UNIVERSIDAD DE COSTA RICA

SISTEMA DE ESTUDIOS DE POSGRADO



EFECTO NEUROQUÍMICO Y CONDUCTUAL DE LA
MIOTOXINA III DE Bothrops asper,
LUEGO DE SU INYECCIÓN EN EL
MESENCÉFALO DE RATAS ADULTAS




Tesis sometida a consideración de la Comisión del Programa de Estudios de
Posgrado en Ciencias Biomédicas para optar por el grado de Magister Scientiae
en Ciencias Biomédicas con énfasis en Farmacología




MANUEL OREAMUNO ZEPEDA





Ciudad Universitaria Rodrigo Facio, Costa Rica



2009

ii
DEDICATORIA









A mis padres Manuel y Hortensia.


iii
AGRADECIMIENTOS

Dr. Bruno Lomonte, Ph. D., investigador Instituto Clodomiro Picado, Universidad
de Costa Rica.

M Sc. Elvira Salas, MSc J uan Carlos Brenes, B Sc Adriana Saborío, B Sc.
Andrea Monge, Michael Padilla y otros investigadores y asistentes del
Programa de Investigación en Neurociencias.

M Sc. Carlos von Marschall Murillo, profesor de estadística Universidad Latina
de Costa Rica.

iv
“Esta Tesis ha sido aceptada por la Comisión del Programa de Estudios de
Posgrado en Ciencias Biomédicas de la Universidad de Costa Rica, como
requisito parcial para optar al grado de Magister Scientiae en Ciencias
Biomédicas con énfasis en Farmacología.”


_______________________________
Ph. D. Bruno Lomonte Vigliotti
Representante de la Decana, Sistema de Estudios de Posgrado


_______________________________
Ph. D. J aime Fornaguera Trías
Director de Tesis


_______________________________
Ph. D. J osé María Gutiérrez Gutiérrez
Asesor


_______________________________
M. Sc. Adriana Suárez Urhan
Asesora


_______________________________
Ph. D. Cecilia Díaz Oreiro
Directora Programa de Posgrado en Ciencias Biomédicas


_______________________________
Manuel Oreamuno Zepeda
Candidato

v
ÍNDICE GENERAL
DEDICATORIA ................................................................................................... ii
AGRADECIMIENTOS ........................................................................................ iii
ÍNDICE GENERAL ............................................................................................. v
RESUMEN .......................................................................................................... x
LISTA DE CUADROS ........................................................................................ xi
LISTA DE FIGURAS ........................................................................................ xiv
ÍNDICE DE ABREVIATURAS.......................................................................... xxi
CAPÍTULO I ........................................................................................................ 1
1. INTRODUCCIÓN ............................................................................................ 1
CAPÍTULO II ....................................................................................................... 7
2. MARCO TEÓRICO ......................................................................................... 7
2.1 Los Ganglios basales .............................................................................. 7
2.2 Neuroquímica en los Ganglios Basales............................................... 12
2.3 Sistema dopaminérgico en el Sistema Nervioso Central ................... 14
2.4 La enfermedad de Parkinson ................................................................ 18
2.5 Modelo en ratas de lesión intracerebral con 6-hidroxidopamina ...... 24
2.6 Efecto conductual en ratas, inducido por lesión de la SNpc con 6-
OHDA ............................................................................................................ 30
2.7 Actividad fosfolipasa A
2
........................................................................ 34
2.8 Efecto farmacológico de la miotoxina III de Bothrops asper ............. 37
CAPÍTULO III .................................................................................................... 41
3. MATERIALES Y MÉTODOS ........................................................................ 41
3.1 Equipos instrumentales y materiales. ................................................. 41
vi
3.2 Reactivos y estándares analíticos ....................................................... 42
3.3 Descripción general de la investigación ............................................. 44
3.4 Aislamiento y purificación de la miotoxina III ..................................... 44
3.5 Modificación (alquilación) de la miotoxina III ...................................... 46
3.6 Sujetos de análisis ................................................................................ 47
3.7 Neurocirugía e inyección intra pars compacta ................................... 48
3.8 Medición de la conducta ....................................................................... 50
3.9 Sacrificio de los animales ..................................................................... 54
3.10 Disección de los tejidos cerebrales ................................................... 55
3.11 Análisis histológicos ........................................................................... 57
3.12 Análisis neuroquímicos ...................................................................... 57
3.13 Primer experimento: Evaluación exploratoria, a tres dosis, del
efecto de la MT-III, l uego de su inyección en la SNpc .............................. 61
3.14 Segundo experimento: Evaluación exploratoria de la evolución del
proceso de lesión neuronal de la miotoxina en cuatro momentos
postoperatorios ........................................................................................... 61
3.15 Tercer experimento: Comparación del efecto por lesión con la
miotoxina y con la miotoxina alquilada en el sitio catalítico, a dosis
constante...................................................................................................... 62
3.16 Análisis estadístico de los resultados ............................................... 63
CAPÍTULO IV ................................................................................................... 65
4. RESULTADOS ............................................................................................. 65
4.1 Implementación de una metodología por HPLC/ED para la
determinación de neurotransmisores y sus metabolitos en tejido
cerebral ........................................................................................................ 65
4.1.1 Condiciones cromatográficas. ............................................................... 65
vii
4.1.2 Condiciones del detector ....................................................................... 66
4.2 Resultados del primer experimento ..................................................... 68
4.2.1 Descripción general .............................................................................. 68
4.2.2 Variación del peso corporal durante el experimento ............................. 69
4.2.3 Conducta de giro ................................................................................... 70
4.2.4 Conducta de peritaxis ........................................................................... 75
4.2.5 Conducta de locomoción ....................................................................... 80
4.2.6 Conducta de exploración ...................................................................... 81
4.2.7 Conducta de acicalamiento ................................................................... 83
4.2.8 Análisis neuroquímicos en estriado dorsal ............................................ 85
4.2 9 Análisis neuroquímicos en estriado ventral. .......................................... 87
4.2.10 Análisis neuroquímicos en septo. ....................................................... 89
4.3 Resultados del segundo experimento ................................................. 90
4.3.1 Descripción general .............................................................................. 90
4.3.2 Análisis neuroquímicos en estriado dorsal ............................................ 91
4.3.3 Análisis neuroquímicos en estriado ventral y septo .............................. 94
4.4 Resultados del tercer experimento. ..................................................... 97
4.4.1 Descripción general .............................................................................. 97
4.4.2 Variación del peso corporal durante el experimento ............................. 98
4.4.3 Conducta de giro ..................................................................................100
4.4.4 Conducta de peritaxis ..........................................................................108
4.4.5 Conducta de locomoción ......................................................................118
4.4.6 Conducta de exploración .....................................................................120
4.4.7 Conducta de acicalamiento ..................................................................122
4.4.8 Análisis neuroquímicos ........................................................................125
4.4.9 Análisis histológicos .............................................................................130
CAPÍTULO V .................................................................................................. 137
5. DISCUSIÓN DE RESULTADOS Y CONCLUSIONES ............................... 137
5.1 Metodología cromatográfica por HPLC/ED .............................................137
5.2 Variación del peso de los animales durante los experimentos................139
viii
5.3 Mortalidad de los animales .....................................................................139
5.4 Variación del efecto de la miotoxina MT-III nativa con la dosis inyectada
en SNpc. .......................................................................................................141
5.5 Efecto de la MT-III el día de la cirugía.....................................................144
5.6 Efecto de la MT-III nativa y la MT-III alquilada sobre las conductas
espontáneas de giro y peritaxis, el primer día postoperatorio. ......................148
5.7 Efecto de la MT-III nativa y la MT-III alquilada sobre las conductas
espontáneas de giro y peritaxis, después del primer día postoperatorio. .....157
5.8 Efecto de la MT-III nativa y la MT-III alquilada sobre las conductas
espontáneas de locomoción, exploración y acicalamiento. ..........................162
5.9 Efecto inducido por apomorfina en las ratas lesionadas con la MT-III
nativa y la MT-III alquilada, el día 20 postoperatorio. ....................................168
5.10 Efecto inducido por anfetamina en las ratas lesionadas con la MT-III
nativa y la MT-III alquilada, el día 22 postoperatorio. ....................................178
5.11 Comparación del efecto por lesión con la miotoxina (MT-III) nativa y
con la miotoxina (MT-III) alquilada ................................................................184
5.12 Conclusiones ........................................................................................189
CAPÍTULO VI ................................................................................................. 197
6. REFERENCIAS BIBLIOGRÁFICAS ........................................................... 197
Capítulo VII .................................................................................................... 209
7. ANEXOS ..................................................................................................... 209
Anexo I. Egresos Hospitalarios de la Caja Costarricense del Seguro Social
(CCSS), de pacientes diagnosticados con la enfermedad de Parkinson.
2005 a 2007. .................................................................................................209
Anexo II. Permiso del Comité Institucional para el Cuido y Uso de Animales
(CICUA) ........................................................................................................211
Anexo III. Diagramas de las vistas dorsal (superior) y lateral (inferior) del
cráneo de una rata macho Wistar de 290 g de masa corporal. Las vistas
muestran las posiciones de los puntos de referencia: Bregma, la cara
posterior de los incisivos y el plano de la línea interaural. ............................212
ix
Anexo IV. Diagramas para la ubicación estereotáxica de la SNpc en un
cerebro de rata macho Wistar de 290 g. Se presenta los cortes coronal en
Bregma - 5,30 mm; sagital en lateral 1,90 mm y horizontal en bregma –8,10
mm. ...............................................................................................................213
Anexo V. Procedimientos de tinción de cortes coronales de cerebro de rata
de 25 m de grosor. ......................................................................................214
Anexo VI. Cuadros con los datos individuales de conducta y de
neuroquímica para los tres experimentos. ....................................................216


x
RESUMEN

La miotoxina MT-III de Bothrops asper, una fosfolipasa A
2
clase II, fue inyectada
estereotáxica y unilateralmente en la substantia nigra pars compacta (SNpc) en
ratas macho Sprague – Dawley adultas con el fin de caracterizar su efecto
sobre algunas conductas (motoras y sensitivas), tanto espontáneas como
inducidas farmacológicamente. Además se caracterizó su efecto sobre la
neuroquímica en estriado dorsal y ventral por HPLC con detector
electroquímico. Se evaluaron dosis de la MT-III entre 0,14 y 14 g. Además se
caracterizó el efecto de la MT-III alquilada con p-BPB a la dosis de 1,4 g. El
día de la cirugía se midió un aumento importante de los niveles de dopamina,
DOPAC y HVA en el hemisferio intervenido. Espontáneamente, entre el día uno
y tres postoperatorios se midió un giro intenso contralateral y una peritaxis
ipsilateral, posiblemente debido al aumento asimétrico de los niveles de
dopamina en estriado ipsilateral respecto al lado de la lesión. Hacia el día 18
postoperatorio las conductas asimétricas espontáneas tienden gradualmente a
la simetría lo que posiblemente es indicativo del avance lento de un proceso
neurodegenerativo. Con la MT-III nativa y la MT-III alquilada (1,4 g) se obtuvo
lesiones moderadas de (28 ±11) %, ámbito (-1 a 61%) y (27 ±12) %, ámbito (-6
a 65) % respectivamente. La apomorfina (0,50 mg/kg, sc), induce un giro y una
peritaxis ipsilaterales y la anfetamina (1,0 mg/kg, ip) induce un giro contralateral
y una peritaxis ipsilateral. Se propone que los animales desarrollan
mecanismos de compensación neuroquímica presinápticos. El efecto de la MT-
III alquilada en el sitio catalítico PLA
2
con p-BPB, es semejante al medido para
la MT-III nativa, de evolución más lenta y de menor intensidad. Se propone que
los mecanismos de lesión de la MT-III en el sistema nigro-estriatal, y la
expresión de las conductas inducidas por lesiones moderadas con MTII son en
algunos aspectos diferentes y en otros semejantes a los reportados en la
literatura por lesión con toxinas clásicas que se emplean en los modelos
animales de la enfermedad de Parkinson como la 6-OHDA. Con este estudio,
se apoya el postulado que la conducta de peritaxis es una conducta que permite
medir procesos neurológicos diferentes y de una manera más sensible que la
conducta de giro.

Este estudio propone un nuevo modelo para estudiar la génesis y progresión de
enfermedades neurodegenerativas con una toxina más potente y mediante dos
mecanismos de lesión (uno PLA
2
y otro desconocido), progresivos y lentos. No
se descarta que la acción de la MT-III pueda ser mediante sitios de unión tipo N.
Este es el primer estudio en el que se estudia la infusión unilateral en SNpc de
una miotoxina PLA
2
“no neurotóxica” en cerebro. Este modelo animal se
propone como una nueva y mejor forma de estudiar procesos neurológicos de
lesión en SNpc, que podrían ser útiles para comprender los mecanismos de los
estados tempranos de la enfermedad de Parkinson en los humanos.

xi
LISTA DE CUADROS
Cuadro I: Calendario de cada una de las actividades que se realizaron con los
animales..................................................................................................... 50
Cuadro II: Egresos hospitalarios por año y edad de todos los hospitales de la
Caja Costarricense del Seguro Social (CCSS). Información tomada de la
base de datos del Departamento de Estadísticas de Salud de la CCSS y
comprende los años 2005 a 2007. ........................................................... 209
Cuadro III: Giros netos (ipsi menos contra) durante 20 minutos por día, para
cada uno de los animales de cuatro grupos de tratamiento con diferentes
dosis de la miotoxina III, nativa: baja: 0,14 µg; media: 1,4 µg; alta: 14 µg y
el grupo control. ....................................................................................... 216
Cuadro IV: Duración en segundos de la conducta de peritaxis neta (ipsi menos
contra) durante 20 minutos por día, para cada uno de los animales de
cuatro grupos de tratamiento con diferentes dosis de la miotoxina III, nativa:
baja: 0,14 µg; media: 1,4 µg; alta: 14 µg y el grupo control. .................... 217
Cuadro V: Número de cruces de cuadrantes virtuales del campo abierto,
durante 20 min, para cada uno de los animales de cuatro grupos de
tratamiento con diferentes dosis de la miotoxina III, nativa: baja: 0,14 µg;
media: 1,4 µg; alta: 14 µg y el grupo control. ........................................... 218
Cuadro VI: Duración de la conducta de exploración en segundos, durante 20
minutos por día, para cada uno de los animales de cuatro grupos de
tratamiento con diferentes dosis de la miotoxina III, nativa: baja: 0,14 µg;
media: 1,4 µg; alta: 14 µg y el grupo control. ........................................... 219
Cuadro VII: Duración de la conducta de limpieza en segundos, durante 20
minutos por día, para cada uno de los animales de cuatro grupos de
tratamiento con diferentes dosis de la miotoxina III, nativa: baja: 0,14 µg;
media: 1,4 µg; alta: 14 µg y el grupo control. ........................................... 220
xii
Cuadro VIII: Porcentajes de depleción en estriado dorsal para dopamina (DA) y
ácido 3,4-dihidroxifenilacético (DOPAC), ácido homovanílico (HVA),
serotonina (5-HT) y ácido 5-hidroxiindolacético (5-HIAA) y en estriado
ventral y septo pada DA y DOPAC; para cada uno de los animales de los
cuatro grupos de tratamiento con diferentes dosis de la miotoxina III nativa:
baja: 0,14 µg; media: 1,4 µg; alta: 14 µg y el grupo control. NSD se refiere
a que el compuesto no fue detectado en algún hemisferio. ..................... 221
Cuadro IX: Porcentajes de depleción en estriado dorsal para dopamina (DA) y
ácido 3,4-dihidroxifenilacético (DOPAC), ácido homovanílico (HVA),
serotonina (5-HT) y ácido 5-hidroxiindolacético (5-HIAA) y en estriado
ventral y septo pada DA y DOPAC, a dosis constante de miotoxina III nativa
(14 µg), para cada uno de los animales de cuatro grupos de tratamiento,
con diferente tiempo de sacrificio a partir de la inyección de la miotoxina
(15, 60, 180 y 360 min). ........................................................................... 222
Cuadro X: Índice de metabolismo en estriado dorsal para el ácido 3,4-
dihidroxifenilacético (DOPAC) y el ácido homovanílico (HVA) en relación
con el neurotransmisor dopamina (DA), a dosis constante de miotoxina III
nativa (14 µg), para cada uno de los animales de cuatro grupos de
tratamiento, con diferente tiempo de sacrificio a partir de la inyección de la
miotoxina (15, 60, 180 y 360 min). ........................................................... 222
Cuadro XI: Giros netos (ipsi menos contra) durante 20 minutos por día, para
cada uno de los animales de tres grupos de tratamiento: control, toxina
nativa 1,4 µg y toxina alquilada 1,4 µg. .................................................... 223
Cuadro XII: Duración, en segundos, de la conducta de peritaxis neta (ipsi
menos contra) durante 20 minutos por día, para cada uno de los animales
de tres grupos de tratamiento: control, toxina nativa 1,4 µg y toxina
alquilada 1,4 µg........................................................................................ 224
Cuadro XIII: Número de cruces de cuadrantes virtuales del campo abierto,
durante 20 min para cada uno de los animales de tres grupos de
xiii
tratamiento: control, toxina nativa 1,4 µg y toxina alquilada 1,4 µg. ......... 225
Cuadro XIV: Duración de la conducta de exploración en segundos, durante 20
minutos por día, para cada uno de los animales de tres grupos de
tratamiento: control, toxina nativa 1,4 µg y toxina alquilada 1,4 µg. ......... 226
Cuadro XV: Duración de la conducta de limpieza en segundos, durante 20
minutos por día para cada uno de los animales de tres grupos de
tratamiento: control, toxina nativa 1,4 µg y toxina alquilada 1,4 µg. ......... 227
Cuadro XVI: Porcentajes de depleción en estriado dorsal y ventral, para
norepinefrina (NE), serotonina (5-HT), dopamina (DA) y ácido 3,4-
dihidroxifenilacético (DOPAC) y ácido homovanílico (HVA) para cada uno
de los animales de tres grupos de tratamiento: control, toxina nativa 1,4 µg
y toxina alquilada 1,4 µg. ......................................................................... 228
Cuadro XVII: Índice de metabolismo en estriado dorsal y ventral para el ácido
3,4-dihidroxifenilacético (DOPAC) y el ácido homovanílico (HVA) en
relación con el neurotransmisor dopamina (DA), para cada uno de los
animales de tres grupos de tratamiento: control, toxina nativa 1,4 µg y
toxina alquilada 1,4 µg. ............................................................................ 230


xiv
LISTA DE FIGURAS
Figura 1: Diagrama de un corte sagital a 1,90 mm lateral de la línea media de
los hemisferios, de un cerebro de rata Wistar de 290 g de peso corporal.
Modificado de Paxinos & Watson, 1998....................................................... 8
Figura 2: Diagrama de uno de los circuitos motores de los ganglios basales en
un cerebro humano. ..................................................................................... 9
Figura 3: Esquema del proceso biosintético de dopamina a partir de L--DOPA
................................................................................................................... 12
Figura 4: Esquema del proceso biosintético de serotonina (5-hidoxitriptamina)
a partir de L-triptófano y 5-hidroxi L-triptófano. (Modificado de Flórez, 2008).
................................................................................................................... 14
Figura 5: Comparación de un circuito neural en los ganglios basales en un
individuo sano (A.) y en un individuo con la enfermedad de Parkinson (B.).
................................................................................................................... 22
Figura 6: Cromatograma por HPLC/UV a 280 nm de la purificación adicional de
la miotoxina III. ........................................................................................... 45
Figura 7: Fórmula para el cálculo del índice de asimetría a partir de la conducta
de giro para un animal i. G ipsi =número total de giros ipsilaterales y G
total =número de giros totales (giros ipsi +giros contralaterales). ............ 52
Figura 8: Diagrama de una vista ventral de un cerebro de rata que muestra las
líneas de corte para la disección de los tejidos que se emplearon para los
estudios neuroquímicos e histológicos. ..................................................... 55
Figura 9: Diagrama de un corte coronal, cara posterior de un cerebro de una
rata Wistar macho de 290 g a 1,00 mm posterior del punto bregma, que
muestra las regiones que se analizaron por HPLC. ................................... 56
Figura 10: Fórmula para el cálculo del porcentaje de depleción relativo entre el
hemisferio lesionado y el no lesionado, para un neurotransmisor o para un
xv
metabolito en un tejido determinado. ......................................................... 59
Figura 11: Fórmula para el cálculo del índice de metabolismo “IM n,m ” para
una rata, en un tejido determinado, donde “n” =neurotransmisor y “m” su
respectivo metabolito. ................................................................................ 60
Figura 12: Ejemplo de una separación cromatográfica para un patrón analítico
compuesto de NE, DHBA (estándar interno), DA, DOPAC, 5-HT, HIAA y
HVA a la concentración de 120 ng de cada analito por mL en HClO
4
0,5N,
medido bajo las condiciones de la metodología desarrollada. ................... 66
Figura 13 Intensidad promedio de la señal del detector electroquímico, para
cada uno de los analitos contra el potencial aplicado al electrodo de
trabajo. ....................................................................................................... 67
Figura 14: Promedio por grupo de la diferencia del peso corporal entre el día 22
postoperatorio y el día preoperatorio, para los diferentes grupos de
tratamiento: control, dosis 0,14 µg; dosis 1,4 µg; dosis 14 µg de miotoxina
III nativa. .................................................................................................... 70
Figura 15: Promedio por grupo del giro neto durante 20 min por día, en
diferentes grupos de tratamiento: control; dosis 0,14 g; dosis 1,4 g; y
dosis 14 g de miotoxina III nativa. El valor de cero en el eje de las
ordenadas indica la simetría conductual. ................................................... 71
Figura 16: Promedio por grupo del índice de asimetría de la conducta de giro
(IA), durante 20 min por día, en diferentes grupos de tratamiento: control;
dosis 0,14 g; dosis 1,4 g; y dosis 14 g de miotoxina III nativa. La línea
roja en el valor de 50 indica la simetría conductual. .................................. 73
Figura 17: Promedio por grupo del tiempo neto de peritaxis durante 20 min por
día, en diferentes grupos de tratamiento: control; dosis 0,14 g; dosis 1,4
g; y dosis 14 g de miotoxina III nativa. El valor de cero en el eje de las
ordenadas indica la simetría conductual. ................................................... 76
xvi
Figura 18: Promedio por grupo del índice de asimetría de la conducta de
peritaxis (IA),durante 20 min por día, en diferentes grupos de tratamiento:
control; dosis 0,14 g; dosis 1,4 g; y dosis 14 g de miotoxina III nativa.
La línea roja en el valor de 50 indica la simetría conductual. ..................... 79
Figura 19: Promedio por grupo de la conducta de locomoción como el número
de cruces de cuadrantes virtuales del campo abierto, durante 20 minutos
por día, en diferentes grupos de tratamiento: control; dosis 0,14 g; dosis
1,4 g; y dosis 14 g de miotoxina III nativa. ............................................. 80
Figura 20: Promedio por grupo del tiempo total de exploración durante 20
minutos por día, en diferentes grupos de tratamiento: control; dosis 0,14 g;
dosis 1,4 g; y dosis 14 g de miotoxina III nativa. .................................... 82
Figura 21: Promedio por grupo del tiempo total en acicalamiento durante 20
minutos por día, en diferentes grupos de tratamiento: control; dosis 0,14 g;
dosis 1,4 g; y dosis 14 g de miotoxina III nativa. .................................... 84
Figura 22: Porcentaje de depleción promedio en estriado dorsal, para dopamina
(DA), ácido 3,4-dihidroxifenilacético (DOPAC), ácido homovanílico (HVA),
serotonina (5-HT) y ácido 5-hidroxi 3-indolacético (5-HIAA) para los cuatro
grupos de tratamiento con diferentes dosis de la miotoxina III, nativa:
control =1 L solución salina; dosis baja =0,14 g MT-III; dosis media 1,4
g MT-III y dosis alta 14 g MT-III. ............................................................ 86
Figura 23: Porcentaje de depleción promedio en estriado ventral, para
dopamina (DA) y ácido hidroxifenilacético (DOPAC) para los cuatro grupos
de tratamiento con diferentes dosis de la miotoxina III, nativa: control =1 L
solución salina; dosis baja =0,14 g MT-III; dosis media 1,4 g MT-III y
dosis alta 14 g MT-III. .............................................................................. 88
Figura 24: Porcentaje de depleción promedio en septo, para dopamina (DA) y
ácido hidroxifenilacético (DOPAC), para los cuatro grupos de tratamiento
con diferentes dosis de la miotoxina III, nativa: control =1 L solución
xvii
salina; dosis baja =0,14 g MT-III; dosis media 1,4 g MT-III y dosis alta 14
g MT-III. ................................................................................................... 89
Figura 25: Promedio por grupo del porcentaje de depleción en estriado dorsal,
para dopamina, serotonina y metabolitos a dosis constante de toxina MT-
III: 14 g/L, para cada uno de los animales involucrados en el estudio.
Dopamina (DA), ácido 3,4-dihidroxifenilacético (DOPAC), ácido
homovanílico (HVA), serotonina (5-HT) y ácido 5-hidroxi 3-indolacético (5-
HIAA). ........................................................................................................ 92
Figura 26: Promedio por grupo del “Índice de Metabolismo” en estriado dorsal,
para la transformación de DA en cada uno de sus metabolitos DOPAC y
HVA respecto a su neurotransmisor padre, y metabolitos a dosis constante
de toxina MT-III: 14 g/L. Dopamina (DA), ácido 3,4-dihidroxifenilacético
(DOPAC), ácido homovanílico (HVA). ....................................................... 94
Figura 27: Porcentaje de depleción en estriado ventral para dopamina (DA) y
ácido hidroxifenilacético (DOPAC) a dosis constante de toxina MT-III: 14
g/L. ......................................................................................................... 95
Figura 28: Promedio por grupo del “Índice de Metabolismo” en estriado ventral,
para la transformación de DA en su metabolito DOPAC, a dosis constante
de toxina MT-III: 14 g/L. Dopamina (DA), ácido 3,4-dihidroxifenilacético
(DOPAC). ................................................................................................... 96
Figura 29: Promedio por grupo de la diferencia del peso corporal entre el día
anterior al sacrificio y el día preoperatorio, para los diferentes grupos de
tratamiento: control, miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-
III alquilada 1,4 g/L (alquilada). .............................................................. 99
Figura 30: Promedio por grupo del giro neto durante 20 min por día, en
diferentes grupos de tratamiento: control, miotoxina MT-III nativa 1,4 g
(toxina) y miotoxina MT-III alquilada 1,4 g/L (alquilada). El valor de cero
en el eje de las ordenadas indica la simetría conductual. ........................ 100
xviii
Figura 31: Promedio por grupo del índice de asimetría de la conducta de giro
(IA), durante 20 min por día, en diferentes grupos de tratamiento: control;
miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-III alquilada 1,4 g
(alquilada). La línea roja en el valor de 50 indica la simetría conductual. 103
Figura 32: Promedio por grupo del giro total (ipsilateral +contralateral) durante
20 min por día, en diferentes grupos de tratamiento: control; miotoxina MT-
III nativa 1,4 g (toxina) y miotoxina MT-III alquilada 1,4 g (alquilada). . 107
Figura 33: Promedio por grupo del tiempo neto de peritaxis durante 20 min por
día, en diferentes grupos de tratamiento: control, miotoxina MT-III nativa 1,4
g (toxina) y miotoxina MT-III alquilada 1,4 g (alquilada). El valor de cero
en el eje de las ordenadas indica la simetría conductual. ........................ 109
Figura 34: Promedio por grupo del índice de asimetría de la conducta de
peritaxis (IA), durante 20 min por día, en diferentes grupos de tratamiento:
control, miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-III alquilada
1,4 g (alquilada). La línea roja en el valor de 50 indica la simetría
conductual................................................................................................ 112
Figura 35: Promedio por grupo del tiempo total de peritaxis durante 20 min por
día, en diferentes grupos de tratamiento: control; miotoxina MT-III nativa 1,4
g (toxina) y miotoxina MT-III alquilada 1,4 g (alquilada). ...................... 116
Figura 36: Promedio por grupo de la conducta de locomoción como el número
total de cruces de cuadrantes virtuales del campo abierto, durante 20
minutos por día, en diferentes grupos de tratamiento: control, miotoxina
MT-III nativa 1,4 g (toxina) y miotoxina MT-III alquilada 1,4 g (alquilada).
................................................................................................................. 119
Figura 37: Promedio por grupo del tiempo total de exploración durante 20
minutos por día, en diferentes grupos de tratamiento: control, miotoxina
MT-III nativa 1,4 g (toxina) y miotoxina MT-III alquilada 1,4 g/L
(alquilada). ............................................................................................... 121
xix
Figura 38: Promedio por grupo del tiempo total en acicalamiento durante 20
minutos por día, en diferentes grupos de tratamiento: control, miotoxina
MT-III nativa 1,4 g (toxina) y miotoxina MT-III alquilada 1,4 g/L
(alquilada). ............................................................................................... 123
Figura 39: Promedio por grupo del porcentaje de depleción para cada
metabolito, en los diferentes grupos de tratamiento: control, miotoxina MT-
III 1,4 g/L y miotoxina MT-III alquilada 1,4 g/L en estriado dorsal. ... 125
Figura 40: Promedio por grupo del porcentaje de depleción para cada
metabolito, en los diferentes grupos de tratamiento: control, miotoxina MT-
III 1,4 g/L y miotoxina MT-III alquilada 1,4 g/L en estriado ventral. .. 127
Figura 41: Promedio por grupo del índice de metabolismo para DOPAC y HVA,
en los diferentes grupos de tratamiento: control, miotoxina MT-III 1,4 g/L
y miotoxina MT-III alquilada 1,4 g/L, tanto en estriado ventral como
dorsal. La línea roja en el valor de índice de metabolismo = 100,
representa el valor de igual actividad metabólica en los hemisferios. ...... 129
Figura 42: Fotografía de una muestra de cerebro de rata preservada en
formalina con amortiguador de fosfatos, colocada en el micrótomo. ....... 131
Figura 43: Microfotografía de un corte coronal de un cerebro de rata con lesión
en SNpc con MTII nativa, que muestra la línea de la cicatriz. La tinción
empleada es con hematoxilina / eosina (aumento 40X). ......................... 132
Figura 44: Microfotografía de un corte coronal de un cerebro de rata con lesión
en SNpc con MTII, que muestra la línea de la cicatriz y el sitio de llegada de
la cánula justo en SNpc. La tinción empleada es con hematoxilina / eosina
(Aumento 400X). Reproducido con permiso de Saborío, 2008. ............... 133
Figura 45: Corte coronal a Bregma -5.60 mm, interaural 3,40 mm (modificado
de Paxinos & Watson, 1998), en el que se muestran los resultados de la
llegada de las cánulas. ............................................................................ 134
xx
Figura 46: Corte coronal a Bregma -6,04 mm, interaural 2,96 mm (modificado
de Paxinos & Watson, 1998), en el que se muestran los resultados de la
llegada de las cánulas. ............................................................................ 135
Figura 47: Diagramas de las vistas dorsal (superior) y lateral (inferior) del
cráneo de una rata macho Wistar de 290 g de masa corporal................. 212
Figura 48: Diagramas para la ubicación estereotáxica de la SNpc (en color rojo)
en un cerebro de rata macho Wistar de 290 g. A. corte coronal en Bregma -
5,30 mm; B. corte sagital en lateral 1,90 mm y C. corte horizontal en
bregma –8,10 mm. ................................................................................... 213


xxi
ÍNDICE DE ABREVIATURAS
Acb: núcleo accumbens
AMPc: adenosínmonofosfato cíclico
p-BPB: bromuro de para-bromofenacilo
COMPT: catecol O-metiltransferasa
CPu: caudado y putamen
DA: dopamina
DOPAC: ácido 3,4-dihidroxifenilacético
ENK: encefalina
GABA: ácido gama-aminobutírico
GLU: glutamato
GPL: globo pálido lateral
GPm: globo pálido medial
5-HIAA: ácido 5-hidroxi 3-indolacético
HPLC: cromatografía líquida de alta eficiencia
5-HT: serotonina o 5-hidroxitriptamina
HVA: ácido homovanílico
MAO: monoamino oxidasa
3-MT: 3-metoxitiramina
MT-III: miotoxina III de Bothrops asper
NE: norepinefrina
NST: núcleo subtalámico
6-OHDA: 6-hidroxidopamina
PLA
2
: fosfolipasa A
2

SNC: sistema nervioso central
SNpc: pars compacta de la substancia nigra
SNpr: pars reticulata de la substancia nigra
SP: sustancia P
VApc/VLo tálamo ventroanterior parvocelular y ventrolateral oralis.
VP: globo pálido ventral
xxii


1

CAPÍTULO I
1. INTRODUCCIÓN
La miotoxina III (MT-III), es una de cuatro miotoxinas que se han aislado y
purificado del veneno de la serpiente Bothrops asper conocida como Terciopelo
(Gutiérrez & Lomonte, 1995). Esta miotoxina, en particular ha sido aislada,
purificada, secuenciada y caracterizada estructuralmente como una fosfolipasa A
2

(PLA
2
), básica y de la clase IIA (Kaiser et al., 1990). Se han realizado muchos
estudios sobre sus efectos farmacológicos en liposomas, músculo gastrocnemio
de ratón (Bultrón et al., 1993a), glóbulos rojos y otras células de origen animal
(Bultrón et al., 1993b).

Varios investigadores han estudiado el efecto de diferentes fosfolipasas A
2
, al
inyectarlas intracerebralmente. Por ejemplo se han estudiado unas aisladas del
veneno de la serpiente Oxyuranus scutellatus scutellatus, y otras aisladas del
veneno de abejas (Gandolfo et al., 1996), además de fosfolipasas A
2
pancreáticas
(Dorandeu et al., 1998). En esta misma dirección, en Costa Rica, se cuenta con
estudios piloto, no publicados, de Gutiérrez, J . M. con las miotoxinas de Bothrops
asper también en cerebro. Específicamente, en los trabajos con MT-III, se ha
medido un efecto farmacológico en ratones, caracterizado por convulsiones y
posteriormente la muerte a una dosis de 1 g en un volumen de 4 L. Es
importante destacar que todos estos estudios presentan en común que la
inyección de las fosfolipasas A
2
es en los ventrículos cerebrales, por lo que el
efecto farmacológico reportado no es producto de una acción localizada en una
sola región cerebral. Se considera relevante estudiar a profundidad la conducta
observada en los ratones lesionados con la MT-III, debido a que esto puede
aportar un mayor conocimiento de la acción de esta toxina en tejido cerebral.


2

El interés general en estudiar la acción de fosfolipasas A
2
en cerebro, se debe a
que éstas además, son compuestos endógenos en humanos y a que la
estimulación de fosfolipasas A
2
, se cree que es importante en los procesos de
inflamación asociada a desórdenes neurológicos (Farooqui et al., 1997). Las
fosfolipasas A
2
contribuyen en la patogénesis de ciertos desórdenes neurológicos,
como el Parkinson, atacando las membranas celulares y liberando mediadores
lipídicos proinflamatorios (Farooqui et al, 1997; Teismann et al, 2003). Por
ejemplo, Klivenyi et al, (1998) demuestran que los ratones que no expresan una
PLA
2
tipo IV presentan resistencia a la toxicidad con 1-metil-4-fenil-1,2,3,6-
tetrahidropiridina (MPTP), una neurotoxina dopaminérgica empleada en la
generación de un modelo animal de la enfermedad de Parkinson (Blum et al.,
2001). Además se han medido niveles elevados de actividad PLA
2
en desórdenes
neurológicos asociados con inflamación y estrés oxidativo, por lo que se estudia
con fines terapéuticos, la acción de inhibidores no específicos de PLA
2
como
quinacrina, heparina, gangliósidos y vitamina E (Farooqui et al., 1999). Otros
investigadores han demostrado un efecto protector de la quinacrina (inhibidor de la
actividad PLA
2
) sobre la neurotoxicidad inducida por 6-hidroxidopamina (6-OHDA)
y MPTP en roedores (Tariq et al., 2001). La 6-OHDA y el MPTP son dos de las
neurotoxinas sintéticas más utilizadas para modelar la enfermedad de Parkinson
en diversas especies de animales (Betarbet et al, 2002; Dawson et al, 2002; Dauer
& Przedborski, 2003; Embord, 2004). También se han medido niveles altos de
PLA
2
en substancia nigra de pacientes con enfermedad de Parkinson comparados
con individuos sanos (Ross et al., 2001). En ratas lesionadas con 6-OHDA se han
determinado niveles mayores de incorporación de ácido araquidónico marcado en
la posición sn-2 de fosfatidilinositol y fosfatidilcolina, en las membranas neurales
de ganglios basales y regiones motoras del córtex, en el hemisferio ipsilateral
respecto de la lesión. Este efecto podría indicar una mayor actividad PLA
2
en el
hemisferio lesionado (Hayakawa et al., 1998). Toda esta evidencia parece sugerir
un efecto nocivo de la acción de fosfolipasas A
2
en desórdenes neurológicos,
específicamente como en la enfermedad de Parkinson.

3


Con este proyecto de investigación se pretende aportar un conocimiento preliminar
sobre el efecto farmacológico a nivel del sistema nervioso central (SNC) de la
miotoxina MT-III de Bothrops asper, utilizando un modelo animal de lesión cerebral
unilateral, muy utilizado para estudiar la enfermedad de Parkinson (Ungerstedt,
1971; Schwarting & Huston, 1996a; Betarbet et al, 2002; Deumens et al, 2002;
Dauer & Przedborski, 2003; Harrison & LaHoste, 2006). Además se pretende
ampliar el perfil farmacológico de esta toxina, en vista de que no ha sido estudiada
en neuronas centrales, lo cual eventualmente podría permitir la caracterización de
los procesos de degeneración y regeneración neuronal, que subyacen en
enfermedades neurodegenerativas como el morbus Parkinson.

Esta investigación requiere de la implementación de una técnica de análisis para
la determinación química de neurotransmisores en tejido encefálico. Este tipo de
metodología, adaptada a otras matrices como sangre u orina, eventualmente
permitirá proyectar el servicio de la Universidad de Costa Rica hacia la población
nacional. Por ejemplo, mediante la colaboración con hospitales nacionales, que
hasta el momento no utilizan este tipo de técnicas cromatográficas, para
establecer un diagnóstico de ciertas enfermedades del sistema nervioso. Tal caso
puede ser el diagnóstico y tratamiento de enfermedades relacionadas con
conductas anormales (e.g. conductas agresivas, déficit de atención) en las que es
importante el monitoreo de los niveles de serotonina, dopamina y de noradrenalina
en sangre, disminuyendo así eventuales efectos adversos por medicaciones
inapropiadas.

Además con este proyecto se establecieron vínculos de investigación entre el
Instituto Clodomiro Picado y el Programa de Investigación en Neurociencias
continuando líneas de investigación propias de ambos centros y aprovechando
recursos propios de la región centroamericana.


4

Con esta investigación se pudo determinar que la miotoxina III de Bothrops asper
es una toxina muy prometedora para el estudio de enfermedades neurológicas
(como el Parkinson) ya que permite estudiar, en modelos animales, la génesis de
esta patología mediante dos mecanismos: uno dependiente de la actividad PLA
2
y
otro independiente (Lomonte & Gutiérrez, 1989; Díaz et al., 1995) y muy
posiblemente diferentes a los descritos para otras toxinas tradicionales como 6-
OHDA y MPTP, entre otras. Este trabajo es la primer vez que se estudia en
neuronas centrales, una miotoxina no neurotóxica (Lambeau et al, 1991; Nicolas et
al, 1997) y que la misma presenta un efecto de lesión importante. En SNpc, la
acción tóxica de la MT-III mediante el mecanismo no enzimático, no es una acción
leve como se ha descrito en estudios en células musculares de mamíferos (Bultrón
et al, 1993a & 1993b), sino una acción de magnitud semejante al medido por la
acción fosfolipasa A
2
.

El objetivo general de esta tesis es caracterizar los efectos neuroquímicos y
conductuales, después de la inyección intracerebral de la MT-III, específicamente
en la sustancia nigra pars compacta de ratas adultas. Los objetivos específicos
son los siguientes:

 Estandarizar una metodología por HPLC/ED para la determinación de
norepinefrina, dopamina, serotonina y algunos metabolitos en tejido cerebral de
rata.
 Establecer las dosis de trabajo de la MT-III mediante un escrutinio de su efecto
farmacológico (conductual y neuroquímico) tras su inyección en la pars
compacta de la sustancia nigra en tres dosis: 0,14; 1,4 y 14 g con controles de
solución salina (NaCl 0,9 %).
 Evaluar por neuroquímica, a dosis constante, la evolución del proceso de lesión
neuronal de la miotoxina MT-III a los 15, 60, 180 y 360 minutos posteriores a su
inyección.

5

 Comparar, a una dosis predefinida, los efectos conductuales y neuroquímicos
por inyección de la MT-III, con los producidos por la inyección de la misma
toxina pero alquilada en el sitio catalítico PLA
2
, lo cual elimina su actividad
enzimática conocida.
 Realizar análisis histológicos para corroborar histológicamente la región
cerebral (sustancia nigra) donde llega la cánula con la que se inyectó la
miotoxina III.

6



7


CAPÍTULO II
2. MARCO TEÓRICO
2.1 Los Ganglios basales
Las regiones del cerebro que se van a estudiar en este proyecto de investigación
forman parte de los ganglios basales, por esto es importante presentar aspectos
teóricos sobre su función y localización.

Los ganglios basales son un conjunto de estructuras del encéfalo que modulan de
forma indirecta, junto con otras estructuras cerebrales, aspectos relacionados con
el movimiento corporal voluntario, entre otras funciones, no todas bien definidas
(Flórez, 2008). Se ubican principalmente laterales y alrededor del tálamo,
ocupando gran parte de las regiones más profundas de ambos hemisferios
cerebrales. Ellos proveen el ligamen fisiológico crucial entre la idea de movimiento
y la expresión motora de esta idea. Estas estructuras ejercen su influencia sobre
las regiones motoras de la corteza cerebral antes que los comandos motores sean
enviados al tallo y la médula espinal. En otras palabras, la actividad neuronal del
sistema motor descendente se correlaciona temporalmente con el acto motor
actual, en cambio la mayoría de la actividad neuronal de los ganglios basales
ocurre antes que el movimiento inicie. Las lesiones en la función del sistema
motor descendente y la médula espinal causan en el paciente paresis o parálisis,
mientras que las lesiones en los ganglios basales causan disturbios en la
iniciación o cese del evento motor (Kandel et al., 2000 y Kingsley, 2000).

Los ganglios basales están formados por el núcleo caudado (del latín: cola) y el
núcleo putamen (del latín: ciruela), el núcleo accumbens (del latín: inclinado), el
globo pálido (del latín: esfera pálida), el núcleo subtalámico (nombrado así por su
ubicación caudal al tálamo) y la sustancia nigra (nombrado así por la coloración

8

oscura que presenta este tejido). La ubicación anatómica de estos núcleos en un
cerebro de rata Wistar, se puede apreciar en un corte sagital (ver Figura 1).


Figura 1: Diagrama de un corte sagital a 1,90 mm lateral de la línea media de los hemisferios, de
un cerebro de rata Wistar de 290 g de peso corporal. Modificado de Paxinos & Watson, 1998.
El diagrama muestra, en un plano, la ubicación de las diferentes estructuras que conforman los
ganglios basales y el tálamo. En el diagrama se destaca: en verde el estriado dorsal (CPu:
caudado y putamen), en amarillo el estriado ventral (Acb: núcleo accumbens) en morado el pálido
ventral (VP), en anaranjado el tálamo, en café oscuro el núcleo subtalámico, en azul la pars
reticulada de la sustancia nigra y en rojo la pars compacta de la sustancia nigra.


El núcleo caudado y el putamen (ambos también denominados neoestriado o
estriado dorsal) son las estructuras de los ganglios basales que reciben la mayor
cantidad de aferencias. Estas dos estructuras junto con el núcleo accumbens se
denominan estriado. El núcleo accumbens (también denominado estriado ventral)
se localiza ventral a la cabeza del caudado. El globo pálido, que forma parte del
diencéfalo, se divide en un segmento externo y uno interno. El núcleo subtalámico
se ubica ventral al tálamo en el punto de unión de éste último con el mesencéfalo.
La sustancia nigra se encuentra en el mesencéfalo y se divide en dos estructuras:

9

la parte pálida ventral (también conocida como pars reticulata o zona reticulada) y
la parte pigmentada dorsal (también conocida como pars compacta o zona
compacta). La zona compacta contiene cuerpos (somas) neuronales
dopaminérgicos, con la mayor cantidad de dopamina de todo el cerebro. Estos
cuerpos además contienen neuromelanina, que es un pigmento responsable de la
coloración negra característica de la región, y que se observa en cerebros frescos
de cadáveres humanos (Kandel et al., 2000 y Kingsley, 2000).

Los ganglios basales se encuentran muy interconectados y funcionan como un
“puente” entre el telencéfalo y el diencéfalo. En la Figura 2, se ilustran las
principales vías de comunicación entre los ganglios basales y otras estructuras
encefálicas.













Figura 2: Diagrama de uno de los circuitos motores de los ganglios basales en un cerebro humano.
Las flechas indican la dirección de la transmisión neuronal. La flecha en rojo señala la vía
dopaminérgica nigro-estriatal. NST: núcleo subtalámico, SNpc: sustancia nigra pars compacta,
SNpr: sustancia nigra pars reticulata. Modificado de Kandel et al. (2000).


SNpr
Córtex
Tálamo
NST
SNpc

Estriado
Pálido Externo
Pálido Interno
Al tronco
encefálico y
médula espinal

10

Casi todas las conexiones aferentes de los ganglios basales llegan al neoestriado.
Éste recibe aferencias principalmente de la corteza cerebral y de los núcleos
intralaminares del tálamo. Cada área del córtex proyecta a un núcleo distinto del
estriado y cada núcleo de estos últimos participa en una función conductual
específica. Por ejemplo, el putamen está implicado fundamentalmente en el
control motor y el caudado participa en el control de los movimientos oculares y en
determinadas funciones cognitivas y el estriado ventral está relacionado con otras
áreas corticales que median los efectos de la emoción sobre la conducta. El
núcleo subtalámico recibe también aferencias de la corteza cerebral. Las
neuronas de distintas regiones del caudado y del putamen envían proyecciones a
zonas específicas del globo pálido y la sustancia nigra. Aún más, la organización
es topográfica de tal modo que zonas específicas de la corteza actúan a través del
estriado en zonas específicas del globo pálido y la sustancia nigra. El núcleo
subtalámico recibe información del segmento externo del globo pálido y envía
proyecciones organizadas topográficamente, a ambos segmentos del globo pálido
y a la zona reticulada de la sustancia nigra. También recibe aferencias directas
organizadas topográficamente desde la corteza motora primaria y premotora,
proporcionando a la corteza motora otro medio para controlar las salidas de los
ganglios basales (Kandel et al., 2000; Kingsley, 2000).

Entre estas rutas de intercomunicación, una es la de mayor relevancia para el
desarrollo de esta investigación: la vía nigro-estriatal. El neoestriado recibe la
proyección dopaminérgica más importante desde la zona compacta de la
sustancia nigra (ver en la Figura 2, la vía que se resalta con una flecha de color
rojo). La pérdida progresiva de esta proyección dopaminérgica es característica
de la enfermedad de Parkinson. Muchas de las neuronas dopaminérgicas de la
pars compacta también producen colecistoquinina (CCK) y un péptido neuroactivo,
por lo que un daño en esta región involucra también la pérdida de estas señales.
Además del neoestriado, estas neuronas dopaminérgicas se proyectan al

11

complejo amigdaloide, el núcleo accumbens y la corteza prefrontal (Kandel et al.,
2000 y Kingsley, 2000).

La vía eferente principal de los ganglios basales surge del segmento interno del
globo pálido y de la zona reticulada de la sustancia nigra. Estas vías terminan en
varios núcleos del tálamo, que a su vez proyectan sobre varias áreas corticales:
prefrontal, premotora y el área motora suplementaria. Mediante estas
proyecciones, los ganglios basales influyen sobre otros sistemas descendentes,
tales como los sistemas corticoespinales y corticobulbar (Kandel et al., 2000;
Kingsley, 2000).

Varias enfermedades neurológicas se han relacionado con lesiones específicas de
los ganglios basales. En general, el daño de los ganglios basales produce
enfermedades caracterizadas por desórdenes en el movimiento corporal o
disquinesias. Las disquinesias son enfermedades en las que se presentan
pérdidas del control voluntario del movimiento y la regulación del mismo. Hay dos
tipos de disquinesias (Kingsley, 2000):

 Las hiperquinesias: que resultan en la expresión de movimientos involuntarios
espontáneos. Por ejemplo, en la enfermedad de Huntington donde se
presenta una pérdida progresiva de los núcleos caudado y putamen, así como
pérdida de neuronas corticales y se caracteriza además por cuadros de
demencia, y alteraciones de la personalidad (Martin, 1999).

 Las hipoquinesias: que resultan en movimientos espontáneos escasos y
enlentecimiento del movimiento voluntario. Un ejemplo de hipoquinesia se da
en la enfermedad de Parkinson (Martin, 1999).



12

2.2 Neuroquímica en los Ganglios Basales
Entre los neurotransmisores a nivel de los ganglios basales se encuentran las
aminas biogénicas que son: las catecolaminas y la serotonina (Kandel et al.,
2000). Todos los neurotransmisores catecolaminérgicos: dopamina, noradrenalina
y adrenalina; se sintetizan a partir del aminoácido tirosina (Tyr) en la misma ruta
biosintética. En esta ruta se han identificado cinco enzimas principales: la tirosina
hidroxilasa (TH), la L-aminoácido aromático descarboxilasa (AAD), la dopamina -
hidroxilasa (DAH), la pteridina reductasa (PtR) y la feniletanolamina N-
metiltransferasa (NMT).

La primera enzima, la tirosina hidroxilasa (TH), facilita la oxidación de la tirosina
(Tyr, L-4-hidroxifenilalanina) en L-3,4-dihidroxifenilalanina (L-DOPA). En este
paso interviene como cofactor una pteridina reducida (Pt-2H), que se regenera a
partir de la pteridina (Pt), por acción de otra enzima: la pteridina reductasa (PtR).
La L-DOPA es biodescarboxilada por la acción de la enzima L-aminoácido
aromático descarboxilasa (LAAD) para generar dopamina (3,4-
dihidroxifeniletilamina) con la consecuente pérdida de la quiralidad en el producto
(ver figura 3).


Figura 3: Esquema del proceso biosintético de dopamina a partir de L--DOPA


La tercera enzima, la dopamina -hidroxilasa (DAH) facilita la producción de
noradrenalina o 3,4-dihidroxifeniletanolamina. La noradrenalina presente en
HO
HO
NH
2
dopamina L-DOPA
HO
NH
3
+
O
O
-
HO LA AD
+CO
2

13

estriado tiene su origen principalmente en proyecciones que provienen del locus
coeruleus. Estas proyecciones pasan ventromedial a la pars compacta
(Nieuwenhuys, 1985).

Finalmente la enzima feniletanolamina N-metiltransferasa (NMT), facilita la
biotransformación de la noradrenalina en adrenalina o 3,4-dihidroxi-N-
metilfeniletanolamina. Este proceso ocurre en la médula adrenal. La enzima NMT
no se sintetiza en sistema nervioso central, aunque algunas neuronas encefálicas
utilizan adrenalina como neurotransmisor (Nelson & Cox, 2000).

No todas las neuronas cerebrales que liberan catecolaminas, expresan las cinco
enzimas. Por ejemplo, las neuronas que liberan noradrenalina no expresan la
NMT y las que liberan dopamina no expresan la NMT ni la DAH.

Las principales enzimas involucradas en el metabolismo de las catecolaminas a
nivel de todo el organismo y también del encéfalo son las MAO
(monoaminooxidasas) y las COMT (catecol-O-metiltransferasas) (Flórez, 2008).
Las MAO son enzimas oxidativas mitocondriales que actúa en la cadena lateral.
Su actividad se centra en la fracción citoplasmática de las monoaminas no
protegidas en el interior de las vesículas. La COMT es una enzima de la fracción
soluble citoplasmática e incluso puede estar asociada a la membrana celular
postsináptica, pero no se encuentra ligada particularmente a las neuronas
catecolaminérgicas (Flórez, 2008).

En el caso específico de la dopamina, ésta es metabolizada por la MAO y luego la
ADH (aldehído deshidrogenasa) a ácido 3,4-dihidroxifenilacético (DOPAC), en la
terminación sináptica. La dopamina liberada es transformada por la COMT a 3-
metoxitiramina (3-MT), la cual es posteriormente metabolizada por la MAO y luego
la ADH en ácido 3-metoxi-4-hidroxifenilacético, también conocido como ácido

14

homovanílico (HVA). El DOPAC a su vez es metabolizado por la COMT también a
HVA.

La serotonina (5-hidroxitriptamina) se biosintetiza en un proceso que inicia con la
hidroxilación de L-triptófano a 5-hidroxitriptófano por acción de la enzima triptófano
hidroxilasa (WH) y luego la descarboxilación de éste último con acción de la LAAD
(ver figura 4).


Figura 4: Esquema del proceso biosintético de serotonina (5-hidoxitriptamina) a partir de L-
triptófano y 5-hidroxi L-triptófano. (Modificado de Flórez, 2008).

Por su parte la serotonina es metabolizada principalmente por la MAO y luego por
la ADH en ácido 5-hidroxi 3-indolacético (5-HIAA). La serotonina presente en el
estriado tiene su origen principalmente en proyecciones que provienen del núcleo
del Rafé. Estas proyecciones pasan dorsomedial a la pars compacta
(Nieuwenhuys, 1985).


2.3 Sistema dopaminérgico en el Sistema Nervioso Central
El sistema dopaminérgico en el sistema nervioso central (SNC), está constituido
por varios elementos de proyección, cuyas fibras son de longitud variable: largas,
cortas y ultracortas (Flórez, 2008):

NH
O
NH
3
+
O
-
L-triptófano
PtR
Pt Pt (2H)
+H
2
O
WH
+O
2
NH
O
NH
3
+
O
-
HO
5-hidroxi L-triptófano
serotonina
NH
NH
2
HO
- CO
2
LAAD

15

a) El sistema nigrostriado: su origen está localizado en la SNpc y en menor
grado en la formación reticulada mesencefálica y proyecta profusamente al
caudado y putamen donde forma una red densa de terminaciones.
b) Sistema mesolímbico: nace principalmente en el área tegmental ventral y se
distribuye por el sistema límbico con excepción del hipocampo, núcleo
accumbens, tubérculo olfatorio, núcleo central de la amígdala, septum
lateral y núcleo intersticial de la estría terminal.
c) Sistema mesocortical: a diferencia de lo que ocurre en los roedores, este
sistema se encuentra muy desarrollado en la especie humana. Desde la
SNpc y área tegmental ventral proyecta hasta las cortezas motoras,
premotoras y suplementarias y a las cortezas parietal, temporal y cingular
posterior, es decir, hasta las principales áreas sensorimotoras y de
asociación. Además, y al igual que en los roedores, las terminaciones
dopaminérgicas se extienden a las cortezas prefrontal, cingular anterior,
insular, piriforme, perirrinal y entorrinal y, más probablemente, a la corteza
visual.
d) Vías cortas: son la tuberohipofisaria, que nace en el hipotálamo ventral
tuberobasal e inerva la eminencia media y el lóbulo intermedio de la
hipófisis, y la incertohipotalámica, que conecta el hipotálamo dorsal y
posterior con los núcleos laterales septales. También existen pequeñas
vías en el núcleo motor dorsal del vago, el núcleo del tracto solitario y la
sustancia gris periacueductal.
e) Vías ultracortas: se encuentran en la capa nuclear interna de la retina,
como células amacrinas, y en las neuronas periglomerulares del bulbo
olfatorio.

Los sistemas dopaminérgicos cerebrales están íntimamente relacionados con
procesos en los que el movimiento y la ejecución de tareas constituyen un
elemento clave. En primer lugar, el sistema nigroestriado es esencial en la
especie humana para que el movimiento sea realizado de forma armoniosa y

16

obedezca a las órdenes voluntarias del individuo de acuerdo con patrones motores
bien establecidos. En esta acción participan probablemente de forma conjunta la
activación de receptores D
1
y D
2
. El sistema mesolímbico interviene
abundantemente en todos aquellos procesos en que la motivación forma parte
esencial de la conducta, sea ésta fisiológica para atender las necesidades
elementales del individuo y de la especie o patológica creada por la
hiperestimulación del sistema, e.g. farmacodependencia (Flórez, 2008).

La dopamina, de forma similar que las otras catecolaminas, se encuentra
mayormente almacenada en gránulos o vesículas de las células neuronales. En
las neuronas, los gránulos se concentran preferentemente en las varicosidades
que existen a lo largo de los axones. La membrana de estos gránulos tiene un
poderoso sistema de transporte que requiere de ATP y Mg
+2
, mediante el cual
genera un gradiente de protones dirigido hacia el interior vesicular. El transporte
hacia el interior vesicular, de la dopamina sintetizada, se realiza mediante
intercambio con protones. La dopamina, una vez en el interior, se mantiene
preferentemente en su forma ionizada, por lo que no puede difundir hacia el
exterior a través de la membrana vesicular. La liberación de dopamina hacia la
terminación sináptica se produce por un proceso de exocitosis mediada por la
activación de canales de Ca
+2
(Flórez, 2008; Kandel et al, 2000; Kingsley, 2000;
Nelson & Cox, 2000).

Se han descrito cinco tipos de receptores dopaminérgicos denominados: D
1
, D
2
,
D
3
, D
4
y D
5
. Esta clasificación se ha basado en su diferente sistema de
transducción de señal (tipo de proteína G), su diferente afinidad farmacológica
(tanto a agonistas selectivos como antagonistas selectivos), así como por el
cromosoma que contiene el gen que expresa cada receptor (Brody et el, 1998;
Flórez, 2008). La estructura molecular de los receptores dopaminérgicos es de
receptores acoplados a proteína G estimuladoras (D
1
y D
5
) o inhibidoras (D
2
, D
3
y

17

D
4
) con una estructura de siete segmentos transmembrana (Brody et al, 1998;
Flórez, 2008).

Los receptores D
1
de localización abundante en neoestriado, se asocian con la
activación de la adenililciclasa. Su excitación produce un aumento del AMPc. Se
localizan en diversos núcleos y áreas del SNC donde participan en el control de la
actividad motora por el sistema extrapiramidal. También se localizan en la
glándula paratiroides cuya estimulación produce liberación de la hormona
(Kebabian, 1995; Flórez, 2008).

Los receptores D
2
, de localización abundante en neostriado, se asocian con la
inhibición de la adenililciclasa, la supresión de corrientes de Ca
+2
y la activación de
las corrientes de K
+
. Se encuentran distribuidos en el SNC: en la hipófisis anterior
y en los núcleos caudado y putamen. Los receptores D
2
se han implicado en la
fisiopatología de la esquizofrenia y de la enfermedad de Parkinson (Brody et el,
1998; Flórez, 2008).

Los receptores D
3
, están asociados con la adenililciclasa también de forma
inhibitoria y presentan similitud con los receptores D
2
. Su localización preferente
en el SNC se circunscribe a los islotes de Calleja y el núcleo accumbens. No se
conoce la acción específica de estos receptores D
3
. Presentan una afinidad por la
dopamina 20 veces superior a su homólogo D
2
(Flórez, 2008). Los receptores D
4

se localizan preferentemente en áreas corticales, a diferencia de la localización
estriatal de su homólogo el receptor D
2
. La clozapina presenta mayor afinidad por
los receptores dopaminérgicos D
4
, que los receptores D
2
(Flórez, 2008). Los
receptores D
5
son muy escasos y se localizan en hipotálamo, hipocampo y el
núcleo parafascicular del tálamo. Los receptores D
5
se asocian con la activación
de la adenililciclasa. Presentan mayor afinidad por la dopamina pero todavía son
indistinguibles farmacológicamente de los receptores D
1
(Flórez, 2008).


18

En el sistema nervioso periférico, se encuentran también receptores
dopaminérgicos. A nivel periférico se distinguen dos tipos de receptores que
corresponden a las familias D
1
y D
2
. Los receptores D
2
se localizan, en buena
parte, en terminaciones simpáticas postganglionares de algunos órganos: aparato
cardiovascular (fibras simpáticas del corazón, vasos renales y mesentéricos),
membrana nictitante, bazo y conducto deferente. Su activación produce inhibición
de la liberación de noradrenalina y por lo tanto reducción de la actividad simpática.
Los receptores de la familia D
1
se encuentran asociados a las fibras musculares
lisas de algunos vasos (e.g. renales), a las células yuxtaglomerulares y a los
túbulos renales (Brody et el, 1998; Flórez, 2008).


2.4 La enfermedad de Parkinson
La enfermedad de Parkinson (EP) descrita por primera vez en 1817 por el Dr.
J ames Parkinson (Brody et al., 1998; Kingsley, 2000) es un desorden
neurodegenerativo de los ganglios basales (Kandel, 2000), de causa desconocida
aún. Clínicamente se maneja su sintomatología; pero aún es imposible detener su
progresión o restaurar la pérdida de funciones (Toulouse & Sullivan. 2008).

La enfermedad de Parkinson afecta a más de un millón de personas en los EEUU
(Lang & Lozano, 1998a). En ese país se ha determinado que la EP afecta
aproximadamente al 1% de la población mayor de 55 años (Deumens et al., 2002),
y con una prevalencia del 2% en la población mayor de 65 años (Martin, 1999), lo
que la convierte en el segundo desorden neurodegenerativo más común después
del Alzheimer (Martin, 1999). La EP se encuentra relacionada con la edad adulta,
cerca del 66% de los pacientes se encuentran entre los 55 y los 69 años (Brody,
et. al., 1998). Datos más recientes en Europa occidental han evidenciado también
un impacto social y económico importante de esta enfermedad. Se reporta que

19

afecta entre el 0,5 y el 1% de la población entre los 65 y 69 años e incrementa
entre un 1 y un 3% de la población mayor de 80 años (Toulouse & Sullivan, 2008).

En Costa Rica no existen, hasta ahora, datos de incidencia, ni prevalencia de esta
enfermedad en la población nacional. Lo anterior se puede concluir luego de
realizar una investigación en noviembre de 2008, en algunas instituciones
públicas. Se investigó en la oficina de la Organización Panamericana de la Salud
(OPS) en Costa Rica, el Departamento de Vigilancia de la Salud del Ministerio de
Salud, el Instituto Nacional de Estadísticas y Censo (INEC), y el Departamento de
Estadísticas de Salud de la Caja Costarricense del Seguro Social (CCSS). En el
sistema público de salud costarricense, las enfermedades neurológicas crónicas
no se encuentran incluidas entre las enfermedades que deben ser reportadas al
Ministerio Salud. Entre las enfermedades reportables se encuentran las
cardiovasculares y el cáncer.

En el Departamento de Estadísticas de Salud de la CCSS, se lleva un registro del
número de egresos por año de todos los Hospitales del Seguro Social del país.
Estos registros se encuentran clasificados por Hospital y por edad del paciente. A
partir de estos datos de egresos entre los años 2005 y 2007 (ver Anexo I), se
calculó que el 76% de los pacientes egresados y que fueron diagnosticados con
EP, son mayores de 65 años. Estos datos permiten extrapolar una mayor
incidencia de esta enfermedad en la población adulta mayor en nuestro país.

Otro dato que se puede extraer del reporte anual de egresos, es que en promedio
por año egresan 65 pacientes diagnosticados con EP. Estos 65 pacientes en la
población nacional (estimada en 4.549.903 habitantes, al 01 de julio de 2008 por el
INEC) representan un 0,0014%. Debido a que el número de egresos solo cubre
los pacientes atendidos en los servicios de medicina interna y emergencias,
además que está restringido al sistema de seguridad social público, no es posible

20

concluir que este 0,0014% represente la incidencia de la EP en el país. La
incidencia real podría ser mayor.

La enfermedad de Parkinson o parálisis agitante se caracteriza por tres síntomas
principales: bradiquinesia (lentitud anormal de movimientos), rigidez o aquinesia
(rigidez muscular y dificultad en iniciar el movimiento) y tremor (temblor en reposo
de 4 a 7 Hz que disminuye durante la realización de movimientos voluntarios).
Este tremor se presenta en un gran porcentaje de los pacientes que padecen esta
enfermedad e inicia en una extremidad (principalmente superiores: manos y
dedos) y luego se extiende a las otras. Otros síntomas son la incapacidad para
mantener la postura normal que resulta en un andar arrastrando los pies y en
frecuentes caídas y disfunciones cognitivas (problemas en el pensamiento, la
memoria y el lenguaje) que aumentan progresivamente (Lang & Lozano, 1998a &
1998b).

La evidencia neuropatológica más consistente en los pacientes con la enfermedad
de Parkinson, es la pérdida de las neuronas pigmentadas de la pars compacta de
la sustancia nigra. La pérdida de estas células se acompaña de una disminución
de otras células pigmentadas del sistema nervioso central, en el locus coeruleus y
en el núcleo motor dorsal del vago. Otra característica neuropatológica distintiva
es la aparición de inclusiones citoplasmáticas anormales denominadas cuerpos de
Lewy que se presentan en las neuronas de la sustancia nigra que contienen
melanina (Martín, 1999).

En la década de 1950 se realizó un descubrimiento muy importante para la
comprensión de esta enfermedad. Se encontró que los pacientes con Parkinson
presentaban una reducción severa del neurotransmisor dopamina. Esta carencia
se debía a la degeneración de las neuronas dopaminérgicas de la sustancia nigra
que proyectan al estriado (Kandel, 2000). El Parkinson fue la primera enfermedad
cuya sintomatología se asoció con la pérdida de un neurotransmisor específico.

21

La importancia de este descubrimiento permitió introducir el tratamiento
farmacológico con L-DOPA, aún vigente (Flórez, 2008). Este hallazgo además
permitió demostrar que los trastornos del sistema nervioso pueden afectar a
neuronas específicas, y a procesos moleculares específicos. Más aún, se puso de
manifiesto que la administración de un neurotransmisor o de su precursor pueden
emplearse como terapia farmacológica, como sucede en la actualidad en ciertos
trastornos psiquiátricos (Kandel, 2000).

El principal circuito neural que se afecta en la EP se describe a continuación. En
un organismo sano, la dopamina producida en las células de la pars compacta,
estimula o facilita las neuronas más abundantes en estriado: las neuronas
espinosas de tamaño mediano “medium spiny neurons” por su acción mediante
receptores del tipo D
1
. Las eferencias GABAérgicas de las espinosas también
reciben terminales de proyecciones corticales glutamatérgicas, así como otras
proyecciones extrínsecas: serotoninérgicas y adenosinérgicas e intrínsecas:
colinérgicas y somatostatinérgicas (Chase et al., 1998). Aproximadamente el 2%
de las células del estriado, las interneuronas no espinosas gigantes, son
colinérgicas y proveen una inervación extensiva en estriado, principalmente sobre
las neuronas GABAérgicas espinosas medianas. Estas aferencias modulan la
actividad de las neuronas medianas espinosas. Un desbalance en estriado entre
la liberación de acetilcolina y dopamina de los axones que se originan en la
substantia nigra pars compacta, es lo que ha sido fuertemente implicado con la
enfermedad de Parkinson (Lin et al., 2004).

En un individuo con Parkinson, esta facilitación sobre el estriado se pierde en más
de un 80% (Brody et. al., 1998). Debido a esto último, se reduce la acción
inhibidora GABAérgica del estriado sobre las neuronas del globo pálido medial y
sobre la sustancia nigra reticulada, como se observa en la figura 5. Por tanto, esta
disminución de la señal inhibitoria sobre las neuronas del globo pálido medial y
sobre la sustancia nigra reticulada producen un aumento de la tasa de disparo del

22

complejo globo pálido – sustancia nigra reticulada (complejo también inhibitorio).
En un individuo sano, este complejo inhibe el tálamo ventro-lateral, y en uno
enfermo, al encontrarse el complejo globo pálido medial - sustancia nigra
reticulada poco inhibido, aumenta su tasa de disparo inhibitoria y el tálamo ventro-
lateral es inhibido en gran medida. Como resultado, en un individuo con
Parkinson, la vía tálamo – cortical no funciona normalmente, lo que produce
hipoquinesia (Kandel, 2000; ver figura 5).



















Figura 5: Comparación de un circuito neural en los ganglios basales en un individuo sano (A.) y en
un individuo con la enfermedad de Parkinson (B.).
D1: receptores dopaminérgicos tipo 1, D2: receptores dopaminérgicos tipo 2, GLU: glutamato, DA:
dopamina; SP: sustancia P; ENK: encefalina; GABA: ácido gama-aminobutírico; GPL: globo pálido
lateral; SNpc: sustancia nigra pars compacta; NST: núcleo subtalámico; GPm: globo pálido medial;
SNpr: sustancia nigra pars reticulata; VApc/VLo: Tálamo ventroanterior parvocelular y ventrolateral
oralis. Adaptado de Kingsley, 2000.

GABA
++
+
SNpc
GPL
NST
GPm / SNpr
Tegmento
Vapc / VLo
Corteza cerebral
GLU GLU GLU
GLU
DA
DA
DA
SP SP
ENK
GABA
GABA
GABA
GABA
GABA
estriado
D
1
D
2

+
+ + +
+
+
+
-
-
-
-
-
SNpc
GPL
NST
GPm / SNpr
Tegmento
Vapc / VLo
Corteza cerebral
GLU GLU GLU
GLU
DA
DA
DA
SP SP
ENK
GABA
GABA
GABA
GABA
estriado
+
+ + +
+
- -
-
-
-
-
-
- -
+
A. B.
+

23

Además de lo anterior, la vía dopaminérgica genera indirectamente una inhibición
sobre las neuronas espinosas de encefalina del estriado actuando sobre
receptores del tipo D
2
. En un individuo con Parkinson, esta inhibición está
disminuida, lo que genera un aumento en la liberación del neurotransmisor GABA
también inhibitorio, que actúa sobre el globo pálido lateral. En un individuo sano, el
estriado inhibe la acción del globo pálido lateral y en uno enfermo esta inhibición
está aumentada y consecuentemente decrece la tasa de disparo del globo pálido
lateral sobre el núcleo subtalámico. Por último, en un individuo enfermo el núcleo
subtalámico presenta incrementada su tasa de disparo estimulante sobre el
complejo: globo pálido medial - sustancia nigra reticulada. Por tanto, este
aumento de la estimulación, incrementa la tasa de disparo inhibitoria del complejo
globo pálido – sustancia nigra reticulada sobre el tálamo ventro-lateral. Con esto
último, también por esta otra vía se produce una inhibición de la vía tálamo –
cortical, que como se describió anteriormente, se traduce en hipoquinesia (Kandel,
2000; ver figura 5).

Una herramienta vital para estudiar el funcionamiento normal de diversas
estructuras cerebrales como los ganglios basales, así como el origen y la
evolución de enfermedades neurodegenerativas como el Parkinson, es mediante
modelos animales. Uno de los modelos animales más utilizados para el estudio
del Parkinson es el modelo de lesión de la vía nigroestriatal con diferentes toxinas
(Woodruff & Nonneman, 1994; Betarbet et al, 2002; Dawson et al, 2002; Dauer &
Przedborski, 2003; Embord, 2004) como por ejemplo la lesión en ratas de esta vía
con la neurotoxina catecolaminérgica: 6-hidroxidopamina (6-OHDA) (Schwarting &
Huston, 1996a & 1996b; Fornaguera & Schwarting, 1999; J ackson-Lewis &
Liberatore, 2000; Sindhu et al, 2006).



24

2.5 Modelo en ratas de lesión intracerebral con 6-hidroxidopamina
Los modelos en ratas de la enfermedad de Parkinson, que involucran la lesión con
neurotoxinas de la vía dopaminérgica nigroestriatal, han sido muy estudiados
(Woodruff & Nonneman, 1994; J ackson-Lewis & Liberatore, 2000; Betarbet et al.,
2002; Dauer & Praedborski, 2003; Sindhu et al, 2005). Existen variaciones entre
los modelos según: la toxina empleada (Konitsiotis et al, 1998; Sawamura et al,
2001; Sindhu et al, 2005; Xu et al, 2005); la región específica de la vía nigro-
estriatal que se lesione (Deumens et al., 2002; Sindhu et al, 2006), el grado de
lesión (Hefti et al, 1980; Fornaguera et al, 1993; Schwarting & Huston, 1996a) y si
la lesión es unilateral (uno de los hemisferios cerebrales) (Schwarting & Huston,
1996a; Deumens et al., 2002) o bilateral (Smith et al, 2002).

Por ejemplo, las regiones de la vía nigro-estriatal que se han lesionado en
modelos con 6-hidroxidopamina (6-OHDA) comprenden (Deumens et al., 2002):

a) La región medial del prosencéfalo. Este tipo de lesión produce una
disminución dopaminérgica extensiva.

b) La pars compacta de la sustancia nigra, lo que produce una disminución
dopaminérgica más específica y moderada.

c) Sub-regiones del complejo caudado – putamen que produce disminuciones
dopaminérgicas específicas y menores que las descritas para la lesión del
punto b), anterior.

Estos modelos de lesión con 6-OHDA han sido muy útiles para aumentar el
conocimiento de la fisiología de los ganglios basales y de su fisiopatología como
en la enfermedad de Parkinson. Además, se han empleado en el desarrollo de
nuevas estrategias terapéuticas, a saber, el desarrollo de nuevos fármacos y la

25

implementación de aproximaciones quirúrgicas como trasplantes de tejido neural
sano (Woodruff & Nonneman, 1994).

Según Schwarting & Huston (1996a), el modelo con mayor selectividad y con
depleciones de dopamina más controladas, es el de la lesión de la sustancia nigra
pars compacta (SNpc) con 6-OHDA. La neurotoxina 6-OHDA es el primer
compuesto químico descubierto que presenta efecto neurotóxico específico sobre
las vías catecolaminérgicas (Ungerstedt, 1968).

Esta toxina puede ser transportada al interior de los cuerpos celulares
dopaminérgicos por el transportador de dopamina. La 6-OHDA produce la
destrucción de las terminales nerviosas. Se han propuesto dos mecanismos
independientes para explicar la neurotoxicidad de la 6-OHDA. Uno de ellos es la
inducción de estrés oxidativo por la generación de peróxido de hidrógeno y
radicales hidroxilo derivados. El otro mecanismo se basa principalmente en su
potente efecto inhibidor de enzimas respiratorias mitocondriales. Debido al déficit
metabólico inducido, las neuronas afectadas mueren (Blum et al, 2001; Deumens
et al., 2002). En este modelo, la lesión no está restringida a la pars compacta,
también se han reportado lesiones, aunque parciales, de las células
dopaminérgicas del área ventral tegmental. La selectividad de la lesión con 6-
OHDA también se puede ver afectada por la captura de la toxina por transportador
presináptico de norepinefrina. Esto último se puede evitar con la administración
sistémica, previo a la lesión, de desipramina: un inhibidor del transportador de
norepinefrina (Deumens et al., 2002).

Aunque los modelos de lesión bilaterales semejan más la lesión en el humano con
Parkinson, la cual es bilateral también, la mayoría de los modelos involucran la
lesión unilateral, es decir, en un solo hemisferio. La preferencia por el modelo
unilateral se debe a que el modelo de lesión unilateral presenta ciertas ventajas
experimentales respecto al bilateral. En el primero, se presentan procesos de

26

compensación neuroquímica, que pueden traducirse en cambios en la conducta
observables, aunque no puede descartarse la situación en que la compensación
neuroquímica no se traduzca en un cambio observable conductualmente. Los
mecanismos que se han propuesto y que conllevan al desarrollo de esta
compensación son: la hipersensibilidad de receptores en el estriado, el aumento
del metabolismo (síntesis de dopamina) por parte de las células remanentes no
lesionadas (de persistir éstas) y las vías neurales cruzadas entre los hemisferios,
siendo este último el mecanismo menos importante (Schwarting & Huston, 1996a).
La lesión unilateral puede ser caracterizada conductualmente, de forma
espontánea y / o por inducción farmacológica. La conducta medida en el modelo
unilateral, está basado en el desbalance que se presenta en los niveles de
dopamina entre ambos hemisferios y el correspondiente cambio en la conducta,
también de manera unilateral. Adicionalmente, el modelo unilateral permite
realizar, además de las comparaciones entre animales, realizarlas intra-animales,
pues cada organismo se convierte en su propio control. Una desventaja del
modelo bilateral es que se producen problemas en la ingesta de alimento y de
agua, lo que requiere de procedimientos adicionales para alimentar a los animales,
de lo contrario éstos morirían. Esta intervención para alimentar los animales
podría afectar la conducta medida (Schwarting & Huston, 1996a).

Los efectos en la conducta y los niveles de neurotransmisores (efecto
neuroquímico), producidos por la lesión unilateral de la pars compacta en ratas,
principalmente con 6-OHDA se han estudiado ampliamente (Ungerstedt, 1971;
Schwarting & Huston, 1996a; Betarbet et al, 2002; Deumens et al, 2002; Dauer &
Przedborski, 2003; Harrison & LaHoste, 2006; Domenger & Schwarting, 2008; J in
et al, 2008). Basándose en este modelo tan bien descrito, resulta ventajoso
evaluar los efectos de una sustancia como la MT-III, cuyo mecanismo de acción a
nivel central no se conoce aún.


27

Una forma de cuantificar el grado de lesión en un tejido es histológicamente
mediante la tinción específica para tirosinhidroxilasa de las regiones
dopaminérgicas (Vivó et al., 2002). Otra forma es mediante la medición de la
actividad de tirosinhidroxilasa (Gibson & Wurtman, 1977). También se puede
realizar mediante la medición neuroquímica, es decir, la determinación química
cuantitativa de los niveles de dopamina en un tejido cerebral específico por HPLC
con detector electroquímico (Schwarting & Huston, 1987; O´Kusky et al. 1991;
Ricker, 2002). En un individuo lesionado unilateralmente, la razón entre la
concentración de dopamina en el tejido del hemisferio intervenido respecto a la del
mismo tejido pero del hemisferio no intervenido permite establecer una medida del
grado de lesión.

En el caso de la medición neuroquímica, en el modelo que nos interesa, se puede
establecer para cada individuo, una aproximación del grado de lesión mediante la
depleción de dopamina en estriado dorsal del hemisferio lesionado respecto al
estriado dorsal del hemisferio intacto. El grado de lesión se puede expresar como
el porcentaje de disminución de dopamina en el estriado lesionado con relación al
estriado contralateral o no lesionado (Sindhu et al., 2005). El modelo que más se
aproxima a un estado avanzado de la situación patológica en el humano es aquel
en el que se logra lesionar más del 80% de las células dopaminérgicas de la pars
compacta y se denomina lesión severa (para una revisión ver Schwarting &
Huston, 1996a). Las lesiones severas o extensas, entre un 80% y un 95%, han
sido el foco de atención de la mayoría de las investigaciones (Schwarting &
Huston, 1996a; J ackson-Lewis & Liberatore, 2000; Díaz-Véliz et al., 2002), como
modelos de estados avanzados de la enfermedad. También han sido de interés
lesiones moderadas (entre un 20% y un 65%) como modelos de procesos de
regeneración y de etapas tempranas de la enfermedad (Hefti et al., 1980;
Fornaguera et al., 1993; Fornaguera & Schwarting, 1999; Saravanan et al., 2005).


28

Específicamente en el modelo con 6-OHDA, con lesiones extensas (más del 80%),
se ha logrado determinar que aproximadamente 24 horas después de la inyección
de la toxina, se pierde la señal dopaminérgica en estriado. Esta pérdida
dopaminérgica es total aproximadamente 3 a 4 días después de la inyección.
Además se reporta que este efecto neuroquímico se mantiene por mucho tiempo
en el individuo (se ha estudiado hasta por 50 días; para una revisión ver
Schwarting & Huston, 1996a).

Sin embargo la pérdida de la inervación dopaminérgica no es siempre total, pues
depende de factores propios de la cirugía: el sitio de aplicación, la dosis
administrada, el volumen de infusión (Fornaguera et al., 1993; Schwarting &
Huston, 1996a; Deumens et al., 2002); además de la variabilidad (e.g. anatómica)
propia de los animales.

La variabilidad del grado de lesión obtenido es crítica al trabajar con este tipo de
modelos para poder establecer comparaciones (Hefti et al., 1980; Fornaguera et
al., 1993; Fornaguera & Schwarting, 1999; Saravanan et al., 2005).

Del grado de lesión dependerá la ocurrencia de cambios a nivel neuronal, cambios
observables en la conducta y la generación de procesos de compensación. Por
ejemplo, si la lesión no es grande, las neuronas no lesionadas pueden aumentar
su actividad dopaminérgica por incremento de la síntesis de dopamina o por
disminución de su recaptura presináptica (para una revisión ver Schwarting &
Huston, 1996a). La mayor especificidad de la lesión se alcanza con: una dosis
adecuada, un volumen de inyección bajo y un buen sistema de inyección que
garantice la inyección exacta en la pars compacta. La especificidad en la lesión es
importante para garantizar que no se afecten otros sistemas de neurotransmisores
en el estriado como el noradrenérgico, y el serotoninérgico (para una revisión ver
Schwarting & Huston, 1996a). Una de las mediciones importantes para verificar

29

este hecho es la determinación neuroquímica de noradrenalina y de serotonina en
estriado.

En 1971, Ungerstedt describió que la denervación dopaminérgica en estriado con
6-OHDA, induce un incremento en la sensibilidad conductual inducida por
agonistas dopaminérgicos. Para explicar esta observación se propuso un
mecanismo de supersensibilidad de los receptores (Flórez, 2008), el cual se
observa aproximadamente a partir del día siete después del día de la lesión con 6-
OHDA. (para una revisión ver Schwarting & Huston, 1996a). El mecanismo exacto
de la supersensibilidad de receptores es desconocido (Harrison & LaHoste, 2006),
sin embargo se han reportado varios cambios bioquímicos y moleculares que se
presentan en las neuronas del estriado denervado, como el aumento entre un 25-
50% de la unión por los receptores D
2
, aumento de la unión de dopamina a
receptores de proteína G, activación de proteínas G, estimulación de
adenilatociclasa, cambios en la expresión génica de reguladores de proteínas G,
entre otros (para una revisión ver Harrison & LaHoste, 2006). En general han
propuesto como mecanismos principales la síntesis de más receptores D
2

postsinápticos o el aumento en la afinidad de los mismos receptores (Harrison &
LaHoste, 2006) que son evidentes a partir de la semana después de la inoculación
de la toxina y se ha determinado que la supersensibilidad tiende a persistir hasta
por 200 días (Determinado por la inducción del giro contralateral con apomorfina
(Ungersted, 1971). En el caso de los receptores tipo D
1
, se ha reportado que no
siempre presentan cambios consistentes en su afinidad. Sin embargo se ha
reportado un incremento de la actividad de segundos mensajeros ligada a
receptores D
1
. También este efecto requiere de días para poder ser observado
(Schwarting & Huston, 1996a; Harrison & LaHoste, 2006).



30

2.6 Efecto conductual en ratas, inducido por lesión de la SNpc con 6-OHDA
En las ratas, la función de los ganglios basales está relacionada con la conducta
motora y sensorial. De hecho una de las formas de evaluar el efecto de la lesión,
especialmente con 6-OHDA, es mediante la medición de la conducta motora y
sensorial de los sujetos de experimentación (Schwarting & Huston, 1996a;
Deumens et al., 2002; Fornaguera et al., 1993).

Los animales con lesión unilateral del sistema dopaminérgico nigro-estriatal
presentan ciertas asimetrías conductuales, además de una postura lateralizada
(para una revisión ver Schwarting & Huston, 1996a). Una de las conductas más
medidas es la de giro, cuya dirección, ipsi- o contralateral respecto al hemisferio
donde se realiza la lesión, es esencial para detectar el grado de lesión en el
individuo.

La conducta de giro, medida por lesión con 6-OHDA, es resumida con un
paradigma, propuesto inicialmente por Ungerstedt (1971), que propone:


“el animal lesionado unilateralmente gira hacia el lado de la
menor actividad dopaminérgica” (Ungerstedt, 1971)


Es decir, si se lesiona el hemisferio izquierdo, el giro espontáneo que presente el
animal, será en mayor medida hacia ese lado. Dicho el paradigma de otra
manera, el giro esperado en un animal lesionado es ipsilateral, es decir, hacia el
lado de la lesión.

La conducta de giro puede clasificarse en giros sobre su propio eje (“head to tail”),
o giros de translación (Schwarting & Huston, 1996a). Además se puede evaluar si
estos giros son parciales o totales (360°C). En un estudio detallado de esta

31

conducta, puede ser importante medir estas diferencias (Schwarting & Huston,
1996a).

La conducta de giro puede ser modificada por la administración de ciertos
fármacos. Si la actividad de estos es conocida, e.g. con actividad dopaminérgica
selectiva o no, se pueden establecer conclusiones respecto a los mecanismos
involucrados en los procesos de lesión o posteriores a la misma. De igual forma
este modelo puede emplearse para evaluar fármacos con actividad farmacológica
no conocida.

Uno de los fármacos que se han utilizado tradicionalmente en estos estudios es la
anfetamina. La anfetamina es un agonista dopaminérgico y noradrenérgico
indirecto (Flórez, 2008) ya que aumenta los niveles de dopamina en la brecha
sináptica mediante tres mecanismos: aumento de su liberación vesicular,
disminución de su recaptura presináptica y disminución de su degradación
enzimática (Flórez, 2008). En general la anfetamina incrementa entonces la
actividad locomotora del animal lesionado y del no lesionado. En un animal con
lesión severa y unilateral con 6-OHDA, la administración de anfetamina aumenta
la actividad locomotora del giro hacia el lado de la lesión (ipsiversiva). Esta
conducta se puede explicar basándose en el paradigma mencionado. El
hemisferio no lesionado presenta, en mayor medida, intactas sus neuronas
dopaminérgicas, las cuales son afectadas por la anfetamina. Entonces, la
actividad dopaminérgica es menor en el hemisferio lesionado y por lo tanto el giro
será ipsilateral. En el modelo con 6-OHDA, el efecto se observa
aproximadamente a los 10 minutos de la aplicación de la dosis con un máximo de
actividad locomotora a la hora (Schwarting & Huston, 1996a).

Otro fármaco que se ha estudiado es la apomorfina. La apomorfina es un
agonista dopaminérgico no selectivo (actividad D
1
y D
2
) sobre receptores
presinápticos y postsinápticos (Flórez, 2008). La ocurrencia, dirección y evolución

32

de la conducta de giro inducida por apomorfina, depende del grado de lesión,
ubicación de la lesión, la dosis de la droga y el tiempo transcurrido después de la
administración de la misma (para una revisión ver Schwarting & Huston, 1996a).
En animales con lesiones moderadas (<80%), no se induce asimetría del giro o se
presenta una asimetría ipsilateral moderada. En lesiones severas (entre el 80 y el
95%) el giro que se induce es contralateral a dosis de apomorfina mayores de 0,1
mg/kg. En animales con lesiones severas también se ha reportado un giro
ipsilateral; sin embargo la respuesta típica es el giro contralateral, aún a dosis
menores de 0,1 mg/kg (Schwarting & Huston, 1996a).

Este giro contralateral inducido por apomorfina, puede ser explicado por el mismo
paradigma citado. En el estriado del hemisferio lesionado se presentaría una
mayor estimulación de los receptores dopaminérgicos, debido al desarrollo de la
supersensibilidad por denervación de receptores descrito anteriormente. En los
animales poco lesionados con 6-OHDA, como el desarrollo de supersensibilidad
es menor o ninguno, la apomorfina no provoca cambios en la simetría de la
conducta de giro. En el caso de lesión con 6-OHDA, el efecto se observa en
minutos luego de la administración y cesa a los 45 minutos (Schwarting & Huston,
1996a).

Con la administración de agonistas dopaminérgicos selectivos en general, se
presenta inducción del giro contraversivo. La inducción del giro es menor con
agonistas D
1
y el desarrollo del efecto es más lento con los agonistas D
2
. Uno de
los principales fármacos en el tratamiento del Parkinson, la L-DOPA, induce
también una conducta contraversiva de giro similar a la explicada para la
apomorfina. De hecho cualquier droga que produzca un efecto similar al
observable con L-DOPA se dice que tiene actividad antiparkinsoniana (para una
revisión ver Schwarting & Huston, 1996a).


33

La destrucción unilateral del sistema dopaminérgico nigroestriatal produce también
una desensibilización contralateral respecto al hemisferio de la lesión (en inglés:
“sensory neglect”). Esta contralateralidad se puede explicar, por la decusación de
las proyecciones sensoriales que llegan hasta la corteza. La pérdida lateralizada
de la sensibilidad se puede medir mediante conductas como la peritaxis (en inglés
“scanning”) que fue establecida por Steiner et al., 1988. La conducta de peritaxis
se puede describir como el movimiento del animal dentro de un campo abierto con
las vibrisas en contacto con las paredes (Steiner et al., 1988). De igual forma, la
conducta de peritaxis puede medirse de forma espontánea o inducida
farmacológicamente con fármacos como la anfetamina y la apomorfina (para una
revisión Schwarting & Huston, 1996a).

La principal limitante que presenta el modelo de lesión unilateral con 6-OHDA es la
variabilidad en el grado de lesión que se logra, el cual, como se ha mencionado,
es crítico para el análisis e interpretación de los datos. Según indica Fornaguera,
se obtiene lesiones superiores al 80% en aproximadamente el 30% de los
animales intervenidos con ese fin. De ahí que surja la necesidad de encontrar
otras toxinas, que logren provocar lesiones, ya sea parciales o totales, con menor
variabilidad o más reproducibles.

En vista que el modelo de lesión unilateral de la pars compacta con algunas
toxinas como la 6-OHDA está bien descrito, esto lo convierte en una herramienta
muy útil para el estudio y comparación de otras toxinas. Un grupo de toxinas
interesantes de estudiar a nivel cerebral son las fosfolipasas A
2
y de interés
especial para este trabajo la miotoxina III de Bothrops asper (MT-III).

Por un lado el interés surge de estudios sobre la acción de fosfolipasas A
2

endógenas en cerebro en el desarrollo de enfermedades neurológicas como el
Parkinson (Farooqui et al., 1999; Hayakawa et al., 1998; Klivenyi et al., 1998; Ross
et al., 2001; Tariq et al., 2001; Mathinsen et al., 2007). Por otro lado surge de

34

estudios en cerebro, sobre neurotoxinas tipo fosfolipasas A
2
no endógenas
(Gandolfo et al., 1996; Dorandeu et al., 1998), incluyendo las miotoxinas de
Bothrops asper (estudios no publicados de Gutiérrez, J . M.) todos ellos por su
inyección en los ventrículos cerebrales. Además se ha propuesto que
mecanismos inflamatorios se encuentran relacionados en los procesos
neurodegenerativos en la enfermedad de Parkinson (Orr et al., 2002).

Se esperaría que la inyección de estas toxinas en los ventrículos cerebrales esté
representando su efecto farmacológico por su acción en numerosas regiones del
cerebro. Es de esperar que el estudio de la MT-III mediante el modelo en ratas de
lesión unilateral en sustancia nigra pars compacta, provoque efectos más
específicos en la caracterización farmacológica central de esta toxina.

Posteriormente se revisarán específicamente los hallazgos farmacológicos más
relevantes reportados para la MT-III, pero antes se explicará brevemente y en
general sobre las fosfolipasas A
2
.


2.7 Actividad fosfolipasa A
2

El proceso de degradación y reemplazo de los lípidos de la membrana celular es
continuo en la mayoría de las células. Para cada enlace hidrolizable de un
glicerofosfolípido hay una enzima hidrolítica específica en el lisosoma y en el
citoplasma (Nelson & Cox, 2000). Las fosfolipasas A
2
(PLA
2
) son enzimas
presentes en el desarrollo de muchos procesos celulares. El mecanismo de
acción de las PLA
2
, consiste en la desesterificación, en el carbono dos, de
glicerofosfolípidos de membrana. Esta acción requiere de iones Ca
+2
. La
desesterificación produce un ácido graso y un lisofosfolípido (Dennis, 2000).


35

Las PLA
2
se encuentran muy distribuidas en la naturaleza, por ejemplo: en
venenos de serpientes, escorpiones, abejas y células de mamíferos como: las
pancreáticas y plaquetas. A las PLA
2
que se encuentran en los venenos de
serpientes se les han descrito varias actividades fisiopatológicas como
miotoxicidad (Gutiérrez & Lomonte, 1995; Bultrón et al, 1993a), neurotoxicidad
(Lambeau et al., 1989), cardiotoxicidad y coagulopatías (Gutiérrez, 2002).
También las PLA
2
tienen funciones fisiológicas importantes como en la regulación
de segundos mensajeros (Flórez, 2008).

Las PLA
2
de venenos de serpientes se clasifican en dos grupos principales: tipo I y
tipo II, basados en el patrón de enlaces disulfuro. Las fosfolipasas tipo I se
caracterizan por presentar un puente disulfuro entre los aminoácidos de las
posiciones 11 y 69, y se encuentran en los venenos de las serpientes de las
familias Elapidae e Hydrophiidae, además de en las secreciones pancreáticas.
Las fosfolipasas tipo II se caracterizan por presentar una extensión en el residuo
C-terminal que forma una cistina con el aminoácido de la posición 50, y se
encuentran en los venenos de las serpientes de la familia Viperidae, en plaquetas
de mamíferos, hígado y bazo (Ogawa et al., 1995).

Si bien el origen de las PLA
2
puede ser diferente, sus estructuras: su secuencia de
aminoácidos y estructuras obtenidas por rayos X son muy similares (Ogawa et al.,
1995).

Parte del interés por estudiar las fosfolipasas A
2
, deriva de la descripción de sitios
de unión de membrana para un gran número de PLA
2
secretorias de diferentes
orígenes (Lambeau et al., 1990). La primera descripción de estos sitios de unión
fue mediante estudios con la -bungarotoxina, una neurotoxina de serpiente, en
sinaptosomas de tejido cerebral de pollo (Rehm & Betz, 1982). Según estos
autores, la citotoxicidad selectiva de la -bungarotoxina en las neuronas
estudiadas no puede ser explicada únicamente por su actividad fosfolipasa A
2
,

36

pues no se ha encontrado una correlación entre la actividad neurotóxica
presináptica (evaluada en neuronas periféricas, en la placa motora, se explica
adelante) y la actividad PLA
2
entre ésta y otras toxinas neurotóxicas.

Se ha descrito la existencia de dos tipos principales de estos sitios de unión de
membrana: tipo N (de neural) y tipo M (de muscular) (Lambeau & Lazdunski,
1999). Específicamente en membranas sinápticas (sinaptosomas) de neuronas
cerebrales de rata, Lambeau et al. (1989), describieron por primera vez la
existencia de sitios de unión tipo N y específicamente encontraron dos subtipos.
Este estudio se realizó con la neurotoxina OS
2
extraída del veneno de Oxyuranus
scutellatus (conocida como serpiente taipan) y los dos sitios de unión se
diferenciaron por su afinidad. Los sitios de unión “tipo M”, fueron descritos por
primera vez en células musculares de conejo (Lambeau et al., 1990). En este
estudio se emplearon como ligandos las neurotoxinas OS
1
y OS
2
, extraídas del
veneno de Oxyuranus scutellatus. Estos autores, describen que los sitios de unión
tipo M son farmacológica y estructuralmente diferentes a los encontrados en las
membranas neuronales. Los receptores tipo M son proteínas de 180 kDa y los
receptores tipo N, ampliamente expresados en cerebro son proteínas de 36 - 51 y
de 85 kDa (Nicolas et al., 1997). Como hipótesis sobre su estructura, se ha
postulado que deben pertenecer a la superfamilia de lectinas tipo C (Lambeau &
Lazdunski, 1999). Las lectinas son proteínas que presentan un dominio de
reconocimiento de carbohidratos en su estructura (Drickamer & Taylor, 1993).

Los sitios de unión tipo N son abundantes en tejido cerebral (1 a 3 pmol∙mg
-1
) en
comparación con otros tejidos de rata (Lambeau & Lazdunski, 1999). Se han
encontrado sitios de unión tipo N para PLA
2
secretorias en otros tejidos de rata
como cardiaco, músculo esquelético, riñón, pulmones, hígado, páncreas y
músculo liso (Lambeau et al., 1991; Nicolas et al., 1997).


37

Lambeau et al. (1991) y Nicolas et al. (1997) han encontrado que, entre las toxinas
estudiadas, los receptores tipo N ligan PLA
2
secretorias neurotóxicas y no ligan las
no neurotóxicas.

El descubrimiento de propiedades miotóxicas de las PLA
2
secretorias extraídas del
veneno de Bothrops asper, no neurotóxicas e inactivas en el sitio catalítico PLA
2

(Gutiérrez y Lomonte, 1995), han permitido proponer que también estas
miotoxinas pueden deber su efecto a un mecanismo diferente (Bultrón et al.,
1993a) quizás mediado por sitios de unión tipo M.

La función biológica normal de los sitios de unión tipo N y M es desconocida
(Nicolas et al., 1997), así también se desconoce sus ligandos endógenos
(Lambeau & Lazdunski, 1999). Estos autores sugieren que el papel de estos
receptores es el de dirigirlas a objetivos celulares específicos y participar en su
mecanismo de acción. El descubrimiento de que algunas fosfolipasas endógenas
de mamíferos también se ligan a estos receptores, ha sugerido una nueva función
fisiológica de las PLA
2
independiente de su función enzimática catalítica que les
da su nombre (Arita et al., 1991).


2.8 Efecto farmacológico de la miotoxina III de Bothrops asper
En América Latina, la mayoría de las mordeduras de serpientes son provocadas
por especies del género Bothrops con la generación de mionecrosis local. Este
hecho ha aumentado el interés de investigar, desde la década de los 80, la
composición de los venenos de las serpientes de este género. En especial ha
sido de interés la investigación de uno de sus componentes mayoritarios: las
miotoxinas. La primera miotoxina de venenos de serpientes del género Bothrops
(MT-I) fue purificada en 1984, a partir del veneno de Bothrops asper (Gutiérrez et
al., 1984). Las miotoxinas conforman cerca del 15 al 25% de la composición de

38

este veneno (Gutiérrez & Lomonte, 1995). Específicamente el interés se ha
centrado sobre su mecanismo de acción miotóxico, la patogénesis de la
mionecrosis, así como en la generación de antídotos (Gutiérrez et al., 1986;
Gutiérrez & Lomonte, 1989; Gutiérrez, 2002).

Se ha determinado que todas las miotoxinas de Bothrops asper son proteínas
básicas, de 10 a 15 kDa de tamaño, con estructura tridimensional de fosfolipasa
A
2
(Gutiérrez & Lomonte, 1995). Algunas de ellas carecen de la expresión de la
actividad PLA
2
(Lomonte & Gutiérrez, 1989; Díaz et al., 1995), lo que parece
deberse a la substitución de aminoácidos en un asa donde ligan iones Ca
+2
. Sin
embargo también son capaces de inducir necrosis muscular (Gutiérrez & Lomonte,
1995). Hasta la fecha, se han logrado aislar y caracterizar un total de cuatro
isoformas de éstas, llamadas: MT-I, MT-II, MT-III y MT-IV. De éstas, únicamente
la MT-II y la MT-IV carecen de actividad PLA
2
(Gutiérrez & Lomonte, 1995).

Específicamente, la miotoxina MT-III, ha sido caracterizada estructuralmente como
una fosfolipasa A
2
de la clase II; muy básica; de 13,9 kDa y con propiedad
anticoagulante, miotóxica e inflamatoria (Kaiser et al., 1990). Los hallazgos más
relevantes respecto a su mecanismo de acción se describen a continuación.

Mediante el estudio con modelos de liposomas, se ha logrado determinar que la
MT-III rompe vesículas multilamelares y unilamelares, cargadas negativamente
(Bultrón et al., 1993a). Esto sugiere la participación de aminoácidos básicos en el
mecanismo de ruptura de la membrana, posiblemente en el paso de unión con la
membrana.

La acción miotóxica de la MT-III ha sido evaluada en miocitos en condiciones que
inhiben su actividad PLA
2
como la disminución de la temperatura a 4 °C, el
secuestro de iones Ca
+2
(Bultrón et al., 1993a) y la alquilación del sitio catalítico
PLA
2
(Bultrón et al., 1993b). Estas condiciones disminuyen su actividad miotóxica;

39

pero no logran inhibirla completamente. Con las toxinas sin actividad PLA
2
,
igualmente el secuestro de calcio no afecta la liberación de creatina kinasa, lo que
ha apoyado la teoría de la existencia de un mecanismo adicional, no enzimático
para su actividad miotóxica. Se ha propuesto que la actividad de ruptura de la
membrana celular se da por dos mecanismos independientes (Bultrón et al.,
1993a; Gutiérrez & Lomonte, 1995), uno de ellos diferente a la actividad PLA
2
.

Se ha medido la actividad de estas miotoxinas sobre diferentes tipos de células
animales (células ováricas de hamster, fibroblastos pulmonares humanos, células
tumorales adrenales de ratón y células epiteliales de intestino de rata) y no
solamente en miocitos (Bultrón et al., 1993b). Contrario a los hallazgos
supracitados, la actividad citotóxica medida a la MT-III es mayor cuando las
células son incubadas en ausencia de calcio, disminuyendo cuando se agrega
calcio. De estos hallazgos se concluye que el calcio protege las células de la
acción de agentes citolíticos. Igualmente la citotoxicidad disminuye a 4°C (Bultrón
et al., 1993b).

La acción de la MT-III, también se ha probado sobre eritrocitos de varias especies
de animales (humanos, ratón, conejo y oveja). Entre todos los tipos de células
animales probadas, los eritrocitos han sido las únicas células que son resistentes
al daño en su membrana (Bultrón et al., 1993a y 1993b).

Según la clasificación estándar por actividad toxicológica para las toxinas de
venenos de serpientes (Klaassen, 2001), la MT-III es clasificada como una enzima
de baja toxicidad o no neurotóxica (LD
50
> 1 mg/kg). Esto último se ha
determinado indirectamente de la siguiente manera: en experimentos de letalidad
de esta toxina por vía intravenosa, se ha determinado que los tiempos de muerte
son largos y las dosis letales altas (LD
50
de aprox. 8 mg/kg, en ratón). Las toxinas
de venenos de serpientes que se clasifican como toxinas de acción presináptica
(toxinas neurotóxicas), presentan LD
50
inferiores a 0,1 mg/kg y la muerte ocurre

40

rápidamente (en pocos minutos) por lesión de la membrana presináptica de las
neuronas motoras que inervan el diafragma lo que provoca paro respiratorio
(Klaassen, 2001). A diferencia de muchas fosfolipasas básicas extraídas de
venenos de serpientes, las PLA
2
de Bothrops asper, no presentan neurotoxicidad
presináptica, de ahí que se les clasifique como no neurotóxicas. Específicamente,
la MT-III, es la primera miotoxina tipo fosfolipasa que es secuenciada y que carece
de tal neurotoxicidad (Kaiser et al., 1990).

La presente investigación pretende completar el perfil farmacológico de la MT-III,
estudiando su efecto en neuronas centrales, tomando como base el modelo de la
lesión unilateral de la pars compacta de la sustancia nigra, en ratas adultas, para
la enfermedad de Parkinson mediante la inyección estereotáxica de la toxina
(Schwarting & Huston, 1996a). Este modelo se encuentra ampliamente
caracterizado principalmente con la toxina 6-OHDA a nivel conductual,
farmacológico y neuroquímico.

La investigación está dividida en tres etapas. En la primera se evalúa el efecto de
diferentes dosis de la miotoxina III (0,14; 1,4; y 14 g) con el objetivo de
seleccionar la dosis de trabajo para los experimentos posteriores. En la segunda
etapa se evalúa la progresión de la lesión celular en el tiempo, a dosis constante
(14 g). Por último, en la tercera etapa se analiza el papel que juega la actividad
catalítica PLA
2
en la neurotoxicidad y su relación con la conducta, mediante la
eliminación de dicha actividad por alquilación de la enzima a dosis constante
(1,4 g).


41

CAPÍTULO III
3. MATERIALES Y MÉTODOS

3.1 Equipos instrumentales y materiales.
 Balanza analítica OHAUS

modelo E12140
 Balanza granataria, OHAUS

triple beam 700-800 series
 Bomba de microinyección CMA / microdiálisis CMA100. La bomba permite
fijar una velocidad de inyección de 0,5 l / min., con cánula de 3 cm de
longitud y calibre 28.
 Cajas de acero inoxidable para 1 animal (base 25 * 20 cm, altura 20 cm)
 Cajas estándar de policarbonato para 4 a 6 animales (tapa 26,5 x 42 cm,
base 22 * 37,5 cm, altura 18 cm) Alphete, Alemania
 Cámaras digitales de video, VITEK

color minicamera, modelo No VTC-
C64P (3.7)
 Centrífuga con refrigeración MICROMAX

RF modelo 120, Termo IEC
 Cromatógrafo líquido Agilent

1100, con bomba cuaternaria, y detector UV
de longitud de onda fija. (cromatógrafo empleado para la purificación de la
miotoxina)
 Cromatógrafo líquido: bomba de un canal (Waters

515) y detector
electroquímico de pulso (Waters

464) con un sistema de tres electrodos:
un electrodo de trabajo de carbón vidriado, un electrodo de referencia de
Ag/AgCl y un contraelectrodo o electrodo auxiliar de platino (cromatógrafo
empleado para la cuantificación de los neurotransmisores)
 Desmembrador ultrasónico modelo F60, Fisher Scientific
 Espectrofotómetro UV, Shimadzu

UV-160
 Guillotina para animales pequeños con una abertura de 4 cm
 Micrótomo LEICA CM3050S con criostato

42

 pH metro, Corning

Rinnade 530 con electrodo Corning “3 in 1” Combo
W/RJ Cat No. 476436
 Rasuradora WAHL

ALL-PRO ajustable
 Taladro de puño BREMEL

, MultiPro
TM
, de 30000 RPM, modelo 275, tipo 5,
con broca de 2 mm de diámetro
 Televisor Panasonic

, modelo: TC-20B12, No. Serie: B2I02296
 Torre estereotáxica para animales pequeños (ratas y ratones) David Kof

.
 Viales can tapa de HDPE, Eppendorf

de centrífuga con capacidad de 1,5
mL.
 Video grabadora VHS Panasonic

, modelo: PV-V4524S, No. Serie:
C4ID26632


3.2 Reactivos y estándares analíticos
 acetonitrilo, grado HPLC
 ácido clorhídrico concentrado, grado reactivo
 ácido 3,4-dihidroxifenilacético, DOPAC (C
8
H
8
O
4
) , Sigma

, lote 12K2607
 ácido 5-hidroxi 3-indolacético, 5-HIAA (C
10
H
9
O
3
N), Sigma

, lote 52K1301
 ácido 3-metoxi-4-hidroxifenilacético, ácido homovanílico, HVA (C
9
H
10
O
4
),
Sigma

, lote 32K5018
 ácido perclórico (HClO
4
), grado reactivo, 70% , Aldrich

, lote 10266EA
 agua desionizada MilliQ

, tipo 1
 agua destilada
 3-aminopropiltrietoxisilano 98%, lote 127H1073, Sigma
®

 bicarbonato de sodio grado reactivo
 bromohidrato de 3,4-dihidroxibenzilamina, DHBA (C
7
H
9
O
2
N.HBr), Aldrich

,
Lot 85,878-1
 clorhidrato de apomorfina (C
17
H
17
O
2
N.HCl) Sigma

, lote 41K1512

43

 clorhidrato de ketamina (C
13
H
16
ONCl.HCl), disolución 10 mg/mL
Pharmacare LTD, lote 16351
 clorhidrato de norepinefrina, NE (C
8
H
11
O
3
N.HCl), Sigma

, lote 58H0922
 cloruro de sodio, grado reactivo, Merck

5271051
 “cresyl fast violet”
 dopamina, DA, Sigma

, lote 12K1175
 eosina Y, Fisher Lote 914735A 88%
 etanol de diferentes grados: 70%, 95% y absoluto.
 etiléndiamino tetraacetato de disodio, dihidratado, grado reactivo, Sigma


Lote 30H0634
 formaldehido 37%, grado reactivo
 fosfato ácido de sodio, dihidratado, grado reactivo
 fosfato diácido de potasio, grado reactivo, Sigma
,
lote 064K0045
 fosfato diácido de sodio, mono hidratado, grado reactivo
 hematoxilina (negro natural I) Mallinckrodt E106KASG
 “luxol fast blue”
 medio de montaje, Thermo Electro Corporation, Shandon Xylene Substitute
Mountant methacrylate polymer 36%, lote 54018
 metanol, grado HPLC
 octilsulfonato de sodio (C
8
H
17
O
3
SNa), grado reactivo, Merck Lichropur

K26281707 922
 sacarosa, grado reactivo
 serotonina (5-hidroxitriptamina), 5-HT, Sigma

lote 121K7059
 d-l sulfato de anfetamina (C
9
H
13
N), Sigma

, lote 45H0400
 xilazina clorhidrato (C
12
H
16
N
2
S.HCl), Sigma

, X-1251
 xilenos J T Baker, grado histológico, lote E25B31



44

3.3 Descripción general de la investigación
La investigación está dividida en tres etapas o experimentos. En el primero se
evaluó el efecto (conductual y neuroquímico) de tres diferentes dosis de la
miotoxina III (0,14; 1,4; y 14 g) comparándolas con un grupo control, con el
objetivo de seleccionar la dosis de trabajo para los experimentos posteriores. En
el segundo se evaluó mediante análisis neuroquímicos la progresión de la lesión
celular en el tiempo (entre 15 y 360 min), a dosis constante (14 g). Por último, en
la tercera etapa se comparó el efecto conductual y neuroquímico de la actividad
catalítica PLA
2
de la miotoxina III contra la acción de ella misma pero con la
eliminación completa de dicha actividad por alquilación, también a dosis constante
(1,4 g).


3.4 Aislamiento y purificación de la miotoxina III
El aislamiento y purificación de la miotoxina III fue realizada por investigadores del
Instituto Clodomiro Picado (I.C.P.), como colaboración. En dicho Instituto se sigue
una modificación del método original reportado por Gutiérrez et al. (1984) basado
en una cromatografía de intercambio iónico en una columna de CM-Sephadex y
empleando un gradiente de KCl (Kaiser et al., 1990). Se realizó una purificación
adicional de la miotoxina III por cromatografía líquida de alta presión (HPLC)
semipreparativa. La fracción de interés que se colectó fue la que corresponde al
segundo pico cromatográfico (ver Figura 6), el cual presenta un tiempo de
retención de aproximadamente 19 min.

Las condiciones cromatográficas para esta purificación adicional son las
siguientes: columna octadecilsilano (C
8
) semipreparativa de 10 mm de ancho por
250 mm de largo; detector UV de longitud de onda fija a 280 nm, fase móvil en

45

gradiente de 100% de una disolución A (acetonitrilo 5%) hasta: 30% de A y 70%
de una disolución B (acetonitrilo 95%), en un período de 20 min. El flujo de la
corrida es de 2 mL / min. La fracción del eluído de interés se deseca en un
sistema de centrifugación al vacío.



Figura 6: Cromatograma por HPLC/UV a 280 nm de la purificación adicional de la miotoxina III.
El tercer pico cromatográfico (tr de aprox. 19 min) corresponde a la fracción de interés que se
colecta, la cual se identifica como MT-III.


Para la cuantificación de la Miotoxina MT-III, se empleó el principio de la ley de
Beer por espectrofotometría UV a 280 nm en PBS. Los valores de coeficiente de
extinción: 20170 cm
-1
M
-1
y masa molar: 13984 g mol
-1
fueron calculados según el
software: “Peptide Property Calculator, versión 1.00” de Adam Chazan, del Centro
de Biotecnología de la Universidad Noroccidental en Evanston, Illinois, disponible
vía Internet en el sitio: http://www.basic.nwu.edu/biotools/ProteinCalc.html, a partir
de la secuencia de aminoácidos para la MT-III reportada por Kaiser et al. (1990):

t / min
Señal
/muA

46

“SLIEFAKMILEETKRLPFPYYTTYGCYCGWGGQGQPKDATDRCCFVHDCCYGKLSNCK
PKTDRYSYSRKSGVIICGEGTPCEKQICECDKAAAVCFRENLRTYKKRYMAYPDLLCKK
PAEKC”

Se prepararon tres disoluciones de MT-III en solución salina en
concentraciones de 0,14; 1,4 y 14 g/L, que son las disoluciones que se van a
probar para la inyección en sustancia nigra compacta.


3.5 Modificación (alquilación) de la miotoxina III
La inhibición de la actividad fosfolipasa A
2
, se realizó mediante la alquilación de la
histidina 48 de la secuencia de la toxina MT-III, que se ubica en el sitio catalítico.
Para esto se siguió una modificación del método reportado por Bultrón et al.
(1993b). En resumen, se disuelven 3 mg de MT-III (0,2 mol) en 2 mL de una
disolución 0,1 M de Tris-HCl (pH 8,0) con 0,7 mM EDTA. A la mezcla anterior se
le agrega 0,2 mL de una disolución de bromuro de p-bromofenacilo (p-BPB) 0,8
mg / mL (0,6 mol) en etanol al 99%. La mezcla se incuba por aproximadamente
24 horas a temperatura ambiente. El exceso de p-BPB que no reaccionó se
removió pasando la mezcla por una membrana para ultrafiltración de 3 kDa de
porosidad, en una centrífuga a 14000 rpm por 30 min.

El grado de inhibición de la actividad enzimática se verificó por investigadores del
I.C.P. empleando fosfolípidos de yema de huevo como sustrato. Para esto, la
yema de huevo (1 mL) se diluyó a una razón de 1:5 con un amortiguador de pH
8,5 compuesto por Tris 0,1 M y CaCl
2
10 mM, en presencia de Tritón X-100 al 1 %.
La mezcla se incubó por 20 minutos a 37°C. Después de la incubación, los ácidos
grasos libres se extrajeron y se valoraron de acuerdo con el método reportado por
Dole (1956).


47

A partir de la valoración anterior se determinó que la miotoxina alquilada no
presenta actividad enzimática. La miotoxina alquilada se prepara en una
disolución a una concentración de 1,4 g/L en solución salina. Esta es la misma
dosis de la miotoxina sin alquilar que se empleó en el tercer experimento en el que
se compara el efecto de la toxina sin alquilar y alquilada.


3.6 Sujetos de análisis
El modelo animal para esta investigación se basó en el modelo de lesión unilateral
de sustancia nigra pars compacta en ratas adultas, mediante la inyección
estereotáxica de una toxina (Schwarting & Huston, 1996a).

En total para los tres experimentos se utilizaron 72 ratas macho de la cepa
Sprague-Dawley, obtenidas en el bioterio de la Universidad de Costa Rica
(Laboratorio de Ensayos Biológicos, LEBi). Los pesos de los animales al inicio de
cada experimento son los siguientes: experimento uno: 218 a 253; experimento
dos: 261 a 331 g y experimento tres: 176 a 354 g. Los animales se mantuvieron
en un ciclo luz-oscuridad de doce horas. Los ciclos de oscuridad fueron a partir de
las 12:00 horas en los experimentos uno y dos y a partir de las 06:00 horas en el
experimento tres. La medición conductual se realizó siempre dentro del período
de oscuridad, es decir, en su fase de mayor actividad.

Los animales fueron mantenidos ad libitum para el agua y el alimento durante todo
el experimento en grupos de no más de 4 animales por jaula.

Todos los experimentos realizados con los animales contaron con los permisos
respectivos (ver Anexo II) y siguieron los lineamientos del Comité Interinstitucional
para el Cuidado y Uso de los Animales (C.I.C.U.A.) y de la legislación vigente: ley
7451: “Bienestar de los animales” de 1994, la Guía para el Manejo de Animales de

48

Laboratorio, del Ministerio de Ciencia y Tecnología de 1996 y el decreto No. 26668
del MICIT de 1997.


3.7 Neurocirugía e inyección intra pars compacta
Previo a la cirugía, cada animal fue anestesiado por vía intraperitoneal con una
solución mixta de: ketamina (dosis: 60 mg / kg) y xilazina (dosis: 7,5 mg / kg) en un
volumen no mayor de 1,5 mL. La inducción de la anestesia se verificó por
observación de los reflejos generados por tacto en los párpados, presión en la cola
y presión en una de las patas traseras estando ambas patas traseras extendidas.
Durante la cirugía, los ojos de cada animal se mantuvieron húmedos utilizando
una solución de NaCl 0,09%.

Una vez anestesiado, cada animal se inmovilizó en la torre estereotáxica fijándolo
en tres puntos: los dos canales auditivos y la cara posterior de los incisivos (ver
Anexo III). Se procedió a rasurar a contra pelo la región de la cabeza con el fin de
facilitar la disección. Durante el rasurado, se evitó cortar las vibrisas, pues su
integridad es indispensable para no alterar la condición sensorial del animal que
se medirá posteriormente. Con el bisturí, se procedió a hacer un corte antero -
posterior desde la línea media de las orejas hacia la línea media de los ojos. El
cráneo es limpiado con la ayuda de aplicadores impregnados con agua oxigenada
hasta la visualización de las suturas craneales que se utilizaron como líneas de
referencia (específicamente el punto Bregma) para la ubicación estereotáxica de la
zona que se desea lesionar, en este caso la sustancia nigra pars compacta (ver
Anexo III).

Con la ayuda de la torre estereotáxica y de los mapas estereotáxicos de Paxinos &
Watson (1998) se localizaron las coordenadas de la pars compacta de la sustancia

49

nigra pars compacta (Ver anexo IV). Las coordenadas empleadas, a partir, del
punto Bregma son:

 antero-posterior: - 5,3 mm
 lateral: +/- 2,0 mm
 dorso-ventral: - 8,0 mm.

La inoculación realizada fue unilateral, es decir en solo un hemisferio. El 50% de
los animales intervenidos fue en el hemisferio derecho y el otro 50% en el
izquierdo.

Con el taladro se realizó un orificio en el cráneo. Se succiona, dentro de la cánula,
aproximadamente 2 L de la disolución a inocular o inyectar. Se introduce
lentamente la cánula en el cerebro hasta la coordenada dorso-ventral indicada
anteriormente y con la ayuda de la bomba de inyección automática se inocula 1 L
de la disolución correspondiente, a una velocidad de inyección de 0,5 l / min.
Una vez finalizada la inyección, se deja la cánula aproximadamente 3 min en el
sitio de inoculación para favorecer la difusión lenta de la disolución inyectada y
disminuir su difusión a otras regiones cercanas. Posteriormente se retira la cánula
lentamente.

La rata se desmonta de la torre estereotáxica, la herida se desinfecta con agua
oxigenada y se cierra con una grapa quirúrgica. La rata se deja recuperar de la
anestesia en una jaula individual con monitoreo esporádico. Los animales
permanecieron alojados individualmente, hasta la recuperación de la anestesia,
momento en el que se reubicaron en las jaulas de cuatro animales como se
encontraban antes de la lesión y como se mantuvieron durante el resto del
experimento.



50

3.8 Medición de la conducta
Para la medición de la conducta, cada animal se colocó individualmente en un
campo abierto de 60 x 60 x 40cm y se filmó con una cámara colocada arriba y en
el centro del campo abierto durante 20 minutos. Los videos se grabaron en un
video cassette (VHS) para el experimento uno y digitalmente en la computadora
para el experimento tres. Lo anterior para cada uno de los días especificados en
el Cuadro I. El campo abierto se encuentra en una habitación sonoamortiguada y
bajo luz de neón cubierta con papel celofán rojo oscuro para disminuir la
intensidad de la misma.

Cuadro I: Calendario de cada una de las actividades que se realizaron con los animales.
Cada recuadro representa un día. El número en la esquina superior izquierda de cada recuadro
corresponde al número de día posterior al día de la cirugía, y el número cero corresponde al día de
la cirugía. Cada recuadro indica la actividad que se realizó el día respectivo.

0
cirugía

1
conducta
espontánea

2
-------

3
conducta
espontánea

4
-------

5
conducta
espontánea

6
-------

7
conducta
espontánea

8
-------

9
-------

10
-------

11
-------

12
conducta
espontánea

13
------

14
-------

15
conducta
espontánea

16
-------

17
-------

18
conducta
espontánea

19
------

20
conducta
inducida por
apomorfina
21
-------

22
conducta
inducida por
anfetamina
23 ó 24
sacrificio



Según se indica en el Cuadro I, los días 1, 3, 5, 7, 12, 15 y 18 después de la lesión
se midió la conducta espontánea, es decir, sin ningún tratamiento farmacológico.
Se midió la conducta inducida farmacológicamente los días 20 y 22
postoperatorios. El día 20 postoperatorio, 20 minutos antes de la medición
conductual, a cada animal se le administró apomorfina a una dosis de 0,50 mg / kg
de peso corporal, por vía subcutánea. El día 22 postoperatorio, también 20 min

51

antes de la medición conductual, a cada animal se le administró anfetamina a una
dosis de 1,0 mg/kg de peso, por vía intraperitoneal. El volumen máximo de
vehículo (solución salina) para la dilución de la dosis, en ambos fármacos, fue de
0,25 mL por animal. Veinte minutos después de la administración del fármaco
respectivo, individualmente cada animal se colocó dentro del campo abierto y se
filmó durante 20 minutos adicionales en los días respectivos.

El análisis de las conductas fue realizado visualmente a partir de las grabaciones
en video cinta. Para la cuantificación de los datos del experimento uno se utilizó el
software “NAD3” desarrollado por el Instituto de Psicología Fisiológica de la
Universidad de Düsseldorf, Alemania. Para la cuantificación de los datos del
experimento tres se utilizó el software EthoLog, versión 2.2.5, E.B. Ottoni 1995 -
1999, elaborado en el Laboratorio de Psicología y Etología del Departamento de
Psicología Experimental de la Universidad de Sao Paulo, Brasil.

Las conductas analizadas son las siguientes:

a) Conducta de giro (“turning” en inglés):

Se contaron la cantidad de giros corporales de 90° que realizó cada animal
hacia el lado ipsilateral y hacia el lado contralateral. Los giros ipsilaterales
son los que realiza el animal hacia el lado de la lesión y los contralaterales
hacia el lado intacto.

Las variables analizadas para contrastar la conducta de giro son:

 Giros netos: que corresponden a la diferencia entre los giros
ipsilaterales totales y los giros contralaterales totales, durante 20 min
por día. De esta forma, los valores positivos del giro neto indican que
el animal gira mayormente hacia el lado ipsilateral (asimetría

52

ipsilateral); un giro neto negativo significa que el animal lo hace
mayormente hacia el lado intacto (asimetría contralateral). Un giro de
cero indica que el giro es simétrico.

 “IA (giro)”, Índice de asimetría para la conducta de giro para una rata
(Fornaguera et al., 1993), que se describe en la figura 7.

(G ipsi)
(G total)

Figura 7: Fórmula para el cálculo del índice de asimetría a partir de la conducta
de giro para un animal i. G ipsi = número total de giros ipsilaterales y G total =
número de giros totales (giros ipsi + giros contralaterales).

Un índice de asimetría de 50 indica que el animal presenta simetría en
la conducta. Valores mayores de 50 indican una asimetría ipsilateral y
valores menores de 50 indican una asimetría contralateral de la
conducta.

 Giro total: que corresponden a la suma entre los giros ipsilaterales
totales y los giros contralaterales totales, durante 20 min por día.
Esta variable es una medida de la realización general de esta
conducta

b) Conducta de peritaxis (“scanning” en inglés):

La conducta de peritaxis corresponde al movimiento del animal a lo largo
del campo abierto, con las vibrisas de un lado en contacto con las paredes
del campo abierto. En lugar de visualizar las vibrisas en el televisor, se
tomó como conducta de peritaxis, cuando el hocico del animal, distaba
aproximadamente 5 cm de una de las paredes del campo abierto.

x 100 IA (giro) =

53

Las variables analizadas para contrastar la conducta de peritaxis son:

 El tiempo neto en peritaxis durante 20 min por día (en segundos).
Esta variable corresponde a la diferencia entre el tiempo total en
peritaxis ipsilateral y el tiempo total en peritaxis contralateral. De esta
forma, los valores positivos de esta variable indican que el animal
presenta asimetría ipsilateral y un valor neto negativo significa que la
asimetría es contralateral. Un tiempo neto de peritaxis de cero indica
que la conducta de peritaxis es simétrica.

 “IA (peritaxis, i)”, Índice de asimetría para la conducta de tiempo en
peritaxis para una rata i, que se calcula con una ecuación similar a la
que se describe en la figura 7; pero con los datos de tiempo de
peritaxis ipsilateral y de tiempo de peritaxis total (ipsi +contra).

 Tiempo total en peritaxis: que corresponden a la suma entre el tiempo
en peritaxis ipsilateral total y el tiempo en peritaxis contralateral total,
durante 20 min por día. Esta variable es una medida de la realización
general de esta conducta.


c) Conducta de locomoción (“locomotion” en inglés):

Para medir esta conducta, se dividió virtualmente el campo abierto de (60 x
60 cm) en cuatro partes iguales (cuadrantes) mediante dos líneas
perpendiculares entre sí y perpendiculares al centro de cada uno de los
lados (paredes) del campo abierto. La variable analizada para contrastar
la conducta de locomoción es el número total de cruces correspondiente al
número total de veces que el animal cruza con las cuatro patas de un
cuadrante a otro, durante 20 min por día.

54



d) Conducta de exploración (“rearing” en inglés):

Se consideró que el animal realiza conducta de exploración cuando el
mismo se levanta sobre sus dos patas traseras dejando libres las
delanteras. Esta conducta se midió mediante el tiempo total en segundos
que el animal realiza la conducta de exploración durante los 20 min por día.


e) Conducta de limpieza o acicalamiento (“grooming” en inglés):

Se consideró que el animal realiza conducta de acicalamiento cuando el
mismo se limpia (con la boca y con las manos) el cuerpo. Se incluyó sin
establecer diferencias todos los comportamientos que el animal realiza
para dicho fin: limpieza facial, genital y secuencial. Esta conducta se midió
mediante el tiempo total en segundos que el animal realiza la conducta de
limpieza durante los 20 min por día.


3.9 Sacrificio de los animales
El sacrificio se realizó mediante decapitación y se llevó a cabo entre los días 23 y
24 postoperatorios para los animales de los experimentos uno y tres. En el caso
del experimento dos, el sacrificio fue el mismo día de la cirugía; 15, 60, 180 y 360
minutos después de la inyección de toxina o solución salina.



55

3.10 Disección de los tejidos cerebrales
El cerebro se extrajo y se sumergió brevemente en una disolución salina
fisiológica (NaCl 0,9%) mantenida en un baño de agua con hielo con el fin de
limpiar la sangre del cerebro y a su vez endurecer un poco para facilitar la
disección de las regiones a estudiar.


Figura 8: Diagrama de una vista ventral de un cerebro de rata que muestra las líneas de corte para
la disección de los tejidos que se emplearon para los estudios neuroquímicos e histológicos.
En el diagrama se indican, con líneas de puntos en azul, los dos cortes que se deben realizar para la
disección de las regiones cerebrales escogidas para el análisis neuroquímico y para el análisis
histológico. Modificado de tesis de Fornaguera, J. (1994).

Se coloca cada cerebro con la cara ventral hacia arriba, y se realizan los dos
cortes que se indican en la Figura 8 mediante las líneas azules de puntos. El
fragmento posterior (a la derecha de la zona gris) se deposita en un tubo que
contiene aprox. 20 mL de una disolución de compuesta por: 100 mL de
formaldehido; 100 g de sacarosa; 4 g de NaH
2
PO
4
.H
2
O; 8,25 g de Na
2
HPO
4
.2H
2
O
y 9 g de NaCl en un litro de agua destilada. Este fragmento se reserva para la
realización del análisis histológico. El fragmento central, que se detalla en gris en
la Figura 8, se aparta y se coloca con la cara posterior hacia el disector (ver Figura
9).

Quiasma óptico
Cuerpos mamilares
puente
3 cm
2 mm

56


Figura 9: Diagrama de un corte coronal, cara posterior de un cerebro de una rata Wistar macho de
290 g a 1,00 mm posterior del punto bregma, que muestra las regiones que se analizaron por HPLC.
El diagrama muestra en el hemisferio de la derecha en verde el estriado dorsal (núcleos: caudado y
putamen), en amarillo el estriado ventral (núcleo accumbens), en rojo la comisura anterior y en
anaranjado la región septal o septo. Modificado de Paxinos & Watson (1998).


Se disecan y colectan de cada hemisferio las siguientes regiones: estriado dorsal,
estriado ventral y septo (Figura 9). En la balanza analítica, se determina la masa
de cada uno de los seis tejidos cortados para la cuantificación de los niveles de
neurotransmisores por masa de tejido. Estos tejidos se colectan en viales con 500
L de una disolución 50 ng/mL de 3,4-dihidroxibenzilamina (DHBA) en ácido
perclórico 0,05 N (HClO
4
). El tejido se homogeniza con el homogenizador
ultrasónico durante 20 s a velocidad baja, (entre los niveles 1 y 3 del instrumento).
Los viales se centrifugaron a 10 000 r.p.m., durante 20 min a una temperatura
aproximada de 3 °C. Las muestras fueron filtradas antes de su inyección en el
HPLC por filtros de jeringa con membrana de nylon de 0,45 m de porosidad. La

57

disolución filtrada se conservó bajo congelación (aproximadamente -20 °C) hasta
la cuantificación de los neurotransmisores por HPLC (aproximadamente 6 meses
después).


3.11 Análisis histológicos
Con el objetivo de ubicar la zona donde la cánula fue insertada se realizaron
análisis histológicos en el experimento tres. Estos análisis se realizaron en el
Laboratorio de Histología del Programa de Investigación en Neurociencias por la
Ing. Adriana Saborío Arce, como parte de los objetivos de su Trabajo Final de
Graduación para optar por el grado de Bachiller en Biotecnología (Saborío, 2008).

El fragmento preservado en formalina con amortiguador de fosfatos y a
temperatura ambiente se coloca en el micrótomo y se realizan cortes coronales de
25 m de grosor. Los cortes se recolectan en portaobjetos precubiertos con medio
de montaje de metacrilato.

Se aplicaron diferentes sistemas de tinción: con “cresyl fast violet”; “hematoxilina y
eosina”; y con “luxol fast blue y cresyl fast violet” (ver la preparación de reactivos y
la secuencia de tinción en el Anexo V).

La visualización de los cortes fijados y teñidos se realiza en un microscopio de luz
(40 y 400x) con el objetivo de ubicar la zona a la cual llegó la cánula.


3.12 Análisis neuroquímicos
En los tejidos de cada hemisferio de cada animal (estriado dorsal, estriado ventral
y septo) seleccionados y tratados para análisis neuroquímicos como se describió

58

en el apartado 3.10, se cuantificó: norepinefrina, dopamina, DOPAC, serotonina,
5-HIAA y HVA en estriado dorsal; y dopamina y DOPAC en estriado ventral y
septo. En el experimento tres no se cuantificó 5-HIAA debido a que se agotó el
estándar analítico. El septo no se colectó en el experimento tres para análisis
neuroquímicos debido a que en los dos experimentos anteriores no se encontró
que esta región se vea influenciada neuroquímicamente por la acción de la toxina.

La determinación se realizó por cromatografía líquida de alta eficiencia con
detector electroquímico (HPLC/ED). Para la determinación cromatográfica se
contó con la asistencia de la BSc Andrea Monge, investigadora del Programa de
Investigación en Neurociencias de la Universidad de Costa Rica.

Se empleó un cromatógrafo líquido compuesto por dos módulos: una bomba de un
canal (Waters 515), acoplada a un detector electroquímico de pulso (Waters 464),
con un sistema de tres electrodos: un electrodo de trabajo de carbón vidriado, un
electrodo de referencia de Ag/AgCl y un contraelectrodo o electrodo auxiliar de
platino. La columna cromatográfica empleada fue una Termo Hypersil-Keystone,
C18 Keystone Catecholamine, 100 mm de longitud x 4,6 mm (standard bore) x 3
m de tamaño de partícula; con precolumna Keystone Catecholamine, 10 mm de
longitud, 4,6 mm (“standard bore”), 3 m de tamaño de partícula. El desarrollo de
esta metodología es parte de los resultados de esta investigación y se describirá
más adelante.

Se preparó un patrón mezcla a un solo nivel de calibración (50 ng/mL) para todos
los analitos en HClO
4
0,05 N. De este patrón se realizaron inyecciones múltiples
de forma periódica entre las inyecciones de las muestras, de tal forma que todos
los días se inyectó el patrón varias veces durante cinco momentos a lo largo de
cada día en que se realizó las mediciones de la muestras. Se empleó DHBA
como estándar interno también a 50 ng/mL.


59

Para la adquisición e integración de los datos cromatográficos se empleó el
software CSW32

Chromatographic Station for Windows, DataApex Ltd., 2001.
Para la cuantificación y procesamiento de los datos se empleó el software
Microsoft

Excel 2000.

A partir de las concentraciones de neurotransmisores en cada tejido, se calculó la
variable denominada “% de Depleción” (ver figura 10). Esta variable corresponde
a la diferencia entre el nivel de un neurotransmisor o metabolito en el hemisferio
no lesionado y el hemisferio lesionado, expresada como porcentaje del nivel del
neurotransmisor o metabolito en el hemisferio no lesionado. En el caso específico
de los niveles de dopamina en estriado dorsal, esta variable es una medida del
grado de lesión de las neuronas nigro-estriatales del individuo y se denomina “%
de Lesión”.

(C
n
hemNL - C
n
hemL)
C
n
hemNL

Figura 10: Fórmula para el cálculo del porcentaje de depleción relativo entre el
hemisferio lesionado y el no lesionado, para un neurotransmisor o para un
metabolito en un tejido determinado.
Cn hemNL = concentración en un tejido del neurotransmisor o metabolito en el
hemisferio no lesionado; Cn hemL = concentración en el mismo tejido del
neurotransmisor o metabolito en el hemisferio lesionado.


Valores del porcentaje de depleción menores al 80%, fueron considerados como
lesiones moderadas y valores entre el 80% y el 95% se consideraron como
lesiones severas.

A partir de los datos de neuroquímica también se calculó la variable índice de
metabolismo (Fornaguera et al., 1993), que hace referencia a una comparación de
las tasas de metabolismo en cada hemisferio (ver figura 11).

x 100 % Depleción =

60

(Cn hemL, m / Cn hemL, n)
(Cn hemNL, m / Cn hemNL, n)

Figura 11: Fórmula para el cálculo del índice de metabolismo “IM n,m ” para una
rata, en un tejido determinado, donde “n” = neurotransmisor y “m” su respectivo
metabolito.
Cn hemNL = concentración en un tejido del neurotransmisor o metabolito en el
hemisferio no lesionado; Cn hemL = concentración en un tejido del
neurotransmisor o metabolito en el hemisferio lesionado.


El Índice de Metabolismo (IM), es una razón de tasas de metabolismo entre los
dos hemisferios. Cada tasa de metabolismo es una medida de la transformación
del neurotransmisor en un metabolito específico en uno de los hemisferios. Una
mayor transformación hacia el metabolito es indicativa de una mayor actividad
metabólica. Si el índice de metabolismo presenta un valor igual o cercano a cien,
esto implica que la tasa de metabolismo es similar entre ambos hemisferios. Un
valor mayor de cien indica que la actividad metabólica en el hemisferio intervenido
se encuentra aumentada respecto al no intervenido. Una actividad metabólica
aumentada en el hemisferio intervenido o lesionado puede ser un indicativo que se
han desarrollo mecanismos de compensación neuroquímica presinápticos como
una mayor liberación del neurotransmisor y/o una menor recaptura presináptica
del mismo. Consecuentemente al haber mayor sustrato (neurotransmisor), se da
una mayor transformación en el metabolito. Así, en el estado estacionario, los
niveles de metabolito son mayores al de su respectivo neurotransmisor. En un
individuo lesionado, la presencia de estos mecanismos de compensación no
implica necesariamente que la compensación sea suficiente para equilibrar los
procesos neurales entre los dos hemisferios. Un valor del índice de metabolismo
menor de cien, es un indicativo que la actividad metabólica aumentada se
encuentra en el hemisferio no intervenido.


IM n,m = x 100

61

3.13 Primer experimento: Evaluación exploratoria, a tres dosis, del efecto de
la MT-III, luego de su inyección en la SNpc
Para este experimento se emplearon un total de 16 animales de un peso entre 218
– 253 gramos, distribuidos en cuatro grupos de cuatro animales cada uno. Las
dosis intra pars compacta, de MT-III nativa, empleadas son: 0,14; 1,4 y 14 g en 1
L de volumen de inoculación. El cuarto grupo se empleó como control. El grupo
control recibió la inyección de 1 L de solución salina 0,9% (también en la pars
compacta).

Se evaluó la conducta espontánea e inducida farmacológicamente, todos los días
que se detallaron anteriormente en el Cuadro I.

Se cuantificaron los niveles de dopamina, DOPAC, HVA, serotonina y 5-HIAA en
estriado dorsal y de dopamina y DOPAC en estriado ventral y septo.


3.14 Segundo experimento: Evaluación exploratoria de la evolución del
proceso de lesión neuronal de la miotoxina en cuatro momentos
postoperatorios
Para este experimento se utilizaron un total de 16 animales, de un peso entre 261
– 331 gramos, distribuidos en cuatro grupos de cuatro animales cada uno,
sacrificados a los: 15, 60, 180 y 360 minutos después de la inyección de la
miotoxina nativa. La dosis de miotoxina empleada en los cuatro grupos fue de 14
g en 1 L de volumen de inoculación. Esta dosis se escogió por ser la dosis más
alta preparada a la que se esperaban efectos mayores a corto plazo (15 a 360
min).


62

Inmediatamente después del sacrificio, se colectaron los tejidos cerebrales para
cuantificar los niveles de dopamina, DOPAC, HVA, serotonina y 5-HIAA en
estriado dorsal, y de dopamina y DOPAC en estriado ventral y septo.


3.15 Tercer experimento: Comparación del efecto por lesión con la miotoxina
y con la miotoxina alquilada en el sitio catalítico, a dosis constante
Para este experimento se emplearon un total de 40 animales, de un peso entre
176 -- 354 gramos distribuidos en tres grupos. El primer grupo (10 animales) se
empleó como control y recibió la inyección de 1 L de solución salina (también en
la pars compacta). El segundo grupo (14 animales) recibió la inyección de 1 L de
MT-III alquilada a una concentración de 1,4 g/L y el tercer grupo (16 animales)
recibió la inyección de 1 L de MT-III nativa a la misma concentración de 1,4
g/L. Esta dosis se escogió por ser la dosis más alta, de las evaluadas en el
experimento uno, a la que se puede explorar el efecto de la miotoxina sin la
muerte de los animales.

De los 40 animales, se descartaron dos: uno del grupo de toxina alquilada se
decidió sacrificar el día 4 postoperatorio por presentar una postura completamente
lateralizada, encontrarse deprimido, carecer de actividad prensil, no presentar
reflejos de enderezamiento, de alarma y por no presentar actividad motora en
general; otro del grupo de la toxina nativa o no alquilada, ya que en los análisis
histológicos se observó un aparente tumor a nivel de la corteza cerebral cerca del
sitio de introducción de la cánula. Este individuo presentó, tanto en las
evaluaciones conductuales como neuroquímicas, valores atípicos del resto de
animales de su grupo experimental.



63

Se evaluó la conducta espontánea e inducida farmacológicamente en todos los
días que se muestran en el Cuadro I.

Se cuantificaron los niveles de norepinefrina, dopamina, DOPAC, HVA y
serotonina en estriado dorsal, y de dopamina y DOPAC en estriado ventral.

Se separó el tejido cerebral respectivo para los análisis histológicos.


3.16 Análisis estadístico de los resultados
Para el análisis estadístico de los resultados se empleó el software “SPSS

for
Windows”, versión 15.0.0, 2006. Los gráficos se elaboraron con el software
Microsoft
®
Office Hogar y Estudiantes, Excel
®
2007. Las barras de error en cada
uno de los gráficos representan una desviación estándar con respecto a la media
(Error Estándar de la Media, SEM). El SEM fue calculado por el software “SPSS


for Windows”, versión 15.0.0, 2006.

Los resultados conductuales entre los grupos experimentales dentro de los días
evaluados se realizaron utilizando un “Análisis Multivariado de Medidas Repetidas”
empleando: el estadístico de prueba multivariada tipo “Pillai´s Trace”, el estadístico
de homogeneidad de varianza de Levene, el estadístico de esfericidad de
Mauchly, y las pruebas post hoc de Scheffe y Tukey, todo con un nivel de
significancia del 95% ( =0,05).

Para la comparación de los promedios de las conductas entre los días dentro de
un mismo grupo experimental se empleó la prueba de t para la comparación de
pares de medias con un nivel de significancia del 95% ( =0,05).


64

Para la evaluación de la simetría conductual en las variables: giro neto, peritaxis
neta, índice de asimetría del giro e índice de asimetría de peritaxis se empleó la
prueba t (a dos colas) para el contraste de significación de cada media con el valor
de simetría. Los valores de simetría utilizados son cero para el giro neto y
peritaxis neta simétricos y 50 para los índices de asimetría del giro y de la
peritaxis, todo con un nivel de significancia del 95% ( =0,05).

Los resultados porcentajes de depleción para cada analito y las diferencias de
peso entre el día preoperatorio y el día 22 postoperatorio, se evaluaron por
ANOVA de una vía empleando: el estadístico de homogeneidad de varianza de
Levene y la prueba post hoc de Scheffe y Tukey, todo con un nivel de significancia
del 95% ( =0,05).

Para la evaluación de la correlación entre las variables de giro neto y peritaxis neta
respecto al porcentaje de lesión medido por neuroquímica, se realizó un análisis
de correlación bivariado, mediante el coeficiente de correlación de Pearson de dos
colas, con un nivel de significancia del 95% ( =0,05).

Los Índices de Metabolismo se analizaron con la prueba t (a dos colas) para el
contraste de significación de cada media contra el valor de 100 que indica una
taza metabólica igual entre hemisferios, todo con un nivel de significancia del 95%
( =0,05).




65

CAPÍTULO IV
4. RESULTADOS
4.1 Implementación de una metodología por HPLC/ED para la determinación
de neurotransmisores y sus metabolitos en tejido cerebral

4.1.1 Condiciones cromatográficas.
El desarrollo de esta metodología está basado en la reportada por O´Kusky et al.,
(1991) y Ricker (2002). Para el desarrollo de las condiciones de la separación
cromatográfica se probaron diferentes composiciones y proporciones de fases
móviles, encontrándose una separación aceptable con las siguientes condiciones.
Como fase móvil se empleó una mezcla desgasificada por ultrasonido compuesta
por una proporción (90:5:5) de amortiguador, metanol y acetonitrilo
respectivamente. El amortiguador se prepara mezclando EDTA.Na
2
.2H
2
O 20 mM;
KH
2
PO
4
0,14 M y octilsulfonato de sodio 0,75 mM, en agua MilliQ, tipo 1. El pH se
ajusta a 3,5 con H
3
PO
4
25%. El flujo de la fase móvil fue de 1,5 mL/min y el lazo
de inyección de 50 L.

La metodología desarrollada permite, en una sola corrida de aproximadamente 15
min, la determinación de norepinefrina (NE), dopamina (DA), ácido 3,4-
dihidroxifenilacético (DOPAC), ácido homovanílico (HVA), serotonina (5-HT) y
ácido 5-hidroxi 3-indolacético (5-HIAA). Con 3,4-dihidroxibenzilamina (DHBA)
como estándar interno. La metodología se evaluó con los patrones y el estándar
interno a una concentración de 50 ng/mL para cada analito, disuelto en HClO
4

0,05 N (ver figura 12).


66










Figura 12: Ejemplo de una separación cromatográfica para un patrón analítico compuesto de NE,
DHBA (estándar interno), DA, DOPAC, 5-HT, HIAA y HVA a la concentración de 120 ng de cada
analito por mL en HClO
4
0,5N, medido bajo las condiciones de la metodología desarrollada.
Detalle de picos cromatográfico: 1 = NE, tr 2,7; 2 = DHBA, tr 6,3; 3 = DA, tr 4,5; 4 = DOPAC, tr 4,9 ; 5
= 5-HT, tr 8,0 ; 6= HIAA, tr 10,6 y 7 = HVA, tr 12,0. El símbolo “ “ señala el tiempo en que se
cambia manualmente la sensibilidad del detector electroquímico.

El cromatógrafo no cuenta con regulador de temperatura, ni el cuarto de
instrumentos tenía aire acondicionado. Las corridas cromatográficas se realizaron
a temperatura ambiente. La temperatura ambiente fue muy variable a lo largo de
cada día de trabajo, lo que provocó una variación de los tiempos de retención. La
respuesta de la celda en los detectores electroquímicos es dependiente de la
temperatura pues ésta depende de procesos de difusión de las especies activas a
las paredes del electrodo. Para compensar un poco el efecto por la variación en la
temperatura sobre la señal del detector, y la separación cromatográfica, se inyectó
frecuentemente durante cada día de trabajo el patrón analítico.


4.1.2 Condiciones del detector
Para establecer el valor del potencial del electrodo de trabajo, se realizó una
evaluación de la respuesta del detector a diferentes valores de este potencial entre
600 y 800 mV. Esta variable se probó por triplicado con disoluciones patrón
mixtas a 120 ng/mL para cada uno de los analitos (ver figura 13).


Tiempo / min
0 2 4 6 8 10 12 14
Voltaje / mV
0
2
4
6
8
1 2 3 4 5 6 7

67


Figura 13 Intensidad promedio de la señal del detector electroquímico, para cada uno de los
analitos contra el potencial aplicado al electrodo de trabajo.
Norepinefrina (NE), 3,4-dihidroxibenzylamina (DHBA), dopamina (DA), ácido 3,4-
dihidroxifenilacético (DOPAC), ácido homovanílico (HVA), serotonina (5-HT) y ácido 5-hidroxi 3-
indolacético (5-HIAA).

El patrón de respuesta de cada uno de los analitos a diferentes voltajes es
diferente. Para establecer el potencial de trabajo se buscó aquel que tuviera una
mayor señal para todos los compuestos; pero principalmente para dopamina y
serotonina. A 750 mV la señal para dopamina, DOPAC, HVA, DHBA y NE es
máxima pero para serotonina es muy pequeña y a 700 mV la señal es alta para
serotonina y en general es similar a la de 750 mV para los otros compuestos.
Cualitativamente la variabilidad de la señal es similar a los diferentes potenciales
estudiados. Esta variabilidad es indicada en el gráfico mediante barras de error
como el valor de dos veces la desviación estándar del promedio.

A partir de los resultados anteriores, se decidió seleccionar como voltaje del
electrodo de trabajo: 700 mV vs Ag/AgCl. Otras variables seleccionadas del
detector, con las cuales se obtuvieron buenas señales a las concentraciones de
trabajo, fueron: constante de tiempo de 0,2 s y una programación manual del
rango de corriente de 10 nA hasta 4 min o hasta que eluya DHBA; 50 nA de
0,0
5,0
10,0
15,0
20,0
25,0
30,0
35,0
40,0
600 700 750 800
Potenci al del el ectrodo de trabaj o en mV
I
n
t
e
n
s
i
d
a
d

d
e

s
e
ñ
a
l

/

A
NE
DHBA
DOPAC
DA
5-HIAA
HVA
5-HT

68

aproximadamente 4 min hasta aproximadamente 6 min de corrida o hasta después
que eluya DOPAC y luego 5 nA hasta el final de la corrida.


4.2 Resultados del primer experimento
4.2.1 Descripción general
Como se mencionó anteriormente el primer experimento consistió en la evaluación
exploratoria del efecto de la miotoxina MT-III nativa, a tres dosis de miotoxina
(0,14 g; 1,4 g y 14 g) y un grupo control con solución salina, por inoculación en
la pars compacta. El objetivo de este experimento fue el de seleccionar las dosis
de trabajo para los dos experimentos siguientes.

Para este experimento se distribuyeron cuatro animales en cada uno de los cuatro
grupos experimentales. De los 16 animales que participaron inicialmente en este
experimento, se descartaron dos de las ratas control al final del experimento. Uno
de estos animales descartados se despertó durante la neurocirugía. En estos dos
animales que se descartaron se observó (inmediatamente después de la cirugía)
una lesión en el oído izquierdo con sangrado. Los resultados medidos a estas dos
ratas son atípicos (en algunas de las conductas y en neuroquímica) del resto de
las otras ratas que participaron en el grupo control.

En este experimento se presentó una mortalidad del 50% (dos de cuatro
animales), únicamente en el grupo inyectado con la dosis mayor (14 g de
miotoxina III nativa). Ambos animales murieron entre el primer y el segundo día
postoperatorios. El primer día postoperatorio, aún estando estos dos animales
con vida, se les midió la conducta, la cual estuvo caracterizada en uno de los
animales por una inactividad generalizada y en el otro animal por pocos giros, en

69

comparación con los otros dos animales del mismo grupo experimental y siempre
contralaterales. En los otros grupos no murieron animales.

Los resultados conductuales y neuroquímicos medidos, corresponden entonces a
12 animales distribuidos en cuatro grupos experimentales: un grupo control
compuesto por dos animales, un grupo con la inyección de la miotoxina a la dosis
de 0,14 g (en adelante dosis baja) compuesto por cuatro animales, un grupo con
la inyección de la miotoxina a la dosis de 1,4 g (en adelante dosis media)
compuesto por cuatro animales, y un grupo con la inyección de la miotoxina a la
dosis de 14 g (en adelante dosis alta) compuesto por dos animales.


4.2.2 Variación del peso corporal durante el experimento
Un efecto estudiado en este experimento fue la variación del peso corporal de los
animales, entre el día 22 postoperatorio y el día preoperatorio, para los cuatro
grupos experimentales. Los valores positivos para la diferencia de estos dos
pesos (ver figura 14) indican que en todos los grupos el peso corporal aumentó en
promedio un poco más de 80 g. Por análisis de ANOVA de una vía, no se
encontraron diferencias significativas para esta variable entre los cuatro grupos de
animales. (p =1 en todas las comparaciones).


70


Figura 14: Promedio por grupo de la diferencia del peso corporal entre el día 22 postoperatorio y
el día preoperatorio, para los diferentes grupos de tratamiento: control, dosis 0,14 µg; dosis 1,4 µg;
dosis 14 µg de miotoxina III nativa.


4.2.3 Conducta de giro
En la figura 15 se pueden observar, los resultados de la variable giro neto por
grupo. En el cuadro III del Anexo VI se presentan los datos individuales de giro
neto. Por análisis estadístico multivariable de medidas repetidas para la variable
de giro neto, únicamente se encontró diferencias estadísticamente significativas el
día 20 entre el grupo de tratamiento a dosis alta (14 µg) y los grupos control (p =
0,03), dosis baja (p =0,02), y dosis media (p =0,04). Mediante un análisis de la
prueba t contra el valor de cero como simetría conductual, no se encontraron
diferencias estadísticamente significativas. Incluso en el mayor valor promedio de
giro neto, que se presentó el día 20 en el grupo de dosis alta (cerca de +600 giros
netos; ver figura 15), las diferencias no son significativas (p =0,3).


71


Figura 15: Promedio por grupo del giro neto durante 20 min por día, en diferentes grupos de
tratamiento: control; dosis 0,14 g; dosis 1,4 g; y dosis 14 g de miotoxina III nativa. El valor de
cero en el eje de las ordenadas indica la simetría conductual.


Un análisis estadístico adicional de los resultados, mediante la prueba t para
medias apareadas, entre los días dentro de cada grupo experimental indica que
solamente se presentan diferencias estadísticamente significativas en el grupo de
dosis alta entre los días 1 y 20 postoperatorios (p =0,02), y entre los días 7 y 22
postoperatorios (p =0,01).

Si bien los resultados de los análisis estadísticos de la variable de giro neto no
permiten indicar un comportamiento diferente entre los cuatro grupos
experimentales, a excepción del día 20, que el grupo de dosis alta se comporta
estadísticamente diferente a los otros tres grupos (incluyendo el grupo control), en
la figura 15, se pueden observar unas tendencias de los promedios que se
describirán a continuación.

El grupo control (ver figura 15) presenta los valores de giro neto más cercanos a
cero (simetría conductual) o entre los más cercanos a cero dentro de cada día.

72

En la figura 15 se puede observar que el giro neto espontáneo, en los tres grupos
intervenidos con la miotoxina III nativa, los días 1, 3 y 5 presenta una tendencia
hacia la asimetría contralateral. Cada uno de estos tres días se puede observar
que esta asimetría contralateral está directamente relacionada con la dosis
inoculada de miotoxina, es decir a mayor dosis de miotoxina mayor giro neto
contralateral. Además, para los tres grupos intervenidos con toxina, la asimetría
contralateral disminuye gradualmente (cada día un giro neto menos negativo)
desde el día uno hacia el día siete postoperatorio. A partir del día siete, los
promedios de giro neto muestran una tendencia de simetría del giro (giro neto
cercano a 0) que se mantiene hasta el día 18. La tendencia observada en la
disminución gradual de la asimetría contralateral hacia la simetría conductual se
observa también inversamente proporcional a la dosis, es decir a mayor dosis más
lenta es la tendencia a la simetría.

El día 20 postoperatorio (figura 15), después de la administración sistémica de
apomorfina, se puede observar un cambio marcado en la conducta de giro. Este
cambio sería de una inversión de la asimetría contralateral de los días 1, 3 y 5, y
de un cambio de la simetría del giro neto simétrico de los días 7 a 18
postoperatorio, a un giro neto ipsilateral. Esta tendencia de giro neto ipsilateral se
observa en los cuatro grupos experimentales. La tendencia observada es dosis
dependiente, siendo mayor a mayor dosis inoculada de la toxina nativa.

También en la figura 15 se puede observar el día 22 postoperatorio, después de la
administración sistémica de anfetamina, una tendencia de inversión en la conducta
del giro ipsilateral del día 20 a un giro neto contralateral. También esta tendencia
de giro contralateral del día 22, se observa relacionada directamente con la dosis
de la toxina MT-III inoculada, es decir a mayor dosis de miotoxina mayor giro
contralateral.


73

Tomando como referencia el giro neto promedio que se midió, para el grupo de
dosis alta de miotoxina el día 18, la magnitud absoluta del cambio del giro neto
hacia contralateral provocado por la anfetamina, es menor que la magnitud
absoluta del cambio del giro hacia ipsilateral provocado por apomorfina. En los
otros dos grupos de animales intervenidos con miotoxina (dosis baja y dosis
media) estos cambios en magnitud absoluta son semejantes, aunque es
importante recalcar que de tendencia opuesta.

A partir de los resultados de la conducta de giro, y la fórmula presentada en la
Figura 7, se calculó el Índice de Asimetría promedio por grupo (IA) para la
conducta de giro (ver figura 16).


Figura 16: Promedio por grupo del índice de asimetría de la conducta de giro (IA), durante 20 min
por día, en diferentes grupos de tratamiento: control; dosis 0,14 g; dosis 1,4 g; y dosis 14 g de
miotoxina III nativa. La línea roja en el valor de 50 indica la simetría conductual.



74

Por análisis estadístico multivariable de medidas repetidas para la conducta de IA
del giro, se obtuvieron diferencias significativas únicamente el día 5 entre el grupo
de dosis alta y el grupo control (p =0,04). Mediante un análisis por la prueba t de
los promedios de cada grupo por día contra el valor de 50 como simetría
conductual para esta variable, en el grupo control en los días evaluados no se
demostró estadísticamente la asimetría. En el grupo de dosis baja se demostró
estadísticamente la asimetría contralateral el día 20 (p =0,03). En el grupo de
dosis media se demostró la asimetría contralateral el día 1 (p =0,01) y en el grupo
de dosis alta los días 5 (p =0,03) y 22 (p =0,002). El día 20, en el grupo de dosis
alta, a pesar que se observa una tendencia de una alta asimetría ipsilateral
marcada, ésta no es estadísticamente significativa (p =0,06) al 95% de confianza.

El contraste de la prueba t para medias apareadas, dentro de cada grupo
experimental, se aplicó entre los días 1, 7, 18, 20 y 22, con el fin de evaluar el
cambio en el tiempo de la variable IA del giro dentro de cada grupo experimental.
Según este análisis se encontró que en el grupo control esta variable, el día 7 es
significativamente diferente del día 18 (p =0,007). En el grupo de dosis baja se
encontraron diferencias significativas entre el día 1 y los días 7 (p =0,05), 18 (p =
0,03) y 20 (p =0,02), además se encontraron diferencias significativas entre los
días 18 y 20 (p =0,05). En el grupo de dosis media se encontraron diferencias
significativas entre el día 1 y los días 7 (p =0,05), 18 (p =0,02), 20 (p =0,02) y 22
(p =0,05). En el grupo de dosis alta se encontraron diferencias significativas entre
el día 20 y los días 7 (p =0,01) y 22 (p =0,04), además entre los días 18 y 22 (p =
0,04). La tendencia observada es de un cambio conductual en el tiempo dentro de
cada grupo experimental, siendo demostrable estadísticamente principalmente en
el grupo de dosis alta.

Tal y como se describió anteriormente, los resultados de los análisis estadísticos
practicados a la variable de IA del giro muestran algunas diferencias
estadísticamente significativas. El número de diferencias significativas obtenidas

75

mediante el análisis de la variable de IA del giro es mayor que el obtenido al
analizar la variable de giro neto.

Las tendencias de asimetría de la variable de IA del giro que se pueden observar
en la figura 16 son semejantes a las tendencias de asimetría que se describieron
en la variable de giro neto (ver figura 15). Estas tendencias son de un IA del giro
contralateral los días 1, 3, 5 y 22 y un IA del giro ipsilateral el día 20. La tendencia
dosis dependiente de un giro asimétrico mayor a mayor dosis, descrita para la
variable giro neto (ver figura 15), se mantiene los días 3, 5, 20 y 22 en la variable
de IA del giro (ver figura 16). Los cuatro grupos experimentales, entre los días 7 a
18 muestran una tendencia de la variable de IA del giro cercanas a la simetría
conductual.

Las tendencias observadas el día uno para la variable IA del giro (ver figura 16)
son diferentes a las descritas para la variable de giro neto, en cuanto que el valor
promedio de IA de giro para el grupo control muestra asimetría contralateral y que
el grupo de dosis alta no presenta la mayor asimetría contralateral del día.

El día 20, luego de la administración sistémica de apomorfina, los dos animales
que conforman el grupo de dosis alta prácticamente solo presentan giros
ipsilaterales. Este resultado se puede observar en la figura 16 donde el valor del
IA del giro es cercano a 100.


4.2.4 Conducta de peritaxis
Los resultados obtenidos para la variable de tiempo neto de peritaxis por grupo se
presentan en la figura 17. En el cuadro IV del Anexo VI se presentan los datos
individuales de tiempo neto de peritaxis. En adelante me referiré a la variable de
tiempo neto de peritaxis como peritaxis neta.

76




Figura 17: Promedio por grupo del tiempo neto de peritaxis durante 20 min por día, en diferentes
grupos de tratamiento: control; dosis 0,14 g; dosis 1,4 g; y dosis 14 g de miotoxina III nativa.
El valor de cero en el eje de las ordenadas indica la simetría conductual.

En la figura 17 se puede observar que prácticamente todos los cuatro grupos
presentan valores promedios positivos para la variable peritaxis neta,
principalmente los grupos de dosis alta y media. El grupo de dosis alta presenta
todos los días valores positivos altos para esta variable. La peritaxis neta positiva
indica una asimetría ipsilateral para esta conducta.

Por análisis estadístico multivariable de medidas repetidas para la variable de
peritaxis netas, se encontraron diferencias significativas únicamente los días 12,
15 y 18, entre los grupos que se detallan seguidamente. Los días 20 y 22 no se
encontraron diferencias estadísticamente significativas entre los grupos
experimentales.

 El día 12 postoperatorio entre el grupo de dosis alta y los grupos control
(p =0,01), dosis baja (p =0,005) y dosis media (p =0,02).

77

 El día 15 postoperatorio entre el grupo de dosis alta y los grupos control
(p =0,04) y de dosis baja (p =0,03).
 El día 18 postoperatorio entre el grupo de dosis alta y los grupos control
(p =0,02), dosis baja (p =0,03) y dosis media (p =0,03).

Mediante un análisis estadístico de la prueba t de los promedios de peritaxis neta
de cada grupo por día, contra el valor de cero como la simetría conductual,
únicamente se encontraron diferencias significativas el día 20 en el grupo de dosis
media (p = 0,02). No obstante la tendencia de la asimetría ipsilateral de los
promedios es evidente gráficamente en la mayoría de los días.

Un análisis estadístico adicional practicado es el del contraste de la prueba t para
medias apareadas, entre días dentro de cada grupo experimental. Esta prueba se
aplicó para los días 1, 7, 18, 20 y 22 postoperatorios, con el fin de evaluar
estadísticamente el cambio que presenta en el tiempo la variable de peritaxis neta
dentro de cada grupo experimental. Mediante este análisis estadístico no se
encontraron del todo diferencias significativas.

Los resultados de las pruebas estadísticas practicadas a la variable de peritaxis
neta promedio permiten indicar estadísticamente únicamente un comportamiento
levemente diferente entre el grupo de dosis alta y los otros tres grupos, algunos de
los días. No obstante, en la figura 17, los promedios de la variable de peritaxis
neto muestran algunas tendencias que se describirán a continuación.

El grupo control presenta la mayoría de los días evaluados los valores de peritaxis
neta promedio más cercanos a cero (simetría) respecto a los otros grupos. La
tendencia clara de efecto dosis dependiente descrito para la variable de giro neto
no es tan clara al observar las tendencias de variable de peritaxis neta en este
sentido. El día 1 postoperatorio, contrario a lo obtenido con la variable de giro

78

neto, la menor asimetría conductual la presenta el grupo de dosis alta respecto a
los otros grupos intervenidos con toxina.

La tendencia más marcada en la variable de peritaxis neta (ver figura 17) es que la
mayoría de las mediciones muestran una peritaxis neta ipsilateral prácticamente
todos los días. Contrastan estos resultados con los obtenidos para la variable de
giro neto (ver figura 15) en cuanto que la simetría conductual del giro es el factor
común entre los días 7 y 18 postoperatorios; la peritaxis neta nunca es
contralateral, y la variable de peritaxis neta no muestra un patrón claro de cambio
conductual espontáneo en el tiempo como se pudo describir para la variable de
giro neto.

En la figura 17, en el día 20 postoperatorio, después de la administración de
apomorfina, se observa un marcado aumento de la peritaxis ipsilateral en el grupo
de dosis baja respecto al valor obtenido el día 18. El día 22 postoperatorio
después de la administración de anfetamina, el grupo de dosis baja muestra una
tendencia de simetría conductual. Esta simetría es aparente pues, si se analizan
los datos individuales (ver en Anexo VI, Cuadro IV), se puede observar que los
animales de este grupo presentan un comportamiento de dirección opuesta. Es
decir, algunos animales presentan peritaxis ipsilateral y otros contralateral, que en
promedio se observa como una simetría aparente.

A partir de los resultados de la conducta de peritaxis, y la fórmula presentada en la
Figura 7, se calculó el Índice de Asimetría promedio por grupo (IA) para la
conducta de peritaxis (ver figura 18).


79


Figura 18: Promedio por grupo del índice de asimetría de la conducta de peritaxis (IA),durante 20
min por día, en diferentes grupos de tratamiento: control; dosis 0,14 g; dosis 1,4 g; y dosis 14 g
de miotoxina III nativa. La línea roja en el valor de 50 indica la simetría conductual.

Por análisis estadístico multivariable de medidas repetidas para la variable IA de
peritaxis, no se encontraron diferencias significativas entre los cuatro grupos
experimentales. Mediante la prueba t de los promedios del IA de peritaxis de cada
grupo por día, contra el valor de 50 como simetría conductual, únicamente se pudo
demostrar estadísticamente la asimetría el día 5 en el grupo de dosis baja (p =
0,05). La asimetría de este grupo es contralateral. Por el análisis estadístico de la
prueba t para medias apareadas, entre días dentro de cada grupo experimental se
encontraron diferencias significativas únicamente en el grupo control entre los días
1 y 22 (p =0,04) y en el grupo de dosis baja (p =0,02).

En la figura 18 se puede observar que algunos de los datos muestran una
tendencia de una asimetría contralateral, principalmente en el grupo de dosis baja.
Además que la peritaxis que se observa en los otros valores promedio no es
siempre ipsilateral, pues en algunos promedios se observa cercano al valor de 50.

80

Estos resultados contrastan con las tendencias descritas anteriormente para la
variable de peritaxis neta (ver figura 17). Se describió anteriormente que la
peritaxis neta mostraba una tendencia de asimetría ipsilateral la mayoría de las
veces. Las varianzas de los promedios para las variables de peritaxis neta y de IA
de peritaxis son grades (ver barras de error de los promedios en las figuras 17 y
18).


4.2.5 Conducta de locomoción
En la figura 19 se pueden observar los valores promedios de la conducta de
locomoción representada como el número total de cruces. En el cuatro V del
Anexo VI se presentan los datos individuales de la conducta de locomoción.


Figura 19: Promedio por grupo de la conducta de locomoción como el número de cruces de
cuadrantes virtuales del campo abierto, durante 20 minutos por día, en diferentes grupos de
tratamiento: control; dosis 0,14 g; dosis 1,4 g; y dosis 14 g de miotoxina III nativa.

Por análisis estadístico multivariable de medidas repetidas no se encontraron
diferencias significativas entre los cuatro grupos experimentales dentro de cada

81

uno de los días de medición de la conducta. Mediante un análisis estadístico de la
prueba t para medias apareadas, entre los días 1, 7, 18, 20 y 22, se encontraron
algunas diferencias significativas que se detallan seguidamente.

 En el grupo control entre el día 22 y los días 1, 7, 18 y 20 (p <0,05 en todas
las comparaciones).
 En el grupo de dosis media (1,4 g) entre el día 22 y los días 1, 7,18 y 20 (p
<0,02 en todas las comparaciones).

En la figura 19 se puede observar que dentro de cada día no hay una tendencia
clara dosis dependiente. El grupo de dosis alta presenta la mayoría de los días los
menores valores de locomoción. El día 22 postoperatorio, después de la
administración sistémica de anfetamina, se observa en la figura 19 un aumento a
aproximadamente el doble en la locomoción de los cuatro grupos experimentales
respecto todos los días anteriores.

A excepción del grupo de dosis media, el día 22, los cuatro grupos experimentales
presentan valores de locomoción promedio similares entre los días evaluados.
Como se describió anteriormente el grupo de dosis media, el día 22 es
significativamente diferente de los otros grupos experimentales este día.


4.2.6 Conducta de exploración
En la figura 20 se presentan los resultados obtenidos para la variable de tiempo de
exploración promedio por grupo, los diferentes días que se realizaron las
mediciones. En el Cuadro VI del Anexo VI se presentan los datos individuales de
tiempo de exploración.



82


Figura 20: Promedio por grupo del tiempo total de exploración durante 20 minutos por día, en
diferentes grupos de tratamiento: control; dosis 0,14 g; dosis 1,4 g; y dosis 14 g de miotoxina
III nativa.


Por análisis estadístico multivariable de medidas repetidas no se encontraron
diferencias significativas entre los grupos experimentales dentro de cada uno de
los días de medición de la conducta, a excepción del día 18 entre el grupo control
y el grupo de dosis media (p =0,03). Mediante un análisis estadístico de la
prueba t para medias apareadas, se encontraron algunas diferencias significativas
que se detallan seguidamente.

 En el grupo control entre el día 1 y el día 18 (p =0,01).
 En el grupo de dosis baja: entre el día 1 y los días 7, 18 y 22 (p <0,05 en
todas las comparaciones); entre el día 7 y los días 18 y 20 (p <0,04 en
todas las comparaciones) y entre el día 18 y el día 20 (p =0,01).
 En el grupo de dosis media: entre el día 1 y los días 7 y 18 (p <0,03 en
todas las comparaciones) y entre el día 20 y los días 7,18 y 22 (p <0,02 en
todas las comparaciones).

83

En la figura 20 se puede observar una tendencia de los promedios de aumento en
los cuatro grupos de animales de la conducta de exploración desde el día 1 al día
18 postoperatorios. Como se describió anteriormente algunas de estas tendencias
son significativas.

El grupo de dosis alta presenta valores de exploración que se encuentran entre los
valores más bajos de cada día. La administración de apomorfina el día 20
provoca un descenso en la conducta de exploración en los cuatro grupos
experimentales respecto a los valores obtenidos el día 18.

El día 22, después de la administración de anfetamina se observa valores de
locomoción mayores que los que indujeron la apomorfina y menores que los
medidos el día 18 con excepción del grupo de dosis media que la exploración
promedio es mayor.

El análisis de los resultados de la conducta de exploración basado en la variable:
número total de exploraciones durante 20 minutos por día, produjo resultados
similares a los análisis presentados anteriormente para la variable: tiempo total de
exploraciones durante 20 minutos por día y por esto no se presentan.


4.2.7 Conducta de acicalamiento
En la figura 21 se presentan los resultados obtenidos para la variable de tiempo de
limpieza promedio por grupo, los diferentes días que se realizaron las mediciones.
En el Cuadro VII del Anexo VI se presenta los datos individuales de tiempo de
limpieza o acicalamiento.



84


Figura 21: Promedio por grupo del tiempo total en acicalamiento durante 20 minutos por día, en
diferentes grupos de tratamiento: control; dosis 0,14 g; dosis 1,4 g; y dosis 14 g de miotoxina
III nativa.

Mediante el análisis estadístico multivariable de medidas repetidas, no se
encontraron diferencias estadísticamente significativas entre los grupos
experimentales dentro de los días. Respecto al comportamiento de la variable de
limpieza entre los grupos experimentales dentro de los días, la tendencia
observada no es clara.

Mediante un análisis estadístico de la prueba t para medias apareadas, se
encontraron algunas diferencias significativas que se detallan seguidamente.

 En el grupo control no se encontraron diferencias significativas.
 En el grupo de dosis baja: entre el día 1 y los días 20 y 22 (p =0,02 en
todas las comparaciones) y entre el día 7 y los días 18, 20 y 22 (p <0,03 en
todas las comparaciones).

85

 En el grupo de dosis media: entre el día 7 y los días 20 y 22 (p <0,01 en
todas las comparaciones) y entre el día 18 y los días 20 y 22 (p <0,05 en
todas las comparaciones).

En la figura 21 se puede observar un patrón de picos en que el acicalamiento
aumenta del día 1 al 7 en todos los grupos y desciende también en todos los
grupos del día 7 al 18.

El grupo de dosis alta presenta los valores menores de la conducta de limpieza
entre los grupos para todos los días. El día 20 postoperatorio, después de la
administración de apomorfina y el día 22 después de la administración de
anfetamina, todos los grupos disminuyen considerablemente en su conducta de
limpieza a valores muy bajos, principalmente el grupo de dosis alta que presenta
valores prácticamente de cero ambos días.

El análisis de los resultados de la conducta de limpieza basado en la variable:
número total de limpiezas o acicalamientos durante 20 minutos por día, arroja
resultados similares a los análisis presentados anteriormente para la variable:
tiempo total de limpieza o acicalamiento y por esto no se presentan.


4.2.8 Análisis neuroquímicos en estriado dorsal
En la figura 22 se presentan los valores de porcentaje de depleción promedios en
estriado dorsal de los neurotransmisores y sus respectivos metabolitos medidos
por HPLC. Por análisis estadístico de ANOVA de una vía no se encontraron
diferencias estadísticamente significativas entre los grupos experimentales para
cada sustancia. En el cuadro VIII del Anexo VI se presentan los datos individuales
de porcentaje de depleción.


86



Figura 22: Porcentaje de depleción promedio en estriado dorsal, para dopamina (DA), ácido 3,4-
dihidroxifenilacético (DOPAC), ácido homovanílico (HVA), serotonina (5-HT) y ácido 5-hidroxi 3-
indolacético (5-HIAA) para los cuatro grupos de tratamiento con diferentes dosis de la miotoxina III,
nativa: control = 1 L solución salina; dosis baja = 0,14 g MT-III; dosis media 1,4 g MT-III y dosis
alta 14 g MT-III.

En esta figura se puede observar que, en los grupos de dosis baja y
principalmente el de dosis alta, la mayoría de los valores son positivos, lo que
indica una disminución de cada sustancia en el hemisferio intervenido respecto al
no intervenido. En el grupo de dosis media la mayoría de los valores son
negativos lo indica una mayor cantidad de la sustancia en el hemisferio no
intervenido respecto al intervenido. En general el grupo control y el grupo de dosis
baja presentan valores de porcentaje de depleción entre los menores. Los
porcentajes de depleción promedios se encuentran entre el ámbito de +/- 30%, por
lo que en promedio las lesiones alcanzadas son de bajas a moderadas.


87

El porcentaje de depleción de dopamina en estriado dorsal se tomó como una
medida del grado de lesión del sistema dopaminérgico nigroestriatal en los
animales. Para el grupo control, se obtuvo un porcentaje de lesión promedio de -1
%; con un ámbito de -10 a 8 %. Para el grupo de dosis baja, se obtuvo un
porcentaje de lesión promedio de 12 ±15 %; con un ámbito de 1 a 27 %. Para el
grupo de dosis media, se obtuvo un porcentaje de lesión promedio de 0 ±13 %;
con un ámbito de -10 a 15 %. Para el grupo de dosis alta, se obtuvo un porcentaje
de lesión promedio de 22 %; con un ámbito de 1 a 43 %.


4.2 9 Análisis neuroquímicos en estriado ventral.
En la figura 23 se presentan los valores de porcentaje de depleción promedios en
estriado ventral de los neurotransmisores y metabolitos medios por HPLC. Por
análisis estadístico de ANOVA de una vía no se encontraron diferencias
estadísticamente significativas entre los grupos experimentales para cada
sustancia. En el cuadro VIII del Anexo VI se presentan los datos individuales de
porcentaje de depleción.

En la figura 23 se puede observar que los valores promedios de porcentaje de
depleción se encuentran entre el ámbito de +/- 15 %. Los valores de porcentaje
de depleción en estriado ventral son menores que los obtenidos en estriado
dorsal.


88


Figura 23: Porcentaje de depleción promedio en estriado ventral, para dopamina (DA) y ácido
hidroxifenilacético (DOPAC) para los cuatro grupos de tratamiento con diferentes dosis de la
miotoxina III, nativa: control = 1 L solución salina; dosis baja = 0,14 g MT-III; dosis media 1,4 g
MT-III y dosis alta 14 g MT-III.

El porcentaje de depleción de dopamina en estriado ventral se tomó como una
medida del grado de lesión en estriado ventral en los animales. Para el grupo
control, se obtuvo un porcentaje de lesión promedio de 8,5 ±17,3 %; con un
ámbito de 6 a 11 %. Para el grupo de dosis baja, se obtuvo un porcentaje de
lesión promedio de -0,3 ±29 %; con un ámbito de -26 a 28 %. Para el grupo de
dosis media, se obtuvo un porcentaje de lesión promedio de 5,4 ±11,8 %; con un
ámbito de -8,5 a 15 %. Para el grupo de dosis alta, se obtuvo un porcentaje de
lesión promedio de 3,4 ±17 %; con un ámbito de 1 a 43 %.

Las mediciones de ácido homovanílico, serotonina y ácido hidroxiindolacético en
estriado ventral se realizaron. En la figura 23 no se presentan estos resultados de
porcentaje de depleción porque los resultados son inconsistentes debido a que en

89

algunos casos los picos cromatográficos son muy pequeños, en otros casos se
encuentran ausentes o la razón señal / ruido experimental es muy grande.


4.2.10 Análisis neuroquímicos en septo.
En la figura 24 se presentan los valores de porcentaje de depleción promedios en
septo de los neurotransmisores y metabolitos medios por HPLC. Por análisis
estadístico de ANOVA de una vía no se encontraron diferencias estadísticamente
significativas entre los grupos experimentales para cada sustancia. En el cuadro
VIII del Anexo VI se presentan los datos individuales de porcentaje de depleción.


Figura 24: Porcentaje de depleción promedio en septo, para dopamina (DA) y ácido
hidroxifenilacético (DOPAC), para los cuatro grupos de tratamiento con diferentes dosis de la
miotoxina III, nativa: control = 1 L solución salina; dosis baja = 0,14 g MT-III; dosis media 1,4 g
MT-III y dosis alta 14 g MT-III.


90

En la figura 24 se puede observar que los valores promedios de porcentaje de
depleción se encuentran entre el ámbito de +/- 30 %. Los valores de porcentaje
de depleción en septo presentan una variabilidad mayor que las obtenidas en los
estriados (ver figuras 22 y 23), la cual puede apreciarse por la magnitud de las
barras de error. Se cree que esta alta variabilidad se debe a que las áreas de los
picos cromatográficos eran muy pequeñas.

Las mediciones de ácido homovanílico, serotonina y ácido hidroxiindolacético en
estriado ventral se realizaron. En la figura 23 no se presentan estos resultados de
porcentaje de depleción por los resultados son inconsistentes debido a que en
algunos casos los picos cromatográficos son muy pequeños, en otros casos se
encuentran ausentes o la razón señal / ruido experimental es muy grande.


4.3 Resultados del segundo experimento
4.3.1 Descripción general
Como se mencionó anteriormente el segundo experimento consistió en la
evaluación exploratoria de la evolución del proceso de lesión provocado por la
miotoxina MT-III nativa a dosis constante (14 g, denominada en el experimento
uno como dosis alta), en cuatro momentos después de finalizar la inyección de la
miotoxina: 15 min, 1 hora, 3 horas y 6 horas. Cada uno de estos cuatro grupos
estuvo conformado por cuatro animales. Los animales de cada grupo fueron
sacrificados a los respectivos tiempos postoperatorios según su grupo. En este
experimento ninguno de los animales murió antes del tiempo destinado para su
sacrificio.

En el momento del sacrificio de las ratas de los grupos 15 min y 1 hora, los
animales no se habían despertado de la anestesia. Aproximadamente a las dos

91

horas después de iniciada la cirugía, las ratas de los grupos de 3 y 6 horas,
despiertan de la anestesia general. Algunas de estas ratas, recién despertadas de
la anestesia, presentan convulsiones intensas. Las convulsiones observadas se
manifiestan con brincos violentos dentro de las cajas de recuperación, e inclusive
la intensidad de las convulsiones provoca que, en algunos casos, las ratas se
salgan de la caja de recuperación. Cabe destacar que las cajas de recuperación
presentan paredes de aprox. 20 cm de alto. Las convulsiones son seguidas de
períodos de reposo. Algunos animales convulsionan más de una vez. Esta
conducta convulsiva no se observó sistemáticamente en cuanto a su intensidad y
otras características de las convulsiones. Tampoco se midió la incidencia de las
mismas en los animales.


4.3.2 Análisis neuroquímicos en estriado dorsal
En la figura 25 se presentan los valores de porcentaje de depleción promedios en
estriado dorsal de los neurotransmisores y los productos del metabolismo de los
neurotransmisores (metabolitos) medidos por HPLC y cómo estos porcentajes de
depleción varían en los tiempos medidos. Por análisis estadístico de ANOVA de
una vía no se encontraron diferencias estadísticamente significativas entre los
grupos experimentales para cada sustancia. Por análisis estadístico de t pareada
de los promedios de cada grupo experimental por cada sustancia no se
encontraron diferencias estadísticamente significativas.

En la figura 25 se puede observar que los valores para el “porcentaje de
depleción” son negativos en los cuatro grupos experimentales, con excepción de
los datos de serotonina. En el cuadro IX del Anexo VI se presentan los datos
individuales de porcentaje de depleción. Los valores negativos para la variable
porcentaje de depleción son indicativos que lo que ocurre no es una disminución
(depleción) de los niveles de estas sustancias en el hemisferio lesionado sino por

92

el contrario un aumento de dichos niveles en el estriado dorsal del hemisferio
lesionado respecto al intacto.



Figura 25: Promedio por grupo del porcentaje de depleción en estriado dorsal, para dopamina,
serotonina y metabolitos a dosis constante de toxina MT-III: 14 g/L, para cada uno de los animales
involucrados en el estudio. Dopamina (DA), ácido 3,4-dihidroxifenilacético (DOPAC), ácido
homovanílico (HVA), serotonina (5-HT) y ácido 5-hidroxi 3-indolacético (5-HIAA).

Entre más negativo sea un porcentaje de depleción, mayores serán las
concentraciones de ese compuesto en el hemisferio intervenido respecto al
hemisferio no intervenido. Con respecto a los niveles de dopamina se puede
observar una tendencia general de disminución en el tiempo de los niveles de este
neurotransmisor (ver figura 25). Con respecto a DOPAC y HVA se puede
observar una tendencia de aumento de los niveles de estos metabolitos entre los
15 y 180 min y luego una tendencia de disminución de sus niveles entre los 180 y
los 360 min. A partir de lo anterior se puede observar que entre los 15 y 180 min,

93

conforme los niveles de dopamina disminuyen en el tiempo en el hemisferio
intervenido, aumentan los niveles de sus metabolitos en el mismo hemisferio (ver
figura 25).

Los niveles de serotonina se ven aumentados en el hemisferio intervenido a los 15
min, luego, a los 60 min se observan semejantes entre los dos hemisferios y a
partir de los 180 min son mayores en el hemisferio no intervenido (ver figura 25).
Respecto al metabolito 5-HIAA, sus niveles se mantienen siempre negativos, es
decir una mayor concentración en el hemisferio intervenido, con un pico a los 60
min. Entre los 15 y 60 min, conforme disminuyen los niveles de serotonina en el
hemisferio intervenido, aumentan los niveles de su metabolito (5-HIAA) en el
hemisferio intervenido.

Los valores de índice de metabolismo para DOPAC y HVA respecto a la
dopamina, para la región de estriado dorsal, en los cuatro grupos experimentales
de tiempo de sacrificio (15, 60, 180 y 360 min) se presentan en la figura 26. En el
cuadro X del Anexo VI se presentan los datos individuales de Índice de
metabolismo. Por análisis estadístico de ANOVA de una vía no se encontraron
diferencias estadísticamente significativas entre los grupos experimentales para
cada sustancia. Por análisis estadístico de t pareada de los promedios de cada
grupo experimental por cada sustancia no se encontraron diferencias
estadísticamente significativas. Por análisis estadístico de la prueba t de los
promedios del IM de cada sustancia de cada grupo experimental se encontraron
diferencias estadísticamente significativas en el en el grupo de IM de DOPAC
respecto a la dopamina a los 180 min (p <0,001) y a los 360 min. En el grupo de
DOPAC/DA a los 15 min en el que el valor promedio de IM es el mayor, no se
encontraron diferencias significativas. Este grupo presenta una variabilidad mayor
que los otros grupos (comparar barras de error en la figura 26 en los promedios de
DOPAC/DA).


94


Figura 26: Promedio por grupo del “Índice de Metabolismo” en estriado dorsal, para la
transformación de DA en cada uno de sus metabolitos DOPAC y HVA respecto a su neurotransmisor
padre, y metabolitos a dosis constante de toxina MT-III: 14 g/L. Dopamina (DA), ácido 3,4-
dihidroxifenilacético (DOPAC), ácido homovanílico (HVA).

En la figura 26 se puede observar una tendencia que los Índices de metabolismo
en todos los grupos son siempre mayores de 100, lo que indica que la actividad
metabólica está aumentada en el hemisferio intervenido respecto al no intervenido.
Los mayores índices de metabolismo se presentan a los 60 min son mayores para
la transformación DA a DOPAC que para la transformación DA a HVA.


4.3.3 Análisis neuroquímicos en estriado ventral y septo
En la figura 27 se muestran los valores de porcentaje de depleción promedios para
dopamina y DOPAC en estriado ventral, medidos por HPLC. Por análisis
estadístico de ANOVA de una vía no se encontraron diferencias estadísticamente
significativas entre los grupos experimentales para cada sustancia. Por análisis
estadístico de t pareada de los promedios de cada grupo experimental por cada
sustancia tampoco se encontraron diferencias estadísticamente significativas. En

95

el cuadro IX del Anexo VI se presentan los datos individuales de porcentaje de
depleción en estriado ventral.

En la figura 27 se puede observar que los porcentajes de depleción” obtenidos en
estriado ventral son negativos para dopamina a los 15 y 360 min y para DOPAC a
todos los tiempos evaluados. Los porcentajes de depleción medidos en estriado
ventral (ver figura 27) son de menores (menos negativos) que los obtenidos en
estriado dorsal (ver figura 25). Los valores negativos para la variable porcentaje
de depleción son indicativos que lo que ocurre no es una disminución (depleción)
de los niveles de estas sustancias en el hemisferio lesionado sino por el contrario
un aumento de dichos niveles en el estriado dorsal del hemisferio lesionado
respecto al intacto.


Figura 27: Porcentaje de depleción en estriado ventral para dopamina (DA) y ácido
hidroxifenilacético (DOPAC) a dosis constante de toxina MT-III: 14 g/L.


96

Los resultados de ácido homovanílico, serotonina y ácido hidroxiindolacético en
estriado ventral no se presentan. La integración de los respectivos
cromatogramas genera áreas muy pequeñas, tanto así que en algunos
cromatogramas no se detecta estos compuestos o que la razón señal / ruido
experimental es grande.

Los valores de índice de metabolismo para DOPAC respecto a la dopamina, para
la región de estriado ventral, en los cuatro grupos experimentales de tiempo de
sacrificio (15, 60, 180 y 360 min) se presentan en la figura 28. En el cuadro X del
Anexo VI se presentan los datos individuales de Índice de metabolismo.



Figura 28: Promedio por grupo del “Índice de Metabolismo” en estriado ventral, para la
transformación de DA en su metabolito DOPAC, a dosis constante de toxina MT-III: 14 g/L.
Dopamina (DA), ácido 3,4-dihidroxifenilacético (DOPAC).

Por análisis estadístico de ANOVA de una vía no se encontraron diferencias
estadísticamente significativas entre los grupos experimentales para cada
sustancia. Por análisis estadístico de la prueba t de los promedios del IM contra el
valor de 100 como índice de actividad metabólica igual entre los dos hemisferio,

97

tampoco se encontraron diferencias estadísticamente significativas en cada grupo
experimental.

En la figura 28 se puede observar una tendencia de aumenta del IM de
DOPAC/DA de los 15 a los 60 minutos y luego una disminución del mismo hacia
los 360 min. A los 15 min se puede observar que el IM es cercano a 100 lo que
indica que la taza de metabolismo es igual entre los dos hemisferios. A los
tiempos de 60 y posteriores este parámetro metabólico es mayor que cien lo que
indica una mayor actividad metabólica en el hemisferio lesionado. Los índices de
metabolismo medidos en estriado dorsal para DOPAC/DA (ver figura 26) son de
una magnitud semejante a los obtenidos para DOPAC/DA en estriado ventral (ver
figura 28).

En el cuadro IX del Anexo VI se presentan los datos individuales de porcentaje de
depleción en septo. En la región septal se observa valores de porcentaje de
depleción promedios de DA y de DOPAC, negativos en los tiempos de 15 a 180
min y positivos a los 360 min. La variabilidad en los datos es muy grande, no se
encontraron diferencias significativas.

Los resultados de ácido homovanílico, serotonina y ácido 5-hidroxiindolacético en
septo no se presentan por las mismas razones planteadas al describir los
resultados en estriado ventral.


4.4 Resultados del tercer experimento.
4.4.1 Descripción general
Como se mencionó anteriormente, en el tercer experimento se contrastó el efecto
por lesión con la miotoxina nativa (MT-III) y por lesión con la miotoxina MT-III

98

alquilada en el sitio catalítico, lo que le bloquea su actividad PLA
2
. La dosis para
la miotoxina nativa como para la alquilada es la misma: 1,4 g en 1 L. El
experimento se corrió contra un grupo control.

Para este experimento se emplearon un total de 38 animales, de un peso entre
176 y 354 gramos distribuidos en tres grupos. El primer grupo (10 animales) se
empleó como control y recibió la inyección de 1 L de solución salina (también en
la pars compacta). Un segundo grupo (13 animales) recibió la inyección de 1 L
de MT-III alquilada a una concentración de 1,4 g/L y un tercer grupo (15
animales) recibió la inyección de 1 L de MT-III nativa a la misma concentración
de 1,4 g/L. Esta dosis se escogió por ser la dosis más alta, probada en el
experimento uno, a la que se puede explorar el efecto conductual y neuroquímico
de la miotoxina nativa sin la mortalidad del 50% que se midió a la dosis de 14 g.

Si bien las mediciones de todas las conductas (espontáneas e inducidas
farmacológicamente) se realizaron para los días 1, 3, 5, 7, 12, 15, 18, 20 y 22
postoperatorios (ver Cuadro I), para la descripción de resultados únicamente se
mostrarán los valores de los días 1, 7, 18, 20 y 22 postoperatorios. Los otros días
presentan valores que no poseen mayor información discriminante de los procesos
subyacentes.


4.4.2 Variación del peso corporal durante el experimento
Un efecto estudiado es el cambio del peso corporal de los animales, entre el día
preoperatorio y el día anterior al sacrificio, entre los diferentes grupos
experimentales. Los promedios por grupo de esta variable se presentan en la
figura 29. Por análisis estadístico de ANOVA de una vía se encontraron
diferencias significativas entre el grupo control y el grupo de toxina alquilada (p =
0,08), así como entre el grupo de toxina nativa y el de toxina alquilada (p =0,04).

99

No se encontraron diferencias significativas entre el grupo control y el de toxina
nativa (p =1). De acuerdo con estos análisis estadísticos, el aumento de peso
promedio de los animales del grupo tratado con toxina alquilada es 24 y 25
gramos menor que la media de los grupos control y de toxina nativa,
respectivamente.


Figura 29: Promedio por grupo de la diferencia del peso corporal entre el día anterior al sacrificio y
el día preoperatorio, para los diferentes grupos de tratamiento: control, miotoxina MT-III nativa 1,4
g (toxina) y miotoxina MT-III alquilada 1,4 g/L (alquilada).

El peso promedio de los animales del grupo de toxina alquilada al inicio del
experimento fue 18 gramos mayor que el del grupo control y 14 gramos mayor que
el del grupo de toxina nativa todos ellos medidos también al inicio del experimento.
El peso promedio final alcanzado por el grupo de toxina alquilada fue de 7 y 12
gramos menor que el alcanzado por los grupos control y de toxina nativa
respectivamente.



100

4.4.3 Conducta de giro
Los resultados obtenidos para la variable de giro neto por grupo se presentan en
la figura 30. En el Cuadro VIII del Anexo VI se presentan los datos individuales de
giro neto.


Figura 30: Promedio por grupo del giro neto durante 20 min por día, en diferentes grupos de
tratamiento: control, miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-III alquilada 1,4 g/L
(alquilada). El valor de cero en el eje de las ordenadas indica la simetría conductual.

Por análisis estadístico multivariable de medidas repetidas para la variable de giro
neto, no se encontraron diferencias significativas entre los tres grupos
experimentales dentro de cada uno de los días de medición de la conducta. No
obstante, mediante un análisis por la prueba t de los promedios de giro neto de
cada grupo por día, contra el valor de cero como simetría de esta conducta, se
encontró un comportamiento estadísticamente diferente entre el grupo control y los
dos grupos tratados con toxina: nativa y alquilada. Para el grupo control, en
ninguno de los días se pudo demostrar estadísticamente la asimetría, mientras en
el grupo tratado con toxina nativa y en el grupo con toxina alquilada sí se demostró
estadísticamente la asimetría conductual en ciertos días. En el grupo con toxina
nativa, se pudo demostrar estadísticamente la asimetría los días 1 (p =0,05;

101

asimetría contralateral); 3 (p =0,001; asimetría contralateral; datos no mostrados
en la figura 30); 20 (p = 0,05; asimetría ipsilateral) y 22 (p = 0,02; asimetría
contralateral). Estos días son en los que se presentan mayores magnitudes de la
conducta de giro neto para el grupo de toxina nativa. En el grupo de toxina
alquilada, se pudo demostrar estadísticamente la asimetría los días 1 (p =0,03;
asimetría contralateral); 3 (p =0,001; asimetría contralateral; datos no mostrados
en la figura 30); 15 (p =0,05; asimetría contralateral; datos no mostrados en la
figura 30) y 20 (p =0,05; asimetría ipsilateral). Estos días son en los que se
presentan mayores magnitudes de la conducta de giro neto para el grupo de
toxina alquilada. Además, en la figura 30 se puede observar que el día 22, el
grupo tratado con toxina nativa presenta un valor negativo marcado para el giro
neto, no obstante no se encontró diferencias significativas (p =0,2) al evaluar
estadísticamente por asimetría.

Un análisis estadístico adicional empleado es el contraste de la prueba t para
medias apareadas, entre días dentro de cada grupo experimental. Esta prueba se
aplicó con el fin de evaluar el cambio que presenta en el tiempo, la variable de giro
neto, dentro de cada grupo experimental. Según este análisis se encontró que en
el grupo control la conducta observada el día 18 postoperatorio es
significativamente diferente solo a la conducta medida los días 1 (p =0,008) y 7 (p
=0,02) y no lo es con la conducta medida los días 20 y 22 postoperatorios. En el
grupo de toxina nativa se encontraron diferencias significativas entre el día 20 con
los días 1 (p =0,02); 7 (p =0,04); 18 (p =0,04) y 22 (p =0,01). En el grupo de
toxina alquilada, se encontraron diferencias significativas entre el día 20 y los días
1 (p =0,03); 7 (p =0,04) y 22 (p =0,03), así también se encontraron diferencias
significativas entre los días 1 y 18 para el grupo de toxina alquilada (p =0,03).

El grupo control, a diferencia de los otros dos grupos, no mostró asimetría
estadísticamente significativa los días evaluados. Tanto para el grupo de toxina
nativa como para el grupo de toxina alquilada la conducta de giro neto es

102

contralateral los días 1 y 3 postoperatorios, simétrica a partir del día 5
postoperatorio, que se mantiene simétrico hasta el día 18 postoperatorio, antes de
la intervención farmacológica. Una excepción a lo anterior es el giro contralateral
medido el día 15 para el grupo intervenido con toxina alquilada (datos no
mostrados en la figura 30).

El día 20 postoperatorio, después de la administración de apomorfina, para los
grupos de toxina nativa y toxina alquilada, el giro neto es ipsilateral y para el día
22, después de la administración de anfetamina, se obtiene una inversión del giro
neto hacia contralateral. En la figura 30 se pueden observar los días 1, 20 y 22
postoperatorios, la tendencia que la magnitud promedio de la asimetría es mayor
para el grupo de toxina nativa en comparación con el grupo de toxina alquilada
(diferencias no significativas estadísticamente).

Tomando como referencia el giro neto que se observa el día 18 para los grupos de
toxina nativa y de toxina alquilada, en ambos grupos la magnitud del cambio del
giro neto hacia contralateral provocado por la anfetamina, es menor que la
magnitud del cambio del giro neto hacia ipsilateral provocado por apomorfina.

A partir de los resultados de la conducta de giro, y la fórmula presentada en la
Figura 7, se calculó el Índice de Asimetría promedio por grupo (IA) para la
conducta de giro (ver figura 31).


103


Figura 31: Promedio por grupo del índice de asimetría de la conducta de giro (IA), durante 20 min
por día, en diferentes grupos de tratamiento: control; miotoxina MT-III nativa 1,4 g (toxina) y
miotoxina MT-III alquilada 1,4 g (alquilada). La línea roja en el valor de 50 indica la simetría
conductual.

Por análisis estadístico multivariable de medidas repetidas para la conducta de IA
del giro, no se obtuvieron diferencias significativas entre los tres grupos
experimentales dentro de cada uno de los días de medición de la conducta. No
obstante, mediante un análisis por la prueba t de los promedios de cada grupo por
día, contra el valor de 50 como simetría conductual, se encontró un
comportamiento diferente entre el grupo control y los dos grupos tratados con
toxina (nativa y alquilada). Para el grupo control, en ninguno de los días se pudo
demostrar estadísticamente la asimetría, mientras en el grupo tratado con toxina
nativa y en el grupo con toxina alquilada sí se demostró estadísticamente la
asimetría conductual en ciertos días. En el grupo con toxina nativa, se pudo
demostrar estadísticamente la asimetría contralateral los días 1 (p =0,04); 3 (p =
0,001; datos no mostrados); 5 (p =0,006; datos no mostrados) y 22 (p =0,02). El
día 20, en el grupo de toxina nativa, la variable de IA no muestra asimetría
estadísticamente significativa (p =0,1) al 95% de confianza; no obstante es el
único día que presenta una tendencia de asimetría ipsilateral. En el grupo de

104

toxina alquilada, se pudo demostrar estadísticamente la asimetría contralateral los
días 1 (p = 0,006); 3 (p =0,001; datos no mostrados); 5 (p = 0,04; datos no
mostrados) y la asimetría ipsilateral el día 20 (p =0,06). El día 22, la tendencia es
de una asimetría contralateral, no obstante las diferencias no son estadísticamente
significativas (p =0,1). La conducta de IA del giro en los grupos tratados con
toxina (nativa y alquilada), muestra asimetría espontánea estadísticamente
significativa desde el día 1 al día 5 postoperatorio, a diferencia de la conducta de
giro neto en la cual la asimetría se pudo demostrar estadísticamente solo hasta el
día 3 postoperatorio.

El contraste de la prueba t para medias apareadas, dentro de cada grupo
experimental, se aplicó los días 1, 7, 18, 20 y 22 postoperatorios, con el fin de
evaluar el cambio en el tiempo de la conducta de IA del giro dentro de cada grupo
experimental. Según este análisis se encontró que en el grupo control la conducta
observada el día 18 postoperatorio es significativamente diferente solo a la
conducta medida los días 1 (p =0,01) y 7 (p =0,05). Así también se encontraron
para el grupo control diferencias entre la conducta de los días 1 y 22 (p =0,005).
En el grupo de toxina nativa se encontraron diferencias significativas entre el día
20 con los días 1 (p =0,03) y 22 (p =0,01). El contraste del día 20 y el día 18,
para el grupo de toxina nativa, no resulta en diferencias significativas al 95% de
confianza (p =0,06). En el grupo de toxina alquilada, se encontraron diferencias
significativas entre el día 1 y el día 7 (p =0,02). El contraste entre el día 1 y el día
18, para el grupo de toxina alquilada, no resulta en diferencias significativas (p =
0,08). Además, en el grupo de toxina alquilada, se encontraron diferencias
significativas entre el día 20 y los días 1 (p =0,01); 7 (p =0,03) y 22 (p =0,004). El
contraste entre los días 18 y 20 para el grupo de toxina alquilada no resulta en
diferencias significativas al 95% de confianza (p =0,1).

Los análisis estadísticos anteriores sobre la variable de IA de la conducta de giro,
indican que el grupo control, a diferencia de los otros dos grupos, no presenta

105

asimetría estadísticamente significativa los días evaluados. Sin embargo si se
presenta un cambio conductual entre el día 1 y los días 7 y 18 postoperatorios (de
valores poco negativos a valores poco positivos). Estos datos son congruentes
con los resultados obtenidos al evaluar la conducta de giro neto, en la cual se
describió un comportamiento diferente para el grupo control respecto a los grupos
intervenidos con toxinas (nativa y alquilada).

Por análisis del IA de la conducta de giro, tanto para el grupo de toxina nativa
como para el grupo de toxina alquilada se pudo demostrar estadísticamente la
asimetría contralateral los días 1, 3 y 5. Además en el grupo de toxina nativa se
demostró la asimetría el día 22 y en el grupo de toxina alquilada el día 20. Estos
resultados muestran un cambio de la conducta para estos dos grupos de una
asimetría contralateral entre los días 1 a 5 postoperatorios a un giro simétrico a
partir del día 7 postoperatorio, que se mantiene simétrico hasta el día 18
postoperatorio, antes de la intervención farmacológica.

El día 20 postoperatorio, después de la administración de apomorfina, para los
grupos de toxina nativa y toxina alquilada, el IA del giro muestra una tendencia de
asimetría ipsilateral en ambos grupos (mucho mayor que en el grupo control), no
obstante la asimetría no es estadísticamente significativa al 95% de confianza (p =
0,1 en el grupo de toxina nativa y p =0,06 en el grupo de toxina alquilada).
Después de la administración de anfetamina el día 22 postoperatorio, se observa
una tendencia de un cambio del IA simétrico del día 18 y del IA ipsilateral del día
20, a un giro contralateral en los dos grupos intervenidos con toxinas (nativa y
alquilada), mientras que el grupo control vuelve a la simetría.

Como se describió anteriormente para la variable de giro neto, los días 1, 20 y 22
muestran una tendencia de una mayor magnitud de esta variable (mayor
asimetría) para el grupo de toxina nativa; pero en diferentes direcciones, a veces
ipsi y a veces contra. Al realizar esta comparación de magnitudes en la variable

106

de IA del giro, los mismos tres días, se encontraron las mismas tendencias,
excepto el día 1 en que la tendencia de la variable IA del giro es inversa a la
descrita para el giro neto entre el grupo de toxina nativa y el de toxina alquilada.

Tomando como referencia el IA del giro simétrico que se midió el día 18 para los
grupos de toxina nativa y de toxina alquilada, la magnitud del cambio del IA del
giro hacia contralateral provocado por la anfetamina, es menor que la magnitud
del cambio del IA del giro hacia ipsilateral provocado por apomorfina. Esto
también se pudo plantear al describir la variable de giro neto.

Otra variable que se analizó es la de giro total (ver figura 32). Como se describió
anteriormente, por análisis estadístico multivariable de medidas repetidas de las
variables giro neto y de IA del giro, no se encontraron diferencias significativas
entre los grupos experimentales dentro de cada uno de los días evaluados, no
obstante, mediante la misma herramienta estadística para la variable giro total (ver
figura 32), se encontraron algunas diferencias estadísticamente significativas.
Estas diferencias en la variable giro total se encontraron el día 1 postoperatorio
entre el grupo de toxina nativa y el grupo de toxina alquilada (p =0,04) y el día 12
entre el grupo control y el grupo de toxina nativa (p =0,02).

Mediante el análisis estadístico de la prueba t de medias apareadas para la
variable giro total, dentro de cada grupo experimental, y que se aplicó los días 1,
7, 18, 20 y 22 postoperatorios se encontró, para los tres grupos experimentales,
que el giro total del día 22 es estadísticamente mayor respecto a los otros días
analizados con un estadístico de p <0,001 en todas las comparaciones. Este
análisis muestra un aumento importante en la expresión general de la conducta de
giro, luego de la administración de anfetamina el día 22 postoperatorio, respecto al
mostrado los otros días.


107


Figura 32: Promedio por grupo del giro total (ipsilateral + contralateral) durante 20 min por día, en
diferentes grupos de tratamiento: control; miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-III
alquilada 1,4 g (alquilada).


En la figura 32 se puede observar que el día 20 postoperatorio, respecto al día 18,
se presenta una tendencia de disminución en la expresión de la conducta de giro
total en los grupos control y de toxina alquilada (diferencias estadísticamente no
significativas). Esta tendencia no se observa en el grupo de toxina nativa que
presentan prácticamente el mismo de valor de giro total entre los días 18 y 20.

Al comparar los resultados de la variable de giro total con las variables que miden
la asimetría de la conducta de giro (giro neto e IA del giro; ver figuras 30 y 31),
entre los días 18 y 20, se encontró que para el grupo control la asimetría
conductual es prácticamente la misma pero las ratas giran menos con apomorfina.
Para el grupo de toxina nativa, si bien giran prácticamente la misma cantidad de
veces, la tendencia es claramente mayor hacia el giro ipsilateral inducido con
apomorfina. En el grupo de toxina alquilada, si bien las ratas giran menos por

108

acción de la apomorfina, éste fármaco induce preferentemente el giro ipsilateral.
En este sentido es importante describir que el día 20, en ambos grupos
intervenidos con toxina (nativa y alquilada), se presenta un aumento de los giros
ipsilaterales y una disminución de los giros contralaterales respecto a los valores
equivalentes de los días 7 a 18 (datos no mostrados). En otras palabras, el día 20
postoperatorio hay menor expresión de la conducta de giro pero la asimetría
conductual aumenta al aumentar los giros ipsilaterales y disminuir los
contralaterales.

El día 22 postoperatorio, se observa un aumento general de la conducta de giro
total luego de la administración de anfetamina (respecto a todos los días
anteriores). La asimetría contralateral medida mediante el análisis de las variables
de giro neto e IA del giro (ver figuras 30 y 31), va acompañada de un mayor
aumento de los giros contralaterales (datos no mostrados). También los giros
ipsilaterales aumentan pero en menor medida que los contralaterales (datos no
mostrados).


4.4.4 Conducta de peritaxis
Los resultados obtenidos para la variable de tiempo neto de peritaxis por grupo se
presentan en la figura 33. En el cuadro IX del Anexo VI se presentan los datos
individuales de tiempo neto de peritaxis. En adelante me referiré a la variable de
tiempo neto de peritaxis como peritaxis neta.


109


Figura 33: Promedio por grupo del tiempo neto de peritaxis durante 20 min por día, en diferentes
grupos de tratamiento: control, miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-III alquilada
1,4 g (alquilada). El valor de cero en el eje de las ordenadas indica la simetría conductual.

Los análisis estadísticos multivariable de medidas repetidas no indicaron
diferencias significativas entre los tres grupos experimentales dentro de cada día,
a excepción del día 22 que se encontraron diferencias significativas entre el grupo
control y el grupo de toxina nativa (p =0,04). Los días 1, 20 y 22 postoperatorios,
el grupo control presenta los menores valores de peritaxis neta, seguido por el de
la toxina alquilada, que presentó siempre una asimetría ipsilateral. El grupo de
toxina nativa presentó una asimetría ipsilateral los días 20 y 22 y mayor que los
otros dos grupos.

En la figura 33 se puede observar que todos los días evaluados los valores de la
variable peritaxis neta son positivos (peritaxis neta ipsilateral) para los tres grupos
(inclusive para el grupo control) con unas pocas excepciones, específicamente
para el grupo de toxina nativa los días 7 y 18 que presentan simetría conductual.


110

Mediante un análisis por la prueba t de los promedios de cada grupo por día,
contra el valor de cero como simetría de la variable de peritaxis neta, se
encontraron diferencias entre el comportamiento del grupo control y los dos grupos
tratados con toxinas (nativa y alquilada). Para el grupo control no se demostró
estadísticamente la asimetría, mientras que en el grupo de toxina nativa de
demostró estadísticamente la asimetría ipsilateral los días 1 (p =0,01); 3 (p =0,03;
datos no mostrados) y 22 (p =0,002). En el grupo de toxina nativa, el día 20
postoperatorio no se demostró la asimetría estadísticamente (p =0,3) y el valor del
error estándar de la media es el más grande de todos los grupos por día. No
obstante, en la figura 33 se puede observar una tendencia una peritaxis neta
ipsilateral prominente para el grupo de toxina nativa el día 20 postoperatorio.

En el grupo de toxina alquilada, por el mismo análisis estadístico descrito en el
párrafo anterior, se demostró estadísticamente la asimetría ipsilateral los días 1 (p
<0,001), 7 (p =0,02) y 22 (p =0,005). A pesar de lo que se observa en la figura
33, en el día 20 postoperatorio no se demostró estadísticamente la asimetría
ipsilateral (p =0,4). Los días 1, 3 (datos no mostrados), 20 y 22, para el grupo de
toxina nativa son los días en que se obtienen los mayores valores de peritaxis neta
ipsilateral para este grupo. Estos cuatro días, además del día 7, son los días que
se presentan los mayores valores de peritaxis neta ipsilateral para el grupo de
toxina alquilada. Los días 1, 3 (datos no mostrados), 7, 20 y 22 son los días en
que el grupo control presenta los mayores valores de la variable peritaxis neta.

Un análisis estadístico adicional empleado es el contraste de la prueba t para
medias apareadas, entre días dentro de cada grupo experimental. Esta prueba
estadística se aplicó para los días 1, 7, 18, 20 y 22 postoperatorios, con el fin de
evaluar el cambio conductual en el tiempo dentro de cada grupo experimental.
Mediante este análisis no se encontraron diferencias significativas entre los días
para el grupo control.


111

En el grupo de toxina nativa, por análisis estadístico de la prueba t para medias
apareadas, se encontró diferencias significativas entre los días 1 y 7 (p =0,01); y 1
y 18 (p =0,01). En la figura 33 se puede observar una tendencia de disminución
de la variable de peritaxis neta de un valor ipsilateral del día 1 a un valor simétrico
a partir del día 5 (datos no mostrados) que se mantiene hacia el día 18. Si bien la
peritaxis neta ipsilateral del día 20, para el grupo de toxina nativa, no es
significativamente diferente a la de los otros días analizados, esta variable muestra
una tendencia de un valor promedio grande (el mayor valor promedio de todos los
grupos en todos los días), con un error estándar de la media también muy grande.
También en el grupo de toxina nativa se encontraron diferencias significativas
entre los días 7 y 22 (p =0,002) y 18 y 22 (p =0,001). El día 22 luego de la
administración de anfetamina se observa una tendencia de aumento importante de
la conducta de peritaxis neta, respecto a los días 7 y 18, semejante en magnitud al
inducido con apomorfina el día 20 (diferencias no significativas). La variabilidad de
los animales del grupo de toxina nativa el día 22 es menor que la medida el día 20
para el mismo grupo.

En el grupo de toxina alquilada, mediante el análisis de t para medias apareadas,
se encontraron diferencias significativas entre los días 1 y 7 (p =0,03), y 1 y 18 (p
= 0,002). La figura 33 muestra una tendencia de disminución gradual de la
simetría ipsilateral de esta conducta hacia el día 18. El día 20 postoperatorio,
después de la administración de apomorfina, en el grupo de toxina alquilada, no se
encontraron diferencias significativas con los otros días, sin embargo se observa
una tendencia de aumento de esta conducta (peritaxis ipsilateral) respecto al valor
promedio del día 18. La magnitud promedio de este aumento es menor a la
medida para el grupo de toxina nativa. Además se encontraron diferencias
significativas entre los días 18 y 22 (p = 0,03). El día 22, después de la
administración de anfetamina, la peritaxis neta ipsilateral aumentó respecto al día
18 y en magnitud un poco mayor (diferencias no significativas) que lo observado el
día 20 también para la toxina alquilada.

112


A partir de los resultados de la conducta de tiempo de peritaxis, se calculó el
Índice de asimetría promedio por grupo (IA) para la conducta de peritaxis (ver
figura 34).

En la figura 34 se puede observar que en general todos los días y en todos los
grupos, la asimetría de la conducta de peritaxis es ipsilateral. Esto es diferente a
los resultados obtenidos para la conducta de giro (ver figura 31), en la cual la
asimetría conductual es en general primero contralateral (día 1 y siguientes), luego
ipsilateral (día 20) y finalmente contralateral (día 22).



Figura 34: Promedio por grupo del índice de asimetría de la conducta de peritaxis (IA), durante 20
min por día, en diferentes grupos de tratamiento: control, miotoxina MT-III nativa 1,4 g (toxina) y
miotoxina MT-III alquilada 1,4 g (alquilada). La línea roja en el valor de 50 indica la simetría
conductual.

Por análisis estadístico multivariable de medidas repetidas no se obtuvieron
diferencias significativas entre los tres grupos experimentales dentro de cada uno
de los días de medición de la conducta, a excepción del día 22 en que se

113

encontraron diferencias significativas entre el grupo control y el grupo de toxina
alquilada (p =0,04).

Mediante un análisis por la prueba t de los promedios de cada grupo por día,
contra el valor de 50 como simetría de la variable de índice de asimetría, se
encontró un comportamiento diferente para el grupo control respecto a los otros
grupos intervenidos con toxina (nativa y alquilada). En el grupo control, se pudo
demostrar estadísticamente la asimetría ipsilateral únicamente los primeros tres
días evaluados, a saber los días 1 (p =0,02); 3 (p =0,01; datos no mostrados) y 5
(p =0,02; datos no mostrados). En la figura 34 se puede observar para el grupo
control que la ipsilateralidad disminuye entre el día 1 y el día 18 postoperatorios;
pero siempre la simetría es ipsilateral. El día 20 el grupo control presenta un
aumento del IA (estadísticamente no se demuestra la asimetría ipsilateral) de
magnitud similar al grupo de toxina nativa y un poco mayor al grupo de toxina
alquilada. El día 22 el IA del grupo control desciende, respecto al día 20, a
valores similares a los medidos el día 18 postoperatorio.

En el grupo de toxina nativa, mediante análisis de la prueba t, se pudo demostrar
estadísticamente la asimetría los días 1 (p = 0,004); 3 (p = 0,02; datos no
mostrados) y también el día 22 (p <0,001). La tendencia de esta variable para el
grupo de toxina nativa es de una disminución gradual de la asimetría del día 1 al
día 7, donde la variable indica la simetría conductual. A partir del día 7 y hasta el
día 18 estadísticamente se encontró que la conducta es simétrica. Contrario a la
tendencia que se pude observar en la figura 34, el día 20 no se demostró
estadísticamente la asimetría ipsilateral (p =0,1) para el grupo de toxina nativa; no
obstante el valor promedio de IA para el grupo de toxina nativa, este día es de los
valores más grandes de todos los grupos. El día 20, el grupo de toxina nativa
presenta un error estándar de la media muy grande en comparación con los de los
otros grupos. El día 22, se demostró estadísticamente la asimetría ipsilateral en el
grupo de toxina nativa (p <0,001). Los valores promedio de IA para los días 20 y

114

22 en el grupo de toxina nativa son mayores que los medidos el día 18 y el valor
de IA del día 22 es mayor que el medido el día 20.

En el grupo de toxina alquilada, el análisis estadístico por la prueba t, permite
demostrar estadísticamente la asimetría ipsilateral los días 1 (p <0,001); 3 (p =
0,08; datos no mostrados); 5 (p =0,05; datos no mostrados), 7 (p =0,05) y 22 (p =
0,001). La simetría se midió a partir del día 12 y hasta el día 18. El día 20 para el
grupo de toxina alquilada no se demostró estadísticamente la asimetría ipsilateral
(p =0,3), no obstante el grupo de toxina alquilada presenta el día 20, después de
la administración de apomorfina, una tendencia de aumento de la asimetría
ipsilateral respecto del valor medido el día 18. El día 22 se encontraron
diferencias estadísticamente significativas en el grupo de toxina alquilada (p =
0,001). El valor de IA para este día en el grupo de toxina alquilada es el mayor
valor de IA que presentó este grupo en el experimento. Este valor de IA ipsilateral
para el grupo de toxina alquilada es de magnitud similar al medido el primer día
postoperatorio para el grupo de toxina alquilada (las diferencias estadísticamente
no significativas).

En la figura 34 se puede observar también, para los dos grupos intervenidos con
toxina (nativa y alquilada), que la magnitud del cambio del IA del día 18 al día 20
postoperatorio es menor que la magnitud de cambio del IA del día 18 al día 22
postoperatorio. Tanto en el día 20 como en el día 22, el grupo de toxina nativa
presenta mayores valores de IA que el de toxina alquilada. Es interesante
describir, para el día 20, que el valor de IA del grupo control es mayor que en el
grupo de toxina alquilada. El día 20 no se pudo demostrar estadísticamente la
asimetría ipsilateral en el grupo control ni en los otros dos grupos.

El contraste de la prueba t para medias apareadas, dentro de cada grupo
experimental, se aplicó los días 1, 7, 18, 20 y 22 postoperatorios, con el fin de
evaluar estadísticamente el cambio en el tiempo, para la variable IA de la peritaxis,

115

dentro de cada grupo. Mediante este análisis estadístico se encontraron
diferencias entre el grupo control y los otros grupos intervenidos con toxinas
(nativa y alquilada). Los resultados de prueba estadística indican que no hay
diferencias significativas entre los días dentro del grupo control. En el grupo de
toxina nativa se encontraron diferencias significativas entre el día 1 con los días 7
y 18 (en ambas comparaciones, p =0,01). Este gráfico muestra una disminución
del IA del día 1 hacia los días 7 y 18 postoperatorios. Además, en el grupo de
toxina nativa se encontraron diferencias significativas entre el día 22 y los días 7 (p
=0,002) y 18 (p =0,001). Este análisis permite corroborar estadísticamente que el
IA del día 22 es mayor que el IA de los días 7 y 18. En el grupo de toxina
alquilada se encontraron diferencias significativas entre el día 1 y los días 7 (p =
0,03) y 18 (p =0,002). El IA disminuye entre el día 1 al 7, al igual que en los
demás grupos experimentales. El valor de IA del día 18 para el grupo de toxina
alquilada no es diferente estadísticamente al medido el día 7 para el mismo grupo.
Además entre el día 18 y el día 22 se encontraron diferencias significativas (p =
0,03) en el grupo de toxina alquilada, siendo mayor el valor del día 22 (mayor
asimetría ipsilateral de la peritaxis).

En todos los grupos se da una tendencia a la disminución de la asimetría
ipsilateral de la peritaxis (ver figuras 33 y 34) en los días sin tratamiento
farmacológico, desde el día 1 al día 18. Esta disminución además está
acompañada de una disminución de la expresión total de la peritaxis en tiempo o
peritaxis total (ver figura 35).


116


Figura 35: Promedio por grupo del tiempo total de peritaxis durante 20 min por día, en diferentes
grupos de tratamiento: control; miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-III alquilada
1,4 g (alquilada).

Por análisis estadístico multivariable de medidas repetidas de la variable peritaxis
total, que compara la variable entre los grupos dentro de cada día, se encontraron
diferencias estadísticamente significativas únicamente para la variable de peritaxis
total, el día 22 entre el grupo de toxina nativa y el grupo de toxina alquilada (p =
0,05). El día 20, la tendencia observada de un valor alto de peritaxis total para el
grupo de toxina nativa respecto al de los otros grupos el mismo día, no es
estadísticamente significativo.

Mediante el análisis estadístico de la prueba t de medias apareadas, para la
variable de peritaxis total, dentro de cada grupo experimental, y que se aplicó los
días 1,7, 18, 20 y 22 postoperatorio se obtuvo un comportamiento diferente para el
grupo control respecto a los grupos intervenidos con toxinas (nativa y alquilada).
En el grupo control se encontraron diferencias significativas únicamente entre el
día 18 y los días 1 (p =0,006) y 7 (p =0,001). No se encontraron diferencias
significativas en el grupo control los días 20 y 22, entre ellos ni respectos a los
otros tres días evaluados en esta prueba estadística. El grupo control presenta

117

entre los días 3 y 18 los mayores valores de peritaxis total, entre los grupos cada
día. Inclusive el día 22, la peritaxis del grupo control es mayor que la del grupo
lesionado con toxina alquilada. En la figura 35 se puede observar una tendencia
del comportamiento del grupo control de una disminución gradual de la variable
peritaxis total del día uno al día 18, donde alcanza sus valores mínimos. Los días
20 y 22, el grupo control presenta un aumento en la peritaxis total respecto al
medido el día 18 (ninguna de estas comparaciones es estadísticamente
significativa).

En la figura 35, en el grupo de toxina nativa, se observa al igual que para los otros
grupos experimentales, una disminución gradual de la conducta total de peritaxis
entre el día 1 y el día 18. Mediante un análisis estadístico de la prueba t de
medias apareadas, dentro del grupo de toxina nativa se encontraron diferencias
estadísticamente significativas entre el día 1 y los días 7 (p =0,006) y 18 (p <
0,001). El día 20, en el grupo de toxina nativa, después de la administración de
apomorfina, la peritaxis total se ve incrementada de forma importante respecto al
valor presentado el día 18 (p =0,05). El valor de peritaxis total presentado el día
22 para el grupo de toxina nativa, es significativamente diferente del presentado
los días 7 (p =0,04) y 18 (p =0,001). La peritaxis total del día 20 en el grupo de
toxina nativa es en tendencia, mayor que la presenta el día 22 por el mismo grupo
(diferencias no significativas). En la figura 3 se puede observar que los valores de
peritaxis total, los días 20 y 22 son los mayores presentados entre todos los
grupos, cada día. Este aumento de la peritaxis ipsilateral, los días 20 y 22, se
acompaña de un aumento de las peritaxis contralaterales y de las peritaxis
ipsilaterales, esta última en mayor medida (datos no mostrados).

En la figura 35, en el grupo de toxina alquilada se puede observar una disminución
gradual de la conducta total de peritaxis entre el día 1 y el día 18, descrita también
para los otros dos grupos. Mediante un análisis estadístico de la prueba t de
medias apareadas, en el grupo de toxina alquilada, se encontraron diferencias

118

estadísticamente significativas entre el día 18 y los días 1 (p =0,003) y 7 (p <
0,001). El día 20, en el grupo de toxina alquilada, después de la administración de
apomorfina, la peritaxis total no es significativamente diferente respecto al valor
presentado el día 18, aunque sí mayor. El día 22, en el grupo de toxina alquilada,
después de la administración de anfetamina, la peritaxis total no es
significativamente diferente respecto los valores presentados los días 18 ni del 20,
aunque de una tendencia levemente mayor respecto al día 18 y levemente menor
respecto al día 20. Los días 20 y 22 se observó, respecto al día 18, un aumento
de las peritaxis ipsilaterales, mientras las peritaxis contralaterales se encuentra
prácticamente constantes (datos no mostrados).


4.4.5 Conducta de locomoción
En la figura 36 se pueden observar los valores promedios de la conducta de
locomoción representada como el número total de cruces. En el Cuadro X del
Anexo VI se presentan los datos individuales de la conducta de locomoción.

Por análisis estadístico multivariable de medidas repetidas no se encontró
diferencias significativas entre los tres grupos experimentales dentro de cada uno
de los días de medición de la conducta. En la figura 36 se puede observar que
durante los días del comportamiento espontáneo, el grupo control presenta en
general valores levemente mayores que los de los otros dos grupos, así también
en el día 22. Por otro lado los valores de los dos grupos de toxinas son muy
similares entre sí en los días espontáneos analizados.


119


Figura 36: Promedio por grupo de la conducta de locomoción como el número total de cruces de
cuadrantes virtuales del campo abierto, durante 20 minutos por día, en diferentes grupos de
tratamiento: control, miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-III alquilada 1,4 g
(alquilada).

En la figura 36, se puede observar en los días 1, 18, 20 y 22 una mayor
locomoción para el grupo de toxina nativa respecto al grupo de toxina alquilada,
estas diferencias no son estadísticamente significativas. Aún en el día 22, en que
la magnitud promedio de esta diferencia es mayor, las diferencias no son
significativas entre el grupo control y el grupo de toxina alquilada (p =0,1), ni entre
el grupo de toxina nativa y el grupo de toxina alquilada (p =0,09).

Mediante un análisis estadístico de la prueba t para medias apareadas, entre los
días 1, 7 y 18, dentro de cada grupo experimental, no se encontraron diferencias
significativas dentro del grupo control entre los días, ni dentro del grupo de toxina
nativa ni para el grupo de toxina alquilada.

En el día 20 postoperatorio se observa una tendencia de disminución, en los tres
grupos experimentales, de la conducta de locomoción respecto a los valores

120

medidos el día 18. En esta comparación entre estos dos días se encontraron
diferencias significativas únicamente en el grupo de toxina alquilada (p =0,02).

La locomoción mayor que presentan los tres grupos experimentales el día 22
respecto a todos los otros días evaluados es significativamente diferente y mayor
(p =0,001 en todas las comparaciones). El día 22 se observa una tendencia de
mayor locomoción para el grupo control que para el grupo de toxina nativa y ésta a
su vez mayor que la que presenta el grupo de toxina alquilada (las diferencias
observadas no son estadísticamente significativas)


4.4.6 Conducta de exploración
En la figura 37 se presentan los resultados obtenidos para la variable de tiempo de
exploración promedio por grupo, los diferentes días que se realizaron las
mediciones. En el Cuadro XI del Anexo VI se presentan los datos individuales de
tiempo de exploración

En la figura 37 se puede observar que el comportamiento de los tres grupos
experimentales dentro de los días de conducta espontánea (entre los días 1 a 18)
presenta una tendencia de aumento de la conducta para los tres grupos
experimentales. Esta tendencia es menos clara en el grupo control con valores
extremos como el que se midió el día 12 postoperatorio. Los valores de
exploración del día 18, son significativamente mayores respecto de los medidos el
día 1 para los tres grupos experimentales: control (p =0,02), toxina nativa (p <
0,001) y toxina alquilada (p =0,002). Este aumento es mayor en el grupo de
toxina nativa.


121


Figura 37: Promedio por grupo del tiempo total de exploración durante 20 minutos por día, en
diferentes grupos de tratamiento: control, miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-III
alquilada 1,4 g/L (alquilada).

El grupo control presenta todos estos los días de expresión de la conducta
espontánea, excepto el día 18, el mayor valor de la variable de exploración. Por
análisis estadístico multivariable de medidas repetidas se encontraron diferencias
significativas el día 12 entre el grupo control y los grupos de toxina nativa (p
=0,006) y de toxina alquilada (p =0,004), así también el día 18 entre el grupo de
toxina nativa y el grupo de toxina alquilada (p =0,02).

El día 20 postoperatorio, se presenta una disminución marcada de la expresión de
la conducta de exploración, respecto a los niveles presentados espontáneamente
el día 18, a niveles muy bajos en los tres grupos experimentales (p <0,001; en
todas las comparaciones con los días 1, 7, 12, 18 y 22). El patrón relativo de
intensidades de la conducta de exploración observado para el día 18, (mayor
tiempo de exploración en el grupo de toxina nativa, menor en el control y menor en
el de toxina alquilada), se reproduce el día 20 postoperatorio. Por análisis
estadístico de t pareada de los promedios de la disminución conductual entre el

122

día 18 y el 20, no se encontró diferencias significativas entre los grupos
experimentales, es decir que la diminución de la conducta de exploración entre el
día 18 y el 20 es similar entre los tres grupos experimentales.

El día 22 la conducta de exploración presenta para los tres grupos experimentales
mayores valores a los medidos el día 20 y menores a los medidos el día 18. En
los tres grupos experimentales, se reproduce el patrón relativo de intensidades
entre los grupos, descrito para los días 18 y 20 postoperatorios. El día 22
postoperatorio se encontraron diferencias significativas entre el grupo de toxina
alquilada y los grupos control (p =0,04) y de toxina nativa (p =0,02). El día 22 la
exploración que presenta el grupo de toxina alquilada es significativamente
diferente de la que presenta el mismo grupo el día 18 (p =0,001) y mayor que la
que se presenta el día 20 (p =0,001).

El análisis de los resultados de la conducta de exploración basado en la variable:
número total de exploraciones durante 20 minutos por día, produjo resultados
similares a los análisis presentados anteriormente para la variable: tiempo total de
exploraciones durante 20 minutos por día y por esto no se presentan.


4.4.7 Conducta de acicalamiento
En la figura 38 se presentan los resultados obtenidos para la variable de tiempo de
limpieza promedio por grupo, los diferentes días que se realizaron las mediciones.
En el Cuadro XII del Anexo VI se presentan los datos individuales de tiempo de
limpieza.

123


Figura 38: Promedio por grupo del tiempo total en acicalamiento durante 20 minutos por día, en
diferentes grupos de tratamiento: control, miotoxina MT-III nativa 1,4 g (toxina) y miotoxina MT-III
alquilada 1,4 g/L (alquilada).

Mediante análisis estadístico multivariable de medidas repetidas no se
encontraron diferencias estadísticamente significativas entre los grupos
experimentales dentro de los días. Respecto al comportamiento de la variable de
limpieza (tendencia relativa) entre los grupos experimentales dentro de cada día,
la tendencia observada no es clara. Hay días (18, 20 y 22) en los que el mayor
valor de esta conducta lo presenta el grupo de toxina nativa y otros días (1, 7 y 12)
en los que el mayor valor lo presenta el grupo de toxina alquilada. Cabe destacar
que casi todos los días el grupo control presenta los menores valores de la
conducta de limpieza dentro de cada día.

En general se presenta un patrón de picos en que el acicalamiento aumenta del
día 1 al 7 en todos los grupos. Luego se observa en la figura 38 una caída
importante del acicalamiento el día 12. Los valores altos del día 7 no se vuelven a
obtener hacia el día 18 postoperatorio. Por análisis estadístico de t pareadas se
encontró diferencias significativas entre el día 1 y el día 7 tanto para el grupo de

124

toxina nativa (p =0,001) como para el de toxina alquilada (p =0,03). No se
encontró diferencias, en este sentido, en el grupo control. Por análisis estadístico
de t para medias apareadas, se encontró diferencias significativas dentro del
grupo de toxina nativa (p =0,002) y dentro del grupo de toxina alquilada (p =
0,001) entre los días 7 y 12. En el grupo control, el contraste de estos días no
genera diferencias significativas (p =0,2).

Entre el día 12 y el día 18, en los tres grupos no se encontró diferencias
significativas y gráficamente se observa promedios muy similares. En el grupo de
toxina alquilada se observa una disminución de la conducta entre estos dos días
(diferencias no son significativas).

Los valores de limpieza del día 20 caen abruptamente a niveles muy bajos (menos
de 8 s en los 20 min de medición) para los tres grupos experimentales, en
comparación con todos los días anteriores. Por análisis de t para medias
apareadas, se encontró que los valores del día 20, para los tres grupos son
significativamente diferentes de todos los valores de los otros días incluyendo el
día 22 (p <0,001 en todas las comparaciones).

Los valores bajos de limpieza medidos el día 22 postoperatorio (menos de 45 s en
los 20 min de medición), para los tres grupos experimentales, son menores en
comparación con todos los días de la medición espontánea, entre el 1 y el 18 (p <
0,001 en todos los casos). El día 22 postoperatorio se presenta una mayor
conducta de limpieza para los tres grupos experimentales que la medida el día 20
también para los tres grupos (p <0,001 en todas las comparaciones).

El análisis de los resultados de la conducta de limpieza basado en la variable:
número total de limpiezas durante 20 minutos por día, produjo resultados similares
a los análisis presentados anteriormente para la variable: tiempo total de limpieza
durante 20 minutos por día y por esto no se presentan.

125



4.4.8 Análisis neuroquímicos
En la figura 39 se presentan los valores de porcentajes de depleción promedios en
estriado dorsal de los neurotransmisores y metabolitos medidos por HPLC. En
esta figura se puede observar que la mayoría de los valores son positivos, lo que
indica una disminución de cada neurotransmisor y/o metabolito en el hemisferio
intervenido respecto al no intervenido.


Figura 39: Promedio por grupo del porcentaje de depleción para cada metabolito, en los diferentes
grupos de tratamiento: control, miotoxina MT-III 1,4 g/L y miotoxina MT-III alquilada 1,4 g/L en
estriado dorsal.

Como era de esperarse, los porcentajes de depleción fueron en todos los casos
menores para el grupo control, que para los otros dos grupos experimentales. En
la figura 39 se puede observar también que los mayores valores de porcentaje de
depleción son para norepinefrina (NE), dopamina (DA) y DOPAC, en los grupos
intervenidos con toxina nativa y con toxina alquilada. Por análisis estadístico de
ANOVA de una vía se encontró que el grupo control es estadísticamente diferente

126

en el porcentaje de depleción de norepinefrina al contrastarlo con el grupo de
toxina nativa (p =0,01), no así al contrastarlo con el grupo de toxina alquilada (p =
0,1). Respecto al porcentaje de depleción de dopamina en el grupo control, éste
es diferente del obtenido en el grupo de toxina nativa (p =0,006) y también con el
del grupo de toxina alquilada (p =0,01). Si bien, en la figura 39 se observa una
tendencia de mayores porcentajes de depleción de DOPAC en los grupos
intervenidos con toxinas (nativa y control) respecto al grupo control, las diferencias
no son estadísticamente significativas. No se encontraron diferencias
significativas entre los porcentajes de depleción de la serotonina (5-HT) y el HVA
entre los tres grupos experimentales.

El porcentaje de depleción de dopamina en estriado dorsal se tomó como una
medida del grado de lesión del sistema dopaminérgico nigroestriatal en los
animales. Para el grupo intervenido con toxina nativa se obtuvo un porcentaje de
lesión promedio de 28 ±11 %; con un ámbito que osciló de -1 a 61 %. Para el
grupo intervenido con toxina alquilada se calculó un porcentaje de lesión promedio
de 27 ±12 %; con un ámbito que osciló de -6 a 65 %. Para el grupo control, se
obtuvo un porcentaje de lesión promedio de 4 ±8 %; con un ámbito que oscila de -
17 a 17 %.

En la figura 40 se presentan los valores de porcentaje de depleción en estriado
ventral. En general las depleciones en estriado ventral son menores que las
obtenidas en estriado dorsal, excepto para HVA que los dos grupos intervenidos
con toxina presentan depleciones mayores en estriado ventral.

En la figura 40 se puede observar que los mayores valores de porcentaje de
depleción son para DOPAC, en los grupos control y el intervenido con toxina
nativa. No obstante por análisis estadístico de ANOVA de una vía no se
encontraron diferencias significativas entre los porcentajes de depleción para un
mismo analito entre los grupos experimentales.

127



Figura 40: Promedio por grupo del porcentaje de depleción para cada metabolito, en los diferentes
grupos de tratamiento: control, miotoxina MT-III 1,4 g/L y miotoxina MT-III alquilada 1,4 g/L en
estriado ventral.

Al comparar los valores de porcentaje de depleción entre estriado ventral y dorsal,
principalmente de norepinefrina, dopamina y DOPAC, en los grupos tratados con
toxinas (nativa y alquilada), se observa una tendencia de mayores valores en
estriado dorsal respecto al estriado ventral. Estas tendencias se corroboran
estadísticamente mediante un análisis t de medias apareadas. Según este
análisis en el grupo tratado con toxina nativa el porcentaje de depleción de
norepinefrina es significativamente mayor en estriado dorsal (p = 0,01) y el
porcentaje de depleción de dopamina es significativamente mayor en estriado
dorsal (p =0,05). No se encontraron diferencias significativas para los porcentajes
de depleción de DOPAC entre estriado ventral y estriado dorsal en el grupo
tratado con toxina nativa. Mediante el análisis de t de medias apareadas, en el
grupo tratado con toxina alquilada el porcentaje de depleción de norepinefrina es
significativamente mayor en estriado dorsal (p =0,06) y el porcentaje de depleción
de dopamina es significativamente mayor en estriado dorsal (p =0,002). No se
encontraron diferencias significativas para los porcentajes de depleción de

128

DOPAC entre estriado ventral y estriado dorsal en el grupo tratado con toxina
alquilada.

En el Cuadro XIII del Anexo V se presentan los datos individuales de porcentaje
de depleción

El porcentaje de depleción en estriado dorsal para dopamina (porcentaje de
lesión) se contrastó, mediante la prueba de correlación de Pearson, con el giro
neto obtenidos los días 1, 18, 20 y 22, para cada uno de los tres grupos
experimentales (control, toxina nativa y toxina alquilada). De las doce
comparaciones evaluadas, únicamente se encontró una correlación
estadísticamente significativa entre el giro neto del día 20 del grupo tratado con
toxina nativa y el porcentaje de lesión de los animales. La relación encontrada es
inversa y es fuerte (r =-0,59; p =0,02). Es decir, que el día 20, en el grupo tratado
con toxina nativa entre mayor es el porcentaje de lesión menor es giro neto
ipsilateral. De acuerdo con el coeficiente de correlación de Pearson, hay un 59%
de certeza en esta correlación.

Un contraste semejante al descrito en el párrafo anterior se realizó entre el
porcentaje de lesión y el tiempo de peritaxis neta, obtenidos los días 1, 18, 20 y
22, para cada uno de los tres grupos experimentales (control, toxina nativa y
toxina alquilada). En ninguna de las doce comparaciones evaluadas se encontró
una correlación estadísticamente significativa.

Los valores del índice de metabolismo para DOPAC y HVA respecto a la
dopamina, para las regiones de estriado ventral y estriado dorsal, en los tres
grupos experimentales (control, toxina nativa y toxina alquilada) se presentan en la
figura 41.



129


Figura 41: Promedio por grupo del índice de metabolismo para DOPAC y HVA, en los diferentes
grupos de tratamiento: control, miotoxina MT-III 1,4 g/L y miotoxina MT-III alquilada 1,4 g/L,
tanto en estriado ventral como dorsal. La línea roja en el valor de índice de metabolismo = 100,
representa el valor de igual actividad metabólica en los hemisferios.

Respecto al grupo control, no se encontró diferencias significativas entre los IM de
DOPAC y HVA, entre las regiones de estriado dorsal y ventral. Tampoco se
encontraron diferencias significativas por comparación de los IM del grupo control,
contra el valor de 100, como indicador de igual actividad metabólica entre los
hemisferios cerebrales.

En la figura 41, se puede observar que los mayores valores de índice de
metabolismo (IM) se obtuvieron para el DOPAC, en los grupos de toxina nativa y
de toxina alquilada en la región de estriado dorsal.

En el caso del grupo intervenido con toxina nativa, el IM de DOPAC/DA es
significativamente diferente de los IM, también para el grupo de toxina nativa en la

130

región ventral para DOPAC (p =0,001), en la región dorsal para HVA (p =0,001) y
en la región ventral para HVA (p = 0,003). El IM para DOPAC en la región dorsal
para el grupo de toxina es mayor que 100 y significativamente diferente del valor
100 (p =0,001).

En el caso del grupo intervenido con toxina alquilada, el IM de DOPAC/DA en la
región dorsal, es mayor respecto al IM de DOPAC/DA de la región ventral (p
=0,02). El IM de DOPAC/DA en la región dorsal es mayor que el IM HVA/DA,
también en la región dorsal (p =0,004). El IM de DOPAC/DA en la región dorsal
es mayor que 100 y significativamente diferente del valor 100 (p =0,003).

4.4.9 Análisis histológicos
Cada muestra cerebral se preparó para su segmentación del modo como se
describió previamente en el apartado 3.11. Además, cada tejido se montó en la
“platina porta-muestras” de tal forma que los cortes obtenidos fueran de su plano
coronal; y con apoyo del Atlas “The Rat Brain in Stereotaxic Coordinates” (Paxinos
y Watson, 1998), se ajustó el ángulo de corte de cada muestra hasta obtener
secciones paralelas a los planos observados en el Atlas. Asimismo, se inició la
recolección de los cortes a partir de la aparición de la cicatriz de la cánula en cada
muestra (ver figura 42).


131


Figura 42: Fotografía de una muestra de cerebro de rata preservada en formalina con
amortiguador de fosfatos, colocada en el micrótomo.
El recuadro inferior en aumento muestra un corte coronal y con las flechas rojas se señala la
cicatriz de la cánula (dorso ventral) que se observa desde la corteza hasta la SNpc, en el
hemisferio izquierdo (a la derecha en la fotografía).


La realización de los cortes histológicos, la tinción de los mismos y la ubicación
estereotáxica de la llegada de la cánula fue realizada por la Ingeniera Adriana
Saborío Arce, como parte de los objetivos de su Trabajo Final de Graduación para
optar por el grado de Bachiller en Biotecnología (Saborío, 2008). Uno de sus
objetivos eran la evaluación y optimización de diferentes técnicas histológicas para
la observación de tejido cerebral de rata, con aplicación al modelo animal de lesión
con MT-III en SNpc que nos ocupa.

En todos los cortes histológicos de todos los animales se observó claramente la
cicatriz de la cánula introducida así como el sitio en el que llegó la cánula. A
manera de un ejemplo se presenta la cicatriz y el sitio de llegada de la cánula en
un corte histológico, con tinción de hematoxilina / eosina (ver figura 43).


132



Figura 43: Microfotografía de un corte coronal de un cerebro de rata con lesión en SNpc con MTII
nativa, que muestra la línea de la cicatriz. La tinción empleada es con hematoxilina / eosina
(aumento 40X).
Las zonas señaladas corresponden a la sustancia nigra compacta porción dorsal (SNpc), sustancia
nigra reticulada (SNpr); pedúnculo cerebral (cp); giro dentado (DG). La flecha roja muestra la línea
de la cicatriz. Reproducido con permiso de Saborío, 2008


En la figura 44, se puede observar un corte con un lente objetivo de mayor
aumento (400X). En el mismo se resalta un soma neuronal (encerrado en un
círculo), núcleos de astrocitos (encerrados en cuadrados) y células de microglia y
astrocitos (encerrados en el triángulo), que se originaron como consecuencia de la
lesión de la cánula. La flecha roja señala depósitos de hemosiderina.


c cp p
D DG G


S SN Np pr r
S SN Np pc c


Interaural: 3.40 mm
Bregma: -5.60 mm

133


Figura 44: Microfotografía de un corte coronal de un cerebro de rata con lesión en SNpc con MTII,
que muestra la línea de la cicatriz y el sitio de llegada de la cánula justo en SNpc. La tinción
empleada es con hematoxilina / eosina (Aumento 400X). Reproducido con permiso de Saborío,
2008.

En las figuras 45 y 46 se muestra, en los planos coronales de Bregma -5,60 mm y
Bregma -6,04 mm respectivamente, los resultados del sitio en que llegaron las
cánulas de cada uno de los animales operados en el experimento tres. Los trazos
de colores corresponden, al punto de llegada de las cánulas de los diferentes
grupos de tratamiento: control (rojo, solución salina), miotoxina III nativa de
Bothrops asper (verde), y la miotoxina III alquilada (azul). Los diagramas de las
figuras 45 y 46 se presentan en posición anatómica por lo que a la izquierda de las
figuras se presenta el hemisferio derecho y a la derecha de las figuras el
hemisferio izquierdo.

134



Figura 45: Corte coronal a Bregma -5.60 mm, interaural 3,40 mm (modificado de Paxinos &
Watson, 1998), en el que se muestran los resultados de la llegada de las cánulas.
SNpc: Sustancia nigra pars compacta. Las flechas indican la ubicación de la SNpc. Ventral a la
SNpc se encuentra la SNpr. Tomado y modificado con permiso de Saborío (2008).

En la figura 45 los animales de los grupos intervenidos con toxina alquilada y
nativa que se representan en colores azul y verde respectivamente presentan el
sitio de llegada de la cánula propiamente en la SNpc o en sitios muy cercanos. En
tres de los animales lesionados con la miotoxina sin alquilar, se observa la cánula
cercana a la SNpr.
rojo: control
verde: miotoxina
azul: toxina alquilada
SNpc

135



Figura 46: Corte coronal a Bregma -6,04 mm, interaural 2,96 mm (modificado de Paxinos &
Watson, 1998), en el que se muestran los resultados de la llegada de las cánulas.
SNpc: Sustancia nigra pars compacta. Las flechas indican la ubicación de la SNpc. Ventral a la
SNpc se encuentra la SNpr. Tomado y modificado con permiso de Saborío (2008).

En la figura 46 los animales de los grupos intervenidos con toxina alquilada y
nativa que se representan en colores azul y verde respectivamente presentan el
sitio de llegada de la cánula propiamente en la SNpc o en sitios muy cercanos con
unas pocas excepciones. El animal intervenido con toxina alquilada (en azul) que
se observa más ventralmente en el hemisferio derecho destaca entre los otros
animales de su grupo por ser el que presenta el giro neto más ipsilateral luego de
la administración de apomorfina. En el hemisferio izquierdo destaca el individuo
intervenido con toxina sin alquilar (en verde) que se observa más dorsalmente.
Este animal presenta el giro neto más contralateral de su grupo luego de la
administración de apomorfina.
rojo: control
verde: miotoxina
azul: toxina alquilada
SNpc

136



137

CAPÍTULO V
5. DISCUSIÓN DE RESULTADOS Y CONCLUSIONES

5.1 Metodología cromatográfica por HPLC/ED
La metodología cromatográfica, desarrollada en este proyecto, permite la
determinación simultánea de norepinefrina, dopamina, ácido 3,4-
dihidroxifenilacético (DOPAC), ácido homovanílico (HVA), serotonina y ácido 5-
hidroxi 3-indolacético en tejido cerebral, empleando 3,4-dihidroxibenzilamina
(DHBA) como estándar interno.

Las regiones cerebrales que se analizaron (estriado ventral y dorsal) son
principalmente sitios de llegada de dopamina, por lo que los niveles de
norepinefrina, serotonina y 5-HIAA son bajos (Kandel et al, 2000). La
determinación de dopamina y DOPAC se logró muy eficazmente pues los picos
cromatográficos obtenidos son grandes. Para la determinación de norepinefrina,
ácido homovanílico, serotonina y 5-HIAA se aumentó electrónicamente la
sensibilidad del detector lo que consecuentemente aumenta la razón señal / ruido
y con ello el error instrumental de la medición analítica. El pico cromatográfico de
norepinefrina en particular eluye cerca del frente de la fase móvil y junto con
algunas impurezas propias de la matriz, no identificadas. La integración de este
último se realizó manualmente.

Para obtener resultados reproducibles y consistentes, se controlaron varios
factores que influyen sobre la técnica cromatográfica y sobre la técnica de
detección electroquímica. Uno de los factores es el empleo del método de
estándar interno (DHBA) que al adicionársele de forma reproducible, a todas las
muestras y los estándares analíticos, permite normalizar la concentración de los
analitos entre las preparaciones de las muestras y de los patrones. Además el

138

estándar interno facilitó la identificación de los picos cromatográficos, al emplearse
como referencia del tiempo de retención, lo que permitió compensar en parte las
variaciones en el tiempo de retención obtenidas para los analitos.

Las principales condiciones ambientales que influyen en la magnitud y calidad de
la señal del detector electroquímico son: la variación de la corriente eléctrica y la
temperatura ambiente. Para disminuir el efecto del ruido eléctrico, el detector se
conectó a un supresor de picos de voltaje. El cuarto donde se ubicó el
cromatógrafo no contó con un sistema de control de la temperatura ambiente (aire
acondicionado) durante las mediciones. Para amortiguar el efecto de la
temperatura, se utilizó un sistema casero mediante una bolsa plástica con agua, a
manera de aislante térmico, para cubrir la columna cromatográfica. La
temperatura también es un factor que afecta la separación cromatográfica y la
reproducibilidad de los tiempos de retención.

Aún así los cambios en la temperatura ambiente provocaron una variación
importante en el tiempo de retención de los analitos. La variación en el tiempo de
retención se corrigió, para efecto de la identificación de los picos cromatográficos,
con la inyección frecuente de un patrón analítico que incluía todos los analitos y
por el tiempo de estándar interno.

La compensación del efecto del cambio de la temperatura sobre la magnitud de la
señal se realizó inyectando seguidas las muestras de los dos hemisferios para un
mismo individuo. Esto permitió contar con condiciones de inyección (temperatura
y corriente eléctrica) semejantes para las dos muestras analíticas con la que
posteriormente se iba a determinar la variable porcentaje de depleción.


139

5.2 Variación del peso de los animales durante los experimentos
En los experimentos 1 y 3 se monitoreó la variación del peso corporal de los
animales como una medida de su estado general. Los animales aumentaron entre
80 y 100 gramos (ver figuras 14 y 29) y no se encontraron diferencias entre los
grupos intervenidos con las miotoxinas (nativa y alquilada) a todas las dosis
evaluadas, ni con los respectivos grupos control. Aparentemente la administración
de las miotoxinas en SNpc no afecta la ingesta de agua y alimentos en los
individuos. En este sentido, el modelo de lesión con las miotoxinas no es diferente
del modelo de lesión unilateral de la SNpc con 6-OHDA (para una revisión ser
Schwarting et al, 1996a). En el modelo de lesión unilateral con 6-OHDA se ha
reportado que no se ven afectadas la ingesta de agua y alimentos, lo que presenta
una ventaja sobre el modelo de lesión bilateral con 6-OHDA.


5.3 Mortalidad de los animales

La mortalidad de los animales es uno de los efectos más evidentes que se
presentaron en esta investigación por administración de la miotoxina III nativa a la
dosis de 14 g (ver apartado 4.2.1). La mortalidad obtenida fue del 50% (n =4)
entre el día 1 y 2 postoperatorios.

Tan solo el estudio de la variable mortalidad permite establecer la presencia de un
efecto producido por la MT-III nativa a la dosis de 14 g respecto al
correspondiente grupo control y a las otras dosis evaluadas de la toxina.

Este efecto no era esperable pues la dosis más alta evaluada de la MT-III nativa
(14 g) en la que se presentó esta mortalidad es equivalente a 1 nmol de
miotoxina. Esta dosis molar se encuentra en el límite inferior del ámbito de las
dosis molares de otras toxinas que se han empleado en este tipo de estudios de

140

lesión unilateral en sustancia nigra. Por ejemplo Xu y colaboradores (2005)
lesionan con 6-OHDA a una dosis de 2 g (12 nmol); J ackson-Lewis y
colaboradores (2000) lesionan con 6-OHDA a una dosis de 8 g (50 nmol);
Sawamura y colaboradores (2001) lesionan con ácido kaínico a una dosis de 1 g
(5 nmol) y Konitsiotis y colaboradores (1998) lesionan con ácido iboténico a una
dosis de 5 g (30 nmol) y en ninguno de estos estudios se reportó a esas dosis
mortalidad en los animales.

A partir de lo anterior se puede proponer que la miotoxina MT-III nativa es más
tóxica en su efecto que las toxinas clásicas de los estudios de lesión unilateral en
Sustancia nigra. El efecto letal de la miotoxina se puede evitar con la disminución,
en un orden de magnitud, de la dosis de 14 g.

Además, la miotoxina III (nativa y alquilada) es una toxina más potente al menos
que la 6-OHDA, pues con una dosis de 0,1 nmol (1,4 g) de las miotoxinas III
nativa y alquilada, se logran lesiones moderadas, mientras que Fornaguera y
colaboradores (1993) obtienen lesiones moderadas con la 6-OHDA a dosis
molares superiores en dos órdenes de magnitud: 24 nmol (4 g) y 50 nmol (8 g).

La causa de la mortalidad a partir del día uno postoperatorio no se determinó. La
sustancia nigra pars compacta no regula procesos relacionados con eventos
neurales vitales (Kandel et al., 2000 & Kingsley, 2000). La mortalidad podría
deberse a la difusión de la toxina hacia otras regiones del cerebro y la activación
directa por esta toxina, de procesos neurales, que puedan estar relacionados con
eventos vitales. Esta posibilidad es poco probable pues los procesos de difusión
son por lo general importantes a distancias muy cortas y cerca de la SNpc no se
encuentra centros neurales que modulen procesos vitales.


141

Otra posibilidad es la activación de procesos neurales relacionados con eventos
vitales de una forma indirecta mediante la activación, por parte de la miotoxina
(una fosfolipasa A
2
), de mediadores de señal tipo eicosanoides o AMPc y
desencadenar así cascadas de señales que puedan afectar núcleos cerebrales
cercanos y distantes o la difusión de los productos de hidrólisis de la miotoxina
(Nelson & Cox, 2000).

5.4 Variación del efecto de la miotoxina MT-III nativa con la dosis inyectada
en SNpc.
En el primer experimento se evaluó el efecto conductual y neuroquímico de la
miotoxina MT-III nativa a tres dosis diferentes (0,14 g; 1,4 g y 14 g) de
miotoxina.

Al evaluar estadísticamente las diferentes conductas medidas en el experimento
uno se encontraron pocas diferencias significativas entre los grupos
experimentales y entre los diferentes días de medición de la conducta. Así mismo
se encontraron muy pocas diferencias significativas entre los grupos
experimentales al evaluar los resultados de los análisis neuroquímicos. Se cree
que la principal explicación de esto se debe a que en el experimento uno los
grupos experimentales son muy pequeños, compuestos por 2 y 4 individuos. Es
importante destacar que en el experimento tres, en el que se midieron las mismas
variables, y se aumentaron el número de animales por grupo, se obtuvieron un
mayor número de diferencias significativas entre los grupos experimentales. Si
bien en el experimento uno se encontraron pocas diferencias estadísticamente
significativas, los promedios de las diferentes conductas (ver figuras 15 a 21) y de
los resultados neuroquímicos a la dosis de 1,4 g de MT-III nativa (ver figuras 22 a
24) mostraron tendencias semejantes a las obtenidas a la misma dosis de MT-III
nativa en el experimento tres. A partir de estos resultados se podría indicar que
ambos experimentos se fortalecen entre sí. Debido a esta congruencia entre

142

experimentos, los resultados de las variables de las diferentes conductas y de los
análisis neuroquímicos obtenidos en el experimento uno serán discutidos más
ampliamente en los apartados 5.6 a 5.10, junto con los resultados del experimento
tres, en el que las herramientas estadísticas permitieron darle un mayor apoyo a
las conclusiones que de ellos se derivan.

La variabilidad sobre el grado de lesión obtenido, en los modelos animales de
lesión con 6-OHDA, es parte inherente de los mismos. En la literatura se cita que
la efectividad en la lesión depende de una serie de factores propios de la cirugía
como el sitio de aplicación, la dosis administrada, el volumen de infusión
(Fornaguera et al., 1993; Schwarting & Huston, 1996a; Deumens et al., 2002),
además de las diferencias anatómicas propias entre cada animal.

El efecto medido para la miotoxina III nativa muestra una tendencia dosis
dependiente en algunas de las variables evaluadas. El efecto de letalidad se
presentó únicamente a la mayor dosis evaluada. Por otro lado, la conducta de giro
(ver figuras 15 y 16) muestra una tendencia de una mayor asimetría del giro los
días 1, 3, 5 y 22 (giro contralateral) y el día 20 (giro ipsilateral) directamente
proporcional a la dosis. Es decir a mayor dosis, mayor asimetría conductual. Esta
tendencia dosis dependiente no es tan clara al evaluar los resultados de la
conducta de peritaxis (ver figuras 17 y 18). Los resultados de neuroquímica
tampoco muestran una tendencia clara dosis dependiente. Los porcentajes de
lesión obtenidos en los tres grupos intervenidos con la miotoxina III nativa son de
moderados a bajos pues en general se encuentran en un rango de 0 a 43% con un
valor promedio del 9%. Los análisis de regresión de las diferentes conductas con
los porcentajes de lesión por grupo no mostraron diferencias significativas.

En las figuras 15 y 16, se puede observar que la conducta de giro presenta
cambios en la asimetría durante el experimento, de contralateral los días 1, 3, 5 a
simétrica los días 7, 12, 15 y 18, luego a ipsilateral el día 20 luego de la

143

administración sistémica de apomorfina y por último a contralateral luego de la
administración sistémica de anfetamina (ver figuras 15 a 16). Contrario a esta
variación de la dirección del giro entre los días, la conducta de peritaxis se
presenta principalmente ipsilateral todos los días evaluados (ver figura 17). Estos
resultados son consistentes con lo reportado por otros investigadores (Matsuda et
al., 1995, Fornaguera & Schwarting, 1999; Henderson & Watson, 2003) que las
conductas de giro y peritaxis miden procesos neurales diferentes.

Los días 7 a 18 postoperatorios, la conducta de giro se presenta simétrica en
todos los grupos experimentales (ver figuras 15 a 16), mientras que la conducta de
peritaxis se presenta ipsilateral en los grupos de dosis media y alta (ver figura 17).
A partir de estas tendencias se podría proponer que la conducta de peritaxis es un
indicador de déficits funcionales más sensible que la conducta de giro, tal y como
ha sido propuesto anteriormente por otros investigadores en lesiones con 6-OHDA
(Fornaguera et al., 1993; Fornaguera & Schwarting, 1999).

Los resultados de los promedios del Índice de asimetría de peritaxis presentados
en la figura 18, presentan algunas diferencias con los resultados de peritaxis netas
presentados en la figura 17 en cuanto que mientras la peritaxis neta nunca indica
resultados de peritaxis neta contralateral (ver figura 17), el parámetro de IA
promedio de peritaxis indica algunos de los días peritaxis contralaterales. Se cree
que la explicación de estas diferencias entre estas dos variables (peritaxis neta e
IA de la peritaxis) para una misma conducta, subyacen en el número pequeño de
individuos y la alta variabilidad que se presentó en los grupos. Como se discutirá
posteriormente en los apartados 5.6 a 5.10, en el experimento tres al evaluar estas
dos variables con un número mayor de individuos, los resultados de estas dos
variables de la conducta de peritaxis fueron congruentes entre sí.

Las conductas de locomoción (ver figura 19), exploración (ver figura 20) y de
acicalamiento (ver figura 21), son casi siempre menores en el grupo de dosis alta

144

respecto al grupo de dosis media. La única excepción a esto es el día 18 en la
conducta de exploración que la tendencia de los promedios se invierte. Esta
tendencia es contraria a los resultados obtenidos para las conductas de giro (ver
figura 15) y de peritaxis (ver figura 17), en las que el grupo de dosis alta muestra la
mayoría de las veces un mayor valor para estas conductas que el grupo de dosis
media con la única excepción del día 1 en la conducta de peritaxis (ver figura 17)
en la que se invierte esta tendencia. Las conductas de giro y peritaxis totales
(datos no mostrados) no muestran una tendencia clara en los grupos de dosis
media y dosis alta, por lo que no se cree que la menor expresión de las conductas
de locomoción, exploración y acicalamiento se deba a una competencia de
expresión entre las conductas.

De las dosis evaluadas en el experimento uno, se decidió escoger la dosis de 14
g para la evaluación el efecto neuroquímico de la MT-III el día de la lesión a
diferentes tiempos (experimento 2), por ser la dosis más alta preparada a la que
se esperaban efectos mayores a corto plazo (15 a 360 min). Para el experimento
tres, la dosis que se escogió fue la media (1,4 g) por ser la dosis más alta en la
que se puede medir un efecto sin el inconveniente de la mortalidad de los
animales.


5.5 Efecto de la MT-III el día de la cirugía
En el experimento dos, se midió el efecto de la MT-III nativa, el día de la cirugía,
se midió a la dosis de 14 g en 1 L de vehículo y en diferentes momentos
postoperatorios (15, 60, 180 y 360 min) a partir de la finalización de la inyección.

Entre los 15 min y los 360 min después de la cirugía, es claro el resultado de
valores negativos de la variable “porcentaje de depleción” en estriados dorsal y
ventral principalmente para dopamina y sus dos metabolitos. Estos valores

145

negativos en la variable porcentaje de depleción (ver figuras 25 y 27) indican que
en el hemisferio lesionado hay un aumento de dopamina respecto al no
intervenido. La actividad dopaminérgica aumentada en el hemisferio intervenido
podría deberse a la activación aguda, por parte de la miotoxina de mecanismos
presinápticos que aumenten la liberación de dopamina, inhiban su recaptura o por
procesos de destrucción de las células dopaminérgicas en SNpc y la consecuente
liberación de la dopamina en estriado. Este mecanismo de destrucción celular ha
sido propuesto anteriormente para explicar la acción de la MT-III nativa en otros
tipos celulares diversos, principalmente miocitos (Bultrón et al. 1993a y 1993b;
Lomonte & Gutiérrez, 1995).

En estudios con otras toxinas de serpientes con actividad neurotóxica a nivel de
unión neuromuscular se ha descrito que su efecto PLA
2
actúa sobre las terminales
nerviosas vía sitios de unión que les permiten acercarse a las membranas
celulares de fosfolípidos, las cuales son hidrolizadas (Lambeau et al 1989). La
hidrólisis lleva a un cambio de la configuración de la membrana que promueve la
fusión de las vesículas a la membrana presináptica y la activación de la exocitosis
de los neurotransmisores que ha sido descrita por otros investigadores (Rigoni, et
al., 2005). La miotoxina III nativa podría estar promoviendo la exocitosis de
dopamina en las neuronas de la SNpc.

La acción de la miotoxina III nativa a la dosis de 14 µg parece no estarse limitando
a una inducción de la exocitosis de dopamina. Además se cree que a esta dosis
también se estarían desarrollando procesos progresivos de lesión, que en el caso
de administración de la MT-III nativa y alquilada generó en los individuos lesiones
moderadas del sistema nigroestriatal (ver figuras 22 y 39).

El tratamiento aplicado a los tejidos de estriado para la determinación de las
monoaminas por la técnica de HPLC, involucra la homogeneización del tejido
destruyendo físicamente las membranas celulares. Entonces, la cantidad de

146

dopamina medida por HPLC corresponde a la cantidad total de dopamina en el
tejido, que incluye la dopamina que se encuentre en estriado dentro de las
vesículas intactas y la dopamina que se haya liberado en estriado por una posible
ruptura inducida por la miotoxina de las membranas vesiculares. Esta cantidad
total de dopamina debería ser la misma entre ambos hemisferios.

El aumento medido en la dopamina por acción de la MT-III nativa parece deberse
a un movimiento de la dopamina que se encuentra en el cuerpo neural en SNpc y
los gránulos o vesículas que se encuentra en las varicosidades que existen a lo
largo de los axones (Flórez, 2008) hacia la zona de la terminal axónica (estriado).
De hecho Flórez (2008) describe la existencia de dos fracciones o depósitos de
catecolaminas: una de fácil disposición que se sitúa cercana a las proximidades de
la membrana presináptica y otra más estable que permanece anclada y se
comporta como sistema de reserva. La liberación de la fracción de reserva de la
dopamina es calcio dependiente y bien puede ser liberada por un estímulo
adecuado.

De la figura 25 se puede observar que a los 15 min los porcentajes de depleción
de dopamina en el hemisferio intervenido son más negativos que los de sus dos
metabolitos (DOPAC y HVA) y que conforme se llega a los 180 min, la relación se
invierte, siendo los porcentajes de depleción de estos metabolitos más negativos
que los de dopamina. A los 360 min se puede observar que los porcentajes de
depleción de dopamina continúan disminuyendo y que los porcentajes de
depleción de sus dos metabolitos (DOPAC y HVA) empiezan a disminuir. Una
posible explicación de estos resultados es que la dopamina se libera mayormente
en los primeros minutos y que producto del agotamiento de las reservas de
dopamina, con el tiempo la liberación de dopamina es menor. Conforme hay más
dopamina en estriado, la misma es metabolizada en DOPAC y éste en HVA. Al
cabo de los 360 minutos los niveles de dopamina son menores y por ende es
menor su metabolismo a DOPAC y éste a HVA. Estas posibles explicaciones se

147

apoyan con los resultados del índice de metabolismo (ver figura 26), en los que se
evidencia que la tasa metabólica siempre está aumentada en el hemisferio
intervenido y que la mayor tasa metabólica se obtiene a los 60 minutos y luego
disminuye.

Los tiempos de sacrificio son bastante cortos como para que los procesos de
síntesis de dopamina se vean modificados. El proceso de síntesis de dopamina
parte del aminoácido tirosina e implica además la síntesis de enzimas que
intervienen en el proceso (Flórez, 2008), de ahí que la disminución del porcentaje
de depleción de dopamina entre los 15 y los 360 min se pueda explicar por el
agotamiento de las reservas de dopamina en los somas de las neuronas
nigroestriatales afectadas.

En estriado ventral (ver figura 27), los niveles de dopamina y su metabolito
también se vieron afectados con una tendencia similar a la descrita para estriado
dorsal. El efecto medido en estriado ventral es en general menor al obtenido en
estriado dorsal. Estos hallazgos son consistentes con los que se reportan por
lesiones con 6-OHDA en SNpc, en los que la neuroquímica en estriado ventral se
ve poco afectada (Fornaguera et al., 1993). La sustancia nigra compacta inerva
principalmente el neoestriado o estriado dorsal (Kandel et al., 2000). La menor
lesión obtenida en estriado ventral es un indicativo de la efectividad de la cirugía.

Otro efecto observado el día de la cirugía es el de las convulsiones intensas que
presentaron algunos de los animales intervenidos a la dosis de 14 g en el
experimento dos, aproximadamente a las dos horas después de iniciada la cirugía
y recién despertados de la anestesia. Sawamura et al., 2001, al lesionar SNpr en
ratas con ácido kaínico (una neuro-excitotoxina análogo de glutamato, Woodruff &
Nonneman, 1994) reportan convulsiones caracterizadas por manifestaciones
límbicas (salivación), períodos de inmovilización, saltos, agitaciones tipo “wet dog”
y otras manifestaciones convulsivas que registra el electroencefalograma. La

148

sustancia reticulada juega un papel importante como centro de inhibición del
fenómeno epiléptico (Sawamura et al, 2001; Garant & Gale, 1983; Tanaka et al.,
1989). Tomando como referencia estos hechos reportados en la literatura, es
posible que las convulsiones obtenidas con MT-III a la dosis de 14 µg se deban a
la afectación quizás parcial de la SNpr, ubicada ventral y contigua a la SNpc. La
afectación de la SNpr (no deseada) puede deberse a que la dosis administrada de
14 g (1 nmol) en 1 L de solución salina, sea grande y siendo la sustancia nigra
compacta de poco espesor (menos de 0,5 mm), el sitio de lesión haya caído cerca
de la parte ventral de la SNpc y la miotoxina pueda difundir ventralmente. Si bien
no se realizó análisis histológicos en el experimento dos, en el experimento tres si
se puede observar (ver figuras 41 y 42) que con el sistema de inyección, algunas
de las intervenciones llegaron a sitios muy cercanos a la SNpr. Incluso un
individuo presenta la llegada de la cánula muy ventral. En el experimento tres no
se presentaron las convulsiones pues la dosis empleada era menor (1,4 g).


5.6 Efecto de la MT-III nativa y la MT-III alquilada sobre las conductas
espontáneas de giro y peritaxis, el primer día postoperatorio.
En el tercer experimento se contrastó el efecto por lesión en SNpc, con la
miotoxina nativa (MT-III) y con la miotoxina III alquilada en el sitio catalítico PLA
2
,
a una misma dosis de 1,4 g; con un grupo control con solución salina.

El primer día postoperatorio (24 horas después de la lesión) los animales
lesionados con la miotoxina nativa y con la miotoxina alquilada presentan un giro
neto contralateral y los animales del grupo control también presentan un giro neto
contralateral pero de menor magnitud (ver figuras 15, 16, 30 y 31). En el grupo
control no se demostró estadísticamente la asimetría del giro, tanto para la
variable de giro neto, como para la variable de IA del giro, y sí se demostró para
los grupos de miotoxina nativa y de miotoxina alquilada.

149


De acuerdo con el paradigma para explicar la dirección de la conducta de giro: “el
animal lesionado unilateralmente gira hacia el lado de la menor actividad
dopaminérgica” (Ungerstedt, 1971). La asimetría contralateral de la conducta de
giro el primer día postoperatorio, indicaría que la mayor actividad dopaminérgica
se encuentra en el hemisferio intervenido con las toxinas. Esta explicación es
consistente con los resultados de los análisis neuroquímicos del día de la lesión
(experimento dos, ver figura 25). Según estos resultados, el día de la cirugía, la
cantidad de dopamina en estriado dorsal es mayor en el hemisferio lesionado, tras
lesionar con una dosis de 14 g de MT-III. Entonces, los resultados de la
conducta de giro parecen indicar que, aún 24 horas posteriores a la inyección de
la toxina, y a una dosis menor (1,4 g), la actividad dopaminérgica en estriado
dorsal ipsilateral está aumentada respecto al estriado contralateral. Una
explicación semejante puede proponerse para explicar la conducta de giro
contralateral espontánea del primer día postoperatorio luego de la inyección de la
MT-III alquilada a la dosis de 1,4 g.

El día 1 postoperatorio, esta mayor actividad dopaminérgica en el hemisferio
intervenido podría deberse a la activación de mecanismos presinápticos que
aumenten la liberación de dopamina, estimulen su síntesis y/o inhiban su
recaptura o por procesos de destrucción de las células dopaminérgicas en SNpc y
la consecuente liberación de la dopamina en estriado. La destrucción celular
parece ser lenta pues aún es evidente 24 horas después de la inyección de la
toxina. Este mecanismo de destrucción celular ha sido propuesto anteriormente
para explicar la acción de la MT-III en otros tipos celulares (Bultrón et al. 1993a y
1993b; Gutiérrez & Lomonte, 1995).

La acción de la miotoxina podría deberse a una acción fosfolipasa A
2
y por otro
mecanismo desconocido, o solamente por este último, ya que el efecto de
asimetría contralateral del giro también se observa por acción de la miotoxina

150

alquilada. La existencia de dos mecanismos, uno fosfolipasa A
2
y otro mecanismo
desconocido ha sido propuesta para la miotoxina III y para las otras miotoxinas de
Bothrops asper (Bultrón et al. 1993a y 1993b; Gutiérrez & Lomonte, 1995) y para
otras toxinas tipo fosfolipasa A
2
, extraídas de otras serpientes (Rehm & Betz,
1982). Bultrón et al. (1993a y 1993b) al estudiar el efecto de la MT-III en células
animales no cerebrales, ha descrito que el efecto tóxico principal es por el
mecanismo fosfolipasa A
2
y que el otro mecanismo de toxicidad es de menor
magnitud. En la presente investigación se encontró que la diferencia entre el
efecto de la MT-III nativa y la MT-III alquilada sobre el giro espontáneo no es tan
marcada. Por lo anterior puede proponerse que el efecto medido no es derivado
de aquel que involucra la acción fosfolipasa A
2
de la miotoxina.

La MT-III de Bothrops asper ha sido descrita como “no neurotóxica” debido que
no presenta acción tóxica importante sobre neuronas a nivel de placa motora
cuando es administrada por vía intravenosa (Kaiser et al., 1990). No obstante
Ponce-Soto y colaboradores (2007) han demostrado la presencia de un efecto de
inhibición completa de la sinapsis neuromuscular (neurotoxicidad) en un sistema in
vitro inducido por la acción local de la miotoxina BaTX, sin actividad PLA
2
(Lys49),
no neurotóxica, extraída del veneno de la serpiente Brothrops alternatus. Es de
esperar que la MT-III se comporte de forma semejante a la BaTX por acción local
a nivel de placa motora, ya que ambas toxinas comparten algunas características.
En esta investigación se propone que la MT-III presenta un efecto tóxico
moderado (grado de lesión no es muy alto a la dosis de 1,4 g) al menos sobre
neuronas dopaminérgicas centrales. De poderse demostrarse lo anterior, la MT-III
sería la primera miotoxina con actividad fosfolipasa A
2
descrita, clasificada como
“no neurotóxica”, que presenta neurotoxicidad a nivel central.

Como una posible explicación para el otro mecanismo no fosfolipasa A
2
, podría
ser mediante la unión de la miotoxina III (nativa o alquilada) a sitios de unión tipo
N, abundantes en tejido cerebral de rata (Lambeau & Lazdunski, 1999). La MT-III

151

sería entonces la primera toxina tipo fosfolipasa A
2
descrita, que carece de
actividad neurotóxica a nivel de placa motora y que ligaría sitios de unión tipo N
(Lambeau et al., 1991; Nicolas et al., 1997). Para demostrar esta propuesta se
requeriría de otros estudios como el conteo de radioactividad en un contador “”,
de la unión de las toxinas marcadas con isótopos radioactivos de yodo a
sinaptosomas de regiones cerebrales específicas (Rehn & Betz, 1982; Lambeau
et al 1989).

El giro contralateral espontáneo del primer día postoperatorio obtenido luego de la
inyección de la MTII nativa y de la MT-III alquilada, es contrario al giro ipsilateral
espontáneo reportado en la literatura para el primer día postoperatorio, por
lesiones unilaterales en SNpc de ratas con 6-OHDA en animales con lesiones
moderadas (35% a 80%) y severas (>80%), (Matsuda et al., 1995, Fornaguera &
Schwarting, 1999; Henderson & Watson, 2003). En los animales lesionados
severa y moderadamente con 6-OHDA en SNpc, el giro espontáneo ipsilateral del
día 1 postoperatorio se ha explicado proponiendo que el efecto neurodegenerativo
posterior a la lesión con 6-OHDA en SNpc inicia entre 30 min y 4 horas posterior a
la administración de la toxina y la depleción dopaminérgica en estriado es evidente
desde el primer día postlesión (Schwarting & Huston, 1996a; Fornaguera &
Schwarting, 1999). Entonces, en el modelo con 6-OHDA, el animal lesionado
tendría desde el primer día postoperatorio una menor actividad dopaminérgica en
el estriado ipsilateral. Los mecanismos en SNpc implicados en la toxicidad
inducida por la MT-III nativa y la MT-III alquilada parecen ser diferentes a los
involucrados en la toxicidad en SNpc con 6-OHDA, desde un punto de vista de la
dinámica funcional. En la literatura consultada se encontró estudios con otras
toxinas que el primer día postoperatorio inducen un giro contralateral y se
discutirán más adelante.

En lesiones unilaterales y severas con 6-OHDA en SNpc, se ha logrado medir que
la administración de anfetamina (1,0 mg/kg; i.p.) el primer día postoperatorio

152

induce una inversión del giro ipsilateral espontáneo, a un giro contralateral
inducido farmacológicamente (Lynch & Carey, 1989). Esta inversión del giro no se
presenta al cuarto día postoperatorio (Lynch & Carey, 1989). Este giro
contralateral por infusión temprana de anfetamina también ha sido replicado a
dosis mayores de anfetamina (2,0 mg/kg; Ungerstedt & Arbuthnott, 1970). Este
giro inicial contralateral ha sido asociado con el incremento de la liberación de
dopamina en el hemisferio intervenido por efecto de la anfetamina.
Aparentemente la anfetamina administrada induce la liberación de la dopamina
extragranular que se acumula en las terminales que están sufriendo
neurodegeneración. A la dosis de 1,0 mg/kg se ha demostrado que la acción de la
anfetamina es principalmente mediante el bloqueo de la recaptura de la dopamina,
lo que facilita la acción de ésta en el hemisferio intervenido (Lynch & Carey, 1989).

El día de la lesión, la mayor actividad dopaminérgica en el hemisferio intervenido
medida neuroquímicamente a la dosis 14 g de MT-III nativa (ver figura 25) y el
giro contralateral medido, principalmente los días 1 y 3 postoperatorios, tanto con
la miotoxina III nativa (dosis entre 0,14 y 14 g) como alquilada (dosis de 1,4 g)
(ver figuras 15, 16, 30 y 31); se habían explicado sugiriendo una activación de
mecanismos presinápticos que aumenten los niveles de dopamina en el hemisferio
intervenido. Los estudios de Lynch y colaboradores (1989) sugieren que los
niveles de dopamina pueden ser aumentados selectivamente en el hemisferio
lesionado (con 6-OHDA) por la acción de la anfetamina vía intraperitoneal, así
como la inducción de un giro contralateral. Esta asimetría neuroquímica y
conductual que puede inducirse farmacológicamente con la anfetamina, parece
también ser inducida por la acción de las miotoxinas (nativa y alquilada). No
obstante hay que tomar en cuenta que Lynch y colaboradores inyectan la
anfetamina intraperitonealmente después del día de la lesión con 6-OHDA y que
en la presente investigación, este efecto de aumento de los niveles de dopamina y
de inducción de un giro contralateral se estaría atribuyendo a la miotoxina

153

remanente en el sitio de lesión desde el día de la cirugía y que actuaría sobre
células no lesionadas aún o sobre células lesionadas parcialmente.

En estudios con otras toxinas de serpientes con actividad neurotóxica a nivel de
unión neuromuscular se ha descrito que su efecto PLA
2
actúa sobre las terminales
nerviosas vía sitios de unión que les permiten acercarse a las membranas
celulares de fosfolípidos, las cuales son hidrolizadas (Lambeau et al 1989). La
hidrólisis lleva a un cambio de la configuración de la membrana que promueve la
fusión de las vesículas a la membrana presináptica y la activación de la exocitosis
de los neurotransmisores (Rigoni et al., 2005). La miotoxina III nativa, si bien se
ha descrito como no neurotóxica, podría estar promoviendo la exocitosis de
dopamina en las neuronas de la SNpc.

Sindu y colaboradores (2005) al realizar lesiones en SNpc con rotenona (inhibidor
del complejo I mitocondrial; Betarbet et al., 2002; Dawson et al., 2002; Dauer &
Przedborski, 2003), describen un giro espontáneo contralateral inmediatamente
que las ratas se recuperan de la anestesia, que persiste por un día y declina
lentamente hasta desaparecer el tercer día postoperatorio. La dosis de rotenona
que estudian estos investigadores es de 12 g y reportan obtener en el día 32
postoperatorio lesiones severas en estriado dorsal (>80%). Sindu et al., proponen
que los procesos neurotóxicos que provocan este giro espontáneo contralateral
ocurren en SNpc o regiones cercanas, pues tras lesionar (también con rotenona)
en la región medial del prosencéfalo (Sindu et al., 2005) y en neoestriado (Sindu et
al., 2006) el giro evocado espontáneamente después de la recuperación de la
anestesia, es ipsilateral. Sindu y colaboradores (2006) también reportan que por
lesión en SNpc con MPP
+
(una toxina inhibidora del complejo I mitocondrial;
Betarbet et al., 2002; Dawson et al., 2002; Dauer & Przedborski, 2003), se induce
un giro contralateral en las ratas recién recuperadas de la anestesia. Cabe
resaltar que la rotenona y el MPP
+
comparten el mismo mecanismo bioquímico de
acción (Betarbet et al., 2002; Dawson et al., 2002; Dauer & Przedborski, 2003;

154

Sindhu et al., 2006), es decir inhiben el complejo I mitocondrial. Para explicar
estos hallazgos, Sindu et al., (2005) proponen que probablemente se da una
liberación de dopamina en el estriado ipsilateral. Ellos lograron demostrar, por
análisis por HPLC, que a las 24 horas se da un aumento de los niveles de
dopamina en estriado del 23% (Saravanan et al., 2005). Como el nivel aumentado
de dopamina persiste por al menos 24 horas, los mismos investigadores proponen
que este aumento de dopamina en estriado lesionado se debe al aumento de su
liberación. Los mecanismos implicados en la toxicidad en SNpc de la MT-III nativa
y la MT-III alquilada podrían ser diferentes a los involucrados en la toxicidad en
SNpc con rotenona, pues aún no se le ha descrito a la MT-III implicada en
procesos de la respiración celular. Además, Sindhu y colaboradores han
trabajado con animales con lesiones severas (>80%) y no incursionan en animales
con lesiones moderadas como los obtenidos en los experimentos 1 y 3 de la
presente investigación a dosis de 14 µg y menores de MT-III nativa y de 1,4 µg de
MT-III alquilada. Como se ha descrito en la literatura, los mecanismos que
subyacen en los animales con lesiones severas son diferentes a los que de
lesiones moderadas (Hefti et al., 1980; Fornaguera et al., 1993, Kirik et al., 1998;
Fornaguera & Schwarting, 1999).

Otra conducta espontánea estudiada fue la de peritaxis. El primer día
postoperatorio (24 horas después de la lesión) los animales lesionados con la
miotoxina nativa y con la miotoxina alquilada presentan una peritaxis ipsilateral
(ver figuras 17, 18, 33 y 34). Los animales del grupo control también presentan
una asimetría ipsilateral para las variables de peritaxis neta y de IA de la peritaxis.
Los niveles alcanzados por el grupo control son menores y no se demostró
estadísticamente la asimetría de la peritaxis, para ambas variables. La asimetría
de la conducta de peritaxis sí se demostró estadísticamente para los grupos de
miotoxina nativa y de miotoxina alquilada, en ambas variables.


155

Al proponer la explicación para el giro contralateral inducido por la MT-III nativa y
la alquilada, el día 1 postoperatorio, se indicó que muy posiblemente los niveles de
dopamina se encontraban aumentados en el hemisferio ipsilateral. De acuerdo
con la descripción clásica para la conducta de peritaxis, los animales lesionados
unilateralmente con 6-OHDA presentan una desensibilización contralateral al
hemisferio de menor actividad dopaminérgica (Steiner et al., 1988). Tomando
como referencia las dos proposiciones anteriores, los animales lesionados con
MT-III nativa y alquilada, deberían presentar una peritaxis contralateral. Sin
embargo la conducta observada por inyección de la toxina MT-III nativa y la
alquilada es de una peritaxis ipsilateral.

Una posible explicación para la peritaxis ipsilateral observada como efecto de la
MT-III nativa y alquilada, podría ser que la peritaxis ipsilateral medida el día 1 esté
asociada con la conducta de giro contralateral. Se propone que la conducta de
giro contralateral se expresa en mayor medida que la conducta de peritaxis, pues
en promedio los animales (lesionados con MTII nativa y con MT-III alquilada)
presentan peritaxis neta de menos de 20 s durante los 20 minutos de la medición
(ver figuras 33 y 35), en cambio la conducta de giro hacia el lado contralateral la
realizan en promedio 80 veces con un giro neto de 40 (ver figuras 30 y 32). De
esta forma, la peritaxis observada podría ser solo aparente y estaría asociada con
el movimiento que hacen los animales para girar en dirección contralateral,
mediante giros amplios y no sobre el eje corporal. De ser esta la explicación, la
peritaxis medida el día 1 postoperatorio, no sería evocada por los procesos
neurales que están ocurriendo en los animales sino sería una conducta asociada a
otra que se expresa en mayor medida. La anterior propuesta podría apoyarse
mediante un estudio más detallado de la conducta de giro que separe los giros
realizados cabeza cola y los giros de traslación lejos de las paredes del campo
abierto, de los giros de traslación cerca de la pared (Schwarting & Huston, 1996a).
El giro medido en esta investigación es el giro total que incluye todos los tipos de
giros de 90° (sobre el eje del animal y giros de traslación).

156


Otra posibilidad es que la peritaxis ipsilateral del primer día postoperatorio se deba
a algún mecanismo diferente al de la integración de la conducta de giro. Podría
ser que el mecanismo que explique la peritaxis ipsilateral no sea solamente un
desbalance de los niveles de dopamina en el estriado, sino a alguna acción directa
o derivada de la acción de la MT-III nativa y la MT-III alquilada en SNpc. Los
hallazgos que las conductas de giro y peritaxis miden procesos diferentes
refuerzan las proposiciones de otros autores de que es importante la
caracterización de ambas conductas, (Steiner et al., 1988; Fornaguera et al., 1993;
Fornaguera & Schwarting, 1999) quienes han demostrado que las conductas de
giro y peritaxis miden procesos funcionales asimétricos diferentes y que un estudio
cuidadoso de estas mediciones puede evidenciar procesos neurales diferentes
aún en lesiones moderadas.

El día 1 postoperatorio, la única diferencia encontrada en el efecto, inducido entre
la miotoxina nativa y la miotoxina alquilada, es que la primera induce un mayor
número de giros totales (ver figura 32), un mayor número de peritaxis totales (ver
figura 35), el giro neto contralateral es levemente más contralateral (ver figura 30)
y la peritaxis neta ipsilateral es levemente menos ipsilateral (ver figura 33).

Sindu y colaboradores (2005 y 2006) en sus investigaciones con rotenona y MPP
+
,
no analizaron otras conductas como la peritaxis, por lo que no es posible realizar
una comparación en este sentido con los hallazgos de la presente investigación.

La peritaxis ipsilateral espontánea del día 1 postoperatorio es coincidente con lo
descrito para el primer día postoperatorio, por lesiones unilaterales en SNpc de
ratas con 6-OHDA en animales con lesiones de diferente intensidad (0 a >80%),
(Matsuda et al., 1995, Fornaguera & Schwarting, 1999; Henderson & Watson,
2003). Además de la peritaxis ipsilateral, estos investigadores obtienen un giro
ipsilateral. Ambas asimetrías conductuales (giro y peritaxis) son explicadas por

157

una menor actividad dopaminérgica en el hemisferio intervenido. Además
recalcan que en lesiones moderadas (<55 %), la conducta de peritaxis es un
indicador más sensible que la conducta de giro para los déficits que están
ocurriendo unilateralmente a nivel central. A partir de esto se concuerda con
estos investigadores que ambas conductas miden procesos neurales diferentes.

En los animales lesionados severa y moderadamente con 6-OHDA en SNpc, el
giro espontáneo ipsilateral del día 1 postoperatorio se ha explicado proponiendo
que el efecto neurodegenerativo posterior a la lesión con 6-OHDA en SNpc inicia
entre 30 min y 4 horas posterior a la administración de la toxina y la depleción
dopaminérgica en estriado es evidente desde el primer día postlesión (Schwarting
& Huston, 1996a; Fornaguera & Schwarting, 1999). Entonces, en el modelo con 6-
OHDA, el individuo lesionado tendría desde el primer día una menor actividad
dopaminérgica en el estriado ipsilateral. Los mecanismos implicados en la
toxicidad en SNpc por la MT-III nativa y la MT-III alquilada parecen ser diferentes a
los involucrados en la toxicidad en SNpc con 6-OHDA.


5.7 Efecto de la MT-III nativa y la MT-III alquilada sobre las conductas
espontáneas de giro y peritaxis, después del primer día postoperatorio.
Luego de discutir sobre los hallazgos encontrados el primer día postoperatorio se
procederá a discutir sobre la conducta espontánea de giro y peritaxis medida los
días posteriores. El tercer día postoperatorio, para los dos grupos intervenidos
con toxina nativa y con toxina alquilada, las conductas de giro y peritaxis son
asimétricas y de igual dirección que las medidas para el primer día, salvo que son
de menores magnitudes netas y absolutas. Es decir, el giro es contralateral y la
peritaxis ipsilateral. Los resultados obtenidos, hasta el día 3 postoperatorio,
podrían explicarse de igual forma que se discutieron los resultados del día 1. Los
resultados del día 3 parecen indicar que los procesos que subyacen el día 1 van

158

gradualmente atenuándose hacia la simetría hacia el día 12 o 15 y que esta
simetría se mantiene hasta el día 18.

Esta tendencia gradual hacia la simetría entre el día 1 y 18 postoperatorios se
comporta de forma diferente para la toxina nativa y para la toxina alquilada.
Además el parámetro de índice de asimetría (IA) se comporta diferente que el de
la conducta neta y la conducta de peritaxis se presenta como un evaluador
diferente al de la conducta de giro. Recapitulando los resultados obtenidos, los
análisis estadísticos de los datos de giro neto indican que el giro es contralateral
hasta el día 3 y con la variable de IA del giro hasta el día 5 en ambas toxinas. Los
análisis estadísticos de los datos de peritaxis neta indican que la peritaxis es
ipsilateral hasta el día 3 en el grupo de toxina nativa y hasta el día 7 en el grupo de
toxina alquilada. Con la variable de IA de peritaxis, la misma es ipsilateral hasta el
día 5 para el grupo de toxina nativa y hasta el día 15 para el grupo de toxina
alquilada.

De lo anterior se podría proponer que la tendencia hacia la simetría es más
gradual con la miotoxina alquilada que con la toxina nativa. Además que el
parámetro IA para las conductas de giro y peritaxis es un indicador más sensible
para evaluar los déficits asimétricos mediante estas conductas, que el parámetro
de la conducta neta. Por otro lado se refuerza el planteamiento discutido
anteriormente que la conducta de peritaxis, además de medir procesos diferentes
(Steiner et al., 1988; Fornaguera et al., 1993; Fornaguera & Schwarting, 1999), es
un indicar más sensible de los déficits funcionales que la conducta de giro. Esta
última conclusión fue propuesta por primera vez por Fornaguera y colaboradores
(1993), al estudiar diferentes grados de lesión en SNpc con 6-OHDA.

Se considera que la evaluación de la conducta neta y el IA conductual deben ser
complementarias entre sí y en conjunto con otras variables como la conducta total
y el total de conductas ipsilaterales y contralaterales. Esta evaluación

159

complementaria, utilizada en este trabajo de investigación, permite una mejor
interpretación, de una forma integral, de las conductas que indican procesos
neurales también asimétricos. Contrario a esta propuesta, algunos investigadores
en este tipo de experimentos indican haber medido solo las conductas netas
(Konitsiotis et al., 1998; J ackson-Lewis & Liberatore, 2000; Vivó et al., 2002; Sindu
et al., 2006; J in et al., 2008) o los índices de asimetría (Fornaguera et al., 1993;
Fornaguera & Schwarting, 1999; Díaz-Véliz et al., 2002). De forma adicional, la
conducta de giro (como única conducta) continúa siendo la más estudiada en
modelos en ratas de enfermedad de Parkinson por lesión unilateral de SNpc con
diferentes toxinas (algunos ejemplos: J ackson-Lewis & Liberatore 2000; Vivó et al.,
2002; Sindu et al., 2005).

La tendencia gradual o lenta de forma espontánea hacia la simetría entre el día 1 y
los días 12 o 15, se podría deber a que pueden estar ocurriendo al menos dos
procesos. Uno es un proceso gradual de avance de la lesión con un nivel mayor
de dopamina liberado en neoestriado ipsilateral, que va disminuyendo en el tiempo
ya sea por agotamiento de las reservas de dopamina en las neuronas y/o a la
destrucción gradual de las neuronas dopaminérgicas de la SNpc. El otro una
acción en SNpc, directa o derivada de la acción de la MT-III nativa y la MT-III
alquilada, que también va disminuyendo en el tiempo por la eliminación
(aclaramiento o metabolismo) de las toxinas. Posterior a estos procesos tóxicos
se obtiene la recuperación de la simetría conductual para ambas toxinas (nativa y
alquilada), posiblemente mediante el desarrollo de mecanismos de compensación
neuroquímica.

Estos mecanismos de compensación neuroquímica pueden haberse desarrollado,
ya que los porcentaje de las lesiones obtenidos por inyección de la MT-III nativa
(28 ±11 %; con un rango de -1 a 61 %) y la MT-III alquilada (27 ±12 %; con un
rango de -6 a 65 %) son moderadas. En ratas con lesiones moderadas, usando
inyección con 6-OHDA en SNpc se han sugerido el desarrollo de mecanismos de

160

compensación neuroquímica que llevan a la simetría conductual del giro y de la
peritaxis a partir del día 7 postoperatorio y se mantiene al menos hasta el día 16
postoperatorio (Fornaguera et al., 1993; Fornaguera & Schwarting, 1999).

El efecto de la MT-III nativa y la alquilada medido estos primeros días, después de
la lesión, sugiere que en el presente modelo animal, se desarrolla un proceso
neurodegenerativo de lesión lento y progresivo, similar a los mecanismos que
ocurren en la enfermedad de Parkinson que también son lentos y progresivos
(Lang, et al. 1998a & 1998b; Toulouse & Sullivan, 2008). Además, el proceso
neurodegenerativo es diferente al que se ha reportado en otros modelos con
neurotoxinas clásicas, en los cuales la lesión es abrupta y se desarrolla en pocas
horas o pocos días (para una revisión ver Schwarting & Huston, 1996a). En el
caso de lesiones con rotenona y MPP
+
, también se ha propuesto el desarrollo de
la neurodegeneración mediante un proceso lento y progresivo, no obstante, la
asimetría conductual (solo miden giro) persiste por más de un día, declina
lentamente y desaparece alrededor del tercer día (Saravanan et al., 2005; Sindu et
al., 2005; Sindhu et al., 2006). En las lesiones con la MT-III nativa los efectos del
día de la lesión son aún evidentes hasta el día 7 y con la MT-III alquilada hasta el
día 12.

La propuesta de un mecanismo neurodegenerativo lento y progresivo para la MT-
III nativa y para la MT-III alquilada en las neuronas dopaminérgicas de la SNpc, es
contrario también al mecanismo típico reportado para la MT-III nativa y para la MT-
III alquilada en liposomas y músculo esquelético como una acción violenta de
destrucción masiva de membranas celulares, vía principalmente un mecanismo
fosfolipasa y en menor medida por el otro mecanismo aún no comprendido
(Bultrón et al., 1993a & 1993b; Gutiérrez y Lomonte, 1995).

El desarrollo de estos procesos de avance la lesión y/o recuperación de la simetría
conductual es más lento cuando es provocado por la MT-III alquilada (asimetría

161

hasta el día 15) que cuando es provocado por la MT-III nativa. En cuanto a la
intensidad del efecto provocado por la toxina nativa y por la toxina alquilada, no se
encontraron diferencias significativas. El primer día, mediante el análisis de las
conductas de giro y peritaxis netas, se observa una tendencia de un efecto mayor
para la toxina nativa y mediante el análisis de los índices de asimetría de las
conductas de giro y peritaxis, se observa un efecto mayor para la toxina alquilada.

Como se mencionó anteriormente, la simetría conductual en giro y en peritaxis se
demuestra estadísticamente, en el grupo intervenido con la toxina nativa a partir
del día 7 postoperatorio y en el grupo intervenido con la toxina alquilada, a partir
del día 12 postoperatorio. Este comportamiento de giro y peritaxis simétricos
sugiere que en los animales se han desarrollado procesos neuroquímicos de
compensación. Según Schwarting & Huston (1996a), los procesos neuroquímicos
de compensación pueden traducirse en cambios en la conducta observables. Los
mecanismos que se han propuesto en la literatura y que conllevan al desarrollo de
esta compensación son: la hipersensibilidad de receptores postsinápticos en el
estriado, el aumento del metabolismo (síntesis de dopamina) y liberación de
dopamina por parte de las células remanentes no lesionadas, la disminución de la
recaptura de la dopamina. La contribución de las vías neurales cruzadas entre los
hemisferios es menos importante (para una revisión ver Schwarting & Huston,
1996a). Es probable que algunos de estos mecanismos estén involucrados en la
compensación conductual que se observa en las ratas lesionadas con MT-III
nativa, con MT-III alquilada y en el grupo control. La discusión de este tema se
retomará más adelante cuando se discuta sobre los resultados sobre las
conductas de giro y peritaxis inducidas farmacológicamente.

Para el grupo control, en cuanto a las conductas de giro y peritaxis los primeros 18
días postoperatorios, se midieron efectos diferentes a los provocados por la
inyección de las toxinas nativa y alquilada (ver figuras 30, 31, 33 y 34). Para el
grupo control, se midió un porcentaje de depleción promedio de (4 ±8 %; con un

162

rango de -17 a 17 %). El análisis estadístico de las variables evaluadas para la
conducta de giro, no indicó la presencia de una conducta asimétrica ninguno de
los nueve días evaluados. El análisis estadístico de las variables de la conducta
de peritaxis permitió establecer que los días 1, 3 y 5 postoperatorios, el grupo
control presentan asimetría ipsilateral (ver figuras 33 y 34, los días 3 y 5 no se
muestra en la figura). A partir de estos resultados obtenidos de la evaluación de la
conducta de peritaxis se puede establecer que tan solo la introducción de la aguja
en el cerebro hasta la SNpc y la inyección del microlitro de solución salina
provocan algún tipo de lesión.


5.8 Efecto de la MT-III nativa y la MT-III alquilada sobre las conductas
espontáneas de locomoción, exploración y acicalamiento.
Otra conducta espontánea estudiada fue la locomoción. La conducta de
locomoción es una conducta poco reportada en este tipo de modelos de la
enfermedad de Parkinson (Schwarting et al, 1993; EP; Sakai & Gash, 1994;
Fornaguera & Schwarting, 1999). También esta conducta ha sido evaluada por
otros autores como un indicador de comportamiento por aislamiento e interacción
social no relacionados con la EP (Brenes et al., 2008). Se considera que es
importante medir la conducta de locomoción, principalmente en los modelos
animales de los estados avanzados de la EP, pues parte de los síntomas que
caracterizan esta enfermedad (en su estado avanzado) en humanos, son la
bradiquinesia que se refiere a una lentitud anormal de los movimientos y la
aquinesia que se refiere a la dificultad en iniciar el movimiento (Lang & Lozano,
1998a). Es importante mencionar que los modelos animales reportados para
estudiar la bradiquinesia son en lesiones bilaterales (Sakai & Gash, 1994). La
conducta de locomoción, junto con la de exploración y acicalamiento son
conductas clásicas que se miden en la prueba de campo abierto (Brenes et al.,
2006; Fornaguera & Schwarting, 1999).

163


Entre los días 1 y 18 postoperatorios, para los grupos intervenidos con las toxinas
(nativa y alquilada), la conducta de locomoción espontánea se mantuvo en un
valor constante de aproximadamente 60 cruces (ver figura 36) durante los 20 min
que se midió la conducta (frecuencia de 1 cruce cada 20 s). No se encontró
diferencias estadísticamente significativas entre los grupos lesionados con toxinas
(nativa y alquilada). La locomoción espontánea medida en los grupos intervenidos
con la MT-III nativa y la MT-III alquilada, se encuentra levemente disminuida
respecto a lo medido para el grupo control (ver figura 36). El grupo control
presentó en promedio 70 cruces en los 20 min (frecuencia de 1 cruce cada 17 s).
A partir de estos resultados obtenidos, se coincide con otros autores (Fornaguera
& Schwarting, 1999) que es importante evaluar la conducta de locomoción también
en modelos animales de los estados preclínicos de la EP (lesiones moderadas),
pues esta conducta mide un efecto provocado por la lesión.

En el modelo de lesión de SNpc con 6-OHDA, no se han reportado diferencias en
la locomoción espontánea entre el día 1 y el día 7 postoperatorios, para animales
de un mismo grado de lesión. Lo anterior fue evaluado dentro de los grupos de
animales moderadamente lesionados y levemente lesionados (Fornaguera &
Schwarting, 1999). Estos hallazgos reportados en la literatura son congruentes
con los resultados obtenidos en el presente estudio en el que los animales
presentan lesiones moderadas. Sin embargo sí se ha reportado que la
locomoción es menor a mayor grado de lesión y que la locomoción tiende a
aumentar entre los días 1 y 7 para los animales con lesiones severas (Fornaguera
& Schwarting, 1999). Es importante mencionar que la variable que emplearon
Fornaguera y colaboradores (1999) para medir la conducta de locomoción es la
distancia total recorrida y que en la presente investigación es el número de cruces
entre los cuadrantes de un campo abierto. La concordancia en los resultados de
la conducta de locomoción obtenidos por Fornaguera y colaboradores (1999) y los
de la presente investigación, parecen indicar que ambas variables (distancia

164

recorrida y total de cruces) son equivalentes en la descripción de la conducta de
locomoción. Muy posiblemente los procesos neurales que integran la conducta de
locomoción en estos dos modelos, se ven afectados de forma semejante.

Otra conducta espontánea estudiada fue la de exploración. La conducta de
exploración ha sido poco reportada en este tipo de modelos animales de la
enfermedad de Parkinson (Lynch & Carey, 1989; Fornaguera & Schwarting, 1999).
También esta conducta ha sido evaluada por otros autores como un indicador de
comportamiento por aislamiento e interacción social no relacionados con la EP
(Brenes et al., 2008). Se considera que es importante la evaluación de la
conducta de exploración, pues parte de los síntomas que caracterizan la EP, en su
estado avanzado, en humanos es la aquinesia que se refiere a la dificultad en
iniciar el movimiento (Lang & Lozano, 1998a). En la conducta de exploración, la
rata debe iniciar un movimiento que consiste en levantarse y pararse con las patas
traseras, luego de un período de quietud.

Entre los días 1 y 18, todos los animales muestran una tendencia al aumento de la
conducta de exploración espontánea y ésta es mayor para el grupo de toxina
nativa (ver figura 37). La diferencia de exploración entre los días 18 y 1
postoperatorios es de +111 s en el grupo de toxina nativa, +69 s en el grupo
control y +63 s en el de toxina alquilada. Si se comparan los animales lesionados
moderadamente (con lesiones <60%) de este experimento con MT-III nativa y
MT-III alquilada, con los animales lesionados también moderadamente con 6-
OHDA (con lesiones leves (35 a 55%) y moderadas (55 y el 80%); Fornaguera et
al. 1999), se puede observar que los resultados son congruentes, pues en las
investigaciones con 6-OHDA, se reporta que la exploración es invariable entre los
días 1 y 7 postoperatorios en las lesiones leves y aumenta un poco en las lesiones
moderadas (Fornaguera et al. 1999).


165

Fornaguera y colaboradores (1999) plantean que en el modelo de lesión con 6-
OHDA los patrones medidos para la conducta de locomoción y para la conducta
de exploración, evaluados a diferentes grados de lesión, son semejantes pues
para ambas conductas hay una menor expresión conductual a mayor lesión y
ambas conductas se presentan invariables en el tiempo a lesiones moderadas.
Ellos mismos indican que en ese modelo estas dos conductas se podrían ver
afectadas por una vía dopaminérgica específica semejante. Mediante estos
nuevos hallazgos de lesión moderada con MT-III nativa y MT-III alquilada se
podría postular que estas dos conductas son afectadas por mecanismos
semejantes a los de la lesión con 6-OHDA. Lo anterior basado en que la conducta
de locomoción se presentó sin cambio en el tiempo (entre los días 1 y 18
postoperatorios) y la de exploración aumentó en el tiempo.

El aumento de la conducta de exploración entre los días 1 y 18, también se midió
en el grupo control. Por lo anterior, este aumento podría, en parte, tener su origen
en algún factor inespecífico derivado de la recuperación de la cirugía. Sin
embargo, el mayor aumento que se observó en el grupo de la toxina nativa
respecto a los grupos control y de toxina alquilada parece indicar que además hay
un efecto provocado por la inyección de la MT-III nativa.

Otra conducta espontánea estudiada fue la de acicalamiento. Al igual que las
conductas de locomoción y de exploración, la conducta de acicalamiento, no ha
recibido una atención considerable en los modelos de lesión unilateral de la
enfermedad de Parkinson (Fornaguera & Schwarting, 1999). Al haberse
relacionado estas tres conductas con el neurotransmisor dopamina (Sakai & Gash
1994), es de esperar que las lesiones del sistema dopaminérgico las afecten en
alguna medida. También la conducta de acicalamiento ha sido evaluada por otros
autores como un indicador de comportamiento por aislamiento e interacción social
no relacionados con la EP (Brenes et al., 2008).


166

La conducta de acicalamiento se presentó principalmente en los minutos últimos
de los 20 min de cada día de medición. Esto puede hacer evidente la presencia
de habituación conductual general al campo abierto descrita en otros modelos
animales (Brenes, et al., 2008). Otros investigadores han descrito la habituación
de la conducta de acicalamiento medible mediante el aumento de la expresión de
la misma (Fornaguera & Schwarting, 1999). En general la conducta de
acicalamiento es considerada como un indicador de habituación, entre más
temprano y más prolongada sea la expresión de esta conducta, hay un mayor
desarrollo de habituación (Brenes et al., 2008).

En esta investigación no se encontraron diferencias estadísticamente significativas
entre los comportamientos de los tres grupos experimentales dentro de cada día
de medición espontánea. La expresión de la conducta de acicalamiento aumentó
progresivamente entre los días 1 y 7 postoperatorios para los tres grupos
experimentales (control, toxina nativa y toxina alquilada; ver figura 38). Este
aumento podría deberse a algún factor inespecífico producto de la recuperación
de la cirugía o quizás al desarrollo de habituación al campo abierto tal y como ha
sido planteado por otros investigadores (Brenes et al., 2008). Este aumento de la
habituación podría deberse a que el tiempo entre mediciones (de día de por
medio: días 1, 3, 5 y 7) fuera muy corto.

El desarrollo de esta aparente habituación que está indicando la conducta de
acicalamiento parece no afectar la expresión de la conducta de giro total
espontáneo (ver figura 32) que se mantiene constante en el tiempo. Podría
explicar en parte la disminución en el tiempo que se presentó en la peritaxis total
espontánea (ver figura 35). Como indican otros autores (Schwarting & Huston,
1996a; Fornaguera & Schwarting, 1999), la conducta de peritaxis mide procesos
sensoriales orofaciales, de ahí que, si la conducta de acicalamiento (que también
incluye procesos orofaciales) sugiere la presencia de habituación, ésta podría
estar relacionada con la disminución de la conducta de peritaxis medida.

167


La conducta de exploración también puede ser un indicador del desarrollo de
habituación (Fornaguera & Schwarting, 1999; Brenes, et al., 2008) al campo
abierto. No obstante, en esta investigación, el aumento en el tiempo de la
exploración espontánea (ver figura 37) no sugiere el desarrollo de habituación.
Cabe mencionar que en lesiones moderadas con 6-OHDA (Fornaguera &
Schwarting, 1999), también se ha reportado el desarrollo de habituación por el
aumento de la conducta de acicalamiento, mientras la expresión de la conducta de
exploración se ha mantenido constante en el tiempo.

Los hallazgos reportados por lesiones moderadas con 6-OHDA (Fornaguera &
Schwarting, 1999) y moderadas con MT-III nativa y alquilada sugieren que en
ambos modelos, los procesos neurales que integran la conducta de acicalamiento,
se ven afectados de forma semejante.

Del día 7 al día 12 postoperatorio se midió una disminución marcada en la
conducta de acicalamiento (ver figura 38). Las diferencias medidas entre estos
dos días son estadísticamente significativas para los tres grupos experimentales.
Entre estos dos días de medición (período de cinco días) los animales no fueron
expuestos al campo abierto. Los tiempos de acicalamiento medidos el día 12
postoperatorio son semejantes a los medidos el día 1 postoperatorio. Los
resultados obtenidos parecen indicar que los cinco días de no exposición al campo
abierto, transcurridos entre el día 7 y el 12, fueron suficientes para romper la
habituación de los animales al campo abierto. Aunque Brenes y colaboradores
(2008) describen que la habituación de la conducta de exploración y de
locomoción se manifiesta por una disminución de las mismas, en la presente
investigación, el día 12 no se observó el desarrollo de habituación mediante el
análisis de estas dos conductas.


168

Anteriormente se había asociado el aumento en la aparente habituación que indica
la conducta de acicalamiento (ver figura 38) con la disminución progresiva en la
conducta de peritaxis total espontánea (ver figura 35). No obstante la conducta de
peritaxis total espontánea presenta una tendencia general de disminución gradual
de su expresión entre los días 1 y 18 postoperatorios, sin modificaciones de esta
tendencia el día 12. De estar relacionada la disminución en la peritaxis total de
forma importante a un componente de habituación, se hubiese esperado un
aumento en la expresión de la peritaxis total el día 12. Aparentemente los
procesos neurales relacionados con estas dos conductas se están afectando de
forma diferente.

Entre los días 12 y 18 postoperatorios, no se observó cambios estadísticamente
significativos dentro de los grupos. Es posible que los tres días entre la exposición
de los animales al campo abierto (días de medición 12, 15 y 18) sean suficientes
para evitar el desarrollo de habituación.


5.9 Efecto inducido por apomorfina en las ratas lesionadas con la MT-III
nativa y la MT-III alquilada, el día 20 postoperatorio.
Como se explicó en el marco teórico, la apomorfina es un agonista dopaminérgico
no selectivo, es decir presenta tanto actividad sobre los receptores D
1
como sobre
los receptores D
2
dopaminérgicos (Flórez, 2008). El efecto típico inducido por
apomorfina, depende del grado de lesión, ubicación de la lesión, la dosis de la
droga y el tiempo transcurrido después de la administración de la misma (para una
revisión ver Schwarting & Huston, 1996a).

En animales con lesiones moderadas (<80%) con 6-OHDA, la apomorfina no
induce asimetría del giro ni de la peritaxis (lesiones 55 a 80%) e induce una
asimetría ipsilateral en animales con lesiones leves (35 a 55%) también en ambas

169

conductas (Fornaguera et al., 1993). En lesiones severas (entre el 80 y el 95%)
con 6-OHDA, tanto el giro como la peritaxis que se induce es contralateral a dosis
de apomorfina mayores de 0,1 mg/kg (Ziegler & Szechtman, 1988; Fornaguera et
al., 1993, Schwarting & Huston, 1996a; Lewis et al., 2000; Deumens et al., 2002).
Esta misma dirección del giro contralateral se ha reportado, también en lesiones
severas con otras toxinas como aminocromo y dopacromo (Díaz-Véliz et al,
2002).

Este giro contralateral, inducido por apomorfina en animales con lesiones severas
descrito en el párrafo anterior, ha sido explicado mediante el desarrollo de
mecanismos de compensación postsináptica en el estriado denervado
(Fornaguera et al., 1993; Schwarting & Huston, 1996a). En 1971, Ungerstedt
describió que la denervación dopaminérgica en estriado por lesión con 6-OHDA,
induce un incremento en la sensibilidad conductual inducida por agonistas
dopaminérgicos como la apomorfina. En los modelos con 6-OHDA, este
incremento en la sensibilidad conductual se ha explicado por el desarrollo de
supersensibilidad de receptores, medible a partir del día 7 postoperatorio (para
una revisión ver Schwarting y Huston, 1996a). El mecanismo exacto del desarrollo
de esta supersensibilidad de receptores es desconocido aún (Harrison & La
Hoster, 2006), sin embargo se han reportado varios procesos bioquímicos
involucrados como el aumento de la ocupación de los receptores D
2
, la mayor
síntesis de estos receptores y/o el aumento de la afinidad de los mismos (Harrison
& LaHoste, 2006). Entonces, luego de la administración de apomorfina, en el
estriado denervado se presentaría una mayor estimulación, de los receptores
dopaminérgicos supersensibilizados. La mayor actividad neuronal se presentaría
en el hemisferio ipsilateral y el giro observado sería contralateral (para una
revisión ver Schwarting y Huston, 1996a).

En la presente investigación, los porcentajes de lesión alcanzados (ver figura 39)
de 28 ±11 % (con un ámbito de -1 a 61 %) para el grupo intervenido con la MT-III

170

nativa y de 27 ±12 % (con un ámbito de -6 a 65 %), para el grupo intervenido con
la MT-III alquilada, no corresponden a animales severamente lesionados, sino más
bien con lesiones leves a moderadas. La apomorfina (0,5 mg/kg por vía
subcutánea) induce una conducta de giro ipsilateral y de peritaxis también
ipsilateral en los animales intervenidos con las toxinas (nativa y alquilada), no así
en el grupo control. El efecto inducido en el giro y la peritaxis por la apomorfina es
menor para el grupo intervenido con la toxina alquilada que en el grupo intervenido
con la toxina nativa.

De acuerdo con el paradigma clásico para explicar la dirección de la conducta de
giro: “el animal lesionado unilateralmente gira hacia el lado de la menor actividad
dopaminérgica” (Ungerstedt, 1971). La asimetría ipsilateral de la conducta de giro
inducida por apomorfina en los animales lesionados leve a moderadamente (con la
miotoxina III nativa y la miotoxina III alquilada, indicaría una mayor actividad
dopaminérgica, inducida por apomorfina, en el hemisferio contralateral respecto a
la lesión.

La apomorfina, administrada sistémicamente, el día 20 postoperatorio, actuó sobre
los receptores D
1
presinápticos y D
2
postsinápticos de ambos hemisferios
(lesionado y no lesionado) pero aparentemente no en igual proporción. La
apomorfina actuaría preferentemente en el estriado donde el número de
conexiones neurales nigro-estriatales intactas sea mayor, es decir, el hemisferio
no intervenido con las toxinas. Entonces basado en el paradigma de la conducta
de giro (Ungerstedt, 1971), el giro preferente sería el ipsilateral, tal y como se
midió en esta investigación en los animales lesionados moderadamente con las
toxinas (nativa y alquilada).

Anteriormente, en el apartado 5.7, se discutió que la conducta de giro y peritaxis
simétricas espontáneas medidas el día 18, en los animales lesionados
moderadamente con MT-III (nativa y alquilada), se debían muy posiblemente al

171

desarrollo de procesos de compensación neuroquímica. Según Schwarting &
Huston (1996a), los procesos neuroquímicos de compensación pueden traducirse
en cambios en la conducta observables. Los mecanismos que se han propuesto
en la literatura y que conllevan al desarrollo de esta compensación son: la
hipersensibilidad de receptores postsinápticos en el estriado y el aumento del
metabolismo. La actividad metabólica incrementada se puede deber a procesos
tales como el aumento de la liberación de dopamina, el aumento de su síntesis y/o
inhibición de su recaptura (Lavielle et al., 1978; Fornaguera et al., 1993). El
incremento de estos procesos metabólicos se puede asociar con el desarrollo de
procesos de compensación presináptica (Hefti et al., 1980; Zigmong, et al., 1990;
Fornaguera et al., 1993).

Los índices de metabolismo mayores de 100 medidos para el DOPAC respecto a
la dopamina en estriado dorsal (ver figura 41), en los animales lesionados con la
miotoxina nativa y con la miotoxina alquilada indican que la actividad metabólica
espontánea es mayor en el estriado dorsal ipsilateral. Los resultados de estos
índices de metabolismo refuerzan la propuesta del desarrollo de procesos de
compensación presinápticos para explicar las simetrías conductuales del giro y de
la peritaxis espontáneas del día 18, así también las asimetrías ipsilaterales
inducidas en el giro y la conducta de peritaxis, por la administración sistémica de
apomorfina. Como el estriado ipsilateral no se encontraría muy denervado
(lesiones moderadas) no se esperaría que se desarrollen mecanismos de
compensación postsinápticos. Se propone que los mecanismos de compensación
neuroquímica presentes son presinápticos, como podrían ser el aumento de la
síntesis de dopamina, disminución de su metabolismo o disminución de su
recaptura.

En estudios de lesiones moderadas y leves con 6-OHDA en SNpc se han descrito
que los índices de metabolismo para DOPAC y HVA se encuentran incrementados
en el estriado dorsal ipsilateral. Este incremento del metabolismo es congruente

172

con el desarrollo de procesos compensatorios presinápticos en el estriado
lesionado moderadamente (Fornaguera et al., 1993).

Los índices de metabolismo en estriado ventral no evidencian la presencia de
procesos compensatorios en esta región y por ende podrían indicar que el estriado
ventral no se vio afectado por lesión con las toxinas MT-III (nativa y alquilada). En
los estudios con animales lesionados moderadamente con 6-OHDA, tampoco se
ha reportado cambios metabólicos de DOPAC y HVA en estriado ventral
(Fornaguera et al., 1993). Estos resultados indican que la cirugía practicada fue
exitosa en el sitio de llegada de la cánula.

Los resultados de esta investigación de un giro ipsilateral en ratas moderadamente
lesionadas son congruentes con la descripción en la literatura en ratas lesionadas
moderadamente (35 a 55%) con la toxina 6-OHDA (Fornaguera et al., 1993).
Estos autores explican la dirección de este giro por el desarrollo de mecanismos
de compensación presináptica a nivel de la SNpc y el no desarrollo de
mecanismos de compensación postsinápticos (Hefti et al., 1980; Fornaguera et al.,
1993).

Otra conducta estudiada, inducida por apomorfina (0,5 mg/kg) es la de peritaxis.
La conducta de peritaxis inducida el día 20 por la apomorfina, medida luego de la
lesión con la miotoxina III nativa y la miotoxina III alquilada presenta una asimetría
ipsilateral. Al discutir anteriormente la conducta de giro inducida por apomorfina
se propuso que este fármaco actúa preferentemente en el hemisferio no
lesionado. Según Steiner y colaboradores (1988), la lesión unilateral del sistema
dopaminérgico nigroestriatal produce una desensibilización contralateral respecto
al hemisferio de la lesión. En otras palabras la peritaxis se presentaría
preferentemente contralateral al hemisferio de mayor actividad dopaminérgica.
Esta contralateralidad se puede explicar, por la decusación de las proyecciones
sensoriales que llegan hasta la corteza. De acuerdo al modelo de Steiner y

173

colaboradores (1988), la mayor actividad dopaminérgica, inducida por apomorfina,
en el hemisferio intacto se traduciría en una conducta de peritaxis ipsilateral tal y
como la medida en esta investigación. De esta forma, los resultados medidos de
giro y peritaxis estarían reforzando la explicación propuesta. No necesariamente,
los mecanismos de compensación presináptica que están involucrados en la
expresión de la conducta de giro ipsilateral son los mismos que se encuentran
involucrados en la expresión de la conducta de peritaxis ipsilateral.

En animales con lesiones severas inducidas por 6-OHDA se ha reportado que la
apomorfina induce una peritaxis contralateral (para una revisión Schwarting &
Huston, 1996a). Esta peritaxis contralateral también ha sido explicada por el
desarrollo de mecanismos de compensación postsinápticos de hipersensibilidad
de los receptores D
2
en el hemisferio denervado. La apomorfina actuaría en
mayor grado en el hemisferio denervado (Fornaguera et al., 1993; Schwarting &
Huston, 1996). En animales con lesiones moderadas (35 a 55%) con 6-OHDA se
ha reportado que la peritaxis preferente, inducida por apomorfina es ipsilateral
(Fornaguera et al., 1993). La peritaxis ipsilateral, se ha explicado por el desarrollo
de mecanismos de compensación presinápticos que permitiría que la apomorfina
actúe preferentemente en el hemisferio intacto, y no por el desarrollo de
mecanismos de compensación postsinápticos (Hefti et al., 1980; Fornaguera et al.,
1993).

Mediante el análisis de las conductas de giro y peritaxis inducidas
farmacológicamente por la apomorfina en los animales lesionados con la
miotoxina (nativa y alquilada) se obtuvieron resultados semejantes a los que se
han reportado, también en animales lesionados moderadamente, con la toxina
clásica 6-OHDA (Fornaguera et al., 1999). Se considera importante resaltar que si
bien ambos modelos de lesión por toxina (MT-III y 6-OHDA) se comportan de
forma semejante por acción de la apomorfina, los animales se comportan de forma
diferente frente a la acción de la respectiva toxina el primer día postoperatorio y

174

los días siguientes de evolución del proceso de lesión. A partir de esto se podría
sugerir que, independientemente del mecanismo de la lesión, los efectos
evocados por la apomorfina son semejantes en ambos modelos.

Otra explicación del giro y la peritaxis ipsilaterales medidos por lesiones con las
toxinas (nativa y alquilada) puede encontrarse en la depleción medida de
norepinefrina en estriado dorsal ipsilateral respecto al lado de la lesión (ver figura
39). Esta depleción puede ser un indicativo de la lesión durante la cirugía o
posteriormente de la vía del locus coeruleus que pasa ventromedial a la pars
compacta (Nieuwenhuys, 1985). La lesión de de la vía del locus coeruleus podría
ser un indicativo de una afectación moderada de la porción dorsal de la SNpr. La
SNpr es una vía eferente de los axones de las neuronas estriatales, entonces la
señal proveniente de estriado (por estimulación de la apomorfina) podría verse
disminuida o bloqueada parcialmente en la SNpr. Histológicamente se pudo
observar que algunas de las cánulas empleadas en la cirugía alcanzaron las
porciones ventrales de la SNpc y dorsales del SNpr (ver figuras 45 y 46). Es de
esperar que la contribución de este efecto, sobre las asimetrías conductuales
inducidas por apomorfina, sea poca, pues la SNpr es una región muy grande y la
porción de la SNpr que se podría ver afectada es pequeña. De poderse medir
aisladamente la influencia de este efecto sobre las conductas de giro y peritaxis
inducidas por apomorfina, el mismo induciría un giro y una peritaxis ipsilaterales.

Respecto al porcentaje de depleción medido para serotonina, éste presenta una
gran variabilidad entre los animales. Los porcentajes de depleción promedios en
estriado son bajos entre los grupos experimentales lo que muestra una tendencia
de una poca afectación promedio de los niveles de serotonina. Estos resultados
indican que la afectación de la vía del núcleo del Rafé es poca.

El comportamiento de giro ipsilateral inducido con apomorfina, observado por
lesiones con MT-III, también se ha reportado para lesiones severas en SNpc con

175

toxinas como la rotenona (Sindhu, et. al., 2005 & Sindhu et al., 2006), el MPP
+

(Sindhu et al., 2006) y otras toxinas (J ackson-Lewis, 2000; Vivó et al, 2002).
Además se ha reportado en lesiones de SNpr con ácido iboténico (Konitsiotis et al,
1998).

El grupo de investigadores de Sindhu y otros (2005 & 2006) reportan que los
animales con lesiones severas con rotenona presentan, luego de la inyección de
apomorfina (1 mg/kg) en días diferentes durante cuatro semanas después de la
cirugía, un predominio del giro ipsilateral. Estos investigadores logran demostrar
histológicamente que si bien las cánulas con la toxina llegaron justo a la SNpc, se
presentó una progresión ventral de la lesión hacia SNpr. Esta progresión fue
evidente mediante la medición de una disminución del número de neuronas en
SNpr (Sindhu, et. al., 2005). En estos animales con lesiones severas, se
esperaría que en el estriado denervado se desarrollen procesos de compensación
postsináptica (supersensibilidad de receptores postsinápticos). No obstante la
estimulación por la apomorfina, de forma mayoritaria sobre los receptores D
2
del
hemisferio lesionado, no se traduciría en un giro y una peritaxis contralaterales
pues las eferencias estriato-nigrales se encontrarían lesionadas, y por ende no
habría señal GABAérgica inhibitoria sobre el tálamo. Estos investigadores no
reportan haber realizado mediciones neuroquímicas de norepinefrina. Estos
mecanismos no pueden ser los que subyacen la presente investigación pues las
lesiones obtenidas con las miotoxinas no son severas y las lesiones en SNpr (de
presentarse) se esperarían que sean leves.

Además, Sindhu y colaboradores (2006) logran, mediante lesiones de las tres
regiones clásicas (SNpc, región medial del prosencéfalo y estriado) que se
estudian para modelar la enfermedad de Parkinson (Deumens et al., 2002),
explicar también el mecanismo propuesto de lesión de la sustancia nigra reticulata
por infusión inicial en la sustancia nigra compacta. Sindhu y colaboradores (2006)
al lesionar la región medial del prosencéfalo (del inglés: medial forebrain bundle:

176

MFB) tanto con rotenona como con MPP
+
, obtienen un comportamiento de giro
similar al reportado para lesiones severas de SNpc con 6-OHDA es decir: un giro
contralateral inducido por apomorfina y un giro ipsilateral inducido por anfetamina
(Ungerstedt & Arbuthnott, 1970; Ungerstedt, 1971; Schwarting & Huston, 1996a).
Al lesionar la región MFB se corta la señal dopaminérgica hacia estriado; pero
permanece intacta la vía estriato - nigral. Al lesionar estriado con rotenona y
también con MPP
+
se provoca un giro ipsilateral inducido por apomorfina y un giro
ipsilateral inducido por anfetamina (Sindhu et al., 2006), este comportamiento es
igual que el que obtienen al lesionar la SNpc. Al lesionarse el estriado, no habrá
señal estriato – nigral. Estos investigadores no reportan la conducta de giro
espontánea en los días cercanos a la administración de apomorfina.

Konitsiotis y colaboradores (1998) al lesionar unilateralmente SNpr y no SNpc con
ácido iboténico reportan, un giro neto ipsilateral intenso por apomorfina (1,5
mg/kg). Estos hallazgos apoyan las explicaciones anteriores de lesión de SNpr
con rotenona. Estos investigadores no hacen referencia al grado de lesión de los
animales. En ese estudio reportan la presencia de afagia, adipsia y pérdida de
peso en los animales. Evidentemente la ausencia de estos efectos secundarios
en la presente investigación hace suponer que la MT-III provocaría, a lo sumo, una
lesión suave en SNpr.

En resumen, los mecanismos que se cree mejor explican los comportamientos
asimétricos inducidos con apomorfina, obtenidos por lesiones con las toxinas MT-
III (nativa y alquilada), son los que se basan en el desarrollo de mecanismos de
compensación presinápticos en el estriado lesionado y la ausencia o poco
desarrollo de mecanismos de compensación postsináptica en el estriado
denervado moderadamente (Fornaguera et al 1993).

Otras conductas estudiadas, inducidas por apomorfina, fueron la locomoción, la
exploración y el acicalamiento. En la presente investigación, el día 20

177

postoperatorio luego de la administración de apomorfina, la conducta de
locomoción disminuye un poco respecto a los valores que se presentaron el día 18
(ver figura 36). Las conductas de exploración (ver figura 37) y acicalamiento (ver
figura 38) medidas el día 20 luego de la administración de apomorfina disminuyen
respecto a los valores espontáneos medidos el día 18 y además, el día 20 los
animales prácticamente no expresan las conductas de acicalamiento y
exploración. El día 20 postoperatorio no se encontraron diferencias en el
comportamiento para estas tres conductas entre los tres grupos experimentales
(control, toxina nativa, toxina alquilada). La disminución de estas tres conductas
parece no depender de la acción tóxica de la miotoxina.

La menor actividad en las conductas de locomoción exploración y acicalamiento
inducidas por la apomorfina (ver días 18 y 20 en figuras 36 a 38), no se traduce en
una mayor expresión de la conducta de giro total (ver días 18 y 20 en figura 32).
Respecto a la conducta de peritaxis totales, ésta solo se ve aumentada respecto al
día 18 en el grupo de toxina nativa (ver días 18 y 20 en figura 35). Aparentemente
en los animales moderadamente lesionados con las miotoxina MT-III (nativa y
alquilada), la apomorfina induce además de asimetrías conductuales ipsilaterales
en giro y peritaxis, una menor actividad corporal generalizada.

De forma adicional se estudió las conductas de giro y peritaxis netos de todos los
días evaluados respecto al porcentaje de lesión de cada individuo. De este
estudio (datos no mostrados), únicamente la variable del giro neto inducido por
apomorfina se pudo correlacionar con el porcentaje de lesión en los animales
tratados con la miotoxina III nativa. Esta correlación fue inversa e indica que los
animales que presentan mayores lesiones presentan un menor giro ipsilateral.
Estos hallazgos son congruentes con lo que se ha reportado en lesiones
moderadas y leves con 6-OHDA. En los animales con lesiones entre el (35 a 55)
%, el giro ipsilateral inducido por apomorfina es mayor que los animales con
lesiones menores al 35% (Fornaguera et al., 1993).

178



5.10 Efecto inducido por anfetamina en las ratas lesionadas con la MT-III
nativa y la MT-III alquilada, el día 22 postoperatorio.
La anfetamina es un agonista dopaminérgico y noradrenérgico indirecto (Flórez,
2008), ya que aumenta los niveles de dopamina en la brecha sináptica mediante
tres mecanismos principales: aumento de la liberación vesicular de dopamina,
disminución de la recaptura presináptica de la misma y disminución de la
degradación enzimática de la dopamina (Flórez, 2008).

La anfetamina, a la dosis evaluada de 1,0 mg/kg por vía intraperitoneal induce una
conducta de giro contralateral (ver figuras 30 y 31) y una peritaxis ipsilateral (ver
figuras 33 y 34) en los animales intervenidos con las toxinas (nativa y alquilada),
no así en el grupo control. El efecto asimétrico inducido en el giro y en la peritaxis
por la anfetamina es menor en el grupo intervenido con la toxina alquilada que en
el grupo intervenido con la toxina nativa.

De acuerdo con el paradigma para explicar la dirección de la conducta de giro: “el
animal lesionado unilateralmente gira hacia el lado de la menor actividad
dopaminérgica” (Ungerstedt & Arbuthnott, 1970; Ungerstedt, 1971), la asimetría
contralateral de la conducta de giro inducida por anfetamina en los animales
lesionados con la miotoxina III nativa y la miotoxina III alquilada, indicaría una
mayor actividad dopaminérgica inducida en el hemisferio ipsilateral respecto a la
lesión. Es posible que la anfetamina esté actuando, en mayor medida en el
hemisferio ipsilateral respecto a la lesión, mediante al menos uno de los
mecanismos descritos (Flórez, 2008) para la anfetamina (aumento de la liberación
vesicular, disminución de la recaptura presináptica y disminución de la
degradación enzimática). No es posible establecer con los datos obtenidos en

179

esta investigación si alguno de estos procesos descritos en la literatura se
presentaría en mayor medida o si los tres se activan de forma semejante.

Por otro lado, la asimetría ipsilateral de la conducta de peritaxis inducida por
anfetamina, en los animales lesionados con las toxinas MT-III (nativa y alquilada),
sugiere que esta droga estimula de forma preferente los mecanismos de aumento
de la liberación vesicular, disminución de la recaptura presináptica y disminución
de la degradación enzimática, en el hemisferio contralateral (respecto a la lesión).

Esta aparente contradicción respecto al hemisferio (lesionado o no lesionado)
donde actúa con mayor intensidad la anfetamina, es un indicativo que los animales
lesionados moderadamente con las toxinas MT-III (nativa y alquilada) no
responden, para las conductas de giro y peritaxis, de igual forma frente a la
estimulación farmacológica con anfetamina. Otra posibilidad de esta aparente
acción disímil es que la integración de las conductas de giro y peritaxis, al ser
inducidas por anfetamina, se produce por mecanismos diferentes.
Adicionalmente, podría ser posible que los patrones de compensación
desarrollados en los animales lesionados moderadamente con las toxinas (nativa y
alquilada) respondan de forma diferente a las conductas de giro y peritaxis cuando
se estimulan por la anfetamina. Lo anterior refuerza los planteamientos
propuestos por otros investigadores (Fornaguera et al., 1993; Fornaguera &
Schwarting, 1999) de que las conductas de giro y de peritaxis responden diferente
a la lesión con 6-OHDA.

También se ha propuesto, en lesiones con 6-OHDA, que la conducta de peritaxis
es un indicador de déficits funcionales más sensible que la conducta de giro
(Fornaguera et al., 1993; Fornaguera & Schwarting, 1999). Como se discutió
anteriormente, en lesiones moderadas con MT-III (nativa y alquilada), la conducta
de peritaxis espontánea evidencia procesos funcionales asimétricos de una forma
más sensible que la conducta de giro. Estos planteamientos podrían sugerir que

180

las diferencias observadas entre estas conductas de giro y peritaxis inducidas por
anfetamina se deban a diferencias en la sensibilidad de cada conducta respecto a
procesos bioquímicos diferentes. Se podría proponer que la conducta de peritaxis
por estimulación con anfetamina, estaría haciendo evidentes conductualmente,
procesos bioquímicos asimétricos de una forma más sensible de lo que permitió
medir la conducta de giro también inducida por anfetamina.

Las conductas de giro y de peritaxis inducidas por la anfetamina, en los animales
lesionados moderadamente con las toxinas MT-III (nativa y alquilada) es diferente
de las conductas de giro y peritaxis descritas en animales lesionados con 6-OHDA
de forma severa (Schwarting & Huston, 1996a; J ackson-Lewis & Liberatore, 2000;
Díaz-Véliz et al., 2002), así como en los animales lesionados de forma moderada
(Hefti et al., 1980; Fornaguera et al., 1993; Fornaguera & Schwarting, 1999).

En los animales lesionados de forma severa (>80%) con 6-OHDA, se ha descrito
que la anfetamina induce una conducta de giro ipsilateral la cual se ha explicado
por la estimulación de los procesos de síntesis de dopamina, inhibición de su
recaptura y disminución de su metabolismo en el hemisferio intacto donde se
espera que haya mayor número de neuronas intactas respecto al hemisferio
lesionado. La conducta de peritaxis inducida por anfetamina en estos animales
también es ipsilateral y es explicada por el mismo efecto bioquímico de la
anfetamina (para una revisión ver Schwarting & Huston, 1996a).

En los animales lesionados de forma moderada (<80%) 6-OHDA, se ha reportado
que la anfetamina no induce ninguna asimetría en las conductas de giro ni de
peritaxis (Fornaguera et al., 1993). Estos investigadores sugieren que en los
animales con lesiones moderadas, los receptores presinápticos de dopamina
presentan una asimetría. Esta asimetría entre los receptores presinápticos
explicaría los procesos de compensación presinápticos que llevan a las conductas
simétricas espontáneas de giro y peritaxis. No obstante, esta asimetría

181

presináptica parece ser independiente de las acciones de la anfetamina sobre los
procesos de síntesis, recaptura y metabolismo de la dopamina. Entonces el
incremento de la dopamina extracelular inducido por la anfetamina sería
prácticamente simétrico (Fornaguera et al., 1993). En las lesiones moderadas
provocadas por las toxinas (nativa y alquilada de MT-III) parece ser que las
asimetrías de los autoreceptores (presinápticos), que permiten la simetría de las
conductas de giro y peritaxis espontáneas, no son independientes de los
mecanismos que induce la anfetamina.

Por lo anterior se puede sugerir que los mecanismos neurales afectados por la
anfetamina y que subyacen en los animales con lesiones moderadas inducidas por
las toxinas MT-III (alquilada y nativa) son diferentes a los que subyacen en los
animales lesionados moderadamente con 6-OHDA.

En la literatura consultada, en lesiones con 6-OHDA en SNpc, no ha sido
reportada aún la inducción de un giro contralateral por acción de la anfetamina a la
dosis de 1,0 mg/kg, sin importar el grado de lesión alcanzado después del cuarto
día postoperatorio (Lynch & Carey, 1989; Fornaguera el tal., 1993; para una
revisión ver Schwarting & Huston, 1996a). No obstante, sí se ha reportado un giro
contralateral inducido por anfetamina en casos muy particulares que se describen
a continuación.

Lynch & Carey (1989) describen que en animales lesionados severamente con 6-
OHDA en SNpc, el día 1 postoperatorio (cuando aún la lesión no es severa), la
anfetamina (1,0 g/kg) induce un giro contralateral que va en decremento con el
tiempo hasta ser inexistente el día 4 postoperatorio. Estos autores proponen que
este giro contralateral inducido se debe a la liberación de dopamina (inducida por
la anfetamina) de los sitios de almacenamiento y al bloqueo de la captura
presináptica de dopamina, ambos mecanismos de forma preferente en el
hemisferio intervenido. Bernstein & Beninger (2000), reportan un giro contralateral

182

inducido por anfetamina en ratas no lesionadas, a los cuales se les coloca
unilateralmente una cánula en el núcleo accumbens. A través de la cánula, los
animales reciben unilateralmente dosis de anfetamina de 10 y 20 g. Richards y
colaboradores (1993), reportan un giro contralateral, inducido por anfetamina (0,12
mg/kg) en ratas lesionadas con 6-OHDA. Estas ratas, 4, 8, 12 y 16 semanas
después de recibir un trasplante de tejido fetal dopaminérgico mesencefálico en
estriado y de recibir un entrenamiento para que giren en busca de agua, muestran
un aumento del giro contralateral.

Los tres casos anteriores son casos muy particulares y ninguno de ellos puede
llegar a explicar el efecto sobre el giro por lesión con MT-III. Inclusive no es
factible pensar en una lesión en el núcleo accumbens pues de acuerdo con la
evaluación neuroquímica en estriado ventral en la presente investigación, la lesión
medida en estriado ventral en muy poca. No obstante, estos tres casos
concuerdan en que la mayor actividad dopaminérgica inducida unilateralmente por
la anfetamina (por inoculación directa, por un trasplante o por una sensibilidad
particular del estriado que está en proceso de neurodegeneración) se traduce en
una conducta de giro contralateral como el medido por acción de la anfetamina en
los animales lesionados moderadamente con las miotoxinas (nativa y alquilada).

Otras conductas estudiadas, inducidas por anfetamina, fueron la locomoción, la
exploración y el acicalamiento. Es conocido que la anfetamina es una droga que
aumenta la actividad locomotora y la conducta de exploración (Lynch & Carey,
1989; Bernstein & Beninger, 2000). Un efecto de la anfetamina en los animales
intervenidos con las toxina MT-III (nativa y alquilada) es un incremento general de
la actividad locomotora el cual se pudo observar no solo en el aumento al doble,
respecto cada uno de los días anteriores) de la actividad locomotora mediante la
variable de número de cruces (ver figura 36) sino por las variables de giros totales
(ver figura 32) y las peritaxis totales (ver figura 35) que aumentan a
aproximadamente el doble de los valores alcanzados el día 18. La conducta de

183

exploración también es una conducta importante inducida por la anfetamina (ver
figura 37) contrario a lo obtenido por inducción por la apomorfina (ver figura 37) en
que la conducta de exploración se ve disminuida. Si bien la conducta de
exploración inducida por anfetamina (día 22) es menor a la obtenida el día 18, la
expresión de la conducta de exploración podría verse disminuida por procesos de
competencia con las otras tres conductas que se mencionó está aumentadas el
día 22 (locomoción, giro total y peritaxis total). A partir de lo anterior se podría
plantear que el comportamiento en locomoción y exploración inducido por la
anfetamina en los animales lesionados con las toxinas MT-III es semejante a la
descripción clásica de aumento generalizado (Lynch & Carey, 1989; Bernstein &
Beninger, 2000).

Si se compara las conducta de locomoción y exploración obtenidas por inducción
con la anfetamina el día 22 (ver figuras 36 y 37) con los valores obtenidos el día
20, se puede observar que ambas conductas se observan considerablemente
aumentadas respecto a las inducidas el 20 por la administración de apomorfina.

El día 22, las conductas de locomoción y exploración que induce la anfetamina
(ver figuras 36 y 37) en el grupo de toxina alquilada es siempre menor que las que
induce en el grupo de toxina nativa. Lo anterior permite sugerir que la medición de
estas dos conductas es importante para evaluar diferencias entre el efecto de la
MT-III nativa y la MT-III alquilada. Como se ha propuesto antes podría también
obedecer a una diferencia de intensidad del efecto, es decir, que el efecto de la
MT-III alquilada parece ser menor.

La anfetamina también provoca en todos los animales una marcada disminución
de conducta de limpieza respecto a los valores obtenidos el día 18 (ver figura 38),
aunque en menor medida que la disminución de la conducta de limpieza inducida
por la apomorfina. El efecto sobre la conducta de acicalamiento (tanto por
inducción de la apomorfina como de la anfetamina) parece no depender del grado

184

de lesión, ni de los procesos neurales que se encuentren involucrados en las
lesiones pues las tendencias entre los tres grupos se observan parecidas. Como
se mencionó anteriormente, la anfetamina como estimulante del sistema nervioso
central (Flórez, 2008) estimula o aumenta la actividad general de los animales. La
anfetamina típicamente presenta un aumento dosis-dependiente de la actividad
conductual general (hiperactividad y incluyendo la locomoción, la exploración y
comportamientos orofaciales (Lynch & Carey, 1989; Schwarting y Huston, 1996a;
Bernstein & Beninger, 2000). Si bien la conducta de limpieza incluye pasos
orofaciales, la menor expresión de la conducta de limpieza requiere que el animal
detenga de su movimiento de traslación, de exploración y de giro lo que contrario
al efecto de estimulación de la actividad locomotora en general que induce la
anfetamina.


5.11 Comparación del efecto por lesión con la miotoxina (MT-III) nativa y con
la miotoxina (MT-III) alquilada
Como se describió en el apartado 3.5, la alquilación de la miotoxina III con
bromuro de p-bromofenacilo (PBP), bloqueó el sitio catalítico PLA
2
, de esta toxina.
La actividad fosfolipasa A
2
, medida a la preparación de la miotoxina alquilada que
se empleó en este experimento, no fue detectable. Por lo anterior, cualquier
efecto observado y que se pueda atribuir únicamente a la acción de la miotoxina
alquilada, no sería dependiente de la actividad enzimática PLA
2
de ninguna
manera.

En la presente investigación, el efecto tóxico (conductual y neuroquímico) medido
por la infusión en SNpc de la toxina alquilada, a la dosis de 1,4 g, es en general
de la misma tendencia o dirección del efecto obtenido por la inoculación de la
toxina nativa a la misma dosis; pero de menor magnitud en ciertas variables
estudiadas. La magnitud del efecto medido a la MT-III alquilada es menor que el

185

efecto medido a la MT-III nativa en las variables: giro contralateral del día 1, giro
ipsilateral inducido por apomorfina, giro contralateral inducido por anfetamina (ver
figura 30), peritaxis ipsilateral inducidas por apomorfina y por anfetamina (ver
figura 33), locomoción los días 1, 20 y 22 (ver figura 36); exploración inducidas los
días 1, 20 y 22 (ver figura 37) y acicalamiento espontáneo del día 18 (ver figura
38).

Una asimetría conductual refleja un desbalance en las funciones neurológicas
entre los hemisferios. Entre mayor sea el desbalance neurológico (neuroquímico o
estructural) se esperaría que fueran mayores las diferencias que se puedan medir
conductualmente. Es importante mencionar que no todo desbalance bioquímico
se tiene que traducir necesariamente en una conducta visible; pero sí un
desbalance conductual si es indicativo de algún desbalance bioquímico. En las
investigaciones con 6-OHDA se ha determinado que la mayor asimetría
conductual (tanto en la conducta de giro, como de peritaxis) es un indicativo de
mayor grado de lesión en los animales, tanto en los comportamientos espontáneos
como inducidos farmacológicamente con apomorfina y anfetamina (Fornaguera et.
al., 1993; Fornaguera y Schwarting, 1999). Se podría proponer entonces que el
efecto tóxico medible conductualmente por inyección en SNpc de la miotoxina
nativa es mayor que el efecto tóxico medido por acción de la miotoxina alquilada.
Las mediciones conductuales evidencian la presencia de diferencias en el efecto
entre las dos miotoxinas aún cuando los rangos de porcentaje de lesión obtenidos
para ambas toxinas son semejantes.

Otra comparación realizada entre el efecto de las dos toxinas es en la evolución
del proceso de la lesión en los animales intervenidos con las toxinas desde el día
01 postoperatorio hasta el día 18 postoperatorio. Como se discutió anteriormente
para ambas toxinas se propone que se desarrollaron procesos de compensación
neuroquímica presinápticos. Para la miotoxina alquilada, se logró medir
asimetrías en las conductas de giro y peritaxis más tardíamente que con la

186

miotoxina nativa. Por lo anterior parece ser los procesos de avance de la lesión,
cicatrización y/o el desarrollo de mecanismos compensatorios presinápticos son
más lentos con la miotoxina alquilada. Se propuso anteriormente que estas
miotoxinas (nativa y alquilada) producen una neurodegeneración más lenta y
progresiva que la reportada en la literatura para la 6-OHDA (para una revisión ver
Schwarting & Huston, 1996a). Aparentemente, estos procesos son más lentos
con la miotoxina alquilada. Parece ser que la actividad PLA
2
presente en la
miotoxina nativa acelera el efecto.

De acuerdo a los resultados obtenidos en esta investigación, el modelo de lesión
de la SNpc con la miotoxina III (nativa y alquilada) parece ser un buen candidato
como modelo preclínico de la enfermedad de Parkinson (Hefti et al, 1980;
Fornaguera et. al., 1993; Kirik et al., 1998; Fornaguera y Schwarting, 1999), debido
que permitiría estudiar los procesos de neurodegeneración por un mayor número
de días. En general el modelo con estas miotoxinas es mejor en este sentido que
los modelos tradicionales.

Las conductas de locomoción y de exploración inducidas por apomorfina y por
anfetamina en el grupo de toxina alquilada son menores que las inducidas en el
grupo de toxina nativa. Así también es menor la conducta de exploración
espontánea (entre los días 1 y 18) en el grupo de toxina alquilada. Estas dos
conductas son empleadas como un indicativo de la actividad locomotora general
de los animales (Lynch & Carey, 1989; Bernstein & Beninger, 2000). La actividad
locomotora de los animales lesionados con la miotoxina alquilada se encuentra
disminuida y quizás este factor influya, en alguna medida, en la menor expresión
de las conductas de giro y peritaxis del grupo de toxina alquilada.

La razón por la cual la actividad locomotora general, de las ratas lesionadas con la
miotoxina alquilada, se encuentra disminuida no puede aclararse con los
resultados presentes.

187


Si bien la MT-III de Bothrops asper ha sido descrita como “no neurotóxica” por
carecer de acción directa sobre placa motora (Kaiser et al., 1990), Ponce-Soto y
colaboradores (2007) han demostrado la presencia de un efecto de inhibición
completa de la sinapsis neuromuscular (neurotoxicidad) en un sistema in vitro
inducido por la acción local de la miotoxina BaTX de Brothrops alternatus. La MT
BaTX es miotóxica, “no neurotóxica” y sin actividad PLA
2
. En esta investigación
se propone que la MT-III (alquilada y nativa) presenta un efecto tóxico moderado
(grado de lesión no es muy alto a la dosis de 1,4 g) al menos sobre neuronas
dopaminérgicas centrales y que sus efectos no serían solo debidos a la actividad
fosfolipasa A
2
que contribuye de manera discreta. La MT-III sería la primera
miotoxina con actividad fosfolipasa A
2
descrita, clasificada como “no neurotóxica”,
que presenta neurotoxicidad a nivel central.

Todos los investigadores (Bultrón et al., 1993a y 1993b; Gutiérrez & Lomonte,
1995) que han trabajando con la miotoxina III de Bothrops asper, han descrito que
la acción tóxica (principalmente miotóxica) de la MT-III se debe a dos mecanismos
independientes: su acción PLA
2
y a otro mecanismo no enzimático. Así también
se han descrito la presencia de dos mecanismos para otras toxinas tipo fosfolipasa
A
2
, extraídas del veneno de otras serpientes (Rehm & Betz, 1982). Con esta
investigación se aporta evidencia adicional que sugiere la existencia de dos
mecanismos de acción tóxica: uno por su acción PLA
2
(catalítica) y a otro
mecanismo no PLA
2
; pero esta vez en neuronas cerebrales dopaminérgicas. Este
trabajo presenta el primer reporte de un efecto de la MT-III (nativa y alquilada) en
neuronas cerebrales.

Se ha descrito que, en células no cerebrales (principalmente miocitos, y también
en células ováricas, fibroblastos, células tumorales adrenales, células epiteliales),
el efecto tóxico principal es por el mecanismo fosfolipasa A
2
y que el otro
mecanismo de toxicidad es de menor magnitud. (Bultrón et al. 1993a y 1993b).

188

En los estudios con miocitos, se ha medido que el efecto sobre la actividad de
permeabilización de la membrana celular se reduce en un 70 % por la alquilación
de la MT-III (Bultrón et al., 1993). En la presente investigación se encontró que el
efecto fosfolipasa A
2
no es el mecanismo de neurotoxicidad más importante.

Se

desconoce aún, cual es la naturaleza de este otro mecanismo de lesión; pero
podría ser interesante investigar en futuros proyectos si el mismo podría estar
ligado a sitios de unión tipo N, abundantes en tejido cerebral de rata (Lambeau &
Lazdunski, 1999). En tal caso, la MT-III podría ser la primera fosfolipasa A
2
, que
carece de actividad neurotóxica a nivel de placa motora, que presentaría acción
central sobre receptores tipo N, pues hasta la fecha la acción sobre receptores
cerebrales tipo N ha sido reportada solo con toxinas neurotóxicas a nivel periférico
(Lambeau et al., 1991 y Nicolas et al., 1997).


El efecto conductual, por lesión moderada, medido para la miotoxina III nativa de
Bothrops asper y para la MT-III inactivada por alquilación en el sitio catalítico
PLA
2
, es diferente en ciertos aspectos al efecto reportado por lesiones moderadas
y severas con la toxina clásica 6-OHDA (para una revisión Schwarting y Huston,
1996a), así como el reportado para la rotenona y el MPP
+
(Sindhu et al, 2005 &
2006; Saravanan et al, 2005), aunque también es semejante en otros aspectos.
Las diferencias se lograron demostrar mediante la medición conductual
espontánea de giro, peritaxis, locomoción y exploración. El modelo de lesión con
la miotoxina (nativa y alquilada) presenta un efecto local el día de la cirugía con un
aumento de los niveles dopamina en el estriado dorsal del hemisferio intervenido.
La progresión de la lesión y el desarrollo de procesos de compensación
presinápticos ocurren en un lapso de tiempo mayor que el modelo clásico con 6-
OHDA. Por esto se propone que el modelo de lesión con MT-III podría ser útil
para comprender los estados preclínicos de la enfermedad de Parkinson en los
humanos. Así mismo los procesos bioquímicos y fisiológicos que subyacen en los
animales lesionados moderadamente con MT-III (alquilada y nativa) son diferentes

189

a los que se obtienen por lesiones moderadas con 6-OHDA, ya que se demostró
que responden de forma diferente a la acción de la anfetamina.


5.12 Conclusiones
La metodología por HPLC desarrollada permite la determinación de tres
neurotransmisores (noepinefrina, dopamina y serotonina) y tres metabolitos (ácido
3,4-dihidroxifenilacético, ácido 5-hidroxi 3-indolacétivoy ácido homovanílico) en
tejido cerebral con buena resolución, aceptable reproducibilidad del tiempo de
retención aceptable y sensible en el orden de las partes por billón (ng/mL). La
detección de norepinefrina se ve afectada por su coelución antes del frente del
disolvente y con componentes del tejido cerebral no identificados, de allí que se
requiere realizar manualmente la integración de este pico cromatográfico. La
sensibilidad de la metodología desarrollada es adecuada para la determinación de
dopamina y ácido 3,4-dihidroxifenilacético. Estos dos compuestos son
mayoritarios en los tejidos estudiados. La detección de serotonina, ácido
homovanílico y ácido 5–hidroxi 3-indolacético en las regiones de estriado ventral y
septo se dificulta debido que la cantidad de tejido que se colecta es muy pequeña
y que los niveles en estos tejidos se encuentran cercanos al límite de detección y
los picos cromatográficos se ven afectados por pequeñas impurezas
cromatográficas.

Como se pudo observar en los tres experimentos realizados, la miotoxina III
(nativa y alquilada) de Bothrops asper al menos a las dosis de 1,4 y 14 µg tiene un
efecto neurotóxico sobre las conductas de giro y peritaxis, además de un efecto
neuroquímico sobre el sistema nigroestriatal al ser inyectada estereotáxicamente
en Sustancia nigra pars compacta. Se sugiere que el proceso de lesión inducido
por la miotoxina III es lento y no agudo como ha sido reportado para esta
miotoxina en otros lechos celulares como miocitos, y para la 6-OHDA al ser

190

inyectada en SNpc. El modelo de lesión unilateral de la SNpc es novedoso y
aplicable para la medición de la función de los ganglios basales. Eventualmente
este modelo podría proyectarse como un modelo para el estudio de los estados
preclínicos de enfermedades neurológicas como la enfermedad de Parkinson
debido a que aparentemente el proceso de lesión inducido es lento y progresivo.
Este modelo podría llegar a permitir ver del desarrollo de enfermedades
neurológicas y con ello colaborar en el campo del tratamiento preclínico de las
mismas.

Los resultados de los experimentos uno y tres se fortalecen entre sí, pues muchas
de las tendencias descritas en el experimento uno se pudieron corroborar
estadísticamente en el experimento tres.

El experimento uno permitió realizar un escrutinio del efecto conductual y
neuroquímico de la miotoxina III, además de seleccionar la dosis de trabajo para
los dos experimentos posteriores. La dosis de 14 g permitió la evaluación del
efecto neuroquímico de la MT-III el día de la lesión a corto plazo (15, 60, 180 y 360
min). La dosis de 1,4 g permitió medir un efecto conductual y neuroquímico sin el
inconveniente de la mortalidad de los animales.

El modelo animal de hemiparkinsonismo estudiado en esta investigación obtenido
mediante la infusión estereotáxica en substancia nigra pars compacta (SNpc) de la
miotoxina III (MT-III) de Bothrops asper, en ratas macho Sprague – Dawley
adultas, es el primer modelo de hemiparkinsonismo que emplea una toxina tipo
fosfolipasa A
2
.

El día de la cirugía, la miotoxina a la dosis de 14 g (1 nmol) provoca la liberación
de la dopamina de las vesículas de las neuronas de sustancia nigra pars
compacta del hemisferio intervenido, se desconoce si el mecanismo es por
estimulación de la exocitosis o por destrucción de la membrana celular o por

191

ambos. También se propone que esta dopamina liberada o la misma miotoxina o
ambas difunden ventralmente hacia la sustancia nigra reticulada y que la
estimulación de la SNpr provocando convulsiones en los animales. No se
caracterizó el efecto de las convulsiones. Para futuras investigaciones con esta
toxina se recomienda caracterizar más sistemáticamente la incidencia y
características de este efecto.

Se propone que entre los tres y cinco días siguientes a la cirugía a las tres dosis
evaluadas de miotoxina los niveles de dopamina son mayores en el hemisferio
intervenido por una liberación gradual de dopamina de sus sitios de
almacenamiento, los cuales van degenerando en el tiempo. A esta conclusión se
llega por la presencia estos días de una conducta preferente de un giro
contralateral espontáneo contrario a lo reportado en otro tipo de lesiones como las
inducidas por 6-OHDA.

Para que esta liberación gradual de dopamina se presente, es requerido que las
neuronas de SNpc del hemisferio intervenido (ipsilaterales) no se hayan destruido
en su totalidad el día uno postoperatorio, sino que durante estos tres a cinco días,
en SNpc ocurra algún mecanismo neurodegenerativo progresivo inducido por la
inoculación de la MT-III. Entonces, no se estaría proponiendo un mecanismo de
lesión por una acción aguda o destrucción masiva de membranas neuronales, sino
un efecto gradual o crónico de la lesión. De demostrarse este mecanismo
neurodegenerativo progresivo, un modelo con MT-III podría emplearse en un
futuro para comprender los procesos neurodegenerativos preclínicos que ocurren
en la enfermedad de Parkinson en humanos.

A partir del día 7 postoperatorio el estado de las ratas es de animales con lesiones
moderadas en el sistema nigroestriatal. La lesión moderada fue corroborada
neuroquímicamente entre el día 23 y 24 postoperatorio. Estos animales muestran
una conducta simétrica espontánea de giro evocada por el desarrollo de procesos

192

de compensación neuroquímica presináptica como podrían ser el aumento de la
síntesis de dopamina por parte de las neuronas intactas, el aumento de liberación
de dopamina y la disminución de su recaptura presináptica. La conducta de
peritaxis neta se presenta a partir del día 7 postoperatorio como una conducta más
sensible que la conducta de giro neto sobre los procesos neurales que están
ocurriendo en los animales, evidenciando un desbalance neuroquímico. La
peritaxis neta estos días es ipsilateral evidenciando una mayor actividad
dopaminérgica en el hemisferio no intervenido. El estado conductual
anteriormente descrito se mantuvo hasta el 18 postoperatorio.

La administración subcutánea de apomorfina (0,5 mg/kg), el día 20 postoperatorio
induce principalmente una conducta de giro neto ipsilateral y una conducta de
peritaxis también ipsilateral. Ambas conductas observadas se pueden explicar por
encontrarse las ratas lesionadas moderadamente. Las ratas no han desarrollado
mecanismo de compensación postsinápticos como es la supersensibilidad de los
receptores D
2
en estriado, sino que la apomorfina actúa principalmente en estriado
del hemisferio no intervenido. Asociado a esto también se plantea una posible
lesión moderada de la parte dorsal de la SNpr, que disminuye más la actividad del
hemisferio ipsilateral. Esta posible ventralización de la lesión se fundamente en la
presencia de convulsiones a la dosis de 14 g de MT-III y la medición a la dosis de
1,4 de g de MT-III de una depleción de noradrenalina en estriado ipsilateral por
afectación de la vía que proviene del locus coeruleos. Además, los estudios
histológicos realizados evidencian que algunos de los animales el sitio de lesión
cae muy cerca de la porción dorsal de la SNpr lo que podría indicar una lesión leve
de la SNpr.

La administración intraperitoneal de anfetamina (1,0 mg/kg), el día 22
postoperatorio induce principalmente la conducta de peritaxis sobre la conducta de
giro. La conducta de peritaxis ipsilateral es congruente con la lesión moderada de
la SNpc del hemisferio intervenido pues la acción de la anfetamina sería

193

preferentemente en el hemisferio no intervenido. Se cree que la presencia de un
giro neto moderadamente contralateral inducido por anfetamina se debe a un
efecto ligado al animal que presenta una actividad locomotora aumentada y que
conforme realiza peritaxis ipsilateral, gira contralateralmente.

Un efecto presente en todos los experimentos conducidos en esta investigación es
la alta variabilidad obtenida entre los diferentes grupos de animales sometidos a
un mismo tratamiento. A saber los porcentajes de lesión obtenidos no dependen
de forma clara de la dosis aplicada y las lesiones obtenidas son muy variables y
no presentan una correlación (por análisis de regresión) con las conductas de giro
y peritaxis.

La miotoxina alquilada en el sitio catalítico PLA
2
, induce un efecto importante
sobre las neuronas dopaminérgicas y de magnitud semejante al inducido por la
MT-III nativa. A partir de esto se puede proponer, que su acción tóxica se da por
dos mecanismos. Estos resultados son congruentes son los hallazgos reportados
por Bultrón, Gutiérrez y su grupo de investigadores. El mecanismo del efecto no
PLA
2
aún se desconoce y con esta investigación solo se puede reforzar su
presencia en este otro tipo de células. A diferencia de los tipos celulares no
cerebrales, este otro mecanismo no fosfolipasa es de mayor relevancia en
neuronas dopaminérgicas centrales que el medido en miocitos y otras células no
centrales. Para comprender mejor el mecanismo no PLA
2
se recomienda realizar
este tipo de modelos de lesión de SNpc en ratas con las miotoxinas II y IV de
Bothrops asper, que se ha determinado que no presentan de forma natural
actividad PLA
2
y si presentan actividad por el otro mecanismo de toxicidad aún
desconocido (Gutiérrez y Lomonte, 1995).

El modelo animal evaluado en esta investigación es muy útil para su aplicación
como un modelo de neurodegeneración progresiva de la enfermedad de Parkinson
en humanos. La MT-III es más potente que otras toxinas clásicas estudiadas en

194

este tipo de modelos, a una dosis de 0,1 nmol (1,4 g), se puede evaluar sus
efectos a nivel conductual y neuroquímico sin problemas de mortalidad, ni pérdida
de peso y se logran lesiones moderadas. Con otras toxinas las dosis molares
requeridas son superiores hasta por dos órdenes de magnitud.

Además del uso de apomorfina y anfetamina, para esclarecer más el mecanismo
de acción de la miotoxina MT-III, se podrían emplear modificadores
farmacológicos de la conducta, como agonistas dopaminérgicos selectivos sobre
receptores D
1
o sobre receptores D
2
. Estos agonistas podrían apoyar el
argumento de la extensión ventral por difusión de la miotoxina hacia SNpr, región
en la cual residen principalmente receptores D
1
.

En general el modelo de lesión de sustancia nigra compacta en ratas con MT-III
aporta un nuevo mecanismo para el estudio de la enfermedad de Parkinson. Si
bien presenta algunas similitudes con los efectos medidos por lesión moderada
con 6-OHDA, se cree que el mecanismo es diferente. Una de las ventajas que
presenta este nuevo mecanismo es que hasta la fecha no se había estudiado este
modelo con una toxina tipo PLA
2
y que aparentemente el efecto obtenido es
neurodegenerativo y progresivo. Más aún la MT-III podría ser la primera toxina
tipo PLA
2
no neurotóxica (a nivel de placa motora) que presenta un efecto
neurotóxico central. Otra área de investigación que se abre con esta investigación
es demostrar si el mecanismo adicional no PLA
2
descrito para la MT-III es vía
sitios de unión tipo N descritos para fosfolipasas neurotóxicas.

La comparación de los resultados obtenidos con lesión con MT-III con los
reportados en la literatura con 6-OHDA, le da apoyo a los planteamientos
propuestos para la MT-III en esta investigación, del desarrollo de compensación
neuroquímica a lesiones moderadas. Lo anterior debido a que estos
planteamientos han sido propuestos en el modelo con 6-OHDA, y que este último
modelo ha sido ampliamente estudiado (Fornaguera et al., 1993, Schwarting &

195

Huston, 1996a; Deumens et al., 2002; Díaz-Veliz et al., 2002) y es utilizado
frecuentemente como un modelo de referencia (J ackson-Lewis & Liberatore, 2000;
Sindhu et al., 2005; Yasuhara et al., 2005).


196



197

CAPÍTULO VI
6. REFERENCIAS BIBLIOGRÁFICAS
Arita, H.; Hanasaki, K.; Nakano, T.; Oka, S.; Teraoka, H.; Matsumoto, K. (1991) Novel
proliferative effect of phospholipase A
2
in Swiss 3T3 cells via specific binding site.
J . Biol. Chem. 266(29) 19139 - 19141.
Berne, R.M. & Levy, M.N. Physiology. 4
th
edition; Mosby, Inc.; St Louis: 1998, págs.:
109 – 128.
Bernstein, S.N.; Beninger, R.J . (2000) Turning in rats following intraaccumbens shell
injections of amphetamine or eticlopride. Pharmacol. Biochem. Behav. 65 (2): 203-
207.
Betarbet, R.; Sherer, T.B. & Greenamyre, J .T. (2002) Animal models of Parkinson´s
disease (review). BioEssays. 24(4): 308-318.
Blum, D.; Torch, S.; Lambeng, N.; Nissou, M.F.; Benabid, A.L.; Sadoul, R. & Verna, J .M.
(2001) Molecular pathways involved in the neurotoxicity of 6-OHDA, dopamine and
MPTP: contribution to the apoptotic theory in Parkinson´s disease. Progress in
Neurobiology. 65: 135-172.
Brenes-Sáenz, J .C.; Rodríguez-Villagra, O. & Fornaguera, J . (2006) Factor analysis of
Forced Swimming test, Sucrose Preference test and Open Field test on enriched,
social and isolated reared rats. Behavioural Brain Research. 169: 57-65.
Brenes, J .C.; Padilla, M. & Fornaguera, J . (2008) A detailed analysis of open-field
habituation and behavioral and neurochemical antidepressant-like effects in
postweaning enriched rats. Behavioural Brain Research. Article in press, 13 pages.
Brody, T.M.; Larner, J . & Minneman, K.P. Human Pharmacology Molecular to Clinical.
3
rd
edition; Mosby-Year Book, Inc.; St Louis: 1998, págs.: 385 – 393.

198

Bultrón, E.; Gutiérrez, J . M.; & Thelestam, M. (1993a) Effects of Bothrops asper
(Terciopelo) myotoxin III, a basic phospholipase A
2
, on liposomes and mouse
gastrocnemius muscle. Toxicon. 31(2) 217 – 222.
Bultrón, E.; Thelestam, M. & Gutiérrez, J . M. (1993b) Effects on cultures mammalian
cells of myotoxin III, a phospholipase A
2
isolated from Bothrops asper (terciopelo)
venom. Biochimica et Biophysica Acta. 1179: 253 – 259.
Chase, T.N.; Oh, J .D. & Blanchet, P.J . (1998) Neostriatal mechanisms in Parkinson´s
disease. Neurology. 51(2) Supp 2:S30 – S35.
Dauer, W. & Przedborski, S. (2003) Parkinson´s Disease: Mechanisms and Models
(review). Neuron. 39: 889 – 909.
Dawson, T.M.; Mandir, A.S. & Lee, M.K. (2002) Animal Models of PD: Pieces of the
Same Puzzle?. Neuron. 35: 219-222.
Dennis, E. A. (2000) Phospholipase A
2
in Eicosanoid Generation. Am. J . Respir. Crit.
Care Med. 161: S32 – S35.
Deumens, R. Biokland, A. & Prickaerts, J . (2002) Modeling Parkinson´s Disease in Rats:
An Evaluation of 6-OHDA Lesions of the Nigrostriatal. Pathway Experimental
Nerurology. 175: 303 – 317.
Díaz, C.; Alape, A.; Lomonte, B.; Olamendi, T. & Gutiérrez, J .M. (1995) Purification and
characterization of myotoxin IV, a phospholipase A
2
variant, from Bothrops asper
snake venom Natural toxins 3:26-31.
Díaz-Véliz, G.; Mora, S.; Dosis, M.T.; Gómez, P.; Arraigada, C.; Montiel, J .; Aboitiz, F. &
Segura-Aguilar, J . (2002) Behavioral effects of aminochrome and dopachrome
injected in the rat substantia nigra. Pharmacology, Biochemistry and Behavior. 73:
843 – 850.
Dole, V. P. (1956) A relation between non-esterified fatty acids in plasma and the
metabolism of glucose. J . Clin. Invest. 35, 150-154.

199

Domenger, D. & Schwarting, R.K.W. (2008) Effects of neostriatal 6-OHDA lesion on
performance in rat sequential reaction time task. Neuroscience Letters. 444: 212-
216.
Dorandeu, F.; Pernot-Marino, I.; Veyret, J .; Perrichon, C. & Lallement, G. (1998)
Secreted phospholipase as-induced neurotoxicity and epileptic seizures after
intracerebral administration: an unexplained heterogeneity as emphasized with
paradoxin and crotoxin .J ournal of Neuroscience Research. 54: 848-862.
Drickamer, K. & Taylor, M.E. (1993) Biology of animal lectins. Annu. Rev. Cell Biol. 9:
237-264.
Emborg, M.E. (2004) Evaluation of animal models of Parkinson´s disease for
neuroprotective strategies. J ournal of Neuroscience Methods. 139: 121-143
Farooqui, A. A.; Litsky, M. L.; Farooqui, T. & Horrocks, L. A. (1999) Inhibitors of
intracellular phospholipase A
2
activity: Their neurochemical effects and
therapeutical importance for neurological disorders. Brain Research Bulletin.
49(3): 139-153.
Farooqui, A.A.; Yang, H.C.; Horrocks, L.A. (1997) Involvement of Phospholipase A
2
in
neurodegeneration. Neurochem. Int. 30: 517-522
Flórez, J . (director) Farmacología Humana. 5
ta
edición; MASSON; Barcelona: 2008.
Fornaguera, J . Schwarting, R.K.W.; Boix, F.; Huston, J .P. (1993) Behavioral indices of
moderate nigro-striatal 6-hydroxydopamine lesion: A preclinical Parkinson’s model.
Synapse. 13: 179-185.
Fornaguera, J . (1994) Tesis: Unilaterale 6-OHDA Läsion des nigrostriatalen Systems:
Beziehung zwischen Neurochemie und Verhalten Heinrich-Heine-Universität
Düsseldorf.
Fornaguera, J . & Schwarting, R.K.W. (1999) Early behavioral changes after nigro-striatal
system damage can serve as predictors of striatal dopamine depletion. Neuro-
Psychopharmacol. & Biol. Psuchiat. 23: 1353 - 1368.

200

Gandolfo, G.; Lambeau, G.; Lazdunski, M. & Gottesmann, C. (1996) Effects on Behavior
and EEG of Single Chain Phospholipases A
2
from Snake and Bee venoms Injected
into Rat Brain: Search for a Functional Antagonism. Pharmacology & Toxicology.
78: 341-347.
Garant, D.S. & Gale, K. (1983) Lesions of Substantia nigra protect agains
experimentally induced seizures. Brain Res. 273: 156 – 161.
Gibson, C.J . & Wutman,R.J . (1977) Physiological control of brain catechol synthesis by
brain tyrosine concentration. Biochem. Pharmacol 26: 1137 – 1142; citado en Hefti
et al, 1980.
Gutiérrez, J .M.; Ownby, C.L. & Odell, G.V. (1984) Isolation of a myotoxin from Bothrops
asper venom: partial characterization and action on skeletal muscle. Toxicon 22(1):
115-128.
Gutierrez, J .M.; Lomonte, B.; Chaves, F., Moreno E. & Cerdas L. (1986)
Pharmacological activities of a Toxic phospholipase a isolated from the venom of
the snake Bothrops asper. Comp. Biochem. Physiol. 84C(1): 159-164.
Gutiérrez, J .M. & Lomonte, B. (1989) Local tissue damage induced by Bothrops snake
venoms. Mem. Inst. Butantan. 51(4): 211-223
Gutiérrez, J . M., Lomonte, B. (1995) Phospholipase A
2
myotoxins from Bothrops snake
venoms. Toxicon. 33(11): 1405 – 1424.
Gutiérrez, J . M. (2002) Comprendiendo los venenos de serpientes: 50 años de
investigaciones en América Latina. Rev. Biol. Trop. 50(2): 377-394.
Hayakawa, T.; Chang, M. C. J .; Bell J . M.; Seeman, R.; Rapoport, S. I. & Appel, N. M.
(1998) Fatty acid incorporation depicts brain activity in a rat model of Parkinson´s
disease. Brain Research. 807: 177 – 181.
Harrison, L.M. & LaHoste, G.J . (2006) Rhes, the Ras homolog enriched in striatum, in
reduced under conditions of dopamine supersensitivity. Neuroscience. 137: 483 -
492.

201

Henderson, J .M.; Watson, S.H. (2003) Convulsive and postural effects of lesioning the
mid-substantia nigra pars reticulate in naïve and 6-OHDA lesioned rats. Brain Res.
Bull. 60: 179-185.
Hefti, F; Melamed E; Wurtman, R.J . (1980) Partial lesions of the dopaminergic
nigroestriatal system in rat brain: Biochemical Characterization. Brain Research.
195: 123-137.
J ackson-Lewis, V. & Liberatore, G. (2000) Effects of a unilateral stereotaxic injection of
Tinuvin 123 into the substantia nigra on the nigrostriatal dopaminergic pathway in
the rat. Brain Research. 866: 197 – 210.
J in, F.; Wu, Q. Lu. Y.F.; Gong, Q.H. & Shi, J .S. (2008) Neuroprotective effect of
resveratrol on 6-OHDA- induced Parkinson´s disease in rats. European J ournal of
Pharmacology. 600:78-82.
Kaiser, I. I.; Gutierrez, J . M.; Plummer, D.; Aird S. D. & Odell, G. V. (1990) The amino
acid sequence of a Myotoxic Phospholipase from the Venom of Bothrops asper.
Archives of Biochemistry and Biophysics. 278(2): 319-325.
Kandel, E. R.; Schwartz, J . H & J essell, T. M. Principles of Neural Science 4
th
edition;
McGraw-Hill Medical; New York: 2000, págs.: 282 - 284 y 853 - 864.
Kebabian, J .W.; Blanchet, P.J . & Bedard, P. (1995) The D-1 dopamine receptor: past,
present and future and idiosyncratic (review). Prog. Neuro-Psychopharmacol. &
Biol. Psychiat. 19: 757-778.
Kingsley, R. E. Concise Text of Neuroscience. 2
nd
edition; Lippincott Williams & Wilkins;
Philadelphia: 2000, págs.: 285 – 305.
Kirik, D.; Rosenblad, C. & Björklund (1998) Characterization of Behavioral and
Neurodegenerative Changes following partial lesions of the Nigrostriatal dopamine
system induced by intrastriatal 6-OHDA in the rat. Experimental Neurology. 152:
259-277.

202

Klaassen, C.D. (editor) Casarett and Doull´s Toxicology, The basic science of poisons.
6
th
edition; McGraw-Hill; New York: 2001, págs.: 955 – 961.
Klivenyi, P.; Beal, M. F.; Ferrante, R. J .; Andreassen, O. A.; Wermwe, M.; Chin, M-R &
Bonventre, J . V. (1998) Mice Deficient in Group IV Cytosolic Phospholipase A
2
are
resistant to MPTP Neurotoxicity. J ournal of Neurochemistry. 71(6): 2634 – 2637.
Konitsiotis, S.; Kafetzopoulos, E.; Anastasopoulos, D. & Blanchet, P.J . (1998) Opposite
rotation induced by dopamine agonists in rats with unilateral lesions of the globus
pallidus or substantia nigra. Behavioral Brain Research. 92: 77 – 83.
Lambeau, G.; Barhanin, J .; Schweitz, H.; Qar, J . & Lazdunski, M. (1989) Identification
and properties of very high affinity brain membrane-binding sites for a neurotoxic
phospholipase from the taipan venom. J . Biol. Chem. 264(19): 11503 - 11510.
Lambeau, G.; Schmid-Alliana, A.; Lazdunski, M. & Barhanin, J . (1990) Identification and
purification of a very high affinity binding protein for toxic phospholipases A
2
in
skeletal muscle. J . Biol. Chem. 265(16): 9526-9532.
Lambeau, G.; Lazdunski, M. & Barhanin, J . (1991) Properties of receptors for neurotoxic
phospholipases A
2
in different tissues. Neurochemical Research. 16(6):651-658.
Lambeau, G.; Lazdunski, M. (1999) Receptors for a growing family of secreted
phospholipases A
2
. Trends in Pharmacological Science. 20: 162 - 170.
Lang, A. E. & Lozano, A.M. (1998a) Parkinon´s Disease. The New England J ournal of
Medicine. 339(15): 1044 – 1053.
Lang, A. E. & Lozano, A.M. (1998b) Parkinon´s Disease. The New England J ournal of
Medicine. 339(16): 1130 – 1143.
Lavielle, S.; Tassin, J .P.; Thierry, A.M; Blanc, G.; Herve, D.; Barthelemy, C. & Glowinski,
J . (1978) Blockade by benzodiazepines of the selective high increase indopamine
turnover induced by stress in mesocortical dopaminergic neurons of the rat. Brain
Research. 168: 585-594.

203

Lin, J .Y.; Chung, K.K.H.; Denis de Castro, Funk, G.D. & Lipski, J . (2004) Effects of
muscarinic acetylcholine receptor activation on membrane currents and
intracellular messengers in medium spiny neurons of the rat striatum. European
J ournal of Neuroscience. 20: 1219 – 1230.
Lomonte, B. & Gutiérrez, J .M. (1989) A new muscle damaging toxin, myotoxin II, from
the venom of the snake Bothrops asper (terciopelo). Toxicon. 27: 725-733.
Lynch, M.R. & Carey, R.J . (1989) Amphetamine-induced rotation reveals post 6-OHDA
lesion neurochemical reorganization. Behavioural Brain Research. 32: 69-74.
Martín, J . B. (1999) Molecular Basis of the Neurodegenerative Disorders. The New
England J ournal of Medicine. 340(25): 1970 –1979.
Mathisen, G.H.; Thorkildsen, I.H. & Paulsen, R.E. (2007) Secretory PLA
2
-IIA and ROS
generation in peripheral mitochondria are critical for neuronal death. Brain
Research. 1153: 43-51.
Matsuda, H.; Akechi, Y.; Shimada, Y.; Terasawa, K.; Watanabe, H. (1995) Relationship
of the ipsilateral rotation in night period and striatal dopamine content reduction in
unilateral nigrostriatal 6-OHDA lesioned rats. Brain Res. 686: 111-114.
Nelson, D. L. & Cox, M. M. Lehninger Principles of Biochemistry. 3
rd
edition; Worth
Publishers; New York: 2000, págs.: 374, 378 – 379, 844.
Nicolas, J .P; Lin, Y.; Lambeau, G.; Ghomashchi, F.; Lazdunski, M. & Gelb, M.H. (1997)
Localization of structural elements of bee venom phospholipase A
2
involved in N-
type receptor binding and neurotoxicity. J . Biol. Chem. 272(11):7173-7181.
Nieuwenhuys R. Chemoarchitecture of the Brain. Sin ed.; Springer-Verlag; Berlin: 1985,
págs. 19 – 30, 33 - 40.
Ogawa, T.; Kitajima, M.; Nakashima, K.; Sakaki, Y. & Ohno, M. (1995) Molecular
Evolution of Group II Phospholipases A
2
. J ournal of Molecular Evolution. 41: 867-
877.

204

O´Kusky, J .R.; Boyes, B.E.; Walker, D.G. & McGeer, E.G. (1991) Cytomegalovirus
infection of the developing brain alters catecholamine and indoleamine
metabolism. Brain Research. 559: 322-330.
Orr, C.F.; Rowe, D.B. & Halliday, G.M. (2002) An inflammatory review of Parkinson´s
disease. Progress in Neurobiology. 68: 325-340.
Paxinos, G. & Watson, C. The rat brain in stereotaxic coordinates. 4
th
edition; Academic
Press; Sydney: 1998.
Ponce-Soto, L.A.; Lomonte, B.; Gutiérrez, J .M.; Rodrigues-Simioni, L.; Novello, J . C.;
Marangoni, S. (2007) Structural and functional properties of BaTX, a new Lys49
phospholipase A
2
homologue isolated from the venom of the snake Bothrops
alternates. Biochimica et Biophysica Acta. 1770: 585-593.
Rehm, H. & Betz, H. (1982) Binding of -bungarotoxin to synaptic membrane fractions of
chick brain. The J ournal of Biological Chemistry. 257(17): 10015-10022.
Richards, J .B.; Sabol, K.E.; Kriek, E.H. & Freed, C.R. (1993) Trained and amphetamine-
induced circling behavior in lesioned, transplanted rats. J . Neural Transplant Plast.
4(2): 157-166. (solo el resumen).
Ricker, R. (2002) Catecholamines / Biogenic Amines: Rapid Separation using Ion Pair
Reagents. Agilent Technologies, Nota de aplicación No.: 5988-6327EN.
Rigoni, M.; Caccin, P.; Gschmeissner, Koster, G; Postle, A.D.; Rossetto, O.M; Schiaco,
G. & Montecucco, C. (2005) Equivalent effects of snake PLA2 neurotoxins an
lysophospholipid fatty acid mixtures. Science. 310: 1678-1680.
Ross, B.M.; Mamalias, N.; Moszczynska, A; Rajput, A. H. & Kish, S.J . (2001) Elevated
activity of phospholipid biosynthetic enzymes in Substantia nigra of patients with
Parkinson´s disease. Neuroscience .102(4): 899 – 904.
Saborío, A. J . (2008) Trabajo Final de Graduación: Implementación y Estandarización
de Diversas Técnicas Histológicas para su aplicación en Estudios Experimentales
con cerebro de Rata. Escuela de Biología, Instituto Tecnológico de Costa Rica.

205

Sakai, K; Gash, D.M. (1994) Effect of bilateral 6-OHDA lesions of the substantia nigra
on locomotor activity in the rat. Brain Research. 633: 144-150.
Saravanan, K.S.; Sindhu, K.M.; Mohanakumar, K.P. (2005) Acute intranigral infusion of
rotenone in rats causes progressive biochemical lesions in the striatum similar to
Parkinson´s disease. Brain Research. 1049: 147 – 155.
Sawamura, A.; Hashizume, K.; Yoshida, K. & Tanaka, T. (2001) Kainic acid-induced
substantia nigra seizure in rats: behavior, EEF and metabolism. Brain Research.
911: 89 – 95.
Schwarting, R.K.W. & Huston, J .P. (1987) Dopamine and serotonin metabolism in brain
sites ipsi- and contralateral to direction of conditioned turning in rats. J ournal of
Neurochemistry. 48: 1473-1479, citado en Fornaguera en al, 1993.
Schwarting, R.K.W.; Goldenberg, R.; Steiner, H.; Fornaguera, J . & Huston, J .P. (1993) A
video image analyzing system for open-field behavior in the rat focusing on
behavioral asymmetries. J ournal of Neuroscience Methods. 49: 199-210.
Schwarting, R.K.W. & Huston, J . P. (1996a) The Unilateral 6-hydroxidopamine lesion
model in behavioral brain research. Analysis of functional deficits, recovery and
treatments. Progress in Neurobiology. 50: 275 – 331.
Schwarting R. K.W. & Huston, J . P. (1996b) Unilateral 6-hydroxidopamine lesions of
meso-striatal dopamine neurons and their physiological sequelae. Progress in
Neurobiology. 49: 215 – 266 (solo el resumen).
Sindhu, K.M.; Saravanan, K.S.& Mohanakumar, K.P. (2005) Behavioral differences in a
rotenone-induced hemiparkinsonian rat model developed following intranigral or
median forebrain bundle infusion. Brain Research. 1051: 25 – 34.
Sindhu, K.M.; Banerjee, R.; Senthilkumar, K.S.; Saravanan, K.S.; Raju, B. C.; Rao, J .M.
& Mohanakumar, K.P. (2006) Rats with unilateral median forebrain bundle, but not
striatal or nigral, lesions by the neurotoxins MPP
+
or rotenone display differential
sensitivity to amphetamine and apomorphine. Pharmacology, Biochemistry and
Behavior. 84: 321 – 329.

206

Smith, A.D.; Amalric, M.; Koob, G.F., Zigmong, M.J . (2002) Effect of Bilateral 6-
hydroxidopamine lesions of the medial forebrain bundle on reaction time.
Neuropsychopharmacology. 26(6): 756-764.
Steiner, H., Bonatz, A.E., Huston, J .P. & Schwarting. R. (1988) Lateralized wall-facing
versus turning as measures of behavioral asymmetries and recovery of function
after injection of 6-hydroxydopamine into the substantia nigra. Exp Neurol. 99: 556-
566. (citado en Schwarting & Huston, 1996a).
Tanaka, T.; Tanaka, S.; Kaijima, M. & Yonemasu, Y. (1989) Ibotenic acid induced nigral
lesion and limbic seizure. Brain Res. 498: 215 – 220.
Tariq, M.; Kahn, H. A.; Moutaery, K.A. & Deeb, S. A. (2001) Protective effect of
quinacrine on striatal dopamine levels in 6-OHDA and MPTP models of
Parkinsonism in rodents. Brain Research Bulletin. 54(1): 77 – 82.
Teismann, P.; Tieu, K.; Choi, D.K.; Wu, D.C.; Naini, A.; Hunot, S.; Vila, M.; J ackson-
Lewis, V. & Prsedborski, S. (2003) Cyclooxygenase-2 is instrumental in
Parkinson´s disease neurodegeneration. Neuroscience. 100(9): 5473-5478.
Toulouse, A. & Sullivan A.M. (2008) Progress in Parkinon´s disease - Where do we
stand?. Progress in Neurobiology. 85: 376-392.
Ungerstedt, U. (1968) 6-Hydroxy-dopamine induced degeneration of central monoamine
neurons. Eur J Pharmacol. 5: 107-110. (citado en Betarbet et al., 2002).
Ungerstedt, U. (1970) Quantitative recording of rotational behavior in rats after 6-
hydroxydopamine lesions of the nigrstriatal dopamine system. Brain Res. 24: 485 -
493. (citado en Sindhu et al., 2006).
Ungerstedt, U. (1971) Postsynaptic supersensitivity after 6-hydroxydopamine-induced
degeneration of the nigrostriatal dopamine system. Acta Physiol. Scand. Suppl.
367: 69-93. (citado en Schwarting & Huston, 1996a y en Harrison & LaHoste,
2006).

207

Vivó, M.; Camón, L.; de Vera, N. & Martínez, E. (2002) Lesion of substantia nigra pars
compacta by the GluR5 agonist ATPA. Brain Research. 955: 104-114.
Woodruff, M. L. & Nonneman, A. J . Toxin-Induced Models of Neurological Disorders. Sin
edición; Plenum Press; New York & London: 1994, págs.: 89 – 212.
Xu, Z.C.; Ling, G.; Sahr, R.N.; Neal-Beliveau, B.S. (2005) Asymmetrical changes of
dopamine receptors in the striatum after unilateral dopamine depletion. Brain
Research. 1038: 163-170.
Yasuhara, T.; Shingo, T.; Muraoka, K.; Kameda, M. et al. (2005) Neurorescue effects of
VEGF on a rat model of Parkinson´s disease. Brain Research. 1053: 10-18.
Ziegler, M. & Szechtman, H. (1988) Differences in the Behavioral Profile of circling
Under Amphetamine and Apomorphine in Rats with Unilateral Lesions of the
Substantia Nigra. Behavioral Neuroscience. 102: 276-288.
Zigmond, M.J .; Abercrombie, E.D.; Berger, T.W.; Grace, A.A. & Stricker, E.M. (1990)
Compensations after lesions of central dopaminergic neurons: some clinical and
basic implications. Trends in Neurosciences. 13(7): 290-296.



208




209

Capítulo VII
7. ANEXOS
Anexo I. Egresos Hospitalarios de la Caja Costarricense del Seguro Social
(CCSS), de pacientes diagnosticados con la enfermedad de Parkinson. 2005 a
2007.
Cuadro II: Egresos hospitalarios por año y edad de todos los hospitales de la Caja Costarricense
del Seguro Social (CCSS). Información tomada de la base de datos del Departamento de
Estadísticas de Salud de la CCSS y comprende los años 2005 a 2007.
2005 2006 2007
edad No. pacientes edad No. pacientes edad No. pacientes
36 1 33 1 23 1
37 1 35 1 43 1
42 1 41 1 44 1
48 1 43 1 45 1
49 2 51 1 57 1
50 2 55 1 58 2
51 1 57 1 62 1
53 1 59 1 64 1
56 1 60 2 65 1
57 3 62 3 66 2
58 1 64 1 67 5
59 1 65 2 68 2
60 1 66 1 69 3
61 2 67 2 70 1
62 1 69 2 72 3
64 4 70 2 73 3
65 2 71 1 74 1
66 3 72 1 75 2
67 3 73 2 76 1
68 1 74 5 77 2

------- continúa en la siguiente página ------

210

------ continuación del Cuadro II, página anterior ------

2005 2006 2007
Edad No. pacientes edad No. pacientes edad No. pacientes
71 2 75 3 78 2
72 2 76 3 79 3
73 4 77 2 80 1
74 3 78 1 81 1
75 5 79 4 82 2
76 7 80 1 84 3
77 5 81 1 85 1
78 4 82 2 87 2
79 6 83 3 88 1
80 1 84 1 90 1
81 1 85 1 94 1
82 4 86 1
83 4 87 1
88 1 89 1
89 1 90 1
92 1
93 1



211

Anexo II. Permiso del Comité Institucional para el Cuido y Uso de Animales
(CICUA)




212

Anexo III. Diagramas de las vistas dorsal (superior) y lateral (inferior) del cráneo
de una rata macho Wistar de 290 g de masa corporal. Las vistas muestran las
posiciones de los puntos de referencia: Bregma, la cara posterior de los incisivos y
el plano de la línea interaural.

Figura 47: Diagramas de las vistas dorsal (superior) y lateral (inferior) del cráneo de una rata
macho Wistar de 290 g de masa corporal.
Las vistas muestran la ubicación de los puntos de referencia: Bregma, la cara posterior de los
incisivos y el plano de la línea interaural (Modificado de Paxinos & Watson, 1998).



213

Anexo IV. Diagramas para la ubicación estereotáxica de la SNpc en un cerebro
de rata macho Wistar de 290 g. Se presenta los cortes coronal en Bregma - 5,30
mm; sagital en lateral 1,90 mm y horizontal en bregma –8,10 mm.



















Figura 48: Diagramas para la ubicación estereotáxica de la SNpc (en color rojo) en un cerebro de
rata macho Wistar de 290 g. A. corte coronal en Bregma - 5,30 mm; B. corte sagital en lateral 1,90
mm y C. corte horizontal en bregma –8,10 mm.
En los diagramas se resalta: en verde el estriado dorsal (caudado y putamen), en amarillo el
estriado ventral (núcleo accumbens) en morado el pálido ventral, en anaranjado el tálamo, en café
oscuro el núcleo subtalámico, en azul la pars reticulada de la sustancia nigra y en rojo la pars
compacta de la sustancia nigra. (Modificado de Paxinos & Watson, 1998).


214

Anexo V. Procedimientos de tinción de cortes coronales de cerebro de rata de 25
m de grosor.

Tinción con cresyl fast violet

Se prepara una Solución de Trabajo de Cresyl Fast Violet al 0.1% en agua
destilada. Se disuelve el colorante removiendo la solución con un agitador
magnético a una temperatura entre 50-60 °C durante 30 minutos e
inmediatamente se filtra la solución para evitar grumos. Se añade la solución de
trabajo, con un gotero, sobre un portaobjetos con muestra de tejido de cerebro de
rata. Se esperan 5 minutos y se lava dos veces en agua destilada. Se añade
etanol al 70%, durante 30 segundos, sobre el portaobjetos con la muestra de
tejido, y se decanta el líquido. Se repite este paso con etanol al 95% y luego con
etanol absoluto. Se aplica una gota de xileno, a cada corte de cerebro de rata del
portaobjetos, y se añade el medio de montaje al cubreobjetos para fijarlo al
portaobjetos. Se deja reposar el portaobjetos por un mínimo de una hora, antes
de observar la muestra al microscopio.

Tinción con hematoxilina y eosina

Se prepara una solución de trabajo de Eosina al 30%, en alcohol 95%; y una
solución de Bicarbonato de Sodio al 1%, en agua destilada. Se sumerge un
portaobjetos, con la muestra de tejido de cerebro de rata, en una batería con la
solución lista para usar de hematoxilina al 1%. Se esperan 3 minutos y se lava
dos veces en agua destilada. Se cubre la muestra con unas gotas de HCl 1N,
hasta decolorar el tejido (aproximadamente 4 segundos), se decanta la solución y
se aplica, seguidamente, la solución de bicarbonato de sodio al 1% hasta
oscurecer el tejido (tornándose nuevamente color morado-azul). Por último se

215

lava la muestra en agua destilada. Se sumerge la muestra en una batería con la
solución de trabajo de eosina al 30%. Se esperan 3 minutos y se lava dos veces
en agua destilada. Se añade etanol al 70%, durante 30 segundos, sobre el
portaobjetos con la muestra de tejido, y se decanta el líquido. Se repite este paso
con etanol 95% y luego con etanol absoluto. Se aplica una gota de xileno, a cada
corte de cerebro de rata del portaobjetos y se añade el medio de montaje al
cubreobjetos para fijarlo al portaobjetos. Se deja reposar el portaobjetos por un
mínimo de una hora, antes de observar la muestra al microscopio.

Tinción con luxol fast blue y cresyl fast violet

Se prepara una solución de trabajo de luxol fast blue 0.1%, en agua destilada y se
añade 0,5 mL de ácido acético al 10 %. Se prepara, una solución de carbonato de
litio 0,05 %, en agua destilada. Se sumerge un portaobjetos, con la muestra de
tejido de cerebro de rata, en una cubeta tipo “Coplin” con la solución de luxol fast
blue 0,1%, durante la noche (aproximadamente 12 horas), a 60°C. Se lava el
exceso de colorante en etanol de 95% y luego en agua destilada, contando 5
segundos en cada líquido. Se sumerge el portaobjetos en la solución de
carbonato de litio 0,05 %, durante 5 segundos. Seguidamente, se sumerge el
portaobjetos, por 30 segundos, en etanol al 70% y luego se lava en agua
destilada. Se realiza una contratinción con la solución de trabajo de cresyl fast
violet al 0,1 %, siguiendo el protocolo anteriormente mencionado.


216

Anexo VI. Cuadros con los datos individuales de conducta y de neuroquímica
para los tres experimentos.

Cuadro III: Giros netos (ipsi menos contra) durante 20 minutos por día, para cada uno de los
animales de cuatro grupos de tratamiento con diferentes dosis de la miotoxina III, nativa: baja: 0,14
µg; media: 1,4 µg; alta: 14 µg y el grupo control.

Grupo / Día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
-11 -5 -2 5 17 -1 23 44 18
-75 -21 7 17 33 8 34 32 61
Dosis de
0,14 µg MT-III
-1 6 23 9 8 13 25 26 -116
-296 -193 -111 -28 -13 -59 -58 143 -79
-112 -79 -47 -16 -47 -54 -24 27 -54
-54 -46 32 9 7 -32 -35 46 24
Dosis de
1,4 µg MT-III
-159 4 6 17 -20 55 51 21 -14
-116 -36 -33 -16 -69 -39 -57 32 -114
-455 -372 -220 -112 -38 -89 -67 347 -318
-28 -25 22 -14 -32 1 42 133 -56
Dosis de
14 µg MT-III
-6 -73 -133 8 8 0 28 857 -142
1 individuo muere el día 1 postoperatorio
-54 individuo muere el día 1 postoperatorio
-582 -208 -285 -20 6 -13 37 345 -176



217

Cuadro IV: Duración en segundos de la conducta de peritaxis neta (ipsi menos contra) durante 20
minutos por día, para cada uno de los animales de cuatro grupos de tratamiento con diferentes
dosis de la miotoxina III, nativa: baja: 0,14 µg; media: 1,4 µg; alta: 14 µg y el grupo control.

Grupo / Día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
3,9 4,0 3,7 2,5 -4,0 3,1 0,3 -1,8 -1,4
1,7 6,7 16,8 13,1 4,6 7,4 5,9 18,5 11,8
Dosis de
0,14 µg MT-III
7,5 -9,5 -9,1 -17,3 0,7 3,3 -0,5 5,7 21,5
81,2 4,2 -0,3 -2,0 -2,5 10,4 11,8 109,8 0,0
8,4 29,1 19,4 7,6 5,4 16,2 1,1 10,0 -5,9
9,9 -1,9 -24,2 -4,5 -4,3 -2,0 6,7 0,0 -15,9
Dosis de
1,4 µg MT-III
0,5 -21,7 -11,2 -10,5 17,6 2,5 11,1 26,8 9,6
23,5 16,9 2,3 0,3 3,2 5,8 16,3 20,6 23,8
55,5 85,0 23,6 22,0 -2,7 13,6 -2,8 10,9 99,8
7,0 13,6 2,0 29,6 6,4 24,3 7,2 10,5 -15,8
Dosis de
14 µg MT-III
17,9 12,5 16,3 13,4 23,8 27,9 23,3 27,5 14,9
0,0 individuo muere el día 1 postoperatorio
0,0 individuo muere el día 1 postoperatorio
0,0 30,2 23,8 50,1 30,4 37,8 34,9 17,0 48,2


218

Cuadro V: Número de cruces de cuadrantes virtuales del campo abierto, durante 20 min, para
cada uno de los animales de cuatro grupos de tratamiento con diferentes dosis de la miotoxina III,
nativa: baja: 0,14 µg; media: 1,4 µg; alta: 14 µg y el grupo control.

Grupo / Día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
35 34 57 62 57 81 90 132 263
30 72 25 68 95 89 106 104 255
Dosis de
0,14 µg MT-III
87 59 75 60 71 86 124 48 206
202 61 77 59 51 80 78 63 136
45 102 87 86 120 81 98 95 419
32 85 69 69 98 68 102 153 177
Dosis de
1,4 µg MT-III
39 65 92 111 133 117 120 124 290
70 79 76 90 100 130 101 66 255
176 280 177 103 62 91 100 14 423
43 105 105 75 72 112 159 159 383
Dosis de
14 µg MT-III
31 41 70 48 59 90 101 22 155
0 individuo muere el día 1 postoperatorio
0 individuo muere el día 1 postoperatorio
69 95 127 112 103 103 95 58 285



219

Cuadro VI: Duración de la conducta de exploración en segundos, durante 20 minutos por día, para
cada uno de los animales de cuatro grupos de tratamiento con diferentes dosis de la miotoxina III,
nativa: baja: 0,14 µg; media: 1,4 µg; alta: 14 µg y el grupo control.

Dosis / Día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
68,4 50 90,2 55,3 98,6 98,8 318,8 4,8 160,8
22,6 99,9 50,6 159,9 182,4 100,6 280,2 71,5 172,6
Dosis de
0,14 µg MT-III
96,6 67,2 181,2 164,9 91,7 204,3 289 74,8 316,9
19 57,4 41,5 70,2 77,7 117,5 114,1 3,1 157,7
36,9 127 141,3 86,8 141,2 157,7 162,2 6,1 273,9
40,7 78 105,5 131,4 142 172,4 322,1 70,4 65,9
Dosis de
1,4 µg MT-III
55,9 103 127,6 130,2 115,2 222,9 165,7 6 161,7
47,2 194 115,9 92,9 88,3 126,5 142,3 14,9 162,3
17,4 51,9 87,6 110,7 73,9 105,9 73,1 0 91,2
1,7 86,5 191,7 79 70,1 94,1 193,6 14,7 287,2
Dosis de
14 µg MT-III
14,4 30,6 65,3 73,4 71,3 95,9 89,3 0 48,4
0 individuo muere el día 1 postoperatorio
0 individuo muere el día 1 postoperatorio
8 103 135,2 128,5 169,3 178,9 322,8 19,5 207,9


220

Cuadro VII: Duración de la conducta de limpieza en segundos, durante 20 minutos por día, para
cada uno de los animales de cuatro grupos de tratamiento con diferentes dosis de la miotoxina III,
nativa: baja: 0,14 µg; media: 1,4 µg; alta: 14 µg y el grupo control.

Dosis / Día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
539,2 574,2 433,9 583,2 149,4 382,1 121,2 13,7 34,7
91,9 363,9 189,7 345,7 271,4 293 790,6 101,4 0
Dosis de
0,14 µg MT-III
232,9 455,7 231,8 529,2 429,9 389,7 262,3 59,9 47
237,1 454,1 417,9 562,1 624,7 465,6 318,2 27,8 4,3
454,8 324,6 307,4 472,7 277,6 375,6 373,5 4,3 0,6
360,1 482,7 455,5 447,6 329,8 146,1 49,9 49,4 64,1
Dosis de
1,4 µg MT-III
286,3 317 263,1 257,1 319,4 207 129 8,3 12,7
324,2 393,4 457,8 503,3 534,2 304 464 113,4 68,7
113 168,7 126,3 361,4 502,4 447 461,9 0 61,7
775,5 429,9 312,7 574,5 595,4 408,6 234 107,4 0,7
Dosis de
14 µg MT-III
534,7 234,9 318,7 598,4 605,6 553,4 333,2 0 0,8
0 individuo muere el día 1 postoperatorio
0 individuo muere el día 1 postoperatorio
0 127 145,4 185,2 134,9 243,9 85,2 16,7 9,4



221

Cuadro VIII: Porcentajes de depleción en estriado dorsal para dopamina (DA) y ácido 3,4-
dihidroxifenilacético (DOPAC), ácido homovanílico (HVA), serotonina (5-HT) y ácido 5-
hidroxiindolacético (5-HIAA) y en estriado ventral y septo pada DA y DOPAC; para cada uno de los
animales de los cuatro grupos de tratamiento con diferentes dosis de la miotoxina III nativa: baja:
0,14 µg; media: 1,4 µg; alta: 14 µg y el grupo control. NSD se refiere a que el compuesto no fue
detectado en algún hemisferio.

estriado dorsal
control baja media alta
DA 8 -10 12 27 9 1 -9 5 15 -10 1 43
DOPAC 10 10 -15 8 18 -9 -25 -12 -8 2 11 42
5HT NSD 6 20 38 -2 -38 8 -50 -23 11 -1 19
5HIAA NSD -11 30 -9 20 -71 -14 -22 -68 -13 10 -9
HVA -4 -17 -1 39 13 -19 -25 11 NSD -12 20 40

estriado ventral
control baja media alta
DA 11 6 12 -16 -26 28 6 15 9 -9 6 1
DOPAC -9 25 22 -10 -10 -35 -21 54 2 16 -24 -9

septo
control baja media alta
DA 49 12 -112 89 34 -111 -13 -36 64 1 75 -20
DOPAC -62 36 -29 73 57 -202 7 -7 25 38 87 -27




222

Cuadro IX: Porcentajes de depleción en estriado dorsal para dopamina (DA) y ácido 3,4-
dihidroxifenilacético (DOPAC), ácido homovanílico (HVA), serotonina (5-HT) y ácido 5-
hidroxiindolacético (5-HIAA) y en estriado ventral y septo pada DA y DOPAC, a dosis constante de
miotoxina III nativa (14 µg), para cada uno de los animales de cuatro grupos de tratamiento, con
diferente tiempo de sacrificio a partir de la inyección de la miotoxina (15, 60, 180 y 360 min).

estriado dorsal

15 60 180 360
DA 12 -25 -225 -65 15 12 -180 32 -115 17 36 -142 14 -17 31 -150
DOPAC -83 -4 -108 18 6 -61 -198 -71 -193 -14 16 -214 -31 -61 7 -194
5HT 15 5 -19 -46 39 1 -44 3 -41 25 59 -19 12 15 19 15
5HIAA 11 -35 -13 34 -68 43 -96 -40 -42 10 -19 -17 14 -23 -21 -61
HVA -6 -35 -26 -43 16 -59 -167 -20 -205 -11 38 -317 19 -65 -5 -226

estriado ventral

15 60 180 360
DA -57 45 -238 -7 2 0 -27 23 17 10 21 -11 9 -60 18 -9
DOPAC -25 35 -190 26 -14 -62 -199 -29 -46 -8 15 -87 17 -71 -32 -2

septo

15 60 180 360
DA 93 -453 80 -557 -120 -247 72 51 31 50 40 -217 85 6 74 94
DOPAC 91 -186 74 -540 -141 -199 67 35 -14 1 51 -105 82 -21 79 85




Cuadro X: Índice de metabolismo en estriado dorsal para el ácido 3,4-dihidroxifenilacético (DOPAC)
y el ácido homovanílico (HVA) en relación con el neurotransmisor dopamina (DA), a dosis constante
de miotoxina III nativa (14 µg), para cada uno de los animales de cuatro grupos de tratamiento, con
diferente tiempo de sacrificio a partir de la inyección de la miotoxina (15, 60, 180 y 360 min).
estriado dorsal
15 60 180 360
DOPAC/DA
208 83 156 49 111 184 106 249 137 137 131 130 152 138 134 118
HVA/DA
120 108 101 87 99 181 95 175 142 134 97 124 94 125 151 131
estriado ventral
DOPAC/DA
80 120 69 141 116 163 235 167 176 120 108 168 91 107 162 93







223

Cuadro XI: Giros netos (ipsi menos contra) durante 20 minutos por día, para cada uno de los
animales de tres grupos de tratamiento: control, toxina nativa 1,4 µg y toxina alquilada 1,4 µg.

Grupo / día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
3 3 32 19 20 29 8 145 -23
-72 -34 53 -58 -32 -44 -44 -5 -73
28 15 -10 0 19 0 -2 34 62
21 -4 -12 10 21 17 54 -2 100
-14 -37 -3 -45 14 9 29 -80 -10
-17 -10 22 -28 -17 -10 -5 62 6
-1 -5 16 8 16 12 49 -47 33
-11 4 1 -34 20 11 24 -27 13
-19 -56 55 8 -65 -3 17 -33 -61
-34 -46 3 8 14 13 6 82 8
Dosis de
1,4 µg MT-III
(nativa)
39 -17 -2 -6 16 -21 15 47 -17
-46 -15 -10 31 15 19 -8 82 34
7 -39 -24 -19 -28 9 4 -118 -145
56 8 24 -5 16 -3 -44 14 -79
-141 -49 -4 -2 4 -11 -37 165 -56
-7 -20 16 -20 2 -17 -12 59 -29
21 -57 -45 -28 21 -35 -34 -37 -31
-227 -71 15 -21 -65 -3 -30 -36 47
-57 -55 -44 -41 -11 13 6 377 -51
-46 -9 -5 13 2 27 12 -115 7
-36 -69 -34 16 -3 7 -8 106 -30
-132 -87 75 -40 -61 -30 -24 100 -143
-31 -24 -7 -22 -8 -1 31 53 -33
-30 -109 19 -5 -21 20 -4 59 -85
17 -25 -4 -1 25 26 -5 288 38
Dosis de
1,4 µg MT-III
(alquilada)
-26 -17 -41 -23 -33 -38 -29 -32 -136
-19 17 -26 -21 -10 8 -8 66 20
-29 -23 -10 10 -10 1 20 61 28
48 1 -37 36 50 33 -3 8 -37
-8 -49 -3 -7 4 -1 22 18 80
-151 -76 53 7 -21 -33 -38 219 -51
-20 -26 -35 -33 -35 -69 -71 122 -171
-16 -58 -28 17 19 3 58 -20 -57
-4 -80 93 30 -26 -38 64 -16 -70
-106 -125 -28 -37 8 -37 -17 46 95
-38 -55 32 -30 -18 -30 -12 -1 -66
-5 -37 -5 -31 24 12 22 -19 -11
-100 -31 25 -17 -30 -24 -17 164 13


224

Cuadro XII: Duración, en segundos, de la conducta de peritaxis neta (ipsi menos contra) durante
20 minutos por día, para cada uno de los animales de tres grupos de tratamiento: control, toxina
nativa 1,4 µg y toxina alquilada 1,4 µg.

Grupo / día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
-9 6 -6 -18 -15 -6 3 4 1
47 4 -13 22 -5 -1 14 13 19
-6 14 11 8 13 -7 0 3 -4
8 21 -18 16 12 -11 -2 0 -28
11 12 -1 -15 -2 -16 -5 77 -7
4 11 -14 16 -5 16 8 -10 0
8 3 5 6 1 4 8 -19 28
5 -11 -3 16 16 11 -6 0 -3
17 31 27 24 -14 2 16 40 33
22 17 -6 -5 11 -5 -6 0 0
Dosis de
1,4 µg MT-III
(nativa)
-15 -2 -1 1 5 12 6 29 21
23 23 -3 -17 -2 5 12 5 9
2 14 4 -6 -6 14 13 199 59
37 19 -17 16 3 0 8 -1 23
17 18 11 4 6 7 11 -115 37
10 -15 2 12 -4 -6 -5 -45 8
45 30 21 12 1 0 13 19 25
25 24 -11 -3 -7 -4 -8 14 -2
8 -16 -10 -4 6 -8 -9 23 33
8 -8 9 -11 -13 -15 -17 310 -25
40 9 1 -7 6 9 6 20 47
22 22 -7 -7 3 3 2 2 17
24 7 7 7 6 3 -15 6 25
7 14 -8 2 8 3 -3 -75 61
-31 -4 4 -3 -5 -12 -9 0 7
Dosis de
1,4 µg MT-III
(alquilada)
17 11 13 15 -11 15 5 38 21
6 -21 -2 26 3 -1 17 3 19
13 22 10 -1 8 5 0 0 4
31 12 -9 6 2 -8 -3 -1 13
3 17 9 2 -12 9 -2 -1 4
32 3 -3 3 -1 9 9 3 4
9 -20 -9 1 15 14 9 -57 6
22 44 23 1 2 -5 1 6 15
21 21 -17 12 10 9 0 92 41
6 2 2 2 -6 -5 4 6 -2
21 11 -6 0 2 10 -3 -7 24
-4 -4 0 4 -3 -10 -11 0 8
19 21 -14 7 10 13 -1 20 -5



225


Cuadro XIII: Número de cruces de cuadrantes virtuales del campo abierto, durante 20 min para
cada uno de los animales de tres grupos de tratamiento: control, toxina nativa 1,4 µg y toxina
alquilada 1,4 µg.

Grupo / día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
98 82 86 104 90 83 88 31 190
67 55 73 65 70 55 56 47 133
71 60 62 36 77 55 84 26 118
64 65 86 64 66 59 78 1 190
55 109 101 91 83 75 78 75 132
85 94 78 79 73 81 49 123 104
27 49 35 67 86 58 73 54 115
48 69 59 59 79 63 80 4 103
47 85 57 72 76 78 58 45 275
88 70 56 49 61 53 46 23 89
Dosis de
1,4 µg MT-III
(nativa)
75 33 52 57 55 62 62 44 42
74 46 69 49 63 41 60 35 102
43 52 58 68 70 52 62 119 148
86 67 83 58 80 54 85 39 174
58 55 68 75 71 77 77 149 154
57 62 59 64 53 50 66 61 133
54 77 60 60 56 56 88 37 94
91 67 61 56 56 56 72 25 170
69 51 45 50 67 60 53 28 146
45 47 41 48 58 55 62 111 149
77 64 78 73 81 67 84 27 188
70 59 63 64 54 44 65 8 170
62 48 50 36 54 56 74 29 105
60 66 47 49 59 56 51 72 154
72 86 52 47 48 60 34 0 175
Dosis de
1,4 µg MT-III
(alquilada)
32 48 69 55 61 40 39 57 98
61 53 77 82 66 64 51 23 117
31 47 69 46 59 48 42 31 77
60 48 64 63 60 57 61 24 143
33 68 70 71 68 53 57 9 136
88 58 64 63 57 65 64 9 113
59 73 57 58 75 74 66 123 75
50 90 71 69 86 62 73 27 65
50 78 82 71 74 78 71 56 85
81 85 62 50 71 72 76 15 189
34 55 61 60 55 54 67 3 106
57 64 55 54 68 54 62 47 143
27 42 39 41 46 66 53 37 71

226

Cuadro XIV: Duración de la conducta de exploración en segundos, durante 20 minutos por día,
para cada uno de los animales de tres grupos de tratamiento: control, toxina nativa 1,4 µg y toxina
alquilada 1,4 µg.

Grupo / día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
112,21 108,04 254,85 200,68 160,07 206,22 151,83 6,43 237,43
108,15 91,45 154,1 104,91 115,08 177,1 110,92 26,91 217,94
126,35 66,18 95,94 88,4 125,11 82,79 165,58 0 52,61
147,24 120,68 161,88 96,86 226,26 202,7 243,95 0 233,42
64,67 170,01 154,92 102,61 317,25 178,37 213,92 12,39 100,88
105,61 178,95 89,1 225,92 376,7 204,31 219,99 11,21 61,95
47,97 128,8 62,05 153,48 137,04 85,38 121,1 23,83 96,42
50,19 107,69 92,22 133,79 257,12 151,06 249,58 3,56 294,29
47,96 268,44 84,57 205,81 228,49 170,73 64,72 0 110,13
252,12 278,63 159,27 186,74 299,64 145,46 207,9 3,2 158,2
Dosis de
1,4 µg MT-III
(nativa)
162,86 66,54 140,25 107,47 127,25 131,47 185,88 0 63,91
130,05 66,44 146,45 165,46 160,46 156,56 248,88 0 237,66
33,35 35,53 92,45 80,89 93,85 121,57 267,81 0 18,73
103,11 82,08 131,09 86,94 105,01 165,43 219,77 1,3 194
111,18 108,17 148,71 169,7 249,35 211,34 284,66 127,36 211,41
91,53 104,39 218,45 106,5 143,22 99,22 274,53 0 178,03
97,07 86,06 105,35 89,33 116,25 99,35 254,88 0 135,07
104,3 61,98 114,76 60,94 106,83 78,42 364,6 0 126,2
100,11 52,32 91,1 136,16 198,37 92,24 185,59 3,19 127,5
108,06 85,18 70,15 65,8 148,09 150,14 145,2 3,66 67,81
105 71,86 112,89 129,9 137,85 124,98 261,34 0,92 37,05
108,45 207,58 196,28 165,57 112,75 229,88 180,68 0 379,53
145,35 103,04 83,87 103,62 186,67 146,94 203,78 366,67 282,91
61,52 145,08 108,88 127,57 141,36 134,88 80,22 0 96,45
90,2 108,39 84,76 96,26 96,09 253,25 61,52 0 314,35
Dosis de
1,4 µg MT-III
(alquilada)
50,96 92,14 122,25 88,16 125,02 110,37 51,29 2,15 30,51
158,56 156,14 153,69 146 159,69 106,76 131,22 0 100,74
39,47 125,26 97,44 141,14 160,56 50,49 50,9 0 34,35
81,75 90,29 94,32 120,71 139,95 98,87 106,98 16,63 40,05
25,03 170,22 92,94 138,08 118,66 162,07 56,8 0 75,53
83,36 155,58 140,78 112,79 135,94 102,31 162,04 0 44,31
54,64 83,11 40,64 64,19 74,22 98,95 89,16 0 37,77
84,48 161,88 103 144,03 146,89 104,84 135,76 3,85 8,82
93,8 176,71 204,45 163,63 247,58 166,28 247,92 4,67 124,03
53,68 121,34 50,08 61,76 78,53 105,99 163,65 0 67,5
59,25 131,48 110 121,21 94,94 101,87 202,65 2,58 105,26
117,59 179,42 94,23 198,27 214,41 115,44 258,21 0,81 234,22
24,42 97,04 100,49 76,25 66,47 179,58 91,82 8,44 47,49



227

Cuadro XV: Duración de la conducta de limpieza en segundos, durante 20 minutos por día para
cada uno de los animales de tres grupos de tratamiento: control, toxina nativa 1,4 µg y toxina
alquilada 1,4 µg.

Grupo / día
postoperatorio
día 1 día 3 día 5 día 7 día 12 día 15 día 18 día 20 día 22
Control
1 µL solución
salina
214,85 224,86 125,57 202,59 253,17 129,12 161,54 0 11,7
328,5 296,21 441,44 558,85 532,76 483,84 641,47 0 113,75
277,76 362,44 532,76 172,9 548,05 570,06 402,48 0 85
489,23 317,1 286,43 504,68 194,55 204,61 318,9 0 1,01
231,25 264,37 266,04 326,99 117,58 244,46 155,51 0 33,28
172,06 341,26 255,87 219,05 171,52 230,22 251,13 0 9,2
431,51 225,68 505,79 535,28 275,7 386,81 280,69 0 24,74
428 398,01 546,65 453,15 286,3 310,85 234,92 0 4,71
146,3 260,39 243,88 185,46 153,81 80,09 215,02 0 0
204,25 146,48 453,87 331,31 147,7 94,72 155,82 0 2,6
Dosis de
1,4 µg MT-III
(nativa)
342,3 499,76 438,38 247,45 376,62 311,13 245,9 14,36 32,38
64,91 586,97 457,24 365,33 345,52 390,88 316,55 0 22,03
224,12 344,52 484,5 461,82 472,1 370,46 239,16 34,68 180,79
270,48 294,67 412,32 492,69 424,91 363,23 321,94 0 50,38
220,43 415,17 282,35 254,2 166,36 192,21 165,44 0 7,83
82,67 511,99 328,76 558,61 206,67 609,58 324,83 0 50,25
225,11 321,67 285,27 433,31 192,39 366,27 193,82 44,25 46,63
198,38 644,66 634,68 644,01 265,96 523,48 300,72 2,64 6,89
454,3 116,59 622,66 400,32 220,11 462,2 393,9 0 37,24
337,72 393,83 669 706,39 434,31 307,53 322,46 7,74 30,74
364,4 437,85 481,37 487,64 340,32 412,23 191,67 7,84 80,48
276,14 269,68 481,19 372,12 280,22 406,86 414,87 0 26,66
161,75 71,19 138,31 569,52 188,37 434,64 120,7 0 66,88
7,41 267,36 299,41 225,39 276,74 493,23 387,41 0 12,86
419,99 273,36 572,7 639 258,81 245,55 444,66 10,43 21,67
Dosis de
1,4 µg MT-III
(alquilada)
378,04 491,92 461,95 628,4 297,36 504,83 207,2 17,34 36,44
352,85 343,86 357,63 444,77 272,56 353,22 189,37 12,84 61,83
277,84 526 316,28 461,1 233,12 557,35 361,96 0 22,71
260,7 242,71 447,11 196,61 351,51 283,3 221,65 27,41 32,7
478,41 451,33 287,59 318,07 221,12 245,28 166,18 0 27,57
199,9 287,59 452,96 506,41 448,57 366,77 336,34 8,18 71,99
427,21 330,65 397,24 572,34 559,72 212,28 442,75 0 41,87
338,4 385,48 432,62 530,29 272,81 108,72 155,37 12,23 38,61
540,18 187,64 257,25 492,82 338,22 244,31 223,8 0 12,81
158,84 374,16 321,36 421,12 147,49 137,04 14,5 0 1,44
323,52 502,86 423,36 541,53 379,68 400,81 177 0 20,3
620,92 441,4 243,6 502,93 265,43 234,18 47,54 0 0
136,81 216,54 518,56 681,51 313,46 404,56 405,02 0 71,29

228

Cuadro XVI: Porcentajes de depleción en estriado dorsal y ventral, para norepinefrina (NE),
serotonina (5-HT), dopamina (DA) y ácido 3,4-dihidroxifenilacético (DOPAC) y ácido homovanílico
(HVA) para cada uno de los animales de tres grupos de tratamiento: control, toxina nativa 1,4 µg y
toxina alquilada 1,4 µg.

Control
1 µL solución salina

Estriado Ventral
NE 2 -18 28 -9 1 -4 31 -20 -13 17
DA 8 -3 25 15 -32 13 15 -21 -22 32
DOPAC -15 -23 16 63 5 4 -48 63 -3 31
5HT 51 -82 37 -10 -43 11 52 81 -102 -13
HVA -34 -1 22 -5 -20 -22 -28 2 -20 18

Estriado Dorsal
NE 6 18 6 -7 -85 7 1 14 4 9
DA 4 3 -7 -17 8 13 11 17 15 -8
DOPAC -32 34 7 -3 -24 12 -5 15 7 17
5HT 50 -13 40 -2 -170 4 31 -1 25 -9
HVA 11 30 -28 -6 4 -10 -3 -14 -11 14

Grupo Dosis de
1,4 µg MT-III (nativa)
Estriado Ventral
NE
5 13 -12 13 -17 -9 -44 -8 20 20 -35 17 -7 16 6
DA
26 5 -9 33 5 0 -24 -37 19 30 -13 14 -11 2 20
DOPAC
9 13 2 22 25 -18 8 39 33 6 4 22 22 -8 21
5HT
-8 22 7 -10 8 -47 6 -41 28 10 -7 -20 -1 26 -2
HVA
16 -16 5 3 15 -15 24 -26 33 -21 17 8 30 -2 21
Estriado Dorsal
NE
27 0 17 38 53 32 49 12 3 36 36 11 5 22 0
DA
29 7 30 49 54 40 61 20 -1 54 25 19 11 28 1
DOPAC
31 -6 26 34 52 26 53 14 10 33 26 9 8 12 -22
5HT
17 -51 63 45 44 22 -11 -21 7 -6 -4 17 -44 -83 20
HVA
26 -14 23 14 7 1 2 -2 -9 -1 3 -10 -5 -10 0

------- continúa en la siguiente página ------


229

------ continuación del Cuadro XIII, página anterior ------

Grupo Dosis de
1,4 µg MT-III (alquilada)
Estriado Ventral
NE
-10 23 -3 9 -7 10 0 -76 19 16 11 14 10
DA
-37 24 9 -3 -4 6 15 3 18 40 19 8 9
DOPAC
5 24 13 14 -12 23 -30 0 23 2 -14 14 23
5HT
-83 61 -6 22 12 -45 24 73 71 2 -35 -35 27
HVA
-9 19 15 -11 -1 -16 -2 4 39 -39 12 35 26
Estriado Dorsal
NE
-3 15 3 15 4 9 2 6 37 29 19 20 24
DA
19 24 27 23 -6 -2 25 12 55 65 34 37 41
DOPAC
29 20 15 8 -9 -10 -19 -22 36 51 30 27 23
5HT
-105 -19 -30 24 -1 67 -45 23 26 30 58 56 16
HVA
-11 -1 10 4 12 -14 5 -1 5 -8 -3 11 -6



230

Cuadro XVII: Índice de metabolismo en estriado dorsal y ventral para el ácido 3,4-
dihidroxifenilacético (DOPAC) y el ácido homovanílico (HVA) en relación con el neurotransmisor
dopamina (DA), para cada uno de los animales de tres grupos de tratamiento: control, toxina nativa
1,4 µg y toxina alquilada 1,4 µg.


estriado ventral estriado dorsal
IM DOPAC/DA IM HVA/DA IM DOPAC/DA IM HVA/DA
Control
1 µL
solución
salina
105 106 138 93
109 98 68 72
102 105 87 102
84 103 88 91
92 91 135 102
100 111 100 106
104 116 117 103
81 81 103 86
85 98 109 110
102 70 77 87
Grupo
Dosis de
1,4 µg MT-
III (nativa)
104 114 97 105
91 101 115 103
90 87 105 110
81 143 129 108
79 90 142 99
118 115 125 96
74 61 123 95
84 92 108 100
83 100 132 100
105 113 145 90
85 93 98 94
80 108 112 91
70 64 103 110
110 104 122 94
67 99 147 98
Grupo
Dosis de
1,4 µg MT-
III
(alquilada)
69 80 88 108
36 107 106 92
96 93 116 98
84 107 119 108
107 97 103 101
33 114 108 93
153 119 158 99
103 99 139 93
39 74 142 110
165 233 140 109
140 108 106 106
93 70 116 95
34 81 129 97

Sign up to vote on this title
UsefulNot useful