaprcticamuyintensivasiqueremosobtenerresultadospositivos.
Volviendoaldesarrolloinfantil,podemosdecirqueaproximadamenteaunquecon
importantesvariacionesentrenioynioaloscuatroaoselnioyahaadquiridolas
152 Bloque II. El desarrollo temprano
basesfundamentalesdelagramticadesulengua.Apartirdeesaedadanesnecesario
adquirir la sintaxis ms compleja por ejemplo: si hubieras venido habras comido
mejor y las habilidades ligadas a la narracin y a otros tipos de discurso, todo ello
hastalaadolescencia.
El aprendizaje de los aspectos gramaticales morfosintcticos de las lenguas es
unafacetadeldesarrollolingsticodifcildeestudiarycomprender.Laadquisicinde
lamorfosintaxisdesulenguaconstituyeunodelosaprendizajesmsimportantesycom-
plejosquerealizanlosniosapartirdelaproduccindesusprimeraspalabras.
Tradicionalmente se han diferenciado dos grandes fases en el desarrollo gramatical
temprano.Lafasedeunapalabraoperodoholofrsticoylafasededospalabraso
hablatelegrfca(Braine,1976).Sesostenaqueeliniciodelacombinacindepalabras,
alrededor de los 2 aos, constitua el hito que marcaba el comienzo del desarrollo gra-
matical. No obstante, este planteamiento est muy sesgado por los primeros estudios
realizadosenPsicolingsticaEvolutiva(Brown,1973),quesehicieroneningls,lengua
conmuypocariquezamorfolgicaadiferenciadelaslenguasromnicascomolaespa-
ola.Losnumerossimosestudiosllevadosacabodesdelosaossesentahastahoysobre
losprocesosdeadquisicindediversaslenguashandibujadounpanoramamuydistinto,
aunquemuypolmicodesdeelpuntodevistaexplicativo.Enuncaptulointroductorio
comoestenopodemosentrarenlosdetallesdelprocesodeadquisicinmorfosintctica,
tanslosealaremosquehoyseaceptaquecomienzamuytempranamente,yquenoes
unprocesoaisladodelosdesarrollosfonolgicoylxico,queparecenteneruncomienzo
anterioraldesarrollogramatical.
Engeneralelprocesodeadquisicindellenguajeescomnparatodoslosniosyse
puedendescribirentodosellosfasessimilares.Sinembargo,sehanconstatadotambin
importantesdiferenciasindividualesenniosconundesarrollonormal,loquehacedif-
cilevaluarlosretrasosy/otrastornosdellenguajedeformaprecoz.Sinembargo,enlos
ltimosaoslasnumerossimasinvestigacionesenPsicolingsticaEvolutivahanapor-
tadoinformacinsobreelprocesoens,susdistintasfases,losmecanismosimplicados
enellas,lasdiferenciasentredistintaslenguasylarelacinentrelosdistintoscomponen-
tesdeldesarrollolingstico.Estaevidenciaempricanoesinterpretadadelmismomodo
porlosinvestigadoresprocedentesdedistintaslneastericas.Lapolmicaenrelacina
losfactoresexplicativosesespecialmenteprofundaenestecampocomoveremosenel
Captulo9.
4. Existe continuidad entre la comunicacin
prelingstica y el lenguaje?: se abre la polmica
Enestecaptulohemosrevisadolosiniciosdelacomunicacinyellenguaje,diferen-
ciandounoyotrodominio.Aunquelasrelacionesentrelashabilidadescomunicativas
yellenguajesonevidentes,ellenguajesuponerealmenteunmodonuevodecomuni-
cacin para el nio que ampla enormemente las posibilidades del sistema basado en
gestos, miradas y expresiones emocionales que utilizaba antes de decir las primeras
palabras. En este sentido cabe preguntarse si la comunicacin lingstica supone un
saltocualitativoenrelacinalaprelingsticaysiambosconstituyensistemassepara-
dosono.
Captulo 6. Los inicios de la comunicacin y el lenguaje 153
Los investigadores no se han puesto de acuerdo en las respuestas a las anteriores
preguntas.Quienessostienenlaideadelacontinuidadentreambostiposdecomunica-
cinconsideranque,tantodesdeelpuntodevistafuncionalcomoformal,lasactividades
comunicativasprelingsticasconstituyenunantecedentenecesarioparapoderadquirir
el lenguaje (Reddy, 1999). Para otros investigadores, la relacin entre ambos tipos de
comunicacinserestringeaunarelacinfuncional:tantolosdispositivosprelingsticos
comoellenguajesirvenparalacomunicacinylarelacinsocial,sinembargo,ellen-
guajerequieredeunconjuntodeoperacionesyprocesosmuyespecfcos,demodoque
slo se puede hablar de adquisicin del lenguaje en el momento que el nio ya com-
prende y empieza a producir signos lingsticos. La polmica por el momento sigue
abierta.
Sinembargo,msalldelasdisputastericas,sparecehaberunconsensogeneral
en torno a qu tipo de actividades favorecen el desarrollo de la comunicacin y el len-
guaje.Todasellasnosonsinoextensionesdeloquesedenominaelmodelonaturalde
adquisicin, es decir, del conjunto de estrategias no conscientes, desde luego que
losadultosutilizamosnormalmentealinteractuarconniospequeos.Elsiguientecua-
dro incluye las principales caractersticas del lenguaje dirigido a los nios llamado
tambinmothereseolenguajematernal/paternal,ydeloscontextosysituacionestpi-
casdeinteraccinadulto-nio.Estasestrategiasomodosdeaccinconstituyenlabase
delosprogramasdeestimulacindellenguajequesellevanacaboactualmenteconnios
menoresde3aos.ComorecuerdanJurezyMonfort(2001):
Los contenidos de los programas de intervencin deben inspirarse en lo que ya
conocemos sobre el desarrollo lingstico del nio normal el mtodo materno
sigue siendo el mejor mtodo conocido para transmitir una competencia mxi-
ma de lenguaje (p.98).
Qu caractersticas tienen las situaciones tpicas de interaccin adulto-nio?
Situaciones cotidianas (rutinas, actividades ldicas, conversaciones sobre aconte-
cimientos o hechos de la vida cotidiana: visitas, juegos, etc.).
Situaciones de accin y atencin conjunta donde adulto y nio se inuyen mu-
tuamente, participan en la misma accin y atienden al mismo objeto o actividad
importancia para la adquisicin del vocabulario.
Situaciones de comunicacin motivadoras crean la necesidad de comunicar-
se y signicativas se ajustan a los intereses y experiencias de los nios.
Cmo es el habla dirigida a los nios? Modicaciones en la forma de hablar:
Entonacin agradable al nio, que capta su atencin: tono ms elevado.
Habla ms lenta y con pronunciacin ms clara.
CONLOSPIES
ENLATIERRA
El Modelo Natural de Adquisicin: base
de los programas de estimulacin del
lenguaje
154 Bloque II. El desarrollo temprano
Lecturas complementarias
Aguado,G.(2000).El desarrollo del lenguaje de 0 a 3 aos.Madrid:CEPE.
Karmiloff,K.yKarmiloff-Smith,A.(2005).Hacia el lenguaje.Madrid:Morata.
Vila,I.(1999).Losiniciosdelacomunicacin,larepresentacinyellenguaje.EnJ.Palacios,A.
MarchesiyC.Coll(eds.).Desarrollo psicolgico y educacin. Volumen I. Psicologa Evolu-
tiva (pp.133-150).Madrid:AlianzaEditorial.
Jurez,A.yMonfort,M.(2001).Estimulacin del lenguaje oral.Madrid:Santillana.
Pausas ms frecuentes.
Habla simplicada desde el punto de vista sintctico y semntico-lxico.
Apoyo gestual y prosdico.
Carcter alegre, exagerado: uso de exclamaciones, risas, onomatopeyas...
Predominio de un estilo de apoyo frente a un estilo correctivo; los errores del nio
tienden a ignorarse (sordera al error) y tienden a reforzarse sus esfuerzos co-
municativos.
Aplicaciones del Modelo Natural a la estimulacin del lenguaje diseo de
formatos o situaciones similares a las que se dan en el ambiente natural.
Actividades
1. Preguntas
Las conductas expresivas que emiten los bebs de menos de 6 meses:
a) Son ya claramente comunicativas, como demuestra la evidencia emprica.
b) Pueden ser comunicativas dependiendo del contexto concreto de emisin.
c) No pueden ser an conductas comunicativas intencionales.
El uso del lenguaje constituye una habilidad muy compleja que implica muchos tipos de
conocimientos distintos. Desde este punto de vista, el nio comienza a adquirir el len-
guaje cuando:
a) Produce sus primeras palabras, en torno al ao.
b) Da muestras de atencin y preferencia hacia la lengua materna
c) Empieza a comprender el lenguaje alrededor de los 8-10 meses.
Un nio de 9-10 meses comprende adecuadamente y responde con gestos ante las si-
guientes emisiones cotidianas: dnde est pap?, quieres papilla?. Estas conduc-
tas ponen de maniesto el siguiente fenmeno:
a) El adelantamiento de la comprensin del lenguaje frente a la expresin o
produccin del mismo.
b) Se trata de un nio con un retraso del lenguaje incipiente al que habra que
atender.
c) Se trata de un nio que muestra claras preferencias por la comunicacin
gestual.
Captulo 6. Los inicios de la comunicacin y el lenguaje 155
2. Lea atentamente la situacin descrita en el siguiente prrafo y decida si la
conducta del gorila implicado es o no una conducta comunicativa. Razone
adecuadamente su respuesta.
Gmez (2004) comenta el caso de una gorila de 10 meses, Muni, que
quera abrir una puerta. Como no alcanzaba al picaporte, general-
mente se suba a un taburete para lograr su objetivo. Sin embargo, un
da sorprendi a los investigadores realizando la siguiente secuencia
de acciones: Se gir hacia uno de los investigadores que estaba tomando notas, tir
de su bata y le empuj en direccin a la puerta. El investigador decidi moverse en
dicha direccin en respuesta a los empujones de Mundi. Una vez all, la gorila tre-
p literalmente por encima del investigador, mirando alternativamente al picaporte
y al cuerpo de la persona sobre la que se estaba encaramando. Sin embargo, ni una
sola vez dirigi su mirada a los ojos de dicha persona. Al fnal Mundi logr alcan-
zar el picaporte y abrir la puerta.
3. Establezca las correspondencias adecuadas entre las conductas descritas en
la columna de la izquierda y los descriptores que aparecen en la columna de
la derecha.
1. Unniosealaconeldedoparapedirunjuguete,alavez
queemitevocalizaciones.
A. Balbuceo cannico o re-
duplicado.
2. Unniode14mesesaprietaloslabioshaciendoelsonido
aummmcuandocomealgoquelegusta.
B. Conducta de bsqueda
dereferenciasocial.
3. Unaniade15mesessealaporlaventanaparamostrara
sucuidadoraungloboquellevaotronioenlacalle.
C. Conducta o gesto proto-
imperativo.
4. Aveceslosniosrepitenunaslabavariasomuchasveces.
Son slabas con una estructura de consonante-vocal (CV)
emitidasgeneralmenteencadena.
D. Gestoprotodeclarativo.
5. Una nia de 9 meses mira a su padre cuando la toma en
brazosunapersonaqueelladesconoce.
E. Gesto comunicativo de
tiposimblicooreferen-
cial.
4. Lea la siguiente descripcin y reexione sobre qu implicaciones, ventajas e
inconvenientes tendra la situacin plateada en relacin al aprendizaje de
una segunda lengua.
Imagine una pareja que reside en Espaa y que est muy preocupada
porque su hija recin nacida aprenda lo antes posible una lengua ex-
tranjera. Como ninguno de los dos es bilinge, deciden conectar una
emisora de radio en lengua inglesa durante un perodo de tiempo va-
riable; empiezan con media hora cuando la nia tiene 4 meses y piensan aumentar
el tiempo de exposicin a medida que sta crezca.
156 Bloque II. El desarrollo temprano
Soluciones a las actividades
1. Preguntas
La respuesta correcta a la primera pregunta es c). Como se explica en el Apartado 2.1.
las conductas expresivas propias de los bebs menores de 6 meses, como por ejemplo
el llanto o la sonrisa, an no son conductas intencionales, puesto que no estn dirigidas
a transmitir ni a compartir informacin acerca de algo de un modo intencionado o a
propsito. En este sentido el llanto o la sonrisa son conductas que posee el beb como
medio de expresin de sus estados; al producir dichas conductas no media ningn tipo
de intencin o propsito de comunicarse con el otro.
La respuesta correcta a la segunda pregunta es la expresada en la alternativa b).
Como se expone en el Apartado 3 del captulo, dada la complejidad inherente al uso
del lenguaje, su proceso de adquisicin se desglosa en multitud de tareas y comienza
muy pronto en la vida del beb. Los procesos de atencin temprana a la lengua ma-
terna constituyen la base sobre la que se asienta el aprendizaje posterior. La preferencia
por la lengua materna es una consecuencia de dichos procesos atencionales tan tem-
pranos y una muestra de que el beb ha creado representaciones sobre la informacin
lingstica asociada a dicha lengua (por ejemplo, la reconoce porque ha extrado y al-
macenado ciertas caractersticas fonolgicas). Las conductas de comprensin (alternati-
va c) y de produccin (alternativa a) tempranas constituyen logros posteriores en el
desarrollo del lenguaje, no sus comienzos.
La respuesta correcta a la tercera pregunta es a). Los ejemplos dados en la pregunta
constituyen una muestra del bien conocido desfase entre la comprensin y la produccin
del lenguaje, que se observan en el proceso de desarrollo normal (vase Apartado 3.3.).
En este sentido, este desfase no es un signo de retraso del lenguaje (alternativa b), sino
de la ms absoluta normalidad. Por otra parte, la utilizacin simultnea de gestos y
lenguaje es comn no slo en los procesos de comunicacin infantil, sino tambin en
los adultos.
2. Conducta comunicativa
La conducta exhibida por Mundi no puede considerarse una conducta genuinamente
comunicativa. La gorila tiene un objetivo claro y realiza una serie de acciones encami-
nadas a conseguir su meta. Para ello utiliza a otra persona, el investigador, pero lo hace
de un modo instrumental. Es decir, el investigador es slo el medio para conseguir lo
que quiere, alcanzar el picaporte. Si la conducta hubiera sido comunicativa, el gorila
habra dirigido su mirada al investigador para transmitirle su intencin de alcanzar el
picaporte de la puerta. Y es justamente este compartir la atencin mediante la mirada
el proceso que est ausente en la situacin descrita por Gmez.
3. Correspondencias
1-C; 2-E; 3-D; 4-A; 5-B.
4. Reexione
Es positivo exponer a los bebs a una segunda lengua (L2) tempranamente. Dadas las
habilidades perceptivas y de anlisis de la seal lingstica que poseen los bebs huma-
nos, se puede predecir que la nia discriminara su lengua materna (L1) de la L2 sin
dicultades. Es obvio que la exposicin temprana a una segunda lengua no perjudica,
sino que fomenta el aprendizaje y la diferenciacin L1/L2. Sin embargo, el aprendizaje
Captulo 6. Los inicios de la comunicacin y el lenguaje 157
de las lenguas, ms all de los procesos de discriminacin fonolgica, requiere de con-
diciones bien distintas a las de la mera exposicin auditiva. La adquisicin del lenguaje,
de cualquier lengua, necesita de un contexto interactivo en el que haya interlocutores
activos, interesados en la comunicacin y en la asignacin de signicado a las emisiones
verbales. Poner a un nio a escuchar la radio en un idioma extranjero no es suciente
para poder aprender una lengua (el vocabulario, su morfosintaxis, sus distintos usos
comunicativos) si no se acompaa de otras condiciones, como las que se sintetizan en
el cuadro Con los pies en la tierra (p. 153).
Desarrollo afectivo,
emocional y social
159
7
BEGOA DELGADO EGIDO
Esquema resumen
Objetivos
Introduccin
1. Aproximacin histrica al estudio del apego
1.1. La investigacin con animales y la deprivacin afectiva
2. Formacin del apego
2.1. La orientacin social y emocional del beb en el momento del nacimiento
2.1.1. Las primeras expresiones emocionales del beb
La produccin de emociones en el beb
La comprensin de emociones en el beb
3. Desarrollo del apego
4. Tipos de apego
5. Factores que afectan a la formacin del vnculo de apego
6. Los elementos del vnculo de apego
7. Estabilidad del vnculo de apego
Lecturas complementarias
Actividades
Soluciones a las actividades
160 Bloque II. El desarrollo temprano
Esquema resumen
1. Aproximacin histrica al estudio del apego
La ntima relacin que se establece entre el beb y la madre ha interesado siempre a los
estudiosos del comportamiento humano. Inicialmente se crey que el vnculo que une
a padres e hijos se basaba en un proceso de aprendizaje simple: la asociacin de los
padres con la satisfaccin de necesidades bsicas (hiptesis de la madre-despensa). En
cambio, hoy sabemos que este vnculo responde a una necesidad afectiva inherente al
ser humano. Los estudios etolgicos han favorecido este enfoque al mostrarnos que la
bsqueda de afecto y proteccin tiene componentes de ndole logentica.
2. Formacin del apego
En este apartado se recuerdan algunas de las principales pre-adaptaciones sociales del
beb. Posteriormente, se ahonda en la capacidad de expresin emocional del beb,
enfatizando la existencia de unas primeras emociones bsicas cuya expresin y compren-
sin es universal y no requiere del aprendizaje. El objetivo nal es ahondar en los fun-
damentos de la comunicacin nio-adulto.
3. Desarrollo del apego
Este apartado detalla la secuencia evolutiva que sigue la formacin del vnculo de ape-
go en circunstancias normales. Se trata de cuatro etapas que se extienden desde el
nacimiento hasta el segundo ao de vida.
4. Tipos de apego
Cada persona y cada circunstancia de crianza son nicas, por ello, al nal del segundo
ao habr notables diferencias en el grado de seguridad que los bebs depositan en los
adultos. Las variaciones pueden ir desde la seguridad total en la proteccin del padre o
la madre hasta una completa desconanza en los adultos.
5. Factores que afectan a la formacin del vnculo de apego
La calidad del vnculo de apego depende tanto de las caractersticas del nio como de
la personalidad del adulto. Ahora bien, pese a la idiosincrasia de ambos, se atribuye a
los adultos un mayor peso en la construccin de un tipo especco de relacin con el
beb. Esto se debe a sus mayores recursos para interpretar y guiar la conducta del beb
en una u otra direccin.
6. Los elementos del vnculo de apego
El vnculo de apego asienta en el nio sentimientos de seguridad o inseguridad, que se
relacionan con el tipo de cuidados recibidos. En su cara ms externa, el vnculo de ape-
go se traduce en conductas que reejan la relacin con las guras de apego (abrazos,
seguimiento ocular o, al contrario, rechazo o indiferencia, etc.). Finalmente, la relacin
vinculante se representa a un nivel mental, mediante lo que se conoce como modelos
internos de trabajo (MIT). Esto implica que, partiendo de las primeras experiencias de
cuidado, el nio genera expectativas sobre los modos de relacin entre las personas y
el grado de ayuda que puede esperar de ellas.
7. Estabilidad del vnculo de apego
La preocupacin por el grado de determinismo de las experiencias tempranas es un
tema candente en la investigacin del apego. En general, se asume que los modelos
Captulo 7. Desarrollo afectivo, emocional y social 161
Objetivos
Conocer el devenir histrico en el estudio del apego: las inuencias etolgicas,
conductistas y psicodinmicas.
Detectar ciertas analogas entre el comportamiento humano y el de otros animales.
Conocer los fundamentos de la teora de Bowlby.
Ahondar en los mecanismos que facilitan la comunicacin nio-adulto: la expre-
sin y comprensin de emociones bsicas.
Conocer el curso evolutivo del primer vnculo afectivo: desde el nacimiento a los
24 meses.
Describir los tres niveles del vnculo de apego: afectivo, conductual y mental.
Acercarse a los aspectos fundamentales que inuyen en la formacin del vnculo
de apego: la personalidad del nio y del cuidador.
Discriminar los diferentes tipos de apego segn la situacin extraa de Ainsworth:
apego seguro, apego evitativo, apego resistente y apego desorganizado.
Estimar de modo crtico la inuencia de las experiencias tempranas: factores que
promueven la continuidad y factores que promueven el cambio.
Introduccin
Enestecaptulovamosaprofundizarenalgunosaspectosdelavidaemocionaldelbeb
y,enespecial,enelvnculoafectivoquecaracterizaalasrelacioneshumanas.Paraello,
convienerepararenunhechofundamentaleinherenteanuestraespecie,sumarcadacon-
dicinsocial.ComosealVygotski,essorprendentequealfnaldelacadenaevolutiva
encontremos un ejemplar que nace altamente indefenso y cuyos sentidos distan mucho
deestarmadurosyoperantes.Paramuchos,estacircunstanciaesunaseaindudablede
que la riqueza de nuestra especie no reside en las capacidades individuales sino en la
facultaddecooperarytrabajarengrupo(Tomasello,1999;VygotskiyLuria,1930/1993).
Lainmadurezdelneonatoylanecesidaddetransmitirunaculturasetraducenenuna
infanciaprolongada,enlaquelasupervivenciadelbebdependedelasatencionesycui-
dadosdesusprogenitores.Porfortuna,losbebscorrespondenprontamentealasemocio-
nesdelosadultosyexhibenotrastantasexpresionesreconociblesporstos.Estaafnidad
emocional,unidaaotrosdispositivostempranosyalapropiasensibilidaddeloscuidado-
res,permitequeentreambosseestablezcaunvnculoafectivoconocidocomoapego.
La funcin esencial de dicho vnculo es procurar la supervivencia y cuidados del
beb.Enestesentido,cuandoelvnculoestbienestablecidosemanifestaenconductas
orientadasamantenerlacercanayelcontactoconlasfgurasdeapego,enespecial,en
aquellassituacionesquesonpercibidascomoamenazantes.
de relacin generados en la infancia pueden ser modicados ms tarde. No obstante,
tambin hay evidencias de continuidad y de dicultad para cambiar modelos de rela-
cin muy asentados. Por tanto, si bien no puede hablarse de determinismo, tampoco
puede minimizarse la importancia que tradicionalmente se ha dado a las experiencias
tempranas.
162 Bloque II. El desarrollo temprano
Finalmente,laposibilidaddemanipularinternamentelarealidadpermitealnioge-
nerarunarepresentacindelarelacinvinculantequeseconocecomomodelointerno
detrabajo(MIT).Estosmodelos,ademsdeordenarlasexperienciasvividas,permiten
desarrollar expectativas sobre la disponibilidad y seguridad que ofrecen las fguras de
apego y podran afectar tambin al modo en que se afrontan otras relaciones. De este
modo,unmodeloderelacinnegativopodraentorpecerlasposibilidadesdeestablecer
en el futuro relaciones ntimas y basadas en la confanza. En este sentido, los expertos
adviertenqueelapegoesalgomsqueunaadaptacininfantil;cadavezms,esteprimer
vnculoesconsideradounlogrofundamentalennuestrodesarrollopsicolgico(Moreno,
2006).
1. Aproximacin histrica al estudio del apego
La estrecha relacin que se establece entre el lactante y la madre
1
ha interesado desde
siempreapsiclogosypsicoanalistas.Amediadosdelpasadosiglosepodandistinguir
hastacuatroposicionestericasdiferentessobrelosmotivosdeestarelacin,queabar-
cabandesdeelpsicoanlisisalconductismo.Sibien,lateoraconductistade lareduccin
del impulso ha sido una de las que mayor inters ha despertado. Segn esta teora, el
afectosurgeporlaasociacinsistemticaentrelamadreylareduccindenecesidades
primarias,entreellasladelhambre.Talcontingenciaacabaraporconvertiraladultoen
unestmuloplacenteroyagradable.Portanto,elvnculodeapegoseraelfrutodeuna
asociacinaprendida.
Sinembargo,numerososejemploscontravienenestaidea.Spitzobservelcompor-
tamientodeniosinstitucionalizados.Segnl,bastanseismesesdebuenarelacincon
la madre para que su separacin repercuta negativamente en el nio, sumindolo en lo
queldenomindepresinanacltica (Spitz,1946).Igualmente,Spitzinvestiglasano-
malas que presentaban los nios criados en instituciones cuya nota defnitoria era la
carenciatotaldeafecto.Lospequeospadecanelsndromedelhospitalismo ylosdes-
cribacomoniospostradosencamas,inexpresivosypasivos(Spitz,1945).Estosdatos
revelanqueunoscuidadosbsicos,orientadosaqueelnionomueradeinanicin,no
garantizanunvnculoafectivo,niundesarrolloadecuado.
Informescomolosanterioresiransentandolasbasesnecesariasparaunestudiori-
gurosodelasrelacionestempranas.Noobstante,elambienteadecuadoparaelsurgimien-
todeunapotenteteorasobreelapegoseproducetrasunosinteresantesdescubrimientos
enelmbitodelaetologa.
1.1. La investigacin con animales y la deprivacin afectiva
Desdeunenfoqueetolgicosesostienequelaconductasocialestanbenefciosaparala
supervivenciaque,sibienpuedehaberaspectosaprendidos,haysiemprealgunosinnatos
(Hess,1970)
2
/
3
.KonrazLorenz(1952)legitimestaideaaldescubrirquecrasdepollos
1
Convienenotarque,enadelante,hablaremosdelafguradelamadreodeloscuidadosmaternospara
referirnosdemanerageneralalapersonaque,demodoprincipal,seocupadelcuidadodelbeb.
2
LatraduccinalcastellanodeestaobrasepuedeencontrarenellibroLecturas de psicologa del nio
(V.1)deJ.Delval(1978).
3
Hessaclaraquelaconductasocialdebeentenderseenunsentidoamplio,incluyendonoslolasrela-
Captulo 7. Desarrollo afectivo, emocional y social 163
y patos siguen a sus madres, casi desde el nacimiento. Este comportamiento, conocido
como troquelado social, garantiza que las cras estn protegidas de los predadores y
sigandesdetempranoalprimerobjetoquevenyque,conmuchasprobabilidades,essu
progenitor.
Adiferenciadelosaprendizajesporasociacin,eltroqueladotienealgunascaracte-
rsticasespeciales.Porejemplo,hayunperodocrtico, enelqueelseguimientoesfcil
de establecer. De hecho, el propio Lorenz sufri sus efectos, ya que una bandada de
patossilvestres,criadosporlinstantesdespusdelnacimiento,leseguainsistentemen-
te, dejando incluso de lado el contacto con otros patos
4
. Durante el perodo crtico, ni
siquiera el castigo materno inhibe o disuade a los polluelos en su tendencia a seguirla.
Tal empeo no hace sino subrayar la importancia que tiene para las cras estar, pese a
todo,cercadeunadulto.Ahorabien,pasadoelperodocrticoestimadoen24horas
tras el nacimiento los polluelos difcilmente desarrollarn conductas de seguimiento
haciaobjetopaternalalguno
5
.
Lasconductasdefliacintambinhansidoestudiadasenprimates.Acomienzosde
los aos cincuenta, los Harlow investigaban la capacidad de aprendizaje en los monos
rehsus,loqueaccidentalmentelesllevainstruiralascrasenausenciadesusmadres
6
.
Deformaimprevistalaseparacintuvoconsecuenciasfatalesparalasprimeras,queco-
menzaronamostrarepisodiosdeterroryconductasautocentradasodepresivas.Sorpren-
didosporlosresultados,losHarlownocesarondeestudiaryprofundizarenlosefectos
deloscuidadosmaternos.
Enunaocasin,losinvestigadoresaislaronalascrasenjaulasdondeslohabados
tiposdemadressustitutas:unamadredealambreyunamadredefelpa,ambasdisea-
dasparasostenerunbibern.Aunqueenalgunoscasoslacomidaeradispensadaporla
madredealambreyenotrosporlamadredefelpa,todaslascrasmostraronunaclara
preferenciaporlamadredefelpa,ysiempreeraaellaalaquetendancuandosesentan
atemorizadas(HarlowyHarlow1962).Conestosdatos,losHarlowconcluyeronquesi
existealgunaconductainstintivaenlosmonos,stasedirigehacialabsquedadeafec-
toyproteccinynodecomida.
Sussiguientestrabajosmostraronqueenlosmonosexistencomplejaspautasdeflia-
cin.Alnacer,lascrasmuestransuorientacinsocialenconductascomoelabrazo,la
elevacindelacabezaolaprensinrefejademanosypies.Alapar,lasmadresexhiben
patrones maternales, ofreciendo a sus cras proteccin y cuidados. Finalmente, cuando
stas se muestran ms independientes, las madres les retiran su ayuda, a fn de que las
cras,yamaduras,serelacionenconotrosmonosjvenes(HarlowyHarlow,1966)
7
.
Porltimo,hayquedecirquelainvestigacinsocialenlosmonoshaestadoligada
alautilizacindeunavarianteexperimentalquetratadeexplorarlasdesventajasdela
cionesflialessinotambinotras,comolasconductasdeemparejamientoodecortejo.
4
Laampliacindeestetipodetrabajos,incluyendoobservacionesensituacionesdelaboratorio,hapues-
todemanifestoquemuchascrasdeavessiguenacasicualquierestmuloquesemueva,incluidosalgunos
tanincreblescomounaparedenformadetablerodeajedrez(Hess,1972).
5
Paramuchosetlogostallimitacintienesentidoyaque,encondicionesnaturales,lascrasqueen24
horasnohubiesenestadoalamparodesuprogenitorposiblementehabranmuertoya.
6
Conestamedidasepretendacontrolarelefectocontaminadordelosrefuerzosocastigosquelamadre
pudieradispensaralascrasyquenoerancontroladosporlosinvestigadores.
7
LatraduccinalcastellanodeestaobraseencuentraenellibroLecturas de psicologa del nio(V.1)
deJ.Delval(1978).
164 Bloque II. El desarrollo temprano
deprivacinafectiva.Esascomosabemosqueunaodetotalaislamientosocialtiene
consecuenciasprcticamenteirreversibles(HarlowyHarlow,1966).Enelfuturo,estos
animales pueden mostrarse miedosos o indiferentes a las relaciones sociales prctica-
mentedeformaperpetua.Porsuparte,aislamientosmenosprolongadospuedenpoten-
ciar conductas agresivas en la adultez. Algunos animales sometidos a esta condicin
tuvieronmstardeconductasdeagresinsuicidaamonosadultosofuerondainoscon
lascras,conductamuyextraaenlasmonasadolescentes.Afortunadamente,cuandola
realidadesmenosadversacomoenelcasodecrascuidadasporotrasodeperodos
deaislamientonomayoresdetresmeseslasposibilidadesdeuncomportamientoso-
cial adecuado y de una maternidad o paternidad no peligrosas aumentan signifcativa-
mente.
Estoshallazgosmuestranquehaypautasdefliacinendistintasespeciesyquelas
experiencias tempranas tienen una importancia crucial para el futuro desempeo de las
cras.Lgicamente,lasiguientepreguntaesqusucedeenelcasodelserhumano.
2. Formacin del apego
LacasualidadquisoquemientraslosHarlowrealizabansusinvestigaciones,mdicosy
psicoanalistas recogiesen datos similares sobre nios criados en situaciones desfavora-
bles. Esta confuencia fue aprovechada por el mdico y psicoanalista ingls Bowlby
quien,trasaosdeintensotrabajo,reneambasinfuenciasenunapotenteteorasobre
elapego.
Traslasegundaguerramundial,Bowlbyrecibeelencargodetrabajarconniosafec-
tadosporgravesproblemasemocionales,cuyonicoatributocomneranunosmalos,o
inexistentes, vnculos familiares. Igualmente, hasta el 40% de los jvenes delincuentes
que trat tenan historias de cuidados maternos negligentes. Su posicin de mdico le
permiti,adems,examinarlaprogresindemuchosnioshospitalizadosquenopodan
verasuspadres.Estospequeos,queyahabanconstruidounvnculodeapegoconuno
oambosdesusprogenitores,llegabanaatravesarhastacuatrofasesquepodanculminar
enunacompletadesvinculacinemocional.Unaprimerafasedeprotesta,unasegunda
Figura 7.1. John Bowlby.
Captulo 7. Desarrollo afectivo, emocional y social 165
defasedeinapetenciaoindefensin,yfnalmenteunatercerafasequellamdedes-
apego.
En1951BowlbyelaborauninformeparalaOrganizacinMundialdelaSalud(OMS)
donde rene sus observaciones y pone especial nfasis en la necesidad de que el nio
pequeo pueda tener una relacin ntima y continuada con la madre. Poco despus, en
1958,exponesuprimerateorasobreelapego,alejndosenotablementedelospresupues-
tosdelaprendizajeyelpsicoanlisis.Ensulugarelautorsedecantaporunaexplicacin
decorteetolgico,sosteniendoqueelvnculoafectivorespondeaunhechoprimarioque
tiene,adems,unaimportantefuncinadaptativa.Deestemodo,Bowlbydescartaqueel
vnculo derive de asociaciones previas; para l, la necesidad de afecto es tan primaria
comoelhambre.
Msadelante,en1969,reformulasuprimeraversinparasostenerquelasconductas
de apego no son el resultado literal de una pauta biolgica e instintiva. En realidad, el
vnculosurgedesdelaactivacininicialdediversossistemasconductualesmuybsicos
comolaorientacinvisualhacialosrostros,olapreferenciaporlavozhumanaque
se desarrollan a lo largo del primer ao y que, en el segundo, dan como resultado las
conductasprototpicasdeapegoentreellaslabsquedadelamadreensituacionesde
riesgo.Esdecir,habraunasensibilidadbiolgicahaciaelotroque,mstardeyantesu
respuestapositiva,permitequesefjenunosparmetrosdeaccinquesonlosqueenten-
demoscomoconductasdeapego.Setrataportantodeunsistemaqueseretroalimenta,
yquereaccionaoseautorregulaenfuncindeculesseanlascircunstanciasalasquese
enfrenta.
Optemos por la versin del instinto o por la de la autorregulacin as es como
Bowlbydenominaasusdosposicionestericassurazonamientoconcuerdaestrecha-
menteconlospresupuestosetolgicos.Enestesentido,esnotabletantoladefensaque
hacedelafuncinadaptativadelapegocomoelreconocimiento,cuantomenos,deunos
primerossistemasdeactuacinqueyadesdelabiologanospredisponenarelacionarnos
conlosotros.
Acontinuacin,nosalejaremosmomentneamentedelapegoparadetenernosenal-
gunosdeestosmecanismostempranos.
2.1. La orientacin social y emocional del beb en el momento
del nacimiento
Laorientacininterpersonaldelbebescrucialenlaconstruccindeunpuentecomuni-
cativoyafectivoconeladulto.Comosabemos,alcomienzodelavida,elbebdispone
deciertasinclinacionesbiolgicasqueaseguransucondicinsocial.Porejemplo,como
vimosenlosCaptulos4,5y6,conslominutosdevidalosbebsimitanlosmovimien-
toslabialesdelosadultos(MeltzoffyDupoux,1990).Igualmente,desdetempranopre-
ferenmirarlosrostroshumanosantesquecualquierotroestmuloy,peseanoentender
loquedecimos,seorientanycalmanconnuestrasvoces.
Aloanteriorsesumanotrostantosmecanismosorientadostambinalainteraccin
como el llanto, la sonrisa refeja o las pausas en la succin
8
. Endefnitiva,prcticamen-
8
Enelcaptuloanterior,dedicadoalacomunicacintemprana,seexplicaquelosbebshumanosrealizan
pausasenlasuccinquenoparecenobservarseenotrosmamferosyquesoncontestadassistemticamente
166 Bloque II. El desarrollo temprano
tedesdeelmomentodelnacimiento,elbebexhibeciertosmecanismosqueslotienen
sentidosihayotroquelosinterpreta.
Enesteconjunto,lafacultadexpresivadelbebesunelementoclaveparalacreacin
de un marco comunicativo y afectivo con el adulto. Por su especial relevancia, en los
siguientesepgrafesnoscentraremosenesteaspecto.
2.1.1. Las primeras expresiones emocionales del beb
9
EnsulibroLa expresin de las emociones en los animales y en el hombre,Darwin(1872)
plantequelaexpresindesentimientosbsicoscomolaira,laalegra,elmiedo,elen-
fadoolasorpresa,mantieneunvnculobiolgicocondichosestadosemocionales.Segn
Darwin,estauninsehabraforjadoalolargodelaevolucinyexplicaraporqucul-
turasmuydiferentesproduceneinterpretandichasexpresionesdeformasimilar
10
.
Todos estn de acuerdo en que las principales acciones expresivas que exhiben
los hombres y los animales inferiores son ahora innatas o heredadas, es decir,
que no han sido aprendidas por el individuo. Muchas de ellas tienen tan poco
que ver con el aprendizaje y la imitacin que estn por completo fuera del al-
cance de nuestro control desde los primeros das y a lo largo de toda la vida. (Darwin,
1872/1984,p.351.)
EstudiosmodernoscorroboranlassemejanzasdetectadasporDarwinenculturasmuy
distintas. El clebre estudio de Ekman y Friesen (1971), realizado con adultos fore de
Nueva Guinea, arroj resultados muy ntidos. La tarea consista en escuchar diversas
porlamadre,quienrespondeaestaspausashablandoy/otocandoalbeb,hastaquestereinicialasuccin.
Dado que dichas pausas no responden a ninguna funcin fsiolgica, se cree que su misin es fomentar la
interaccinporturnosmadre-hijo.Esdecir,sucometidoseraimplantarenelbeblosritmosdeunacomu-
nicacinregularysimilarensuformaaundilogoadulto.
9
EllectorquelodeseepuedeacudiraPardoyMartndelCampo(1997)paraunarevisindidcticade
losestudiosclsicossobreemocionesenbebsoaNavarro,EnescoyGuerrero(2003)paraunarevisinms
actualizada.
10
Lasimilitudconquediferentesculturasexpresansusemocionestambinsirvideargumentoparala
defensadeuntroncocomnenelhombre.
Figura 7.2. Charles Darwin.
Captulo 7. Desarrollo afectivo, emocional y social 167
historiasquetenanunaimportantecargaemocional,trasellodebanseleccionardeentre
variasfotografaslaexpresinquemsseadecuasealahistoriaoda.Peseaquelasfo-
tografascorrespondanaadultoseuropeos,conlosquenohabantenidocontactoprevio,
losforerealizaronlatareadeemparejamientoconunaltoniveldexito.Curiosamente,
lapruebatuvoidnticosresultadoscuandofueronloseuropeosquienestuvieronquein-
terpretarlasexpresionesfotografadasdelosfore(Ekman,1973)
11
.
LasideasuniversalistasdeDarwintambinconcuerdanconlaexpresividadobserva-
da en los bebs, quienes no tardan en experimentar emociones bsicas como la ira, el
asco, el miedo, la alegra, la tristeza o la sorpresa, que expresan de modo similar a los
adultos.Igualmente,tambindesdetempranolosbebsreaccionandeformaadecuadaa
talesexpresiones.
Laproduccindeemocionesenelbeb
Desdetempranoesposibleidentifcarenelbebexpresionesfacialesquesonsimilares
alasdelosadultos.Porejemplo,comovimosenelCaptulo5,lamuecadeunbebque
saboreaunlquidoamargoesmuydistintaaladeotroquepruebaunsabordulce.Ms
an,quienesestudiaronestadiferenciaadvirtieronquelosobservadoresnoslolasiden-
tifcaban,sinoquedetectabaninclusosiloslquidostenanmuchaopocaconcentracin.
Asimismo, los bebs expresan su inters mirando fjamente tal y como hara cualquier
adulto(FogelyHannan,1985;FogelyThelen,1987).
Noobstante,sesostienequesonpocaslasexpresionesdiscriminadasquepodemos
observarenelrecinnacido.Anivelmuscularelneonatopuederealizartodoslosmovi-
mientosfacialesimplicadosenlaexpresinemocional,peroparaexteriorizarunaemo-
cinnobastacontenerlafacultadmuscularparaesbozarunasonrisaofruncirlascejas.
Esnecesario,adems,estarendisposicindeexperimentarverdaderasemocionescomo
laalegraolairayestonoocurredesdeelnacimiento.Porestemotivo,muchasexpre-
sionesaparecerndeformaprogresiva.
Siguiendo el modelo evolutivo de Lewis (2000), en el momento del nacimiento el
bebmostraraunavidaemocionalbipolar,talycomopropusoBridges(1932).Segn
esto,elbebdenotasuangustiaatravsdelllantoylairritabilidad,ysuregocijoyplacer
conmuestrasgeneralesdesatisfaccinyatencin
12
.
Yahaciaeltercermeselbebdespliegaemocionesmsdiscriminadasydecarcter
mssocial.Porejemplo,lasonrisabrotaahoraenrespuestaaestmulossocialesocono-
cidos,dejandodeserunamuecaoriginadaporestadosdebienestarinternos
13
.Igualmen-
te,lainterrupcinbruscadelainteraccinconlamadresuscitalatristezadelbeb,que
esdistinguibledelaexpresingeneraldemalestar.Alapar,elllantopuedeempezara
serunaformadereclamarlaatencindelotro.
Tambin a los tres meses podemos observar los primeros sntomas de indignacin,
aunquelaexpresindecleraoenfadoemergedeformamsntidaentreelcuartoyel
11
Enambaspoblacionesladiscriminacinentrelasexpresionesdemiedoysorpresafuelamscostosa.
12
Lewis,matizaqueestemodelopodrallegarasertripolarsiconsidersemosladivisinentrminosde
(i)satisfaccin,(ii)sufrimientoy(iii)inters;estoltimocomounacategoraaparte.
13
Posiblemente,lamisindeestaprimeramueca,aligualqueladelaimitacinrefeja,seapuramente
adaptativa,procurandolassimpatasylaidentifcacinentreelbebysucuidadorenunmomentocompro-
metidoparalasupervivencia.
168 Bloque II. El desarrollo temprano
sextomesdevida.Enestemomento,bastarpresionarhaciaabajolosbrazosdelbeb
parafrustrarloyobservarsuexpresindeira
14
.
Por ltimo, la expresin de sorpresa no suele aparecer antes de los seis meses y
requierecomprenderquesehavioladounaexpectativa,oquesecumpleenladireccin
deundescubrimientotipoAja!.Deigualforma,laexpresindemiedoespropia
delossietemeses,yaque,aligualquelasorpresa,estaemocinsurgetrasconfrmarque
uneventodiscrepasignifcativamentedetodoslosconocidos
15
.
Comoresultado,hacialosochoonuevemesespodemosobservarenelbebunam-
pliorepertoriodeexpresionesemocionalescomoelasco,laalegra,latristeza,laira,la
sorpresayelmiedo,cuyaconexinconlaemocinvividaparecetenerunabaseinnata.
Peroeldesarrolloemocionalantieneotrospeldaosquesubiry,hacialosdieciocho
meses,emergernnuevasemocionesrelacionadasconlaautoconciencia.Aestaedad,los
niosempiezanareconocerseenelespejoysefortalecesusentidodelaidentidad,di-
bujndosecomonicaydistintaaladelosotros.Semejantedescubrimientoincitaemo-
cionesalgomscomplejascomola vergenza, la envidia o la empata quesonespecf-
camentehumanasysedistinguendelasanterioresporquenosiemprerespondenauna
expresinfacialdeterminada,loquehacemscostosasuidentifcacin.Finalmente,el
modelodeLewisrecogealgunasotrasemocionesdeaparicinmstardaqueserntra-
tadasenelCaptulo10.
Lacomprensindeemocionesenelbeb
LosdatossobrecompresinemocionaltambinrefuerzanlaposicininnatistadeDa-
rwin.Estudiosbasadosenelparadigmadelahabituacinpruebanqueeltiempodefja-
cin visual de los bebs aumenta tras presentarles una expresin emocional nueva. Es
decir,apuntanaquelosbebsdistinguenlosrasgosdelasdiferentesexpresionesemo-
cionales.
Noobstante,comosealanPardoyMartndelCampo(1997),losestudiosqueutili-
zanestosmtodosnoaseguranqueelnioconozcaelsignifcadodedichasemociones.
Encambio,esteconocimientossepusodemanifestoenelestudiodeHavilandyLe-
lwica(1987)realizadoconniosdetanslo10semanas.Enlsepedaaungrupode
madresqueadoptaranlaexpresinyeltonodevozadecuadoatresemocionesconcretas:
alegra,tristezayenfado,grabndoselasreaccionesinmediatasdesusbebs.Puesbien,
entodosloscasos,losniosrespondierondeformacongruente.Antelaalegrasemos-
traronalegres,antelatristezasuccionabanomovanloslabiosyanteelenfadoseenfa-
dabanosequedabaninmviles.Curiosamente,laestabilidaddeestefenmenopermite
14
Merece la pena sealar que, segn Darwin (1872), la ira es una respuesta diseada para superar un
obstculo.Enconsecuencia,Lewissospechaquealgnconocimientomuyprecozsobrelasmetasdelaaccin
olarelacinmedios-fnespodrasubyaceralaemocindeira.
15
Debesealarseque,sincontradecirloanterior,hayquienessostienenquepuedenobservarseexpresio-
nesdemiedoenbebsdepocassemanas.Algunosestmulos,porejemplounruidofuerte,podrandesenca-
denarexpresionesdemiedoquenosonfrutodeunaevaluacindelasituacin.Lacuestinessiestaemocin
demiedoesidnticaonoalaprovocada,mesesmstarde,porelenjuiciamientoovaloracindeunasituacin.
Igualmente,Navarro,EnescoyGuerrero(2003)indicanquelaexpresindesorpresaqueapareceaestaseda-
desnoescomparablealaexpresindeintersosorpresaqueseregistraenmuchosestudiosbasadosenel
paradigma de la habituacin y que se limitan, por lo general, a medir la sorpresa por el tiempo de fjacin
visual.Portanto,convienesaberquehaydiferentesformasdeentenderymedirlaemocin.
Captulo 7. Desarrollo afectivo, emocional y social 169
que las observaciones de Haviland y Lelwica sean muy similares a las que en su da
efectuaseDarwinsobresuhijo:
Cuando tena cinco meses pareci entender una expresin y tono de voz com-
pungidos. A los pocos das de haber cumplido seis meses, su niera simul que
lloraba y vi cmo su rostro adquira al instante una expresin melanclica, con
los ngulos de la boca muy dirigidos hacia abajo. Ahora bien, es difcil que este
nio hubiera visto llorar a otro nio, y nunca vio llorar a ninguna persona adulta. Dudo
adems de que a una edad tan temprana hubiera podido razonar sobre la cuestin. Me pa-
rece pues que un sentimiento innato debe haberle dicho que el llanto simulado de su niera
expresaba pena, lo cual provoc su propia pena a travs del instinto de simpata. (Darwin,
1872/1984,p.358.)
Enconclusin,podemospensarquemsalldelasdiferenciasculturalesodeedad,
hayunconjuntodeexpresionesbsicasqueserefejanenelrostroyquesoncompartidas
por todos, incluidos los nios afectados de ceguera congnita (Eibl-Eibesfeldt, 1973;
1979).Asimismo,cuandolosbebsobservanestasemocionesenlosotrosreaccionande
formacongruenteyrespondenconaccionesquenosonunameracopiadelgestoadulto.
Anteestosdatos,laopiningeneralesquenilaproduccinynilacomprensininiciales
deexpresionesemocionalesbsicasparecendependerdelaprendizaje.
3. Desarrollo del apego
Trasesterepasoaladotacinemocionaldelbeb,veremoscmoestesistemainfantilse
adaptaeinteractaconelcomplejomundodelcuidador.Comoespredecible,larespues-
tacontingenteyadecuadadeladultoeslaotrapiezaesencialparaqueelsistemadein-
teraccinsedespliegueconvenientemente.
ElmodeloevolutivodeBowlby(1969)contemplacuatrofasesqueacompaadeunas
edadesaproximadas(vaseTabla7.1).Enellaspodemosapreciarcmoelvnculoafec-
tivosedesarrollaparejoalacomprensinqueelniovateniendodesmismoydelotro
16
.
Aunqueesarriesgadoprecisarcundounnioyaestapegadoalosadultos,Bowlby
(1969) crea que esto sucede en algn punto entre la tercera y la cuarta fase, es decir,
entreelprimeraoyelsegundoaodevida.
Tambinmerecesealarqueelapegononecesariamenteseestablececonunanica
persona. Al fnal del primer ao el beb podr sentirse apegado a diferentes personas
comosupadre,madre,familiarescercanosyotroscuidadores.Esos,losdistintosvn-
culossuelenorganizarseenunajerarquadeapegosordenadosenfuncindesurele-
vanciaparaelnio,ysuelenresponderaunestilodeapego,esdecir,aunatendencia
acomportarsedeunmododeterminadoquesobresaleporencimadeadaptacionesparti-
culares.Porltimo,merecenotarquelostrabajosdelosaoscincuenta,enespecialel
16
Espertinenterecordarqueelbebnonaceconunaideaclaradequinessonlosotrosodequinesl
mismo.Suidentidadsevadibujandoalmismotiempoqueseaclaraladelrestodepersonasquelerodeane,
incluso,altiempoquelosobjetosfsicosvansiendoobjetivadoscomorealidadesindependientesdesusac-
ciones(WerneryKaplan,1963;Piaget,1936;1937).
170 Bloque II. El desarrollo temprano
delpropioBowlby,tendanaidentifcarlafguraprincipaldeapegoconlamadrebiol-
gica, sin embargo, la actitud actual es bastante ms laxa y admite que cualquiera que
atiendaaunbebdeformaprolongadaysolcitaessusceptibledeconvertirseensuf-
guradeapego.
Tabla 7.1. Fases en el desarrollo del vnculo afectivo segn Bowlby
Fase 1: Orientacin y seales sin discriminacin de fgura (desde el nacimiento hasta las ocho/doce
semanas).
Elbebmuestrasupreferenciaporestmulossocialesyreaccionaantelasvocesmsfamiliares,pero
nohayevidenciasdequepuedareconoceralaspersonasencuantoatales.Elajustesocialvienefavo-
recidoporciertaspre-adaptacionescomoel llanto, la imitacin y la sonrisa refeja, la preferencia por
rostros, etc.,quetiendenaincrementareltiempoqueelnioestenlaproximidaddeuncompaero.
Setratadesistemasderelacinmuybsicosysuevolucindependerdelareaccindeladulto
17
.
Fase 2: Orientacin y seales dirigidas hacia una o ms fguras discriminadas (entre los dos/tres meses
y los seis/siete).
La sensibilidad del adulto favorece el inicio de las primeras seales verdaderamente sociales, como
sonreroimitarenrespuestaainvitacionesyaccionesdeladulto.Escaractersticoqueelbebcomien-
ce a manifestar su inclinacin por algunas personas, con las que se producen reacciones mucho ms
intensas.Noobstante,ansedejacuidarpordesconocidosynomuestramuchasdiferenciasalseparar-
sedelamadreodeotraspersonas.
Fase 3: Mantenimiento de la proximidad hacia una fgura por medio tanto de la locomocin como de
seales (desde los seis/siete meses a los veinticuatro).
Estaeslafasedeapegopropiamentedicha.Lasrespuestasamistosasindiscriminadassereducenyla
bsquedadelaproximidaddelamadresehacepatente.As,elseguimientodelamadre,elsaludoasu
vueltaysuutilizacincomobaseseguraparaexplorar,sonconductaspropiasdeestaetapa
18
.Asimismo,
escomnqueelbebseleccioneaunaspocaspersonasqueseconviertenenfgurasdeapegosubsidia-
riasalamadre.Porltimo,estapredileccinsocialseexpresamedianteelrechazoalosextraos.Pre-
cisamente, la crisis de separacin o angustia

de separacin
,
subraya lo difcil que es en esta etapa
separaralbebdesusfgurasdecrianza.Endefnitiva,elbebquieremantenerlaproximidadconla
fguradeapegoyladistanciaconlosextraos.
Fase 4: Formacin de una asociacin con adaptacin al objetivo (desde los veinticuatro meses en adelante).
Las mayores posibilidades lingsticas del nio y su facultad de concebir a la madre como un objeto
persistenteeneltiempo(nocindepermanenciadelobjeto)relajansutendenciaaseguirla.Enadelan-
te,podrsaberdelosmotivosquelainducenaausentarse,altiempoqueimaginarlayrepresentarlaen
sumente
19
.Asimismo,hayquesealarqueenelsegundoaotambinseiniciarnlasprimerasestrate-
giasparatratardeinfuirenlaconductamaterna(vase Captulo 10).
Finalmente, aunque la posibilidad de crear vnculos afectivos permanece a lo largo
detodalavida(Lpez,1999),elprimervnculosientaunprecedenteparalossiguientes.
Precisamente,muchasdelasinvestigacionesydiscrepanciasactualessobreelapegose
centranenlaestimacindesuinfuenciaenlasrelacionesafectivasfuturas
20
.
17
Recursosinteractivosmuybsicos,comoeldelaimitacinrefeja,puedenprolongarseeneltiempo,o
inclusorecuperarse,sielambientequerodeaalnioesmuydesfavorable.
18
Escomnquelasmiradasalamadreseagudicenenelcasodequeelnioseenfrenteaalgunanove-
dad. Este patrn, conocido como referencia social (vase Captulo 6), indica que para el beb la expresin
emocional del otro es una informacin muy valiosa de cara a esclarecer el peligro de la novedad (Source,
Emde,CamposyKlinnert,1985).
19
Herranz(2002)informadequeenestemomentolasmadresqueexplicanasushijoslasrazonesdesu
separacinyeltiempoquestavaadurarobtienenreaccionesmsserenas.
20
Entrelosvnculosafectivosadultosunomuyimportanteeselqueseestablececonlapareja.
Captulo 7. Desarrollo afectivo, emocional y social 171
4. Tipos de apego
Aunquelasrelacionesdeapegosedefnenporlaconfanza,laintimidadyladuracinen
eltiempo,yaenelprimervnculoafectivoseaprecianimportantesdiferenciasenfuncin
del grado de confanza que el nio deposita en sus fguras de apego. Este aspecto fue
desarrolladoporMaryAinsworth,cuyasindagacionescontribuyeronaldescubrimientoy
clasifcacindetalesvariaciones.
Sus avatares, personales y profesionales, llevaron a Ainsworth a realizar notables
cambiosderesidenciaque,encontrapartida,lepermitieronestudiarlasrelacionestem-
pranasendistintasculturasyenfuncindediferentescomportamientosmaternos.Como
resultado,Ainsworth(1967)proponeque,sibienentodaslasculturaslosniosmuestran
algntipodeapegohaciasuspadreshay,noobstante,diferenciasnotablesenelcarcter
queadopta.Finalmente,yaenBaltimore,Ainsworthycolaboradores(1978)diseanun
procedimientodeobservacinparaevaluarelgradodeseguridadqueelniodepositaen
lamadre.Esteprotocolodeobservacinseconocecomolasituacinextraaypermite
estudiarlasreaccionesdelosniosantediferentessituacionesamenazantes.Ensudise-
osejuegaconlosdosmotivosantagnicosque,paraAinsworth,eranelejedelapego:
labsquedadeproteccinylanecesidaddeexploracindelmedio.
Lapruebadelasituacinextraaconstadeochoepisodios,deunostresminutosde
duracin,enlosquemadreehijosonobservadosendiferentessituaciones.Laevaluacin
comienzaconlaentradadelaparejaenunasaladejuegosconfortableybienequipada.
Una vez all, se suceden diferentes episodios en los que, entre otros sucesos, la madre
dejasoloalnio,olodejaencompaadeunextrao.Estassituacionesdeseparaciones
yposterioresreencuentrosconlamadreoconunextraosonvaloradasdedistintama-
neraporcadabeb,enfuncindelacalidadysolidezdelvnculoconlamadre.
Tabla 7.2. Episodios en la situacin extraa de Ainsworth
Episodio Personas presentes Duracin Acontecimiento
Uno Madreynio 30segundos El experimentador introduce a la madre y al
nioenlasalayseva.
Dos Madreynio 3minutos Lamadresesientamientraselniojuegacon
losjuguetes.
Tres Madre,nioy extrao 3minutos Elextraoentra,sesientayhablaconlamadre.
Cuatro Extraoynio 3minutoso menos Lamadresevadelasala.Elextraoresponde
alasiniciativasdelbebytratadecalmarloen
elcasodequesteseenfade.
Cinco Madreynio 3minutosoms Lamadrevuelve,saludaalnioysiesnece-
sarioleconsuela.
Seis Niosolo 3minutosomenos Lamadresevadelasala.
Siete Extraoynio 3minutoso menos El extrao entra en la sala e intenta consolar
alnio.
Ocho Madreynio 3minutos Lamadrevuelve,siesnecesarioloconsuelay
trata de que el nio vuelva a interesarse por
losjuguetes.
172 Bloque II. El desarrollo temprano
Seconsideraqueunniotieneunapegosegurocuandodisfrutadelosjuguetesen
presenciadesumadre,perodetienesuexploracincuandoellaabandonalasala.Esfcil
observar que estos nios se alegran de la proximidad de la madre y que recuperan la
tranquilidadylaexploracincuandoellaregresa.Paramuchosestepatrnindicaquela
madreespercibidacomounabaseseguradesdelaqueexplorarelmundo.
Encambio,otrosniostienenactuacionessignifcativamentediferentesquerevelan
inseguridadenelvnculoafectivo.Entrelosapegosinsegurossesuelendistinguirdos
tipos
21
:apegoevasivoyapegoresistente.
Elapegoevasivooevitanteprcticamentesuponeelpatrninversoalapegoseguro.
A estos nios no parece causarles ansiedad la salida de la madre y tampoco tienden a
saludarlacuandoregresa.Portanto,sureaccinnoesmuydistintaalaquemuestranante
elextraoylosnicossignosexternosdeansiedadsurgencuandoselesdejasolos.
Finalmente,enelapegoresistente tambinconocidocomoambivalentelosni-
osexhibenunaltoniveldeansiedadinclusoencompaadelamadre.Suabandonode
lasalaescontestadocongritosyprotestas,ycuandoellavuelvesemuestranmuyenfa-
dados. Para los especialistas este comportamiento revela cierta ambivalencia entre una
tendenciaabuscarsuproximidadyotraopuestaarechazarla.
Tabla 7.3. Distribucin de los tipos de apego segn los estudios de Ainsworth realizados con
nios de clase media norteamericana
Tipo de apego Proporcin de nios
Reaccin ante la vuelta
de la madre
Seguro Seguro(0,65) Tiendeasaludarla
Inseguro Evitativo(0,20) Tiendeaignorarlaoevitarla
Resistente(0,15) Seenfadaconella
Durante ms de dos dcadas esta tipologa fue sufciente, pero la acumulacin de
datosllevaMainySolomon(1986,1990)adescribiruncuartotipodeapego,conocido
comoapegodesorganizadoodesorientado.Losniosqueseincluyenaqutienenuna
conductadifcildedescribir.Sucomportamientoesinestableycontradictorioynopare-
ceresponderaningunaorganizacinlgica.Estepatrnatpicoesmsfrecuenteennios
quehansufridoalgunaexperienciademaltrato.Secreequeeltemorylafaltadecohe-
renciaqueexpresanestosniosrespondealasreaccionesimprevisiblesyatemorizantes
deladulto.Detodoslosvnculos,pareceinnegablequeeltiposeguroeselqueexpresa
conmayorclaridadunequilibrioptimoentrelaexploracindelentornoylabsqueda
deseguridad.Asuvez,eselvnculoquemejorrefejalaconfanzadelnioeneladulto
y el que presenta mayores probabilidades de asociarse con una adecuada competencia
socialenelfuturo(Soufre,1997).
21
Convienematizarqueladistincinexpuestanoestlibrededebate.Algunospsiclogosopinanquela
nicadistincinverdaderamenterelevanteyntidaeslaqueseestableceentretenerunvnculodeapegose-
guroonotenerlo.Lasrestantesmatizacionesnoseranparaestosautoresunasuntodeterminante.
Captulo 7. Desarrollo afectivo, emocional y social 173
Noobstante,elsignifcadodelosdiferentestiposdeapegoylaformaenqueafectan
anuestroedifciopsicolgicosonasuntosencontinuainvestigacin.Porejemplo,Chis-
holm (1996) puntualiza que todos los tipos de apego podran interpretarse como res-
puestasadaptativas.Entendiendoquepodraestarjustifcadomantenersecercadeladulto
o,alcontrario,alejarsedel.Esdecir,ensegnqusituacioneslosapegosresistenteso
evitativospodranserlosmsadaptativos.
Igualmente,hayciertasdiscrepanciasenlainterpretacindelcomportamientoevitan-
te.Razonablemente,sehaplanteadoqueesteperflpodrarefejarciertacostumbrecon
lassituacionesdeencuentrosydesencuentrosynonecesariamenteunafaltadeconfan-
za(Clarke-Steward,1989;Thompson,1988).Recientementesehacuestionado,adems,
la impasibilidad inherente al tipo evitativo, destacndose, por ejemplo, que estos nios
respondenalamarchadelamadreconunaelevacincardiacasimilaralaqueobserva
enniosconapegoseguro(SpangleryGrossmann,1993)
22
.
Finalmente,hayquemencionarquelostiposdeapegoguardanrelacinconlasdis-
tintas culturas en que tiene lugar la crianza.As, por ejemplo, los bebs de sociedades
tradicionales,comosucedeenalgunasculturasasiticas,suelentenderaunapegosegu-
ro. En cambio, en algunas sociedades occidentales se promueve en mayor medida los
apegosevitativos,posiblementeenunintentodefomentar,desdetemprano,laindepen-
denciadelosmspequeos.Todoellopuedeserunbuenejemplodecmoelmacrosis-
tema (por ejemplo, el sistema socio-econmico o cultural) puede infuir en el mbito
familiar.
5. Factores que afectan a la formacin del vnculo
de apego
Losfactoresqueincidenenlarelacinmadre-hijoenlosdosprimerosaosdevidahan
sidootrorecurrentetemadeinvestigacin.Engeneral,sueleadmitirsequeelperfldel
bebinfuyeensucrianza,enespecial,cuandostepresentaalgnrasgoparticularein-
frecuente; por ejemplo, los bebs excepcionalmente apticos o los excepcionalmente
excitablessuelentenermayoresprobabilidadesdequesucuidadortiendaaignorarloso
aresponderconexasperacin.

Sinembargo,suelesostenersequeloscuidadoresdesem-
peanunpapelmuchomsdecisivo
23
.
Bowlby (1969) explicaba que, si bien madre e hijo aportan a la relacin variables
biolgicasytemperamentales,slolaprimeraincorporaelementosdesuhistoriaprevia,
sus valores culturales y sus expectativas sobre la crianza, atributos que hacen que su
comportamientoresultemsvariadoeimpredecible.ParailustrarestepuntoBowlbycita
elestudiodeMoss(1967)quienencontrqueelmodoenquelasmadresrespondenal
llantodelhijocorrelacionaconeltipodeideasysentimientossobrelacrianzaexpresados
tresaosantes.Igualmente,destacaelestudiodeDavidyAppell(1966),dondesedetec-
22
Estas discusiones ocurren porque no todos los signifcados de nuestra conducta son explcitos, y es
comnquealgunoscomportamientosseanmsfcilmentedescifrablesqueotros.Enestecaso,elapegose-
guro,ysusopuestosresistenteydesorganizado,parecenmsfcilesdeinterpretarqueelapegoevitante.
23
AunqueBowlbysiempreserefrialamadrebiolgica,hoysesostienequeestoesigualmentevlido
paracualquierpersonaqueasumalacrianzadelbebdeformaprincipal.
174 Bloque II. El desarrollo temprano
taquelosniossiemprerespondenalasiniciativasdesusmadresmientrasstascorres-
pondenonoalasprovocacionesenfuncindesupropiaidiosincrasia.
De forma notable los autores convienen en que son las relaciones marcadas por la
sensibilidaddeladultolasqueconducen,conmayorprobabilidad,aunvnculodeapego
frme(Ainsworthycols.1978;Bowlby,1969;Isabela,1995).Dichasensibilidadsere-
ferealahabilidaddeladultopararesponderdeformacontingenteyconlaintensidady
cualidadadecuadasalassealesydemandasdelbeb
24
.Trasmuchosestudios,estapa-
receserlamejorfrmulaparaqueelniopercibaasualrededorunambienteseguroy
acogedor.MarioMarrone(2001)sealabadeestaformalasrelacionesentreelvnculo
afectivoyelcomportamientodeladadamadre-hijo.
Cada patrn de conducta tiene patrones defnidos en la interaccin diaria ma-
dre-hijo. [...] La respuesta sensible que la madre ofrece de un modo continuo
durante el primer ao de vida del nio es el mejor predictor de la seguridad
del apego del nio en ese primer ao (Betherton, 1985; Smith y Pederson,
1988). Por otra parte, la actitud distante y la conducta de rechazo por parte del cuidador
(particularmente en cuanto al contacto corporal con el nio) predicen un patrn de conduc-
ta evitativo (Ainsworth y cols. 1978; Main y Stadtamn, 1981). Parece existir evidencia clara
de que los nios ambivalentes tienen madres inconstantes que tambin tienden a desalentar
la autonoma y la independencia. [...] Toda cuestin de los estilos parentales disfuncionales,
como determinantes del apego inseguro y de la psicopatologa, merece un estudio cuidado-
so. (Marrone,2001,p.56.)
Aunqueahoranospuedaparecertrivial,estaaportacincontribuyasacudirlaim-
portanciadealgunosmitoscomoeltipodealimentacinpechofrenteabiberno
laedaddeldestete.Segnloanterior,todaopcinesbuenasiemprequenosedescuide
lasensibilidadhacialassealesdelbeb.
Finalmente,merecesealarquecadadasonmslosestudiosqueseinteresanporla
relacindelosbebsconsuspadres,ascomoconotrasfgurasdecrianza.Enestesen-
tido,lasensibilidadesunarecomendacingeneralparacualquieraquesealafguraprin-
cipaldeapego.
6. Los elementos del vnculo de apego
El vnculo afectivo posee un marcado carcter emocional que despierta en nosotros
sentimientosdeconfanzaodesconfanza,deestimaodesestima,enfuncindecmo
hayamos percibido la relacin con las fguras de apego. Igualmente, la reaccin a la
prdidadelamadreoasuvueltaenlasituacinextraadeAinsworthsonejemplosde
lasdistintasmanifestacionesconductualesdelapego.Peroelvnculotambintieneun
24
Loanteriornoimplicaquenohayaerroresodesajustesenlainteraccin,msan,estospuedenfo-
mentarlahabilidaddelpequeoparareorganizarsuinteraccinyafrontarciertaincertidumbreofrustracin.
En este sentido, el objetivo fnal es que el beb, como balance, estime que sus iniciativas sociales llevan a
resultadosprevisiblesypositivos.
Captulo 7. Desarrollo afectivo, emocional y social 175
componente mental yquizporellomenosevidente. stesereferealaconstruccin
deunmodelointernoquerepresentalarelacinvinculanteyquerecoge,conespecial
importancia, el grado de confanza y disponibilidad que el beb ha percibido en los
otros.Bowlbydenominaestarepresentacinmodelointernodetrabajo(MIT).
Una caracterstica inherente a los modelos mentales es su capacidad para generar
expectativas sobre el futuro, as como para fltrar e integrar la informacin nueva. En
defnitiva,losmodelosmentalesayudanalnioadotardesignifcadoalarealidad.De
este modo, un modelo de apego seguro har creer al nio que la persona amada estar
siempreaccesibleyquesuayudaserincondicional.Encambio,enelpeordeloscasos,
unniopuedecreerquenomereceseramadoynotenerexpectativasdeayudasajenas
encasodenecesidad;porejemplo,GarcaTorres(2003)destacalamayorincidenciaen
nios maltratados o abandonados de modelos mentales errneos que incitan al nio a
culparsedeloscastigosmaternosodelosconfictosparentales.
Porfortuna,casitodoscoincidenenquelosmodelosinternossondinmicosyestn
encontinuocrecimientoenfuncindelasrelacionesafectivasquesetengan,loqueper-
miteciertafexibilidad.Noobstante,larepresentacinoriginaldelarelacinvinculante
actuar de base para futuras interpretaciones y su transformacin absoluta no ser un
asunto banal. La razn fundamental es que los modelos mentales tienden a operar de
modoinconsciente,loquesuponequelasinterpretacionesresultantespuedenestarses-
gadas,tendiendoaperpetuarunmodeloderelacindelqueelsujetonisiquieraescom-
pletamenteconsciente.Portanto,nopodemoshablardeundeterminismoabsolutodelas
experienciastempranas,peroquizsdeunprimersesgoenlaformadepercibirlasre-
lacionesconlosotros.
Eltrabajoconniosmaltratadosesunbuenejemplodeloquedecimos.Expertosen
eltemacoincidenenquelasnuevasexperienciasdefamilia,comoenelcasodelaadop-
cin,nosustituyendeformainmediataalaspasadas(Moreno,2006).Confrecuenciael
modelogeneradosobreelrechazodelotro,einclusosobreelabuso,estpresenteenel
nioquien,enmuchoscasos,desafayponeallmiteasunuevafamilia,afndeconfr-
marelmodeloderelacinqueleresultamsfamiliar.Elxitodelaadopcindepender
enbuenamedidadelaantigedadycualidaddelosmodelosiniciales
25
.
7. Estabilidad del vnculo de apego
Lapreguntasobreeldeterminismodelasexperienciastempranasnotieneunarespuesta
sencilla.Haynumerosasevidenciassobrelaestabilidaddelapegoenelsegundoaode
vida,ytambinseconfrmaqueenpoblacionesnormaleselapegosegurotiendeenma-
yor medida a la estabilidad que el apego inseguro.Ahora bien, ms all de esto, poco
puededecirsesinnecesidaddemuchasmatizaciones.
Para algunos, el primer apego suscita un modelo interno capaz de condicionar las
restantessituaciones.Enconsecuencia,esdifcilescaparaunmodoparticulardeentender
lasrelacionesyquebuscaeternamentesupropiaperpetuacin.Alternativamente,elape-
25
Enestemomentoseestllevandoacabounambiciosoestudiosobrelainfuenciadelasexperiencias
tempranasenlosmodelosinternosdeniosenacogimientoresidencialydeniosenadopcininternacional
(vaseRomnyPalacios,2006).
176 Bloque II. El desarrollo temprano
goesconsideradounsistemafexibleyadaptativo,capazdeacomodarsealasdiferentes
situaciones.Segnesto,losmodelosinternosderelacinsonmltiplesysonrevisados
continuamentedebidoalanecesidaddeadaptacinaunarealidadcambiante.
Curiosamente,ambasposturasencuentransulugarenlosdatos.As,aunque,como
mediael72%delosadultosmantieneelestilodeapegoqueconstruyenlainfancia,el
28% restante lo modifca en funcin de cambios signifcativos en sus vidas (Waters y
cols.2000).Portanto,lacontinuidadencontradapuedeatribuirsealanaturalezaestable
delvnculocasitantocomoaladelambiente.
Enestebailedefuerzas,Soufrehasidounodelosdefensoresdelmodelodeconti-
nuidad. Segnl,losniosconapegosinsegurostienenagenerarhostilidadenlosdems
lo que, con mucha probabilidad, incita a los otros a reaccionar con agresividad, confr-
mandoaselmodelooriginaldelnio.Alapar,losniosconapegosegurosuelenesco-
ger como compaeros a quienes confrman sus expectativas de apoyo mutuo, lo que
igualmenteperpetasumodeloderelacin(Soufre,1979).
El macroestudio longitudinal de Mineapolis (Soufre y Egeland, 1991) aport datos
querespaldabanestemodelo.Segnesteestudio,lospequeosquemanifestabanunape-
goseguroalosdoceodieciochomeseseran,aosmstarde,descritosporsusprofesores
comomsempticos,socialmentemscompetentesyconmsamigosqueaquellosque
tiempoatrsfueronclasifcadoscomoinseguros.Msan,elseguimientodealgunosde
estosniosmostrquelasdiferenciasseseguandandoenlapreadolescencia.
Enrealidadlosindiciosdecontinuidadenlosmodosderelacinsonmuchos,llegan-
doadarsecorrelacionesentreelapegoenlosprimerosaosyelestilodeapegoenlas
relacionesamorosas(vaseLpez,2006).Laacumulacindedatosqueaboganporcier-
tocontinuismohafomentadolateoradequelosniosconapegoevitativosernenel
futuroadultosdecontactofro,mientrasquelosniosambivalentessernconmayor
probabilidadadultosemocionalmenteinestables.Sinembargo,seraincorrectoquedarse
sloconestosdatosynoconsiderarotros.Sonmuchoslosestudiosqueencuentranque
lostiposdeapegocambianenfuncindeexperienciassignifcativas.
Lambysuscolaboradoresfguranenlalistadequienesenfatizanquecualquiercam-
bioqueafectedeformaseverayconstantealasformasderelacinpodrasucedersede
cambios en el apego de los hijos. De hecho, Thompson (1988) confrmaba que en las
clasessocialesmsbajashaymayoresprobabilidadesdequeelapegoseguromudehacia
formasinseguras,loqueseexplicaporlosmayoresriesgossocialesalosqueseenfren-
taestapoblacin.
Desdeestaposicintambinsedestacanlasevidenciassobrecambioseneltipode
apegotrasacontecimientosqueafectanalascondicionesdecuidadodelosnios,como
eldivorciodelospadres,elcambioderesidencia,lallegadadeunnuevohermano,etc.
A su vez, se da importancia al vnculo de apego que se establece con la pareja. Parece
probableque,sistaofreceunascondicionesdeconfanzaestables,unestiloderelacin
inseguro acabe mudando en favor de otro ms basado en la autoestima y la confanza.
Ante estos hechos, quiz la posicin ms sensata sea mantener cierto eclecticismo que
permita decantarse por un modelo u otro en funcin de variables como la intensidad y
duracindeunascondicionesadversas,laidiosincrasiadelapersonaolafrmezadelas
condicionesfuturas.Deestemodo,serposibleconsiderarqueelapegotiendeaseres-
table pero, a la vez, que es susceptible de cambiar si las condiciones as lo demandan
(Lpez,2006).
Captulo 7. Desarrollo afectivo, emocional y social 177
En cualquier caso, debemos concluir que las experiencias de fexibilidad no deben
servirpararebajarlaimportanciacrucialdelasvivenciastempranas.Aunquelosmodelos
afectivossedesarrollanyserposiblecrearnuevosmodosderelacinenelfuturo,todo
apuntaalaindudableimportanciadelprimervnculoafectivo.Estaevidencianosinvita
a refexionar de un modo crtico sobre la cualidad de las pautas de crianza y sobre la
posibilidaddefomentarmodelosdeactuacinbasadosenlasensibilidad.
Lecturas complementarias
Delval,J.(1978)(Comp.)Elapegocomoprimerarelacinsocial.EnLecturas de psicologa del
nio(Vol.1)(pp.317-386).Madrid:Alianza.
Enesco, I. (2003) (Coord.) El desarrollo del beb: cognicin, emocin y afectividad. Madrid:
Alianza.
Herranz,P.(2002).Eldesarrollodelapego.EnP.HerranzyP.Sierra(Eds.).PsicologaevolutivaI
(Vol.II).Madrid:UNED.
Marrone,M.(2001).La teora del apego: un enfoque actual.Madrid:EditorialPsimtica.
Actividades
1. Conteste a la siguiente pregunta
Segn Bowlby, la calidad de la relacin afectiva entre madre y nio depende:
a) De la cantidad de horas que el beb pase con la madre: a mayor nmero de
horas, mayor posibilidad de un vnculo de apego seguro.
b) Tanto de la capacidad de ajuste de la madre a las necesidades del nio, como
de las caractersticas de ste.
c) Bsicamente del temperamento del beb, que hace ms o menos difcil el
establecimiento del vnculo afectivo.
2. Relacionando sistemas en desarrollo
Tomando como eje el desarrollo el vnculo de apego, le pedimos que reexione sobre
los avances motores, perceptivos, comunicativos y afectivos. Es decir, partiendo del de-
sarrollo del apego, le pedimos que observe y extraiga alguna relacin entre los diferen-
tes sistemas en desarrollo.
3. Las fases del apego
Desde su conocimiento sobre el apego, intente estimar la fase o el tipo de apego que
se maniesta en cada uno de los siguientes ejemplos:
Caso 1. Una familia nos indica que su beb, de muy corta edad, se deja cuidar
por cualquier adulto que se muestre afable con l. Tambin nos dicen que se en-
cuentra ms cmodo en el saln de casa, donde se desarrolla la vida familiar, que
en el ambiente ms recogido y clido de su habitacin.
Caso 2. Una madre nos comenta que, segn su experiencia, dejar a su beb al-
guna ropa suya ayuda a que se sienta ms tranquilo en la cuna.
178 Bloque II. El desarrollo temprano
Caso 3. Una nia de tres aos de edad, acostumbra a bajar al parque con su pa-
dre, all se relaciona bien con otros nios, y slo busca a su padre en momentos de
riesgo o ante la necesidad de que su padre intervenga para darle explicaciones sobre
alguno de sus muchos descubrimientos.
Caso 4. Manuel y Alicia son una pareja consolidada que acostumbran a pasar
mucho tiempo juntos. Esta vez Manuel tiene que salir de viaje y Alicia lleva noches
desvelada e inquieta ante la posibilidad de que Manuel pueda conocer a alguien
ms atractivo que ella. Le cost mucho despedirse de l en el coche y continuamen-
te le llama al mvil. Pese a que Manuel nunca ha irteado con otras chicas, Alicia
est viviendo la separacin realmente mal.
Soluciones a las actividades
1. Pregunta
La opcin B es la correcta. Este enunciado recoge un aspecto subrayado por Bowlby. La
opcin A no es correcta por tratarse de un argumento meramente cuantitativo. El ma-
yor o menor tiempo pasado con el beb no asegura que la interaccin con el adulto sea
adecuada. Es decir, esta opcin no informa de cmo se articula la relacin ni de si el
adulto es sensible a las seales del beb. Por ltimo, la alternativa C no es correcta por
incidir en el peso otorgado al beb cuando, an reconociendo la responsabilidad de
ambos, se atribuye ms poder al adulto.
2. Relacionando sistemas en desarrollo
Conviene sealar que la formacin del vnculo de apego sucede pareja y armnicamen-
te en relacin a los desarrollos de otros sistemas, como el motor o el perceptivo. En este
sentido se advierte una relacin inversa entre la edad del beb y la aceptacin del cui-
dado de otras personas. Es decir, en los momentos ms comprometidos para la super-
vivencia el beb acepta los cuidados de prcticamente cualquier adulto. De forma dis-
tinta, para cuando se inician los primeros desplazamientos autnomos (por ejemplo, el
nio comienza a andar), los sistemas comunicativos y afectivos se han perfeccionado lo
suciente como para que la comunicacin ya sea intencional y tridica y para que ya
haya una persona que se considera una base segura desde la que explorar el mundo.
En denitiva, diferentes sistemas avanzan de una forma ordenada y conjunta, que bus-
ca en todo momento una adaptacin ptima a las circunstancias externas.
3. Las fases del apego
Caso 1. La informacin proporcionada indica que el nio podra encontrarse en las
fases uno o dos de la formacin del apego. El pequeo an no tiene una preferen-
cia social muy marcada y simplemente disfruta de los entornos donde no se encuen-
tra solo.
Caso 2. El ejemplo pone de maniesto un fenmeno comn en el vnculo afectivo:
el reconocimiento privilegiado de los rasgos ntimos de la gura de apego como
su olor o el sonido de sus pisadas. Si alguno de estos rasgos ya puede apaciguar
una situacin, posiblemente el vnculo que se est formando sea de tipo seguro.
Captulo 7. Desarrollo afectivo, emocional y social 179
Caso 3. Es un ejemplo prototpico de un comportamiento seguro. La nia se siente
conada para explorar y slo cesa en su labor cuando necesita consejo.
Caso 4. Los apegos en los adultos tienen caractersticas particulares. No obstante,
en muchos aspectos el vnculo con la pareja recuerda al vnculo con los progenitores
y, en este caso, a un vnculo inseguro resistente.
LA PRIMERA
INFANCIA:
DE LOS TRES
A LOS SEIS AOS III
BLOQUE
En este bloque vamos a abordar la primera infancia, que comprende el actual segundo ciclo
de Educacin Infantil y abarca el desarrollo entre los 3 y los 6 aos. Comenzaremos tratando
de explicar los avances que se producen en el pensamiento infantil en estas edades y para
ello nos apoyaremos en la etapa preoperatoria descrita por Piaget. A continuacin dedicare-
mos un captulo exclusivo a la adquisicin de una herramienta fundamental para el desarro-
llo del ser humano: el lenguaje. Ya hemos visto los inicios de la adquisicin de esta capacidad
pero en esta etapa es cuando realmente se produce el despegue y la gran evolucin del
lenguaje. Por ltimo, abordaremos los aspectos relacionados con el mundo social, es decir,
todos aquellos mbitos de la vida del nio en los que los otros son parte fundamental. As
pues, aspectos como las relaciones con los dems, las emociones o el razonamiento moral
sern tratados en este ltimo captulo del bloque.
SUMARIO
CAPTULO 8. El desarrollo del pensamiento
1. El nio pequeo en la teora de Piaget
2. El nio pequeo en la teora de Vygotski
3. La teora de la mente
4. Conclusiones
CAPTULO 9. El desarrollo del lenguaje oral
1. El desarrollo de la forma del lenguaje durante la primera infancia
2. El desarrollo pragmtico y las habilidades para narrar
182 Bloque III. La primera infancia: de los tres a los seis aos
3. Las relaciones entre el pensamiento y el lenguaje desde la perspectiva evolutiva
4. Cmo se explica la adquisicin del lenguaje: modelos lingsticos innatistas y
explicaciones constructivistas
5. Aprender el lenguaje en contextos bilinges
CAPTULO 10. El mundo social
1. El desarrollo del yo
2. El mundo emocional y afectivo
3. Las relaciones con los dems
4. El juego
5. La identidad de gnero
6. El pensamiento moral
El desarrollo
del pensamiento
183
8
BEGOA DELGADO EGIDO
M. NGELES GARCA NOGALES
Esquema resumen
Objetivos
Introduccin
1. El nio pequeo en la teora de Piaget
1.1. Los rasgos del pensamiento preoperatorio
1.2. Algunas limitaciones de la teora de Piaget
2. El nio pequeo en la teora de Vygotski
3. La teora de la mente
3.1. La atribucin de creencias falsas
3.2. Habilidades mentalistas anteriores a la comprensin de creencias falsas
4. Conclusiones
Lecturas complementarias
Actividades
Soluciones a las actividades
184 Bloque III. La primera infancia: de los tres a los seis aos
Esquema resumen
1. El nio pequeo en la teora de Piaget
La teora de Piaget describe el perodo de dos a seis aos como una etapa marcada por
el uso de la funcin simblica y la carencia de un pensamiento lgico y reversible. En
consecuencia, la infancia aparece como un perodo cualitativamente diferente al pero-
do sensoriomotor o al siguiente, marcado este ltimo por la posibilidad de realizar ope-
raciones mentales.
Segn Piaget, el nio pequeo es un ser inteligente y constructivo, pero en su in-
tento de comprender la realidad acabar por imponer sus esquemas de modo super-
cial, sin realizar un verdadero esfuerzo por organizar sus pensamientos conforme a las
leyes de la lgica.
2. El nio pequeo en la teora de Vygotski
El trabajo de este autor es un perfecto contrapunto al de Piaget. Es notable la elegancia
con la que Vygtoski nos indica cmo, por medio del lenguaje egocntrico, el nio se
hace consciente de sus procesos mentales y adquiere un mayor control de su conducta.
El aspecto ms destacado de este trabajo es la claridad con la que nos muestra la in-
uencia decisiva de la cultura y de los instrumentos de comunicacin en el desarrollo
de nuestras formas de conciencia.
El vnculo que Vygotski establece entre el lenguaje y la emergencia en el nio de
una conciencia verbal es de profunda actualidad y, sin duda, la autorregulacin por
medio del lenguaje es uno de los logros ms importantes del perodo que nos ocupa.
3. La teora de la mente
El perodo de los 3 a los 6 aos se ha identicado con una creciente comprensin de la
naturaleza de las personas como seres que mantenemos estados mentales sobre la rea-
lidad, como son los deseos, las creencias, cuya atribucin a uno mismo y a los dems
permite dar sentido a la accin humana.
Hacia los 4-5 aos, las habilidades mentalistas del nio incluyen la comprensin de
las creencias falsas, momento que se ha considerado como crtico en el desarrollo de
su teora de la mente. Hacia los 6-7 aos, adems de comprender que nuestros estados
mentales pueden representar de manera falsa la realidad y que son representaciones las
que guan nuestra conducta, van a entender que los estados mentales pueden repre-
sentar a su vez otros estados mentales.
Con anterioridad a estos desarrollos, entre los 3 y 4 aos, se ponen de maniesto
habilidades relacionadas con la comprensin de otros estados mentales, como son los
de deseo.
Objetivos
Conocer la teora de Piaget sobre el desarrollo intelectual entre los 2 y los 6
aos, con especial atencin a los logros y limitaciones lgicas que propuso este
autor.
Reexionar sobre la delicadeza de los procesos intelectuales y la necesidad de
adecuar al mximo los instrumentos de medicin al objeto de estudio.
Conocer el papel del lenguaje en la autorregulacin segn la teora de Vygotski.
Captulo 8. El desarrollo del pensamiento 185
Introduccin
Losniospequeostiendenasorprendernosconunagranvariedadderespuestasyrazo-
namientos.Aveces,tratanlosacontecimientosdesdesupropiopuntodevistaresultndo-
nosalgosimplistasyexcesivamentepersonalesensusexplicaciones.Pero,enocasiones,
tambinsoncapacesdesorprendernosconargumentosdeunaenormelucidez,oconre-
cuerdosquenoesperbamosquepudiesenrecuperar.Naturalmente,paracomprendereste
amplioabanicodecomportamientosesnecesariorecurriramsdeunaaproximacinte-
rica.Nosotrosempezaremosconlateoraquemsinvestigacinydatoshagenerado;nos
referimoslgicamentealateoradeJeanPiaget.Suingenteobranospermitiracercarnos
deunmodoamplioalpensamientoinfantil,sibien,debemosadvertirqueestaaproxima-
cintiendeaminimizarloslogrosintelectualesdelosniosdeentredosyseisaos.
ParaPiaget,laetapaquenosocupavienemarcadaporelconfictoentrelastendencias
msindividualesysimblicasdelpensamientoinfantilyaquellasotrasmssocializadas
ylgicasqueapenasseestnestableciendo.Enconsecuencia,elautordefneelrazona-
mientoinfantilporelusodelossmbolosylafjacindelnioensupuntodevistasub-
jetivoyparticular.Deestemodo,elllamadoegocentrismointelectualimpregnartoda
la mentalidad infantil, afectando de modo esencial al razonamiento y la comunicacin
hastalossieteuochoaos.
LaperspicazmiradadePiagetnoimpidequealgunosvacoslgicosimputadosalos
niosresultenatenuadoscuandolastareasycontextosdeevaluacinsepresentandeun
modoatractivoyrelevante.Elretratopiagetianodelainfanciaes,enestesentido,con-
secuenciadirectadelaexigenciaconlaquePiagettratlashabilidadesquesepropuso
investigar; un estilo severo y concienzudo, que arrastr tanto en las tareas como en el
anlisis de las respuestas. En cualquier caso, las limitaciones atribuidas a la teora de
Piagetnolainvalidancomomarcoineludibleparacualquieraqueseacerquealestudio
deldesarrollohumano.
Un segundo bloque del captulo abordar el desarrollo infantil desde la perspectiva
deLevVygotski.Supticasitalainfanciaenelmarcodeunentornosocialycomuni-
cativo,delqueelnioextraelosconocimientoseinstrumentos,enespecialellenguaje,
queharnposiblesupropiaregulacin.Laetapadedosaseisaosesclaveenestepro-
cesodecrecimientoindividual.
Finalmente,dedicamosunltimoapartadoaldesarrollodelacomprensinmentalis-
ta.Lacapacidadparatratarconentidadesmentales,comopensamientosoactitudes,su-
pone un problema intelectual de indudable calado. Los estudios de teora de la mente
Reexionar sobre las diferentes maneras de enfocar el desarrollo humano, repa-
rando en los aspectos que se ponen de maniesto segn la perspectiva de traba-
jo que se adopte.
Entender la teora de la mente como una capacidad que se adquiere de manera
progresiva.
Conocer las principales habilidades mentalistas que se desarrollan durante la eta-
pa de 3 a 6 aos.
Conocer los procedimientos de evaluacin paradigmticos en la investigacin
sobre la adquisicin de la teora de la mente.
186 Bloque III. La primera infancia: de los tres a los seis aos
pondrndemanifestoque,sibienlacomprensindelosestadosmentalessealargaen
eltiempo(veremostareasmentalistasdedistintadifcultad),entrelos4y5aossesu-
peraunaimportantebarreraevolutivaqueimpidealnioentenderquecadapersonatie-
nesusrepresentacionesdelarealidadyconfaenellastantocomolenlassuyas.
Ensuma,enestecaptulo,trataremosalgunosdelosprincipalesaspectosquesehan
estudiado en el nio como su capacidad lgica, su uso del lenguaje egocntrico y su
comprensin de s mismo y de los otros. Nos limitamos a presentar estos mbitos sin
pretenderserexhaustivos,nienlosejemplosnienlostrabajosreseados.Nuestroobje-
tivo,simplemente,eseldeacercarallectoralgunosdelostrabajosmsclsicosorepre-
sentativosdeestastreslneasdeinvestigacinque,porsupuesto,noagotannilaspregun-
tas ni los procedimientos que continuamente se desarrollan en torno a la inteligencia
infantil.
1. El nio pequeo en la teora de Piaget
EnlateoradePiagettodaformadeinteligenciasurgedesdelasaccionesprcticasdel
beb quien, segn el autor, es capaz de gestionar su adaptacin al entorno ayudado de
dos mecanismos fundamentales: la acomodacin y la asimilacin. En consecuencia, la
funcinsimblicaquecaracterizaralosniosdeentredosyseisaos,tambinprovie-
nedelaaccin,enestecaso,delaaccinimitativa
1
.SiguiendolaspalabrasdeMandler
(1983),conelnacimientodelasimgenesseconseguiraqueunnio,ademsdepoder
caminarsobreunalnearectapudieseimaginarla
2
.Enpocaspalabras,latrascendenciade
estanuevaetaparesideenlacapacidadparanegociarnosloconlosaspectospercibidos,
sinotambinconlosimaginados.
Laconquistadelafuncinsimblicahacequeseanposiblesnuevoscomportamientos
comoeljuegodefccin,laimitacindiferida,eldibujooellenguaje,quemarcanun
modocualitativamentedistintodeentenderyrelacionarseconlarealidad.Ahora,elnio
puede entender que un objeto sigue existiendo aunque no lo perciba ni vea (nocin de
permanenciadelobjeto
3
)oqueesposibleutilizarunobjetorealconlaspropiedadesde
otroquesloexisteenlamentedelnio(porejemplo,jugaraqueunpltanoesunte-
lfonojuegodefccin).Esdecir,esposiblejugarconlossignifcados,alterandolas
propiedadesdeloreal(vaseCaptulo10).Igualmente,eldibujoserotroejemplonoto-
riodelsimbolismodeestaetapa.
Encontrapartida,Piagetdestacaqueelnioqueacabadeaccederalafuncinsim-
blicaestaprisionadoenunarefexincentradaenelyodondelospuntosdevistade
los otros no se entienden, donde es difcil separar lo objetivo de lo subjetivo, y donde
dominaelprincipiodelplacersobreelderealidad.Esteaspectolimitadorycentristafue
1
Segn Piaget, las primeras representaciones mentales son imitaciones interiorizadas. Esto supone que
laimitacinseharitualizadotantoquehaconseguidoquelosmovimientosexternosserealicenenunplano
interno,enunarepresentacinquenorequieredelaaccin(vaseCaptulo5).
2
Al igual que otros autores, Mandler crea que la funcin simblica tena que emerger necesariamente
antesdeloprevistoporPiaget.
3
Recordemosqueestanocincomienzaadesarrollarsemuytempranamente,peroessloalos24meses
cuando,segnPiaget,podemosasegurarqueparaelniolaexistenciaopermanenciadelosobjetosestotal-
menteindependientedesuacciones(vaseCaptulo5).
Captulo 8. El desarrollo del pensamiento 187
abordadoporPiagetenvariasdesusobrascomoEl juicio y el razonamiento en el nio
(1924/72),La representacin del mundo en el nio(1926/84)oLa causalidad fsica en
el nio(1927/34)
4
.
EllargoperodoquenosocupaesdivididoporPiagetendossubperodos:laetapa
preconceptual (de los dos a los cuatro aos) y la etapa intuitiva o transicional (que se
inicia hacia los cinco aos). La primera se caracteriza por un creciente empleo de los
signos,sibien,elnioanestmuylejosdepoderoperardemodolgico.SegnPiaget,
elnioestmuycentradoensupuntodevistaydemuestraunanotabletendenciaade-
formar la realidad. Prueba de ello son sus explicaciones sobre la realidad, que apenas
denotandistincinentrelofsico,lomentalolosocial
5
.Demododistinto,enlasegunda
etapaelniocomienzaaentenderotrospuntosdevistaaunqueannocompletamen-
teyadquiereunamejorcomprensindelasleyesquerigenenlosdiferentesdominios
delarealidad,porejemplo,entenderquelasleyesfsicassonindependientesdelasleyes
moralesoquenoesposibleatribuirconcienciaeintencionesaobjetosinanimados.Sin
embargo,nisiquieraenestaetapaelniosercapazderealizaroperacionesmentales
bsicas (vase Captulo 2); aunque se aprecia un avance importante hacia el siguiente
perodo(delasoperacionesconcretas).
1.1. Los rasgos del pensamiento preoperatorio
ComoyahicieseRousseau,Piagetdefendiqueelnionoesunadultoenpequeo.Se-
gnl,elniodeentredosyseisaosnobuscalaverdadsinoelplacer,oloqueeslo
mismounaexplicacinquelesatisfagadeformainmediata.Estacaractersticaseagrava,
anms,porlaseguridadqueelniodepositaensusjuicios.Comosealaelautor,lo
primeroqueimpresionaenunniomenordesieteuochoaosessuseguridadextrema
entodo.Cuando mostramos a un sujeto de 4-5 aos, [...] dos cajitas del mismo volumen,
y le preguntamos cul es ms pesada?, el nio responde de entrada esa, sin haber
siquiera sopesado las cajas! Y lo mismo para todo. (Piaget,1972,p.155).
Piagetopinabaquelaexperiencia,porsmisma,nodesengaaalosnios,quienes
compensanconlaimaginacinlascontradiccionesolagunasenqueincurrensusexpli-
caciones.Debidoaesto,unarealidadquedesafasecontinuamentesusexplicacionesno
harasinopotenciarsuimaginacinhastaeldelirio.Comoalternativa,Piagetcreaque
eraunanecesidadsocialloqueimpulsaalnioaverifcarsupensamiento.Enconcreto,
eraeldeseodecompartirunargumentoloquegeneraraenelnioladudaylanecesidad
decomprobacin.Dehecho,Piagetllegadefnirelrazonamientolgicocomounadis-
cusinconnosotrosmismosquereproduceinteriormentelosaspectosdeunadiscusin
real.
4
EsteplanteamientoeracongruenteconlastesispsicoanalticasalasquePiageteramuysensible.Segn
stas,lasprimerasformasdepensamientoestaraninclinadashacialaintrospeccinyelprincipiodeplacer
para,mstarde,acercarsealalgicayelprincipioderealidad.Engeneral,laideadequeelsujetoesprime-
ramenteunserbiolgicoeindividualy,slomsadelante,unsercultural,hasidomuyaceptadaenpsicologa,
sibien,desdehaceunasdcadasestsiendoseriamenterevisada.
5
SegnPiaget,elpensamientodelnioenestaetapaseparecemuchoaldelsensoriomotor.As,aunque
el nio preoperatorio es capaz de representar sus acciones, an no realiza operaciones mentales por lo que,
comoelniosensoriomotor,actaabasedeensayoyerror.
188 Bloque III. La primera infancia: de los tres a los seis aos
Es la necesidad social de compartir el pensamiento de los dems, de comunicar
el nuestro y de convencer, lo que est en el origen de nuestra necesidad de ve-
rifcacin: La prueba ha nacido de la discusin. (Piaget,1972,p.156.)
Perodichadiscusinylaconsiguientebsquedadelaverdadencuentranenelego-
centrismoinfantilunfuerteescollo.SegnPiaget,elniotieneimportantesdifcultades
para ponerse en el punto de vista del otro, por lo que comprender a un interlocutor o
transmitir una idea de forma adecuada, se convierten en tareas casi imposibles (vase
Figura 8.1)
6
.
El egocentrismo al que se refere Piaget seguir manifestndose hasta el fnal de la
primerainfancia.Pruebadeelloesladifcultadquemanifestanlosmenoresdesieteaos
para establecer una comunicacin en la que se expliquen y entiendan las opiniones de
todos los interlocutores. Asimismo, las difcultades para entender y hacerse entender,
acarrean,segnPiaget,unaleveconcienciadelospropiosprocesosmentales,yaque:En
la medida en que piensa para s mismo, el nio no tiene, en efecto, ninguna necesidad
de cobrar conciencia de los mecanismos de su razonamiento(Piaget,1972,p.162).
Lafuertetendenciadelnioaasimilarlarealidadalpropiopuntodevista,erapara
Piagetunacaractersticatansobresalienteque,prcticamente,explicabatodoslosdems
rasgosdelainteligenciainfantildesdelos2alos6aos.
Hemos tratado de remitir al egocentrismo infantil la mayora de los caracteres
de la lgica del nio. (Piaget,1972,p.155.)
Enrelacinconloanterior,losniosdeestaetapapresentandifcultadesparaenten-
dernocionesrelativas,esdecir,conceptosquerequierenconsiderardospuntosdevista
personales. Por ejemplo, aunque el nio pueda decirnos cuntos hermanos tiene, quiz
nopuedadecirnoscuntoshermanosyhermanastienensushermanos,yaqueelhecho
dequelseahermanodesushermanosnoimplicalocontrario
7
.
Igualmente,Piagetdefneelpensamientoinfantilcomocentrado,loquesignifcaque
elniodifcilmentepuedeconsiderarvariosaspectosdeformasimultnea.Porejemplo,
aunniolecostarentenderquesusabuelosson,adems,loshermanos,tosopadres
deotraspersonas
8
.Muchasdeestasdifcultadesseponendemanifestoenlasconocidas
6
ElegocentrismoalquesereferePiagetesdetipointelectualynotienelasconnotacionesdevolunta-
riedadoegosmoquerecibeenlaterminologapopular.
7
Segn Piaget, las difcultades para invertir un proceso tambin se relacionan con un modo de operar
excesivamente inclinado a la asimilacin. Segn esto, el nio tiende a deformar toda informacin a la que
aplicaunesquemaantiguo,llegandoadestruir,incluso,elpropioesquemaaplicado.Estaasimilacindefor-
mantehaceimposiblevolversobrelospasosdadosy,sinlareversibilidad,elpensamientodelnioesincapaz
deoperacioneslgicas.
8
Como veremos en los ejemplos de yuxtaposicin, al nio tambin le costar entender que un objeto
puedeformarpartedevariascategoras;esdecir,lainclusindeclases.
Captulo 8. El desarrollo del pensamiento 189
tareaspiagetianasdelaconservacin,cuyaprincipaldifcultadresideendistinguirun
cambio aparente de uno estructural. Por ejemplo, si mostramos a un nio pequeo dos
vasosidnticosyconlamismacantidaddelquidoy,delantedel,vertemoselconteni-
dodeunodeellosenuntercerrecipientemsestrecho,probablementeelniocreerque
hacambiadolacantidad,porejemplo,dirquehaymsliquidoenelvasomsestrecho,
porqueahelnivelsubems.Esdecir,aunqueesevidentequenosehaaadidoniseha
La tarea de las tres montaas
Piaget estudi la toma de perspectivas mediante la prueba de las tres montaas. En esta
tarea se sienta al nio frente a una maqueta en la que hay varias montaas y se le
muestran diversas fotografas tomadas desde distintos ngulos. Su labor consiste en
discriminar qu fotografas muestran lo que l ve y qu otras lo que vera una persona
sentada en frente. Por lo general, los nios de esta etapa tienen problemas para distin-
guir su punto de vista del de los dems. No obstante, algunos estudios muestran que
cuando la tarea resulta ms relevante, la perspectiva visual del otro se adopta antes de
lo previsto por Piaget (ver apartado 1.2)
Figura 8.1.
Tareas de las tres monta-
as (tomada de Dickinson
1984/1991) en A. Coral
y P. Pardo (2001).
190 Bloque III. La primera infancia: de los tres a los seis aos
quitadonada,elniopensarquelacantidadhavariadoguiadoporlaaparienciadelos
elementosquecompara.
Latareadescritaseconocecomolaconservacindellquidoodelacantidadcontinua
yladisePiagetprecisamenteparainvestigarlacapacidadlgicadelosnios.Como
sealaelautor,antesdelosseisaoslosniossuelencentrarsuatencinsloenelnivel
dellquido,sinconsiderarlaformadelosrecipientes(centracin).Igualmente,suactua-
cinrevelalairreversibilidaddesupensamiento,yaqueelnionoinfereque,devuel-
to el lquido al recipiente original, el nivel volver a igualarse. Es decir, es incapaz de
invertirunprocesoorealizarunaoperacinlgica(vase Figura 8.2).
Nmero Cantidad continua Longitud Masa Peso
Igualdad inicial
Transformacin
Estado final
Pregunta de
conservacin
Peticin de
explicacin
Tienen las dos
filas el mismo
nmero de bolas
o una fila tiene
ms bolas que
la otra?
Tienen los dos
vasos la misma
cantidad de agua
o un vaso tiene
ms agua que
el otro?
Son los dos
palos igual de
largos, o un
paso es ms
largo que
el otro?
Tienen los
dos objetos la
misma cantidad
de arcilla, o
uno tiene ms
que el otro?
Pesan igual
los dos objetos,
o uno pesa ms
que el otro
Por qu
piensas eso?
Por qu
piensas eso?
Por qu
piensas eso?
Por qu
piensas eso?
Por qu
piensas eso?
Figura 8.2. Ejemplos de tareas de la conservacin (tomado de Vasta y cols. 1992/96, p. 314),
en A. Corral y P. Pardo (2001).
Las difcultades lgicas se refejan tambin en las explicaciones infantiles. Segn
Piagetmuchasdeellasdenotanunayuxtaposicindeargumentos,endetrimentodelas
esperadas relacin de inclusin o exclusin que permitiran entrever una jerarqua de
premisas.Veamosesteaspectoconunsilogismoquefuepresentadoaniosdedistintas
edades.Algunos habitantes de la ciudad de Saint-Marcel eran bretones. Todos los bre-
tones de la ciudad de Saint-Marcel fueron muertos en la guerra. Quedan habitantes en
Saint-Marcel?(Piaget,1972,p.169).SegnlosdatosdePiaget,unabuenapartedelos
niosde10y11aosconcluanqueyanoquedabanhabitantesenSaint-Marcel,esdecir,
norealizabanunaintegracinointerseccincorrectaentredosargumentosque,eneste
Captulo 8. El desarrollo del pensamiento 191
caso, se relacionan en trminos del todo y la parte. Para Piaget la yuxtaposicin es un
atributocomnamuchosyvariadoscomportamientos.Porejemplo,lamismaseravisi-
bleenellenguajedonde,segnl,seproduceunabusodelaconjuncinyendetri-
mentodeconectoresqueexplicitanlarelacinjerrquicaentrelaspremisascomopor-
que o despus. Igualmente, este rasgo tambin estara presente en el dibujo. As,
creyquemientraslosniosnoconociesenlarelacincorrectaentrediversosaspectos
delarealidad,sudibujodelosmismosserainconexo;porejemplo,conindependencia
delapericiatcnicanoseraposibledibujarcorrectamenteunabicicletasinconoceran-
tessumecanismo.SegnPiaget,detallescomoelpin,lacadenaolospedalespodran
noaparecerohacerlosincontactoentres(yuxtapuestos).
Enparalelo,Piagetdescribeelpensamientodelniocomosincrtico,oloqueeslo
mismo,inclinadoaconcebirlarealidaddeformaexcesivamenteinterconectadayglobal.
Esterasgodisponealnioaexplicarunosacontecimientosenfuncindeotrosquesim-
plementeco-ocurren,comosiloshechosquesucedenjuntosseimplicasenrecprocamen-
te.Porejemplo,unniopuedeexplicarqueelsolnosecaeporqueesamarilloycalien-
tao,preguntadoporqusubeelniveldelaguaalponerunapiedraenelvaso,puedecreer
queelloesdebidoaquelapiedraesdura.Endefnitiva,susexplicacionesremitenaunos
caracteresdelfenmeno(porejemplo,elcolordelsol)larazndeserdeotros(porejem-
plo, la suspensin del astro). Segn Piaget, la yuxtaposicin no es incompatible con el
sincretismo ya que, en ambos casos, la clave est en la ausencia de una comprensin
profunda y lgica de la realidad.Asimismo, aadi que el sincretismo era un producto
ms del egocentrismo intelectual; sosteniendo que la tendencia egocntrica del nio le
conduceapercibirlarealidaddeestapeculiarformaenlaquetodoestindefectiblemen-
teconectado.Elegocentrismoinclinaraalnioa:
...ignorar los enlaces objetivos en provecho de los subjetivos, imponer esque-
mas arbitrarios a las cosas, asimilar incesantemente las experiencias nuevas a
esquemas antiguos, en suma a reemplazar la adaptacin al mundo exterior por
la asimilacin al yo. El sincretismo es la expresin de esa asimilacin perpetua
de todas las cosas a esquemas subjetivos y esquemas globales e inadaptados.(Piaget,1972,
p.172.)
Las insufciencias lgicas del nio han llevado a describir su pensamiento como f-
gurativo,esdecir,basadoenlosrasgossuperfcialesycambiantesdelarealidad.Lgi-
camente,estacaractersticaeselorigendemltiplesconfusionesascomoderepresen-
tacionesdelarealidadcualitativamentedistintasalasdeladulto.Piagetanalizalgunas
de estas construcciones a travs de concienzudas preguntas que pusieron en evidencia
importantesconfusionessobrelosdistintoshechosdelanaturaleza.Porejemplo,consul-
tados por las diferencias entre lo interno y lo externo, mediante cuestiones como: se
puede tocar el pensamiento?, dnde estn los sueos?, o dnde se encuentra lo
que sueas?,muchosniosmenoresdesieteaoscontestabanatribuyendoalointerno
lopsquicolasmismaspropiedadesvisiblesytangiblesdelosfenmenosexternos.
Deestemodo,notenanproblemasenubicarelpensamientoenlabocaolossueosen
lahabitacin,otorgandoasidentidadmaterialafenmenosquenolatienen.Estacon-
192 Bloque III. La primera infancia: de los tres a los seis aos
fusininfantilseconocecomorealismoysemanifestatambinenlafaltadedistincin
entrelossignifcantesylossignifcados.Porejemplo,muchosnioscreenquelosnom-
bresdelascosas(lossignifcantes)provienendelascosasmismas,esdecir,sonintrn-
secosaellas.Porejemplo,antelapregunta:cmo la gente pudo saber que sol se llama-
ba de esta manera?,algunosdelosniosentrevistadoscontestaronporque podan ver
que era redondo y caliente o preguntados sobre el nombre de las nubes contestaron:
porque podan ver que eran grises; ensuma,losniosactuabancomosielnombrede
lascosas(unatributoexternoyarbitrario)fueseunapropiedadmsdelasmismas.
Tambinsehaobservadoquelosniosatribuyenpropiedadesbiolgico-psicolgicas
comointenciones,conciencia,sensacionesysentimientosalarealidadinanimada.
Enestesentido,algunosniosconfesaronaPiagetqueelsolsabaquesellamabasolo
queelvientosabaquesoplaba.Engeneral,lasrespuestasqueobtuvoindicabanqueel
niotiendeahumanizartodoaquelloquetienemovimiento,comolasombraounahoja
mecidaporelviento.Estatendenciaaextenderlosrasgosdelavidahumanaaobjetosy
hechosfsicosseconocecomoanimismo.
La tendencia animista no es incompatible con otra de las caractersticas que Piaget
atribuye al pensamiento infantil: la inclinacin a concebir los hechos de la naturaleza
comoproductosdelaaccinhumana;msconocidacomoartifcialismo.Deestemodo,
el nio puede creer que el sol o la luna han sido hechos por alguien, o que alguien ha
hecholoslagosexcavandoorifciosyrellenndolosconagua.Curiosamente,todoellono
esincompatibleconquemstardelosastrosuotrosfenmenosfsicostenganconciencia
yvidapropia.
Porltimo,debemosinsistirenquemuchosdeestosrasgosinfantiles,tienensuclave
de salida en la comunicacin con un otro. Hay que recodar que, segn Piaget, slo el
confictoconlospuntosdevistaajenosliberaralniodesuegocentrismo.Sinembargo,
susobservacionesenlaescuelainfantilLacasadelospequeosrefejabanlasgraves
limitacionesinterpersonalesdelosnios.Concretamente,entrelostresycincoaos(cer-
canosalperodopreconceptual)lasmanifestacionesegocntricas,estoes,intilesdesde
unpuntodevistainteractivosesituabanentreel54%yel60%deltotaldelasregistradas.
Aunqueesteporcentajedisminuaentrelos5y7aos(perodointuitivo),endichaseda-
des el habla egocntrica an capturaba entre el 44% y el 47% del habla del nio. La
llamadahablaegocntricacorrespondamayoritariamenteasoliloquiosoamonlo-
goscolectivosdondelosnioshablanenvozaltaperosinprestarseatencinniatender-
seentres.SegnPiaget,suegocentrismolesllevaasentirsecomprendidosporlosdems
casideformaautomtica,porloqueprescindendetodoesfuerzoporhacerseentender.
No slo los nios creen que se hablan los unos a los otros y que se escuchan
efectivamente, sino que tienen una tendencia a admitir que cada uno de sus
pensamientos es comn a todos, que todos pueden leerlo y comprenderlo sin que
sea siquiera necesario expresarlo distintamente. (Piaget,1972,p.158.)
Para el autor ginebrino, el egocentrismo oculta al nio la necesidad de entender y
hacerse entender, generndole la ilusin comunicativa de ser automticamente com-
prendido.Sinembargo,enelplanoreal,elnioestfuertementeaisladodelosotrosy
Captulo 8. El desarrollo del pensamiento 193
sumidoenestadodesemi-inconsciencia,muylejosandeungenuinointercambiode
opiniones.
Bstenos recordar que la incomprensin entre nios se debe tanto a una inca-
pacidad de expresin por parte del explicador, quien sigue siendo egocntrico
en su lenguaje mismo, como a una difcultad de adaptacin por parte del inter-
locutor, que no escucha porque cree haber comprendido todo de entrada, y que
incorpora todo lo que oye a su punto de vista egocntrico. (Piaget,1972,p.159.)
Segnelautor,lascomunicacionesdonde,porprimeravez,seescuchanyentienden
lospuntosdevistadelosotrosnoaparecenantesdelossieteuochoaos.Tambin,a
partirdeestaedad,elnioalcanzarlapropiedaddelareversibilidadyladescentracin
y, en general, ser entonces cuando se superaren muchos de los rasgos ilgicos y ex-
travagantesquehanimpregnadoelpensamientoinfantil.Mientrastanto,loslogrosdel
niopreoperatorioseguirnestandomsenlaposibilidaddeusarsmbolos(juegode
fccin, imitacin diferida, adquisicin del lenguaje, inicio del dibujo, etc.) que en la
dehacerlodemodolgicoentareasquerequierandelareversibilidadyladescentra-
cin.
1.2. Algunas limitaciones de la teora de Piaget
LaobradePiagetcontinasiendounarmazndereferenciaparaestudiarnuestrodesa-
rrollo intelectual. Su perspicacia en las preguntas, su tenacidad en la observacin y su
lucidezenelanlisisdelastareashacenque,peseaalgunosdesaciertosensusplantea-
mientosoprocedimientos,sulegadosigateniendounincalculablevalorparalainvesti-
gacin. Dicho esto, veremos a continuacin algunas de las limitaciones de su teora,
destacandolospeligrososderroterosquetomsuobra.
Deformalcita,Piagetseinteresporelnacimientodelpensamientolgico-matem-
tico,perosuempeoquisoquesuformadeprocederacabaseviolandolasmselemen-
tales normas de la conversacin. Por ejemplo, es difcil imaginar cul es la respuesta
esperableapreguntascomo:Dnde est el nombre del sol?,oDe dnde vienen los
sueos?. Estas abstrusas cuestiones indican cierta falta de adecuacin a la mentalidad
quesequeraestudiar;sloeldesconciertodelnioantetalescuestionesseraunaame-
naza para las conclusiones. De hecho, siguiendo una metodologa ms ecolgica, hay
quienesencuentranenlosniosunamejorcomprensindeladistincinentrelofsicoy
lopsquicodeloquesupusiesePiaget(vase Apartado 3).
Porotrolado,algunosseplanteansilasflosofasinfantiles,comoelanimismo,deben
sertratadasslocomounfenmenoevolutivo.Unestilodepensamientoanimistapuede
serelresultadodeunaprendizajeadecuadoenundeterminadoentornosocio-cultural,sin
queellosignifquequeelpensamientoensutotalidadrespondaapatronespreoperatorios
(SarriyQuintanilla,2003).
Las crticas anteriores nos dejan entrever el principal problema que se atribuye al
trabajo de Piaget: su notable descuido por el contexto y el contenido de las tareas. Por
ejemplo,esindiscutiblequesedebeaprenderaadoptarlasperspectivasajenas,perono
194 Bloque III. La primera infancia: de los tres a los seis aos
es cierto que el nio de entre dos y seis aos sea tan egocntrico como lo dibuja este
autor.Dehecho,tareasparalelasaladelastres montaas,perodondeelcontextohace
relevantelalabordeocultarsedelalcancevisualdeunotro,sonmuchomejorresueltas
porlosnios.Enconcreto,MargaretDonaldsonmostrqueimplicadosenunjuegoque
consisteenesconderaunniodeunpolica,losnioseranmspropensosaadoptarlas
perspectivas visuales de la otra persona (Donaldson, 1978). Igualmente, en tareas que
reproducenproblemascotidianos,elniomuestraunamejorcomprensindelarelacin
entreeltodoylaspartes(Donaldson,1978).Porende,podradecirsequeloqueverda-
deramente los nios no entienden son los problemas de perspectiva o de inclusin de
clasesplanteadosentrminosmuyabstractosomuydescontextualizados;encambio,el
redimientomejoraamedidaqueacercamoslarepresentacindelproblemaalarepresen-
tacininfantildelarealidad(vase Cuadro 8.1).
Cuadro 8.1. Ejemplo de una de las tareas usadas por Margaret Donaldson
Medianteunsencilloestudio,MargaretDonaldsonmostrlainfuenciaquetienelainterpretacindela
tareaenelrendimiento.Elestudioconsistaenintroducirunnmerovariabledecochesenunnmero
variabledegarajes.Seguidamentesepreguntabaalosniossitodosloscochesestabanguardadosen
losgarajes.
Curiosamente,cuandoquedabaungarajelibrelosniosrespondanquetodosloscochesNOesta-
ban en un garaje. La investigacin posterior revel que los nios suponan que an deba llegar otro
coche,puestoquenohayraznparaquealguientengaungarajevaco.Esteresultadoponedemani-
festolanecesidaddeconsiderarlarepresentacinqueelniosehacedelatarea,ysistaeslamisma
quetieneelinvestigador.
Finalmente,esciertalatendenciadelniopequeoadeformarlarealidadasuanto-
jo,comodemuestrasupredileccinporeljuegodefccin,perohayquedestacarqueno
todoenelnioesasimilacin;tambinintentaadaptarsealospuntosdevistadelosotros
y es ms consciente de sus propios procesos mentales de lo que supusiese Piaget. Un
ejemplodeestoltimoseencuentraenlosestudiossobrememoriadondeinclusolosms
pequeosseafananpornoolvidar.ElCuadro8.2recogeunamuestradeestostrabajos.
Enconclusin,podemosresumirquemuchasdelastareasdePiagetmarcanloslmi-
tesdeloqueelniopuedehacerdesdeelpuntodevistalgico.Sinembargo,elpanora-
madelainteligenciainfantilcambiacuandolastareasseformulanentrminosrealmen-
terelevantesparaelniooconelementosquelesonfamiliares.Cuandohacemosesto,
suegocentrismoysusinsufcienciaslgicasresultan,cuandomenos,atenuados.
Captulo 8. El desarrollo del pensamiento 195
Cuadro 8.2. Estrategas a los dos aos
Sehaobservadoqueniosdeentre18y24mesesseimplicanyaenaparentesestrategiasmnemotcni-
cas.As,envueltosenunanimadojuegoqueimplicaesconderunjugueteparamstarderecuperarlo,los
pequeospasansutiempodedemorapaseandocercadelescondite,mirandoosealandohaciaeselugar,
yhablandosobreelesconditeoelmueco.
Lapruebadequetalesactividadesestnencaminadasarecordarprovienededistintosargumentos,
fundamentalmentedequedichasconductasocurrenmsenlassituacionesmsdesafantesparalame-
moria.Porejemplo,haymsconductascomolasindicadascuandoeljuegosedesarrollaenambientes
nofamiliarescomoellaboratorio(DeloacheyBrown,1983),ocuandoconsideramoslosprimerosen-
sayos,dondeelnioestpocofamiliarizadoconlatarea(Deloache,CassidyyBrown,1985).Perosin
dudaelmejorindicadordelaintencindetalesconductasessuaumentoodisminucinenfuncinde
queaquienseleatribuyalaresponsabilidadderecordar.Sielduranteelperododedemoraelniocree
quetendrquerecuperarelmuecoaumentarnsusconductasmnemotcnicas.Sicreequeloharun
adultodejardemostrarlas(Deloache,CassidyyBrown,1985).
Encontrapartida,losprimerosindiciosdeefcacia,esdecir,derelacinentrelaestrategiautilizada
yenelxitoenelrecuerdo,seencuentranenniosalgomayores,entrelos3ylos4aos(Wellman,
RitteryFlavell,1975;Delgado,GmezySarri,2002,enprensa).Esdecir,sloapartirdeestasedades
losniosejecutanaccionesquerealmentesonefcacesparaelrecuerdo.Noobstante,ypesealafalta
deefcienciadesusprimerasacciones,esevidentequeciertaconcienciadequeesnecesariohaceralgo
paramantenerlainformacinenlamenteestyadesdelosdosaos.
A continuacin presentamos una segunda aproximacin a la infancia radicalmente
distinta.Segnsta,eldesarrollonoseexplicadesdeelpropioindividuo,seexplicacon
relacinalcontextosocialyculturalyalacomunicacinconlosotros.
2. El nio pequeo en la teora de Vygotski
El contrapunto al retrato piagetiano de la infancia lo encontramos enVygotski. Para el
autorbielorruso,lainfancianopuededefnirseporelegocentrismo,yaque,asujuicio,
ningn ser inmaduro y encerrado en s mismo superara la prueba de la supervivencia.
Porello,elniodebe,cuantoantes,guiarseporelprincipioderealidadynoporeldel
placer,loquesignifcaquedebeadaptarsealasdemandasrealesyadecuarsealasnormas
queimperanensucomunidad.Endefnitivatienequeactuarcomounsersocialcompe-
tente.
Elejemplomsclarodeestaposicin,ancladaenlosocial,apareceenlainterpreta-
cinqueVygotskihizodelhablaegocntrica(Vygotski,1934/1982)
9
.Comosabemos,el
habla egocntrica haba sido identifcada por Piaget como un tipo de lenguaje que no
sirvealacomunicacinporqueelnionoseadecuaalpuntodevistadelinterlocutory
slohabladesmismo.Porende,paraelautor,estelenguajeeraslounsignomsdel
egocentrismo infantil y su disminucin, hacia los ocho aos, contribua a reafrmar su
inoperancia.Vygotski,porelcontrario,interpretestefenmenodesdelaposicinopues-
ta,defendiendoqueelhablaegocntricanoesunsntomadelafaltadesocializacinde
9
Puesto que este fenmeno es a la vez intelectual y lingstico volver a ser tratado con detenimiento
(vaseCaptulo9).
196 Bloque III. La primera infancia: de los tres a los seis aos
lamenteinfantilmsbiendesufaltadeindividualizacin!yatribuyndole,adems,
unaimportantefuncinintelectual.
Vygotskipartiradelaideadequeellenguajeesuninstrumentosocialquesurge
porque hay un otro con el que compartir y cooperar. En este sentido, la funcin pri-
meradelhablaeslacomunicacinynotienesentido,segnl,queelnioadquiera
el lenguaje para usarlo con fnes de ensoamiento o egocntricos en el sentido de
Piaget.Ahorabien,alolargodeldesarrollolosadultosintentancontrolarlaaccin
delniomedianteinstruccionesverbales(porejemplo,nocomaseso,sultalo!,
ponmsarena,etc.).Estainiciativaverbalpermiteque,msadelante,seaelpropio
nioquienseenveasmismomensajessimilaresconelpropsitoderegularsuac-
cin.Porejemplo,noesextraoobservaraniospequeosnarrandocadaunadesus
accionesmientrasjuegansolitariamente,omientrasabordansustareasescolares.Con
ello,losniosnobuscanqueunotroexternolesentiendaylesconteste,setratadeun
lenguaje dirigido a s mismos con el fn de tomar mayor conciencia de las propias
acciones.
Portanto,siPiagetacertaldiferenciarestelenguajedelquesirvealacomunicacin
conunotro,Vygotskiharalopropioaldemostrarqueentreestehablaylaaccinha-
baunarelacinmuchomsprofundaqueelmeroacompaamientoolaco-ocurrencia.
Enconcreto,elautorbielorrusodifcultlasactividadescotidianasdelosnios,enten-
diendo que esto incrementara su lenguaje egocntrico en un intento de cobrar mayor
concienciadesusprocesosmentalesporejemplo,hizoquealahoradeemprenderuna
accinlospequeosnocontasenconlasherramientasadecuadas.ComoVygotskiha-
baprevisto,losobstculosinterpuestosprovocaronunnotableincrementodeemisiones
egocntricas,loquerefrendabaqueellenguajeegocntricoformabapartedeunesfuerzo
delniopordarsecuentadeladifcultaddelproblema,dehallarunasalidaodeplanear
laprximaaccin.
Nuestros nios han mostrado un incremento del lenguaje egocntrico cuando,
en cualquier situacin, tropezaban con difcultades. Frente a una difcultad el
nio trataba de entender y remediar la situacin hablando y razonando consigo
mismo: Dnde est el lpiz?; ahora necesito uno azul; no importa, pintar
con el rojo y lo mojar con agua, se pondr oscuro y parecer azul. (Vygotski, 1934/1982,
p.50.)
Posiblemente,ellectorestarpensandoque,enrealidad,todaslaspersonas,niosy
mayores, hablan consigo mismas. Efectivamente, la diferencia est en que slo los se-
gundospuedenhablarseenlaintimidaddesuconciencia,sinemitirlossonidosdelhabla.
Estoesdebidoaque,sibienellenguajeegocntricoprocededellenguajecomunicativo
yensusiniciosesaudible,amedidaqueseadaptaasufuncinreguladora,ellenguaje
egocntricovatransformandosuformaparaadecuarsealacomunicacinconunomismo.
Deestemodo,elhablaegocntricaseabreviaprogresivamenteycadavezesmenosau-
dible, hasta no ser siquiera perceptible. SegnVygotski, la interiorizacin del lenguaje
egocntricoprovocalaimpresinerrneadeunaextincin,sinembargo,lafuncinau-
torreguladoradelhablanodesaparecesinoquesubsisteenunaformanueva:ellenguaje
Captulo 8. El desarrollo del pensamiento 197
interno
10
.Esdecir,laautorregulacinverbalcontina,perolalaborserealizaahoraen
el plano interno, sin necesidad de vocalizaciones. En apoyo a este proceso, Vygotski
aludialasimilitudentreelhablaegocntricadelospreescolaresyellenguajeinterno
delosadultosodelosniosmsmayores.Ensustrabajoshabaobservadoque,alrea-
lizarunaactividad,losescolaresnomostrabanhablaegocntrica.Trasobservardeteni-
damente la tarea, estos nios actuaban directamente, sin mediacin aparente del habla.
Ahorabien,siselespreguntabaporloquehabanpensado,losmayoresdabanexplica-
cionesmuyparecidasaloexpresadoenelhablaaudibledelospreescolares.Paraelautor,
estosdatosnodejabandudasdequelaautorregulacinverbalseefectuabaenlosmayo-
resenunplanointernoynoaudible.
Finalmente, el hecho establecido por Piaget de la rpida desaparicin del len-
guaje egocntrico en la edad escolar permite suponer, dadas las similitudes
funcionales y estructurales mencionadas, que la abreviacin progresiva no con-
duce a la atrofa y a la desaparicin del lenguaje egocntrico, sino a su trans-
formacin en lenguaje interno, a su interiorizacin. (Vygotski,1934/1982,p.53.)
Conformealasinvestigacionesclsicas,losnuevosestudiosencuentranqueelhabla
egocntricaalcanzasucotamximahacialoscuatroaos,momentoenqueseiniciasu
transformacin hacia formas ms abreviadas, hasta ser interiorizada cerca de los seis
(Beaudichon, 1973; Berk, 1986, 1992; Bivens y Berk, 1990; Girbau, 1993; Kholberg,
YaegeryHjertholm,1968;Winsler,CarltonyBarry,2000;Winsler,DeLen,Wallace,
CarltonyWillson-Quayle.2003).Lainteriorizacindelhablaegocntricanosignifcano
volver a hablar en alto; el proceso puede volver a ser audible si la tarea que queremos
controlarrequieredetodanuestraatencin.Porejemplo,noesextraoobservarnosha-
blandoenaltocuando,minutosantesdesalirdeviaje,revisamoselcontenidodenuestra
maleta.Precisamente,elrecursoahablarenvozaltahallevadoaalgunosareplantearel
habla egocntrica como una herramienta de solucin de problemas y no slo como un
fenmenoevolutivo.
Finalmente, merece destacar la lucidez con queVygotski sita el origen de la con-
cienciaenlavidasocial.As,mientrasPiagetdescribaalniocomounseregocntrico,
quedebeavanzarhacialacomprensindeotrospuntosdevista,Vygtoskicreaqueera,
precisamente,elpensamientoindividualelplanoqueestabaanporsurgir,ylaapropia-
cinprogresivadellenguajeparafnesprivadoseraunaclarademostracindeestaidea.
Esevidenteque,segnlateoradeVygotski,elperodoquenosocupaesdeexcep-
cionalimportanciaparaeldesarrollodelautocontrolylaconstruccindeunaconciencia
verbal. Por ello, algunos autores recomiendan no prohibir a los nios hablar en alto ya
que,mientraslohacen,estncontrolandosupropioaprendizaje.Dehecho,losnioscon
dfcitatencionalretrasanlainternalizacindelhablaegocntricaposiblementedebidoa
susdifcultadesparacontrolarsuatencin(BerkyLandau,1993;Winsler,Daz,Atencio,
10
Vygotskidescribedetalladamentelaspropiedadesdeestelenguajementalperodebidoalacomple-
jidaddelasmismasprescindiremosdeahondarenellas.Noobstante,ellectorinteresadopuedeacudirala
bibliografarecomendada.
198 Bloque III. La primera infancia: de los tres a los seis aos
McCarthyyChabay,2000).Porelcontrario,lainteriorizacintempranadelhablaego-
cntricaes,paraalgunos,unindicadordemadurez.
3. La teora de la mente
Laltimapartedeestecaptuloestdedicadaaunodelostemasdeestudioquehasus-
citado un gran inters entre los psiclogos evolutivos durante las ltimas dcadas: la
adquisicin de la teora de la mente; temtica que ha recibido grandes aportaciones de
otros campos de la psicologa y de disciplinas afnes como la etologa comparada o la
flosofa de la mente.Antes de comentar algunas de las habilidades mentalistas que el
niodesarrollaentrelos3y6aos,veamosaqunosreferimosconestaexpresinde
teoradelamente.
Sinesfuerzoaparenteydemaneracasiconstante,ennuestrasrelacionesinterperso-
nalesatribuimostodounmundointernodedeseos,creencias,recuerdos,conocimiento,
intenciones,etc.;estadosmentalesqueempleamosparaexplicar,anticiparyentenderel
comportamiento propio y ajeno. Podemos presentar aqu un extracto de cualquier obra
literaria,unanovelapolicaca,porejemplo,opedirallectorquetomelaquetengams
amanoyqueanoteaquellasocasionesenlasquesuautorhacereferenciaexplcitaalos
estadosmentalesdelospersonajessobrelosqueseconstruyelahistoria,oaquellasotras
enlasque,cuandonosehacenexplcitos,somosnosotroslosqueselosatribuimos.Pa-
sandodelafccinalavidareal,tambinpodemospedirlequehagaunesfuerzodeme-
moriayrecuerdelaltimavezquesevioenvueltoenunmalentendidooquefueobjeto
deunengao.Ahora,tratedereconstruircmoseprodujoaquelmalentendidooporqu
cayenelengao.Inevitablemente,tendrquerecurriratodounentramado,msome-
nos complejo, de intenciones, deseos, creencias, conocimientos, ignorancia, recuerdos,
suposiciones...
Alrealizarestasactividadeshabrechadomanodesucapacidaddeteoradelamen-
te,expresinconlaqueentrminosgeneralessehacereferenciaalacapacidaddeatribuir
estadosmentalesalosdemsyaunomismo.Estacapacidaddeveralotroyaunomis-
mocomoseresquetenemosmenteconstituyeunapotenteherramientaparalarelacin
interpersonal,quepermitedarsentidoalcomportamientohumano,elcual,comoseala
Rivire(1996),nolointerpretamosdeformanaturalaludiendoacausasdetipofsiol-
gicoopuramenteconductuales,sinoentrminosdeestadosmentalesquemedianentre
lassituacionesynuestrasacciones.
Laexpresindeteoradelamentetienesuorigenenelcampodelestudiodelacon-
ductaanimalyfueacuadaporlosetlogosPremackyWoodruf(1978).Considerando
la funcin de adaptacin social de la inteligencia (Humphrey, 1976) y en el marco del
debate sobre la continuidad-discontinuidad evolutiva de algunos procesos psicolgicos
enprimateshumanosynohumanos,estosautoresenfrentaronaunachimpanc,Sarah,
adiversosproblemasquetenaunapersona.Porejemplo,selepresentabaunvdeoenel
quesucuidadorintentabacogerunracimodepltanosquecolgabadeltechodeunajau-
la en la que tambin haba una caja. Despus se enseaban a Sarah unas fotografas y
tenaqueelegirlaquemostrabalasolucindelproblema.Segnlosautores,parallegar
aunasolucinSarahdeberacomprenderqueunpersonajetenaunproblema,atribuirle
eldeseodesolucionarloypredecirqudebahacerelpersonajepararesolverlasituacin.
Captulo 8. El desarrollo del pensamiento 199
SiSarahlohaca,entoncestendraunaespeciedeteoradelamente.SegnPremacky
Woodruf un individuo tendra una teora de la mente si atribuye estados mentales a
otrosyasmismo.Dadalanaturalezanodirectamenteobservabledelosestadosmenta-
lesyelusoquetienesuatribucinparahacerprediccionesydarsentidoalaconducta
deaquelalqueselosatribuimos,losautoresutilizaneltrminoteoraparahacerre-
ferenciaaestacapacidad.
3.1. La atribucin de creencias falsas
Enelmbitodelapsicologaevolutiva,WimmeryPerner(1983)llevaronacaboelpri-
mertrabajoespecfcamentedirigidoaponerapruebacundolosnioshabranadquiri-
dounateoradelamente
11
.Tomandocomoreferenciaunampliodebateinterdisciplinar
alquediolugarelestudiodePremackyWoodruf,sobresiSarahverdaderamenteatribua
losestadosmentalesquetenasucuidadoro,porelcontrario,podasolucionarlatarea
haciendo una interpretacin de la situacin ms simple, disearon una exigente prueba
que pudiera ofrecer datos objetivos de que los nios, al resolverla, estaran llevando a
cabounrazonamientomentalista.Lapruebaalaquenosreferimosesconocidacomola
prueba de creencia falsa del cambio inesperado. En lugar de presentarla tal cul fue
empleadaeneltrabajoinicialdeestosautores,vamosaejemplifcarestetipodepruebas
describiendolatareaquemsfrecuentementehasidoempleadaenestembito.Esuna
prueba que respetando la estructura bsica de la original, constituye una versin ms
simpleyfuediseadaporBaron-Cohen,LeslieyFrith(1985)paraevaluarlateorade
lamenteenpersonasconautismo.EsconocidacomolatareadeSally,Annylacanica,
delacanica,osimplemente,latareaclsicadecreenciafalsa.
En la tarea de la canica se cuenta al nio y se escenifca mediante miniaturas una
historiaquediscurrealolargodecuatroepisodiosyenlaqueintervienendospersonajes
(vase Figura 8.3).
Figura 8.3. Representacin grca de la tarea de creencia falsa de la canica.
11
Algunos antecedentes sobre el inters en el estudio de la comprensin de los fenmenos mentales lo
encontramosenlapropiaobradePiaget(1926),cuandoabordaelconocimientoquetienenlosniosdelas
entidades mentales como el pensamiento o los sueos. No obstante, es con el trabajo deWimmer y Perner
cuandoseintroduceelestudiodeldesarrollodelascompetenciasmentalistascomocampodeestudioespec-
fco.
200 Bloque III. La primera infancia: de los tres a los seis aos
Antes de comenzar la narracin se describe el escenario inicial y se presentan los
personajes: Sally, que tiene una cestita y una canica, yAnn, que tiene un bolsito y no
tienecanica.
Unavezqueelevaluadorcompruebaqueelnioreconocealospersonajesporsus
nombres,comienzalanarracindelahistoria:Sally,dejasucanicaenlacestita(episodio
1:situacin inicial).Acontinuacin,elexperimentador,bajoelpretextodequeSallyva
asaliradarunpaseo,sacaalamuecadelaescena(episodio2:desaparicin de la es-
cena del personaje protagonista).UnavezqueSallyestfuera,Anncogelacanicadela
cestitaylaguardaenelbolsito(episodio3:cambio de localizacin del objeto).Lahis-
toriafnalizacuandoSallyvuelvedesupaseo(episodio4: reaparicin del protagonista).
Acontinuacinserealizalapreguntadeprueba,querecaesobrelaprediccindelacon-
ductadeSally,dnde va a ir Sally a buscar su canica?.Porltimoserealizandos
preguntasdecontrol:unadememoria(dnde estaba al principio la canica?)yotra
de realidad (dnde est ahora la canica?), que aseguran que el nio ha tenido en
cuentaelcambiodelocalizacindelobjeto.
Comovemos,alosniosselespreguntaporlaprediccindelaconducta,ynoex-
plcitamente sobre la creencia del personaje. Esto es as porque,Wimmer y Perner en-
tiendenque,desdeunpuntodevistalgico,parapredecircorrectamentelaconductaes
necesariohaberinferidopreviamente,apartirdelaccesodelainformacinquehatenido
el personaje, su creencia. La idea de que la actividad mentalista requiere llevar a cabo
procesosdeinferenciaesunadelasquehadominadoelpanoramatericoenestecampo.
Enestesentido,otrodelostrminosconquesehacereferenciaenlaliteraturaalateora
delamenteeseldecapacidadesdeinferenciamentalista.
Por qu no disear una prueba ms simple en la que se presente un personaje que
guarda un objeto en uno de dos contenedores y se pregunte por dnde va a ir luego a
buscarlo,osielpersonajesabedndeestelobjeto?Enestoscasosnosquedaramossin
lascaractersticasque,aefectosmetodolgicosdeinvestigacin,hizodelassituaciones
de creencia falsa buenos contextos para tener pruebas objetivas de que el nio al
resolverla estara teniendo en cuenta el estado mental del personaje. Nos referimos a la
caracterstica que tienen los estados mentales de creencia de que pueden representar de
manera falsa la realidad y en este sentido, permiten distinguir entre respuestas a la pre-
guntadeprediccindelaconductaenlasqueelnioserepresentaelestadomentaldel
protagonista,derespuestasbasadasenelestadomentaldelpropioniooenunarepre-
sentacin de la localizacin real de la canica. Fjese el lector que si el nio predice la
conductadelpersonajebasndoseensupropioestadomentalsobrelalocalizacindela
canica(elniosabedndeest)oenlalocacinrealdelacanica,estolellevaraapre-
decirquelamuecairaabuscarlacanicaallugarcontrarioalqueiraelpersonaje,ya
questetieneunacreenciasobresulalocalizacinqueresultaserfalsa.Enestesentido,
latareadecreenciafalsaexigiraunrazonamientodescentradodelpropioestadomental
delnioycontrafctico.Desdeelpuntodevistadelosrequisitoscognitivosderepresen-
tacin,latareaseharelacionadoconlacapacidaddemetarrepresentacin(Phylyshyn,
1978;Perner,1991).Estacapacidad,quevamsalldeladepoderformarrepresentacio-
nesmentalessobrelassituaciones,implicarepresentarserepresentacionesmentalessobre
lassituaciones.
EltrabajodeWimmeryPernerhatenidoungranimpactoenelestudiodelateora
delamente,dandolugaranumerosasinvestigaciones.Losprimerosestudiosestuvieron
Captulo 8. El desarrollo del pensamiento 201
centradosenlarealizacindelasprimerasrplicasdelestudiooriginal,elcontrolexpe-
rimentaldediversasvariablesquepudieranestardifcultandoofacilitandoelrendimien-
to, as como el diseo de nuevas pruebas de creencia falsa (CF) que, junto a esta del
cambioinesperado,sehanconvertidoenprocedimientosparadigmticosdeevaluacin.
EsteeselcasodelapruebadeCFdelrecipienteengaoso,quepermiteabordarla
habilidaddeatribucindeCFaunomismo(Hogrefe,WimmeryPerner,1986;Perner,
LeekamyWimmer,1987;entreotros).Estetipodetareaspresentalapeculiaridaddeque
losniosevaluadossufrenensupropiapielunengao,lacreenciafalsa,quemstar-
detendrnquetenerencuenta.Entrminosgenerales,estetipodetareassedesarrolla
delasiguientemanera(vase Figura 8.4).Semuestraalosniosunrecipientefcilmen-
te identifcable al que atribuyen su contenido habitual, pero que, en realidad, contiene
otrosobjetos(ej.untubodecaramelosdeSmartiesquetienelpices).Deestemodo,
Figura 8.4. Representacin grca de la tarea de creencia falsa de los Smarties (Frith, 1989).
202 Bloque III. La primera infancia: de los tres a los seis aos
elexperimentadorcreaenelniolacreenciafalsadequeelrecipientecontieneaquello
queeshabitual.Despusdecomprobarquelosniospiensanquehaycaramelos(qu
crees que hay dentro?), se deja que abran el tubo y vean y cojan lo que hay dentro,
constatandoelengao.Finalmentesevuelveaponerelobjetodentro(loslpices,por
ejemplo),secierraeltuboyserealizanlaspreguntadeprueba.Esteesquemadeprueba
permitehacerpreguntastantodeautoatribucindecreenciasfalsascomodeheteroatri-
bucin:porejemplo:al principio, cuando te he enseado el tubo, qu creas que ha-
ba? / qu me has dicho que haba dentro? paralaautoatribucin,ycundo en-
seemos a otro nio el tubo as, cerrado, qu va a creer que hay dentro? / qu va a
decir que hay? en el caso de la heteroatribucin. Finalmente se concluye con una
preguntadecontrolsobreloquecontienerealmenteeltubo.
Wellman,CrossyWatson(2001)recopilaronlosdatosbrutosde187estudiosinde-
pendientesrealizadosentre1983y1998enlosqueseaplicabantareasdecreenciafalsa
comolasquehemosvisto,ascomootrasversionesdeellas.Utilizandolatcnicaesta-
dsticademeta-anlisiscontrastaronelefectodediversasvariablessobreelrendimiento:
edadmediadelosparticipantes,tipodetareadecreenciafalsa(decambioinesperadoo
derecipienteengaoso),naturalezadelprotagonista(ej.sieranmuecos,personasreales
o si se utilizaban dibujos en lugar de escenifcar la historia), presencia o ausencia del
objetoenelmomentodehacerlapreguntadeprueba(ej.unachocolatinaqueescomida
frenteaunachocolatinaquesecambiadesitio),lanotoriedaddelacreenciadelprota-
gonista(ej.enlahistorianosehacereferenciaalgunaalestadomental,osehaceverbal-
mente explcita la creencia antes de pregunta por la conducta del personaje), el tipo de
pregunta(preguntarporlacreenciadelpersonajeopordndeirabuscarelobjeto),etc.
Losresultadosdeestetrabajocorroboranlaexistenciadeunaprogresinenelrendimien-
to entre los 3 y 6 aos, siendo entre los 4 y 5 aos cuando se podra hablar de claros
porcentajesdexito.Porotraparte,entrelas14variablesestudiadas,unaminoradeellas
facilitabanelrendimiento,comoporejemplolaintencindeengaarquetieneelperso-
naje que realiza el cambio de lugar del objeto (vase a este respecto, Nez y Rivire,
1994)oantesdepreguntardndevaairelpersonajeabuscarlacanica,hacerexplcito
questecreequeestenlacestita.
Engeneral,aunquelainvestigacincentradaenlaevaluacindelateoradelamen-
teatravsdesituacionesdecreenciafalsaindicaquealgunasmodifcacionesdelproce-
dimientodeaplicacinpuedenfacilitarenniosdeedadcercanaalos4aossuresolu-
cin, se acepta la edad de entre 4 y 5 aos como edad crtica para la resolucin de
situacionesmentalistasenlasqueestnimplicadosestadosmentalesdecreenciafalsas,
marcandounmomentodeavanceimportanteeneldesarrollodelashabilidadesmenta-
listas,alponerenevidencialacomprensindequelasrepresentacionesquelaspersonas
nospodemoshacerdelassituacionesnotienenporqucoincidirconlarealidaddedichas
situaciones,ydequesonnuestrasrepresentacioneslasqueguannuestrasaccionesyno
loshechosensmismos.
Pocodespus,apartirdelos6-7aos,adems,losniossoncapacesdesolucionar
pruebasquerequierenciertacomprensindelcarcterrecursivodelosestadosmentales
(Perner yWimmer, 1985; Nez, 1993); esto es, entender que el referente de nuestros
estadosmentalespuedeserotroestadomental;oenotraspalabras,quenuestrosestados
mentalesnoslorepresentansituacionesohechosdelarealidad,sinoquetambinpue-
densersobreotrosestadosmentales.Laestructuraformaldelastareasdecreenciafalsa,
Captulo 8. El desarrollo del pensamiento 203
denominadas de segundo orden de intencionalidad es el siguiente: el personaje (A), al
quehayqueatribuirelestadomental,tieneunacreenciafalsasobrelacreenciaqueun
segundo personaje (B) tiene sobre un determinado estado de hechos (X). La creencia
falsa deA viene provocada porque el personaje no tiene informacin de que B ha sido
informadodequehahabidouncambioenelestadodeloshechos.Porejemplo,toman-
dounatareadiseadaporNez(1993)sobrelapruebadecreenciafalsadelacanica,
pensemosqueelpersonajequesehaidoveatravsdeunaventanaquelaotraniacam-
biadelugarlacanica.Cuandovuelvelamuecapreguntamosalnioevaluadodnde
cree Ann que Sally va a ir a buscar su canica?DadoqueAnnnohavistoqueSallylave
cambiardelugarlacanica,AnntendrunacreenciafalsasobrelacreenciaquetieneSa-
llysobrelalocalizacindelacanica.
3.2. Habilidades mentalistas anteriores a la comprensin
de creencias falsas
Aunque como hemos sealado los nios hasta los 4-5 aos tienen problemas con las
creenciasfalsas,estonoquieredecirqueenmomentosanterioresdeldesarrolloelnio
permanezcaajenoalmundomentaldelaspersonasyelpapelquedesempeanlosesta-
dosmentalessobrelaconducta.
Sinpretenderserexhaustivosycentrndonosenelperododeedadquetratamosen
estecaptulo,vamosaexponeralgnejemplodelashabilidadesmentalistasquemuestran
losniosentrelos3y4aos.
WellmanyEstes(1986),enunestudioclsico,plantearonaniosdetresaosuna
seriedesituacionesenquedospersonajesqueranunobjeto,peromientrasqueunode
ellossolamentepensaba,soaba,simulabaorecordabaelobjeto(estoes,elobjetoera
un contenido propio del mundo de lo mental), el otro lo consegua (y por tanto era un
fenmenopropiodelmundodelofsico).Porejemplo,losautoresdecanalosniosque
aSamyaKatelesgustanlasgalletas,lamadredeSamledaunagalleta,mientrasque
Kateestpensandoenlagalleta.Acontinuacinlesformulabanunaseriedepreguntas
paraexplorarsilosniosdistinguanalgunascaractersticaspropiasdelosobjetosen
cuantofenmenosmentalesofsicos.Losniosaestaedaderancapacesdeapreciarque
elpersonajequetenalagalletapodacomerla,oqueelquetenaunabicipodamontar
enellaperonoelquelarecordaba,mostrandoasciertacomprensindequelosfen-
menosfsicos,ynolarealidadmental,ofrecenevidenciasensorio-comportamentalde
suexistencia:sonperceptiblesypodemosactuarsobreellos.
Otrostrabajosindicanqueduranteesteperododeedad,losniosavanzanenlacom-
prensin de estados mentales ms simples que las creencias, como por ejemplo los de
deseo(vaseWellmanyLiu,2004paraunarevisin).
En ciertas situaciones simples de evaluacin, los nios de 3 aos parecen entender
los deseos como elementos que dirigen la accin, y que los otros pueden tener deseos
diferentesalospropios.Porejemplo,dirnqueunpersonajeseguirbuscandoalgoque
quieresinoloencuentra,mientrasquesiloencuentradejardebuscarlo;siselesdice
queelprotagonistadeunahistoriapuedejugaraXoaY,sepresentandosdibujosdel
protagonista, uno para cada una de las posibles situaciones de juego, y se les pide que
elijanquharelprotagonista,eligeneldibujoquerepresentaalpersonajejugandoalo
que se ha especifcado que quiere jugar, aunque ellos mismos haban preferido el otro
204 Bloque III. La primera infancia: de los tres a los seis aos
juego.Adems,vanaponerenrelacinlasatisfaccin/insatisfaccindelosdeseoscon
emociones simples de alegra/tristeza. Durante este perodo tambin se ha sealado un
progreso en la comprensin de que algo que en un determinado momento es deseado
puededejardeserloenotro,odequelaspersonaspodemostenerdeseosdiferentessobre
unmismoaspectodelarealidad(unamismacosapuedeserdeseadaporunapersonapero
noporotra)(Yuill,1984;Harris,Johnson,Hutton,AndrewsyCooke,1989;Flavell,Fla-
vell,GreenyMoses,1990;WellmanyWoolley,1990;HadwinyPerner,1991;Wellman
yBanerjee,1991;BartschyWellman,1995,entreotros).
Porsuparte,trabajosquehanevaluadolaatribucindeconocimiento/ignoranciaindi-
canqueaestaedadlosniosentiendenunaspectotancentralcomoquequiennovealgo,
nolosabe,yquequienlovelosabe.Estoes,relacionanelaccesoquelaspersonastienen
alainformacincomofuentedelcontenidodelosestadosmentales(Hogrefe,Wimmery
Perner,1986;PerneryOgden,1988;Pillow,1989;PrattyBryant,1990,entreotros).
4. Conclusiones
Alolargodelcaptulosehanmostradotresdiferenteslneasquecoincidenenexplorar
algunas de las aptitudes y limitaciones del nio entre los dos y los seis aos. Desde la
teorapiagetianaseincideenlacapacidadsimblicadelniocomovaluartedenuevas
acciones,impensablesenelperodosensorimotor,comoeldibujo,laimitacindiferida
oeljuegodefccin(vase Captulo 10).Asimismo,hemosmostradolascarenciaslgi-
casdelnio,segnestateora.Porotrolado,hemosconocidolainterpretacinvygots-
kianadellenguajeegocntrico,olosestudiosmodernosdeteoradelamente,quecoin-
ciden en resaltar importantes desarrollos en los nios de entre 2 y 6 aos. Pero, sera
errneoignorarqueenesteperodohayotrosmuchosdominiosqueestnavanzandode
unmodosutil.Porejemplo,entrelosdosylosseisaossegestanimportanteshabilida-
desnumricasodesolucindeproblemasqueresultarnevidentesenlasegundainfan-
ciaentrelos6ylos11aos(vase Captulo 11).Conocerestasdiferenteslneasde
investigacinycomprendersusdiferenciaspuededarnoslaimpresin,correcta,deque
elestudiodeldesarrollohumanoestanpolidricocomoelpropiodesarrollo.
Todasestasposicionestericas,aligualqueotrasquepodramoshabermencionado,
tienen su lugar en el desarrollo, su parcela de verdad. No obstante, para descubrir los
aciertosdecadaunadeellasesprecisoconsiderarconqupropsitos,situaciones,tareas
y nivel de exigencia se mide el comportamiento infantil. Muchas habilidades no son
cuestin de todo o nada. En esta etapa, muchas de las capacidades intelectuales de los
niossonanmuyfrgilesyporellomuysensiblesalmodoenqueseevalan.
Lecturas complementarias
Piaget,J.(1924/1972).El juicio y el razonamiento en el nio, vol.II.BuenosAires:EditorialGua-
dalupe.
Rivire,A.yNez,M.(1996).La mirada mental.BuenosAires:AIQUE.
Vygotski,L.S.(1982).Pensamiento y lenguaje.Obrasescogidasvol.II.Mosc:EditorialPeda-
ggica.
Captulo 8. El desarrollo del pensamiento 205
Actividades
1. Conteste a las siguientes preguntas abiertas
1.1. Piense en diferentes ejemplos de egocentrismo infantil.
1.2. Piense en algn ejemplo de realismo infantil.
1.3. Piense en algn ejemplo de habla egocntrica externa o audible en per-
sonas adultas.
1.4. Qu dos aspectos de la capacidad de atribucin de estados mentales se en-
cuentran en la base de que fuera denominada teora de la mente?
1.5. En cul de ellos se fundamenta la idea de que la teora de la mente es una
actividad de carcter inferencial?
1.6. En la siguiente tabla se recogen algunos enunciados relacionadas con el de-
sarrollo de la teora de mente en el nio. A partir de la lectura de los aparta-
dos 3.1 y 3.2, seale la edad a la que prototpicamente los nios dan muestras
de su comprensin.
Edad
3-4 4-5 6-7
Una situacin puede provocar en una persona tristeza y en
otraalegra.
Losestadosmentales,inclusocuandorepresentandemanera
equivocadalarealidad,dirigennuestraconducta.
Laspersonaspodemostenerdiferentesestadosmentalesso-
breunamismasituacin.
Losestadosmentalespuedenrepresentarasuvezotrosesta-
dosmentalesquelaspersonastienensobreelmundo.
Elaccesoalainformacindeterminaelcontenidodeloses-
tadosmentales.
2. Indique si las siguientes armaciones son verdaderas o falsas
2.1. Para Piaget el habla egocntrica ayuda al nio a organizar su accin (V/F).
2.2. Segn Vygotski, en el ejercicio de su funcin privada, el habla egocntrica iba
atrondose hasta hacerse incomprensible y nalmente no ser siquiera per-
ceptible (V/F).
2.3. Slo los nios pequeos y los adultos que padecen enfermedades psiquitri-
cas hablan para s en voz alta (V/F).
2.4. Segn Piaget, los nios hablan en alto con mucha frecuencia porque an no
han interiorizado su lenguaje egocntrico (V/F).
206 Bloque III. La primera infancia: de los tres a los seis aos
Soluciones a las actividades
1. Preguntas abiertas
1.1. El egocentrismo infantil queda patente en muchos comportamientos cotidia-
nos, por ejemplo cuando los nios nos invitan a ver sus juguetes a travs del
telfono, o cuando se ocultan tras el lateral de un silln dejando a la vista sus
pies. Todo ello son ejemplos de que lo que ve o no ve el nio es tomado de
forma universal: es lo que ve o no ve todo el mundo.
1.2. Estirando los tipos de realismo propuestos por Piaget, un ejemplo de realismo
lo podramos encontrar en la dicultad de los nios para admitir la exibilidad
de las normas en los juegos. Por ejemplo, si un nio aprende que un deter-
minado juego de cartas siempre comienza con el cinco de oros, ser difcil
que, en otra situacin, admita que otros cincos, como el de copas, bastos o
espadas, puedan tambin abrir el juego si as lo acuerdan todos los jugadores.
El problema, en trminos realistas, es que la norma es percibida como parte
integrante del juego, al nivel mismo que las cartas. Violarla es parejo a destruir
las cartas de la baraja, as las cosas, difcilmente el nio admitir una regla
nueva.
1.3. Los adultos acostumbramos a pensar de forma dialogada, pero en silencio.
El dilogo con nosotros mismos se efecta en un plano interno y slo en
contadas ocasiones lo necesitamos exteriorizar. Un ejemplo de estas situa-
ciones es cuando afrontamos tareas que desafan nuestra atencin, por
ejemplo, al revisar una maleta minutos antes de salir de viaje o al repasar
nuestras respuestas antes una prueba de evaluacin. Estas situaciones que
requieren toda nuestra atencin pueden llevarnos a hablar en voz alta en un
intento de controlar de forma ms precisa e intensa nuestros procesos men-
tales.
1.4. Uno de los aspectos que dan sentido al trmino de teora de la mente
sera el carcter no directamente observable de los estados mentales que
atribuimos en nuestra actividad mentalista. Otro tiene que ver con la fun-
cin que tiene dicha atribucin a la hora de hacer predicciones e intentar
explicar el comportamiento de las personas que son objeto de dicha atri-
bucin.
1.5. La idea de que la teora de la mente requiere de procesos de inferencia es-
tara relacionada con el primer aspecto que hemos mencionado al resolver
la actividad 1: que los estados mentales no son directamente observables.
Estos tendran que ser inferidos a partir del acceso que la persona ha tenido
a la informacin sobre las situaciones, como en el caso de la tarea de creen-
cia falsa. Lo que decimos verbalmente ante situaciones concretas, aunque
no hagamos referencia explicita a nuestros estados mentales, nuestras expre-
siones faciales o, por ejemplo, tambin cmo nos comportamos ante una
determinada situacin seran otros elementos que las personas empleamos
para hacer inferencias mentalistas. Por ejemplo, si vemos que nuestro com-
paero de piso abre y cierra uno de los cajones del aparador, a continua-
cin se dirige con cara de extraeza hacia otro de los cajones, vuelve
a realizar esta misma operacin y saca del cajn su MP3 con la misma cara
de extraeza, probablemente inramos que quiere encontrar algo que cree
que dej en el primero de los cajones, pero que resulta que no es as, y es
ms, no recuerda haberlo dejado en el cajn en que nalmente lo en-
contr.
Captulo 8. El desarrollo del pensamiento 207
1.6. La solucin a la actividad 3 se muestra en la siguiente tabla:
Edad
3-4 4-5 6-7
Una situacin puede provocar en una persona tristeza y en
otraalegra.
X
Losestadosmentales,inclusocuandorepresentandemanera
equivocadalarealidad,dirigennuestraconducta.
X
Laspersonaspodemostenerdiferentesestadosmentalesso-
breunamismasituacin
X
Losestadosmentalespuedenrepresentarasuvezotrosesta-
dosmentalesquelaspersonastienensobreelmundo.
X
Elaccesoalainformacindeterminaelcontenidodeloses-
tadosmentales.
X
2. Verdadero o falso
2.1. F. Piaget no atribuy al habla egocntrica ninguna funcin relevante. Este
fenmeno era slo una demostracin de la incapacidad infantil para ma-
nejar el punto de vista del interlocutor.
2.2. V.
2.3. F. Hablar en voz alta es un recurso que nos permite controlar mejor nuestra
conducta y nuestros procesos de pensamiento. Por consiguiente, muchas
situaciones desaantes pueden desencadenar el habla egocntrica en los
adultos. Por ejemplo, en situaciones de evaluacin muchos alumnos ha-
blan para s o eso esperamos! mientras repasan sus respuestas.
2.4. F. Efectivamente, los nios pequeos suelen pensar en voz alta en ms oca-
siones que los adultos, ya que puede que an no hayan completado su
proceso de interiorizacin del habla egocntrica. Pero esto no lo dijo Pia-
get, sino Vygotski.
El desarrollo
del lenguaje oral
209
9
SONIA MARISCAL ALTARES
Esquema resumen
Objetivos
Introduccin
1. El desarrollo de la forma del lenguaje durante la primera infancia
1.1. Desarrollo fonolgico: cmo se va completando la adquisicin del sistema
de fonemas
1.2. Desarrollo del vocabulario y desarrollo gramatical
2. El desarrollo pragmtico y las habilidades para narrar
3. Las relaciones entre el pensamiento y el lenguaje desde la perspectiva evolutiva
4. Cmo se explica la adquisicin del lenguaje: modelos lingsticos innatistas y
explicaciones constructivistas
5. Aprender el lenguaje en contextos bilinges
5.1. La importancia de los perodos crticos: por qu es mejor aprender las
lenguas desde pequeos?
5.2. Ventajas del bilingismo: en qu condiciones tiene consecuencias positivas
para el desarrollo general?
Lecturas complementarias
Actividades
Soluciones a las actividades
210 Bloque III. La primera infancia: de los tres a los seis aos
Esquema resumen
1. El desarrollo de la forma del lenguaje durante la primera infancia
Los aos de Educacin Infantil son un importante perodo de desarrollo para los aspec-
tos formales del lenguaje: fonolgicos y gramaticales.
Las habilidades fonolgicas de los nios experimentan un crecimiento importante,
aunque pueden persistir para algunos nios las dicultades de pronunciacin.
El vocabulario experimenta un importante crecimiento en trminos cuantitativos,
pero tambin se producen cambios cualitativos en cuanto a la organizacin del lxico.
El desarrollo gramatical avanza hacia la comprensin y produccin de emisiones
complejas, que se concatenan entre s. Desde el punto de vista morfolgico se observan
errores de sobregeneralizacin.
2. El desarrollo pragmtico y las habilidades para narrar
El uso del lenguaje en contextos reales constituye una habilidad compleja que exige la
coordinacin de distintos tipos de conocimiento (lingstico y extra-lingstico).
El perodo de 3 a 6 aos es un espacio temporal privilegiado en relacin al desarro-
llo de las habilidades pragmticas.
La funcin narrativa del lenguaje constituye una interfaz entre los distintos niveles
del lenguaje: formales (lxico y gramatical) y funcionales (semntico y pragmtico).
Durante los aos preescolares se produce un desarrollo importante de las habilida-
des narrativas.
La produccin de narraciones constituye una faceta del desarrollo que se relaciona
tambin con la construccin de recuerdos personales y el desarrollo de la memoria au-
tobiogrca, aspectos relacionados con la identidad personal.
3. Las relaciones entre el pensamiento y el lenguaje desde la perspectiva
evolutiva
Piaget y Vygotski abordaron la relacin entre pensamiento y lenguaje y su evolucin en
relacin al desarrollo del fenmeno del habla egocntrica, un tipo de habla para s
mismo, no social, que acompaa la accin del nio desde los 3 aos aproximadamente.
Piaget plante que el habla egocntrica desapareca cuando el nio supera el ego-
centrismo caracterstico del perodo preoperatorio; en su modelo terico, el desarrollo
del lenguaje se subordina al desarrollo de la inteligencia, de ah la evolucin del fen-
meno.
Vygotski reinterpret el fenmeno del habla egocntrica relacionndolo con el sur-
gimiento de una nueva funcin del lenguaje: la funcin reguladora de la propia conduc-
ta. El habla egocntrica no desaparece, sino que evoluciona hacia el pensamiento verbal.
4. Cmo se explica la adquisicin del lenguaje: modelos lingsticos innatistas
y explicaciones constructivistas
El problema de explicar la adquisicin del lenguaje y de dar cuenta de los mecanismos
que la hacen posible ha sido y es una cuestin central en Psicologa.
La propuesta del lingista Noam Chomsky es paradigmtica del tipo de explicacio-
nes innatistas. Para este lingista la facultad de lenguaje implica la existencia de una
base de conocimiento especca, de origen gentico, que hace posible el aprendizaje
de la sintaxis de las lenguas la Gramtica Universal.
Las propuestas constructivistas, como la de Karmiloff-Smith, niegan la existencia de
representaciones lingsticas especcas, de origen gentico, pero no la de predisposicio-
nes iniciales y mecanismos de aprendizaje ajustados a la tarea de aprender una lengua.
Captulo 9. El desarrollo del lenguaje oral 211
Objetivos
Conocer cules son los principales procesos de desarrollo del lenguaje en la etapa
entre 3 y 6 aos.
Diferenciar los procesos de cambio cuantitativo y cualitativo en el desarrollo l xico.
Identicar las habilidades relacionados con la adquisicin del componente grama-
tical en la primera infancia.
Conocer los procesos lingsticos formales y funcionales implicados en la narracin.
Establecer la importancia de las actividades narrativas en el desarrollo cognitivo y
socio-afectivo de los nios.
Conocer los planteamientos piagetiano y vygotskiano sobre las relaciones entre
el pensamiento y el lenguaje y su evolucin. Saber diferenciar la explicacin pia-
getiana sobre el lenguaje egocntrico de la propuesta alternativa de Vygotski.
Conocer las principales propuestas tericas sobre el proceso de adquisicin del
lenguaje; distinguir los modelos de tipo lingstico-innatista y las propuestas cons-
tructivistas.
Aproximarse al proceso de adquisicin del lenguaje en contextos bilinges.
Saber denir el concepto de perodo crtico con las matizaciones que se han he-
cho al mismo en la actualidad.
Conocer las implicaciones cognitivo-lingsticas y socio-afectivas del desarrollo en
contextos bilinges.
Introduccin
Elprocesodeadquisicindellenguajeesunadelasvertientesmsimportantesdelde-
sarrolloinfantilenlaprimerainfancia.EnelCaptulo6vimoslosiniciosdeesteproce-
soylosprincipaleslogrosadquiridoshastaaproximadamentelos3aosdeedad.Sibien
latareadeaprenderunalenguaseponeenmarchamuytempranamente,elaprendizaje
dellenguajeconstituyeunmbitodedesarrollocomplejoy,comosealaacertadamente
El lenguaje se constituye en dominio especco de conocimiento como resultado
no como punto de partida del proceso de aprendizaje.
5. Aprender el lenguaje en contextos bilinges
Un individuo bilinge es aquel que posee dos sistemas lingsticos y es capaz de utili-
zarlos en cualquier circunstancia con una facilidad y ecacia semejantes.
Las circunstancias por las que un nio puede llegar a ser bilinge son enormemen-
te variadas, as como los posibles grados de bilingismo alcanzados.
Actualmente se utiliza la nocin de perodo sensible, frente a la de perodo crtico
en relacin con los momentos evolutivos ms apropiados para el aprendizaje de las
lenguas.
No todas las condiciones familiares, sociales ni culturales son igualmente propicias
para promover un desarrollo lingstico y de la identidad bilinge adecuados.
Las actitudes y expectativas positivas de padres, profesores y educadores son crticas
en relacin a un buen desarrollo de la condicin bilinge en todas sus facetas: cogniti-
vo-lingstica y socio-afectiva.
212 Bloque III. La primera infancia: de los tres a los seis aos
Aguado (1997), se trata de un trabajo de sol a sol, que contina durante los aos de
EducacinInfantil.Frutodeesetrabajo,enprcticamentetresocuatroaosyencondi-
cionesnaturales,elbebhumanosetransformaenunhablantebastantecompetente:es
capaz de mantener una conversacin ciertamente fuida, comprende el lenguaje de los
adultosenconversacionessencillas,puedecontarsusexperienciaspresentesypasadas,
puede hablar de lo que va a hacer maana e incluso es capaz de jugar con el lenguaje.
Perolaadquisicindellenguajenoesslointeresanteysorprendenteensmisma,
sinoquecomoprocesocognitivobsico,sudespliegueinfuyeeneldesarrollodeotros
procesosevolutivosintelectuales,afectivosysociales.
Enestecaptulonoscentraremosendescribirlosprincipalesprocesosdedesarrollo
lingsticoquetienenlugarentrelos3ylos6aosaproximadamenteyanalizaremosel
papelfundamentalquetieneellenguajeenrelacinconeldesarrollocognitivo.Tambin
abordaremoselaprendizajedellenguajeencontextosbilingesomultilingesyrefexio-
naremossobrelascondicionesenlasqueestassituacionestienenconsecuenciaspositivas
paraeldesarrolloinfantilyposterior.
1. El desarrollo de la forma de lenguaje durante
la primera infancia
Delos3alos6aosseabreunimportanteperododedesarrolloparatodoslosaspectos
dellenguaje;sinembargo,desdeelpuntodevistaformalseproducenavancesmuyim-
portantesquehacenqueellenguajedelosniossehagamscomprensibleycomplejo.
Lashabilidadesfonolgicasdelosniosexperimentanuncrecimientoimportante,aun-
queparaalgunospersistirnlasdifcultadesdepronunciacinduranteestaetapa.Adems,
de las emisiones de 2 o 3 palabras tpicas de los nios menores de 3 aos, el lenguaje
infantil evoluciona hacia la produccin de oraciones complejas que se van hilvanando
unasconotrasypermitenalnioconstruirnarraciones.Veamosconalgomsdedetalle
algunodeestosprocesosdeadquisicinformales.
1.1. Desarrollo fonolgico: cmo se va completando
la adquisicin del sistema de fonemas
ComovimosenelCaptulo6,laactividadarticulatorianecesariaparapronunciarcorrec-
tamentelaspalabrasdecualquierlenguaimplicaunacomplejacoordinacinneuromus-
cularyrespiratoria.Generalmentelosniosmenoresde4o5aosantienendifcultades
parareproducirlassutilesvariacionesdesonidosquedemandalaproduccindellengua-
jeoral.Estasdifcultadessematerializanenformasdepronunciacinaninmadurasque
sonproductodelaaplicacindelosdenominadosprocesosfonolgicos.EnlaTabla9.1
seexplicaenquconsistendichosprocesosyculessonlosprincipalestipos.
Puestoquelaslenguassediferencianyaenelnivelfonolgico,elordendeadquisi-
cindelosdistintosfonemasvaradeunaaotra.Centrndonosendatossobrelaadqui-
sicindelalenguaespaola(Bosch,2005)podemosdestacarquealos3aos:
El 90% de los nios espaoles ya emiten correctamente los siguientes fonemas:
/m/,/n/,//,/p/,/t/,/k/,/b/,/l/,ademsdelsonidocorrespondientealajyg
enpalabrascomojota,ogesto.
Captulo 9. El desarrollo del lenguaje oral 213
Losniosyapronuncianbienlosdiptongosdecrecientes,talescomo/ai/,/ei/,pero
tienendifcultadesconloscrecientes(porejemplo,dicenlogoodenteenlugar
de luego y diente). Tambin tiene problemas con los grupos consonnticos
CL(porejemplo,clara,clase)yCR(porejemplo,croar).
Siguehabiendoalgunasdifcultadesconelfonema/d/cuandovaentrevocales(por
ejemplo,enpalabrascomoadelante),ylosfonemascorrespondientesalazy
c(enpalabrascomocerilla,Celia).Ademslamayoradelosniosnopro-
nunciancorrectamentelarfuerte(porejemplo,perro,roto).
Portanto,alostresaosestconseguidogranpartedelsistemafonolgico,siendo
normaleslasdifcultadesenlapronunciacindelosgruposconsonnticosydealgunas
consonantes.Entrelos4y5aosseobservanlossiguientesprogresos:
Selograproducircorrectamentela/d/entrevocales,searticulabienla/g/(cuando
suenacomoengato,guinda,etc.).
El90%delosniosyaproducebienlaconsonantefricativa/f/;un80%articula
bienla/s/yun70%elsonidocorrespondienteala/z/.
Lamayoradelosniospronuncianbienelsonidocorrespondienteala/ch/,adi-
ferenciadeloqueocurraalos3aos.
Todava no se alcanza la cifra del 90% de nios que pronuncian bien los grupos
consonnticos, ni la r fuerte, aunque muchos ms nios de estas edades ya las
articulanbien.
Alos6aos,antesdelcomienzodelaetapaescolar,losnioscastellano-hablantes
puedenpronunciarcorrectamentecualquiersonidodelalengua(incluidaslasfricativas,
la r fuerte y los grupos consonnticos). Pueden presentar nicamente difcultades en
relacin a palabras muy largas o complejas, pero mejoran mucho la pronunciacin de
sonidosdifciles(/ch/,/s/,/z/,/l/,rfuerte).Apartirdelos6o7aos,losniosestabi-
lizan su pronunciacin y las habilidades fonolgicas adquiridas favorecen adems el
Tabla 9.1. Los procesos fonolgicos de simplicacin del habla
Denicin y ejemplos
Losprocesosfonolgicossonestrategiasdesimplifcacinquepermitenalosniosmenoresde4aos
comunicarse y hacerse entender, an cuando no son capaces de reproducir todas las sutiles variaciones
desonidosqueimplicalaproduccindellenguajeoral.Haytrestiposdeprocesos:
1. Reduccinysimplifcacindelaestructurasilbica:consisteensimplifcarlasslabas,reduciendosu
nmerooconvirtindolasenlaslababsica(CV).
Ejemplo:Unniodicefandaenlugardebufandaodicedeteenlugardediente.
2. Procesosdeasimilacin:sonresultadodelainfuenciadeunsegmentoosonidosobreotrosegmen-
todentrodelamismapalabra.
Ejemplo:Unaniadicelibloenvezdelibro,y,nunaenlugardeluna;enelprimercaso
arrastralaconsonanteinicialalasegundaslaba,yenelsegundocasoeslaconsonantenlaque
afectaretroactivamentealaprimeraslaba.
3. Procesos sustitutorios: consisten en la sustitucin de un fonema por otro sin hacer referencia a los
sonidosprximos.
Ejemplo:Unniodiceborroenvezdegorro,y,sapatillaenvezdezapatilla,sustituyendo
enamboscasoslasconsonantesinicialesporotrasmsfcilesdepronunciar.
214 Bloque III. La primera infancia: de los tres a los seis aos
aprendizajeydesarrollodelalectura.Lamejoradelashabilidadesfonolgicasfacilita
el desarrollo creciente del vocabulario y ste tambin se ve impulsado por dicho creci-
mientofonolgico.
1.2. Desarrollo del vocabulario y desarrollo gramatical
Lamayoradelosestudiossobreeldesarrollodelvocabulariosecircunscribenalospri-
meros aos y abordan los principales procesos que intervienen en el aprendizaje del
lxicoinicial(vaseporejemplo,Serra,2000).EnelCaptulo6vimoscmoelvocabu-
lario creca inicialmente de modo lento y que despus este proceso experimentaba una
aceleracinimportante.Durantelaprimerainfancialaadquisicindelvocabulariosigue
estatendenciadecrecimientoacelerado.Eldesarrollocognitivodelnio,sushabilidades
deinteraccinsocialysuparticipacinencontextosextra-familiarescadavezmsdiver-
sos(escuelainfantil,amigos,etc.)favorecendeformaindudableelaprendizajedenuevas
palabras.Sinembargo,elcrecimientoadecuadodellxicosemanifestanosloeneluso
deunmayornmerodeentradaslxicas,sinotambinenlaorganizacindelvocabulario
yenlautilizacindelaspalabrasendistintoscontextoslingsticos.Porejemplo,lapa-
labraaguaqueesaprendidamuytempranamenteencontextosdealimentacinconel
signifcado de sustancia para beber, puede ser utilizada en muchos otros contextos y
conectadaconotraspalabrasrelacionadas;porejemplo,sepuedeutilizaralhablardeun
roodelmar,enrelacinalalluvia,alanieve,etc.
Sitenemosquecaracterizarelprocesodedesarrollolxicoenlaprimerainfanciaes
indudablequehayquealudirauncrecimientocuantitativo(vase Tabla 9.2),perotam-
binacambiosdetipocualitativo.Estosltimossereferenalaorganizacindelvoca-
bulario, a las relaciones que se establecen entre unas palabras y otras. Por ejemplo, un
nioqueaprendilapalabracochecon24meses,puedeaprenderlapalabravehcu-
lo a los 5 aos, pero debe aprender tambin qu relaciones se establecen entre ambas
parahacerunusoadecuadodeellas;esdecir,vehculohabrdesituarsecomocatego-
ramsgeneral,supraordinada,enrelacinacoche,perotambinenrelacinaauto-
bs, tren, etc. Ese mismo nio puede aprender la palabra taxi como un tipo de
coche especial; por tanto, si incorpora esta palabra a su vocabulario, sta se situara en
unlugarsubordinadorespectoalapalabracoche.
Tabla 9.2. Algunos datos cuantitativos sobre el desarrollo del vocabulario
Desarrollo del vocabulario
Templin(1957)estimqueeltamaodelvocabulariodeunniode6aospodaserdeunas14.000
palabras.
Carey(1978)calculqueelritmodeaprendizajemediodepalabrasdelosniosentrelos18mesesy
los6aossesitaentornoa9palabrasporda.
ElestudiodeAnglin(1993)sobreelcrecimientolxicoenlosprimerosaosdeescolarizacinindica
que entre los 6-7 aos y los 10-11 aos el vocabulario medio se multiplica por 4: de ms de 10.000
palabrasconocidasporlosniosde6aossepasaaunas40.000palabrasenlospreadolescentes.
Elvocabularioesuncomponentedellenguajequecontinacreciendomsalldelainfancia.
Laentradaenlaescuelayelaprendizajedelalecturafavorecenindudablementelosprocesosdeaprendi-
zajelxico.Loslibrosproporcionanelaccesoaunabanicodepalabrasmuchomayordelquenosencon-
tramoshabitualmenteenelhabladiaria.
Captulo 9. El desarrollo del lenguaje oral 215
Loscambiosenrelacinaldesarrollolxicosuponen,portanto,laconstruccinde
losdistintoscampossemnticosqueformanelvocabulariodeunalengua;losprocesos
cuantitativos y cualitativos que mencionbamos ms arriba implican el aprendizaje de
ms elementos por cada nivel de organizacin y el establecimiento de relaciones entre
ellos.Unametforatilparacaracterizarlarepresentacindelaspalabrasenelsistema
cognitivoeslaimagendeunaredintegradapormltiplessubredeslxico-semnticasque
dan soporte a lo que podramos caracterizar como el diccionario mental de cada ha-
blantedeunalengua.
Pero aprender las palabras de una lengua no implica nicamente ser capaz de esta-
blecer relaciones entre la forma fonolgica (cmo suena la palabra) y el referente o
signifcado de la misma; el aprendizaje lxico se relaciona tambin con el aprendizaje
gramatical.Veamosenqusentido.
Conocer una palabra supone tambin saber de modo implcito a qu categora
gramaticalpertenece.Nohacefaltaserunlingistaprofesionalparasaberque,porejemplo,
lapalabraelefanteesunnombre,mientrasquelapalabrasoaresunverbo.Saberla
categoragramaticalalaquepertenecenambaspalabrasesunrequisitobsicoparapoder
construirfrasesgramaticalmentecorrectas:pertrechadosconesteconocimiento,nuncase
nosocurriradecir*yoelefantoparaexpresar,porejemplo,quemuevomimanocomo
sifueralatrompadeunelefante,puessabemosqueeserrneotrataresapalabracomoun
verbo; diramos hago como si fuera un elefante, agrupando correctamente el nombre
elefanteconelartculounyconstruyendouncorrectsimoSintagmaNominal.
Losprocesosdeaprendizajedelascategorasgramaticalessoncomplejosyconstitu-
yenunadelastareasmsimportantesdeaprendizajedurantelosprimerosaosdelde-
sarrollo lingstico. Su inicio es temprano, como apuntamos en el Captulo 6, pero su
extensin a lo largo del desarrollo ocupa al menos hasta la adolescencia. La forma de
estimarlasdifcultadesdeestosprocesosestratardeadoptarelroldeaprendizypensar
ennosotrosmismosaprendiendounasegundalengua.Lagramticasenospresentaen-
toncescomounmuromuchasvecesimpracticable!
Durantelaetapade3a6aoslosniosseencuentraninmersosenunactivoproceso
deaprendizajegramatical.Enlabibliografaespecializadasesuelesealarqueentorno
alos4aoslosniosyatienenadquiridaunaprimeragramticabsica.Sinembargo,el
estadofnal(siesqueexistetalestadoeneldesarrollodellenguaje)estanmuylejos.
Hablarcomounadultoimplicaconocerlassutilezasmorfolgicasdelalengua,especial-
mentesisetratadeaprenderunalenguatanricaaestenivelcomolaespaola,ytodas
lasestructurassintcticas,incluyendolasmscomplejas.Nopodemosentrarenlacarac-
terizacinendetalledeestosprocesos,puesnoeselobjetivodeestecaptuloniseadecua
alasnecesidadesdeformacindeuneducador.Sinembargo,paraobtenerunaimpresin
deesteimportanterecorridoevolutivoestilacercarseadatosempricoscomolosque
sepresentanenelTabla9.3.
Sicomparamosambastranscripcionesconellenguajetpicodelnioenlosinicios
delprocesodeadquisicin,esfcilapreciarloscambios:deunaausenciadeorganizacin
gramaticalenellenguajetemprano,enelquelosniosrealmentenoconstruyenoracio-
nes,sinoquejuntanpalabras(porejemplo,aqunenes),sepasaaunlenguajeinte-
gradopororacionessimplesbienformadas(porejemplo,amimegustanlasbujaspi-
rujasniade3aos)yaemisionessintcticasmscomplejas(porejemplo,mira,te
puedespasearporahsiquieresniade5aos).
216 Bloque III. La primera infancia: de los tres a los seis aos
Entre los indicadores de las difcultades que plantea el proceso de adquisicin del
componente gramatical se encuentran los errores morfolgicos y las pausas entre una
oracinyotra,oenelinteriordeoracionescomplejas.Losprimerossonmuyinforma-
tivosdelniveldeadquisicinalcanzadoporlosniosydelprocesodeaprendizajesub-
yacente.Noeslomismocometerunerrorcomo*yosabe,enelqueloquefallaesla
concordanciaentreelsujeto(1.persona)yelverbo(3.personaenelejemplo)porque
el nio probablemente no ha detectado, ni extrado, ni almacenado el morfema verbal
de persona, que cometer un error como *yo sabo. Este segundo tipo de errores, lla-
madoserroresdesobregeneralizacin,indicanjustamentequelosniosyahanadqui-
rido una regla gramatical de tipo morfolgico. El nio que dice *sabo en lugar de
se,realmenteyasabeyestonoesunmerojuegodepalabras,comoseapreciaen
elTabla9.4.
Tabla 9.4. Errores de sobregeneralizacin
Denicin y ejemplos
Los errores de sobregeneralizacin implican la extensin de una regla gramatical ms all de lo per-
mitido por la lengua. Consisten en la aplicacin de dicha regla a palabras que son una excepcin a la
misma.
Ejemplosrelacionadosconlamorfologaverbal:Unaniade2aosymediodice:voya*cojouna
silla(envezdevoyacogerunasilla)yyono*sabo(enlugardeyonos).
Ejemplosrelacionadosconlamorfologanominal:Unniode4aosdice:mam,yosoy*unafan-
tasmayestenioes*idioto.
Loserroresdesobregeneralizacindemuestranqueelnioyaconocelasreglasgramaticales.Por
tanto,sonsignospositivosdeunbuendesarrollolingstico.
Tabla 9.3. Transcripcin del lenguaje espontneo de una nia a los 3 y 5 aos
Nia 3 aos Nia 5 aos
N=nia.
M=mam.
N: Yamequito,yamequitaolatoallaysoyMa-
niayo.
M: Claro.
N: Qutamelolatoalla,quenomegutanlasbujas
pirujas.
M: Notegustan?
N: Noo!
M: Porqu,miamor?
N: Poqueno.Amimegutanlasbujaspirujas.Es-
tabaenelcuentounabujapiruja.
M: Yquhaca?
N: Nos.
M: Pinsalo,averquhaca.
N: Quetenaunamasana,aques?
N=nia. xxx=hablaininteligible
P=pap.
P: Vasahacer,qu?
N: Unas cortinas, aqu. Unas cortinas muy boni-
tas.Sonderayas.Ahoratelasenseosiquiero
[leenseaeldibujoasupadre].Miralacortina
[pintadenuevo].Vaaestarmuybienconcor-
tina.Yaestconcortinaymuybientapadito[lo
ensea].
P: Muybien.
N: Ahoranecesitootra.Estasqueesrojadever-
dad[juntadoslpicesylosponedepie,como
si fueran muecos] Vale, hijo... xxx... ya que
hemosvenido.Mira,tepuedespasearporah,
siquieres.Aypap!Peroesqueestosetiene
queacercar.Vale!...xxx...acrcate;poraqu,
yomeacercoporaqu.
Captulo 9. El desarrollo del lenguaje oral 217
Entre los 4 y los 5 aos es frecuente que los nios mientras estn contando algo a
alguieninterrumpansusoraciones,repitanpartedelodichoycambiendeunaestructura
aotra(vase Tabla 9.5)Estetipodeprocesossonindicativosdelasdifcultadesquesu-
poneconstruircorrectamenteunanarracinydelaatencinquerequiereelprocesamien-
to lingstico que subyace a esta actividad relacionada con la produccin del lenguaje.
Narrar es un tipo de actividad lingstica que constituye un interfaz entre los distintos
nivelesdellenguaje:losmsformales(lxicoygramatical)ylosmsligadosalafuncin
yalainteraccin(semnticoypragmtico).Nosocuparemosdeestetemaenelsiguien-
teapartado.
Tabla 9.5. Dicultades en la construccin gramatical durante la produccin del lenguaje
Ejemplo de interaccin entre un adulto y una nia de 4 aos
[Lospuntossuspensivos...indicanpausasquepuedeninterpretarsecomotiempoparaprocesar].
Adulto:paraques?(hablandodeunchndal).
Nia:para dormir? el chndal no es para dormir, es para la calle, y para...., y para casa
Adulto:s,mivida,peroencasaloutilizamoscomopijama,vale,miamor?
Adulto:cuntamelohija,quemamnolohaentendidobien.
Nia:pap se llama Mira el nio se asust, estaba sentado en una silla el nio, slo el nio y el nio
como, com le como le daba caramelo l, ET, pues como ya se despert el nio se daba caramelos
y ya estaba bueno y ya puede tomar caramelos. Estaba dormido con caramelos y y tom mucha
cerveza po lo, haca babas.
2. El desarrollo pragmtico y las habilidades
para narrar
Lacomprensindellenguajeencontextosdehablarealesycotidianosimplicalaparti-
cipacin de distintos tipos de conocimientos y habilidades. Por ejemplo, ante la frase
mepuedespasarlajarra?,porfavor,unainterpretacinliteraldelamismallevaraal
oyenteacontestarsono.Sinembargo,coneseactodehablaindirecto
1
loquepersigue
elemisoresquesuinterlocutorleacerquefsicamenteelobjetoquepide,lajarra.
Sipensamosenlostiposdeinformacinquehayquetenerencuentaparacompren-
der(ytambinparaemitir)estetipodeemisionestancomunesenlavidacotidiana,de-
bemosincluiralmenoslassiguientes:1)informacinestrictamentelingsticarelativaa
laspalabrasqueformanlaemisin(supronunciacinysignifcado),losmorfemasyla
estructuragramaticalquesehautilizado;2)informacinsobreelcontextoenelquese
emiteestafrase;enelejemploprobablementesetratadeunasituacinrelacionadacon
lacomidaynoconunaclasedeyoga;3)informacinsobreelinterlocutor:siestefuera,
porejemplo,unniopequeo,nolepediramosquenosacercaralajarra,puesnopodra
1
Eltrminoactodehablaindirectoserefereaemisioneslingsticasenlasquenohayunacorrespon-
denciaentreelsignifcadoliteral(loquesedicerealmente)yelpretendidoporelhablante.Sonactosdehabla
indirectostodaslaspeticionescorteses(medas...?,podrasacercarme...?,teimportaabrirlaventana?)y
lasquejasformuladascomopreguntas(noestmuyaltalamsica?),entreotras.
218 Bloque III. La primera infancia: de los tres a los seis aos
hacerlo; 4) informacin sobre los usos del lenguaje, concretamente sobre qu tipo de
frmulasseutilizanparapedirdeformacortsenunalengua.
Esdecir,usarellenguajeencontextosrealesconstituyeunahabilidadcomplejaque
exigedistintostiposdeconocimientoquevanmsalldelosrelativosalapropiaestruc-
turadellenguaje.Comovimosenelcaptulo6,elcomponentepragmticodellenguaje
serelacionaconelusorealdeesteencontextoeimplicaintegrarnecesariamentetodas
lasfuentesdeinformacinquehemosaludidoanteriormente.
Lasnumerosasinvestigacionesquesehanrealizadosobreeldesarrollodelashabili-
dadespragmticas(Bates,1976;Halliday,1975;OchsySchieffelin,1974;Snow,1986,
entremuchasotrasreferencias)muestranqueesuncomponentemuyligadoalashabili-
dadesdeinteraccinsocialyalasqueluegoconstituirnloquesehandenominadoha-
bilidades mentalistas o de teora de la mente (vase Captulo 8). En este sentido, los
orgenes de su proceso de adquisicin pueden rastrearse y encontrarse en los primeros
aos.A travs del uso del lenguaje con los otros, en las conversaciones y narraciones
cotidianas,losniosdesarrollanciertosmodelospragmticossobreellenguaje(Halliday,
1975)ydescubrenlasmltiplesfuncionesyusosaquepuedenservir.Estosmodelosson
muyvariadosysevanenriqueciendoytransformandoamedidaqueelniosedesarrolla
ycrecesuexperiencialingsticayconversacional.Elperodoqueahoraestudiamoses
unespaciotemporalprivilegiadoenrelacinconestasadquisiciones.Losniosamplan
enormemente los recursos para iniciar y mantener conversaciones con los otros, para
hacer peticiones y solicitudes, para expresar su rechazo por algo; es decir, para hacer
distintascosasconellenguaje.
Unadelasfuncionesprivilegiadasdellenguajecuyaimportanciatransciendeelpro-
pio desarrollo lingstico es la funcin narrativa. Comencemos sealando qu es una
narracin:
La narracin es un tipo de discurso o texto que se caracteriza por la presen-
tacin o comentario de acontecimientos que se desarrollan en el tiempo. (Be-
linchn,RivireeIgoa,1992,p.630.)
Enelapartadoanterioryahemosapuntadolacomplejidadasociadaalaactividadde
narrar,ensucalidaddeinterfazentrelosdistintosnivelesdellenguaje:losmsformales
(lxicoygramatical)ylosmsligadosalafuncinyalainteraccin(semnticoyprag-
mtico).Desdeelpuntodevistalingstico,lacomplejidadligadaalaactividaddenarrar
serelacionaconlanecesidaddeconectarunasoracionesconotras,deevitarlaredundan-
cia,deestablecerrelacionesentrelainformacindadaylaquesevaintroduciendocomo
nueva, etc.Todas estas operaciones requieren de un dominio complejo de la forma del
lenguaje(porejemplo,usodeoracionessubordinadastemporalescomocuandolarana
salt,lamoscasalivolando)parapoderexpresarcorrectamentelossignifcadosqueel
hablantetieneintencindetransmitiryparahacerlodeformaordenadaycomprensible
paraeloyente.
Para numerosos autores (entre ellos, Bruner, 1991; Nelson, 1986, 1989, 1996) las
narracionesconstituyenungneroprivilegiadodediscursoporque:1)permitenintegrar
experienciaspresentes,pasadasyfuturas;2)permitencomunicarhistoriasrepresenta-
Captulo 9. El desarrollo del lenguaje oral 219
cionalmente complejas que implican personajes que actan movidos por intenciones u
objetivosencontextosconcretos;y3)permitentransmitirlaescaladevaloresdominante
en el grupo sociocultural. Este estatus privilegiado de las narraciones en la experiencia
humanaesresaltadotambinporotrosintelectualesajenosalquehacerpsicolgico.La
siguientecitaesilustrativaalrespecto:
La narrativa, sin embargo, se halla en una esfera un tanto diferente de las dems
artes. Su medio es el lenguaje, y el lenguaje es algo que compartimos con los
dems, comn a todos nosotros. En cuanto aprendemos a hablar, empezamos a
sentir avidez por los relatos. Los que seamos capaces de rememorar nuestra
infancia recordaremos el ansia con que saborebamos el cuento que nos contaban en la
cama, el momento en que nuestro padre, o nuestra madre, se sentaba en la penumbra junto
a nosotros con un libro y nos lea un cuento de hadas. Los que somos padres no tendremos
difcultad en evocar la embelesada atencin en los ojos de nuestros hijos cuando les leamos
un cuento. A qu se debe ese ferviente deseo de escuchar? Los cuentos de hadas suelen ser
crueles y violentos, describen decapitaciones, canibalismo, transformaciones grotescas y
encantamientos malfcos. Cualquiera pensara que esos elementos llenaran de espanto a
un cro; pero lo que el nio experimenta a travs de esos cuentos es precisamente un encuen-
tro fortuito con sus propios miedos y angustias interiores, en un entorno en el que est per-
fectamente a salvo y protegido. Tal es la magia de los relatos: pueden transportarnos a las
profundidades del inferno, pero en realidad son inofensivos. Nos hacemos mayores, pero no
cambiamos. Nos volvemos ms refnados, pero en el fondo seguimos siendo como cuando
ramos pequeos, criaturas que esperan ansiosamente que les cuenten otra historia, y la
siguiente, y otra ms. (TomadodelDiscursodePaulAusterenlaceremoniaderecepcindelosPre-
miosPrncipedeAsturiasde2006.)
Losniosoyennarracionesdesdeprcticamentesunacimientoporque,deunmodo
uotro,elrelatoonarracindehistorias(personales,realesofcticias)constituyeunras-
gocaractersticodelavidasocialentodaslasculturas.As,yendoalterrenoevolutivoy
comonosrecuerdaBelinchn(2000),losnios:
Escuchanloscuentosinfantilesquelospadresylosadultosengenerallespresen-
tanconosinacompaamientogrfco.
Escuchanlashistoriaspersonalesquelosadultossecuentanentres.
Escuchanlashistoriasprotagonizadaspor(orelacionadascon)elpropionio.
Elaborancooperativamente,ensusconversacionesconlosadultos,narracionesde
loshechosenlosquehanparticipadooenlosquevanaparticipar.
Cuentan,encasayenlaescuela,loquehanhechooleshapasado,yloquequie-
renoplaneanhacer.
Losniosaprendenmuyprontoadiferenciarlosrelatosohistoriasdeotrasformas
deconversacin.Algunosdatoslongitudinales(Nelson,1989),incluso,revelanqueantes
delos2aos,losniosusanunmododevozespecialcuandoactancomonarradores.
Altenerquecontaraotrosexperienciasdelasquenohansidotestigos,comosucedea
partir de los 3 aos en el contexto escolar, deben seleccionar hechos supuestamente de
220 Bloque III. La primera infancia: de los tres a los seis aos
intersparaelgrupo.Estaactividad,esencialparaeldesarrollodelascompetenciasna-
rrativas, constituye tambin un ejercicio de atribucin mentalista y nos remite a las
habilidadesdeteoradelamente(vanse Captulos 8 y 10).
Antesdelos3o4aoslosrelatosdelosniospuedenresultarextremadamentesim-
ples, pero progresivamente van incorporando dispositivos gramaticales especfcos que
sonesencialesparagarantizarlanarratividadycoherencialgico-temporaldeldis-
curso. En concreto, los nios aprenden a utilizar las marcas morfolgicas de tiempo y
aspectoverbales,losadverbiostemporalesparalocalizarcorrectamenteeneltiempolas
accionesquerelatan,trminosrelacionalescomodistintostiposdeconjunciones(copu-
lativas: y, ni; adversativas: pero, sin embargo; causales: porque, es que) y pronombres
personales para expresar la referencia a los personajes sin repetir siempre sus nombres
(l, este, nosotros...).Aunquetradicionalmentesehaconsideradoqueelaprendizajede
lagramticadelosdiscursosesposterioraldelagramticaoracional,actualmente
esmsplausiblesuponerqueambostiposdegramticasseadquierenyoperandurante
laetapainfantilcomodossistemasdeconocimientoplenamenteinterdependientes(Nel-
son,1996).
Adems,laactividaddecontarhistorias,sucesosoexperienciasalosotrosniosy
laelaboracincooperativadehistoriaspersonalesentreniosyadultos(padresoeduca-
dores)constituyeelfactorcrticoquehaceposibleapartirdelos3aoslaconstruccin
derecuerdospersonalesyeldesarrollodelamemoriaautobiogrfca.Enestesentido,
Bruner (1997) plantea que la habilidad para construir y entender narraciones es capital
paraconstruirnuestravidaysulugarenelmundo.Esteautorsubrayaunaideaquenos
parece especialmente interesante: la conexin entre la actividad narrativa de los seres
humanos,yadesdelainfancia,ysuimportanciaenlaconstruccindelaidentidadper-
sonal. La narracin sera un modo de pensamiento y un vehculo para la creacin de
Figura 9.1. Los nios oyen narraciones de los adultos durante todo el desarrollo.
Captulo 9. El desarrollo del lenguaje oral 221
signifcados,propiosycompartidossocialmente.Yunodelosobjetivosdelaeducacin
deberasercrearunasensibilidadnarrativayfomentarlaalolargodeldesarrollo.Fi-
nalizaremosesteapartadoconlavozdeJ.Bruneratravsdelasiguientecita:
... un nio debera saber, tener una idea de los mitos, las historias, los cuentos
populares, los relatos convencionales de su cultura (o culturas). Enmarcan y
nutren la identidad. El segundo supuesto compartido reclama a la imaginacin
a travs de la fccin. Encontrar un lugar en el mundo, por mucho que implique
la inmediatez de la casa, el colega, el trabajo y los amigos, es en ltimo extremo un acto de
imaginacin (...). Un sistema de educacin debe ayudar a los que crecen en una cultura a
encontrar una identidad dentro de esa cultura. Sin ella se tropiezan en sus esfuerzos por al-
canzar el signifcado. Solamente en una modalidad narrativa puede uno construir una iden-
tidad y encontrar un lugar en la cultura propia. (Bruner,1997,p.62.)
3. Las relaciones entre el pensamiento y el lenguaje
desde la perspectiva evolutiva
Hemosvistoquelanarracincomoformadediscursolingsticoconstituyeunvehculo
privilegiadoparaelestablecimientodeuntipoespecialdepensamientoo,mejor,deun
producto de l si se nos permite considerarlo as: el relacionado con la propia iden-
tidad.
Sinembargo,elproblemadelasrelacionesentreelpensamientoyellenguaje,taly
comoaparecienelcontextodelaPsicologaEvolutiva,noserefereexactamenteaesta
cuestin.
Larelacinentrepensamientoylenguajeesuntemaantiguo,quehapreocupado
histricamenteaflsofosypsiclogos,porquelascapacidadespararepresentarseyma-
nipularsimblicamentelarealidadyparacomunicarseconlosotrosconstituyenlasseas
de identidad del ser humano. Jean Piaget retom para la Psicologa del Desarrollo esta
cuestiny,posteriormente,Vygotskiofreciunaperspectivabiendistintaaladelautor
suizoparaanalizardichasrelaciones.
Piaget(1923/1983)descubriquetodoslosnios,apartirdelos3aosaproximada-
mente,hablabanenvozaltaparaellosmismosmientrasjugabanorealizabanalgntipo
deactividad.Noesdifcilobservaraniosdeesasedadesutilizandoestetipodelengua-
je no social en contextos ldicos, por ejemplo. Este autor llam a este tipo de habla
hablaegocntricayladescribiconlascaractersticasqueaparecenenlaTabla9.6.
Tabla 9.6. Caractersticas del habla egocntrica segn Piaget
El habla egocntrica segn Piaget...
1. Esuntipodehablaparaunomismo,sininterlocutor.
2. Acompaaalaaccindelnio.
3. Desaparececuandoelniosuperalafaseegocntrica.
222 Bloque III. La primera infancia: de los tres a los seis aos
Segn Piaget el habla egocntrica no sera sino una manifestacin ms del tipo de
pensamientoegocntricopropiodelniopreescolar.Estainterpretacinescoherentecon
el modelo piagetiano general del desarrollo de la inteligencia (vase Captulo 2) en el
queellenguajeesunamanifestacinmsdelacapacidadsimblica,subordinadaadicho
desarrollo.EnestesentidosepuededecirquePiagetconcebaellenguajecomoproduc-
to del pensamiento. Planteado desde la perspectiva evolutiva, esto es coherente con el
hechodequeenlosniospequeosexisteactividadintelectualsinqueexistaanellen-
guaje(vase Captulo 5).
Aestainterpretacinpiagetianalesiguiunosaosmstarde,en1934,lacrticade
Vygotski(1934/1981)quesupusounareinterpretacinclaramentedistintadelfenmeno
delhablaegocntrica.SegnVygotski,lautilizacindellenguajecomoacompaamien-
todelaaccin,lejosdeconstituirunindicadordelpensamientoegocntrico,constituye
unhitodecisivoeneldesarrollodelnio.Enrealidadrevelalaemergenciadeunanueva
funcin del lenguaje: la funcin de regulacin de las propias acciones.Vemoslo con
algomsdedetalle.ParaVygotski,adiferenciadePiaget,eldesarrollodellenguajeest
ligadosobretodoaldesarrollodelacomunicacin,ytiene,enprincipio,unorigendis-
tinto, no subordinado al del desarrollo del pensamiento o la inteligencia. Puesto que el
lenguajeesutilizadoporelniopequeodesdeelcomienzocomoinstrumentoparala
comunicacin,cuandonecesitautilizarloparaunanuevafuncin,lohacecomosabe:
envozalta.Portanto,loquesucedeentornoalos3aos,segnVygotski,esqueelnio
necesitaaadirunafuncinms,adquiridaenelplanointerpersonal, alasfuncionesco-
municativasyrepresentacionalesdellenguaje(vase Captulo 3).Esafuncinestligada
aladireccin y regulacin de la propia accin.Medianteelhablaautodirigidaycentra-
daenlapropiaaccin,losniosquehastaentoncessloparticipabanenconversaciones
conlosotros,seconviertenalavezenemisoresyreceptoresdesuspropiasemisiones
lingsticas.Yusaneselenguajeprimeroparaacompaarsusaccionesyalgomstarde
paraanticiparseaellas,planifcarlas,etc.Enestesentidonosetratadelenguajeegocn-
trico,sinodeuntipodelenguajequeacompaaalaaccinyalpensamiento.Amedida
que avanza el desarrollo, el habla egocntrica se interiorizara, convirtindose entonces
en pensamiento verbal, un tipo de lenguaje interior como lo denomina Sigun
(1986).
Vemosportanto,quelainterpretacinvygotskianadelfenmenodelhablaegocn-
tricaesabsolutamentecoherenteconsuleydedobleformacindelasfuncionespsico-
lgicas superiores; en este caso, la funcin reguladora del lenguaje como forma de
pensamientosurgeenuncontextointerpersonal(laconversacinconlosdems)yluego
setrasladaalplanointrapersonal(primeroenlenguajeegocntricoydespusenlengua-
jeinteriorizado).
Lacapacidaddelosniosdepensarverbalmente,planifcaraccionesfuturasyevaluar
lasaccionesyapasadas,tieneunaimportanciatrascendentaleneldesarrollopsicolgico
yevidentementeevolucionahastaelfnaldelciclovital.Losadultostambinutilizamos
estetipodehablainterioreincluso,enciertassituaciones,noshablamostambinenvoz
alta.Sinembargo,comoautoresmsrecienteshanpuestodemanifesto,puedeobservar-
se ya antes de la edad sealada por Piaget yVygotski, en los soliloquios que algunos
niosproducenocasionalmenteantesdedormir(Nelson,1989).Elanlisisdelosconte-
nidosyestructurasempleadosenlossoliloquiosporniosdeentre2y3aoshaconfr-
mado que sirven para rememorar y fantasear sobre experiencias cotidianas que, por lo
Captulo 9. El desarrollo del lenguaje oral 223
general,hansidonarradaspreviamenteporlospadresohansidoobjetodeconversa-
cionespreviasentrelosniosysuscuidadores.Deestemodo,apartedesuutilidadpara
el aprendizaje de dispositivos propiamente gramaticales (por ejemplo, conjunciones y
adverbios),lossoliloquiosconstituyenunaocasinmsdeentrenamiento,porpartede
losnios,enlaconstruccindelashabilidadesnarrativasalasquenosreferamosenel
apartadoanteriory,denuevo,alcomienzodeeste.
4. Cmo se explica la adquisicin del lenguaje:
modelos lingsticos innatistas y explicaciones
constructivistas
Eldesarrollodellenguaje,comovimosenelCaptulo6ycomohemosretomadoenlos
apartadosanterioresdeestecaptulo,esunodelosprocesosevolutivoscentralesenrela-
cinaldesarrollohumano.Ellenguajetienecomofuncinbsicalacomunicacin,pero
es adems un medio fundamental para la representacin del conocimiento sobre el
mundoysobreunomismoyparalaregulacindelapropiaconducta.Poresoelinte-
rsporexplicarcmoesposiblesuadquisicin,porconocerqumecanismosdeapren-
dizajerequiereyporcomprenderporquseadquierecontalnaturalidadyfacilidada
pesar de ser una competencia tan compleja son cuestiones que han estado presentes
desdemuchoantesdequelaPsicologaexistiesecomocienciaindependiente.
El volumen de propuestas y publicaciones sobre el tema es inmenso. Nosotros nos
vamosalimitaraacercarallectoradostiposderespuestaparadigmticaalproblemade
la adquisicin del lenguaje: las respuestas de tipo innatista, de la mano del infuyente
lingistaNoamChomsky,ylaspropuestasconstructivistasactuales,entrelasqueselec-
cionaremosladeKarmiloff-Smith,unaaventajada(ycrtica)alumnadePiaget.Estosdos
tiposderespuestasconstituyennoslopropuestasalternativasalproblemaconcretodel
aprendizaje del lenguaje, sino que dejan entrever dos modos bien distintos de concebir
cmoseorganizayconstituyelamentehumana.
EllingistaN.Chomsky(1959)realizunacrticademoledoraaSkinner,unpsic-
logo conductista que conceba en los aos cincuenta el lenguaje como conducta verbal
quepodaaprendersedelmismomodoquecualquierotraconductahumana,pormedio
delreforzamiento.
LaaportacingenialdeChomskyconsistiensituarellenguajeenelplanocogniti-
voyplantearqueelrasgofundamentaldelaactividadlingsticaerasucreatividad,
enelsiguientesentido:ellenguajeconstituyeuntipodecompetencia(untipodecono-
cimiento)quepermitegenerarinfnidaddeoracionesdistintasapartirdeunconjuntode
reglas relativamente pequeo. Evidentemente, Chomsky centra su caracterizacin del
lenguajeentornoalconocimientogramaticalquepareceserelmsdifcildeexplicary
comprender.Enestesentido,esciertoquelosaprendicesdecualquierlenguaestnex-
puestosaunconjuntorelativamentelimitadodefrasesymuestrasdehabla(lasquees-
cuchayledirigensusinterlocutoresensusinteraccionescotidianas)y,sinembargo,una
vezadquiridoellenguajeunopuedeproducirunconjuntodefrasesinfnitas,frasesque
no se han escuchado jams. Las preguntas que se hizo Chomsky son las siguientes:
cmoesposibleexplicarestepotencial?,cmoesposiblegeneraresasoracionesinf-
224 Bloque III. La primera infancia: de los tres a los seis aos
nitas a partir de la experiencia lingstica, un conjunto de emisiones (las de los otros)
relativamentepequeoopobre?Vistaas,latareadeadquirirunalenguallevaaChoms-
ky(1959)aplantearlacuestinenlossiguientestrminos:
El estudio de la habilidad observada en un hablante parece que nos fuerza
a la conclusin de que esta gramtica es de un carcter extremadamente com-
plejo y abstracto, y que el nio pequeo ha logrado llevar a cabo con xito lo
que, desde un punto de vista formal por lo menos, parece un tipo de construccin
terica muy complicado(p.27).
La nica solucin que encuentra Chomsky para explicar la adquisicin del conoci-
mientogramaticalporpartedelosniosessuponerquetienequehaberunconocimien-
toinnato,unaespeciedefacultadparaellenguajequevendradealgnmodoyainscri-
taenelbagajegenticodelaespeciehumana.Chomskydenomingramticauniversal
a esta capacidad humana intrnseca. Esta gramtica incluye un conjunto de principios
abstractosrelacionadosconelfuncionamientodellenguajequeserancomunesatodas
laslenguas.Graciasalagramticauniversal,unavezquelosniosseenfrentanalaex-
periencialingstica,esdecir,entranencontactoconsulenguamaterna,sabrancmo
organizar la informacin y no tendran que depender nicamente del aprendizaje para
extraerelconocimientogramatical.Evidentementeelaprendizajeesnecesario;laslen-
guassondistintasenrelacinasufonologaysuvocabulario.PeroChomskyconsidera
queesosprincipiosuniversalesrelacionadosconloqueescomndesdeunpuntode
vistaestructural,gramaticalatodaslaslenguasdelmundosonimprescindibles.Dicho
conocimiento comn o gramtica universal sera la llave que permitira a los nios pe-
queosabrirlapuertaaunaprendizajetancomplejocomoelgramatical.Enpalabrasde
Aguirre(2001)los principios... son algo que el nio no tiene que aprender, una especie
de regalo de la naturaleza que hace posible la adquisicin del conocimiento gramatical
(p.23).
Algunosautores,seguidoresdelastesisgeneralesdeChomsky,utilizanexpresiones
como el instinto del lenguaje (Pinker, 1989) o nacer sabiendo (Mehler y Dupoux,
1992),llevandoalextremolaposicininnatistaensentidofuertequeellingistaintro-
dujoenelpanoramadelapsicologacognitiva.
Lapropiateorachomskyanahaexperimentadodiversoscambiosdesdesuformula-
cinoriginalafnalesdelosaoscincuenta,perosemantienenlospostuladosprincipales
quedeformageneralhemosintroducidoanteriormente.Y,sobretodo,laideadequela
facultad de lenguaje constituye una capacidad innata e independiente de la inteligencia
general.Veamosahoraunaexplicacinconstructivista,contrapuestaalachomskyana,de
lamanodeA.Karmiloff-Smith.
Karmiloff-Smithesunainvestigadorabritnica,formadaenGinebrajuntoaPiaget
ysuescuela.Estaautoraadoptunaposturarelativamentecrticaalapiagetianasobre
elpapeldellenguajeeneldesarrollodelnio.Porunaparte,asumelospostuladoscons-
tructivistas generales de la teora de Piaget, pero por otra parte considera que el autor
ginebrinonosituensujustolugarellenguajerespectoaldesarrollocognitivogeneral.
Karmiloff-Smith lleg a plantear que el lenguaje constitua una tarea o problema de
desarrolloporsmismo(a problem-space per se)(Karmiloff-Smith,1979).ParaPia-
Captulo 9. El desarrollo del lenguaje oral 225
getysusseguidoreslaadquisicindellenguajerequierelosmismosmecanismosgene-
rales de aprendizaje que utilizan los nios para aprender sobre cualquier cosa, sobre
cualquierdominiodeconocimiento:sobreconceptosfsicos,numricos,sobreelespa-
cio,sobrelasconvencionessociales,etc.Karmiloff-Smithseopusoaesteplanteamien-
to,peroalaveznoestabadeacuerdoconaquellasotrasposturascomolasderivadas
delmodelochomskyanoqueconsideranqueellenguajeconstituyeundominioabso-
lutamente especfco de conocimiento y adquisicin. En realidad, esta autora propone
un modelo de desarrollo (Karmiloff-Smith, 1992/1994), no slo respecto al lenguaje
aunque aqu nos ceiremos a l, sino respecto al desarrollo cognitivo general del
nio, que trata de superar la anttesis entre racionalismo-innatismo y constructivismo
generala la Piaget (vanse Captulos 1 y 2). Dichomodelorecogelosnumerososha-
llazgossobrelashabilidadestempranasdeprocesamientodellenguajequeyaexhiben
losbebsdesdeeliniciodesudesarrollo(recurdese lo expuesto en el Captulo 6).La
sntesisqueproponelaautoraseresumemuybienensuspropiaspalabrasenunlibro
reciente:
... el lenguaje es, en efecto, especial, pero como hiptesis creemos que la solu-
cin de la evolucin no ha consistido en preinstalar unas representaciones lin-
gsticas complejas en la mente del neonato. Creemos, en cambio, que la evo-
lucin ha aportado dos cosas interesantes. En primer lugar, ha hecho que en los
humanos el perodo de desarrollo cerebral postnatal sea extremadamente amplio, de manera
que las infuencias ambientales puedan confgurar la estructura del cerebro en desarrollo.
Sin embargo, desde nuestro punto de vista el cerebro no es una tablilla blanca homognea,
como diran los conductistas. Nuestro segundo argumento es que la evolucin nos ha equi-
pado con una serie de mecanismos de aprendizaje que, aunque no sean especfcos de domi-
nio, son lo que llamaramos relevantes para el dominio. (...) en el nacimiento (y antes) el nio
posee unas predisposiciones mnimas que le hacen prestar particular atencin a ciertas par-
tes del medio, como, por ejemplo, rostros y voces. Desde el principio, diferentes mecanismos
cerebrales estarn ms sintonizados para procesar un tipo de entradas que otro. Por tanto,
un mecanismo que es sensible a entradas sucesivas y que se desvanecen con rapidez puede
prestar especial atencin al lenguaje oral o de signos... y a medida que se especializa cada
vez ms en el procesamiento del lenguaje, estar ms dedicado a ese dominio especfco. Por
eso en la edad adulta acabamos con esas reas del cerebro especializadas en el lenguaje. En
otras palabras, el cerebro infantil no empieza con unos circuitos dedicados en exclusiva a
procesar el lenguaje, sino que acaba con unos circuitos especializados en funcin de la ex-
periencia.(KarmiloffyKarmiloff-Smith,2005,pp.20-21.)
Lacitaanteriorrecogemuybienlaoposicindelasautorasalaexistenciadecono-
cimientoorepresentacionesinnatassobreellenguajequeestuvieranyapreinstaladas
en la mente del recin nacido. Por otra parte, cuestionan tambin la idea de que haya
mecanismos de procesamiento especfcamente destinados al aprendizaje del lenguaje.
Frenteaambasideas,lasolucinqueseplanteaseraasumirqueelconocimientodel
lenguajeeselproductocomplejodelainteraccinentreunaspredisposicionesiniciales
(vase Captulo 6, Apartados 3.1 y 3.2)ylapropiaexperienciaconlalenguaenlaque
seveninmersoslosbebsdesdesunacimientoencualquierlugardelmundo.Dealguna
226 Bloque III. La primera infancia: de los tres a los seis aos
maneralanaturalezagarantizaqueelbebhumano,frenteaotrascrasanimales,atienda
desdemuytempranamentealassealeslingsticas;estaatencinconstituyeelprimer
escalndelprocesodeaprendizaje.Sisegarantizalaatencin,lainformacinlingstica
secomenzaraprocesar,aanalizar,aalmacenaryprogresivamenteseconstituirenun
dominio de conocimiento especfco. Pero esa especifcidad de dominio ser en ltima
instanciaunaconstruccin,frutodeunlargoprocesodeaprendizaje,desdeelfetohasta
laadolescenciaalmenos,ynoalgodadoyadesdeelinicio.
Laconcepcingeneral,constructivistaperomatizada,deKarmiloff-Smithconstituye
unasntesisdenumerosascontribucionesdeinvestigadoresactualesquetrabajandefor-
maintensivasobreelprocesodeadquisicindellenguaje.Paratodoselloslaideadela
gramtica universal chomskyana est muy desencaminada. Si la especie humana tiene
algndonespecialrelacionadoconellenguaje,estenoconsisteendichagramticaen
s,sinoenlacapacidadparaaprenderla.
5. Aprender el lenguaje en contextos bilinges
Hasta ahora nos hemos estado refriendo a la adquisicin y desarrollo del lenguaje en
contextosmonolinges,esdecir,enelcasodeniosqueaprendenunanicalenguaen
la infancia. Sin embargo, desde siempre y de forma muy evidente en la actualidad, el
fenmeno del bilingismo y del multilingismo existen. Por numerosas circunstancias
familiares,sociales,econmicas,etc.,haymuchaspersonasquedesdepequeosseven
abocadosaaprendermsdeunalengua.Dichoaprendizajepresentaunasparticularidades
interesantesymltiplesvariacionesdesujetoasujeto.
En este apartado nos vamos a detener un poco en los procesos de aprendizaje del
lenguaje en contextos bilinges. Sealaremos algunas caractersticas de los mismos y
fnalizaremos con algunas consideraciones sobre las ventajas del bilingismo y las
circunstanciasenlasquedichacondicin,ladeserbilinge,constituyeunenriquecimien-
todeldesarrollopsicolgicogeneral.Comencemosplanteandoalgunassituaciones,como
lasqueserefejanenelTabla9.7queconducenalbilingismo:
Tabla 9.7. Situaciones bilinges
Ejemplos
Caso1:JohnyMarasonunaparejadeprocedenciainglesayespaolarespectivamente,conresidencia
enMadrid.Tienenunbebydecidendirigirsealpequeocadaunoenunalengua.Suintencinesqueel
niollegueaserbilingeyhanpensadollevarleauncolegiobilinge(espaol/ingls).
Caso 2: Ibrahim es un nio de 5 aos, hijo de una familia procedente del Magreb. Sus padres siempre
hablanconelnioenundialectodelrabe.IbrahimvaauncolegioenEspaadesdelosdosaos.Habla
dichodialectodelrabeyespaol.Estempezandoaleeryescribirenestaltimalengua.
Caso 3: Julia es una nia de 1 ao, nacida en Espaa de padre espaol y madre alemana. Su madre le
hablaenalemncuandoestnencasa;supadresedirigeaellaenespaol.Lospadreshablanentresen
alemn,aveces;otrasvecesencastellano.LaparejahadecididoquelaniavayaaunaEscuelaInfantil
pblicadesuciudadyluegoirauncolegiomonolingedeespaol.Piensanviajardevezencuandoa
Alemaniaypasaralgunatemporadaestivalall,juntoalafamiliamaterna.
Captulo 9. El desarrollo del lenguaje oral 227
Sialgotienenencomnlasanterioressituacionesesquelosniosprotagonistases-
tninmersosenunprocesodeadquisicindemsdeunalengua.Sinembargo,lascon-
dicionesdeunosyotrossondistintas,yprobablementelosresultadosdesusprocesosde
aprendizajelingsticoypersonaltambinlosern.
Esmuydifcil,comoatestigualainmensabibliografasobreeltema,darunadefni-
cindebilingismoenlaqueestndeacuerdolosdistintosautores.Sigun(1998)de-
nomina bilinge al individuo que posee dos sistemas lingsticos y que es capaz de
utilizarlos en cualquier circunstancia con una facilidad y efcacia semejantes (p. 72).
Ahorabien,comoelpropioSigunreconoce,elbilingeperfectonoexiste,einclusola
defnicinanteriorhabraqueentenderlacomounadefnicindelbilingismoidealque
slosirveenlamedidaenqueseleacercaunindividuoconcreto.Evidentementenote-
nemosdosvidas;unapersonabilingeseleccionaloscontextosenqueutilizaunayotra
lengua.Porejemplo,unniopuedehablarunalenguaencasa,perootraenlaescuela;
de este modo su mundo afectivo familiar, el ms prximo, estar impregnado por una
lengua,peronoporlaotra.Aunqueconeltiempoaprendaatraducirdeunalenguaala
otra,elmanejodeambasnosernuncaidnticoentodossusdetalles.
Lo que sin embargo no se debe confundir con el concepto de bilingismo es el de
aprendizajedeunasegundalengua.Unprofesorqueescapazdeleereninglslabiblio-
grafarelacionadaconsutrabajoeinclusoquelohablaenciertoscontextosprofesionales
nosepuedeconsiderarbilinge.VolviendodenuevoaSigun(1998)quiz la caracte-
rsticas ms tpica del bilinge es que ha interiorizado la segundo lengua y es, por tanto,
capaz de pensar en una u otra segn las circunstancias (p.72).
Endefnitiva,unapersonabilingeesaquellaqueporlascircunstanciasqueseaha
necesitado aprender a utilizar dos lenguas; el verbo necesitar es importante en esta
defnicin. Evidentemente la defnicin de bilingismo se puede hacer extensiva a ms
deunalengua;entonceshablaramosdemultilingismo,unacondicinbastanteexten-
didaenmuchosdelosllamadospasespobresdelmundo(muchospasesafricanos,la
India,etc.).
Perocentrndonosenelprocesomismodeadquisicindemsdeunalengua,cules
sonlasetapasofasesdeldesarrollolingsticoenlosniosbilinges?Sepodrapensar
queelnioquedesdesunacimientoestexpuestoadoslenguasdistintas(porejemplo:
espaolyrabe)tieneunadobletarea.Esdecir,tienequeaprenderdossistemasdeso-
nidosdiferentes,dosvocabulariosdistintos,dosconjuntosdereglasgramaticales(mor-
fosintcticas)ydosformasdeusarellenguajedeformaapropiadaalosdistintoscontex-
tos.Yesto,sinentrareneltemadelalecto-escrituraylashabilidadeslingsticastpicas
delcontextoescolar.
Asumirqueaprenderdoslenguas,lenguaAyB,esdosvecesmsdifcilqueapren-
derslouna(lenguaAoB),equivaleasuponerquecadaniocuentaconunacapacidad
determinadaylimitadaparaellenguaje.Siguiendoestalgica,siesacapacidadlaocu-
pamosconlasdoslenguasenvezdeconuna,entonceseltrabajoserdifcilycompli-
cado,einclusohabrproblemas.Haymultituddecasosconocidosybiendocumentados
deniosquehanadquiridodos(oinclusoms)lenguasalavezporquesuspadrestenan
lenguasdistintas.Estosniosnotienenproblemasnicognitivosnilingsticos.Hanad-
quirido las dos lenguas de forma natural y fuida, aunque, evidentemente su desarrollo
lingstico tiene caractersticas peculiares. La Tabla 9.8 sintetiza las principales fases
caractersticasdeestedesarrollo.
228 Bloque III. La primera infancia: de los tres a los seis aos
Tabla 9.8. Principales fases del desarrollo lingstico bilinge
Procesos fonolgicos, lxicos y gramaticales
Procesos fonolgicos.Losniosexpuestosadoslenguasdesdemuytempranamente,sobretodosison
lenguasconentonacionesmuydiferentes,distinguenydiscriminanambasdesdemuypequeos.
Laexperienciaconmsdeunalenguafavoreceladiscriminacinperceptiva;noladifculta
Procesos lxicos.Alprincipiodeldesarrollodellenguaje,elnioslotieneunsistemadevocabulario
(lxico);esdecir,conocepalabrasenlosdosidiomasalosqueestexpuesto,perotiendeaevitarequi-
valentesdetraduccin,palabrasoexpresionesque,encadaunadelaslenguasalasqueestexpuesto,
sereferenalomismo.Unequivalentedetraduccindeunapalabraenunalenguavendraaserlapa-
labraoexpresinsinnimaenlaotralengua;elequivalentedelapalabracasaeninglseshouse,
yelequivalentedelsaludoenespaolqutal?,es,eningls,how is it going?.Enunasegunda
etapa de la adquisicin del vocabulario, el nio empieza a construir un sistema de equivalentes para
palabrasqueyallevausandountiempoencadalengua.Yasabequeunamismacosa,objetoosituacin
tienenombresdistintosencadalengua.Sinembargo,apesardelaevolucinqueseobservaenlase-
gundaetapadelaadquisicinlxica,duranteelprocesoseobservanavecesmezclasdelosdosidio-
mas.Estoocurreporquelaspalabrasnoseadquierennecesariamentealmismotiempoenlosdosidio-
mas. El nio puede haber aprendido la palabra elefante en el colegio, pero an no ha hablado de
elefantesconsuspadres,quehablan,porejemplo,ruso.Esenestassituacionescuandoelnioutiliza
enunamismafrasepalabrasdeambaslenguas.Veamosunejemplo:
Mishaesunniode2aosyochomeses,depadresrusosquevivenenEspaa.Unda,unamigo
desuspadresleregalauncuentodeanimales.Elniocorrehaciasumadreysealandoalcuento
dice:Smatrmma,etajigafa.Laprimerapartedelafraseladiceenruso(smatrmma,eta=
mira,mamestoes...)ylasegundaenespaol(jigafa=jirafa).Silamadre,enestecontexto,dice
lapalabrarusaparajirafa,entoncesesprobablequeelniolaaprendayestasituacinnosuce-
dadenuevo.
Procesos gramaticales.Silaexposicinylaprcticaenlasdoslenguasesequilibrada,seobservaquelos
niossiguenuncursodeaprendizajegramaticalsemejantealdelosniosmonolingesdecadaunade
laslenguasqueestaprendiendoelniobilinge.Losniosbilingessevandandocuentatraselpero-
doinicialdeadquisicin,dequealgunasreglasmorfolgicasosintcticaspertenecenenexclusivaauna
uotralenguaydebenpermanecerseparadas.Secompruebaestafaseenlascorreccionesquelosniosse
hacenespontneamente.Porejemplo,sidicenunafraseenunalengua,peroconlaestructuradelaotra,
sedancuentaysecorrigen.Esteperododediferenciacincontinadurantetodoeldesarrollolingstico.
Losprocesosrecogidosenlatablaanteriorsonprocesosgenerales.Sinembargo,si
algocaracterizalaadquisicinbilingeeslavariabilidad,pueslassituacionesdeapren-
dizajesonmltiplesysedanencontextosmuydistintos.Porejemplo,noeslomismo
aprenderdoslenguasalavez(bilingismosimultneo)queaprenderlasdeformasuce-
siva(bilingismosucesivo).Sinembargo,sielnioesanpequeoytieneuncontacto
sufcienteymotivanteconlasegundalengua,llegaradominarlayutilizarlaenloscon-
textosquelorequieran.Estacuestinnosllevaaunaspectomuyconocidoenelcampo
delaadquisicindellenguaje,queabordamosenelsiguientesubapartado.
5.1. La importancia de los perodos crticos: por qu es mejor
aprender las lenguas desde pequeos?
Comencemosporladefnicindeperodocrtico.Estetrminoseacuparareferirse
al perodo de tiempo, limitado, establecido por la naturaleza en el que los mecanismos
para la adquisicin de una determinada habilidad estn activos. Si bien surgi en un
Captulo 9. El desarrollo del lenguaje oral 229
contextodistintoaldeldesarrollodellenguaje(PrezPereira,1995:p.228),enseguida
seaplictambinaestedominioevolutivo(Lenneberg,1967).Aunquehaydiscusiones
sobresuextensin,tradicionalmentesehasupuestoqueabarcadesdeelnacimientohas-
ta los 12 aos. Hasta los tres o cuatro aos se supone que el nio est en condiciones
especialmentebuenasparalaadquisicindellenguaje.Desdelostresocuatroaoshas-
talaadolescencia,lasposibilidadesdeaprendizajesiguensiendofavorables.Despusel
cerebropareceestarmenospreparadoparaadquirirelconocimientoyusodellenguaje.
Eltemadelosperodoscrticosestsiendomuydiscutidohoy.Sinembargo,seacep-
tademodogeneralque:
Losniosadquierenellenguajedeformamsfcilyefcazquelosadultos.
Losprimerosaosdevidasonespecialmenteapropiadosparalaadquisicindelas
lenguas por varias razones: razones biolgicas (de funcionamiento y plasticidad
cerebral), razones ambientales (las condiciones de interaccin comunicativa pro-
pias de esa etapa del desarrollo favorecen la adquisicin), razones cognitivas y
perceptivas.
En conexin con estas ideas, se suele hablar hoy de perodo sensible, en lugar de
perodocrtico,dejandolapuertaabiertaaunamayorfexibilidadyplasticidadenrela-
cinalasposibilidadesdelaprendizaje.Encualquiercasopareceaprioriqueserbilinge
esunacondicinventajosaparalosindividuosquelaostentan.Desdeunpuntodevista
estrictamentelingsticoparecequeconocermsdeunalenguaesmejorquereducirsea
la condicin monolinge. Ms all de la simplicidad de este argumento es importante
resaltar una vez ms que el proceso de aprendizaje del lenguaje no es un dominio de
desarrolloaisladodelosdems.Elaprendizajedeunalenguatienelugarenuncontexto
socialycultural,ylasfuncionesdellenguajesonmltiples,entreellaslasdeayudara
constituirlapropiaidentidadpersonal.Abordaremosestetemaenelsiguienteapartado.
5.2. Ventajas del bilingismo: en qu condiciones
tiene consecuencias positivas para el desarrollo general?
Comenzaremosesteapartadosintetizandoalgunasdelascondicionesgeneralesquecon-
tribuyenaquelacondicinbilingeseconstituyaenventajosaparaeldesarrollopsico-
lgicodelnio(vase Tabla 9.9).
Sisedanestascondiciones,lomsprobableesquelasituacinbilingeconllevelas
siguientesventajas:1)Lamsevidenteeslaadquisicindealmenosunalenguamsde
locomnenlapoblacingeneral,conlasventajassocialesyprofesionalesfuturasaso-
ciadas;2)Losniosbilingessonmsconscientesdelaspropiedadesdelalengua,pue-
den refexionar (y de hecho lo hacen) sobre el lenguaje como sistema de smbolos, y
estashabilidadesfavorecenypreparanelaprendizajedelalecto-escriturayotrosapren-
dizajesabstractos;y3)Losniosbilingesestnmssensibilizadosymotivadoshacia
ladiversidadlingsticaycultural,locualaadeuncomponentedefexibilidadasude-
sarrollointelectual.Adems,alaprenderunaterceralenguajugarnconventaja.
DelaTabla9.9sededucelaimportanciadelosfactoresexternos;esdecir,sisega-
rantizanunascondicionesfamiliaresysocio-afectivasadecuadas,elnionoparecetener
difcultadesinsalvablesparaadquirirmsdeunalengua.Dehecholosniosquecrecen
230 Bloque III. La primera infancia: de los tres a los seis aos
endichascircunstanciasfavorableslogranunmanejoadecuadodelaslenguasyconsiguen
gradosdeidentifcacinaceptablesconlasculturasycontextosenquedichaslenguasse
hablan. Sin embargo, esto no siempre es as. Para cualquier educador (educador social,
profesor,pedagogo,psiclogo)conocerlassituacionesenlasqueunniotendrdifculta-
desderivadasdesucondicinbilinge/biculturalesespecialmenterelevante,puespermi-
tepensarenestrategiaspreventivasoenactuacioneseducativasdirigidasacompensarlas.
Hay un caso concreto de bilingismo que merece un comentario independiente por
laproblemticaquesuscita.Setratadeloshablantesdelenguasminoritarias,especial-
menteaquellosquepertenecenagrupossocialesmarginadosocuyaculturaespocovalo-
rada.EnEspaatienenproblemasescolaresloshijosdeinmigrantesmagrebesyproce-
dentesdealgunospasesdelllamadotercermundo,loshijosdepersonasprocedentes
deEuropadelEste,etc.LaTabla9.10recogelacomparacinentredossituacionesbien
distintasqueocurrenenlarealidaddenuestropas.
Tabla 9.10. Comparacin entre dos situaciones bilinges que conducen a resultados distintos.
[L1 = primera lengua; L2 = segunda lengua]
Alumno perteneciente
a la mayora lingstica (espaol)
Alumno perteneciente a la minora
lingstica (por ejemplo, marroqu)
AprenderunaL2leenriquecer.
Gruposocioeconmicomedio(lamayora).
Elprogramaescolarrefejaelsistemadevalores
desugrupo.
Elespaoleslalenguadominante.Tienepresti-
gioyapoyoinstitucional.
Elaprendizajedelespaolestgarantizado.
Elniodesarrollasuidentidadculturalnativa.
Aprender espaol es imprescindible para su
adaptacin.
Gruposocioeconmico,generalmente,bajo.
Su sistema de valores es ignorado o poco reco-
nocido.
Sulenguamaterna(L1)estdesvalorizadaenla
sociedad,sinapoyoinstitucional.
Su L1 se pierde con frecuencia o queda restrin-
gidaalentornofamiliar.
Se rechaza frecuentemente la cultura de origen
sinasimilarsetotalmentealadelamayora.
Alaconvivenciaentredoslenguasenrelacindedesigualdadseledenominadisglo-
sia,mientrasquealassituacionesdeinadaptacin,tantoalaculturadeorigen,comoa
Tabla 9.9. Condiciones en las que el bilingismo tiene consecuencias positivas
para el de sarrollo
Cundo es positivo el bilingismo?
1. Cuandoselograunniveldeconocimientosufcienteenlasdoslenguasporquesehatenidoelcon-
tactoeinteraccinadecuadosconcadauna.
2. Enelcasodeniosqueaprendenlasegundalenguaenelcolegio,esnecesariounbuendesarrollode
lalenguamaterna(L1).
3. Antecedentesfamiliaresfavorables(culturales,afectivos,sociales)favorecenunabuenaimplantacin
delbilingismoysusconsecuenciaspositivas.
4. Buenprestigiosocialdelasdoslenguas.Cuandoestasituacinnoseda,sepuedenaplicarestrategias
quesirvanparacompensarestasituacin,atravsdeprogramasescolares,sociales,etc.
5. Ysobretodo,actitudesyexpectativaspositivasdepadres,profesores,educadoresenrelacinaldesa-
rrollodelnio.
Captulo 9. El desarrollo del lenguaje oral 231
lanuevacultura,seledenominaanoma.Elobjetivodeunprogramaeducativo,enestos
casos,debeserelbilingismoeldominiodelasdoslenguasporigualylaintegra-
cinaceptacindelaculturapropiayadaptacinalaculturamayoritaria.
Veamos, por su relevancia prctica, un ejemplo en el que se pone de manifesto la
necesidaddesersensiblealosretosqueplantealaintegracinyelbilingismo:
Empieza un nuevo curso. En una clase de nios de 5 aos, la maestra pide a los nios
que dibujen una familia. Todos los nios se ponen a la tarea, menos Acharad, un nio
marroqu que viene por primera vez al colegio. La maestra se da cuenta, se sienta junto
a l y le explica lo que tiene que hacer con la ayuda de lminas, dibujos, etc. Ya entien-
de algo de espaol, pues lleg a Espaa con 4 aos. El nio de repente comprende,
sonre y se pone a hacer la tarea. Los dems nios van terminando y entregan sus di-
bujos a la profesora. Acharad sigue dibujando y pide otra hoja. Los dems nios le
miran y van a contarle a la maestra que Acharad ha dibujado a muchos padres y ma-
dres. La maestra se acerca y le dice:
No, Acharad, no hace falta que dibujes a todos tus parientes, slo a tu familia, a
los que viven contigo.
Acharad mira a la profesora sorprendido. La maestra cree que no ha comprendido
y dibuja una casa con una mam, un pap y dos nios.
Ves? Slo tienes que dibujar a la familia que vive contigo...
Pero el nio sigue sin comprender, porque l vive con su madre, el hermano mayor
de su madre (que hace de cabeza de familia) con su mujer y dos hijos, el hermano
pequeo de la madre, que es el que sabe ms espaol y va a hablar a veces con la
directora del colegio (la maestra cree que es el padre del nio) y la hermana pequea
del propio Acharad. El padre del nio slo viene a veces porque est trabajando en
Francia.
CONLOSPIES
ENLATIERRA
Los retos de la integracin y el bilingismo:
un caso real
El ejemplo sirve para subrayar la idea de la importancia que tiene para el autocon-
ceptodeestosniosquelosmaestrosyeducadorescompruebenqusignifcansusmen-
sajesparaellos.Encasoscomoeldelejemplosucedeademsquelasfamiliasnoconsi-
guen mantener la lengua materna, la minoritaria, y sus hijos acaban por perderla. La
Tabla9.11resumealgunasdelasprincipalescausasdeestaprdida.
Anteestassituacionesyparaevitarquesedesarrolleunbilingismoincompletoy/ouna
faltadeidentifcacinconlaculturafamiliar,sepodranproponerlassiguientesmedidas:
Proporcionaralosniosunaescolarizacinquecontineeldesarrollodesulengua
materna(L1)yquecontribuyaavalorarsupropiacultura;comoconsecuenciaes-
taremos promocionado el desarrollo de un autoconcepto positivo, con las conse-
cuenciastantosociales,comocognitivasyemocionalesquesederivandeste.
Parallegaraserverdaderamentebilingesehadepoderhablar,comprender,leer
yescribirenlasdoslenguas.Enelcasodelenguasminoritariasnosiempreseal-
canzanestasmetas.Esfrecuenteencontrarniosyadolescentesquesonanalfabe-
232 Bloque III. La primera infancia: de los tres a los seis aos
tos(noleenniescriben)ensulenguamaterna.Evidentemente,estasituacincon-
tribuye a desvalorizar la lengua propia. La escuela y la familia han de ser
conscientesdeestasituacinytratardedarsolucinalamisma.
Tabla 9.11. Condiciones en las que el bilingismo no se mantiene.
Cundo se pierde el bilingismo?
Hayvariasrazones.Esimportantequeeleducadoromaestrodelniolasconozcaylascomparta,sies
necesario,conlospadres:
Lospadresdebensaberquenosellegaaserbilingesloporquesehableunalenguaencasayotraen
elcolegioyenlacalle.
Silospadressesientenavergonzadosdesuorigenculturalpuedequenomotivenalnioparaquede-
sarrollelashabilidadeslingsticasencasa.
Otrasveces,lospadresaprendenprontolalenguamayoritariaycreenqueesmejorhablarenesteidio-
maconsushijos.
Lalenguaseaprendeconlacomunicacin.Lospadresdebenpasartiempoconsushijos,disfrutarcon
ellos,hablardecosasquelesinteresenmutuamente;endefnitiva,debenusaryhacerusarsulenguaal
nioencontextoscomunicativosreales.
Noesfcilmantenerunalenguaminoritariaenunacomunidadenlaquesehablaotralengua(lama-
yoritaria). Tanto los padres como el nio han de poner mucho de su parte. Pero... el resultado puede
compensarestosesfuerzosconcreces.
Conestasmedidasdecarctergeneralterminamosesteapartado,resaltandounavez
ms la enorme amplitud que tiene el tema del bilingismo y sus consecuencias para el
desarrollogeneraldelosnios.
Lecturas complementarias
Aguirre,C.yMariscal,S.(2001).Cmo adquieren los nios la gramtica de su lengua. Perspec-
tivas tericas. Madrid:EdicionesUNED.
Halliday, M.A. K. (1982). Exploraciones sobre las funciones del lenguaje. Barcelona: Editorial
MdicayTcnica.
Karmiloff,K.yKarmiloff-Smith,A.(2005).Hacia el lenguaje. Madrid:EdicionesMorata.
SnchezLpez,M.P.yRodrguezdeTembleque,R.El bilingismo: Bases para la intervencin
psicolgica.Madrid:Sntesis.
Sol,R.(2000).Eldesarrollodelapragmtica.EnSerra,M.,Serrat,E.,Sol,R.,Bel,A.yApa-
rici,M.La adquisicin del lenguaje. Captulo8.Barcelona:ArielPsicologa.
Captulo 9. El desarrollo del lenguaje oral 233
Actividades
1. Conteste a las siguientes preguntas
Considere la siguiente produccin de un nio de 4 aos: este juguete est doto. En
ella se observa el siguiente fenmeno:
a) Un error sintctico que afecta al verbo producido por el nio.
b) Una pronunciacin incorrecta que revela la presencia de un retraso del habla.
c) Un proceso fonolgico relativo a la sustitucin de un fonema de adquisicin
tarda en espaol.
El/los proceso/s de desarrollo lxico ms importante/s entre los 3 y los 6 aos es/son:
a) El crecimiento cuantitativo tan enorme que se produce en relacin al vocabu-
lario de los nios.
b) Procesos cuantitativos (por ejemplo, aumento del vocabulario), pero tambin
procesos cualitativos relativos a la organizacin del lxico.
c) Procesos fonolgicos de simplicacin del habla que permiten incorporar
palabras aunque an no se pronuncien correctamente.
El supuesto fundamental de la teora lingstica de Chomsky sobre la adquisicin
del lenguaje es el relativo a:
a) La necesidad de que exista una base de conocimiento innato sobre el funcio-
namiento sintctico de las lenguas.
b) La imposibilidad de adquirir una lengua ms all de la adolescencia por
razones biolgicas.
c) La existencia de mecanismos de aprendizaje de tipo perceptivo que aplican los
recin nacidos al lenguaje.
2. Lea atentamente el siguiente texto tomado de Belinchn, Rivire e Igoa (p.
179) referido a una de las funciones del lenguaje. Su tarea consiste en lo si-
guiente: 1. Extraer las ideas principales de forma resumida. 2. Establecer la
conexin entre lo que se plantea en el texto y alguna de las habilidades evo-
lutivas que se han tratado a lo largo de este captulo.
(...) El lenguaje no es slo un sistema de relacin con los dems, sino que
lo emplean los usuarios para comunicarse consigo mismos, defniendo
as un plano refexivo y metacognitivo de conciencia, que modifca esen-
cialmente la experiencia humana y el modo de ser del hombre. De este
modo el lenguaje modifca el medio interno del hombre y defne, en l, un nuevo plano
que probablemente no se encuentre en otras especies animales: el plano de una concien-
cia, por as decirlo, de segundo orden, que posee una estructura semitica, permite ni-
veles de refexividad sin precedentes, y consiste en procesos autocomunicativos. A partir
de esta adquisicin compleja, el mundo humano se modifca por completo.
3. Considere los siguientes casos de bilingismo y responda a las preguntas que
se formulan a continuacin.
Caso 1. Edad del nio: 3 aos. Pas de origen del nio: Japn. Lengua materna
del padre y la madre: japons. Escolarizacin: Se inicia a los 3 aos en un colegio
234 Bloque III. La primera infancia: de los tres a los seis aos
monolinge de espaol, cuando la familia llega a Madrid. El nio slo dice algunas
palabras en castellano al principio. Lnea de actuacin de los padres: Hablan al nio
en japons y visitan con cierta frecuencia a amigos japoneses. Le cuentan cuentos
e historias propias de su cultura en casa y ven dibujos animados en esta lengua.
Cuando estn con personas espaolas, fuera de casa, se esfuerzan por utilizar la
lengua espaola, que tambin estn aprendiendo. El padre, por razones profesio-
nales, tiene un mejor dominio de espaol.
Caso 2. Edad del nio: 3 aos. Pas de origen: Rumana. Lengua materna del padre
y la madre: rumano. Escolarizacin: Se inicia cuando la familia llega a Espaa y el
nio tiene 2 aos. A los tres aos el nio comprende bastante aunque todava habla
poco. Lnea de actuacin de los padres: Los padres no hablan bien espaol, pero
preeren dirigirse al nio en esta lengua, aunque entre ellos hablan siempre en ru-
mano. En casa no se habla mucho sobre la cultura de origen. La familia tiene pro-
blemas de integracin en el barrio donde residen. Durante los veranos tienen pen-
sado visitar su pas de origen.
2.1. Qu cabe predecir sobre el desarrollo lingstico de ambos nios? Llegarn
a dominar las dos lenguas?
2.2. Qu consecuencias tendrn estas dos situaciones sobre el desarrollo psico-
lgico general de los nios? Qu cabe predecir sobre su grado de adaptacin
y de identicacin con las culturas espaola, japonesa y rumana, respectiva-
mente?
2.3. Qu tipo de actuaciones educativas seran recomendables en estos casos
para favorecer el aprendizaje de las lenguas y la identicacin con las culturas
mayoritaria y minoritaria?
Soluciones a las actividades
1. Preguntas
Para la primera pregunta la respuesta correcta es c). Como se recoge en el Apartado 2.1,
la produccin del fonema /r/ es una de las adquisiciones ms tardas en espaol. No
todos los nios de 4 aos pronuncian bien dicho fonema. Por tanto, la sustitucin que
se observa /d/ por /r/ es un proceso fonolgico perfectamente normal; no se puede
considerar a esta edad como signo de retraso del habla (alternativa b). Evidentemente,
tampoco se trata de un error de tipo sintctico, como se plantea en la alternativa a).
Para la segunda pregunta la opcin correcta es la alternativa b). Como se explica en
el Apartado 1.2 del texto, en la etapa de 3 a 6 aos el vocabulario experimenta un cre-
cimiento exponencial (por ejemplo, proceso cuantitativo), pero a la vez las palabras
adquiridas se organizan estableciendo las relaciones pertinentes entre ellas. Este ltimo
proceso de tipo cualitativo es tan importante como el primero para una adecuada cons-
titucin del lxico. Los procesos fonolgicos (alternativa c) son ms tpicos del desarrollo
anterior a los 3 aos, aunque se siguen observando en menor medida en nios de
4 y 5 aos.
Para la tercera pregunta la respuesta correcta es la expresada en la alternativa a).
Como es bien conocido (vase Apartado 4) la propuesta fundamental de N. Chomsky
se relaciona con la necesidad de que exista un conocimiento de tipo innato que gue al
nio en la adquisicin del lenguaje. Sin esta gua innata, que denomin Gramtica Uni-
versal, el lingista considera imposible la adquisicin del lenguaje. Lo expresado en la
Captulo 9. El desarrollo del lenguaje oral 235
alternativa b) podra considerarse una consecuencia indirecta de la propuesta de la GU,
pero evidentemente no constituye la principal aportacin de Chomsky al problema de
la adquisicin lingstica. La alternativa c) se reere a un conjunto de habilidades de
procesamiento de la seal del habla (vase Captulo 6, Apartados 3.1 y 3.2) que fueron
puestas de maniesto por distintos investigadores, pero en ningn caso por el lingista
americano.
2. Funciones del lenguaje
La primera tarea, resumir el texto en dos lneas, es una actividad libre que admite ml-
tiples posibilidades. La facilidad o dicultad con que la haya realizado constituye un
buen ndice del nivel de comprensin que ha alcanzado tras el estudio del tema. En
relacin a la segunda tarea, el texto se reere a las funciones del lenguaje interior,
que seran herederas del habla egocntrica. Evidentemente la funcin de comuni-
cacin consigo mismos est ms conectada con la interpretacin que dio Vygotski al
habla egocntrica y a su evolucin hacia un habla interiorizada, que nalmente se cons-
tituye en la base de la conciencia personal.
3. Casos de bilingismo
3.1. Lo probable es que ambos nios adquieran las dos lenguas a las que estn
expuestos. Ambos adquirirn la lengua espaola si siguen viviendo en Espaa,
pues el contacto con la lengua ser suciente para garantizar el dominio del
espaol. El primer nio adquirir sin problemas la lengua japonesa. El segun-
do probablemente aprender tambin rumano si lo oye en casa y si pasa
temporadas en Rumana. Sin embargo, a priori parece que el grado de domi-
nio del primer nio respecto de la lengua de sus padres ser mejor que el del
segundo respecto de la lengua de los suyos.
3.2. Lo ms probable es que el primer nio pueda identicarse con las dos cultu-
ras (espaola y japonesa) sin dicultades. La situacin del segundo nio es
ms dudosa. Hay factores sociales y familiares que no favorecen que el nio
llegue a dominar igualmente bien las dos lenguas, ni que acepte la cultura
rumana, a la vez que se adapta a la cultura mayoritaria.
3.3. Caben distintos tipos de actuaciones; la respuesta a esta pregunta est com-
pletamente abierta. Algunas posibles actuaciones seran las siguientes: en el
contexto escolar de ambos nios estaran indicadas actividades que favorecie-
ran la difusin de algunos rasgos culturales propios de los pases de origen
de los nios (Japn y Rumana). Hacer partcipes a los dems compaeros de
las costumbres culturales del pas de origen (por ejemplo, los saludos tan par-
ticulares de los japoneses) y aprender algunas expresiones en las lenguas
minoritarias (japons y rumano) ayudara a la convivencia de todos los nios
y al respeto por la diversidad. En el segundo caso sera conveniente informar
a los padres de la importancia y ventajas de dirigirse al nio en rumano, de
valorar esta lengua y de motivar al nio en relacin al conocimiento de la
misma y de su cultura de origen.
237 Bloque III. La primera infancia: de los tres a los seis aos
El mundo social
237
10
MARTA GIMNEZ-DAS
Esquema resumen
Objetivos
Introduccin
1. El desarrollo del yo
2. El mundo emocional y afectivo
3. Las relaciones con los dems
3.1. La familia
3.1.1. Los estilos educativos
3.2. Los amigos
3.2.1. El ajuste en las relaciones sociales: nios queridos y nios
rechazados
4. El juego
5. La identidad de gnero
6. El pensamiento moral
6.1. La intencionalidad y la responsabilidad objetiva
6.2. La mentira
6.3. La justicia inmanente y retributiva
Lecturas complementarias
Actividades
Soluciones a las actividades
238 Bloque III. La primera infancia: de los tres a los seis aos
Esquema resumen
1. El desarrollo del yo
Entre los 3 y los 6 aos, los nios reejan la idea que tienen de s mismos a travs del
lenguaje. En un principio, se describen a travs de rasgos visibles como el sexo, la edad
o sus pertenencias y poco a poco van incorporando otros menos evidentes como las
caractersticas de personalidad.
La interaccin con otros nios ayuda al sujeto a establecer la denicin de s mismo.
La teora de la mente y la formacin de amistades son dos elementos que inciden de
forma signicativa en este proceso.
Los nios de estas edades suelen disfrutar de una buena autoestima, es decir, suelen
mantener una visin positiva de s mismos. No obstante, con el inicio de la escolarizacin
comienzan a tener importancia las valoraciones positivas y negativas de los dems.
2. El mundo emocional y afectivo
Los nios de estas edades empiezan a entender emociones complejas como la vergen-
za o el orgullo. Por otra parte, comienzan a establecer relaciones entre acontecimientos
y emociones y entre estados mentales y emociones.
Se producen avances importantes en el autocontrol y la expresin de las emociones,
adquirindose otras estrategias ms adaptativas que producen mejores resultados al
interactuar con los dems.
En el mbito del desarrollo emocional se ha encontrado una gran variabilidad indi-
vidual. El establecimiento del vnculo afectivo y el desarrollo cognitivo se han propuesto
como dos elementos que podran explicar estas diferencias.
3. Las relaciones con los dems
La familia es el contexto ms importante para los nios entre 3 y 6 aos. Satisface las
necesidades afectivas y constituye el primer contexto de socializacin.
Los padres emplean diferentes estilos educativos que tienen importantes repercusio-
nes en sus hijos.
En esta etapa los nios comienzan a hacerse amigos gracias a la capacidad para
considerar al otro y al juego de ccin, que proporciona el contexto ideal para intimar
con otros nios.
Las estrategias que los nios emplean para acercarse a los dems ya pueden consi-
derarse efectivas o provocar rechazo. La autoestima, la comprensin emocional y las
estrategias de interaccin son elementos que inuyen en la popularidad o rechazo que
los nios provocan.
4. El juego
Hacia los 3 aos, los nios realizan juego de ccin simple y solitario o en paralelo. A
partir de los 4 aos, se observa un juego simblico diferente en el que los nios represen-
tan situaciones cotidianas, exploran sus temores, etc. La expresin de este tipo de juego,
denominado sociodramtico, est condicionada por los estereotipos y roles de gnero.
5. La identidad de gnero
Desde muy temprano los nios interiorizan estereotipos y roles de gnero. La acumula-
cin de informacin relativa a cmo debe ser y qu deben hacer los hombres y las mu-
jeres termina, aos ms tarde, con la adopcin de una identidad de gnero.
Captulo 10. El mundo social 239
Introduccin
Alolargodeestecaptulovamosadescribircmosedesarrollanenelniodiferentes
aspectosparalosqueelcontactoconotraspersonasesunapoyoimprescindible.Aunque
alolargodetodoellibroyahemosmencionadoquetantolosprogresosdelrazonamien-
tocomolosemocionalesolosafectivosestnmediadosporlainteraccinconlosdems,
existenciertosaspectosligadosalmundosocialenlosquedichainteraccinesconstitu-
tivaeinseparabledelpropioprocesodedesarrollo.As,porejemplo,losniosvanapren-
diendoquconductassonbuenasyculesreprobables,culessonlasmejoresestrategias
Objetivos
Entender los progresos que realizan los nios entre los 3 y los 6 aos en diversos
mbitos relacionados con el mundo social, es decir, en mbitos en los que el con-
tacto con los dems es un elemento clave.
Asimilar los progresos que se producen en la comprensin emocional y en la con-
sideracin del otro como un agente intencional. Relacionar dichos progresos con
los cambios que se dan en el desarrollo social.
Comprender la importancia de la familia como contexto de socializacin para el
nio y la repercusin de los estilos educativos en los hijos.
Entender las repercusiones que tiene la interaccin con otros nios en todos los
mbitos del desarrollo social.
Conocer la importancia del juego de ccin como forma de prctica social y como
contexto de interaccin que da paso a la intimidad y la amistad.
Denir y explicar cmo se adquiere la identidad de gnero desde los distintos
modelos tericos expuestos.
Aprender los rasgos tpicos del criterio moral en el nio tal y como los deni
Piaget.
Desde el psicoanlisis, las teoras del aprendizaje y los modelos cognitivos se han
realizado diferentes propuestas que intentan explicar cmo el nio adopta dicha iden-
tidad.
6. El pensamiento moral
La vida del nio se rige por una gran cantidad de normas impuestas por el adulto. A
partir de estas normas los pequeos van desarrollando un pensamiento o criterio moral,
es decir, van aprendiendo lo que est bien y lo que est mal.
Piaget dedic parte de su obra a estudiar el criterio moral en el nio. A partir de sus
conversaciones con los nios, calic la moral del nio pequeo como una moral hete-
rnoma, basada en la obediencia a la autoridad y en el cumplimiento de normas im-
puestas.
Adems, Piaget observ que los nios pequeos no consideraban la intencionalidad
a la hora de juzgar las conductas (responsabilidad objetiva), consideraban los errores y
palabrotas como mentiras y crean en la justicia inmanente y retributiva.
240 Bloque III. La primera infancia: de los tres a los seis aos
para tener amigos, qu implica socialmente y para uno mismo ser nio o nia o cmo
interpretarlasemocionespropiasyajenas.Todasestascuestionesnacenysedesarrollan
teniendocomomarcoinmediatoalotro,atravsdelasinteraccionesmscercanascomo
lafamiliaolosamigos,ycomoreferentemsamplioelcontextosocioculturalqueim-
ponelasnormasmorales,lasimplicacionesligadasalgnero,etc.
Noobstante,nohayqueolvidarqueenelcentrodetodasestascuestionessociales
est siempre el sujeto, el propio nio que va elaborando su propia identidad, su propio
yocomorefejodelosotrosydesupropiodesarrollo.Deestemodo,lamayorcomple-
jidad que va alcanzando el pensamiento permite que el nio comprenda aspectos ms
sofsticadosdelasrelacionesconlosdemseintegrenuevoselementosasuidentidad.
Entrelos3ylos6aoslosnioscomienzanadefnirseasmismosaunqueslosea
atravsdeelementosbsicos,empiezanaentenderlasemocionescomplejasyapre-
decirlasconductasdelosdemsenfuncindecmosesientenyestablecenrelaciones
conotraspersonasguiadasporpautassocialesquedebeninteriorizarporejemplo,con
loshermanosoloscompaeros.Porotraparte,enestaetapadominaprincipalmenteel
juego de fccin.A este tipo de juego subyace un importante avance cognitivo ya bien
asentado(lacapacidadsimblica,vase Captulo 2)queenestaetapatendrunaimpor-
tanterepercusinenlacomprensininfantildelmundosocial,delorealydeloposible.
Atravsdeljuegodefccinlosniosreproducirnnumerosassituacionesdelavidareal
ytambinexplorarnnuevasposibilidades,conlaventajadequeningunadesusacciones
tendrconsecuenciasreales.Porltimo,doscuestionesqueseintegranenlaidentidady
lapersonalidaddelniotienenenestaetapasusinicios:lasimplicacionesdeservarn
omujerylacomprensindelasnormasmoralesqueregulanlainteraccinconlosde-
ms.Acontinuacinexploraremostodosestosaspectosdeldesarrolloinfantil.
1. El desarrollo del yo
Entre los 15 y los 18 meses los bebs dan claras seales de reconocimiento cuando se
venfrenteaunespejo(LewisyBrooks-Gunn,1979).Lasconductasqueaparecenaesta
edad,cuandopercibensupropiaimagen,constituyenlaprimeramanifestacinclarade
reconocimientodeunomismo.Apartirdeestaedad,pues,podemospensarqueelnio
sereconocecomounserindependienteydiferenciadodelresto,almenosenloreferen-
tealaspectofsico.Porotraparte,laaparicindellenguajeautorreferencialmediantela
utilizacin de los pronombres personales (vase Captulo 6) indica que, tambin desde
unpuntodevistacognitivo,elnioconsiguediferenciarsedelresto.Estasdoshabilidades
revelancmolaconcienciadeunomismosevaadquiriendodeformalentayprogresiva
alcompsdelashabilidadescognitivasqueelniovadesarrollando.
Entrelos3ylos6aos,losniosofrecenmuyamenudomuestrasdelaconciencia
desmismosatravsdellenguaje.Aestaedadlosniosrealizanmultituddeafrmacio-
nesenlasquerefejanloquelescaracterizayloquenoformapartedesuyo.Porejem-
plo,puedendecirsisonunnioounania,cuantosaostienenoaqugrupopertenecen
medianteafrmacionescomoyonosoyunbeb,soyunaniamayor.Igualmente,con
frecuencia van a hablar de s mismos en funcin de los objetos materiales que poseen.
As,frasescomotengouncochegrandeoestemuecoesmoformanpartedesu
repertoriohabitual.Estaidentifcacindeunomismoconlascosasqueposee,aunqueno
Captulo 10. El mundo social 241
desapareceenlaedadadulta,vaacompletarsealolargodeldesarrolloconaspectosms
complejos,msrelevantesymenosvisiblescomolosrasgosdepersonalidad,lascapaci-
dadesyloslogrosvitalesquenoscaracterizan.Noobstante,losniosentre3y6aos
tienenyaciertacomprensindelosrasgosmssobresalientes,delosestadosemociona-
lesydelarelacincausalentrelosacontecimientosylasemocionesqueprovocan.Como
veremosmsadelante,lacomprensindelasemocionesestodavalimitada,perolosu-
fcientementeavanzadaparaqueelniocomprendacmoseprovocanyquconsecuen-
ciaspuedenteneralgunosestadosemocionalescomolaalegra,latristeza,elenfadoyel
miedo.As,enesteperodoaunqueelniotodavanoentiendelavariabilidaddelasap-
titudesnilasconductasesdecir,queunamismapersonapuedatenerhabilidadespara
ciertastareasperonoparaotras,oquepuedacomportarsedeunaformaenunasituacin
ydeotracompletamentedistintaenotra,spuedeatribuirtendenciaspsicolgicasge-
nerales. Por ejemplo, cuando los nios de esta edad excluyen a un igual de un juego
pueden explicarlo en funcin de un rasgo o una predisposicin del nio excluido con
argumentoscomoporqueesunamandonaoporquesiemprepega.
Unodelosprincipaleselementosatravsdeloscualeselnioprogresaenladefni-
cindesmismoeslainteraccinconlosdems.Tantolosintercambiosconlosadultos
comoconotrosnios,constituyencontextosenlosquelasdiferenciasentrepersonasse
manifestanclaramente.Lainteraccinconlosotrosponederelievelosdiferentesinte-
reses, las distintas estrategias y las diversas predisposiciones que nos caracterizan y el
nio, al igual que el adulto, tendr no slo que tomar conciencia de dichas diferencias
sino lograr conciliarlas para conseguir una interaccin armnica. Durante este perodo
del desarrollo los nios logran una importante mejora en sus habilidades sociales. La
comprensin de la separacin de los estados mentales y emocionales propios y ajenos
lallamadateora de la menteconstituyeunlogrodelpensamientoquepermiteco-
ordinaryarmonizarlasinteracciones(vase Captulo 8).Alos6aos,pues,losniosya
noinsistirnparaconseguiralgosinoquepondrnenmarchaestrategiasdenegociacin
atravsdelascualesharnconcesionesydemandasparaalcanzarsuobjetivo.
Laformacindeamistadesque,comoveremosmsadelante,tienesusiniciosenesta
etapaconstituyeunelementoclaveenladefnicindeunomismo.Atravsdelasrela-
cionesconlosamigoselniocoordinalasinteraccionescreandounvnculoemocional
quefavorecelaconsideracindelosintereses,emocioneseintencionesdelotro.As,los
niosponenenmarcharecursosmssofsticadosysemuestranmsconciliadorescuan-
dointeractanconunamigoquecuandolohacenconunsimpleconocidooinclusoun
hermano (Dunn, 2004). Estas diferencias ponen de manifesto no slo la capacidad de
consideraralotroydenegociarconl,sinolamediacindelosvnculosemocionalesy
ladiferenciacindeloscontextosinteractivos.Aunqueconunhermanotambinseesta-
blece un fuerte vnculo afectivo, la relacin no es la misma que con un amigo y desde
muytempranolosniosrefejanesasdiferenciasensumaneradeinteractuar.Msade-
lantetrataremosestosaspectosenprofundidad.
Unelementoqueformapartenucleardeladefnicindeunomismoeslaautoestima.
Losniosdeestasedadessuelendisfrutardeunavaloracinpositivadesmismos.Los
padres,principalesartfcesdelaautoestimaenestaetapa,generalmenteofrecenjuicios
positivossobretodaslascapacidadesdesushijos.Estosjuiciosdanlugaraunconcepto
positivoyunabuenavaloracin,detalformaquelosniossecreencapacesdellevara
cabocualquieraccin.Porejemplo,siunadultoproponeaunniode5aosecharuna
242 Bloque III. La primera infancia: de los tres a los seis aos
carrera,elnioaceptarsiempreelretopensandoademsquepuedeganaralgoque,de
hecho,sueleocurrirpuestoqueeladultoledejarcorrermsrpidoyllegarantesala
meta.Medianteaccionescomoesta,losadultoscreanenlosnioslaideadequetienen
grandescapacidades.Porotraparte,laconciencia,larefexinylaautocrticasobrelas
propiascapacidadesaestasedadesesprcticamenteinexistente,tantoenloqueserefe-
re a las capacidades fsicas como a las intelectuales. Por ejemplo, los estudios sobre la
memoriainfantilenlosquesepideaniosentre5y6aosquepredigansiserncapa-
cesderecordarunaserielargaycomplejadecifrasyletrasodepalabras,muestranque
suelenequivocarseatribuyndoseunacapacidadderecuerdodelaquenodisponen(Kail,
1990;SchneideryPressley,1989).Igualmente,cuandojuzgansucapacidadpararealizar
tareas o imitar modelos se creen ms habilidosos de lo que son.Algunos autores han
pensadoqueestafaltadeconocimientoydecontrolsobrelospropiosprocesosycapa-
cidadespuedetenerunainfuencianegativaenelrendimiento.Noobstante,esmsplau-
siblepensarqueestavisintanpositivaquelosniosmantienendesmismosconstituya
noslounaproteccincontralosataquesalaautoestima,sinotambinunaventajamo-
tivacional que predispone de forma positiva para el aprendizaje (Bjorklund y Green,
1992,citadoenVasta,HaithyMiller,1996).Silosniosfueranmsrealistasyportan-
toconscientesdequehaymuchascosasquenopuedenconseguir,nisiquieralointenta-
ran.Deestaotraforma,alestarconvencidosdelaposibilidaddealcanzarlametaque
se proponen, intentan las cosas una y otra vez sin desanimarse ante el primer fracaso.
ComoafrmanVasta,HaithyMiller(1996)esatravsdeestapersistenciacomosesu-
perangradualmentelaslimitacionesyseconsigueeldominiodelascosas(p.365).
Laautoestimaconstituyeunelementoesencialdelapersonalidadquecuandopresen-
tacarenciaspuedetenerrepercusionesmuynegativas.Losniosylosadultosquenotienen
unabuenavaloracindesmismospuedenperderlainiciativayelintersporlascosas.
Lasensacindeincapacidadpuedellegaraprovocarsentimientosprximosaladepresin
yhacerqueelsujetoabandonelastareasyactividadesqueleproducenplaceryatravs
delascualesprogresaensudesarrollo.Comoacabamosdeapuntar,podemospensarque
losniosdeestasedadesseencuentranprotegidosdeestospeligrosgraciasadoselemen-
tos. Por una parte, el nio no puede elaborar por s mismo una visin realista sobre sus
propiascapacidades.Porotra,laactituddeladultoimpidedichaelaboracinrealistayfo-
mentalavisindeunsuperniocapazdecualquiercosa.Amboselementosimpidenuna
actitudcrticahaciaunomismoyfomentanlamotivacinparaelaprendizaje.
Noobstante,existenotroselementosenelmundodelnioquelimitanestavaloracin
positivadesmismo.Porunaparte,lacrticadelospadrescuandonoseactadeforma
correctay,porotra,eliniciodelaconsideracindelosjuiciosdelosiguales.Comoire-
mos viendo, la consideracin de la valoracin de los padres y la de los iguales siguen
patronesopuestosalolargodeldesarrollo.Lavaloracindelosigualesvacobrandocada
vez ms importancia, alcanzando su punto mximo en la adolescencia, mientras que la
delospadresvadisminuyendo.Entrelos3ylos6aos,lavaloracindelospadrescons-
tituyeelelementofundamentalsobreelqueseasientalaautoestimadelosnios.Estos
integranyempleanlosvaloresdelosadultosparaevaluarelxitoofracasodesuspropias
conductasyemitirjuiciossobresmismos.Deestaforma,cuandonoconsiguenrealizar
una tarea o provocan un desastre rompiendo o tirando algo, incluso en ausencia de los
adultos,losniosreaccionanconvergenzaosentimientodeculpa(BergeryTompson,
1995).Comodecamosantes,enesteperodolosigualesrealizansuprimeraapariciny
Captulo 10. El mundo social 243
constituyenyaunreferenteaconsiderar.Apartirdelaescolarizacinelniocomenzar
atenerencuentalosjuiciosdesuscompaerosquepuedenconstituirlaprimerafuente
devaloracinnegativa.Adems,laaceptacindelosdemscomienzaaserimportante
obligandoalpequeoaadaptarsealasnormasqueimponeelgrupo.
Utilizando la descripcin de Erikson, el nio se encuentra en este momento en la
etapadeiniciativa frente a culpabilidad (Erikson,1950).Esdecir,tienequelograrcon-
ciliar su motivacin para realizar tareas y conseguir nuevos logros (iniciativa) con las
normasqueleimponenlosadultosylosigualesparaseraceptadoyvalorado(culpabili-
dad).As,laguaprincipalparaelprogresoenesteperodoeslainiciativaylaindepen-
denciadelnioquelellevanalaexploracinyelintentodenuevosobjetivos,perocon-
siderandoalavezlasnormasdeactuacinqueleimponendesdeelexterioryterminarn
porregularsuconducta.Laimposicineintegracindeestasnormasjuntoconlosvalo-
res para emitir juicios sobre lo bueno y lo malo darn lugar, como explicaremos ms
adelante,atodounsistemadepensamientomoral.
2. El mundo emocional y afectivo
Hacialos2aoslosniosadquierenunagrancantidaddetrminoslingsticosreferidos
asusestadosemocionales.Aprendenaidentifcaryetiquetaralgunasdelasemociones
bsicascomolaalegra,elmiedo,latristezayelenfadoypuedenempezarahablar
de las emociones pasadas o futuras.A partir de los 3 o 4 aos el conocimiento de las
emocionessehacemuchomscomplejo.SiguiendoaPons,Doudin,HarrisydeRosnay
(2005),porunaparte,seidentifcanotrasemocioneslasdenominadasemocionescom-
plejascomolaculpa,lavergenza,elorgulloolatimidezysehacendistincionesms
sutilesentreestadosemocionales.Porotra,seempiezanaidentifcarlosacontecimientos
queprovocanlasemocionesylascausasdedichosestados.Porejemplo,hacialos3aos
losniosentiendenquerecibirunregaloprovocaalegramientrasquelamuertedeuna
mascotaprovocatristeza.Tambinaestaedadcomprendenqueatravsdelafccinse
puedenprovocaremocionesyque,porejemplo,siunnioesperseguidoporunabruja
sentirmiedo,aunqueseafngido.
Hacia los 4 aos, los nios comienzan a entender que la memoria y los recuerdos
pueden intervenir en los sentimientos. Comprendern, pues, que recordar una festa de
cumpleaosprovocaralegramientrasquerecordarlapersecucindeunperroprovoca-
rmiedo.Entrelos4ylos5aoslosniosentiendenquelosotrossonagentescausales,
esdecir,quetienenintenciones,creenciasydeseospropiosyqueactandeacuerdocon
ellos.Estacomprensininfuyeenlaconsideracindelosaspectosmentalescomoele-
mentosqueintervienenenlosestadosemocionales.Asporejemplo,entendernquesi
alguienconsiguealgoquedeseaestarcontentoyviceversa.Tambincomprendernla
diferenciaentreemocionesrealesyemocionesaparentesylautilidaddefngiremociones
enciertassituaciones.Porejemplo,siunniopierdetodassuscanicasaljugarconotro,
peronoquieremanifestarsuenfado,losniosde5aospredecirncorrectamenteque
tendrquefngiralegraoindiferencia.
Otroavancedeestaetapa,relacionadoconlaconcepcindelotrocomoagenteinten-
cional,eslacomprensindequedistintaspersonaspuedensentirdiversasemocionesante
elmismoacontecimientoenfuncindecuestionesinternas.Estopermitirpredecir,por
244 Bloque III. La primera infancia: de los tres a los seis aos
ejemplo,queanteelmismoregalounniosesientafelizporqueesloquemsdesea-
barecibiryotrosesientadecepcionadoporqueesunjuegoquenolegusta.Unpoco
mstarde,hacialos6aos,empezarnaentendercmoelconocimientoinfuyeenlos
estadosemocionales.
Tambinentrelos5y6aosseproducenavancesrespectoalcontrolylaexpresin
delasemociones,unelementofundamentalparaestablecerrelacionessatisfactoriascon
losdems.Losniosvanaprendiendoqueparaconseguirdeterminadosobjetivosdeben
controlar sus emociones. Por ejemplo, el enfado o las rabietas son respuestas emocio-
nales bruscas que van desapareciendo con la edad porque el grado de control es cada
vez mayor. Los adultos suelen ofrecer pautas alternativas para que los nios consigan
susobjetivosmedianteotrasvascomolaespera,lanegociacin,etc.Igualmente,cuan-
do se juega con otros nios, la frustracin, el enfado y las conductas agresivas se van
controlandoparadejarpasoaestrategiasmsadaptativasyqueproducenmejoresresul-
tados.
Apesardeestaspautasgeneralesdeldesarrollodelacomprensinyregulacinemo-
cional,hayquesealarqueenestembitoexistengrandesdiferenciasindividualesob-
servablesdesdemuytemprano.Inclusodesdelos2aos,hayniosqueverbalizanuna
grancantidaddetrminosemocionalesunamediade25referenciasporhoramien-
trasqueotrosnoproducenninguno(Dunn,BrownyBeardsall,1991).Existendospos-
turasqueintentanexplicarestasdiferencias.Porunaparte,losmodeloscentradosenla
afectividaddefendenqueunaexperienciaemocionalyafectivaajustadaeslabasenece-
saria,aunquenosufciente,paradesarrollarmstardeunabuenacomprensinyregula-
cinemocional.Laexperienciaemocionaltempranasecentraprincipalmenteenelesta-
blecimiento del vnculo afectivo.As pues, como vimos en el Captulo 7, se considera
queelestablecimientodeunapegosegurodurantelosprimerosmesesyaosdevidaes
elindicadordeunaadecuadaexperienciaemocional.Elnioqueestableceunapegose-
guro aprende que sus necesidades emocionales estn cubiertas y que cuenta con unos
padresatentosasusdemandas.Estaseguridademocionalalrelacionarseconlospadres
ayudaaqueelniodesarrollemstardeunacomprensinyregulacinemocionalefec-
tiva.Diferentestrabajoshanencontradoque,engeneral,losniosconapegosegurore-
suelvenmejortareasenlasquehayquecomprenderysolucionarconfictosemocionales
(Ponset al.,2005).
Desdeotropuntodevista,existenautoresquedefendenqueeldesarrollodecapaci-
dades cognitivas y la prctica a travs de la interaccin social son los elementos que
explicancmoseadquiereunabuenacomprensinyregulacinemocional.Lasinterac-
cionesfamiliaresdesempean,segnestemodelo,unpapelfundamental,puestoquese
tratadelprimercontextoenelqueelniosocializasumundoemocional.Alanalizar
eltipodecomunicacinacercadelasemocionesdentrodelafamilia,sehaencontrado
quelosnioscuyasfamiliashablanamenudosobreestadosemocionales,suscausasy
consecuencias, la relacin con los estados mentales, etc., comprenden y regulan mejor
lasemociones(Denham,1998;Dunn,BrownyBeardsall,1991).Lashabilidadeslings-
ticas,queconstituyenunbuenindicadordeldesarrollocognitivo,tambinserelacionan
conlacomprensinemocionaly,deformamsgeneral,conlashabilidadesmentalistas
delosnios.As,sehaencontradoquelosniosconunnivelverbalmselevadotambin
resuelvenmejorlastareasdeteoradelamenteycomprendenmejorlasemociones(Cu-
ttingyDunn,1999;Pons,Lawson,HarrisydeRosnay,2003).Todavanoestclarocul
Captulo 10. El mundo social 245
de los dos modelos explica mejor la comprensin emocional, pero quizs habra que
plantearsesilaartifciosaseparacinentreafectoycognicinnonosestarconfundien-
dounavezms.
Comoacabamosdever,elmundoemocionalescomplejoysusmecanismosysuti-
lezas se van aprendiendo poco a poco. Como veremos ms adelante, las repercusiones
quetienenlashabilidadesemocionalesenelajustesocialdelosniosydelosadul-
tosesenorme.Aunquelasemocionesnosehantrabajadodesdelaescueladeforma
sistemtica,hoyseempiezaareconocerelimportantepapelquedesempeanyseestn
desarrollando programas de intervencin centrados en las competencias emocionales
cuyoobjetivoespromoverlainteligenciaemocionaldelosnios.Enelsiguientecua-
droresumimoslasprincipalesestrategiasquesetrabajandesdeestosprogramas.
Los profesores y tambin los padres pueden mejorar las habilidades emocionales de los
nios. El objetivo principal de estos programas es lograr que el nio sea consciente de
sus emociones y las de los dems y aprenda a manejarlas adecuadamente en sus inte-
racciones sociales. Algunos aspectos que suelen trabajar en estos programas son
1
:
Aprender vocabulario emocional identicando diferentes estados emocionales y eti-
quetndolos mediante palabras.
Aprender a reconocer las emociones en uno mismo y en los dems a travs de si-
tuaciones reales, juegos, canciones, etc.
Aprender algunos aspectos bsicos sobre las emociones:
las emociones cambian
puedes sentir de forma distinta a los dems
puedes tener ms de una emocin hacia algo
todas las emociones son vlidas, lo que importa es lo que haces con ellas
Aprender a identicar el enfado y manejarlo:
aprender que el enfado puede impedir la solucin de un problema
aprender a reconocerlo
tcnicas para calmarse
buscar formas adecuadas de expresarlo
buscar soluciones alternativas y evaluarlas: es una solucin justa, es segura,
nos hace sentir bien a todos
Qu hacer en situaciones de conicto?
aprender respuestas alternativas cuando alguien nos molesta o pega
aprender a expresar de forma adecuada cuando algo molesta
aprender a ignorar conductas negativas de los dems
CONLOSPIES
ENLATIERRA
Cmo se puede trabajar la competencia
emocional?
1
Basado en el programa diseado por el Center on the Social and Emocional Foundations for Early
Learning. Mdulo 2: Enseando estrategias socioemocionales.
246 Bloque III. La primera infancia: de los tres a los seis aos
3. Las relaciones con los dems
3.1. La familia
Comoyahemosmencionado,elcontextofamiliareselmsimportanteparaeldesarrollo
enesteperodo.Lafamiliaconstituyeunsistemacomplejoenelquetodoslosmiembros
interactan entre s, se infuyen y evolucionan. De esta forma, podemos considerar la
familiacomounsistemaenconstantecambio,enelquetodossusmiembrossedesarro-
llan adaptndose en funcin de las necesidades y cambios que van aconteciendo. As
pues,cualquiercambioonovedadqueseproduzcaafectaratodoslosmiembrosdela
familiayasusrelaciones.Porejemplo,elnacimientodeunnuevohijoouncambiode
residenciasonacontecimientosqueprobablementemodifcarntantolasrelacionesfami-
liarescomoacadaunodesusmiembros.
Lafamiliahumanaesuntipodeagrupacinquecumplediversasfunciones.Entrelas
msimportantesseencuentranasegurarlasupervivenciadelascrasyportantodela
especieatravsdelcuidadoqueseproporcionaalosmiembrosmsjvenes,propor-
cionaruncontextoafectivoyemocionaladecuadoparaeldesarrolloeinstruiracercade
las normas y pautas de conducta ajustadas al contexto sociocultural al que los hijos se
enfrentarn(Berk,1999).Todasestasfuncionesestnestrechamenterelacionadasentre
sytienencomoejecomnelvnculoafectivoqueseestableceentrepadresehijosdes-
de el inicio de la vida. Gracias a esta capacidad innata para crear lazos afectivos, los
adultoscuidanyprotegenalosmiembrosjvenesysepreocupanporofrecerlesuncon-
textoafectivoquepromuevaeldesarrolloajustado.Estosvnculostanestrechossemo-
difcanconeltiempo,peropermanecentodalavida.Enestesentido,lasfamiliasdisfun-
cionales, como las que maltratan o son negligentes, suelen dejar graves secuelas en el
desarrolloafectivoyemocionaldelosnioslimitandosusposibilidadesdeadaptacin.
Lafamiliasuponeparalosnioselprimercontextodesocializacin,esdecir,elpri-
merlugarenelqueaprendenainteractuarconlosdems.Sonlospadresquienesempie-
zanaponerlmitesenlaconductadelnioyquienesempiezanapautarlasinteracciones
desdelosprimerosmesesdevida.Losniosmuyprontoempiezanaobservaryescuchar
lo que se debe hacer y, sobre todo, lo que no se debe hacer. De esta forma los adultos
proporcionan de forma explcita e implcita herramientas y normas para que los nios
actendeacuerdoconelcontextosocialenelqueviven.Lasestrategiasdeinteraccin
que los nios observan y aprenden en casa son las que en principio ponen en prctica
cuando se encuentran en otros contextos.As por ejemplo, las interacciones con otros
niosestarnguiadasporlaspautasdeinteraccinfamiliarydeellasdependernaspec-
tos como la popularidad o la valoracin positiva por parte de los compaeros. Como
veremosacontinuacin,losllamadosestiloseducativosquelospadrespracticanestn
muyrelacionadosconlasestrategiasdeactuacindelosniosy,comoconsecuencia,con
suajustesocialenotrosambientes.
3.1.1. Los estilos educativos
Cmoeducanlospadresasushijos?Ponenenmarchaunaseriedeestrategiasplani-
fcadas y estudiadas o simplemente siguen su instinto? Son consistentes a la hora de
aplicar sus estrategias o varan en funcin de la situacin y con cada hijo? En general,
Captulo 10. El mundo social 247
lospadressuelenguiarseporpautaseducativasespecfcasquesesuelenaplicardeforma
constanteaunquepuedenvariardeunhijoaotro.Laadopcindelaspautaseducativas
dependedefactorescomolaspropiasexperienciaseducativasdelospadres,elcarcter
deloshijosydelospadres,lasexpectativassobreloshijosylasideasimplcitasdelos
padresacercadeldesarrolloylaeducacin.Tambininfuyenaspectosexternoscomola
clasesocialyelentornocultural.Estaspautaseducativasquelospadresaplicansedeno-
minan estilos educativos y determinan el tipo de interaccin que se establece con los
hijos.
Los estilos educativos lograron defnirse partiendo de observaciones de interaccin
entreniosde3a6aosysuspadres.Alrealizarestasobservacionesparecaclaroque
existandosgrandesdimensionesquediferenciabandichasinteracciones:porunaparte,
elcontroldelospadressobresushijosy,porotra,elafectoquelospadresproporcionan
asushijos(Baumrind,1971;Maccoby,1992).Laprimeradimensincontroldife-
renciaalospadresenfuncindelarigidezalahoradeimponeryhacercumplirnormas,
mientras que la segunda afecto les diferencia en funcin del grado de implicacin
emocional,apoyoysensibilidadantelasnecesidadesdeloshijos.Enfuncindelacom-
binacindelniveldecontrolyafectoquelospadresempleanconsushijossehandef-
nidocuatroestiloseducativosdiferenciados:democrtico,autoritario,permisivoeindife-
rente(Baumrind,1971;MaccobyyMartin,1983,citadoenVastaet al.,1996;MacDonald,
1992). Aunque no se ha establecido una relacin causal directa entre el tipo de estilo
educativoylosrasgosqueloshijosdesarrollanconeltiempo,sparecequeelempleode
algunos estilos tiene ms probabilidades de generar determinadas caractersticas en los
hijos(BergeryThompson,1995).
Lospadresquesiguenunestilodemocrticoadoptannivelesaltosencontrolyafec-
to.Sonpadresqueproporcionanunentornoafectivoycomunicativoadecuado,soncari-
osos,creanunentornoconunaaltaexpresividademocionalyestnpendientesdesus
hijos,peroalavezmantienenbiendelimitadaslasnormasyreglasqueloshijosdeben
cumplir.Cuandoaparecenconfictosintentanquelosnioscumplanlasnormasatravs
deldilogo,elrazonamientoyelcompromisomutuoevitandoelcastigofsicoylaim-
posicin.Estospadressesientenmuycomprometidosconlaeducacindesushijos,pero
valoranyfomentanlaautonomaylacapacidadcrticaantesquelaobedienciainmedia-
ta.Losnioscuyospadresempleanesteestiloparecenserlosmsbenefciados:poseen
una buena valoracin de s mismos, son independientes y curiosos y obtienen buenos
resultadosenelcolegio.
Los padres autoritarios ejercen altos niveles de control y manifestan poco afecto.
Setratadepadresexcesivamenteexigentesyseverosencuantoalaimposicinycum-
plimientodenormas.Estasnormassuelenserincuestionablesyseutilizaelcastigocuan-
do no se cumplen. Por otra parte, no establecen buenas vas de comunicacin con sus
hijos,mantienenunarelacindistanteynocreanunclimaafectivoadecuado.Losnios
no suelen reaccionar bien ante este estilo educativo y pueden presentar problemas de
conducta,agresin,hostilidadyfrustracin.Adems,puedensermsinmaduros,insegu-
rosydependientes,ascomodesarrollarunmenorniveldecapacidadcrtica.
Cuandoelniveldecontrolesbajoperoelniveldeafectoesaltoseempleaunestilo
educativo permisivo. Estos padres no tienen inters en imponer normas de conducta a
sus hijos ya que consideran que los nios deben progresar por sus propios medios. El
niveldeexigenciadelospadresesmuybajoylosniospuedentomardecisionesoactuar
248 Bloque III. La primera infancia: de los tres a los seis aos
sobrecuestionesquenolescompetenyquesuperansucapacidaddeprevisin,susha-
bilidades, etc. No obstante, dado que el nivel de afecto es alto, estos padres establecen
unarelacincariosa,mantienenbuenasvasdecomunicacinconsushijosylesofrecen
apoyoemocional.Losnioscriadosconesteestiloeducativotiendenaserimpulsivose
inmaduros.
Porltimo,lospadresquepresentanbajosnivelesdecontrolydeafectoutilizanun
estiloeducativoindiferente.Esteeselestilomsdainoparalosnios.Estospadresno
proporcionan a sus hijos apoyo emocional, no crean un entorno afectivo adecuado y
tampocosepreocupanporestablecerlmitesninormasdeconducta.Engeneral,setrata
depadrespococomprometidosconlatareadeeducarasushijosyenellaempleanpoco
esfuerzo.Estosniosnodisfrutandebuenosvnculosafectivosconsuspadresnisebe-
nefciandeunaricaestimulacincognitiva.Loshijoseducadosconesteestilonosuelen
presentar un desarrollo ajustado, tienen difcultades para establecer interacciones
satisfactoriasconlosdemsypuedenserinmaduros,inestables,desobedientesyexigen-
tes.Adems,tienendifcultadesparacontrolarseycumplirnormasypresentanunabaja
autoestima.
A pesar de que existen ms estilos educativos, ya que esta clasifcacin deja fuera
muchosmaticesylospadresnosiempreejercenlosestilosdeformapura,pareceque
el mejor estilo para el desarrollo sano de los nios es el democrtico, es decir, el que
proporcionaunadecuadoclimaafectivoenelqueelniosesientevaloradoyescuchado,
peroquealavezimponenormasasuconductaymantieneunaltoniveldeexigenciaen
suslogros.
Comomencionamosaliniciodeesteapartado,existenmuchasvariablesqueinciden
enelestiloeducativodelospadres.Unastienenqueverconcaractersticasdelospadres
como su personalidad, su propia educacin o sus ideas acerca de cmo se produce el
desarrollo.Muchospadresreproducen,antesusorpresa,laspautaseducativasqueellos
mismos recibieron de pequeos. Esta reproduccin, que puede ser inconsciente e irre-
fexiva,ponedemanifestohastaqupuntolaaplicacindeunestiloeducativoestcon-
dicionadapornumerosasvariablesinternasqueinclusoescapananuestrocontrol.Otras
variablesqueincidenenestaeleccintienenqueverconlosrasgosdepersonalidadde
loshijos.Aunqueelestiloeducativodelospadressueleserconsistente,sinembargo,se
adaptaalosdiferenteshijosenfuncindesusrasgosdepersonalidad.Otrascaractersti-
casdeloshijos,comoporejemploelgneroyelordendenacimiento,tambininfuyen
enlaspautaseducativasqueseadoptan.Losajustesqueserealizanconcadahijosobre
elestiloeducativoempleadounidoalasdiferenciasdepersonalidadentreellosylare-
percusindelosestilosencadauno,explicanenpartelasdiferenciasqueluegoseob-
servan entre hermanos (vase Captulo 4). Por ltimo, el entorno cultural y econmico
tambin infuye en la adopcin de un estilo educativo. Las familias que poseen pocos
recursosysoportanproblemassocialesgravescomopobreza,desempleo,etc.nopodrn
invertir el esfuerzo que requiere el estilo democrtico y recurrirn ms a menudo a la
imposicindenormasyelcastigocomoestrategiaeducativa.
3.2. Los amigos
Entrelos3ylos6aoslosniossuelenenfrentarseaunanuevaeimportantetarea:es-
tablecer relaciones con otros nios de su edad. Hasta este momento los nios no han
Captulo 10. El mundo social 249
creadoverdaderosvnculosdeamistad.Aunqueentrelos2ylos3aossepuedenesta-
blecerinteraccionesclidasyenocasionesduraderasconalgunoscompaeros,general-
mente los nios de estas edades no disponen de las habilidades cognitivas ni sociales
necesariasparapoderestablecerverdaderasamistades.Apartirdelos3aos,sinembar-
go,yconelcomienzodelaescolarizacinlosniospodrnsumergirseenlacomplejidad
delasocializacinylaamistad.
Losestudiosmsclsicossobrelasrelacionesinfantilessealanquelasamistadesen
estaetapasonmsbienrelacionesocasionaleseinestables,pocoprofundas,dirigidaspor
losadultosygobernadasporelegocentrismo(Rubin,1980;Selman,1981).Apesarde
quemuyamenudolasamistadesinfantilesenestaetapaposeenestascaractersticas,a
estaedadlosnioscomienzanadesarrollarunaseriedehabilidadesbastantecomplejas
que les permiten relacionarse con los iguales estableciendo lazos ms profundos. As
pues,losniosdeestasedadespreferenjugarconunosniosdeterminadosydespliegan
conellostodaunaseriedehabilidadesquenoutilizanenotroscontextos.
Existendoselementosquepermiteneliniciodeestasnuevasrelaciones.Enprimer
lugar,elniopuedeempezarautilizarunaseriedeestrategias,comolanegociacino
lacooperacin,queposibilitanlainteraccinconlosdems.Elempleodeestasestrate-
giasvienedeterminadoporlaadquisicindenuevashabilidadessociocognitivasrelacio-
nadasconlaadopcindelpuntodevistadelotro.As,graciasaestedescensodelego-
centrismoyalarecientecapacidadparatenerencuentalospensamientos,sentimientos
e intenciones de los dems, los nios pueden establecer intercambios ms complejos,
negociar o sentir empata. En segundo lugar, el juego de fccin, que como veremos
constituyeunadelasprincipalesocupacionesdelniodeestaedad,proporcionaeles-
pacio ideal para la aparicin de relaciones ntimas. Cuando las relaciones que se van
creando a travs del juego son satisfactorias, aparecen los vnculos afectivos que dan
lugaralaamistad.
Los nios pequeos no se hacen amigos de cualquiera. Existen varios elementos que
facilitan o impiden el acercamiento y condicionan la eleccin de un amigo potencial. De
forma general, parece que los nios similares se hacen amigos. Esta similitud se concre-
ta en varios rasgos fcilmente observables: el gnero, la edad y el grupo tnico.
El gnero constituye en estas edades y hasta la adolescencia, el principal factor por
el cual los nios se guan para escoger amigos. En este perodo de construccin y ar-
macin de uno mismo, los nios se relacionan principalmente con otros de su mismo
gnero y las interacciones entre nios y nias son raras.
Por otra parte, los nios suelen relacionarse con otros de su misma edad que dis-
frutan de las mismas actividades, comparten los mismos intereses, etc.
El grupo tnico constituye tambin un importante factor a la hora de elegir amigos.
Dada la importancia del tema y su relativo desconocimiento, nos centraremos en este
aspecto. A partir de la dcada de 1940, diferentes estudios realizados en Estados Unidos
mostraron que desde los 4 aos, los nios manifestaban pautas claras y marcadas de
preferencias y rechazos a sus compaeros en funcin del color de piel. As, los nios
CONLOSPIES
ENLATIERRA
Quieres ser mi amigo? Factores que
condicionan la eleccin de las amistades
250 Bloque III. La primera infancia: de los tres a los seis aos
Entre los 3 y los 4 aos los nios descubren todo un universo ldico que pueden
compartir con los dems.A partir de este momento los iguales pasan a ser el mejor
compaerodejuegoylosadultosquedanrelegadosaunsegundoplano.Porqulle-
ga un momento en el que a los nios les interesa ms jugar con otros nios que con
adultos?Laclavedeestecambioestenlaaparicindeljuegodefccin.Cuandoel
nio empieza a disfrutar de todas las posibilidades que ofrece el juego de fccin, se
encuentraconunadultodemasiadopegadoalarealidadquenolesigueenlaimagi-
nacin de mundos fantsticos o en la adopcin de papeles. Jugar a los piratas, por
ejemplo,esmuchomsdivertidoconuncompaero,queestdispuestoasaltarselas
leyesdelmundorealeimprovisarenlosacontecimientosquevansurgiendo,quecon
unadultoqueprobablementesevaalimitarareproducirelestereotipodelpiratacon-
vencional.
As pues, el juego de fccin, a travs del cual se inventan situaciones, se adoptan
papelesosereproducenescenarios,seconvierteenelespacioperfectoparacompartiry
blancos preferan como amigos nios de su mismo color de piel y rechazaban a los nios
de piel negra. Los nios de piel oscura o bien preferan a los nios blancos y rechazaban
a los de su propio grupo o bien no mostraban una pauta de elecciones clara (Clark y
Clark, 1939). Los resultados de estos trabajos provocaron tal alarma social que consi-
guieron que en las escuelas estadounidenses se aboliera la segregacin racial. A pesar
de este importante logro social, desde entonces se han realizado numerossimos estu-
dios sobre el tema en diferentes pases y, en general, podemos concluir que las pautas
se mantienen. Por supuesto, con el tiempo se han producido cambios que responden a
las situaciones sociales que viven los diferentes grupos tnicos en sus pases de acogida.
Por ejemplo, hoy en Estados Unidos la mayor parte de los nios de piel negra ya pree-
ren nios de su mismo color de piel y rechazan a otros grupos. Los movimientos de
Derechos Civiles y el trabajo de revalorizacin social que se ha realizado dentro de este
grupo durante muchos aos ha conseguido que estos nios puedan sentirse, al igual
que los de piel blanca, ms orgullosos de su grupo de referencia. No obstante, la pauta
observada en los nios de piel negra hacia 1940 la reproducen hoy los nios latinoame-
ricanos.
En nuestro pas tambin se han recogido datos con nios pequeos y se han en-
contrado resultados similares: ya en 1997 nios espaoles de 5 aos preferan a nios
de su mismo grupo y rechazaban a los de piel oscura (Gimnez-Das, 1999). Estos re-
sultados sorprenden por dos motivos principales: la fecha del estudio y la edad de los
nios. Hace diez aos, cuando en Espaa prcticamente no haba mezcla entre grupos
tnicos diferentes y por tanto no poda haber conictos, los nios de 5 aos ya
utilizaban el color de piel como un rasgo determinante de sus preferencias y sus recha-
zos. Es decir, estos nios haban asimilado perfectamente los estereotipos y prejuicios
que invaden nuestro mundo viviendo incluso en un contexto sin mezcla ni conicto.
Qu ha ocurrido en estos aos en Espaa? Estudios recientes han indagado las prefe-
rencias y rechazos de los nios latinoamericanos que residen en Espaa, encontrndose
resultados que recuerdan los de Estados Unidos. As, en un estudio realizado en Madrid
con nios latinoamericanos de diferentes edades, los de 4 y 5 aos fueron los que ex-
presaron mayor preferencia por su propio grupo llegando al 33 por 100 (Gmez, en
preparacin). Adems, todos los nios expresaron preferencias marcadas por los espa-
oles de piel blanca y un claro rechazo hacia los nios de piel negra.
Captulo 10. El mundo social 251
comenzaraintimarentrenios.Atravsdeestosintercambiosldicoslosniossehacen
amigos,esdecir,construyenrelacionesntimasycompartenintereses.Apartirdelos5
aos,ademsdecompartireljuego,losnioscomienzanaintercambiarpensamientos
ysentimientosdeformamsexplcita.Apartirdeestaedadseobservaungranincre-
mentoenlafrecuenciadelasconversacionessobrepensamientos,recuerdos,sentimien-
tosycreenciasconlosamigos.Adems,estasconversacionessedanconmsfrecuencia
entreamigosqueconmiembrosdelafamilia(Dunn,2004).Porotraparte,losniosde
estasedadesqueyamanejanestrategiasdecooperacinoquesoncapacesdeprovocar
enfadoenlosdems,nosecomportanigualcuandoestnconunamigo,conunherma-
nooconunadulto.Porejemplo,lasestrategiasdeconciliacinylaconsideracindel
puntodevistadelotroaparecenconmsfrecuenciacuandohayconfictoconunamigo
queconunhermanooconunadultocomolamadre.Sinembargo,lasconductascuyo
fnesmolestarofastidiaraotrosedanmsamenudoentrehermanosqueentreamigos
(Dunn, 2004). Estas diferencias a la hora de ajustar la propia conducta y producir un
efectoenotraspersonas,ponendemanifestounconocimientobastanterefnadoacerca
delasrelacionessociales.Enconcreto,parecequelasrelacionesentreamigospromue-
venlautilizacindeestrategiasmsorientadashacialaarmonaenlarelacin.Segura-
menteaspectoscomolaigualdadqueexisteentrelosniosalahoradeinteractuaryla
calidademocionaldesurelacindeterminanlaaparicindeestasestrategiasmspro-
sociales.
3.2.1. El ajuste en las relaciones sociales: nios queridos
y nios rechazados
Comovemos,saberconquinseinteracta,questrategiassedebenadoptaryqufnes
sequierenalcanzarempiezayaaserimportanteparaconvertirseenunapersonasocial-
mentecompetente.Desdeedadestantempranascomolos4y5aos,sepuedenidentif-
car los nios que tienen xito social y los que son rechazados porque tienen estilos de
interaccinmuydiferentes:unoesajustadoyfuncionamientrasqueelotroproducere-
chazo. Cmo son estos estilos de interaccin? Los nios populares son hbiles a la
hora de introducirse en un grupo o acercarse a un desconocido. No son intrusivos, no
agredenypersisteninclusocuandonosontanbienacogidoscomoesperaban.Adems,
sonexpresivos,alegresyproponenactividadesqueresultanatractivasalosdems.Cuan-
doaparecenconfictossemuestranatentosalasopinionesyemocionesdelosdems,se
comunican con facilidad, saben escuchar, negocian y proponen soluciones razonadas y
justas.Endefnitiva,losniospopularessonlosquetienenlascualidadesquesedesean
enunamigoyporesolosconsiguenconfacilidad.
Alosniosrechazadoslesocurretodolocontrario.Suelenserniosquenodisponen
delashabilidadesnecesariasparaintroducirseenlosgruposysepresentanantelosde-
msde forma agresiva e intrusiva. En general, los nios poco valorados por los dems
suelenestarporencimadelnivelmediodeagresividad.Adems,puedenpresentarcon-
ductasantisocialesysuelenproponeractividadespocoadecuadasparaelgrupoquepue-
denmolestarlaactividadoresultarextraas.Estosniostienenpocashabilidadespara
negociaryencontrarsolucionesylescuestaentenderelpuntodevistadelotro,susemo-
ciones,susdeseoseintenciones.
252 Bloque III. La primera infancia: de los tres a los seis aos
Aspues,desdeeliniciodelasrelacionessocialesencontramosgrandesdiferencias
enlahabilidadpararelacionarseconlosdems.Porquexistendiferenciastanmar-
cadasentreniostanpequeos?Qufactoresinfuyenenlacompetenciasocialdelos
niosdeestasedades?Existenvarios.Porunaparte,numerososestudioshanmostrado
que los nios ms competentes en el plano social obtienen puntuaciones ms altas en
pruebas de teora de la mente. Es decir, los nios populares entienden y diferencian
mejor las intenciones, los deseos, las creencias y los pensamientos propios y ajenos
(DunnyCutting,1999;HughesyLeekam,2004;JenkinsyAstington,2000;Lalondey
Chandler, 1995, entre otros). Por otra parte, muchos trabajos tambin han encontrado
que los nios populares entienden mejor sus emociones y las de los dems y son ms
hbilesalahoradeexpresaremocionesadecuadasalcontextoycontrolarlasinapropia-
das (Cassidy, Parke, Butkovsky y Braungart, 1992; Denham, McKinley, Couchoud y
Holt, 1990; Dunn y Herrera, 1997; Edwards, Manstead y MacDonald, 1884; Hughes,
DunnyWhite,1998).Estosresultadosponendemanifestoquemanejarunabuenateo-
radelamenteyposeerunabuenacomprensinemocionalsondosingredientesclaves
paraelxitosocial.
Otrosfactoresqueinfuyenenlacompetenciasocialdelosniosestnrelacionados
con cuestiones del contexto, en concreto, de la familia. El tipo de apego que se esta-
bleceentrelospadresyelnioesunbuenpredictordelacompetenciasocialposterior
siendo los nios con apego seguro los ms benefciados (Daz-Aguado y Martnez
Arias, 2006;Vasta, Haith y Miller, 1996). El establecimiento de un vnculo afectivo
segurotambinpredicelacalidaddelaamistad.Aspues,losbebsconapegoseguro
tendrnmsposibilidadesdeserniossocialmentecompetentes,popularesydeesta-
blecerrelacionessatisfactoriasconlosdems.Otroelementofamiliarqueestrelacio-
nadoconlacompetenciasocialeselestiloeducativodelospadres.Loshijosdepadres
democrticossonlosmspopularesymejorvaloradosporsuscompaerosenelcole-
gio (Berger yThompson, 1995). Los efectos del estilo democrtico se dejan notar en
varios mbitos que repercuten en la competencia social de los nios. Por una parte,
como ya vimos, estos nios desarrollan una buena autoestima teniendo as la base a
partir de la cual relacionarse satisfactoriamente con los dems. Adems, los padres
democrticosproporcionanapoyoafectivoyofrecenuncontextoconunaaltaexpresi-
vidademocional,formandoasalosniosenlacomprensinyeladecuadomanejode
lasemocionespropiasyajenas.Porltimo,cuandoexistenconfictoslospadresdemo-
crticossuelenrazonar,negociarycooperarparaalcanzarunacuerdoconsushijos.A
partirdeestasformasdesocializacin,loshijosdepadresdemocrticosutilizarnestas
mismas estrategias principalmente porque no poseen otras cuando se encuentren
enunasituacindifcilconsuscompaeros.Endefnitiva,unabuenaautoestimacomo
base,unaadecuadacomprensindelasemocionesyherramientasparanegociaryco-
operar considerando la postura del otro son tres caractersticas que fomenta el estilo
democrtico y que repercuten en los hijos, ayudndoles a hacerse amigos y devenir
populares,esdecir,asersocialmentecompetentes.
Captulo 10. El mundo social 253
A partir del ao y medio, los nios pueden realizar conductas de ayuda y apoyo a otros.
Por ejemplo, cuando un nio llora o est triste pueden intentar consolarle ponindose
a su lado, abrazndole, preguntndole qu le pasa, etc. Para poder realizar este tipo de
conductas es necesario darse cuenta de cmo est el otro, sentirse implicado con l y
pensar que se le puede ayudar a sentirse mejor. Estas tres capacidades son bastante
complejas y aunque se observan de forma rudimentaria desde temprano, entre los 3 y
los 6 aos se van aprendiendo respuestas cada vez ms apropiadas y se van compren-
diendo estados mentales y emocionales cada vez ms sosticados. Como acabamos de
sealar, para ayudar a otro antes hay que darse cuenta de que tiene una necesidad, es
decir, es necesario adoptar su punto vista. Muy relacionada con esta toma de perspec-
tiva se encuentra la empata, que se reere a la experiencia de los sentimientos ajenos
en uno mismo. Estos dos elementos son denitivos para llevar a cabo conductas proso-
ciales y altruistas. Los nios que tienen facilidad para ponerse en el punto de vista de
otro y que sienten de forma intensa las emociones de los dems, tienden a ayudar ms
a menudo. No obstante, sentir empata no garantiza ayudar a otra persona, ya que
existen otros elementos que estn implicados en este proceso. Estos son (Kail y Ca-
vanaugh, 2003):
El sentimiento de responsabilidad: los nios ayudan ms cuando se sienten res-
ponsables de la persona que se encuentra mal. As, por ejemplo, ayudarn ms
a menudo a sus amigos que a desconocidos.
La sensacin de competencia: poseer las estrategias necesarias para poder prestar
una ayuda ecaz condiciona la aparicin de la ayuda. Si un nio se enfada porque
no consigue poner una pelcula en el DVD necesitar de un compaero ms com-
petente. Quien no sepa manejar el aparato no podr ayudarle.
El estado de nimo: los nios que se sienten competentes y estn contentos ayu-
dan ms a menudo que los que estn tristes o sienten que han fracasado.
El coste de la ayuda: los nios se comportan de forma altruista cuando el coste
es pequeo o moderado. A un nio le cuesta ms compartir su golosina preferi-
da que otra menos querida.
Con estos elementos, cmo se puede promover el altruismo y la conducta pro-
social en nios pequeos? Por una parte, se pueden fomentar las habilidades relacio-
nadas con la teora de la mente que incluyen adoptar el punto de vista ajeno y
sentir las emociones de los dems. Razonar con los nios, tanto en la escuela como
en casa, por ejemplo, cuando surgen problemas parece ser muy ecaz. Si a los nios
se les explica las consecuencias materiales, pero sobre todo emocionales que tie-
nen sus conductas en los dems, aprenden a adoptar otra perspectiva y a sentirse
responsables frente a los otros. Adems, disponer de modelos adultos que ayudan y
son altruistas es una excelente inuencia para los nios. Cuando los adultos expresan
preocupacin por los dems, los nios aprenden a ser empticos; cuando los adultos
se comportan de forma altruista y ofrecen apoyo, los nios aprenden a ayudar, a com-
partir y a ser menos crticos con los dems. Por ltimo, cuando los adultos premian y
alaban las conductas altruistas de los nios les hacen sentir competentes y refuerzan
su autoestima. Como ya hemos visto, una buena autoestima, un buen estado de ni-
mo y una sensacin de competencia son elementos que promueven las conductas
prosociales.
CONLOSPIES
ENLATIERRA
Fomentando la competencia social:
empata, conducta prosocial y altruismo
254 Bloque III. La primera infancia: de los tres a los seis aos
4. El juego
Entrelos3ylos6aos,losniospasancasitodosutiempojugando.Eltipodejuegoque
principalmente les ocupa es el juego simblico o de fccin. Este juego supone actuar
como siuncomportamientoounobjetofueranotracosa(Bretherton,1984).Entrelos15
y18meses,losniosempiezanautilizarsmbolosdeformaldica:utilizanobjetoscomo
sifueranotracosaofngenescenassimples.Porejemplo,puedenhacerquecomenco-
giendocomidadeunplatovaco,puedenhacercomosisepeinaranpasndoseunlpiz
por el pelo o pueden simular que hablan por telfono ponindose la mano en la oreja y
emitiendo sonidos.Todos estos son ejemplos de las formas ms tempranas y simples de
juegosimblico.Enunprimermomento,enestetipodejuegoelniorealizaaccionesco-
tidianasmuyconocidassobresmismo.Estasmismasaccionessepuedentrasladaraotros,
generalmentemuecos,alosquesedadecomer,sepeina,seacuesta,etc.Hacialos3aos
losniosyarealizanjuegosimblicoperotodavanosoncapacesdecoordinarseentres
yjuegandeformasolitaria.Estetipodejuego,denominadoenparalelo,essegnalgunos
autorescomoPiaget,unrefejodelegocentrismointelectualpropiodeestaetapa.Cadanio
estaracentradoensupropiaactividadynosecomunicaconlosdems.
Hacialos4aos,eljuegodefccinempiezaaorganizarseentrevariosjugadoresy
aborda temas ms complejos e interesantes. El juego simblico adquiere entonces otro
matizysepuededenominarsociodramtico.Estejuegosimblicosecaracterizaporque
losjugadoresencadenansusaccionesconsiderandolasconductassimblicasdelosde-
ms(Garvey,1977).Losniosempiezanarepresentardiferentessituacionesmsome-
nosconocidascomolasmams,lostenderos,losmdicos,etc.Atravsdeestosescena-
rios actan como si fueran otras personas, es decir, adoptan otras personalidades, otros
puntos de vista, otros paisajes emocionales y exploran los elementos y variables de la
vidareal.Medianteestosjuegoslosnioscomprenden,aprendenyensayanlospapeles
socialessinestarexpuestosapeligrosnialasconsecuenciasrealesdelasacciones.Para
queelresultadodeestetipodejuegosimblicoseasatisfactorio,losniosnecesitanes-
tablecer una estrecha colaboracin y coordinar sus acciones (Garvey, 1977). Para eso
empleanunasreglasdeterminadas:antesdeempezarajugardecidirneltema,sepon-
drn de acuerdo sobre qu papel desempear cada uno y sobre cmo transcurrir la
accin. Los nios de estas edades preferen refejar la realidad a travs del juego y se
reprendern unos a otros cuando las acciones se desven de esa realidad.An as, los
acuerdos que guan el juego suelen ser fexibles y los participantes estn dispuestos a
modifcarlos, transgredirlos e improvisar situaciones nuevas que se van creando al hilo
delpropiojuego.
Unodelosaspectosquecondicionancmoseorganizaeljuegodefccintieneque
verconlosestereotiposdegnero,queyaaestasedadesmarcangrandesdiferenciasen
lasactuacionesdeniosynias.Aunqueacabamosdemencionarqueeljuegoesfexible
yestabiertoamodifcacionesespontneas,sinembargo,existenconvencionessociales
asociadasalgneroquelosniosnosuelensaltarse.Asporejemplo,serextraoque
unnioactedemadreorealiceconductasasociadasalasmujeres.Enocasiones,inclu-
so,lospropiosjugadoresexplicitarnlasconductasquenoresultenadecuadasenfuncin
delgnero.Duranteestosaos,losniosylasniasjueganseparados,muestranestilos
de interaccin diferentes y preferen de forma muy marcada compaeros de juego del
mismosexo.Enelsiguienteapartadovolveremossobrelascuestionesdegnero.
Captulo 10. El mundo social 255
Atravsdeljuegodefccinelniotambinexploraaspectosdelarealidadquele
preocupanoleatemorizan,comolaoscuridadolamuerte,ypracticacuestionesrelacio-
nadasconelconocimientopsicolgicoquevaadquiriendo.Porejemplo,unniopuede
reconfortaraunmuecoexplicndolequenopasanadaporbajaralstanoaunqueest
oscuroyquelosmonstruosnoexisten.Atravsdeestasfccioneselnioatribuyeemo-
cionesaotros,controlalaspropiasylograconvencerseasmismoadoptandolaperspec-
tivaquesuelentomarlosadultosanteestascuestiones.Otrojuegotpicopuedesercas-
tigaraunmuecoporquesehaportadomal.Losniosexploranatravsdeestafccin
lossentimientosdeculpacuandonohacenloqueseesperadeellosyadoptantambin
elpuntodevistadeladultoqueaplicalasnormaseimponelassanciones.Endefnitiva,
atravsdeestosjuegoslosniosexploransustemores,emocionesycreenciasypractican
situacionessocialesadoptandoperspectivasdiferentesalapropia.
Eljuegodefccinsevahaciendoconeltiempomsymscomplejo.Estacomple-
jidadsetraduceenunadescontextualizacincadavezmayor.Enunprincipiolosobjetos
resultanimportantesparajugar,perolosniosvanempleandocadavezmsellenguaje
paracrearescenariosysustituirobjetos.Deestaforma,losniosde5y6aospodrn
representar papeles y construir escenarios complejos y poco conocidos. Por ejemplo,
podrn organizarse para jugar a los astronautas aunque no dispongan de ningn objeto
relacionadoynosepanexactamentequhaceunastronautaocmoeselespacio.
Esta progresiva descontextualizacin es posible gracias a las estructuras cognitivas
que se van adquiriendo y al desarrollo del lenguaje (Harris y Kavanaugh, 1993), pero
tambinlaprcticadeljuegodefccinfavoreceeldesarrollodecapacidadesintelectua-
lescomoellenguaje,lateoradelamente,lamemoriayelrazonamiento(KailyCava-
naugh,2003).Porotraparte,laintervencindelosadultoseneljuegopuedefavorecer
el desarrollo de capacidades cognitivas y sociales en el nio. Por ejemplo, si un nio
juegaaconstruirunatorreconbloquesestejercitandolamotricidadfna,laplanifcacin
delaaccin,lacoordinacin,etc.,perosiunadultocogelosbloquesylosconvierteen
vasos para beber limonada, est incitando al nio a jugar en un nivel superior. En otro
sentido,cuandodosniosjueganjuntosysurgenconfictos,lamediacindeunadulto
queayudeaconciliar,negociarybuscarunasolucinintermediacontribuiralaadqui-
sicindehabilidadessocialesyaldescensodelaagresividad.Aspues,laintervencin
deladultoeneljuegoinfantilpuedeconstituirunaformadeandamiaje,deformaqueel
nioseapoyaraenestructurascognitivasprestadasparaactuarypensarenunnivel
superior.
Entre los 3 y los 6 aos, los nios pasan gran parte de su tiempo inmersos en un mun-
do en el que las reglas y las leyes de lo real se desafan continuamente. Cuando
los nios juegan a ser personajes fantsticos son capaces de traspasar paredes, volar
o ver a travs de objetos. Las pelculas y las historias infantiles estn plagadas de seres
con poderes mgicos que pueden desaparecer, poseen un conocimiento ilimitado o
viven eternamente. En principio, parece que la mayor parte de los nios separan el
CONLOSPIES
ENLATIERRA
Existen las hadas y las brujas? La
distincin infantil entre realidad y ccin
256 Bloque III. La primera infancia: de los tres a los seis aos
mundo real y el cticio y no intentan aplicar las reglas que funcionan en uno para
conseguir metas en el otro. As, si por ejemplo un nio desea ir al cine intentar con-
vencer a sus padres para que le lleven y no probar a transportarse mediante meca-
nismos mgicos. Sin embargo, todos los nios han tenido alguna vez miedo de los
monstruos que se esconden en los armarios o esperan debajo de la cama, han credo
durante algunos aos en la existencia real de los Reyes Magos y han pensado que las
hadas tie nen poder para conceder deseos. As pues, la cuestin principal que nos
planteamos ahora es existen fronteras claras entre la ccin y la realidad en el razo-
namiento infantil?
Muchos estudios han intentado resolver esta cuestin y parece que se puede dar
una respuesta clara aunque matizada: en la mayor parte de las situaciones los nios
distinguen la ccin de la realidad pero existen algunos elementos de confusin para
los pequeos. Los nios mantienen elementos contradictorios en las explicaciones sobre
algunos acontecimientos del mundo en el que viven porque se les anima tanto a creer
en la ccin como a mantener concepciones ms orientadas hacia la realidad. Los adul-
tos proponemos explicaciones mgicas cuando consideramos que vale la pena que el
nio crea en algo cticio como los Reyes Magos pero tambin las desmontamos
cuando juzgamos que no conviene fomentar la creencia como en el caso de las bru-
jas o los monstruos. No obstante, cuando el nio es quien inventa su contexto cticio
es raro encontrar confusin. El juego de ccin es un claro ejemplo en el que el nio se
muestra lcido en su distincin a pesar de la gran implicacin emocional que supone.
Incluso en los casos que podramos denominar extremos de juego de ccin, en el
que los nios crean personajes imaginados con los que mantienen una estrecha amistad
y comparten muchas actividades, la conciencia de su naturaleza cticia es siempre clara.
El control que mantiene el nio en su creacin cticia parece ser un elemento clave en
la diferenciacin.
As pues, los adultos podemos inducir al error e impulsar al nio a investigar la exis-
tencia real de los seres cticios cuando el contexto es propicio. Si el nio encuentra la
ocasin de comprobar si hay un monstruo debajo de la cama o de probar la ecacia de
las palabras mgicas, no la desaprovechar. Estas conductas reejan, efectivamente, la
confusin del nio y la duda sobre la existencia real de aspectos cticios.
Con el tiempo y la conuencia de varios elementos, los nios terminan por con-
vencerse de la irrealidad de la ccin. En primer lugar, los adultos comienzan a des-
montar las creencias mgicas y a sustituirlas por otro tipo de explicaciones. Para todos
los nios llega un momento en el que los Reyes Magos dejan de existir. Adems, la
educacin formal insiste ao tras ao en la conguracin de un sistema racional y
cientco que, sin duda, organiza de manera coherente las explicaciones sobre el mun-
do en la mente infantil. Las demostraciones cientcas son ms convincentes y termi-
nan por imponerse porque, por otra parte, todas las exploraciones que los nios rea-
lizan cada vez que pueden llevan siempre al mismo resultado decepcionante: ni las
hadas ni las brujas ni los monstruos existen. Ningn nio consigue obtener pruebas
ables sobre la existencia de los seres cticios ni sobre la ecacia de los conjuros. Al
contrario, lo que s obtienen son explicaciones alternativas que permiten entender los
fenmenos mgicos de una forma ms realista. Ahora bien, signica este abandono
de la causalidad mgica una renuncia total de la ccin? Se puede decir que los
adultos mantienen nicamente creencias racionales y que el pensamiento mgico des-
aparece de su sistema cognitivo? Sin duda, la ccin se sigue manifestando durante
la vida adulta provocando intensas reacciones emocionales y el pensamiento mgico
muchas veces inunda el razonamiento adulto plagndolo de creencias y supersticiones
cticias.
Captulo 10. El mundo social 257
Antesdeterminaresteapartadoqueremossealarquemuchosniosdeestasedades
preferen jugar con otros, precisamente para compartir y crear estos espacios ldicos,
aunqueeljuegodefccincompartidonoocupatodosutiempoyexistenmuchasdife-
renciasindividuales.Engenerallosniossuelendisfrutardeljuegosimblicocomparti-
doperotambinbuscanespaciosdejuegosolitario.Elqueunniopreferajugarsolono
debesermotivodepreocupacinens,aunquehayciertaspautassolitariasquepueden
indicarunaausenciadehabilidadessociales.Porejemplo,losnioscuyapautadejuego
habitualesdeambularsolosdeunaactividadaotraperosindetenersearealizarninguna
ylosniosqueprincipalmenteobservanjugaraotrosniosperonoparticipan,pueden
necesitarunentrenamientoquelesproporcionelasestrategiasnecesariasparaintroducir-
seenungrupoocolaborarconotros(KailyCavanaugh,2003).
Tabla 10.1. Comparacin de los aspectos tericos del juego entre Piaget y Vygotski
El juego visto por Piaget El juego visto por Vygotski
SegnPiaget,eljuegoquerealizaelnioesun
refejo de sus estructuras cognitivas. Una vez
queelnioescapazdeutilizarsmbolos,puede
realizarjuegosimblicoodefccin.
Unadelasfuncionesdeljuegoesconsolidarlas
estructurasintelectualesquesevanadquiriendo
a lo largo del desarrollo. Tambin lo considera
unaproyeccindecuestionesinternasyunafor-
madeexplorarlarealidad.
Eneljuegopredominalaasimilacin.
Unadelascrticasrealizadasalavisinpiage-
tianadeljuegoeslaescasaimportanciaquecon-
cedealainteraccinentreiguales.
ParaVygostki el juego simblico es la realiza-
cin inmediata, a travs de la imaginacin, de
deseosirrealizables.
El juego no es, por tanto, una actividad inte-
lectual.
Aunque no es la actividad primordial del nio,
el juego simblico es en la primera infancia la
fuenteprincipaldedesarrollo.Atravsdeljuego
simblicoelniocreazonasdedesarrolloprxi-
moquefomentansudesarrollo.
Eljuegosimblicosurgedelasideasynodelos
objetos. La separacin de la percepcin directa
esunadesuscaractersticasprincipales.
5. La identidad de gnero
Una de las categoras bsicas que organiza nuestra sociedad es el gnero, es decir, las
ideasyconvencionessocialesligadasalsexobiolgico.Paralagranmayoradelosadul-
toslasactitudesyestereotiposasociadosalgneroestntaninteriorizadosquemuchas
vecesseadoptanysetransmitencasideformaautomtica.Nacerniooniacondiciona
enlosadultosyentodalasociedadunaseriedeconductas,atribucionesyexpectativas
quemarcarndemaneradefnitivaeldesarrollodelapersonalidadylaidentidaddelin-
dividuo.
Lasideasacercadeloquedebenhacerrolesdegneroocmodebenseres-
tereotiposdegnerohombresymujeresjuntoconlasconductasqueculturalmente
seconsideranapropiadasacadagruposeaprendendesdemuytemprano.Alavezque
elniovainteriorizandoestosestereotiposyrolesdegnerovatambinidentifcndose
con uno de los dos grupos, formando as su identidad como nio o nia. Hacia los 2
aos,losniosyareconocenaloshombresylasmujeresytambinsabensiellosmis-
mossonniosonias.Desdeestaedad,oinclusoantes,losniospreferenjugarcon
258 Bloque III. La primera infancia: de los tres a los seis aos
juguetesasociadosasugrupo.As,losniospreferenjugarconbloquesdeconstruccin
o camiones mientras que las nias preferen jugar con muecas. Un poco ms tarde,
como ya hemos visto, nios y nias preferen como compaeros de juego a los de su
mismosexo.Tambindesdelosiniciosdeljuegosimblicolosrolesqueserepresentan
estntipifcados,estoes,lasniassuelen,porejemplo,hacerdemamsylosnios
depaps.
Entrelos3ylos6aoslosniosaprendenmuchasmscosasacercadelgnero.Este
aprendizajeculminaraosmstardeconlaadopcindeunaidentidaddegneroque
se puede defnir como el conjunto de valores, actitudes, estereotipos y roles ligados al
grupodereferenciavaronesomujeresconlosqueunosereconoce.Laidentidadde
gneroesuncomponentemsdelautoconceptojuntoconelrestodeloselementosque
conformanlavisindeunomismo.Pero,cmoseconstruyeestaidentidaddegnero?
Mediantequvassetransmitenesosvaloresyactitudes?Diferentesteorashaninten-
tadoexplicaresteproceso.
Segnelpsicoanlisis,delos3alos6aoslosniosseenfrentanconlaetapafli-
ca.EnestafaseapareceenlosnioselcomplejodeEdipo,llamadoasenhonoralmito
griegoenelqueEdiposinsaberlomataasupadreysecasaconsumadre.ParaFreud,
alprincipiodelavidalosbebsestnunidosdeformasimbiticaconsumadreysienten
quetodoelafectodelamadreesparaellos.Hastalos2aoscreenquelamadreesex-
clusivamentesuya,peroapartirdeestemomentoapareceunrivalquepretendequitarle
elcarioexclusivodelamadre:elpadre.Ascomienzaunarelacintriangularenlaque
elniosienteagresividadporelpadreyalaveztemesercastigadoporl.Estemiedoa
sercastigadoporsentiragresividadhaciaelpadreseexpresaenlaterminologaanal-
ticacomomiedoalacastracin.Noesunmiedoaquenoscastreslogenitalmente,sino
aquenosdestruya,puestoqueesunrivalmuypoderoso.Elnio,ensufantasa,siente
que entra en rivalidad con un gigante (FernndezVillamarzo, 1978). No obstante, el
padre constituye una fgura esencial en la vida del nio y necesita solucionar este con-
ficto.Laformaqueencuentradesolucionarloesinternalizarlaprohibicindelamadre
eidentifcarseconelpadre.Deestaforma,silmismoseprohbealamadre,elconfic-
to con el padre desaparece. Esta prohibicin pasar a formar parte de los imperativos
moralesdelsuperyo.Alinternalizarlaprohibicindelamadreseproducelaidentifca-
cinconunodelosprogenitores,queenlasniassuelesermsfuerteconlamadreyen
los nios con el padre. As pues, durante esta etapa los nios adquieren su identidad
sexualprefriendorealizaraccionestpicasdesusexoeidentifcndoseconlaspersonas
desumismosexo.
Lasteorasdelaprendizajemantienenquelosniosaprendenacomportarsecomo
varonesomujeresenfuncindeloquelosadultosylasociedadlesensea.Tantolos
adultos, como los iguales y los medios de comunicacin transmiten permanentemente
estereotipos y valores ligados al gnero que los nios van interiorizando. Los padres,
por ejemplo, refuerzan y premian las conductas acordes con el estereotipo de gnero
mientras que critican o castigan las conductas que no se ajustan a lo que se espera de
unnioodeunania.Enestesentido,algunosestudioshanmostradoquelospadresy
lasmadresnosecomportandelamismaformaconsushijosehijas(KailyCavanaugh,
2003).Aunqueambossonigualdecariososyfomentanlaindependenciaensushijos
ehijas,existenciertasdiferenciasdetratoligadasalgnero.Porejemplo,losjuegosque
se fomentan en nios y nias son distintos y las tareas de casa tambin se asignan en
Captulo 10. El mundo social 259
funcin del sexo de los hijos. En general, parece que los padres tienden ms que las
madres a tratar a sus hijos e hijas en funcin de los estereotipos de gnero. As por
ejemplo, los padres sern ms crticos si su hijo juega de forma femenina, pero fo-
mentarnlasensibilidaddesushijas.Lasmadres,alcontrario,parecentratarasushijos
e hijas ms en funcin de sus caractersticas y necesidades personales que en funcin
delosestereotiposdegneroynocriticarnelllantodesuhijosi,porejemplo,respon-
deaunafaltadeseguridad.
Otro elemento que contribuye a este aprendizaje de la identidad de gnero son los
iguales.Comohemosvisto,eljuegoylaorganizacindelosgruposenestasedadesse
realizanenfuncindelsexo.Niasyniospreferenjugarconcompaerosdesumismo
sexo. Esta separacin hace que cada nio o nia pase la mayor parte de su tiempo con
otros de su mismo sexo, aprendiendo precisamente de sus iguales, consolidando las
semejanzasdentrodesugrupoyenfatizandolasdiferenciasconelotro.Estaseparacin
ayudaalaconstruccindelapropiaidentidadyareforzarelsentimientodepertenencia
aungrupo.Ademsdeinteriorizarlopropiodecadagrupo,mediantelainteraccincon
losigualeslosniosaprendenquconductasseconsideraninadecuadasporelgrupoy
susconsecuencias.Yadesdeestasedadeslosniosmarginanycriticanaaqulloscuyo
comportamientonorespondealosestereotiposdegnero,especialmentealosniosque
realizanconductasasociadasalasnias.
Porltimo,lostericosdeaprendizajesocialconsideranquelosniosaprendenmu-
chosaspectossobreelgneroobservandoeimitandolasconductasquevenasualrede-
dor.Lospadressuelenserlosmodelosquelosniostienenmsamanoydeellosimitan
conductas e integran valores que el adulto reproduce, en muchos casos, sin tomar con-
ciencia.
Losmodeloscognitivossecentranencmoentiendenlosnioslasdiferenciasentre
hombresymujeresparaconstruirsuidentidaddegnero.Desdeestepuntodevista,al-
gunosautoreshanplanteadolanecesidaddecomprenderelsexocomounrasgoinmodi-
fcablealolargodelavidaantesdepoderadoptarunaidentidaddegnero.Esdecir,los
niospequeosdebenentenderqueelsexoesunrasgopermanenteparapoderatribuir
rasgosyconductasacadaunodelosgruposeidentifcarseconunodeellos.Estacom-
prensin del sexo como un rasgo permanente, denominada constancia de gnero, se
suele adquirir hacia los 5 aos (Bem, 1989). Sera, pues, a partir de esta comprensin
cuandolosniosempezaranainteresarseporlosrasgoscaractersticosdecadagnero
yaadaptarsuconductaenfuncindelosrolespropiosdesugrupo.Noobstante,algunos
estudios han mostrado que antes de comprender la constancia de gnero los nios se
comportandeacuerdoconlosrolesasociadosasugrupoyconocenmuchosdeloseste-
reotipos de gnero que regulan la conducta de los hombres y las mujeres (Berger y
Thompson,1995).
Este problema ha llevado a una reformulacin de las teoras cognitivas que se han
centradoenelconceptodeesquemadegnerocomounidadexplicativaprincipaldela
adquisicindelaidentidaddelgnero.Unodelosaspectosenlosquelosniossefjan
cuandoconstruyensusesquemasdeconocimientosobrelaspersonassonlosrelacionados
conelgnero.Losesquemasdegnero,pues,sonelconjuntodeconocimientosquese
vanadquiriendoenrelacinconelgnero,incluyenestereotiposyrolesydarnlugara
laidentidaddegnero.Estosesquemasdegnero,quesevanadquiriendodeformapro-
gresiva,ayudantantoacomportarsedeformaadecuadacomoapredecirlaconductade
260 Bloque III. La primera infancia: de los tres a los seis aos
losdems.Porejemplo,hacialos2aoslosniosyaposeenelconocimientosufciente
comoparapodercategorizaralaspersonasenhombresomujeresenfuncindelaspec-
tofsico.Esteesquemadegnerobsicoseirahaciendomssofsticadoamedidaqueel
nioincorporeinformacinrelacionadaconelgneroqueleayudeacomprenderaspec-
tos ms complejos. Por ejemplo, hacia los 3 o 4 aos muchos nios y nias ya habrn
integradoasuesquemadegneroquecuidaralosbebsesunatareaasignadasobretodo
a las mujeres. Igualmente, muchos nios y nias a esta misma edad ya se habrn dado
cuentadequeloshombresseocupanmsamenudodecuestionesmecnicascomoarre-
glarelcoche.Estasrepresentacionessobreloqueespropiodehombresymujeresguan
laconductadelosniosalavezquesevanformandounaideasobresmismoscomo
niosonias.Losesquemasdegneroseadquierenmuyprontoporquenuestrasociedad
establecemuchasdistincionessignifcativasentrehombresymujeresquelosniosper-
ciben desde temprano, pero son instrumentos que se emplean toda la vida. Durante la
edadadultalosesquemasdegnerotambindirigirnlasconductas,expectativas,atribu-
ciones y valoraciones que se hagan sobre lo que es propio de las mujeres y lo que es
propiodeloshombres.
6. El pensamiento moral
Apartirdelos2aos,oinclusoantes,losniosyasabenqueciertasconductassonre-
probadasporlosadultos.Lamayorpartedelosadultosregaanalnioquepegaydes-
aprueban las muestras de egosmo animando a compartir con los dems.Adems, los
adultos imponen gran cantidad de normas en cuya elaboracin el nio no interviene y
cuyafnalidadprobablementeselesescapa.Porejemplo,lasnormasdehigiene,dese-
guridad o de respeto hacia los dems no tienen, probablemente, mucho sentido para el
nio,perorigensuvidadesdemuytemprano.Apartirdelasvaloracionesylasnormas
impuestasporlosadultos,losniosvandesarrollandounpensamientoocriteriomoral,
esdecir,vanaprendiendoloqueestbienyloqueestmal.
Piaget(1932)dedicpartedesuobraaestudiarenprofundidadcmoentiendenlos
niosaspectosmoralesrelacionadosconlajusticia,lamentiraoelrobo.Paraelloplan-
teabaunaseriedehistoriasypreguntabaalosnioscuestionescomoqudebanhacer
lospersonajes,culsehabaportadomejor,culmerecamayorcastigo,etc.Dadoque
eltrabajodePiagetofreceladescripcinmsdetalladasobreelrazonamientomoralen
estaetapadeldesarrollo,noscentraremosensuinvestigacinysusresultados.
Comohemosmencionado,elniovaaprendiendoloquesedebeyloquenosedebe
hacerapartirdelasindicacionesquerecibedelosadultos.Cuandolosniossonpeque-
os,losadultosimponenmultituddenormasquerigenlaconductadelosniosentodos
losmbitos.Enmuchasocasiones,losniospequeosnoentiendenelsentidodeestas
normas pero, dada la presin que ejerce el adulto para su cumplimiento, los nios no
puedensinoacatarlassinnegociarocuestionarlas.Enestesentido,Piagetcalifclamo-
raldelniopequeocomounamoralheternoma,esdecir,unamoraldeobedienciaa
laautoridadquesedebealrespetoqueelniosienteporeladultoysebasaenelcum-
plimientodenormasimpuestas.Estetipodemoraldecumplimientodenormasseman-
tieneporqueelniopercibealadultocomounaautoridadalaqueesobligatorioobede-
ceryquetienepoderparasancionarypremiar.Aunque,comoveremosenelCaptulo12,
Captulo 10. El mundo social 261
laorientacinmoraldelnioseharmsautnomagraciasalareciprocidadylacoope-
racinqueseestableceenlasinteraccionesconotrosnios,lamoralheternomapropia
del nio pequeo se mantiene a lo largo de toda la vida. Durante la edad adulta, gran
parte de las normas que rigen la vida de los ciudadanos se cumplen por presin de la
autoridadyporevitarlassancionesqueimpone.Aspues,aunqueelcriteriomoralde-
vienemuchomscomplejo,laorientacinheternomapermanece.Enestesentido,Pia-
getnoconcibilamoralheternomaylaautnomacomodosetapasquesesucedenen
el desarrollo sino, ms bien, como dos orientaciones que pueden coexistir. Veamos a
continuacincmorazonanlosniospequeossobrediferentesaspectosmoralesalos
quePiagetprestespecialatencin.
6.1. La intencionalidad y la responsabilidad objetiva
Unodelosprincipaleselementosquelosadultostienenencuentaaljuzgarunaconduc-
tacomoadecuadaoinapropiadaeslaintencindequienlarealiza.Si,porejemplo,un
nio empuja a otro sin querer juzgaremos su conducta menos grave que si lo hace de
formaintencionadaparahacerledao.Piagetseinteresporlaconcepcininfantildela
intencionalidad y la responsabilidad a la hora de juzgar acciones. Para preguntar a los
niosporestascuestiones,lespresentabahistoriascortasconsituacionescotidianasyles
pedaquerefexionaransobrelasactuacionesdelospersonajes.Veamosunejemplode
estashistorias:
Historia I: Haba un nio que se llamaba Jules. Su pap no estaba. Entonces
Jules tuvo la idea de divertirse con el tintero de su pap. Jug un momento con
la pluma y despus manch un poquito el pao de la mesa.
Historia II: Un nio, que se llamaba Auguste, vio que el tintero de su pap
estaba vaco. Un da que su pap haba salido, se le ocurri, para hacerle un favor, llenar
el tintero para que el pap encontrara tinta al volver. Pero, al abrir la botella de tinta, hizo
una gran mancha en el pao de la mesa.
Estos nios, son igual de malos o uno de ellos es ms malo que el otro? Cul de los
dos es ms malo y por qu?(Piaget,1932,p.105.)
Alformularestetipodepreguntasalosnios,Piagetobservquelospequeosemi-
tanjuiciosenlosquenoconsiderabanlaintencindelactorsinoslolasconsecuencias
materialesdelaaccin.Estetipodejuiciolodenominresponsabilidadobjetiva.Por
ejemplo, en la historia anterior, una respuesta tpica de nio de 6 aos sera: [Es ms
malo] el que ha hecho la mancha grande. Por qu? Porque era grande. Por qu ha
hecho una mancha grande? Para hacer un favor.Y el segundo, por qu ha hecho una
manchapequea?Porque lo tocaba todo. Hizo una mancha pequea.Entonces,cules
msmalo?El que hizo la mancha grande(Ibd, p.106).
Piaget encontr que a partir de los 7 u 8 aos los nios ya consideran la intencin
comounelementoimportantealahoradevalorarunaaccinydenominaestosjuicios
responsabilidadsubjetiva(vase Captulo 12).
262 Bloque III. La primera infancia: de los tres a los seis aos
6.2. La mentira
Otro de los aspectos estudiados por Piaget fue la concepcin infantil de la mentira.
Cmoentiendenlosnioslasmentiras?Cmoestablecenladiferenciaentrelaver-
dad,lamentirayelerror?Paraestudiarestacuestin,pedaalosniosquedefnieran
quesunamentira.Piagetencontrquelosniospequeosentendanquelamentira
eraunengaoperoleaadanotrossignifcados.Hastaaproximadamentelos6aos,
losniosconsiderabanmentira,porunaparte,loqueparalosadultosylosniosma-
yoressonexageracionesoerroresy,porotra,laspalabrotas.Veamoslasrespuestasde
un nio de 6 aos: Qu es una mentira? Quiere decir cuando se dicen cosas malas
que no haba que decir.Ququieredecircosasmalas?Que ha dicho malas pala-
bras. Dime malas palabras, sabes alguna? Charrogne (carroa) (esta palabra se usa
enSuizacomoreniegooinsulto).Esunamentira?S.Porquesunamentira?Porque
es una mala palabra.Unchicohabavolcadounataza,perohabadichoquenoeral.
Esunamentira?S.Porqu?Porque lo haba hecho l.(...)Decirque2y2son5,
esunamentiraono?S.Malaono?No es mala.Porqu?Porque no es una mala
palabra.
Al igual que en el caso de la responsabilidad objetiva, para los nios pequeos la
gravedaddelamentiranoseencuentrarelacionadaconlaintencinnilaconsecuencia
delengaosinoconsucredibilidad.Paraexplorarestetemalosniosentrevistadospor
Piagetescucharonhistoriascomoestas:
Historia I: Un chico se pasea por la calle y encuentra un perro grande que le
da mucho miedo. Entra en su casa y explica a su mam que ha visto un perro
tan grande como una vaca.
Historia II: Un nio vuelve de la escuela y explica a su mam que la maes-
tra le ha dado buenas notas. Pero no era verdad: la maestra no le haba dado ninguna nota,
ni buena ni mala. Su mam se puso muy contenta y le dio una recompensa(Ibd,p.124).
Cuando se les preguntaba cul de las dos mentiras era peor, los nios pequeos
afrmabanqueerapeorlaprimeraporque esto no es posibleoporquesu mam lo saba
(que era falso, imposible) mientras que el otro, la mam no lo saba. Si se dice algo
que mam no sabe, es menos malo, porque la mam podra creerlo. Si la mam lo sa-
be que no es verdad, la mentira es ms grande (Ibd,p.127).Apesardecomprender
que en la segunda historia el personaje consigue un premio gracias a la mentira, los
niospensabanquehabraquecastigarmsalprimeroporqueeramsmentirosoyms
malo(p.126).
6.3. La justicia inmanente y retributiva
Piagetestudialgunosaspectossobrelaconcepcindelosniosdelajusticia.Poruna
parte,explorsilosnioscreanenunajusticiainmanente,esdecir,enlaideadeque
tardeotempranolosculpablessiempreserncastigados.Aestaideasubyacelaconcep-
cindeunajusticiaperfectaquecastigaaquienlomerece.Paraestudiarestepuntopre-
sentabaalosniosestahistoria:
Captulo 10. El mundo social 263
Haba una vez dos nios que robaban manzanas. De repente llega un guarda y
los dos nios escapan corriendo pero el guarda coge a uno de ellos. El otro, al
volver a su casa por un atajo, cruza el ro por un puente en mal estado y se cae
al agua.
Si no hubiera robado las manzanas y hubiera pasado el ro por el mismo puente, tam-
bin se habra cado al agua?(Ibd, p.211.)
El86%delosniosde6aospensabanquesielprotagonistanohubierarobadolas
manzanastampocosehubieracadodelpuente,estableciendounarelacincausalentre
ambossucesos.Asporejemplo,decanquees justo, no hubiera debido robar () si no
hubiera robado no se habra cado al agua porque no habra hecho nada malo (p.213).
Tambinpodanafrmarquesinosehubieracadodelpuentelehubierapasadootracosa,
esdecir,detodasformashubierarecibidouncastigoporrobarlasmanzanas.Sinembar-
go,apartirdelos9aos,lasrespuestasdelosniosponandemanifestoquenohaba
unarelacindirectaentreelroboylacada.
Porltimo,Piagetencontrquealosniospequeoslesparecejustocastigaralcul-
pable con el mismo dao que l caus, es decir, creen en la justicia retributiva. Esta
concepcinseexpresapopularmenteconelfamosoojoporojo,dientepordiente.Esta
concepcindelajusticiafueestudiadaapartirdehistoriascomo:
Una mam tena dos hijas, una obediente y otra desobediente. Esta mam que-
ra ms a la que obedeca y le daba los trozos de pastel ms grandes. Qu te
parece?(Ibd,p.221.)
Anteunasituacindeestetipo,lamayorpartedelosnioshastalos9aosaprueban
laconductadelamamdiciendoporejemploqueera justo, debera hacer siempre lo que
se le dice,queestababienpara ensear a la otra cmo la querra si fuera obediente o
quela ms obediente debe tener las mejores cosas (p.222).Apartirdelos9aos,sin
embargo, los nios ya manifestaban en sus respuestas que el reparto igualitario de los
bienesesunaopcinmsjusta.
Lecturas complementarias
Cantn,J.yCorts,M.R.(2000).El apego del nio a sus cuidadores: Evaluacin, antecedentes
y consecuencias para el desarrollo.Madrid:Alianza.
Garvey,C.(1977).El juego infantil.Madrid:Morata,1985.
Gimnez-Das,M.(2003).Existenlashadasylosmonstruos?Ladistincininfantilentreloreal
ylomgico.Unarevisincrticadelaliteratura.Estudios de psicologa, 24(3),337-352.
Harris,P.L.(1989).Los nios y las emociones.Madrid:Alianza,1992.
Rodrigo,M.J.yPalacios,J.(Coords.)(2003).Familia y desarrollo humano.Madrid:Alianza.
Rubin,Z.(1980).Amistades infantiles.Madrid:Morata,1981.
264 Bloque III. La primera infancia: de los tres a los seis aos
Actividades
1. Conteste a las siguientes preguntas:
Un nio de 5 aos se mostrar ms conciliador cuando tenga que resolver un conicto
con:
a) Su madre.
b) Un hermano pequeo.
c) Un amigo.
Sobre los estilos educativos podemos armar que:
a) Existe una relacin causal directa entre el estilo adoptado por los padres
y los rasgos de personalidad y aptitudes de sus hijos.
b) El autoritario tiene consecuencias ms negativas para los hijos que el
indiferente.
c) Los padres realizan ajustes en el estilo que emplean en funcin de las
caractersticas de cada hijo.
Los nios de 4 y 5 aos que son competentes socialmente, probablemente:
a) Han establecido un apego seguro con sus cuidadores.
b) Han sido educados con un estilo permisivo.
c) Preeren ser espectadores del juego de otros nios.
2. Diseo de actividad
Disee una actividad que fomente una competencia emocional para nios entre 3 y 6
aos. Puede adaptar materiales que ya conozca, inventar otros nuevos o inspirarse en
libros o juegos infantiles.
3. Juan, Antonio y Carla
Estudie la siguiente situacin y conteste a la pregunta que se plantea a continuacin:
A Juan, que tiene 6 aos, se le ha quedado atrapado el dedo en el reproductor
de CD cuando intentaba poner un disco. Mientras lloraba y lloraba, sus hermanos An-
tonio y Carla de 2 y 3 aos, le miraban pero no fueron a ayudarle. Cuando lleg su
madre consol a Juan y vio que al dedo no le haba pasado nada, pero se qued pre-
ocupada ante la reaccin de sus hijos pequeos. Por qu, viendo que Juan lloraba,
Antonio y Carla no hicieron nada para ayudarle? (Adaptado de Kail y Cavanaugh,
2003, p. 189).
4. Los estilos educativos
Complete la siguiente tabla relacionando lo que ya sabe sobre los estilos educativos que
practican los padres y las consecuencias probables que tienen en los hijos. En las dos
primeras las debe establecer si el nivel de control y afecto es alto o bajo para cada uno
de los estilos, escribiendo uno u otro adjetivo en cada casilla. En el resto de la tabla,
marque con una cruz las caractersticas que describen cada estilo (en letra normal) y las
consecuencias que suelen provocar en los hijos (en negrita).
Captulo 10. El mundo social 265
Autoritario Permisivo Democrtico Indiferente
Afecto
Control
Excesivamenteexigentes
Altaautoestima
Impulsividad
Inmadurez
Buenrendimientoescolar
Autonoma
Dependencia
Altacapacidadcrtica
Pococomprometidos
Bajaautoestima
Utilizaelcastigo
Enfatizaelrazonamiento
Desobediencia
Evitalaimposicin
Agresividad
Difcultadesenrelaciones
sociales
Soluciones a las actividades
1. Preguntas
En la primera pregunta la respuesta correcta es la c). Como se explica en el texto, los
nios a los 5 aos despliegan capacidades distintas en funcin de con quin interactan.
Las relaciones con los iguales son ms igualitarias y ms clidas desde el punto de vista
emocional, lo cual puede favorecer que los nios se muestren ms conciliadores cuando
surge un conicto.
En la segunda pregunta la respuesta correcta es la c). Los padres suelen utilizar el
mismo estilo educativo con sus hijos aunque realizan ajustes en funcin de las cualida-
des de cada uno. La alternativa a) es falsa porque no se han establecido relaciones
causales directas entre la adopcin de un estilo educativo y sus repercusiones en los
hijos. Slo parece que el empleo de algunos estilos tiene ms probabilidades de generar
determinadas caractersticas en los hijos. Por ltimo, la alternativa b) es falsa porque el
estilo ms daino para los nios es el indiferente.
En la tercera pregunta la respuesta correcta es la a). Entre los factores que parecen
estar relacionados con la competencia social est el haber establecido un vnculo segu-
ro con los cuidadores. La alternativa b) es falsa porque es el estilo democrtico el que
fomenta la competencia social. La alternativa c) es falsa porque los nios que preeren
mirar cmo juegan otros nios no suelen tener habilidades para introducirse en los
grupos y, por tanto, no se puede decir que sean socialmente competentes. La pauta
de juego que se caracteriza por la observacin del juego de otros o el juego solitario
suele darse en nios que necesitan apoyo para colaborar con otros y establecer amis-
tades.
266 Bloque III. La primera infancia: de los tres a los seis aos
2. Diseo de actividad
Por ejemplo, para aumentar el vocabulario emocional e identicar diferentes emociones
en los dems se pueden hacer fotografas de los nios de la clase pidindoles que ex-
presen alegra, enfado, tristeza, rabia, etc. Despus se pueden colgar en un espacio de
la clase y pedir a los nios que las identiquen para ponerles la etiqueta correspondien-
te. Tambin se pueden presentar caras en blanco y que los nios dibujen la expresin
correspondiente a un estado emocional. Otra forma de trabajar es con espejos: los
nios ponen la expresin correspondiente a la emocin que se est explicando o tra-
tando.
3. Juan, Antonio y Carla
Dos factores pueden explicar por qu los hermanos pequeos no ayudaron al mayor. En
primer lugar, la responsabilidad para ayudar al mayor se diluye entre los dos pequeos
y ninguno se siente lo sucientemente responsable como para actuar. En general, los
nios de estas edades no suelen sentirse responsables de los dems. En segundo lugar,
probablemente, ninguno de los dos hermanos sabe cmo ayudar a Juan puesto que su
experiencia con el reproductor de CD es mnima. As pues, tampoco tienen la compe-
tencia necesaria para ayudar a su hermano mayor.
4. Los estilos educativos
A continuacin tiene la tabla en la que aparecen las respuestas correctas sobre los rasgos
de los estilos educativos y sus consecuencias probables en los hijos.
Autoritario Permisivo Democrtico Indiferente
Afecto Bajo Alto Alto Bajo
Control Alto Bajo Alto Bajo
Excesivamenteexigentes X
Altaautoestima X
Impulsividad X X
Inmadurez X X X
Buenrendimientoescolar X
Autonoma X
Dependencia X
Altacapacidadcrtica X
Pococomprometidos X
Bajaautoestima X
1
X
Utilizaelcastigo X
Enfatizaelrazonamiento X
Captulo 10. El mundo social 267
Desobediencia X
Evitalaimposicin X
Agresividad
X
Difcultadesenrelaciones
sociales
X
1
Hemosconsideradoqueelrasgoinseguridadqueapareceeneltextosepuedeconsiderarcomo
bajaautoestimaenestatabla.
Referencias
269
Aguado,G.(1997).El desarrollo del lenguaje de 0 a 3 aos.Madrid,CEPE.
Ainsworth,M.D.S.(1967).Infancy in Uganda.Baltimore:TheJohnHopkinsUniversityPress.
Ainsworth,M.D.S.,Blehar,M.,Waters,E.yWalll,S.(1978).Patterns of attachment. Hillsdale,
N.J.:Erlbaum.
Anglin,J.M.(1993).Vocabularydevelopment:Amorphologicalanalysis.Monographs of the So-
ciety for Research in Child Development,238,1-165.
Baillargeon,R.(1993).Theobjectconceptrevisited.Newdirectionsintheinvestigationofinfants
physicalknowledge.EnC.Granrud(Ed.),Visual perception and cognition in infancy.Hills-
dale,N.J.:LEA.
Bates,E.(1976).Language and context. The development of pragmatics. NuevaYork:Academic
Press.
Bates,E.,Benigni,L.,Bretherton,I.,Camaioni,L.yVolterra,V.(1979).The emergence of sym-
bols: cognition and communication in infancy. NuevaYork:AcademicPress.
Bates, E., Camaioni, L. yVolterra,V. (1975). The acquisition of performatives prior to speech.
Merril Palmer Quarterly,21,3,205-226.
Baumrind, D. (1971). Current patterns of parental authority. Developmental Psychology Mono-
graph, 4, 1-103.
Belinchn, M. (2000). Aprendiendo a conversar y a narrar. Manuscrito no publicado. Madrid:
CentrodePsicologaAplicada.UniversidadAutnomadeMadrid.
Belinchn,M.,Rivire,A.eIgoa,J.M.(1992).Laproduccindeldiscursoylaconversacin.En
M.Belinchn,A.yJ.M.Igoa,Psicologa del lenguaje. Madrid:Trotta.
Bem,S.(1989).Genitalknowledgeandgenderconstancyinpreschoolchildren.Child Develop-
ment, 60,649-662.
Berger, K. y Thomson, R. (1995). Psicologa del desarrollo: Infancia y adolescencia. Madrid:
EditorialMdicaPanamericana,1998.
Berk, L. E. (1986). Relationship of elementary school childrens private speech to behavioral
accompaniment to task, attention and task perfomance. Developmental Psychology, 22,
671-680.
Berk,L.E.(1992).Childrensprivatespeech:anoverviewoftheoryandthestatusofresearch.En
R. M. Daz y L. E. Berk (Eds.), Private speeh: from social interaction to self-regulation
(pp.17-53).Hillsdale,N.J:Erlbaum.
Berk,L.E.(1998).Desarrollo del nio y del adolescente.Madrid:PrenticeHall,1999.
Berk,L.E.yLandau,S.(1993).Privatespeechoflearningdisabledandnormallyachievingchil-
dreninclassroomacademicandlaboratorycontexts.Child Development, 64(2),556-571.
Bivens,J.A.yBerk,L.E.(1990).Alongitudinalstudyofthedevelopmentofelementaryschool
childrensprivatespeech.Merrill-Palmer Quarterly, 36(4),443-463.
270 Referencias
Bowlby,J.(1969).El vnculo afectivo. BuenosAires:Paids,1976.
Bowlby,J.(1951).Maternalcareandmentalhealth.World Health Organization, Monograph se-
ries, 2.
Bowlby,J.(1958).Thenatureofchildstietohismother.International Journal of Psychoanalysis,
39,350-373.
Bosch,L.(2005).Evaluacin fonolgica del habla infantil.Barcelona:Masson.
Braine, M. D. S. (1976). Childrens frst combinations. Monographs of the Society for Research
on Child Development, 41,Serialn.164.
Bretherton,I.(1984).Symbolic play: The development of social understanding.NuevaYork:Aca-
demicPress.
Bridges, K. M. B. (1932). Emotional development in early infancy. Child Development, 3,
324-334.
Brioso,A.(2001).Lostrastornosdeldesarrollo.EnA.CorralyP.Pardo(Eds.),Psicologa Evo-
lutiva I. Volumen 1: Introduccin al desarrollo.Madrid:UNED.
Brown,R.(1973).A frst language: the early stages.Cambridge,MA:HarvardUniversityPress.
Bruner,J.(1990).Actos de signifcado. Madrid:Alianza,1991.
Bruner,J.(1996)La educacin, puerta de la cultura. Madrid:Visor,1997.
Butterworth, G. E. (1991) The ontogeny and phylogeny of joint visual attention. EnA. Whiten
(Ed.),Natural theories of mind(pp.223-232).Oxford,UK:Blackwell.
Baron-Cohen,S.,Leslie,A.yFrith,U.(1985).Doestheautisticchildhaveatheoryofmind?
Cognition, 21,37-46.
Bartsch y Wellman, H. (1995). Children talk about the mind. NuevaYork: Oxford University
Press.
Beaudichon,J.(1973).Natureandinstrumentalfunctionofprivatespeechinproblemsolvingsi-
tuations.Merrill-Palmer Quarterly(19),117-135.
Camaioni,L.,Volterra,V.yBates,E.(1976).La communicazione nel primo anno di vita.Torino:
Boringheri.
Carey,S.(1978).Thechildasawordlearner.EnM.Halle,J.BresnanyG.A.Miller(Eds.)Lin-
guistic theory and psychological reality. Cambridge,MA:MITPress.
Carpendale, J. (1997).An explication of Piagets constructivism: implications for social cognitive
development. En S. Hala (Eds.), The development of social cognition. Londres: Psychology
Press.
Cassidy,J.,Parke,R.,ButkovskyL.yBraungart,J.(1992).Family-peerconnections:Therolesof
emotionalexpressivenesswithinfamilyandchildrensunderstandingofemotions.Child De-
velopment, 63,603-618.
Ceci,S.yWilliams,W.(1999).The nature-nurture debate. The essential readings.Oxford:Black-
well.
Chisholm,J.S.(1996).Theevolutionaryecologyofattachmentorganization.Human Nature, 1,1-37.
Clark, K. y Clark, M. (1939). The development of consciousness of self and the emergence of
racialidentifcationinnegropreschoolchildren.The Journal of Social Psychology, S.P.S.S.I.
Bulletin, 10,591-599.
Clarke-Stewart,K.A.(1989).Infantdaycare:Malignedormalignant?American Psychologist, 44,
266-273.
Corral,A. (2001). Los fundamentos neuronales del desarrollo humano. EnA. Corral y P. Pardo
(Eds.),Psicologa Evolutiva I. Volumen 1: Introduccin al desarrollo.Madrid:UNED.
Corral,A.yPardo,P.(1997).Elpensamientopreoperacionalylacapacidadrepresentacional.En
C.Corral,F.GuitirrezyP.Herranz(Eds.),Psicologa Evolutiva, vol. I.Madrid:UNED.
Corral,A.yPardo,P.(2002).Eldesarrollodelapercepcinydelaatencin.EnJ.GarcaMadru-
ga,F.GutirrezyN.Carriedo(Eds.),Psicologa Evolutiva II. Desarrollo cognitivo y lings-
tico, vol. I.Madrid:UNED.
Referencias 271
Cutting,A.yDunn,J.(1999).Theoryofmind,emotionunderstanding,language,andfamilybac-
kground:Individualdifferencesandinterrelations.Child Development, 70,853-865.
Cyrulnik, B. (2001). Los patitos feos. La resiliencia: Una infancia infeliz no determina la vida.
Barcelona:Gedisa,2002.
Chi, M. T. H. (1978). Knowledge structure and memory development. En R. Siegler (Ed.),
Childrens thinking. What develops? Hillsdale,N.J.:LEA.
Chomsky,N.(1959).Chomsky o Skinner? La gensis del lenguaje.EnR.Bayes(Ed.),Barcelona:
Fontanella,1977.
Damasio,A. (2004). En busca de Spinoza. Neurobiologa de la emocin y de los sentimientos.
Barcelona:Crtica,2005.
Darwin,C.(1872).La expresin de las emociones en los animales y en el hombre.Madrid:Alian-
za,1984.
DeCasper,A.J.yFifer,W.P.(1980).Onhumanbonding:Newbornsprefertheirmothersvoices.
Science, 208,1174-1176.
DeCasper,A.J.ySpence,M.J.(1986).Prenatalmaternalspeechinfuencesnewbornsperception
ofspeechsounds.Infant Behavior and Development, 9,133-150.
Delgado,B.,Gmez,J.C.,ySarri,E.(2002).Can young children use their pointing gestures as
a private tool to regulating their thought processes?Posterpresentadoenla32stAnnualmee-
tingoftheJeanPiagetSociety,Philadelphia.
Delgado,B.,Gmez,J.C.,ySarri,E.(enprensa).Privatepointingandprivatespeech:developing
parallelisms. EnA.Winsler, C. Fernyhough e I. Montero. (Eds.), Private Speech, Executive
Functioning, and the Development of Verbal Self-Regulation. Cambrigde, UK: Cambrigde
UniversityPress.
Deloache,J.S.,yBrown,A.L.(1983).Veryyoungchildrensmemoryforthelocationofobjects
inalarge-scaleenvironment.Child Development, 54,888-897.
Deloache,J.S.,Cassidy,D.J.,yBrown,A.L.(1985).Precursorsofmnemonicstrategiesinvery
youngchildrensmemory.Child Development, 56,125-137.
Delval,J.(1978).(Comp.).Lecturas de psicologa del nio(Vol.1).Madrid:Alianza.
Delval,J.(1994).El desarrollo humano.Madrid:SigloXXI.
Denham,S.(1998).Emotional development in young children.NuevaYork:GuilfordPress.
Denham,S.,McKinley,M.,Couchoud,E.,yHolt,R.(1990).Emotionalandbehavioralpredictors
ofpreschoolpeerratings.Child Development,61,1145-1152.
Daz-Aguado,M.J.yMartnezArias,R.(2006).Lareproduccinintergeneracionaldelaexclusin
socialysudeteccindesdelaeducacininfantil.Psicothema, 18(3),378-383.
Donaldson,M.(1978).La mente de los nios.Madrid:Morata.
Douglas,J.D.yWong,A.C.(1977).Formaloperations:Age,sexdifferencesinChineseAmerican
children.Child Development, 48,689-692.
Dulit,E.(1972).AdolescentthinkinglaPiaget:Theformalstage.Journal of Youth Adolescence,
1, 281-301.
Dunn,J.(2004).Childrens friendships. The beginnings of intimacy.Oxford:Blackwell.
Dunn,J.yCutting,A.(1999).Understandingothers,andindividualdifferencesinfriendshipinte-
ractionsinyoungchildren.Social Development, 8,201-219.
Dunn,J.yHerrera,C.(1997).Confictresolutionwithfriends,siblingsandmothers:Adevelop-
mentalperspective.Aggressive Behavior, 23,343-357.
Dunn, J., Brown, J. y Beardsall, L. (1991). Family talk about feeling states and childrens later
understandingofothersemotions.Developmental Psychology, 27,448-455.
Edwards,R.,Manstead,A.,yMacDonald,C.(1984).Therelationshipbetweenchildrenssocio-
metricstatusandtheirabilitytorecognizefacialexpressionsofemotions.EuropeanJournal
of Social Psychology,14,235-238.
Eibl-Eibesfeldt,I.(1973).El hombre preprogramado.Madrid:Alianza,1977.
272 Referencias
Eibl-Eibesfeldt,I.(1979).Human ethology.NuevaYork:AldinedeGruyter.
Eimas,P.D.,Siqueland,E.R.,Jusczyk,P.W.yVigorito,J.(1971).Speechperceptionininfants.
Science, 171,303-306.
Ekman,P.(1973).Cross-culturalstudiesoffacialexpression.EnP.Ekman(Ed.),Darwin and fa-
cial expression.NuevaYork:AcademicPress.
Ekman, P. y Friesen,W.V. (1971). Constants across culture in the face and emotion. Journal of
Personality and Social Psychology, 17,124-129.
Enesco,I.yGuerrero,S.(2003).Eldesarrollodelapercepcin.EnI.Enesco(Coord.),El desa-
rrollo del beb. Cognicin, emocin y afectividad.Madrid:Alianza.
Erikson,E.H.(1950).Childhood and society.NuevaYork:Norton.
Eysenck, H. J. (1990).An improvement on personality inventory. Current Contents: Social and
Behavior Sciences, 22(18),20.
Fantz,R.(1961).Theoriginofformperception.Scientifc American, 204,66-72.
FernndezVillamarzo,B.(1978).Psicoanlisis de la experiencia tico-religiosa.Madrid:Marova.
Fifer,W.yMoon,C.(1988).Earlyvoicediscrimination.EnC.V.Euler,H.FossbergyH.Lager-
crantz(Eds.),The Neurobiology of Early Infant Behavior. NuevaYork:Stockton.
Flavell, J., Flavell, E., Green, F. y Moses, E. (1990).Young childrens knowledge of fact beliefs
versusvaluebeliefs.Child Development, 61, 915-928.
Fogel,A.,yHannan,T.E.(1985).Manualactionsofninetoffteen-week-oldHumaninfantsdu-
ringfacetofaceinteractionwiththeirmothers.Child development, 56,1271-1279.
Fogel,A.,yThelen,E.(1987).Developmentofearlyexpressiveandcommunicativeaction:rein-
terpretingtheevidencefromadynamicsystemsperspective.Developmental psychology, 23(6),
747-761.
Franco,F.yButterworth,G.(1988).The social origins of pointing in human infancy. Paperpre-
sentadoenlaconferenciaanualdelaSociedadBritnicadePsicologa,SeccinsobreDesa-
rrollo,ColegHarlech,Gales.
Friedlander,B.(1970).Receptivelanguagedevelopmentininfancy.Merrill Palmer Quarterly, 16,
7-51.
GarcaTorres,B.(2003).Eldesarrolloemocional.EnI.Enesco(Coord.)El desarrollo del beb.
Cognicin, emocin y afectividad.Madrid:Alianza.
Garvey,C.(1977).El juego infantil.Madrid:Morata,1985.
Gibson,E.yWalk,R.(1960).Thevisualcliff.Scientifc American, 202,64-71.
Gimenez-Das, M. (1999). El desarrollo de la conciencia racial: Actitudes e ideas implcitas en
nios de tres a seis aos.Tesisdoctoral.UniversidadAutnomadeMadrid.
Girbau,D.(1993).Elprocsdecomparaciilegocentrismeenlacomunicacireferencialinfan-
til. En C. Martn (Ed.), Proceedings of the IX Congress on Natural Languages and Formal
Languages.Barcelona:PublicacionsdelaUniversitatdeBarcelona.
Gmez,J.C.(2004).Apes, monkeys, children, and the growth of mind.Cambridge:HarvardUni-
versityPress.
Gmez,J.C.,Sarri,E.yTamarit,J.(1993).Thecomparativestudyofearlycommunicationand
theoriesofmind:Ontogeny,flogenyandpathology.EnS.Baron-Cohen,H.Tager-Flusbergy
D.Cohen(Eds.),Understanding other minds: Perspectives on the theory of mind hypothesis
of autism. Oxford:OxfordUniversityPress,pp.397-426.
Gmez,M.(enpreparacin). El desarrollo de la conciencia tnico-racial en nios de origen lati-
noamericano residentes en Espaa: Un estudio exploratorio. Tesinadelicenciatura,Univer-
sidadAutnomadeMadrid.
Hadwin, J. y Perner, J. (1991). Pleased and surprised: childrens cognitive theory of emotions.
British Journal of Psychology, 9,215-234.
Halliday,M.A.K.(1975).Learning how to mean. Londres:EdwardArnold.
Harlow,H.F.yHarlow,M.K.(1966).Learningtolove.American Scientist, 54,244-272.
Referencias 273
Harlow,H.F.,yHarlow,M.K.(1962).Socialdeprivationinmonkeys.Scientifc American, 207,
137-146.
Harris,P.(1997).PiagetinParis:FromAutismtologic.Human Development, 40,109-123.
Harris, P., Johnson, C., Hutton, D.,Andrews, G. y Cooke,T. (1989).Young childrens theory of
mindandemotion.Cognition and Emotion, 3,379-400.
Harris,P.L.yKavanaugh,R.D.(1993).Youngschildrenunderstandingofpretense.Monographs
of the Society for Research in Child Development, 58,SerialNo231.
Haviland,J.M.,yLelwica,M.(1987).Theinducedaffectresponse:10week-oldinfantsrespon-
setothreeemotionexpressions.Developmental Psychology, 23,97-104.
Herranz,P.(2002).Eldesarrollodelapego.EnP.HerranzyP.Sierra(Eds.),Psicologa evolutiva
I(Vol.II,pp.52-72).
Hess,E.H.(1970).Theethologicalapproachtosocialization.EnR.A.HoppeyE.C.Simmel(Eds.),
Early experience and the process of socialization (pp. 19-36). NuevaYork:Academic Press.
Hess,E.H.(1972).ImprintinginaNaturalLaboratory.Scientifc American,24-31.
Hogrefe,G.,Wimmer,H.yPerner,J.(1986).Ignoranceversusfalsebelief:Adevelopmentallag
inattributionofepistemicstates. Child Development, 57,567-582.
Hughes,C.yLeekam,S.(2004).Whatarethelinksbetweentheoryofmindandsocialrelations?
Review,refectionandnewdirectionsforstudiesoftypicalandatypicaldevelopment.Social
Development, 13(4),590-619.
Hughes,C.,Dunn,J.,yWhite,A.(1998).Trickortreat?Unevenunderstandingofmindandemo-
tionandexecutivedysfunctioninhard-to-managepreschoolers.Journal of Child Psycholo-
gy and Psychiatry, 39,981-994.
Humphrey, N. (1976).The social function of the intellect. En P. P. G. Bateson and R.A. Hinde
(eds.),Growing Points in Ethology(pp.138-153).Cambridge:CambridgeUniversityPress.
Ilari,B.(2002).Musicperceptionandcognitioninthefrstyearoflife.Early Child Development
and Care, 172(3),311-322.
Inhelder,B.yPiaget,J.(1955).De la lgica del nio a la lgica del adolescente. BuenosAires:
Paids,1972.
Johnson,M.H.yMorton,J.(1991).Biology and Cognitive Development: the case of face recog-
nition.Oxford:Blackwell.
Jurez,A.yMonfort,M.(2001).Estimulacin del lenguaje oral. Madrid:Santillana.
Jusczyk,P.(1997).The discovery of spoken language.Cambridge,MA:MITPress.
Kail,R.(1990).El desarrollo de la memoria en los nios.Madrid:SigloXXI,1994.
Kail,R.yCavanaugh,J.(2003).Human development. A lifespan view.Belmont,CA:Wadsworth.
Karmiloff,K.yKarmiloff-Smith,A.(2001).Hacia el lenguaje. Madrid:Morata,2005.
Karmiloff-Smith, A. (1979). A functional approach to child language. Cambridge: Cambridge
UniversityPress.
Karmiloff-Smith,A.(1992).Ms all de la modularidad. Madrid:Alianza,1994.
Kaye,K.(1982).La vida social y mental del beb.BuenosAires:Paids,1986.
Kellman, P. J. y Spelke, E. (1983). Perception of partly occluded objects in infancy. Cognitive
Psychology, 15,483-524.
Kelly,M.H.yMartin,S.(1994).Domain-generalabilitiesappliedtodomain-specifctasks:Sen-
sitivitytoprobabilitiesinperception,cognition,andlanguage.Lingua, 92,105-140.
Kisilevsky,B.S.yLow,J.A.(1998).Humanfetalbehavior:100yearsofstudy.Developmental
Review, 18,1-29.
Kohlberg, L.,Yaeger, J. y Hjertholm, E. (1968). Private speech: four studies and a review of
theories.Child Development, 39(3),691-736.
Kugiumutzakis,G.(1993).Intersubjectivevocalimitationinearlymother-infantimitation.EnJ.
NadelyL.Camaioni(Eds.),New perspectives on early communicative development.Londres:
Routledge.
274 Referencias
Kuhl,P.(1991).Humanadultsandhumaninfantsshowaperceptualmagneteffectfortheproto-
typesofspeechcategories.Perception and Psychophysics,50,93-107.
Kuhl,P.(1998).Thedevelopmentofspeechandlanguage.EnT.J.Carew,R.MenzelyC.Shatz
(Eds.), Mechanistic relationships between development and learning. Cambridge, MA: MIT
Press.
Kuhl,P.(2000).Language,mindandthebrain:experiencealtersperception.En M.S.Gazzaniga
(Ed.),The new cognitive neurosciences. Cambridge,MA:MITPress.
Kuhl, P. K. y Meltzoff,A. (1982). The bimodal perception of speech in infancy. Science, 218,
1138-1141.
Labouvie-Vief, G. (1992).A neo-piagetian perspective on adult cognitive development. En R. J.
StembergeryC.A.Berg(Eds.),Intellectual development. NuevaYork:CambridgeUniversity
Press.
Lacasa,P.yGarcaMadruga,J.(1997).Aprendizaje,desarrolloyeducacin.EnJ.A.GarcaMa-
drugayP.Pardo(Eds.),Psicologa Evolutiva, vol. II.Madrid:UNED.
Lalonde,C.yChandler,M.(1995).Falsebeliefunderstandinggoestoschool:Onthesocial-emo-
tionalconsequencesofcomingearlyorlatetoafrsttheoryofmind.Cognition and Emotion,
9,167-185.
Laurendeau-Benavid, M. (1977). Culture, schooling and cognitive development:A comparative
studyinFrenchCanadaandRwanda.EnP.R.Dasen(Ed.),Piagetian psychology. Cross-cul-
tural contributions.NuevaYork:GardnerPress.
Lecanuet,J.,Fifer,W.,Krasnegor,N.ySmotherman,W.(Eds.)(1995).Fetal develpment: A psy-
chobiological perspective.Hillsdale,N.J.:LEA.
Lcuyer,R.,Pcheux,M.G.yStreri,A.(1994).Le dveloppement cognitif du nourrisson.Pars:
NathanUniversit.
Lenneberg,(1967).Fundamentos biolgicos del lenguaje. Madrid:Alianza,1975.
Lewis, M. (2000). The emergence of human emotions. En M. Lewis. y J. M. Haviland-Jones.
(Eds.),Handbook of emotions(pp.265-280).NuevaYork:TheGuilfordPress.
Lewis,M.yBrooks-Gunn,J.(1979).Social cognition and the acquisition of the self.NuevaYork:
PlenumPress.
Liszkowski, U., Carpenter, M., Striano, T. y Tomasello, M. (2006). Twelve-and 18-month-olds
pointtoprovideinformation.Journal of Cognition and Development, 7,173-187.
Liszkowski,U.,Malinda,C.yTomasello,M.(2007).Pointingoutnewnews,oldnews,andabsent
referentsat12monthsofage.Developmental Science, 10(2),F1-F7.
Lpez, F. (2006).Apego: estabilidad y cambio a lo largo del ciclo vital. Infancia y Aprendizaje,
29(1),9-23.
Lpez, F. (1999). El apego desde la adolescencia hasta la muerte. En F. Lpez, I. Etchebarra,
M.J.Fuentes,yM.J.Ortiz(Eds),Desarrollo afectivo y social(pp.67-94).Madrid:Pirmide.
LpezOrnat,S.,Fernndez,A.,Gallo,P.yMariscal,S.(1994).La Adquisicin de la Lengua Es-
paola. Madrid:SigloXXI.
Lorenz,K.Z.(1952).King Salomons ring.NuevaYork:Crowell.
Maccoby,E.E.(1992).Theroleofparentsinthesocializationofchildren:Anhistoricaloverview.
Developmental Psychology, 28,1006-1017.
MacDonald,K.B.(1992).Warmthasadevelopmentalconstruct:Anevolutionaryanalysis.Child
Development, 63,753-773.
Main, M., y Solomon, J. (1986). Discovery of an insecure-disorganized/disoriented attachment
pattern.EnT.B.BrazeltonyM.W.Yogman(Eds.),Affective development in infancy(pp.95-
124).Norwood,NJ:ABLEX.
Main,M.,ySolomon,J.(1990).Proceduresforidentifyinginfantsasdisorganized/disorientedduring
theAinsworthStrangeSituation.EnM.T.Greenberg,D.CicchettiyE.M.Cummings(Eds.),
Attachment in the preschool years(pp.121-160).Chicago:UniversityofChicagoPress.
Referencias 275
Mandler. (1983). Representation. En J. H. Flavell. y E. M. Markman (Eds.), Handbook of child
psychology: Cognitive development(Vol.3).NuevaYork:Wiley.
Marrero,V.(2000).Introduccin a la Lingstica Aplicada a fnes clnicos. Madrid:UNED.
Marrone,M.(2001).La teora del apego: Un enfoque actual.Madrid:EditorialPsimtica.
McCrae,R.yCosta,P.(1990).Personality in adulthood.Londres:GuilfordPress.
McDowell,D.,ONeil,R.yParke,R.(2000).Displayruleapplicationinadisappointingsituation
andchildrensemotionalreactivity:Relationswithsocialcompetences.Merril Palmer Quar-
terly, 46,306-324.
Mehler,J.yDupoux,E.(1990).Nacer sabiendo.Madrid:Alianza,1992.
Mehler, J., Jusczyk, P., Lambertz, G., Halstead, G., Bertoncini, J. yAmiel-Tison, C. (1988).A
precursoroflanguageacquisitioninyounginfants.Cognition, 29,143-178.
Meltzoff, A. y Bolton, R. W. (1979). Intermodal matching by human neonates. Nature, 282,
403-404.
Meltzoff,A.yMoore,M.K.(1977).Imitationoffacialandmanualgesturesbyhumanneonates.
Science, 198,75-78.
Meltzoff,A. y Moore, M. K. (1983). Newborn infants imitate adult facial gestures. Child Deve-
lopment, 54,702-709.
Moon,C.,Panneton-Cooper,R.yFifer,W.P.(1994).Two-day-oldsprefertheirnativelanguage.
Infant Behaviour and Development,16,495-500.
Moreno,C.(2006).Lasrelacionesdeapego:polmicaentornoasutrascendencia,continuidady
posibilidadesdecambioalolargodelciclovital.Infancia y Aprendizaje, 29(1),3-7.
Nadel, J. y Camaioni, L. (Eds.) (1993). New perspectives on early communicative development.
Londres:Routledge.
Nazzi,T.,Bertoncini,J.yMehler,J.(1998).Languagediscriminationbynewborns:Towardsan
understandingoftheroleofrhythm.Journal of Experimental Psychology: Human Perception
and Performance,24,756-766.
Nelson, K. (1986). Event knowledge: structure and function in development. NuevaYork: LEA.
Nelson,K.(1989).Narratives from the crib.Cambridge,Mass.:HarvardUniversityPress.
Nelson, K. (1996). Language in cognitive development: emergence of the mediated mind. Cam-
bridge:CambridgeUniversityPress.
Nez,M.(1993).Teora de la Mente: metarrepresentacin, creencias falsas y engao en el de-
sarrollo de una psicologa natural.Tesisdoctoralindita.UniversidadAutnomadeMadrid.
Nez,M.yRivire,A.(1994).Engao,intencionesycreenciaseneldesarrollodeunapsicologa
natural.Estudios de Psicologa,52,83-128.
Ochs, E. y Schieffelin, B. (Eds.) (1974). Developmental pragmatics. Nueva York: Academic
Press.
PrezPereira,M.(1995).Nuevas perspectivas en psicologa del desarrollo. Madrid:Alianza.
Perner,J.(1991).Understanding the representational mind.Cambridge,MS:MITPress/Bradford
Books.
Perner, J., Leekam, S. y Wimmer, H. (1987). Three-years-olds diffculty with false belief: The
caseforaconceptualdefcit.British Journal of Developmental Psychology, 5,125-137.
Perner,J.yOgden,J.(1988).Knowledgeforhungry:childrensproblemswithrepresentationin
inputtingmentalstates.Cognition, 29,47-61.
Perner,J.yWimmer,H.(1985).Johnthinksthat...Attributionofsecondorderbeliefsby5to-
10-yearsoldchildren.Journal of Experimental Child Psychology, 39,437-471.
Piaget,J.(1965).Sociological studies.NuevaYork:Routledge,1995.
Piaget, J. (1923). El lenguaje y el pensamiento en el nio. BuenosAires: Editorial Guadalupe,
1983.
Piaget,J.(1924).El juicio y el razonamiento en el nio(Vol.II).BuenosAires:EditorialGuada-
lupe,1972.
276 Referencias
Piaget,J.(1932).El criterio moral en el nio.Barcelona:MartnezRoca,1984.
Piaget,J.(1936).El nacimiento de la inteligencia en el nio.Barcelona:EditorialCrtica,1985.
Piaget,J.(1937).La construccin de lo real en el nio.BuenosAires:Proteo,1965.
Piaget,J.(1937).La formacin del smbolo en el nio.Mxico:FCE,1961.
Piaget,J.(1952).Autobiografa.EnL.Goldman(Ed.),Jean Piaget y las ciencias sociales.Sala-
manca:Sgueme,1974.
Piaget,J.(1959).Lesmodlesabstraitssont-ilsoppossauxinterprtationspsycho-physiologiques
dans lexplication en psychologie: Esquisse dautobiographie intellectuelle. Bulletin de Psy-
chologie, 13,7-13.
Piaget,J.(1964).Seis estudios de psicologa.Barcelona:Planeta-Agostini,1985.
Piaget,J.(1978).Filosofasinfantiles.EnJ.Delval(Ed.),Lecturas de psicologa del nio(Vol.II,
pp.287-302)Madrid:AlianzaEditorial.
Pillow,B.(1989).Earlyunderstandingofperceptionasasourceofknowledge.Journal of Expe-
rimental Child Psychology, 47,116-129.
Pinker,S.(1989).El instinto del lenguaje. Madrid:Alianza,1995.
Pons,F.,Doudin,P.A.,Harris,P.ydeRosnay,M.(2005).Helpingchildrentoimprovetheiremo-
tionunderstanding.EnF.Pons,D.Hancock,L.LafortuneyP.A.Doudin(Eds.),Emotions in
learning.Aalborg:AalborgUniversityPress.
Pons,F.,Lawson,J.,Harris,P.ydeRosnay,M.(2003).Individualdifferencesinchildrensemotion
understanding. Effects of age and language. Scandinavian Journal of Psychology, 44(4),
345-351.
Pratt,C.yBryant,P.(1990).Youngchildrenunderstandingthatlookingleadstoknowing(solong
astheyarelookingintoasinglebarrel). Child Development, 61,973-982.
Premack,D.yWoodruff,G.(1978).Doesthechimpanzeehaveatheoryofmind?The Behavioral
and Brain Sciences, 4,515-526.
Pylyshyn, Z. (1978).When is attribution of beliefs justifed? Behavioral and Brain Sciences, 1,
592-593.
Reddy,V.(1999).Prelinguisticcommunication.EnM.Barrett(Ed.),The development of language,
pp.25-50.Londres:PsychologyPress.
Riegel,K.(2007).The developing individual in a changing world.AldineTransaction.
Rivire,A. (1986). Interaccin precoz: una perspectiva vygotskiana a partir de los esquemas de
Piaget.EnM.Monfort(Ed.),Investigacin y Logopedia. III Simposium de Logopedia. Madrid:
EditorialCepe,pp.43-79.
Rivire,A.yNez,M.(1996).La mirada mental.BuenosAires:AIQUE.
Rodrguez,C.yMoro,C.(1998).El mgico nmero tres. Cuando los nios an no hablan.Bar-
celona:Paids.
Rubin,Z.(1980).Amistades infantiles.Madrid:Morata,1981.
Rubinstein,S.(1965)El ser y la consciencia.LaHabana:EditorialNacionaldeCuba.
Sarri,E.yQuintanilla,L.(2003).Realismo,AnimismoyTeoradelaMente:caractersticascul-
turalesyuniversalesdelconocimientomental.Estudios de Psicologa, 24(3),313-335.
Scarr,S.yMcCartney,K.(1983).Howpeoplemaketheirownenvironments:Atheoryofgenoty-
pe/environmentaleffects.Child Development, 54, 424-435.
Schaffer,H.R.(1979).El desarrollo de la sociabilidad. Madrid:PablodelRo.
Schneider,W.yPressley,M.(1989).Memory development between 2 and 20.NuevaYork:Sprin-
ger-Verlag.
Serra, M. (2000). El lxico inicial y su evolucin. En M. Serra, E. Serrat, R. Sol, A. Bel y
M.Aparici(2000).La adquisicin del lenguaje.Captulo5(pp.223-276).Barcelona:Ariel.
Shaffer,D.(2000).Psicologa del desarrollo: Infancia y adolescencia.Mxico:ThomsonLearning.
Sigun,M.(1986).Laexpresinliterariadellenguajeinterior.EnM.Sigun(Coord.)Estudios de
Psicolingstica. Madrid:Pirmide.
Referencias 277
Sigun,M.(1998).Bilingismoypersonalidad.EnM.Peralbo,B.GmezDurn,R.Santrumy
M.GarcaFernndez(Eds.),Desarrollo del lenguaje y cognicin. Madrid:Pirmide.
Snow,C.E.(1986).Conversationswithchildren.EnM.GarmanyP.Fletcher(Eds.),Language
acquisition. Cambridge:CambridgeUniversityPress.
Snow, C. E. (1977). The development of conversation between mothers and babies. Journal of
Child Language, 4,1-22.
Soufre,L.A.(1979).Thecoherenceofindividualdevelopment:earlycare,attachment,andsub-
sequentdevelopmentalissues.American Psychologist,34,834-841.
Soufre,L.A.yEgeland,B.(1991).Illustrationofperson-environmentinteractionfromalongitu-
dinalstudy.EnT.D.WachsyR.Plomin(Eds.),Conceptualization and measurement of orga-
nism-environment interaction(pp.68-84).Washington:AmericanPsychologicalAssociation.
Source,J.F.,Emde,R.N.,Campos,J.yKlinner,M.D.(1985).Maternalemotionalsignalling:its
effectsonthevisualcliffbehaviorof1-year-olds.Developmental Psychology, 21,195-200.
Spangler,G.yGrossmann,K.E.(1993).Biobehavioralorganizationsecurelyandinsecurelyatta-
chedinfants.Child Development, 64,1439-1450.
Spitz, R. A. (1945). Hospitalism: an inquiry into the genesis of psychiatric conditions in early
childhood.Psychoanalytic Study of the Child, 1,113-117.
Spitz,R.A.(1946).Anacliticdepression.Psychoanalytic Study of the Child, 2,313-342.
Templin,M.C.(1957).Certain language skills in children.Minnesota,MN:UniversityofMin-
nesotaPress.
Thelen,E.ySmith,L.(1994).A Dynamic Systems Approach to the Development of Cognition and
Action. Cambridge,MA:MITPress.
Thomas,A.yChess,S.(1977).Temperament and development.NuevaYork:Brunner/Mazel.
Thompson,R.A.(1988).Theeffectsofinfantdaycarethroughtheprismofattachmenttheory:A
criticalappraisal.Early Childhood Research Quarterly, 3,273-282.
Tomasello,M.(1999).The cultural origins of human cognition.Cambridge,M.A.:HarvardUni-
versityPress.
Trevarthen, C. (1982).The primary motives for cooperative understanding. En G. Butterworth y
P.Light (Eds.), Social cognition: Studies of the development of understanding (pp. 77-109).
Brighton,UK:HarvesterPress.
Vasta,R.,Haith,M.yMiller,S.(1992).Psicologa infantil.Barcelona:Ariel,1996.
Vidal,F.(1994).Piaget antes de ser Piaget.Madrid:Morata,1998.
Vygotski,L.(1934)Pensamiento y lenguaje. BuenosAires:LaPlyade,1981.
Vygotski,L.S(1929).Problemasfundamentalesdedefectologa.EnL.S.Vygotski,Obras Esco-
gidas.Vol.V.Madrid:Visor,1997.
Vygotski,L.S.(1931).Elproblemadeldesarrollodelasfuncionespsquicassuperiores.EnL.S.
Vygotski,Obras Escogidas.Vol.III.Madrid:Visor,1995.
Vygotski,L.S.yLuria,A.R.(1930). Studies on the history of behaviour: ape, primitive, and child.
NuevaJersey:LEA,1993.
Waddington,C.H.(1957).The strategy of the genes.Londres:Allen&Unwin.
Waters,E.,Merrick,S.D.T.,Crowell,J.yAlbersheim,L.(2000).Attachmentsecurityininfancy
andearlyadulthood:atwenty-yearlongitudinalstudy.Child Development, 71(3),684-689.
Wellman,H.yBanerjee,M.(1991).Mindandemotion:childrensunderstandingoftheemotional
consequences of beliefs and desires. British Journal of Developmental Psychology, 9,
191-214.
Wellman, H., Cross, D. yWatson, J. (2001). Meta-analysis of theory-of-mind development: the
truthaboutfalsebelief.Child Development, 72,655-684.
Wellman,H.yEstes,D.(1986).Earlyunderstandingofmentalentities:Areexaminationofchil-
dhoodrealism.Child Development, 57,910-923.
Wellman,H.yLiu,D.(2004).ScalingTheory-of-MindTasks.Child Development, 75,523-541.
278 Referencias
Wellman, H. M., Ritter, K. y Flavell, J. H. (1975). Deliberate memory behavior in the delayed
reactionsofveryyoungchildren.Developmental Psychology, 11,780-787.
Wellman,H.yWoolley,J.(1990).Fromsimpledesirestoordinarybeliefs:Theearlydevelopment
ofeverydaypsychology.Cognition, 30,245-247.
Werner,H.yKaplan,B.(1963). Symbol formation.NuevaYork:JohnWiley&Sons.
Wimmer, H. y Perner, J. (1983). Beliefs about beliefs: Representation and constraining function
ofwrongbeliefsinyoungchildrensunderstandingofdeception.Cognition, 13,103-128.
Winsler,A.,Carlton,M.P.yBarry,M.J.(2000).Age-relatedchangesinpreschoolchildrenssys-
tematicuseofprivatespeechinanaturalsetting.Journal of Child Language, 27,665-687.
Winsler,A.,DeLen,J.R.,Wallace,B.,Carlton,M.P.yWillson-Quayle,A.(2003).Privatespeech
inpreschoolchildren:Developmentalstabilityandchange,across-taskconsistency,andrela-
tionswithclassroombehavior.Journal of Child Language, 30,583-608.
Winsler,A., Diaz, R. M.,Atencio, D. J., McCarthy, E. M. y Chabay, L.A. (2000b).Verbal self-
regulationovertimeinpreschoolchildrenat-riskforattentionandbehaviorproblems.Journal
of Child Psychology and Psychiatry and Allied Disciplines, 41,875-886.
Yuill,N.(1984).Youngchildrenscoordinationofmotiveandoutcomeinjudgmentsofsatisfaction
andmorality.British Journal of Developmental Psychology, 2,73-81.