Está en la página 1de 357

PROYECTO BSICO Y DE EJECUCIN DE

VIVIENDA UNIFAMILIAR CON GARAJE


en C/ Montes, 20 de Ronda (Mlaga)

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

NDICE GENERAL

I.-MEMORIA
1.- MEMORIA DESCRIPTIVA
2.- MEMORIA CONSTRUCTIVA
3.- CUMPLIMIENTO DEL CTE
4.- CUMPLIMIENTO DE OTROS REGLAMENTOS Y DISPOSICIONES
5.- ANEJOS A LA MEMORIA

II.-PLANOS
1.- SITUACIN E INFRAESTRUCTURAS EXISTENTES
2.- ESTADO ACTUAL
3.- ESTADO REFORMADO. PLANTAS, CUBIERTA Y SECCIN
4.- ESTADO REFORMADO. ALZADOS Y SECCIONES SUPERPUESTAS
5.- ESTADO REFORMADO. CIMENTACIN SANEAMIENTO Y ESTRUCTURA
6.- ESTADO REFORMADO. INSTALACIONES DE ELECTRICIDAD Y FONTANERA
7.- ESTADO REFORMADO. INSTALACIN DE VENTILACIN Y MEMORIA GRFICA
DE CARPINTERA
8.- ESTADO REFORMADO. INSTALACIN SOLAR-TRMICA Y DETALLES
CONSTRUCTIVOS

III.-PLIEGO DE CONDICIONES
1.- CLUSULAS ADMINISTRATIVAS
2.-CONDICIONES TCNICAS DE LOS MATERIALES, DE LA EJECUCIN Y DE LAS
VERIFICACIONES

IV.-MEDICIONES Y PRESUPUESTO

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

I.- MEMORIA

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.- MEMORIA DESCRIPTIVA


CONTENIDO Y OBJETO
En el presente documento se desarrolla el Proyecto Bsico y de Ejecucin de
Vivienda Unifamiliar con Garaje en la calle Montes, 20 de Ronda (Mlaga), de
conformidad con lo establecido en el Cdigo Tcnico de la Edificacin (CTE), Real
Decreto 314/2006 de 17 de marzo y sus modificaciones posteriores, siendo su objeto
proporcionar toda la documentacin tcnica necesaria para la ejecucin de la obra
as como para la obtencin de las correspondientes autorizaciones administrativas.

ndice
1.1.- AGENTES
1.2.- INFORMACION PREVIA
1.2.1.- ANTECEDENTES Y CONDICIONANTES: ESTADO DE RUINA DE LA EDIFICACION EXISTENTE
1.2.2.- DATOS DE PARTIDA
1.2.2.1.- SOLAR, EMPLAZAMIENTO Y ENTORNO FISICO
1.2.3.- NORMATIVA URBANISTICA DE APLICACION

1.3.- DESCRIPCION DEL PROYECTO


1.3.1.- PROGRAMA DE NECESIDADES
1.3.2.- DESCRIPCION DE LA SOLUCION ADOPTADA
1.3.3.- SUPERFICIES UTILES Y CONSTRUIDAS
1.3.4.- CUMPLIMIENTO NORMA URBANISTICA
1.3.5.- CUMPLIMIENTO DEL CODIGO TECNICO DE LA EDIFICACION
1.3.6.- CUMPLIMIENTO DE OTRAS NORMATIVAS
1.3.7.- DESCRIPCION GENERAL DE LOS PARAMETROS QUE DETERMINAN LAS PREVISIONES TECNICAS A
CONSIDERAR EN EL PROYECTO RESPECTO A LOS SISTEMAS DE LA EDIFICACION
1.3.7.1.- SISTEMA ESTRUCTURAL
1.3.7.2.- SISTEMA DE COMPARTIMENTACION
1.3.7.3.- SISTEMA ENVOLVENTE
1.3.7.4.- SISTEMA DE ACABADOS
1.3.7.5.- SISTEMA DE ACONDICIONAMIENTO AMBIENTAL
1.3.7.6.- SISTEMA DE SERVICIOS

1.4.- PRESTACIONES Y LIMITACIONES DE USO DE LA EDIFICACION


1.4.1.- PRESTACIONES
1.4.1.1.- SEGURIDAD
1.4.1.2.- HABITABILIDAD
1.4.1.3.- FUNCIONALIDAD
1.4.2.- PRESTACIONES QUE SUPERAN EL CTE
1.4.3.- LIMITACIONES

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.1.- AGENTES
Promotores: David Lpez Blanco y Ana Becerra de Haro, con DNI 76799241X y
25556855Z respectivamente, con domicilio en calle N Sra. de Ftima, 6
de Ronda (Mlaga)
Autor del Proyecto: Pedro Enrique Santos Buenda. Arquitecto colegiado n115 del
Colegio Oficial de Arquitectos de Mlaga
Otros agentes:

1.2.- INFORMACION PREVIA


1.2.1.- ANTECEDENTES Y CONDICIONANTES: ESTADO DE RUINA DE LA EDIFICACION
EXISTENTE
Habiendo aceptado el encargo de redactar el proyecto Bsico y de Ejecucin y
realizar la direccin de obra de Vivienda Unifamiliar con Garaje en la calle Montes, 20
de Ronda (Mlaga), el tcnico que suscribe procedi a la inspeccin del lugar donde
se han de efectuar las intervenciones previstas en el presente proyecto.
El principal condicionante destacable es el ESTADO DE RUINA en el que se encuentra
la edificacin existente ya que cuenta con una antigedad superior a los 60 aos y, al
no estar habitada desde hace mucho tiempo, no se realiza el oportuno
mantenimiento. En la inspeccin ocular realizada se ha observado prdida de
verticalidad en los muros resistentes de mampostera ordinaria, forjados tradicionales
flectados y con vigas "descabezadas" en su empotramiento en muros, vas de agua en
la cubierta de teja, etc; condicionando todo ello, junto con la baja calidad de los
materiales empleados, que el estado general de la edificacin se califique de
RUINOSO.
Por tal motivo, en el presente proyecto, se plantea la demolicin total de la edificacin
existente y su sustitucin por una nueva.
1.2.2.- DATOS DE PARTIDA
1.2.2.1.- SOLAR, EMPLAZAMIENTO Y ENTORNO FISICO
El solar donde se emplazar la edificacin que se proyecta est situado en la calle
Montes, 20 de Ronda (Mlaga), en el Conjunto Histrico de Ronda y, ms
concretamente, en la zona denominada "Ensanche del Mercadillo" por rl PGOU
vigente y " Santa Cecilia" por el PERI en tramitacin, rodeado por edificaciones con la
tipologa edificatoria predominante en la zona, esta es de edificaciones de dos
plantas para uso residencial con una vivienda unifamiliar, con fachadas alineadas al
vial, adosadas a medianeras y con patios traseros. Su topografa es regular,
ligeramente inclinada en sentido transversal y su eje longitudinal se desarrolla en
sentido noroeste-sureste. Cuenta con una superficie de 142.00 m2 y tiene forma
rectangular-irregular, lindando por el frente (segn se entra) con la calle Montes por la
cual tiene acceso, con un lindero describir forma y longitud de lindero; por la derecha
con indicar colindante con un lindero describir forma y longitud de lindero; por la
izquierda con indicar colindante con un lindero describir forma y longitud de lindero; y
por el fondo con indicar colindante con un lindero describir forma y longitud de

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

lindero. El solar cuenta con las acometidas a los servicios urbansticos (agua potable,
saneamiento, electricidad y telfono), adems de los servicios comunes de alumbrado
pblico y recogida de residuos.
.
Todo lo anterior se refleja en los planos correspondientes.
con fachadas alineadas al vial, adosadas a medianeras, con patios traseros
1.2.3.- NORMATIVA URBANISTICA DE APLICACION
Al presente proyecto le es de aplicacin el Plan General de Ordenacin Urbana
(PGOU) de Ronda en vigor, el Plan Especial del Casco Histrico de Ronda en vigor, y el
Plan Especial de Proteccin y de Reforma Interior del Conjunto Histrico de Ronda
aprobado inicialmente por el Excmo. Ayuntamiento de Ronda.
Es de aplicacin el Plan General de Ordenacin Urbana (PGOU) de Ronda en vigor, el
Plan Especial del Casco Histrico de Ronda en vigor, y el Plan Especial de Proteccin y
de Reforma Interior del Conjunto Histrico de Ronda aprobado inicialmente por el
Excmo. Ayuntamiento de Ronda en fecha reciente.

1.3.- DESCRIPCION DEL PROYECTO


1.3.1.- PROGRAMA DE NECESIDADES
El programa de necesidades expuesto por los promotores se refiere a una edificacin
de dos plantas para una vivienda unifamiliar con garaje. Desde el punto de vista del
estilo arquitectnico, expresan su inters en que la edificacin que se proyecta quede
integrada en el entorno donde se emplaza.
1.3.2.- DESCRIPCION DE LA SOLUCION ADOPTADA
Se proyecta una edificacin para uso Residencial Vivienda Unifamiliar con las
siguientes caractersticas: Edificacin, con la configuracin formal y tipologa similares
a la edificacin que se demoler as como a las existentes en el entorno, que se adosa
a medianeras, alinea su fachada al vial y cuenta con un patio trasero; se desarrolla en
dos plantas situndose en la planta baja el garaje , el patio y el acceso a la planta
alta, en la que se ubica la vivienda que se distribuye en diferentes dependencias
(saln-comedor, cocina, tres dormitorios y dos baos).
El volumen de dicha edificacin es el resultado de la aplicacin de las ordenanzas
urbansticas y los parmetros relativos a habitabilidad y funcionalidad. El acceso y la
evacuacin se realizarn por el viario establecido en la normativa de aplicacin. La
tipologa edificatoria, la composicin de fachadas as como el lenguaje formal y
funcional que se plantean propiciarn una buena integracin en su entorno, pues son
similares a los predominantes en la zona.
Se ha procurado satisfacer todas las necesidades expuestas en el programa por los
promotores, siempre bajo la premisa de reducir, en la medida de lo posible, el costo
total de las obras. Para ello se plantea una organizacin lgica de la edificacin en lo
referente a su funcionalidad, as como el empleo de los sistemas constructivos
adecuados al tipo y volumen de dicha edificacin.
.
Todo lo anterior se refleja en los planos correspondientes

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.3.3.- SUPERFICIES UTILES Y CONSTRUIDAS


La relacin de superficies tiles y construidas de la edificacin que se proyecta, que
se refleja tambin en los planos correspondientes, es la siguiente:
POR USOS:
Superficies
Cerradas

til Construida
(m2)
(m2)

Superficies
Abiertas

VIVIENDA

90.05

106.80

Patio

P.Baja

9.40

12.25

Entrada
Ascensor
Escaleras

5.00
1.20
3.20

P. Primera

86.65

Distribuidor y escaleras
Ascensor
Saln-comedor
Cocina
Dormitorio 1
Bao 2
Dormitorio 2
Dormitorio 3
Bao 1

GARAJE

94.55

8.00
1.20
21.30
7.40
12.60
3.50
12.65
10.60
3.40

73.75

82.30

POR PLANTAS:
Superficies
Cerradas
EDIFICACIN
P. Baja
P. Alta

Construida
(m2)
189.10
94.55
94.55

Pedro Enrique Santos Buenda______________________Arquitecto

Construida
(m2)
47.45

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.3.4.- CUMPLIMIENTO NORMA URBANISTICA


Como justificacin del cumplimiento de los parmetros urbansticos se incluye a
continuacin la ficha de declaracin de circunstancias urbansticas, segn el modelo
del Colegio Oficial de Arquitectos de Arquitectos de Mlaga:

DECLARACIN RESPONSABLE SOBRE


CIRCUNSTANCIAS Y NORMATIVAS URBANSTICAS DE APLICACIN
(Art. 14 del Reglamento de Disciplina Urbanstica de Andaluca)

TTULO DEL PROYECTO: VIVIENDA UNIFAMILIAR CON GARAJE


UBICACIN:
C/ Montes, 20 de Ronda (Mlaga)
ENCARGANTE:
David Lpez Blanco y Ana Becerra de Haro
ARQUITECTO:
Pedro Enrique Santos Buenda

INSTRUMENTOS DE ORDENACIN Y DE GESTIN URBANSTICA QUE AFECTAN AL PROYECTO

POT ND PGOU
Vigente

NNSS
(Mun.)

NNSS
(Prov.)

PDSU

POI PS PAU PPO

PE PERI ED

PA
PU PR
(SNU)

En
tramitatacin

OBSERVACIONES
Anterior a LOUA
Planeamiento
general
vigente

Adaptado parcialmente a LOUA


Adaptado totalmete a LOUA

Aprobacin inicial
Aprobacin
Provisional

Instrumento
urbanstico
en tramitacin Aprobacin
Definitiva
no publicada

CLASIFICACIN Y CATEGORIZACIN DEL SUELO

Segn planeamiento general vigente:


SUELO URBANO
Consolidado

SUELO URBANIZABLE
X

Ordenado

No consolidado:
Sometido a planeamiento en
desarrollo
Unidad de ejecucin delimitada
(UE)
De actuacin directa

Sectorizado

SUELO NO URBANIZABLE
Especialmente protegido
Preservado por el Plan
De carcter rural o natural
(comn)
Hbitat rural diseminado

No sectorizado

De secano

De regadio

Calificacin segn PEPMF:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Segn planeamiento general en tramitacin:


SUELO URBANO
Consolidado

SUELO URBANIZABLE
X

Ordenado

No consolidado:
Sectorizado

Sometido a planeamiento en
desarrollo

SUELO NO URBANIZABLE
Especialmente protegido
Preservado por el Plan
De carcter rural o natural
(comn)
Hbitat rural diseminado

Unidad de ejecucin delimitada


(UE)

No sectorizado

Calificacin segn PEPMF:

De actuacin directa
OBSERVACIONES
Es de aplicacin el Plan General de Ordenacin Urbana (PGOU) de Ronda en vigor, el Plan Especial del
Casco Histrico de Ronda en vigor, y el Plan Especial de Proteccin y de Reforma Inerior del Conjunto
Histrico de Ronda aprobado inicialmente por el Excmo. Ayuntamiento de Ronda.

LEYENDA
______________________________________________________________________________________________________
POT Plan de Ordenacin Territorial e mbito
PAU Programa de Actuacin Urbanstica
sugregional
ND
Normativas Directoras
PPO Plan Parcial de Ordenacin
PGOU Plan General de Ordenacin Urbanstica
PE Plan Especial (diferentes especialidades)
NN.SS.(Mun.) Normas subsidiarias de mbito
PERI Plan Especial de Reforma Interior
municipal
NN.SS (Prov.) Normas subsidiarias de mbito
ED Estudio de Detalle
provincial
PDSU Proyecto de delimitacin de suelo urbano PA Proyecto de Actuacin en Suelo No Urbanizable
POI Plan de Ordenacin Intermunicipal (Novedad
PU Proyecto de Urbanizacin
LOUA)
PS Plan de Sectorizacin
PR Proyecto de Reparcelacin

CLASIFICACIN URBANSTICA DEL SUELO


VIGENTE

EN TRAMITACIN

PGOU

PERI

Calificacin

URBANO
CASCO HISTRICO

URBANO
CONJUNTO HISTRICO

Ordenanza de aplicacin

PLAN ESPECIAL
CASCO HISTRICO

PLAN DE PROTECCIN
Y
REFORMA INTERIOR DEL
CONJUNTO HISTRICO

Instrumento de ordenacin
preciso

OBSERVACIONES

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

CUADRO-RESUMEN DE ORDENANZAS

CONCEPTO

NORMATIVA VIGENTE

NORMATIVA EN
TRAMITACIN

PROYECTO

Parcela Catastral

Parcela Catastral

Parcela catastral- 142 m2

Estudios previos de ordenacin


Parcela mnima
Parcela mxima
Longitud mnima de fachada
Dimetro mnimo inscrito
Densidad (n max. viviendas)
Viviendas protegidas
obligatorias
Altura mxima, plantas

PB+2

PB+1

PB+1

Altura mxima, metros

10.50m

6.50m

6.15m

100%

67% (*)

66.58%

12.00m

10.00m

Residencial

Residencial

Residencial

Adosada, alineada

Adosada, alineada

Adosada, alineada

Altura mnima
Edificabilidad
Ocupacin planta baja
Ocupacin planta primera
Ocupacin resto plantas
Separacin lindero pblico
Separacin lindero privado
Separacin entre edificios
Profundidad edificable
Retranqueos
Usos predominantes
Usos compatibles
Usos prohibidos
Tipologa de la edificacin
Patios mnimos
Cuerpos salientes
Plazas mnimas aparcamiento
.
Grado de proteccin
.
Otras determinaciones
.
OBSERVACIONES

(*) La ocupacin mxima de la Normativa en tramitacin (PERI) es el 80% de la ocupacin media de la


manzana 71879 que es de 83.75%, segn la Tabla Media correspondiente de la citada normativa.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

DECLARACIN DE LAS CIRCUNSTANCIAS URBANSTICAS QUE INCIDEN EN EL PROYECTO


X

No existen desajustes con respecto a la normativa urbanstica de aplicacin.

Dado que el proyecto se justifica sobre la base de un instrumento urbanstico


an no aprobado definitivamente, su tramitacin colegial es condicionada a la
publicacin de la aprobacin definitiva del mismo. El encargante reconoce que,
en virtud de lo dispuesto por el Art. 5.1 RDU, mientras no se produzca la
entrada en vigor de dicho planeamiento no podr concederse licencia urbanstica.
Los desajustes urbansticos declarados anteriormente no afectan a parmetros
urbansticossustanciales, segn la justificacin efectuada en las observaciones.
El encargante manifiesta que el proyecto no se ajusta a la normativa urbanstica
en vigor y solicita la tramitacincolegial del proyecto para su presentacin ante
la administracin municipal. El encargante reconoce as mismo que,en virtud de lo
dispuesto por el Art. 14.5 del Reglamento de Disciplina Urbanstica de Andaluca,
el visado se entien-de en este caso denegado por razones urbansticas.
__________________________________________________________________________________
ENCARGANTE
Fecha y firma:

ARQUITECTO/A
Fecha y firma:

Julio de 2.011

Pedro Enrique Santos Buenda


Arquitecto

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.3.5.- CUMPLIMIENTO DEL CODIGO TECNICO DE LA EDIFICACION


A continuacin se describen las prestaciones de la edificacin por requisitos bsicos
y en relacin con las exigencias bsicas del CTE. Dichos requisitos bsicos que,
conforme a la Ley de Ordenacin de la Edificacin, son los relativos a la funcionalidad,
seguridad y habitabilidad, se establecen con el fin de garantizar la seguridad de las
personas, el bienestar de la sociedad y la proteccin del medio ambiente, debiendo
los edificios proyectarse, construirse, mantenerse y conservarse de tal forma que se
satisfagan estos requisitos bsicos. Por tal motivo, en el presente documento ,se
adoptan las soluciones y los procedimientos propuestos en los diferentes Documentos
Bsicos del CTE, cuya utilizacin es suficiente para acreditar el cumplimiento de las
citadas exigencias bsicas.
Requisitos bsicos relativos a la funcionalidad:
Utilizacin, de tal forma que la disposicin y las dimensiones de los espacios y la
dotacin de las instalaciones faciliten la adecuada realizacin de las funciones
previstas en el edificio. En la edificacin objeto del presente proyecto se ha primado,
as mismo, la reduccin de recorridos de circulacin no tiles, como son los pasillos,
ubicando las zonas comunes en la parte central de la pieza. En cuanto a las
dimensiones de las dependencias se ha seguido lo dispuesto por la normativa
urbanstica de aplicacin. La edificacin estar dotada de todos los servicios bsicos.
Accesibilidad, de tal forma que se permita a personas con movilidad y
comunicacin reducidas el acceso y la circulacin por el edificio en los trminos
previstos en su normativa especfica. Tanto el acceso del edificio, como las zonas
comunes de ste, estn proyectadas de tal manera que sean accesibles a personas
con movilidad reducida, estando, en todo lo que se refiere a accesibilidad, a lo
dispuesto por la normativa tcnica para la accesibilidad y eliminacin de barreras
arquitectnicas y urbansticas en vigor, cuyo cumplimiento se justifica en el anexo
correspondiente.
Acceso a los servicios de telecomunicacin, audiovisuales y de informacin de
acuerdo con lo establecido en su normativa especfica. Se proyecta la edificacin de
tal manera que se garanticen los servicios de telecomunicacin conforme al Real
Decreto 346/2011, de 11 de marzo, por el que se aprueba el Reglamento regulador de
las infraestructuras comunes de telecomunicaciones para el acceso a los servicios de
.
telecomunicacin en el interior de las edificaciones
Facilidad para el acceso de los servicios postales, mediante la dotacin de las
instalaciones apropiadas para la entrega de los envos postales, segn lo dispuesto en
su normativa especfica. Se dotar a la edificacin de casilleros postales individuales.
Requisitos bsicos relativos a la seguridad:
Seguridad estructural, de tal forma que no se produzcan en la edificacin, o partes
de la misma, daos que tengan su origen o afecten a la cimentacin, los soportes, las
vigas, los forjados, los muros de carga u otros elementos estructurales, y que
comprometan directamente la resistencia mecnica y la estabilidad del edificio.
Los aspectos bsicos que se han tenido en cuenta a la hora de adoptar el sistema
estructural para la edificacin que nos ocupa son principalmente: resistencia
mecnica y estabilidad, seguridad, durabilidad, economa, facilidad constructiva,
.
modulacin y posibilidades de mercado
Seguridad en caso de incendio, de tal forma que los ocupantes puedan desalojar el
edificio en condiciones seguras, se pueda limitar la extensin del incendio dentro del
propio edificio y de los colindantes y se permita la actuacin de los equipos de
extincin y rescate. Condiciones urbansticas: el edificio es de fcil acceso para los

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

bomberos. El espacio exterior inmediatamente prximo al edificio cumple las


condiciones suficientes para la intervencin de los servicios de extincin de incendios.
Todos los elementos estructurales son resistentes al fuego durante un tiempo superior al
sector de incendio de mayor resistencia. El acceso est garantizado ya que los huecos
cumplen las condiciones de separacin. No se produce incompatibilidad de usos.
No se colocar ningn tipo de material que por su baja resistencia al fuego,
combustibilidad o toxicidad pueda perjudicar la seguridad del edificio o la de sus
ocupantes.
Seguridad de utilizacin, de tal forma que el uso normal del edificio no suponga
riesgo de accidente para las personas. La configuracin de los espacios, los elementos
fijos y mviles que se instalen en el edificio, se proyectan de tal manera que puedan
ser usado para los fines previstos dentro de las limitaciones de uso del edificio que se
describen ms adelante sin que suponga riesgo de accidentes para los usuarios del
mismo.
Requisitos bsicos relativos a la habitabilidad:
Higiene, salud y proteccin del medio ambiente, de tal forma que se alcancen
condiciones aceptables de salubridad y estanqueidad en el ambiente interior del
edificio y que ste no deteriore el medio ambiente en su entorno inmediato,
garantizando
una
adecuada
gestin
de
toda
clase
de
residuos.
El edificio proyectado rene los requisitos de habitabilidad, salubridad, ahorro
energtico y funcionalidad exigidos para el uso de vivienda. La edificacin
proyectada dispone de medios que impiden la presencia de agua o humedad
inadecuada procedente de precipitaciones atmosfricas, del terreno o de
condensaciones, y dispone de medios para impedir su penetracin o, en su caso,
permiten su evacuacin sin produccin de daos. El edificio dispone de espacios y
medios para extraer los residuos ordinarios generados en ellos de forma acorde con el
sistema pblico de recogida. La edificacin dispone de medios para que sus recintos
se puedan ventilar adecuadamente, eliminando los contaminantes que se produzcan
de forma habitual durante su uso normal, de forma que se aporte un caudal suficiente
de aire exterior y se garantice la extraccin y expulsin del aire viciado por los
contaminantes.
La edificacin dispone de medios adecuados para suministrar al equipamiento
higinico previsto de agua apta para el consumo de forma sostenible, aportando
caudales suficientes para su funcionamiento, sin alteracin de las propiedades de
aptitud para el consumo e impidiendo los posibles retornos que puedan contaminar la
red, incorporando medios que permitan el ahorro y el control del agua.
La edificacin proyectada dispone de medios adecuados para extraer las aguas
residuales generadas de forma independiente con las precipitaciones atmosfricas.
Proteccin contra el ruido, de tal forma que el ruido percibido no ponga en peligro
la salud de las personas y les permita realizar satisfactoriamente sus actividades.
Todos los elementos constructivos verticales (particiones interiores, paredes
separadoras de salas de mquinas, fachadas) cuentan con el aislamiento acstico
requerido para los usos previstos en las dependencias que delimitan.
Todos los elementos constructivos horizontales (forjados generales separadores de
cada una de las plantas, cubiertas transitables y forjados separadores de salas de
mquinas), cuentan con el aislamiento acstico requerido para los usos previstos en las
dependencias que delimitan.
.
Ahorro de energa y aislamiento trmico, de tal forma que se consiga un uso racional
de la energa necesaria para la adecuada utilizacin del edificio.
El edificio objeto del presente proyecto dispone de una envolvente adecuada a la
limitacin de la demanda energtica necesaria para alcanzar el bienestar trmico en
funcin del clima de la ciudad de en la que se ubicar, del uso previsto y del rgimen
de verano y de invierno.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Las caractersticas de aislamiento e inercia, permeabilidad al aire y exposicin a la


radiacin solar, permiten la reduccin del riesgo de aparicin de humedades de
condensacin superficial e intersticial que puedan perjudicar las caractersticas de la
envolvente.
Se ha tenido en cuenta especialmente el tratamiento de los puentes trmicos para
limitar las prdidas o ganancias de calor y evitar problemas higrotrmicos en los
mismos.
La edificacin proyectada dispone de instalaciones de iluminacin adecuadas a las
necesidades de sus usuarios y a la vez eficaces energticamente disponiendo de un
sistema de control que permita ajustar el encendido a la ocupacin real de la zona,
as como de un sistema de regulacin que optimice el aprovechamiento de la luz
natural, en las zonas que renan unas determinadas condiciones.
La demanda de agua caliente sanitaria se cubrir en parte mediante la incorporacin
de un sistema de captacin, almacenamiento y utilizacin de energa solar de baja
temperatura, adecuada a la radiacin solar global de su emplazamiento y a la
demanda de agua caliente del edificio.

1.3.6.- CUMPLIMIENTO DE OTRAS NORMATIVAS


Otras normativas a cumplir en el presente proyecto son:
Estatales:
EHE-08 (R.D. 1247/2008): Se cumple con las prescripciones de la Instruccin de
hormign estructural y se complementan sus determinaciones con los
Documentos Bsicos de Seguridad Estructural.
.
NCSE-02 (R.D. 997/2002): Se cumple con los parmetros exigidos por la Norma
de construccin sismorresistente y que se justifican en la memoria de estructuras
del proyecto de ejecucin.
.
ICT (R.D. 346/2011): Se cumplen las prescripciones del Real Decreto sobre
Infraestructuras Comunes de Telecomunicaciones.
.
REBT (R.D. 842/2002): Se cumple con las prescripciones del Reglamento
Electrotecnico de Baja Tensin y sus Instrucciones tcnicas complementarias.
RITE (R.D. 1027/2007): Se cumple con el Reglamento de Instalaciones Trmicas
.
en los Edificios.
Accesibilidad (R.D. 505/2007): Se cumple con las condiciones bsicas de
accesibilidad y no discriminacin de personas con discapacidad para el
acceso y utilizacin de los espacios pblicos urbanizados y edificaciones.
Autonmicas de Andaluca:
Accesibilidad: Decreto 293/2009, de 7 de julio, por el que se aprueba el
reglamento que regula las normas para la accesibilidad en las infraestructuras,
el
urbanismo,
la
edificacin
y
el
transporte
en
Andaluca.
Normas Disciplina Urbanstica: Decreto 60/2010, de 16 de marzo, por el que se
aprueba el Reglamento de Disciplina Urbanstica de la Comunidad Autnoma
de Andaluca.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.3.7.- DESCRIPCION GENERAL DE LOS PARAMETROS QUE DETERMINAN LAS PREVISIONES


TECNICAS A CONSIDERAR EN EL PROYECTO RESPECTO A LOS SISTEMAS DE LA
EDIFICACION
Los parmetros que condicionan la eleccin de los concretos sistemas adoptados
para el edificio y que vienen determinados por las condiciones del terreno, de las
parcelas colindantes, por los requerimientos del programa funcional, etc, se enumeran
a continuacin con relacin a los sistemas siguientes:
1.3.7.1.- SISTEMA ESTRUCTURAL
Cimentacin:
Los parmetros determinantes para la eleccin del tipo de cimentacin, su diseo y
caractersticas tcnicas se adoptan tras la observacin e inspeccin del terreno
donde se cimentar y de la informacin obtenida de otras obras del entorno. Antes
del inicio de las obras se realizar el correspondiente estudio geotcnico para
determinar si la solucin prevista para la cimentacin, as como sus dimensiones y
.
armados son adecuadas al terreno existente.
Las bases de clculo adoptadas y el cumplimiento de las exigencias bsicas de
seguridad se ajustan a los documentos bsicos del CTE

Estructura portante:
Los aspectos bsicos que se han tenido en cuenta a la hora de adoptar el tipo de
estructura portante son principalmente la configuracin de la cimentacin, la forma y
diseo, el nmero de plantas y el uso previsto de la edificacin que se proyecta,
adems de la resistencia mecnica y estabilidad, la seguridad, la durabilidad, la
economa, la facilidad constructiva, la modulacin y las posibilidades del mercado.
Las bases de clculo adoptadas y el cumplimiento de las exigencias bsicas de
seguridad se ajustan a los documentos bsicos del CTE.

Estructura horizontal:
Los aspectos bsicos que se han tenido en cuenta a la hora de adoptar el tipo de
estructura horizontal son principalmente la configuracin de la cimentacin y de la
estructura portante, la forma y diseo y el uso previsto de la edificacin que se
proyecta, adems de la resistencia mecnica y estabilidad, la seguridad, la
durabilidad, la economa, la facilidad constructiva, la modulacin y las posibilidades
del mercado.
.
Las bases de clculo adoptadas y el cumplimiento de las exigencias bsicas de
seguridad se ajustan a los documentos bsicos del CTE.
1.3.7.2.- SISTEMA DE COMPARTIMENTACION
Los aspectos que determinan las previsiones tcnicas para el sistema de
compartimentacin, tanto vertical como horizontal, en usos privativos como entre usos
diferenciados, son principalmente los niveles de aislamiento acstico y trmico,
resistencia al fuego, etc, que cumplirn con las exigencia del CTE, adems de los
criterios econmicos, la facilidad constructiva, y las posibilidades del mercado.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.3.7.3.- SISTEMA ENVOLVENTE


Los parmetros que determinan las previsiones tcnicas para la eleccin del sistema
envolvente son, entre otros, las zonas climtica y pluviomtrica donde se ubica la
edificacin que se proyecta, la transmitancia media de los muros de las fachadas, su
exposicin al viento, su resistencia al fuego, etc.
.
El sistema envolvente general de de la edificacin se ajustar a las exigencias de
seguridad estructural, salubridad (proteccin contra la humedad y evacuacin de
aguas), seguridad en caso de incendio, seguridad de utilizacin, aislamiento acstico
y limitacin de demanda energtica del CTE.

1.3.7.4.- SISTEMA DE ACABADOS


Los aspectos que determinan las previsiones tcnicas para la eleccin del sistema de
acabados, tanto verticales u horizontales como interiores o exteriores, son las zonas
climtica y pluviomtrica donde se ubica la edificacin qobjeto del presente
proyecto,
su
exposicin
al
viento,
su
resistencia
al
fuego,
etc.
El sistema de acabados en general de de la edificacin se ajustar a las exigencias de
seguridad estructural, salubridad (proteccin contra la humedad y evacuacin de
aguas), seguridad en caso de incendio, seguridad de utilizacin, aislamiento acstico
y limitacin de demanda energtica del CTE.

1.3.7.5.- SISTEMA DE ACONDICIONAMIENTO AMBIENTAL


Los aspectos que se ha tenido en cuenta para determinar el sistema de
acondicionamiento ambiental son los derivados de la eleccin de materiales y
procedimientos constructivos que garanticen las condiciones de higiene, salud y
proteccin del medio ambiente, alcanzando condiciones aceptables de salubridad y
estanqueidad en el ambiente interior del edificio y disponiendo de los medios para
que no se deteriore el medio ambiente en su entorno inmediato, con una adecuada
gestin de los residuos que generar el uso previsto de la edificacin que se proyecta.
El sistema de acondicionamiento ambiental en general de de la edificacin se
ajustar a las exigencias de salubridad (proteccin contra la humedad, evacuacin
de aguas, recogida y evacuacin de residuos y calidad del aire interior).

1.3.7.6.- SISTEMA DE SERVICIOS


Los parmetros que determinan las previsiones tcnicas del conjunto de servicios
externos a la edificacin necesarios para el correcto funcionamiento de sta son:
.
Abastecimiento de agua potable:
Se dispone de acometida de abastecimiento de agua apta para el consumo
humano. Los datos de presin y caudal correspondientes al suministro se detallarn en
el correspondiente apartado del cumplimiento del CTE.
.
Evacuacin de Aguas:
.
Se dispone de una red de alcantarillado general a la que se podr conectar el sistema
de evacuacin del edificio que se proyecta. Los datos de dicho alcantarillado se
detallarn en el correspondiente apartado del cumplimiento del CTE.
Suministro elctrico:
.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Se dispone de una red de suministro elctrico con potencia suficiente para la previsin
de carga total del edificio proyectado.
.
Telefona:
.
Se dispone de red de telefona a la que se podr conectar el edificio que se proyecta.
Recogida de basuras:
.
El lugar donde se ubica la edificacin que se proyecta goza del servicio de recogida
de basuras.

1.4.- PRESTACIONES
EDIFICACION

LIMITACIONES

DE

USO

DE

LA

1.4.1.- PRESTACIONES
A continuacin se describen las prestaciones de la edificacin por requisitos bsicos
(Seguridad, Habitabilidad y Funcionalidad) y en relacin con las exigencias bsicas del
CTE.
Se indican, si fuese el caso, las prestaciones acordadas entre promotor y proyectista
que superen los umbrales establecidos en el CTE.
1.4.1.1.- SEGURIDAD
Seguridad estructural.
Se proyecta de acuerdo con los parmetros y procedimientos especificados
en los Documentos Bsicos y las Normativas que se indican a continuacin:
Documentos Bsicos
DB SE. Seguridad estructural

DB SE-AE. Acciones en la edificacin

DB SE-C. Cimientos

DB SE-A. Estructuras de acero


DB SE-F. Estructuras de fbrica

DB SE-M. Estructuras de madera


Normativas
NCSE. Norma de construccin
sismorresistente

EHE. Instruccin de hormign estructural

Con su cumplimiento se satisfacen las exigencias bsicas y se superan los


niveles mnimos de calidad propios del requisito bsico de seguridad
estructural, con el objetivo de asegurar que el edificio tenga un
comportamiento estructural adecuado frente a las acciones e influencias
previsibles a las que pueda estar sometido durante su construccin y uso
previsto.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Seguridad en caso de incendio.


Se proyecta de acuerdo con los parmetros y procedimientos especificados
en el Documento Bsico DB-SI Seguridad en caso de incendio, con cuyo
cumplimiento se satisfacen las exigencias bsicas y se superan los niveles
mnimos de calidad propios del requisito bsico de seguridad en caso de
incendio, con el objetivo de reducir a lmites aceptables el riesgo de que los
usuarios sufran daos derivados de un incendio de origen accidental, como
consecuencia de las caractersticas de su proyecto, construccin, uso y
mantenimiento. Para todo ello en la edificacin que se proyecta:
Se disponen todos los medios de evacuacin y los equipos de instalaciones
adecuados para el control, extincin y aviso y alarma del incendio de origen
accidental para que sus ocupantes puedan abandonar o alcanzar un lugar
seguro dentro de la edificacin en condiciones de seguridad.
.
Los huecos exteriores garantizan el acceso al interior y cumplen las
condiciones de separacin que impidan la propagacin del fuego entre
sectores.
Los espacios exteriores inmediatamente prximos a la edificacin renen las
condiciones exigibles para la intervencin de los servicios de extincin de los
bomberos.
Toda la estructura portante de la edificacin se dimensiona para que
mantenga su resistencia al fuego durante un tiempo igual o superior necesario
al tiempo del sector de incendio de mayor resistencia, con el fin de que se
pueda
cumplir
las
prestaciones
anteriores.
No se prevn materiales que perjudiquen la seguridad de la edificacin o de
sus usuarios por su baja resistencia al fuego, combustibilidad o toxicidad.
No existen incompatibilidad de los usos previstos.
Seguridad de utilizacin y accesibilidad.
Se proyecta de acuerdo con los parmetros y procedimientos especificados
en el Documento Bsico DB-SUA Seguridad de Utilizacin y Accesibilidad, con
cuyo cumplimiento se satisfacen las exigencias bsicas y se superan los niveles
mnimos de calidad propios del requisito bsico de seguridad de utilizacin, con
el objetivo de reducir a lmites aceptables el riesgo de que los usuarios sufran
daos inmediatos durante el uso previsto del edificio, as como facilitar el
acceso y la utilizacin no discriminatoria, independiente y segura de los
usuarios con discapacidad, como consecuencia de las caractersticas de su
proyecto, construccin, uso y mantenimiento.

1.4.1.2.- HABITABILIDAD
Salubridad.
Se proyecta de acuerdo con los parmetros y procedimientos especificados
en el Documento Bsico DB-HS Salubridad, con cuyo cumplimiento se
satisfacen las exigencias bsicas y se superan los niveles mnimos de calidad
propios del requisito bsico de salubridad, con el objetivo de reducir a lmites
aceptables el riesgo de que los usuarios, dentro del edificio que se proyecta y
en condiciones normales de utilizacin, padezcan molestias o enfermedades,
as como el riesgo de que el edificio se deteriore y de que deteriore el medio
ambiente en su entorno inmediato, como consecuencia de las caractersticas
de su proyecto, construccin, uso y mantenimiento.
Proteccin frente al ruido.
Se proyecta de acuerdo con los parmetros y procedimientos especificados
en el Documento Bsico DB-HR Proteccin frente al ruido, con cuyo

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

cumplimiento se satisfacen las exigencias bsicas y se superan los niveles


mnimos de calidad propios del requisito bsico de proteccin frente al ruido,
con el objetivo de limitar, dentro del edificio que se proyecta y en condiciones
normales de utilizacin, el riego de molestias o enfermedades que el ruido
pueda producir a los usuarios, como consecuencia de las caractersticas de su
proyecto, construccin, uso y mantenimiento.
Ahorro de energa.
Se proyecta de acuerdo con los parmetros y procedimientos especificados
en el Documento Bsico DB-HE Ahorro de energa, con cuyo cumplimiento se
satisfacen las exigencias bsicas y se superan los niveles mnimos de calidad
propios del requisito bsico de ahorro de energa, con el objetivo de conseguir
un uso racional de la energa necesaria para la utilizacin del edificio que se
proyecta, reduciendo a lmites sostenibles su consumo y conseguir asimismo
que una parte de este consumo proceda de fuentes de energa renovable,
como consecuencia de las caractersticas de su proyecto, construccin, uso y
mantenimiento.

1.4.1.3.- FUNCIONALIDAD
Utilizacin.
Se proyecta una edificacin en la que la disposicin y las dimensiones de los
espacios y la dotacin de las instalaciones facilitan la adecuada realizacin de
las funciones previstas, por lo que se ha primado la reduccin de recorridos de
circulacin interior, evitando los espacios residuales como pasillos, con el fin de
que la superficie sea la necesaria y adecuada al programa requerido y las
dependencias, sus superficies y sus dimensiones cumplan con lo establecido en
las normas de habitabilidad vigentes.
Accesibilidad.
Se proyecta una edificacin en el que el acceso desde el exterior y el acceso
a las dependencias se han diseado de manera que se permite a las personas
con movilidad y comunicacin reducidas la circulacin por el edificio en los
trminos previstos en la normativa especfica.
Acceso a los servicios.
Se proyecta la edificacin de manera que se garantiza el acceso a los
servicios de telecomunicaciones, audiovisuales y de informacin de acuerdo
con lo establecido en su normativa especfica vigente. Se prevn en la zona de
acceso a la edificacin, la colocacin de casilleros postales adecuados al uso
de la misma.

1.4.2.- PRESTACIONES QUE SUPERAN EL CTE


En el presente proyecto, por expreso deseo del promotor, no se incluyen
prestaciones que superen los umbrales establecidos por el CTE, en relacin con
ninguno de los requisitos bsicos.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.4.3.- LIMITACIONES
Las limitaciones de uso de la edificacin que se proyecta respondern, en general, a
la adecuacin de las prestaciones y previsiones proyectadas en concordancia con
usos compatibles y del funcionamiento adecuado de sus estructura e instalaciones.
Por lo que el edificio en conjunto, todas y cada una de sus dependencias y todas y
cada una de sus instalaciones solo podrn destinarse a los usos previstos en el presente
proyecto. La dedicacin de algunas de sus dependencias a uso distinto del
proyectado requerir de un proyecto de reforma y cambio de uso que ser objeto de
licencia nueva. Este cambio de uso ser posible siempre y cuando el nuevo destino no
altere las condiciones del resto del edificio ni sobrecargue las prestaciones iniciales del
mismo en cuanto a estructura, instalaciones, etc, lo que implicar la comprobacin de
que los parmetros de utilizacin siguen siendo vlidos para el nuevo uso pretendido.

Julio de 2.011

Pedro Enrique Santos Buenda


Arquitecto

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.- MEMORIA CONSTRUCTIVA


ndice
2.0.- DEMOLICIN
2.1.- SUSTENTACION DEL EDIFICIO
2.1.1.- JUSTIFICACION DE LAS CARACTERISTICAS DEL SUELO
2.1.2.- BASES DE CALCULO

2.2.- SISTEMA ESTRUCTURAL


2.2.1.- CIMENTACION
2.2.2.- ESTRUCTURA PORTANTE
2.2.3.- ESTRUCTURA HORIZONTAL

2.3.- SISTEMA ENVOLVENTE


2.3.1.- CERRAMIENTOS DE SEPARACION CON EL AIRE EXTERIOR
2.3.1.1.- FACHADAS
2.3.1.2.- CUBIERTAS
2.3.2.- CERRAMIENTOS DE SEPARACION CON EL TERRENO
2.3.3.- CERRAMINETOS DE SEPARACION CON OTROS EDIFICIOS

2.4.- SISTEMA DE COMPARTIMENTACION


2.4.1.- PARTICIONES VERTICALES
2.4.2.- PARTICIONES HORIZONTALES

2.5.- SISTEMA DE ACABADOS


2.6.- SISTEMA DE ACONDICIONAMIENTO E INSTALACIONES
2.6.1.- PROTECCION CONTRA INCENDIOS
2.6.2.- ELECTRICIDAD
2.6.3.- ALUMBRADO
2.6.4.- FONTANERIA
2.6.5.- EVACUACION RESIDUOS SOLIDOS Y LIQUIDOS
2.6.6.- VENTILACION
2.6.7.- ANTI-INTRUSION
2.6.8.- TRANSPORTE
2.6.9.- SUMINISTRO DE COMBUSTIBLES
2.6.10.- INSTALACIONES TERMICAS Y SU RENDIMIENTO
2.6.11.- INCORPORACION DE ENERGIA SOLAR TERMICA O FOTOVOLTAICA

2.7.- EQUIPAMIENTO

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.0.- DEMOLICIN
La demolicin de la edificacin existente se realizar de manera general por medios
mecnicos con el empleo de retroexcavadora y, en las zonas sensibles (medianeras,
elementos estructurales empotrados en muros, elementos a recuperar, etc), por
medios manuales empleando pequea maquinaria y herramientas de mano; todo
con las necesarias medidas de seguridad para los operarios y realizndose los apeos
oportunos para seguridad de las edificaciones prximas.
Se proceder de la siguiente forma:
Se levantar manualmente la cubricin de teja que se acopiar en lugar
seguro.
Se levantarn las carpinteras
acopindola en lugar seguro.

cerrajeras

que

se

quieran

reutilizar,

Se demolern los forjados, comenzando en la zona central y reservando las


zonas prximas a las edificaciones colindantes, que se demolern
manualmente.
Se demolern mecnicamente los muros exteriores e interiores y la tabiquera,
comenzando por la zona central y reservando las zonas prximas a las
edificaciones colindantes, que se demolern manualmente.
Los escombros se retirarn diariamente y se mantendrn en correcto estado de
limpieza los espacios anejos a la obra.
Se cumplir el Plan de Gstin de Residuos anejo a este proyecto.

2.1.- SUSTENTACION DEL EDIFICIO


A continuacin se describen las caractersticas del suelo y se exponen los parmetros
a considerar para el clculo de la parte del sistema estructural correspondiente a la
cimentacin.
2.1.1.- JUSTIFICACION DE LAS CARACTERISTICAS DEL SUELO
El anlisis y dimensionado de la cimentacin exige el conocimiento de las
caractersticas del terreno de apoyo, la tipologa del edificio previsto y el entorno
donde se ubica la construccin. Por tal motivo, al no contar con un estudio geolgicogeotcnico del terreno donde se va a cimentar, se ha realizado un reconocimiento
inicial del mismo y basndonos en la experiencia de las obras y edificaciones de
reciente construccin colindantes y cercanas a la que se proyecta, se deduce que el
terreno, a una profundidad de 1,00 metros a la cual se empotrarn las zapatas, est
formado por materiales arcillosos de consistencia dura y naturaleza compacta con
una tensin admisible estimada de 0,10N/mm y una expansividad baja y no se prev
la presencia de agua.
Estas previsiones se comprobarn con la realizacin del oportuno estudio geolgicogeotcnico del terreno antes del inicio de las obras.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.1.2.- BASES DE CALCULO


El mtodo de clculo aplicado es de los Estados Lmites, en el que se pretende limitar
que el efecto de las acciones exteriores, ponderadas por unos coeficientes, sea inferior
a la respuesta de la estructura, previa minoracin de la resistencia de los materiales de
sta. Se considerarn las acciones que actan sobre la edificacin segn el DB-SE-AE,
y las acciones geotcnicas que transmiten o generan a travs del terreno en que se
apoya segn la NCSE-02.

2.2.- SISTEMA ESTRUCTURAL


A continuacin se establecen los datos e hiptesis de partida, el programa de
necesidades, las bases de clculo y procedimientos o mtodos empleados, as como
las caractersticas de los materiales que intervienen, para todo el sistema estructural.

2.2.1.- CIMENTACION
Datos e hiptesis de partida: Para el anlisis y dimensionamiento de la cimentacin
se toma como datos de partida los expuestos en el apartado anterior, adems de el
conocimiento de la tipologa del edificio previsto y el entorno donde se ubica la
construccin.
Programa de necesidades: Se prev una cimentacin superficieal formada por
zapatas continuas y aisladas de hormign armado, todo para al apoyo de la
estructura portante que se describe en el siguiente punto.
.
Bases de clculo: Atendiendo al estudio realizado en el terreno sobre el que se
cimentar, se adopta como resistencia del terreno en el presente proyecto para el
clculo de la cimentacin 0,1N/mm.
.
Procedimientos o mtodos empleados: El dimensionado de secciones se realiza
segn la Teora de los Estados Lmites ltimos (apartado 3.2.1 DB-SE) y los Estados Lmites
de Servicio (apartado 3.2.2 DB-SE). El comportamiento de la cimentacn debe
comprobarse frente a la capacidad portante (resistencia y estabilidad) y la aptitud de
servicio.
Caractersticas de los materiales que intervienen: Hormign armado tipo HA25/B/4o/IIa, de 25N/mm de resistencia caracterstica a los 28 das y con acero en
barras tipo B-500-S.

2.2.2.- ESTRUCTURA PORTANTE


- Pilares de hormign armado:
Datos e hiptesis de partida: Hiptesis y combinaciones. De acuerdo con las
acciones determinadas en funcin de su variacin en el tiempo, su naturaleza, su
variacin espacial y la respuesta estructural, as como los coeficientes de seguridad se
realizar el clculo de las combinaciones oportunas.
.
Programa de necesidades: Soportes de hormign armado con seccin cuadrangular
o circular.
.
Bases de clculo: Para la obtencin de las solicitaciones se han considerado los

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

principios de la Mecnica Racional y las teoras clsicas de la Resistencia de Materiales


y Elasticidad. El mtodo de clculo aplicado es de los Estados Lmites, en el que se
pretende limitar que el efecto de las acciones exteriores ponderadas por unos
coeficientes, sea inferior a la respuesta de la estructura, minorando las resistencias de
los materiales. En los estados lmites ltimos se comprueban los correspondientes a:
equilibrio, agotamiento o rotura, adherencia, anclaje y fatiga (si procede). En los
estados limites de utilizacin se comprueba: deformaciones (flechas) y vibraciones (si
procede). Definidos los estados de carga segn su origen, se procede a calcular las
combinaciones posibles con los coeficientes de mayoracin y minoracin
correspondientes de acuerdo a los coeficientes de seguridad y las hiptesis bsicas
definidas en la norma. La obtencin de los esfuerzos en las diferentes hiptesis simples
del entramado estructural, se han realizado de acuerdo a un clculo lineal de primer
orden, es decir admitiendo proporcionalidad entre esfuerzos y deformaciones, el
principio de superposicin de acciones, y un comportamiento lineal y geomtrico de
los materiales y la estructura. Para la obtencin de las solicitaciones determinantes en
el dimensionado de los elementos de los forjados (vigas, viguetas, losas, nervios) se
obtienen los diagramas envolventes para cada esfuerzo. Para el dimensionado de los
soportes se comprueban para todas las combinaciones definidas. Resistencia de
clculo del hormign fcd=16,66N/mm. Resistencia de clculo del acero
fyd=474,38N/mm.
Procedimientos o mtodos empleados: El mtodo de clculo aplicado es de los
Estados Lmites, en el que se pretende limitar que el efecto de las acciones exteriores
ponderadas por unos coeficientes, sea inferior a la respuesta de la estructura,
.
minorando las resistencias de los materiales.
Caractersticas de los materiales que intervienen: Pilares de hormign armado tipo
HA-25/B/20/IIa de 25N/mm de resistencia caracterstica a los 28 das con acero en
barras tipo B-500-S.

- Muros resistentes:
Datos e hiptesis de partida: Hiptesis y combinaciones. De acuerdo con las
acciones determinadas en funcin de su variacin en el tiempo, su naturaleza, su
variacin espacial y la respuesta estructural, as como los coeficientes de seguridad se
realizar el clculo de las combinaciones oportunas.
.
Programa de necesidades: Muros resistentes de una hoja.
.
Bases de clculo: Para la obtencin de las solicitaciones se han considerado los
principios de la Mecnica Racional y las teoras clsicas de la Resistencia de Materiales
y Elasticidad. El mtodo de clculo aplicado es de los Estados Lmites, en el que se
pretende limitar que el efecto de las acciones exteriores ponderadas por unos
coeficientes, sea inferior a la respuesta de la estructura, minorando las resistencias de
los materiales. En los estados lmites ltimos se comprueban los correspondientes a:
equilibrio, agotamiento o rotura, adherencia, anclaje y fatiga (si procede). En los
estados limites de utilizacin se comprueba: deformaciones (flechas) y vibraciones (si
procede). Definidos los estados de carga segn su origen, se procede a calcular las
combinaciones posibles con los coeficientes de mayoracin y minoracin
correspondientes de acuerdo a los coeficientes de seguridad y las hiptesis bsicas
definidas en la norma. La obtencin de los esfuerzos en las diferentes hiptesis simples
del entramado estructural, se han realizado de acuerdo a un clculo lineal de primer
orden, es decir admitiendo proporcionalidad entre esfuerzos y deformaciones, el
principio de superposicin de acciones, y un comportamiento lineal y geomtrico de
los materiales y la estructura. El dimensionado de los soportes se comprueban para
todas las combinaciones definidas. La estructura de muros se disea para resistir
esfuerzos laterales, de acuerdo con clculos de estabilidad global.Resistencia
caracterstica a compresin fk=4.00N/mm.
.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Procedimientos o mtodos empleados: El mtodo de clculo aplicado es de los


Estados Lmites, en el que se pretende limitar que el efecto de las acciones exteriores
ponderadas por unos coeficientes, sea inferior a la respuesta de la estructura,
minorando las resistencias de los materiales.
.
Caractersticas de los materiales que intervienen: Fbrica de bloque cermico
tomados con mortero de cemento tipo M5. Resistencia de la pieza de bloque
cermico fb=10N/mm2. Resistencia del mortero fm=5.00N/mm.

2.2.3.- ESTRUCTURA HORIZONTAL


Datos e hiptesis de partida: Hiptesis y combinaciones. De acuerdo con las
acciones determinadas en funcin de su variacin en el tiempo, su naturaleza, su
variacin espacial y la respuesta estructural, as como los coeficientes de seguridad se
.
realizar el clculo de las combinaciones oportunas.
Programa de necesidades: Forjados unidireccionales semiempotrados en prticos
planos de hormign armado realizados in situ y apoyados en muros resistentes de
fbrica de bloque cermico.
.
Bases de clculo: Para la obtencin de las solicitaciones se han considerado los
principios de la Mecnica Racional y las teoras clsicas de la Resistencia de Materiales
y Elasticidad. El mtodo de clculo aplicado es de los Estados Lmites, en el que se
pretende limitar que el efecto de las acciones exteriores ponderadas por unos
coeficientes, sea inferior a la respuesta de la estructura, minorando las resistencias de
los materiales. En los estados lmites ltimos se comprueban los correspondientes a:
equilibrio, agotamiento o rotura, adherencia, anclaje y fatiga (si procede). En los
estados lmites de utilizacin se comprueba: deformaciones (flechas) y vibraciones (si
procede).Definidos los estados de carga segn su origen, se procede a calcular las
combinaciones posibles con los coeficientes de mayoracin y minoracin
correspondientes de acuerdo a los coeficientes de seguridad y las hiptesis bsicas
definidas en la norma. La obtencin de los esfuerzos en las diferentes hiptesis simples
del entramado estructural, se han realizado de acuerdo a un clculo lineal de primer
orden, es decir admitiendo proporcionalidad entre esfuerzos y deformaciones, el
principio de superposicin de acciones, y un comportamiento lineal y geomtrico de
los materiales y la estructura. Para la obtencin de las solicitaciones determinantes en
el dimensionado de los elementos de los forjados (vigas, viguetas, losas) se obtienen los
diagramas envolventes para cada esfuerzo. Resistencia de clculo del hormign
fcd=16.66N/mm.
Resistencia
de
clculo
del
acero
fyd=434.78N/mm.
Procedimientos o mtodos empleados: El mtodo de clculo aplicado es de los
Estados Lmites, en el que se pretende limitar que el efecto de las acciones exteriores
ponderadas por unos coeficientes, sea inferior a la respuesta de la estructura,
minorando las resistencias de los materiales.
.
Caractersticas de los materiales que intervienen: Semiviguetas pretensadas,
bovedillas aligerantes de hormign vibrado de 25cm de canto, hormign armado tipo
HA-25/B/20/IIa de 25N/mm de resistencia caracterstica a los 28 das con acero en
barras tipo B-500-S y mallazo electrosoldado stipo B-500-T.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.3.- SISTEMA ENVOLVENTE


En este apartado se definen los distintos cerramientos verticales y horizontales que
forman la envolvente edificatoria, entendiendo como tales, conforme al Apndice
A: Terminologa del Documento Bsico HE1, los elementos constructivos del edificio
que lo separan del exterior, ya sea aire, terreno u otros edificios". Se describe su
comportamiento frente a las acciones a las que estn sometidos (peso propio, viento,
sismo, etc), frente al fuego, seguridad de uso, evacuacin de agua y comportamiento
frente a la humedad, aislamiento acstico y aislamiento trmico, y sus bases de
clculo. As mismo se definen el aislamiento trmico de dichos subsistemas, la
demanda energtica mnima prevista del edificio para condiciones de verano e
invierno y su eficiencia energtica en funcin del rendimiento energtico de las
instalaciones, proyectado.

2.3.1.- CERRAMIENTOS DE SEPARACION CON EL AIRE EXTERIOR


2.3.1.1.- FACHADAS
CERRAMIENTO DE FACHADA SEXT0: Bloque cermico aligerado 29 cm sin aislante.
Cerramiento vertical para fachada de una hoja sin aislante, formado por
revestimiento exterior de enfoscado de mortero de cemento, fbrica de bloques
cermicos aligerados tomados con mortero de cemento y revestimiento interior de
guarnecido y enlucido de yeso.
Listado de capas:
1- Mortero de cemento o cal para albaileria
1.50cm
d=1900
2- Fbrica de bloque cermico aligerado 29cm
29.00cm
3- Guarnecido y enlucido de yeso d<1000
1.50cm
Espesor total 32.00cm
Proteccin en caso de incendio:
Resistencia al fuego
>El 60
Proteccin frente al ruido:
Masa (kg/m): 335.00
RA- ndice global de reduccin acstica,
51.00
ponderado A (dBA) :
Limitacin de la demanda energtica:
Resistencia Trmica R (mK/W):
0.808
Transmitancia trmica U (W/mK):
1.022
Proteccin frente a la humedad:
Grado de impermeabilidad alcanzado:
3
Solucin adoptada: R1+C2

HUECO VERTICAL SEXT52: Ventana/puerta acristalada <2.70 m2, con marco metlico y
con rotura de puente trmico 4<d<12mm.
.
Hueco vertical para ventana/puerta acristalada con una superficie menor o igual a
2.70 m2, retranqueada 20cm desde la lnea exterior de la fachada, marco de aluminio
color oscuro, doble acristalamineto de vidrio normal incoloro 4+6+4, con rotura de
puente trmico 4<d<12mm y capialzado interior con aislante.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Limitacin de la demanda energtica:


Fraccin de marco:
Absortividad (color marco):
Fh/Fs (factor solar modificado/factor sombra):
Permeabilidad:
Transmitancia Hueco Uh (W/mk):
Transmitancia Marco Um (W/mk):
Proteccin frente al ruido:
RA - ndice global de reduccin acstica, ponderado A (dBA):
RA,tr - Mejora del ndice global de reduccin acstica,
ponderado A (dBA):
RA,tr - Mejora del ndice global de reduccin acstica,
ponderado A para el capialzado (dBA):

20%
0.80
0.63
Clase 3
3.4
4
31
27
30

Para huecos con superficie mayores


se aplicarn los siguientes factores de correccin sobre RA y RA,tr:
- 2.70 m2<S>3.60 m2: -1 dB
- 3.60 m2<S<4.6 m2: -2 dB
- 4.60 m2<S: -3 dB

2.3.1.2.- CUBIERTAS
CUBIERTA INCLINADA CONVENCIONAL SEXT21: Cubierta inclinada de teja mixta con
cmara
de
aire
ventilada
sobre
forjado
unidireccional
horizontal.
Cubierta inclinada convencional formada por teja cermica mixta, mortero de agarre,
lmina de proteccin, impermeabilizante (lmina asfltica de betn modificado de
4kg/cm2), mortero de regularizacin, tablero de rasillones cermicos, tabiques
aligerados de fbrica de ladrillos huecos para formacin de pendientes, cmara de
aire ligeramente ventilada, aislante de lana mineral, forjado unidireccional de
hormign armado con entrevigado de hormign y revestimiento de enlucido de yeso.
Listado de capas:
1- Teja cermica mixta
1.00cm
2- Mortero de cemento o cal para albailera d=1900
2.00cm
3- Lmina geotextil
0.50cm
4- Impermeabilizante (lmina betn modificado 4kg/cm2) 0.50cm
5- Mortero de cemento o cal para albailera d=1900
1.50cm
6- Tablero de rasillones cermicos
4.00cm
7- Cmara de aire lijramente ventilada
40.00cm
8- Aislante MW Lana mineral [0.031 W/[mk]]
5.00cm
9- Forjado unidireccional hormign armado
30.00cm
10- Guarnecido y enlucido de yeso d<1000
1.50cm
Espesor total 86.00cm
Proteccin en caso de incendio:
Resistencia al fuego: >El 60
Proteccin frente al ruido:
Masa (kg/m): 506.00
RA- ndice global de reduccin acstica, ponderado A
52.00
(dBA):
Limitacin de la demanda energtica:
Resistencia Trmica R (mK/W):
2.215
Transmitancia trmica U (W/mK):
0.424
Proteccin frente a la humedad:
Grado de impermeabilidad: nico

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.3.2.- CERRAMIENTOS DE SEPARACION CON EL TERRENO


SOLERA HORMIGN ST1: Solera de hormign pavimentada sobre encachado.
Cerramiento horizontal de separacin del terreno, formado por encachado de piedras
calizas, lmina impermeabilizante, solera de hormign ligeramente armado, cama de
arena, mortero de agarre y pavimento de baldosa de gres.

Listado de capas:
1- Baldosa de gres (slice) d<2200 kg/m3
1.00cm
2- Mortero de cemento o cal para albaileria d=1900
3.00cm
3- Cama de arena 1700<d>2200
5.00cm
4- Solera de hormign armado 2300<d>2500
15.00cm
5- Lmina polietileno alta densidad (HDPE)
0.70cm
6- Encachado roca caliza dureza media
20.00cm
Espesor total:
44.70cm
Masa (kg/m):
744.60
Limitacin de la demanda energtica:
Resistencia Trmica R (mK/W):
0.275
Transmitancia trmica U (W/mK):
2.061
Proteccin frente a la humedad:
Presencia de agua:
Baja
Grado de impermeabilidad alcanzado:
2
Solucin adoptada: C2+C3+D1

2.3.3.- CERRAMINETOS DE SEPARACION CON OTROS EDIFICIOS


CERRAMIENTO
DE
MEDIANERA
SEDF2:
Bloque
cermico
24cm.
Cerramiento vertical de una hoja, formado por fbrica de bloques cermicos
aligerados de 24cm de espesor, tomados con mortero de cemento y revestimiento
exterior de mortero de cemento e interior de guarnecido y enlucido de yeso.
Listado de capas:
1- Mortero de cemento o cal para albaileria d=1900
1.50cm
2- 1 pie fbrica de bloque cermico aligerado
24.00cm
3- Guarnecido y enlucido de yeso d<1000
1.50cm
Espesor total: 27.00cm
Proteccin en caso de incendio:
Resistencia al fuego: >El 120
Proteccin frente al ruido:
Masa (kg/m): 303.60
RA- ndice global de reduccin acstica, ponderado A
52.00
(dBA):
Limitacin de la demanda energtica:
Resistencia Trmica R (mK/W):
0.615
Transmitancia trmica U (W/mK):
1.274
Proteccin frente a la humedad:
Grado de impermeabilidad alcanzado:
3

Solucin adoptada:

Pedro Enrique Santos Buenda______________________Arquitecto

R1+C2

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.4.- SISTEMA DE COMPARTIMENTACION


A continuacin se definen los elementos de particin, entendiendo como tales,
conforme al Apndice A: Terminologa del Documento Bsico HE1, los elementos
constructivos del edificio, tanto verticales como horizontales, que dividen su interior en
recintos independientes. Se especifica su comportamiento ante el fuego y su
aislamiento acstico y, en su caso, otras caractersticas que sean exigibles.

2.4.1.- PARTICIONES VERTICALES


PARTICIN VERTICAL PV1: Tabicn de ladrillo hueco.
.
Particin interior vertical de una hoja, formada por fbrica de ladrillos cermicos
huecos dobles colocados a tabicn tomados con mortero de cemento y revestimiento
de guarnecido y enlucido de yeso en ambas caras.
Listado de capas:
1- Guarnecido y enlucido de yeso d<1000
1.50cm
2- F.L.H.D. a tabicn
7.00cm
3- Guarnecido y enlucido de yeso d<1000
1.50cm
Espesor total: 10.00cm
Proteccin en caso de incendio:
Resistencia al fuego:
>El 60
Proteccin frente al ruido:
Masa (kg/m):
92.10
RA- ndice global de reduccin acstica, ponderado
36.00
A (dBA):
Limitacin de la demanda energtica:
Resistencia Trmica R (mK/W):
0.237
Transmitancia trmica U (W/mK):

2.457

PARTICIN VERTICAL PV2: 1/2 pie de ladrillo hueco


.
Particin interior vertical de una hoja, formada por fbrica de ladrillos cermicos
huecos dobles de 1/2 pie de espesor, tomados con mortero de cemento y
revestimientos de guarnecido y enlucido de yeso en ambas caras.
Listado de capas:
1- Guarnecido y enlucido de yeso d<1000
2- F.L.H.D. a tabicn
3- Guarnecido y enlucido de yeso d<1000

1.50cm
11.50cm
1.50cm
Espesor total: 14.50cm

Proteccin en caso de incendio:


Resistencia al fuego:

>El 60

Masa (kg/m):
RA- ndice global de reduccin acstica, ponderado A
(dBA):
Limitacin de la demanda energtica:
Resistencia Trmica R (mK/W):

140.30

Transmitancia trmica U (W/mK):

2.033

Proteccin frente al ruido:

Pedro Enrique Santos Buenda______________________Arquitecto

40.00
0.321

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

PARTICIN VERTICAL PV3: 1/2 pie ladrillo perforado.


.
Particin interior vertical de una hoja, formada por fbrica de ladrillos cermicos
perforados de 1/2 pie de espesor, tomados con mortero de cemento y revestimientos
de guarnecido y enlucido de yeso en ambas caras.

Listado de capas:
1- Guarnecido y enlucido de yeso d<1000
2-1/2 pie de F.L.H.Perforado
3- Guarnecido y enlucido de yeso d<1000

1.50cm
11.50cm
1.50cm
Espesor total: 14.50cm

Proteccin en caso de incendio:


Resistencia al fuego:

>El 60

Masa (kg/m):
RA- ndice global de reduccin acstica, ponderado A (dBA):
Limitacin de la demanda energtica:
Resistencia Trmica R (mK/W):

166.70
44.00

Transmitancia trmica U (W/mK):

1.717

Proteccin frente al ruido:

0.235

2.4.2.- PARTICIONES HORIZONTALES


PARTICIN HORIZONTAL PH1: Forjado unidireccional 30cm, pavimento y aislante.
Particin interior horizontal, formada por baldosa cermica de gres, mortero de agarre
y regularizacin, aislante trmico-acstico de lana mineral, forjado unidireccional de
de hormign armado y revestimiento de enlucido de yeso.

Listado de capas:
1- Baldosa de gres (Slice) d<2200 m3
2- Mortero de cemento o cal para albailera
3- Aislante MW Lana mineral [0.031 W/[mk]]
4- Forjado unidireccional hormign armado
5- Guarnecido y enlucido de yeso d<1000

1.00cm
5.00cm
5.00cm
30.00cm
1.50cm
Espesor total: 42.50cm

Proteccin en caso de incendio:


Resistencia al fuego:

>El 60

Masa (kg/m):
RA- ndice global de reduccin acstica, ponderado A (dBA):
RA,EB- ndice global de reduccin acstica, ponderado A
para el elmento base(dBA):
Ln,w- Nivel global de presin de ruido de impactos (dB):
Limitacin de la demanda energtica:
Resistencia Trmica R (mK/W):
Transmitancia trmica U (W/mK):

420.10
60.00

Proteccin frente al ruido:

Pedro Enrique Santos Buenda______________________Arquitecto

44.00
37.00
2.018
0.449

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.5.- SISTEMA DE ACABADOS


A continuacin se indican las caractersticas y prescripciones de los acabados de los
paramentos a fin de cumplir con los requisitos de funcionalidad, seguridad y
habitabilidad.
Paramentos exteriores
-Fachadas:
Revoco de mortero de cemento M5 maestreado y fratasado de 15 mm de espesor,
realizado in situ sobre fbrica. Pintado con pintura plstica lisa para exteriores.
-Medianeras:
Revoco de mortero de cemento realizado in situ sobre fbrica, maestreado y
fratasado de 15 mm de espesor. Pintado con pintura plstica lisa para exteriores.
-Suelos:
Pavimento de baldosa cermica de gres (slice) rstico antideslizante colocada sobre
la formacin de pendientes mediante mortero-cola adhesivo.
Paramentos interiores
-Paredes:
General: Guarnecido y enlucido de yeso-perlita de 15 mm de espesor total,
maestreado y con malla de refuerzo en encuentros y guardavivo en aristas. Pintura
.
plstica lisa previa preparacin del soporte.
Cocina y baos: Alicatado con azulejo cermico sobre enfoscado rugoso mediante
adhesivo cementoso C1 y mortero de juntas hasta 1.50m de altura y guarnecido y
enlucido de yeso-perlita de 15 mm de espesor total, maestreado y con malla de
refuerzo en encuentros y guardavivo en aristas y pintura plstica lisa desde 1.50m de
altura hasta el techo.
.
Garaje: Guarnecido y enlucido de yeso-perlita de 15 mm de espesor total, maestreado
y con malla de refuerzo en encuentros y guardavivo en aristas. Pintura plstica lisa
previa preparacin del soporte
..
-Techos:
General: Guarnecido y enlucido de yeso-perlita de 15 mm de espesor total,
maestreado y con malla de refuerzo en encuentros y guardavivo en aristas. Pintura
plstica lisa previa preparacin del soporte
..
Cocina, bao y aseo: Guarnecido y enlucido de yeso-perlita de 15 mm de espesor
total, maestreado y con malla de refuerzo en encuentros y guardavivo en aristas.
Pintura
plstica
lisa
previa
preparacin
del
soporte.
Garaje: Guarnecido y enlucido de yeso-perlita de 15 mm de espesor total, maestreado
y con malla de refuerzo en encuentros y guardavivo en aristas. Pintura plstica lisa
previa preparacin del soporte.
.
-Suelos:
General: Pavimento de baldosa rstica de barro cocido y pulido, colocada sobre la
capa de mortero mediante adhesivo cementoso C1 y mortero de juntas.
Garaje: Pavimento de baldosa cermica de gres (slice) esmaltada, colocada sobre la
capa de mortero mediante adhesivo cementoso C1 y mortero de juntas.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.6.- SISTEMA DE ACONDICIONAMIENTO E INSTALACIONES


En este aparatado se indican los datos de partida, los objetivos a cumplir, las
prestaciones y las bases de clculo para los subsistemas siguientes:

2.6.1.- PROTECCION CONTRA INCENDIOS


-Datos de partida:
Uso principal del edificio proyectado: Residencial unifamiliar.
Usos secundarios: Aparcamiento
Altura de evacuacin descendente:3.00m
Altura de evacuacin ascendente: No procede

.
.
.
.

-Objetivos:
El objetivo a cumplir consiste en reducir a lmites aceptables el riesgo de que los
usuarios del edificio sufran daos derivados de un incendio de origen accidental,
como consecuencia de las caractersticas de su proyecto, construccin, uso y
mantenimiento.
-Prestaciones:
Se limita el riesgo de propagacin del incendio por el interior del edificio proyectado.
Se limitar riesgo de propagacin del incendio por el exterior, tanto en el edificio
proyectado como a otros edificios.
.
Se dota al edifico que se proyecta de los medios de evacuacin adecuados para que
sus ocupantes puedan abandonarlo o alcanzar un lugar seguro dentro del mismo en
.
condiciones de seguridad.
El edificio que se proyecta dispone de los equipos e instalaciones adecuados para
hacer posible la deteccin, el control y la extincin del incendio, as como la
transmisin de la alarma a los ocupantes.
.
Se facilita la intervencin de los equipos de rescate y de extincin de incendios.
La estructura portante se proyecta para que mantenga su resistencia al fuego
durante el tiempo necesarios para que puedan cumplirse las anteriores exigencias
bsicas.
-Bases de clculo:
.
Los medios de evacuacin y las instalaciones de proteccin contra incendios se
proyectan tomando como base los parmetros objetivos y los procedimientos
especificados en el documento bsico DB SI Proteccin contra incendios, con lo que
se satisfacen las exigencias bsicas y se superan los niveles mnimos de calidad del
requisito bsico de seguridad en caso de incendio.

2.6.2.- ELECTRICIDAD
-Datos de partida:
Viviendas: 1 con electrificacin elevada (9.200w)
Aparcamientos:1
Locales: 0
-Objetivos:
El objetivo a cumplir consiste en el cumplimiento del Reglamento Electrotcnico de
Baja Tensin e Instrucciones Tcnicas Complementarias.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

-Prestaciones:
Se garantiza el buen funcionamiento de la instalacin, limitndose el riesgo de los
usuarios a sufrir daos por el uso normal de la misma, as como evitando las
perturbaciones en otras instalaciones y servicios del edificio que se proyecta.
-Bases de clculo:
.
El diseo y dimensionamiento de la instalacin elctrica se realiza en base a las
prescripciones del Reglamento Electrotcnico de Baja Tensin e Instrucciones Tcnicas
Complementarias (REBT-2002) y otras normas de aplicacin relativas a las instalaciones
elctricas en edificios.

2.6.3.- ALUMBRADO
-Datos de partida:
Uso del edifico proyectado: Residencial unifamiliar
Nivel mnimo de iluminacin:
Escaleras interiores uso exclusivo personas: 75 lux
Resto zonas interiores uso exclusivo personas: 50 lux
Interior uso aparcamiento o mixto: 50 lux
-Objetivos:
El objetivo a cumplir consiste en reducir a lmites aceptables el riesgo de que los
usuarios sufrn daos inmediatos durante el uso previsto del edifico que se proyecta,
como consecuencia de las caractersticas de su proyecto, construccin, uso y
mantenimiento.
-Prestaciones:
Se limita el riesgo de daos a las personas como consecuencia de una iluminacin
inadecuada en zonas de circulacin de los edificios, tanto interiores como exteriores,
incluso en caso de emergencia o de fallo de alumbrado.
.
-Bases de clculo:
El diseo y dimensionamiento de las instalaciones de alumbrado se realiza en base al
documento bsico DB SU4 Seguridad frente al riesgo causado por iluminacin
inadecuada, al y al Reglamento Electrotcnico de Baja Tensin y al documento
bsico DB HE3 Eficiencia energtica de las instalaciones de iluminacin.

2.6.4.- FONTANERIA
-Datos de partida:
N de suministros del edificio: 1 vivienda, 1 aparcamiento
Origen del abastecimiento: Red general municipal

.
.

-Objetivos:
El objetivo a cumplir consiste en que la instalacin de fontanera cumpla con el
documento bsico DB HS 4 Suministro de Agua.
-Prestaciones:
La instalacin proporciona el suministro de agua potable adecuado y suficiente para
los consumos previstos en el edifico que se proyecta.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

-Bases de clculo:
.
El diseo y dimensionamiento de la instalacin de fontanera se realiza en base a los
parmetros especificados en el documento bsico DB HS 4 Suministro de Agua,
apartados 3 y 4.

2.6.5.- EVACUACION RESIDUOS SOLIDOS Y LIQUIDOS


-Datos de partida:
Unidades de evacuacin del edificio:1 vivienda, 1 aparcamiento
Red de ingerencia: Red mixta de alcantarillado municipal, D=315mm
-Objetivos:
El objetivo consiste en que la instalacin de evacuacin cumpla con el documento
bsico DB HS 5 Evacuacin de Aguas.
-Prestaciones:
El edificio que se proyecta dispone de instalacin de evacuacin, con redes
independientes para aguas residuales y pluviales, que extraen de forma segura y
saludable las aguas residuales generadas en el edificio y las aguas pluviales recogidas
en ste.
-Bases de clculo:
.
El diseo y dimensionamiento de la instalacin de evacuacin se realiza en base a los
parmetros especificados en el documento bsico DB HS 5 Evacuacin de Aguas,
apartados 3 y 4.

2.6.6.- VENTILACION
-Datos de partida:
Zona trmica: Z
N plantas del edificio: 2
-Objetivos:
El objetivo consiste en limitar el riesgo de contaminacin del aire interior del edificio y
del entorno exterior en fachadas y patios, cumpliendo con los requisitos del
documento bsico DB HS 3 Calidad del Aire Interior.
-Prestaciones:
El edificio que se proyecta dispone de los sistemas de ventilacin oportunos para que
sus recintos se puedan ventilar adecuadamente, eliminando los contaminantes que se
producen de forma habitual durante el uso normal del edificio, de forma que se
aporta un caudal suficiente de aire exterior y se garantiza la extraccin y expulsin del
aire viciado por los contaminantes.
-Bases de clculo:
El diseo y dimensionamiento del sistema de ventilacin se realiza en base a los
parmetros especificados en el documento bsico DB HS 3 Calidad del aire interior,
apartados 3 y 4.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.6.7.- ANTI-INTRUSION
No se prev ningn sistema o instalacin anti-intrusin en la edificacin que se
proyecta, si bien se dotar de rejas en los huecos exteriores indicados en los planos
correspondientes y las mediciones adjuntas.

2.6.8.- TRANSPORTE
-Datos de partida:
N de plantas del edificio:2
N total de viviendas: 1
-Objetivos:
El objetivo a cumplir consiste en dotar al edificio que se proyecta de los medios de
transportes exigibles por la normativa que le es de aplicacin, adems de cumplir con
el documento bsico DB SUA 9 Accesibilidad.
-Prestaciones:
El edificio que se proyecta dispone de un ascensor accesible hidrulico para
transporte de las personas desde la entrada a la edificacin en planta baja y la
vivienda situada en la planta alta.
-Bases de clculo:
.
El diseo y dimensionamiento del ascensor se realiza en base a la normativa tcnica
de aplicacin y a los parmetros especificados en el documento bsico DB SUA 9

2.6.10.- INSTALACIONES TERMICAS Y SU RENDIMIENTO


-Datos de partida:
Las instalaciones trmicas previstas, de acuerdo con artculo 2 del RITE, son:
Calefaccin: No se proyecta
Refrigeracin: No se proyecta
Ventilacin: No se proyecta
Produccin de agua caliente sanitaria: Se proyecta
-Objetivos:
El objetivo consiste dotar al edificio que se proyecta de las instalaciones trmicas
destinadas a atender la demanda de bienestar e higiene de las personas, durante su
diseo y dimensionado, ejecucin, mantenimiento y uso.
-Prestaciones:
El edificio que se proyecta dispone de las instalaciones trmicas relacionas
anteriormente, atendiendo adecuadamente la demanda de bienestar e higiene de
los usuarios del edificio.
.
-Bases de clculo:
El diseo y dimensionamiento de las instalacin trmicas proyectadas se realiza en
base al 1027/2007, de 20 de julio, por el que se aprueba el Reglamento de
Instalaciones Trmicas en los Edificios (RITE) y al documento bsico DB HE 2
Rendimiento de las instalaciones trmicas del CTE.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.6.11.- INCORPORACION DE ENERGIA SOLAR TERMICA O FOTOVOLTAICA


-Datos de partida:
Zona climtica: IV
Caso: General
Demanda total A.C.S.: 50-5000 litros/da
Contribucin solar mnima: 60 %
-Objetivos:
El objetivo consiste dotar al edificio que se proyecta de la instalacin solar trmica que
optimice el ahorro energtico global de la instalacin en combinacin con el resto de
equipos trmicos, garantice una durabilidad y calidad suficientes y garantice un uso
seguro de la instalacin.
-Prestaciones:
El edificio que se proyecta dispone de las instalaciones trmicas relacionas
anteriormente, atendiendo adecuadamente la demanda de bienestar e higiene de
los usuarios del edificio.
-Bases de clculo:
.
El diseo y dimensionamiento de la instalacin solar trmica proyectada se realiza en
base al RD.1027/2007, de 20 de julio, por el que se aprueba el Reglamento de
Instalaciones Trmicas en los Edificios (RITE) y al documento bsico DB HE 4
Contribucin solar mnima de agua caliente sanitaria del CTE.
Nota Importante: Las placas solares para la instalacin solar trmica se colocarn en
lugar conveniente para que, cumpliendo su funcin, no sean visibles desde ningn
punto del exterior de la edificacin. Si esto no fuese posible y por su necesaria
ubicacin para que pueda cumplir su funcin sera visible (tal como lo impide el PGOU
de Ronda vigente), no se instalarn.

2.7.- EQUIPAMIENTO
La edificacin que se proyecta estar equipada en:
-Cocina, (recinto destinado a la elaboracin de alimentos y guarda y limpieza de los
enseres y utensilios necesarios para ello) con las tomas de las instalaciones de
electricidad, fontanera y desage correspondientes para una cocina-horno, para un
fregadero y un lavavajillas, para una lavadora y para un frigorfico.
-Bao/aseo, (recinto destinado a la higiene personal) con baera de chapa
esmaltada, lavabo, bid, inodoro con cisterna baja de porcelana sanitaria y grifera
monomando.

Julio de 2.011

Pedro Enrique Santos Buenda


Arquitecto
Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.- CUMPLIMIENTO DEL CTE


ndice
3.1.- DB SE SEGURIDAD ESTRUCTURAL
3.1.1.- SE-AE ACCIONES EN LA EDIFICACION
3.1.2.- SEC-C CIMENTACION
3.1.2.1.- BASES DE CALCULO
3.1.2.2.- JUSTIFICACION DE LAS CARACTERISTICAS DEL SUELO
3.1.2.3.- CIMENTACION
3.1.2.4.- ACONDICIONAMIENTO DEL TERRENO
3.1.3.- SE-f FABRICA

3.2.- DB SI SEGURIDAD EN CASO DE INCENDIO


3.2.1.- PROPAGACION INTERIOR
3.2.1.1.- COMPARTIMENTACION EN SECTORES DE INCENDIO
3.2.1.2.- ESPACIOS OCULTOS, PASO DE INSTALACIONES A TRAVES DE ELEMENTOS DE
COMPARTIMENTACION DE INCENDIOS
3.2.1.3.- REACCION AL FUEGO DE LOS ELEMENTOS CONSTRUCTIVOS, DECORATIVOS Y DE MOBILIARIO
3.2.2.- PROPAGACION EXTERIOR
3.2.2.1.- MEDIANERIAS Y FACHADAS
3.2.2.2.- CUBIERTAS
3.2.3.- EVACUACION DE OCUPANTES
3.2.3.1.- CALCULO DE LA OCUPACION
3.2.3.2.- DIMENSIONADO DE LOS MEDIOS DE EVACUACION
3.2.3.3.- PROTECCION DE LAS ESCALERAS
3.2.3.4.- PUERTAS SITUADAS EN RECORRIDOS DE EVACUACION
3.2.4.- DETECCION, CONTROL Y EXTINCION DEL INCENDIO
3.2.4.1.- DOTACION DE INSTALACIONES DE PROTECCION CONTRA INCENDIOS
3.2.5.- INTERVENCION DE LOS BOMBEROS
3.2.6.- RESISTENCIA AL FUEGO DE LA ESTRUCTURA

3.3.- DB SUA. SEGURIDAD DE UTILIZACION Y ACCESIBILIDAD


3.3.1.- SUA 1. SEGURIDAD FRENTE AL RIESGO DE CAIDAS
3.3.1.1.- DISCONTINUIDADES EN EL PAVIMENTO
3.3.1.2.- DESNIVELES
3.3.1.3.- ESCALERAS Y RAMPAS
3.3.1.3.1.- ESCALERAS DE USO RESTRINGIDO
3.3.1.4.- LIMPIEZA DE LOS ACRISTALAMIENTOS EXTERIORES
3.3.2.- SUA 2. SEGURIDAD FRENTE AL RIESGO DE IMPACTO O DE ATRAPAMIENTO
3.3.2.1.- IMPACTO
3.3.2.2.- ATRAPAMIENTO
3.3.3.- SUA 3. SEGURIDAD FRENTE AL RIESGO DE APRISIONAMIENTO EN RECINTOS
3.3.4.- SUA 4.SEGURIDAD FRENTE AL RIESGO CAUSADO POR ILUMINACION INADECUADA
3.3.4.1.- ALUMBRADO NORMAL EN ZONAS DE CIRCULACION
3.3.5.- SUA 8. SEGURIDAD FRENTE AL RIESGO CAUSADO POR LA ACCION DEL RAYO
3.3.6.- SUA 9. ACCESIBILIDAD

3.4.- DB HS. SALUBRIDAD


3.4.1.- HS1. PROTECCION FRENTE A LA HUMEDAD
3.4.1.1.- DISENO
3.4.2.- HS2. RECOGIDA Y EVACUACION DE RESIDUOS
3.4.2.1.- ESPACIO DE RESERVA
3.4.2.2.- ESPACIO DE ALMACENAMIENTO INMEDIATO EN LAS VIVIENDAS
3.4.3.- HS3. CALIDAD DEL AIRE INTERIOR
3.4.3.1.- DISENO
3.4.3.1.1.- CONDICIONES GENERALES DEL SISTEMA DE VENTILACION
3.4.3.1.1.1.- EN VIVIENDAS
3.4.3.1.1.2.- EN APARCAMIENTOS Y GARAJE
3.4.3.1.2.- CONDICIONES PARTICULARES DE LOS ELEMENTOS
3.4.3.2.- DIMENSIONADO
3.4.3.2.1.- VIVIENDAS
3.4.3.2.2.- APARCAMIENTOS Y GARAJES
3.4.3.3.- HS4. SUMINISTRO DE AGUA
3.4.3.3.1.- DISENO
3.4.3.3.1.1.- INSTALACION DE AGUA FRIA
3.4.3.3.1.1.1.- ACOMETIDA
3.4.3.3.1.1.2.- INSTALACION GENERAL
3.4.3.3.1.1.3.- INSTALACIONES PARTICULARES
3.4.3.3.1.2.- OTRAS CONDICIONES DE LA RED DE SUMINISTRO DE AGUA

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.4.3.3.1.3.- INSTALACION DE AGUA CALIENTE SANITARIA (A.C.S.)


3.4.3.3.2.- DIMENSIONADO
3.4.3.3.2.1.- ARMARIO PARA CONTADOR GRAL.
3.4.3.3.2.2.- REDES DE DISTRIBUCION
3.4.3.3.2.3.- EQUIPOS, ELEMENTOS Y DISPOSITIVOS DE LA INSTALACION
3.4.3.4.- HS5. EVACUACION DE AGUAS
3.4.3.4.1.- DISENO
3.4.3.4.1.1.- CONFIGURACION Y CONDICIONES GENERALES DE LA EVACUACION
3.4.3.4.1.2.- ELEMENTOS DE LA INSTALACION
3.4.3.4.1.3.- SUBSISTEMA DE VENTILACION DE LA INSTALACION
3.4.3.5.- DIMENSIONADO
3.4.3.5.1.- RED DE AGUAS RESIDUALES
3.4.3.5.2.- COLECTORES MIXTOS
3.4.3.5.3.- ARQUETAS
3.4.3.5.4.- SISTEMA DE VENTILACION

3.5.- DB HR.PROTECCION CONTRA EL RUIDO


3.5.1.- PROCEDIMIENTO DE VERIFICACION
3.5.2.- CARACTERIZACION Y CANTIFICACION DE LAS EXIGENCIAS
3.5.3.- DISENO Y DIMENSIONADO
3.5.4.- FICHAS DE LA OPCION SIMPLIFICADA

3.6.- DB HE. AHORRO DE ENERGIA


3.6.1.- HE1. LIMITACION DE DEMANDA ENERGETICA
3.6.1.1.- PROCEDIMIENTO DE VERIFICACION
3.6.1.2.- CARACTERIZACION Y CANTIFICACION DE LAS EXIGENCIAS
3.6.1.3.- CALCULO Y DIMENSIONADO
3.6.1.3.1.- DATOS PREVIOS
3.6.1.3.2.- OPCION SIMPLIFICADA
3.6.2.- HE2.RENDIMIENTO DE LAS INSTALACIONES TERMICAS
3.6.3.- HE3. EFICIENCIA ENERGETICA DE LAS INSTALACIONES DE ILUMINACION
3.6.4.- HE4. CONTRIBUCION SOLAR MINIMA DE AGUA CALIENTE SANITARIA
3.6.4.1.- PROCEDIMIENTO VERIFICACION
3.6.4.2.- CARACTERIZACION Y CUANTIFICACION DE LAS EXIGENCIAS
3.6.4.3.- CALCULO Y DIMENSIONADO
3.6.4.4.- CONDICIONES GENERALES Y COMPONENTES DE LA INSTALACION
3.6.4.5.- MANTENIMIENTO
3.6.5.- CONTRIBUCIN FOTOVLTICA MNIMA DE ENERGA ELCTRICA

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.1.- DB SE SEGURIDAD ESTRUCTURAL


La edificacin que se proyecta, con el fin de asegurar su comportamiento estructural
adecuado frente a las acciones e influencias previsibles a las que pueda estar
sometido durante su construccin y uso previsto, satisface las exigencias bsicas que
se establecen en el documento bsico DB SE Seguridad estructural, pues en el
presente proyecto se aplican correctamente los parmetros y procedimientos
contenidos en dicho documento bsico, para lo cual se han tenido en cuenta los
documentos bsicos del Cdigo Tcnico de la Edificacin (CTE) y las especificaciones
tcnicas de la normativa sealados en el siguiente cuadro:
Documentos Bsicos

Si

Normativa

DB SE-AE. Acciones en la edificacin

NCSE. Norma de construccin sismorresistente

Si

DB SE-C. Cimientos

EHE. Instruccin de hormign estructural

DB SE-A. Estructuras de acero


DB SE-F. Estructuras de fbrica

DB SE-M. Estructuras de madera

Se adopta, para la edificacin que se proyecta, un periodo de servicio de servicio de


50 aos.
Documentacin
El contenido del presente proyecto de edificacin, en relacin con la seguridad
estructural, es el descrito en el Anejo I del CTE e incluir la informacin que se indica en
el apartado 2 "Documentacin" de la Seccin "SE Seguridad estructural". Esta
documentacin se completa con la especfica que se detalla, en su caso, en cada
uno de los restantes DB relativos a la seguridad estructural que se utilicen
conjuntamente con ste.
Anlisis estructural y dimensionado
.
La comprobacin estructural de un edificio requiere:
determinar las situaciones de dimensionado que resulten determinantes;
establecer las acciones que deben tenerse en cuenta y los modelos adecuados
para la estructura;
.
realizar el anlisis estructural, adoptando mtodos de clculo adecuados a cada
problema;
verificar que, para las situaciones de dimensionado correspondientes, no se
sobrepasan los estados lmite.
.
Las situaciones de dimensionado se clasifican en :
.
persistentes, que se refieren a las condiciones normales de uso;
transitorias, que se refieren a unas condiciones aplicables durante un tiempo limitado
(no se incluyen las acciones accidentales).
.
extraordinarias, que se refieren a unas condiciones excepcionales en las que se
puede encontrar, o a las que puede estar expuesto el edificio (acciones
accidentales).
Estados lmite:
.
Se denominan estados lmite a aquellas situaciones para las que, de ser superadas,
puede considerarse que el edificio no cumple alguna de los requisitos estructurales
para las que ha sido concebido.
Estados lmite ltimos.
.
Los estados lmite ltimos son los que, de ser superados, constituyen un riesgo para las

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

personas, ya sea porque producen una puesta fuera de servicio del edificio o el
colapso total o parcial del mismo.
.
Como estados lmite ltimos deben considerarse los debidos a:
.
prdida del equilibrio del edificio, o de una parte estructuralmente independiente,
considerado como un cuerpo rgido;
.
fallo por deformacin excesiva, transformacin de la estructura o de parte de ella en
un mecanismo, rotura de sus elementos estructurales (incluidos los apoyos y la
cimentacin) o de sus uniones, o inestabilidad de elementos estructurales incluyendo
los originados por efectos dependientes del tiempo (corrosin, fatiga).
Estados lmite de servicio.
.
Los estados lmite de servicio son los que, de ser superados, afectan al confort y al
bienestar de los usuarios o de terceras personas, al correcto funcionamiento de del
edificio o a la apariencia de la construccin.
.
Los estados lmite de servicio pueden ser reversibles e irreversibles. La reversibilidad se
refiere a las consecuencias que excedan los lmites especificados como admisibles,
.
una vez desaparecidas las acciones que las han producido.
Como estados lmite de servicio deben considerarse los relativos a:
las deformaciones (flechas, asientos o desplomes) que afecten a la apariencia de la
obra, al confort de los usuarios, o al funcionamiento de equipos e instalaciones;
las vibraciones que causen una falta de confort de las personas, o que afecten a la
funcionalidad de la obra;
.
los daos o el deterioro que pueden afectar desfavorablemente a la apariencia, a la
durabilidad o a la funcionalidad de la obra.
Variables bsicas:
Acciones: Las acciones a considerar en el clculo se clasifican por su variacin en el
tiempo en:
.
acciones permanentes (G): son aquellas que actan en todo instante sobre el
edificio con posicin constante. Su magnitud puede ser constante (como el peso
propio de los elementos constructivos o las acciones y empujes del terreno) o no
(como las acciones reolgicas o el pretensado), pero con variacin despreciable o
tendiendo montonamente hasta un valor lmite.
.
acciones variables (Q): son aquellas que pueden actuar o no sobre el edificio, como
las debidas al uso o las acciones climticas.
.
acciones accidentales (A): son aquellas cuya probabilidad de ocurrencia es
pequea pero de gran importancia, como sismo, incendio, impacto o explosin.
Las deformaciones impuestas (asientos, retraccin, etc.) se considerarn como
acciones
permanentes
o
variables,
atendiendo
a
su
variabilidad.
Las acciones tambin se clasifican por:
.
.
su naturaleza: en directas o indirectas;
su variacin espacial: en fijas o libres;
.
la respuesta estructural: en estticas o dinmicas.
Valores caractersticos de las acciones: Se indican en la justificacin del DB SE-AE
Datos geomtricos: Los datos geomtricos se representan por sus valores
caractersticos, para los cuales en el proyecto se adoptan los valores nominales
deducidos de los planos.
Materiales: Las propiedades de la resistencia de los materiales o de los productos se
representan por sus valores caractersticos, los cuales se detallan en la justificacin de
la instruccin EHE-08.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Modelo para el anlisis estructural


Se realiza un clculo espacial en tres dimensiones por mtodos matriciales de rigidez,
formando las barras los elementos que definen la estructura: pilares, vigas, brochales y
viguetas. Se establece la compatibilidad de deformacin en todos los nudos
considerando seis grados de libertad y se crea la hiptesis de indeformabilidad del
plano del forjado, impidiendo los desplazamientos relativos entre nudos del mismo. A
los efectos de obtencin de solicitaciones y desplazamientos se supone un
comportamiento lineal de los materiales.
Verificaciones basadas en coeficientes parciales
.
Se realizan las oportunas verificaciones de la capacidad portante, de la aptitud al
servicio y de los efectos del tiempo sobre la estructura, siguiendo las especificaciones,
combinaciones de acciones y expresiones reflejadas en el apartado 4 "Verificaciones
basadas en coeficientes parciales" del documento bsico DB SE "Seguridad
estructural".

3.1.1.- SE-AE ACCIONES EN LA EDIFICACION


A continuacin se determinan las acciones actuantes sobre la edificacin que se
proyecta, para verificar el cumplimiento de los requisitos de seguridad estructural
(capacidad portante y estabilidad) y aptitud al servicio que establece el documento
bsico DB SE "Seguridad estructural".
Acciones permanente (G)
Peso propio: El peso propio que se tiene en cuenta es el de los elementos
estructurales, los cerramientos y elementos separadores, la tabiquera, todo tipo de
carpinteras, revestimientos (pavimentos, guarnecidos, enlucidos, falsos techos),
rellenos (como los de tierras) y equipo fijo.El valor caracterstico del peso propio de los
elementos constructivos, se determina como su valor medio obtenido a partir de las
dimensiones nominales y de los pesos especficos medios, de acuerdo con el Anejo C
"Prontuario de pesos y coeficientes de rozamiento interno".
Datos considerados en el cculo de la estructura de la edificacin que se proyecta:
NIVEL 1 Techo:Planta Baja
NIVEL 2:Cubierta

Elemento estructural

4,00 KN/m2

Solados, tabiquera y revestimiento

2,15 KN/m2

Elemento estructural

4,00 KN/m2

Faldn de teja <20 y revestimiento

3,15 KN/m2

Pretensado: La accin del pretensado se evala a partir de lo establecido en la


Instruccin EHE.
Acciones del terreno: Las acciones derivadas del empuje del terreno, tanto las
procedentes de su peso como de otras acciones que actan sobre l, o las acciones
debidas a sus desplazamientos y deformaciones, se evalan y tratan segn establece
el DB-SE-C.
Acciones permanentes de valor no constante (G*)

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Acciones reolgicas:No se considera en el cculo de la estructura de la edificacin


que se proyecta.
Acciones variables (Q)
Sobrecarga de uso: La sobrecarga de uso es el peso de todo lo que puede gravitar
sobre el edificio por razn de su uso. Los valores caractersticos de la sobrecarga en los
edificios se determinan segn el uso de cada zona, de acuerdo con las
especificaciones del apartado 3.1 "Sobrecargas de uso" y con la tabla 3.1"Valores
caractersticos de las sobrecargas de uso", ambos del documento bsico DB SE-AE.
Datos considerados en el cculo de la estructura de la edificacin que se proyecta:
NIVEL 1: Techo Planta Baja

2,00 kN/m2

NIVEL 2:Cubierta

1,00 kN/m2

Acciones sobre barandillas y elementos divisorios: No procede


Accin del viento: La distribucin y el valor de las presiones que ejerce el viento
sobre un edificio y las fuerzas resultantes dependen de la forma y de las dimensiones
de la construccin, de las caractersticas y de la permeabilidad de su superficie, as
como de la direccin, de la intensidad y del racheo del viento. La accin de viento,
como fuerza perpendicular a la superficie de cada punto expuesto, o presin esttica
(qe) se calcula, en funcin de la presin dinmica del viento (qb) el coeficiente de
exposicin (ce) y el coeficiente elico o de presin (cp), mediante la expresin:
qe=qbcecp,
de acuerdo con lo expuesto en el apartado 3.3 "Viento" y el Anejo D "Accin del
viento", del documento bsico DB SE-AE.
Datos considerados en el cculo de la estructura de la edificacin que se proyecta:
Zona elica:

Grado de aspereza:

IV - Zona urbana, industrial o forestal

Presin dinmica del viento qb:

0.42 kN/m2

Altura punto considerado:

6.00 m

Coeficiente de exposicin ce:

1.4

Coeficiente elico o de presin cp:

0.8

Acciones trmicas: La edificacin y sus elementos estn sometidos a deformaciones


por las variaciones de la temperatura exterior, que conducen a deformaciones de
todos los elementos constructivos, en particular, los estructurales, que, en los casos en
los que estn impedidas, producen tensiones en los elementos afectados.Los efectos
globales de la accin trmica se obtienen a partir de la variacin de temperatura
media de los elementos estructurales, en general, separadamente para los efectos de
dilatacin en verano y de contraccin en invierno, de acuerdo con el apartado 3.4
"Acciones trmicas" y el Anejo E "Datos climticos", ambos del documento bsico DB
SE-AE. En edificaciones habituales con elementos estructurales de hormign o acero y
con juntas de dilatacin de forma que no existan elementos continuos de ms de 40

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

m de longitud, no se consideran las acciones trmicas, siendo este el caso de la


edificacin que se poyecta por lo que no se considera en el clculo de la estructura
de la edificacin que se proyecta.
Nieve: La distribucin y la intensidad de la carga de nieve sobre un edificio, o en
particular sobre una cubierta, depende del clima del lugar, del tipo de precipitacin,
del relieve del entorno, de la forma del edificio o de la cubierta, de los efectos del
viento, y de los intercambios trmicos en los paramentos exteriores. El valor de la
sobrecarga de nieve sobre un terreno horizontal (Sk) se determina segn lo expuesto
en el apartado 3.5 "Nieve" y segn la tabla E.2 "Sobrecarga de nieve en un terreno
horizontal (kN/m2)" del Anejo E "Datos climticos", ambos del documento bsico DB SEAE.
Datos considerados en el clculo de la estructura de la edificacin que se proyecta:
Zona climtica invernal

Altitud

Valor

700 m

0.40 kN/m2

Acciones accidentales (A)


Sismo: Las acciones ssmicas se aplican a la edificacin que se proyecta conforme a
la NCSR-02, "Norma de construccin sismorresistente: parte general y edificacin".
Datos considerados en el cculo de la estructura de la edificacin que se proyecta:
Ubicacin
Trmino Municipal:

Ronda

Aceleracin Ssmica Bsica ab:

0.08 g (siendo g la aceleracin de la gravedad)

Coeficiente de contribucin k:

1.0

Terreno
Tipo:

II (Suelo cohesivo duro)

Coeficiente de tipo de terreno C:

1.3

Coeficiente de amplificacin del terreno S:

Para pab<0.1g S= C/1.25 = 1.04

Construccin:
Clasificacin:

2 - Construccin de normal importancia

Coeficiente adimensional de riesgo p:

1.0 - Construccin de normal importancia

Factor de amortiguamiento:

5% (Estructura de hormign armado compartimentada)

Coeficiente de comportamiento por ductilidad :

2 (Ductilidad baja)

Clculo:
Aceleracin ssmica de clculo ac:

Spab = 0.0832 g

Fraccin de sobrecargas considerada:

0.5 - uso vivienda

Mtodo adoptado:

Mtodo simplificado

Nmero de modos de vibracin considerados:

3 primeros modos, pues Tf>1.25 s

Periodo fundamental del edificio Tf:

Edificio con prticos de hormign armado


0.92 plantas=1.8 segundos

Coeficiente de respuesta :

0.50

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Incendio: Las acciones debidas a la agresin trmica del incendio se definen en el


documento bsico DB-SI "Seguridad en caso de incendio".
Impacto: Las acciones sobre la edificacin causadas por un impacto dependen de
la masa, de la geometra y de la velocidad del cuerpo impactante, as como de la
capacidad de deformacin y de amortiguamiento tanto del cuerpo como del
elemento contra el que impacta. Se consideran slo las acciones debidas a impactos
accidentales (como la del impacto de un vehculo o la cada del contrapeso de un
aparato elevado) con los valores de clculo segn lo expuesto en el apartado 4.3
"Impacto" del documento bsico DB SE-AE.

3.1.2.- SEC-C CIMENTACION


3.1.2.1.- BASES DE CALCULO
Generalidades
El comportamiento de la cimentacin se comprueba frente a la capacidad portante
(resistencia y estabilidad) y la aptitud al servicio. A estos efectos se distingue entre
estados lmite ltimos y estados lmite de servicio.
.
Las comprobaciones de la capacidad portante y de la aptitud al servicio de la
cimentacin se efectan para las situaciones de dimensionado siguientes:
a) situaciones persistentes, que se refieren a las condiciones normales de uso;
b) situaciones transitorias, que se refieren a unas condiciones aplicables durante un
tiempo limitado, tales como situaciones sin drenaje o de corto plazo durante la
construccin;
c) situaciones extraordinarias, que se refieren a unas condiciones excepcionales en las
que se puede encontrar, o a las que puede estar expuesto el edificio, incluido el sismo.
Se tienen en cuenta los efectos que, dependiendo del tiempo, pueden afectar a la
capacidad portante o aptitud de servicio de la cimentacin, comprobando su
comportamiento frente a:
a) acciones fsicas o qumicas que pueden conducir a procesos de deterioro;
b) cargas variables repetidas que puedan conducir a mecanismos de fatiga del
terreno
y
c) las verificaciones de los estados lmites de la cimentacin relacionados con los
efectos que dependen del tiempo deben estar en concordancia con el periodo de
servicio de la construccin.

Mtodo de los estados lmite


Para el dimensionado de la cimentacin se tienen en cuenta:
a) los Estados lmite ltimos (asociados con el colapso total o parcial del terreno o con
el fallo estructural de la cimentacin), segn lo expuesto en el apartado 3.2.1"Estados
lmite ltimos" del documento bsico DB-SE
"Seguridad estructural" y
b) los Estados lmite de servicio (asociados con determinados requisitos impuestos a las
deformaciones del terreno por razones estticas y de servicio), segn lo expuesto en el

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

apartado 3.2.2"Estados lmite de servicio" del documento bsico DB-SE "Seguridad


estructural".
Las verificaciones de los estados lmite se basan en el uso de modelos adecuados para
la cimentacin y el terreno de apoyo, as como para evaluar los efectos de las
acciones del edificio y del terreno sobre el mismo.
.
Se verifica que no se supera ningn estado lmite utilizando, en los modelos
mencionados anteriormente, valores adecuados para:
a) las solicitaciones del edificio sobre la cimentacin;
.
b) las acciones (cargas y empujes) que se puedan transmitir o generar a travs del
terreno sobre la cimentacin;
.
c) los parmetros del comportamiento mecnico del terreno;
.
d) los parmetros del comportamiento mecnico de los materiales utilizados en la
construccin de la cimentacin;
.
e) los datos geomtricos del terreno y la cimentacin.
Las verificaciones se llevan a cabo para todas las situaciones de dimensionado.

Variables bsicas
La verificacin de los estados lmite se realiza mediante modelos en los que intervienen
las denominadas variables bsicas, que representan cantidades fsicas que
caracterizan las acciones sobre el edificio, acciones sobre el terreno, acciones
generadas por el terreno sobre la cimentacin, influencias ambientales, caractersticas
del terreno y de los materiales de la cimentacin, y los datos geomtricos tanto del
.
terreno como de la cimentacin.
Para cada situacin de dimensionado de la cimentacin se distingue entre acciones
que actan sobre el edificio y acciones geotcnicas que se transmiten o generan a
travs del terreno en que se apoya.
.
Para cada situacin de dimensionado y estudio de estado lmite se definie un modelo
geotcnico del terreno que incorpora, junto con los distintos tipos de materiales y sus
.
superficies de contacto, los niveles piezomtricos pertinentes.
Las caractersticas de los materiales utilizados en la construccin de la cimentacin se
representan mediante sus valores caractersticos, que se determinan de acuerdo con
el apartado 3.3.4 del "Materiales" del documento bsico DB-SE "Seguridad estructural".
A la hora de definir la configuracin geomtrica para cada tipo de cimentacin se
tiene en cuenta las consideraciones que se hacen en el documento bsico DB SE-C
"Seguridad estructural: Cimientos", dedicando especial atencin a la cota y
pendiente de la superficie del terreno, los niveles de excavacin y la definicin de los
niveles piezomtricos del agua del terreno en cada una de las situaciones de
dimensionado a las que sus posibles variaciones puedan dar lugar. Los valores de
clculo de la dimensiones geomtricas de la cimentacin se coinciden con sus valores
nominales reflejados en los planos de ejecucin correspondientes.

Verificaciones basadas en el formato de los coeficientes parciales


El dimensionado de la cimentacin, como elemento que ejerce presiones sobre el
terreno, se realiza exclusivamente con el formato de acciones y coeficientes de
seguridad indicados, a tal efecto, en el documento bsico DB SE-C "Seguridad
estructural: Cimientos".
.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

La comprobacin de la capacidad estructural de la cimentacin, como elemento


estructural a dimensionar, se realiza con el formato de acciones y coeficientes de
seguridad indicados en la tabla 2.1 "Coeficientes de seguridad parciales" del
documento bsico DB SE-C "Seguridad estructural: Cimientos".

3.1.2.2.- JUSTIFICACION DE LAS CARACTERISTICAS DEL SUELO


Para el anlisis y dimensionado de los cimientos de la edificacin que se proyecta es
necesario conocer las caractersticas del terreno donde se cimentar. Por tal motivo,
al no contar con un estudio geolgico-geotcnico del terreno donde se va a
cimentar, se ha realizado un reconocimiento inicial del mismo y basndonos en la
experiencia de las obras y edificaciones de reciente construccin colindantes o
cercanas a la que se proyecta, se realiza una previsin cuyos datos y caractersticas
principales se resumen a continuacin:
Resumen parmetros geotcnicos:

Tipo de construccin: C-0


Grupo de terreno: T-1
Descripcin del terreno: Compuesto por materiales arcillosos de carcter duro con baja
expansividad y 0.00% contenido en sulfatos.
N y Tipo de prospecciones: 2 calicatas mecnicas
Cota de cimentacin: -1.50 (media respecto de la rasante)
Estrato de cimentacin:arcillas duras
Nivel fretico: No se aprecia
Peso especfico: 17 KN/m3
Tensin admisible:1.00 kp/cm2
ngulo de rozamiento interno: 20
Mdulo de balasto: 1000 Tm/m3

Estas previsiones se comprobarn con la realizacin del oportuno estudio geolgicogeotcnico del terreno antes del inicio de las obras.

3.1.2.3.- CIMENTACION
Se plantea, para la edificacin que se proyecta, una cimentacin directa con las
siguientes caractersticas:

Diseo: La cimentacin es superficial y se resuelve mediante zapatas aisladas y


contnuas, con cantos variables y debidamente unidas entre si por vigas de
atado y centradoras.
Materiales utilizados: La cimentacin se realiza con hormign armado del tipo,
caractersticas y cuanta de armado indicados en la memoria constructiva, los
planos de estructura correspondientes y las mediciones adjuntas.
Dimensionado: Las dimensiones y secciones de la cimentacin se indican en los
planos de estructura correspondientes y las mediciones adjuntas.
Condiciones constructivas: Bajo la cimentacin, sobre la superficie de
excavacin, se extiende una capa de hormign de regularizacin con un
canto 10cm o, donde fuera necesario, un relleno de hormign pobre hasta
alcanzar la cota de apoyo de la cimentacin, que servirn como base plana
horizontal para la facil colocacin de las armaduras, evitando el contacto con

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

el terreno. Se observarn las condiciones constructivas que le son de aplicacin


de las indicadas en el apartado 4.5 "Condiciones constructivas" del
documento bsico DB SE-C "Seguridad estructural Cimmientos y las juntas de
hormigonado y los procesos de hormigonado, vibrado y curado se efectuarn
con los criterios definidos en la Instruccin EHE.

3.1.3.- SE-F FABRICA


Generalidades
En este punto se justifica, de acuerdo con el documento bsico DB-SE "Seguridad
estructural", el cumplimiento de la seguridad estructural de muros resistentes, en la
edificacin que se proyecta, realizados con fbricas de piedra, de ladrillo cermico,
de bloques de hormign y de bloques cermicos aligerados tomados con mortero de
cemento, tanto para elementos de fbrica sustentante (que forma parte de la
estructura general del edificio), como para elementos de fbrica sustentada
(destinada slo a soportar las acciones directamente aplicadas sobre ella, y que debe
transmitir a la estructura general), en condiciones adecuadas de utilizacin e
incluyendo los aspectos relativos a la durabilidad.
Bases de clculo
Se desarrollan y completan las reglas establecidas con carcter general en
documento bsico DB SE "Seguridad estructural" para el caso de elementos resistentes
de fbrica y en particular las referentes a juntas de movimiento, capacidad portante y
aptitud al servicio para los elementos resistentes:
Juntas de movimiento: Se disponen juntas de movimiento para permitir dilataciones
trmicas y por humedad, fluencia y retraccin, deformaciones por flexin y efectos de
las tensiones internas producidas por cargas verticales o laterales, sin que la fbrica
sufra daos, teniendo en cuenta, para las fbricas sustentadas, las distancias
indicadas en la tabla 2.1 del documento bsico DB SE-F "Seguridad estructura Fbrica".
Capacidad portante: Para la verificacin de la capacidad portante, en los anlisis
de comportamiento de muros en estado lmite de rotura se adopta un diagrama de
tensin a deformacin del tipo rgidoplstico. El coeficiente parcial de seguridad para
acciones de pretensado, despus de las prdidas ser igual a 1,00.
Aptitud al servicio: Para evitar la fisuracin y asegurar la durabilidad del acero
pretensado, se comprobar que, para las combinaciones de acciones del tipo casi
permanente no se producen tracciones ni rotura a compresin de la fbrica. Se
considerar que ya se ha transferido el pretensado, una vez producidas las prdidas
de tensin. El coeficiente parcial de seguridad para acciones de pretensado, despus
de las perdida es igual a 1,05 con la armadura es pretesa y el efecto de la accin
desfavorable.
Durabilidad
Para asegurar la capacidad, de los elementos resistentes de fbrica, para soportar las
condiciones fsicas y qumicas a las que estarn expuestos durante el periodo de
servicio para el que se proyecta la edificacin y con la composicin, propiedades y
comportamiento de los materiales, se tiene en cuenta:
a) la clase de exposicin a la que estar sometido el elemento, segn lo establecido
en las tablas 3.1 y 3.2 del documento bsico DB SE-F "Seguridad estructura Fbrica".

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

b)
composicin, propiedades y comportamiento de los materiales, segn lo
establecido en las tablas 3.3 del documento bsico DB SE-F "Seguridad estructura
Fbrica".
Materiales
Las caractersticas y condiciones de las piezas, los morteros, hormigones, armaduras y
los componentes auxiliares que se emplearn en los elementos de fbrica de la
edificacin que se proyecta, cumplen con lo prescrito en el apartado 4 "Materiales" y
las tablas 4.1 a 4.8 (ambas inclusive) del documento bsico DB SE-F "Seguridad
estructura Fbrica".
Comportamiento estructural
Se comprueba el comportamiento de la estructura de los muros resistentes de fbrica
de la edificacin que se proyecta, segn lo establecido en el aparado 5
"Comportamiento estructural" del documento bsico DB SE-F "Seguridad estructura
Fbrica".
Anlisis de solicitaciones :La estructura de muros de la edificacin que se proyecta se
disea para que pueda resistir esfuerzos laterales, de acuerdo con clculos de
estabilidad global. La determinacin de esfuerzos se realiza de acuerdo con los
mtodos generales de anlisis estructural, utilizando modelos planos o espaciales.
Para el anlisis a carga vertical se plantea una estructura constituida por elementos de
profundidad unidad, en la cual los muros y los forjados se sustituyen por barras con sus
mismas caractersticas geomtricas y de deformacin, formando prticos que
idealizan la estructura para su clculo utilizando modelos planos. A los efectos del
clculo, el arranque inferior del muro en la solera, forjado sanitario o zanja, puede
considerarse como empotramiento perfecto. Todos los muros de carga tienen un
espesor superior a 115mm. La resistencia del edificio frente a acciones horizontales de
fbrica sustentante se consigue mediante los forjados, funcionando como diafragmas
rgidos, y los muros dispuestos en la direccin de la accin. Para la distribucin de las
acciones horizontales se emplear la rigidez elstica de los muros de corte, incluidas
las alas. Para muros de altura mayor que el doble de su longitud, puede despreciarse
el efecto de la rigidez a cortante. El clculo de muros sometidos a acciones laterales
se basa en su respuesta como pieza a flexin sustentada en uno o varios bordes, o en
su respuesta como arco estribado entre ambos bordes. En los elementos de fbrica
armada, pretensado o confinada, sometidos predominantemente a flexin, tales
como dinteles, una vez analizadas sus solicitaciones, para calcular el momento flector
resistente de su seccin, se adopta como simplificacin una distribucin rectangular
de tensiones, como la usada en hormign.
Capacidad portante: En todo pao de un muro de fbrica, la compresin vertical
de clculo ser menor o igual que su resistencia vertical de clculo; que el esfuerzo
cortante de clculo aplicado es menor o igual que el esfuerzo cortante resistente; que,
en cualquier direccin, el momento de clculo aplicado ser menor o igual que el
momento resistente.

3.2.- DB SI SEGURIDAD EN CASO DE INCENDIO


La edificacin que se proyecta, con el fin de reducir a lmites aceptables el riesgo de
que sus usuarios sufran daos derivados de un incendio de origen accidental, satisface
las exigencias bsicas que se establecen en el documento bsico DB SI "Seguridad en

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

caso de incendio", pues en el presente proyecto se aplican correctamente los


parmetros y procedimientos contenidos en dicho documento bsico.
3.2.1.- PROPAGACION INTERIOR
1.2.1.1.- COMPARTIMENTACION EN SECTORES DE INCENDIO
La edificacin se compartimenta en los sectores de incendio indicados a
continuacin, segn las condiciones que se establecen en la tabla 1.1 "Condiciones
de compartimentacin de sectores de incendio" de la Seccin SI 1 "Propagacin
interior".
A efectos del cmputo de la superficie de un sector de incendio, se considera que los
locales de riesgo especial, las escaleras y pasillos protegidos, los vestbulos de
independencia y las escaleras compartimentadas como sector de incendios, que
estn
contenidos
en
dicho
sector
no
forman
parte
del
mismo.
Toda zona integrada en la edificacin, cuyo uso sea diferente y subsidiario del
principal, constituir un sector de incendio diferente cuando supere los lmites que se
establecen en la tabla 1.1 "Condiciones de compartimentacin de sectores de
incendio" de la Seccin SI 1 "Propagacin interior".
SECTORES DE INCENDIO
Sectores

Uso previsto

Superficie Construida
Norma

nico

Residen. vivienda

<= 2500 m2

Resistencia al fuego
Altura de
Puertas
Evacuacin Paredes y techos

Proyecto

Norma Proyecto Norma

Proyecto

189.10 m2

El2 30C5

El2 30-C5

<15 m

El 60

El 60

Los vestbulos de independencia cumplirn las siguientes condiciones: No proceden.

3.2.1.2.- ESPACIOS OCULTOS, PASO DE INSTALACIONES A TRAVES DE ELEMENTOS DE


COMPARTIMENTACION DE INCENDIOS
La compartimentacin contra incendios de los espacios ocupables tienen
continuidad en los espacios ocultos, tales como patinillos, cmaras, falsos techos,
suelos elevados, etc., salvo cuando stos estn compartimentados respecto de los
primeros al menos con la misma resistencia al fuego, pudiendo reducirse sta a la
mitad en los registros para mantenimiento.
Se limita a tres plantas y a 10 m el desarrollo vertical de las cmaras no estancas en las
que existan elementos cuya clase de reaccin al fuego no sea B-s3,d2, BL-s3,d2
mejor.
La resistencia al fuego requerida a los elementos de compartimentacin de incendios
se mantiene en los puntos en los que dichos elementos son atravesados por elementos
de las instalaciones, tales como cables, tuberas, conducciones, conductos de
ventilacin, etc., excluidas las penetraciones cuya seccin de paso no exceda de 50
cm. Para ello se opta por una de las siguientes alternativas:
a) Mediante elementos que, en caso de incendio, obturen automticamente la
seccin de paso y garantice en dicho punto una resistencia al fuego al menos igual a
la del elemento atravesado, por ejemplo, una compuerta cortafuegos automtica EI t

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

(i<-->o) siendo t el tiempo de resistencia al fuego requerida al elemento de


compartimentacin atravesado, o un dispositivo intumescente de obturacin.
b) Mediante elementos pasantes que aporten una resistencia al menos igual a la del
elemento atravesado, por ejemplo, conductos de ventilacin EI t (i<-->o), siendo t el
tiempo de resistencia al fuego requerida al elemento de compartimentacin
atravesado.
3.2.1.3.- REACCION AL FUEGO DE LOS ELEMENTOS CONSTRUCTIVOS, DECORATIVOS Y DE
MOBILIARIO
Los elementos constructivos cumplen las condiciones de reaccin al fuego que se
exponen a continuacin y, en todo caso, las que se establecen en la tabla 4.1. de la
Seccin SI 1 "Propagacin interior".
Revestimientos
De techos y
paredes

Situacin del elemento

Norma

De suelos

Proyecto Norma Proyecto

Zonas comunes del edificio

C-s2,d0

C-s2,d0

Aparcamiento

A2-s1,d0

A2-s1,d0 A2FL-s1

EFL

EFL
A2FL-s1

Pasillos y escaleras protegidos

B-s1,d0

B-s1,d0

CFL-s1

CFL-s1

Recintos de riesgo especial

B-s1,d0

B-s1,d0

BFL-s1

BFL-s1

Espacios ocultos no estancos, tales como patinillos, falsos


techos y suelos elevados (excepto los existentes dentro de
las viviendas) etc. o que siendo estancos, contengan
instalaciones
susceptibles de iniciar o de propagar un incendio.

B-s3,d0

B-s3,d0

BFL-s2

BFL-s2

Las condiciones de reaccin al fuego de los componentes de las instalaciones


elctricas, cables, tubos, bandejas, regletas, armarios, etc, se regulan en su
reglamentacin especfica (Reglamento Electrotcnico de Baja Tensin, REBT-2002).
3.2.2.- PROPAGACION EXTERIOR
3.2.2.1.- MEDIANERIAS Y FACHADAS

Los elementos verticales separadores de otro edificio alcanzan una resistencia


al fuego mnima EI 120.
En la edificacin que se proyecta, con el fin de limitar el riesgo de propagacin
exterior horizontal del incendio a travs de la fachada entre dos sectores de
incendio, entre una zona de riesgo especial alto y otras zonas o hacia una
escalera protegida o pasillo protegido desde otras zonas, todas sus fachadas
alcanzan una resistencia al fuego mnima EI 60. Los puntos, si los hubiere, que
no alcancen dicha resistencia estarn separados la distancia d en proyeccin
horizontal que se indica a continuacin, como mnimo, en funcin del ngulo
formado por los planos exteriores de dichas fachadas.

DISTANCIA HORIZONTAL MNIMA ENTRE HUECOS DE FACHADA

ngulo

0 (fachadas paralelas
enfrentadas)

45

Distancia

3.00m

2.75m

60 90 135
2.50m 2.00m

180

1.25m 0.50m

Para valores intermedios del ngulo , la distancia d puede obtenerse por


interpolacin lineal.
.
Cuando se trate de edificios diferentes y colindantes, los puntos de la fachada de la

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

edificacin que se proyecta que no sean al menos EI 60 cumplirn el 50% de la


distancia d hasta la bisectriz del ngulo formado por ambas fachadas.

Con el fin de limitar el riesgo de propagacin vertical del incendio por fachada
entre dos sectores de incendio, entre una zona de riesgo especial alto y otras
zonas ms altas del edificio, o bien hacia una escalera protegida o hacia un
pasillo protegido desde otras zonas, dicha fachada alcanza una resistencia al
fuego mnima EI 60 en una franja de 1 m de altura, como mnimo, medida
sobre el plano de la fachada. En caso de existir elementos salientes aptos para
impedir el paso de las llamas, la altura de dicha franja podr reducirse en la
dimensin del citado saliente.
La clase de reaccin al fuego de los materiales que ocupen ms del 10% de la
superficie del acabado exterior de las fachadas o de las superficies interiores
de las cmaras ventiladas que dichas fachadas puedan tener, son B-s3,d2
hasta una altura de 3,5 m como mnimo, en aquellas fachadas cuyo arranque
inferior es accesible al pblico desde la rasante exterior o desde una cubierta, y
en toda la altura de la fachada cuando esta exceda de 18 m, con
independencia de donde se encuentre su arranque.

3.2.2.2.- CUBIERTAS

En la edificacin que se proyecta, con el fin de limitar el riesgo de propagacin


exterior del incendio por la cubierta, ya sea entre dos edificios colindantes, ya
sea en un mismo edificio, esta tiene una resistencia al fuego mnima REI 60 en
una franja de 0,50 m de anchura medida desde el edificio colindante, as
como en una franja de 1,00 m de anchura situada sobre el encuentro con la
cubierta de todo elemento compartimentador de un sector de incendio o de
un local de riesgo especial alto. Como alternativa a la condicin anterior
puede optarse por prolongar la medianera o el elemento compartimentador
0,60 m por encima del acabado de la cubierta.
En el encuentro entre una cubierta y una fachada que pertenezcan a sectores
de incendio o a edificios diferentes, la altura h sobre la cubierta a la que est
cualquier zona de fachada cuya resistencia al fuego no sea al menos EI 60 ser
la que se indica a continuacin, en funcin de la distancia d de la fachada, en
proyeccin horizontal, a la que est cualquier zona de la cubierta cuya
resistencia al fuego tampoco alcance dicho valor.
Distancia (m)

>=2.50

2.00

1.75

Altura (h)

0.00

1.00

1.50

1.50

1.25

1.00

0.75

0.50

0.00

2.00

2.50

3.00

3.50

4.00

5.00

Los materiales que ocupen ms del 10% del revestimiento o acabado exterior
de las zonas de cubierta situadas a menos de 5 m de distancia de la
proyeccin vertical de cualquier zona de fachada, del mismo o de otro
edificio, cuya resistencia al fuego no sea al menos EI 60, incluida la cara
superior de los voladizos cuyo saliente exceda de 1 m, as como los lucernarios,
claraboyas y cualquier otro elemento de iluminacin o ventilacin, deben
pertenecer a la clase de reaccin al fuego BROOF (t1).

3.2.3.- EVACUACION DE OCUPANTES


3.2.3.1.- CALCULO DE LA OCUPACION
Para el clculo de la ocupacin de la edificacin que se proyecta se toman los
valores de densidad de ocupacin que se indican en la tabla 2.1 "Densidades de
ocupacin" de la Seccin SI 3 "Evacuacin de ocupantes" en funcin de la superficie

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

til de cada zona, tenindose adems en cuenta el carcter simultneo o alternativo


de las diferentes zonas de un edificio, considerando el rgimen de actividad y de uso
previsto para el mismo.
.
El nmero de salidas mnimas y las longitudes mximas de los recorridos de evacuacin
hasta ellas cumplen con lo expuesto en la tabla 3.1 "Nmero de salidas de planta y
longitud de los recorridos de evacuacin" de la Seccin SI 3 "Evacuacin de
Ocupantes".
El cumplimiento de todo lo anterior y el clculo de la ocupacin se justifica en el
siguiente cuadro:
Zona

P.Baja

Planta 1

Uso

Aparcamiento

Resid.vivienda

Densidad
(m2/persona)

40

20

Superficie
til (m2)

73.75

90.05

Ocupacin
(personas)

Instalacin
automtica
Extincin

No

No

Altura
Evacuacin
(m)

Descend. <28

Descend. <28

Recorrido
evacuacin
mximo
(m)

35

25

Recorrido
evacuacin
proyecto
(m)

14

16

N
salidas
mnimo

N
salidas
proyecto

3.2.3.2.- DIMENSIONADO DE LOS MEDIOS DE EVACUACION


El dimensionamiento de los medios de evacuacin (puertas, pasos, pasillos, rampas y
escaleras) de la edificacin que se proyecta, se realiza con las condiciones de
proteccin en funcin de la ocupacin, altura de evacuacin y uso de los sectores de
incendio a los que dan servicio, todo ello cumpliendo con lo expuesto en el punto
4."Dimensionado de los medios de evacuacin" y, ms concretamente, en las tablas
4.1 "dimensionado de los elementos de la evacuacin", 4.2 "Capacidad de
evacuacin de las escaleras en funcin de su anchura" y 5.1"Proteccin de las
escaleras", de la Seccin SI 3 "Evacuacin de ocupantes".

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Dimensionado

Elemento

Norma

Proyecto

Puertas y pasos:

A>=P/200=>0.80m

>=0.80m

Pasillos y rampas:

A>=P/200=>1.00m

>=1.00m

No protegidas

Descend: A>=p/160
Ascend: A>=P/(160-10h)

Descend: >=1.00m
---

Protegidas

E<=3S+160As

---

Escaleras:

A = Anchura del elemento


As =

Anchura de la escalera protegida en su desembarco en la planta de salida del edificio.(m)

P = Nmero total de personas cuyo paso est previsto por el punto cuya anchura se dimensiona.
E = Suma de los ocupantes asignados a la escalera en la planta considerada ms los de las plantas
situadas por debajo o
por encima de ella hasta la planta de salida del edificio, segn se trate de una escalera para
evacuacin descendente o
ascendente, respectivamente. Para dicha asignacin solo ser necesario aplicar la hiptesis de
bloqueo de salidas de
planta indicada en el punto 4.1 en una de las plantas, bajo la hiptesis ms desfavorable;

3.2.3.3.- PROTECCION DE LAS ESCALERAS


La condiciones de proteccin y las capacidades de evacuacin las escaleras
previstas en el edifico que se proyecta se indican a continuacin, cumpliendo en
todo caso lo expuesto en las tablas 4.2 "Capacidad de evacuacin de las escaleras
en funcin de su anchura" y 5.1 "Proteccin de las escaleras" de la Seccin SI 3
"Evacuacin de ocupantes".
N
Altura
Evacuacin Evacuacin
Plantas Ancho
evacuacin mxima
Proyecto
a
(m)
(m)
(personas) (personas)
evacuar

Zona

Uso

Sobre
rasante

Residencial
Vivienda

1.00

<14.00

160

Direccin

Proteccin

Descendente

No
protegida

3.2.3.4.- PUERTAS SITUADAS EN RECORRIDOS DE EVACUACION


Las puertas previstas como salida de planta o de edificio y las previstas para la
evacuacin de ms de 50 personas sern abatibles con eje de giro vertical y su
sistema de cierre, o bien no actuar mientras haya actividad en las zonas a evacuar, o
bien consistir en un dispositivo de fcil y rpida apertura desde el lado del cual
provenga dicha evacuacin, sin tener que utilizar una llave y sin tener que actuar
sobre ms de un mecanismo. Las anteriores condiciones no son aplicables cuando se
trate de puertas automticas.
.
Abrir
en
el
sentido
de
la
evacuacin
toda
puerta
de
salida:
a) prevista para el paso de ms de 200 personas en edificios de uso Residencial
Vivienda
o
de
100
personas
en
los
dems
casos,
o
bien.
b) prevista para ms de 50 ocupantes del recinto o espacio en el que est situada.
Para la determinacin del nmero de personas que se indica en a) y b) se debern
tener en cuenta los criterios de asignacin de los ocupantes establecidos en el
apartado 4.1 de esta Seccin

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.2.4.- DETECCION, CONTROL Y EXTINCION DEL INCENDIO


3.2.4.1.- DOTACION DE INSTALACIONES DE PROTECCION CONTRA INCENDIOS
La edificacin que se proyecta dispone de los equipos e instalaciones de proteccin
contra incendios que se indican a continuacin, conforme a lo establecido en la
tabla 1.1 "Dotacin de instalaciones de proteccin contra incendios" de la Seccin SI
4
"Deteccin,
control
y
extincin
del
incendio".
El diseo, la ejecucin, la puesta en funcionamiento y el mantenimiento de dichas
instalaciones, as como sus materiales, componentes y equipos, cumplirn lo
establecido en el Reglamento de Instalaciones de Proteccin contra Incendios, en
sus disposiciones complementarias y en cualquier otra reglamentacin especfica que
le sea de aplicacin. La puesta en funcionamiento de las instalaciones requiere la
presentacin, ante el rgano competente de la Comunidad Autnoma, del
certificado de la empresa instaladora al que se refiere el artculo 18 del citado
reglamento.
Los locales y zonas de riesgo especial, segn lo establecido en la tabla 2.1
"Clasificacin de los locales y zonas de riesgo especial integrados en edificios" de la
Seccin SI 1 "Propagacin interior", as como aquellas zonas cuyo uso previsto es
diferente y subsidiario del principal del edificio que se proyecta en el que estn
integradas y que, conforme a la tabla 1.1 del Captulo 1 de la Seccin 1 "Propagacin
interior", constituyen un sector de incendio diferente, dispondr de la dotacin de
instalaciones que se indica para cada local de riesgo especial, as como para cada
zona, en funcin de su uso previsto, pero en ningn caso ser inferior a la exigida con
carcter general para el uso principal de la edificacin.
DOTACIN DE INSTALACIONES DE PROTECCIN CONTRA INCENDIOS
Zona

Vivienda - Sector nico

Uso

Residencial vivienda

Planta
Superficie

Baja y alta
(m2)

Extintores 21A-113B

189.10
X

Boca Incendio Equipada


Columna Seca
Hidrantes Exteriores
Sistemas de Alarma
Sistema Deteccin y Alarma
Instalacin Automtica Extincin
Ascensor Emergencia

3.2.5.- INTERVENCION DE LOS BOMBEROS


La altura de evacuacin descendente de la edificacin que se proyecta es menor
que 9.00m por lo que, aunque forman parte del presente proyecto de una vivienda
unifamiliar con garaje los espacios del entorno de dicha edificacin o el vial o viales
para la aproximacin, NO le es de aplicacin los apartados 1 "Condiciones de
aproximacin y entorno" y 2 "Accesibilidad por fachadas" de la Seccin SI 5
"Intervencin de los bomberos".

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.2.6.- RESISTENCIA AL FUEGO DE LA ESTRUCTURA


La resistencia al fuego de los elementos estructurales principales (forjados, vigas y
soportes) de la edificacin que se proyecta es suficiente pues alcanzan la clase
indicada en la tabla 3.1"Resistencia al fuego suficiente de los elementos estructurales"
o 3.2 "Resistencia al fuego suficiente de los elementos estructurales de zonas de riesgo
especial integradas en los edificios" de la Seccin SI 6 "Resistencia al fuego de la
estructura", que representa el tiempo en minutos de resistencia ante la accin
representada por la curva normalizada tiempo temperatura, o soporta dicha accin
durante el tiempo equivalente de exposicin al fuego indicado en el anejo B "Tiempo
equivalente de exposicin al fuego".
Resistencia al fuego suficiente de los elementos estructurales principales

Zona o sector (1)

Uso

Plantastano

Sector nico

Residencial vivienda unifamiliar

R30

Plantas sobre rasante


<=15m <=28m =<28m
R30

(1) La resistencia al fuego suficiente R de los elementos estructurales de un suelo que


separa sectores de incendio es funcin del uso del sector inferior. Los elementos
estructurales de suelos que no delimitan un sector de incendios, sino que estn
contenidos en l, deben tener al menos la resistencia al fuego suficiente R que se exija
para el uso de dicho sector.
.

3.3.- DB SUA. SEGURIDAD DE UTILIZACION Y ACCESIBILIDAD


3.3.1.- SUA 1. SEGURIDAD FRENTE AL RIESGO DE CAIDAS
En este apartado se justifica el cumplimiento de la exigencia bsica SUA
1"Seguridad frente al riesgo de cadas", limitndose as el riesgo de que los usuarios
puedan sufrir cadas. Para ello los suelos que se proyectan son adecuados para
favorecer que las personas no resbalen, tropiecen o se dificulte la movilidad. Asimismo
se limita el riesgo de cadas en huecos, en cambios de nivel, escaleras y rampas y se
facilita la limpieza de los acristalamientos exteriores en condiciones de seguridad.
3.3.1.1.- DISCONTINUIDADES EN EL PAVIMENTO
Los suelos del edificio que se proyecta, con el fin de limitar el riesgo de cadas como
consecuencia de traspis o de tropiezos, tienen las caractersticas y cumplen las
condiciones siguientes:

No tiene juntas que presenten un resalto de ms de 4mm. Los elementos


salientes del nivel del pavimento, puntuales y de pequea dimensin (los
cerraderos de puertas, por ejemplo) no sobresalen del pavimento ms de
12mm y el saliente que exceda de 6mm en sus caras enfrentadas al sentido de
circulacin de las personas forma un ngulo con el pavimento menor de 45.
Los desniveles que no excedan de 5cm se resuelven con una pendiente menor
del 25%.
En las zonas de circulacin de personas el suelo no presenta perforaciones o
huecos por los que pueda introducirse una esfera de 1.5cm de dimetro.
La delimitacin de zonas de circulacin se realiza con barreras de altura igual o
mayor a 80cm.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

No se dispone un escaln aislado ni dos consecutivos en las zonas de


circulacin, excepto en las zonas de uso restringido, en las zonas comunes del
edificio con uso residencial y en los accesos y salidas del edifico, salvo que
dichas zonas de circulacin incluyan un itinerario accesible.

3.3.1.2.- DESNIVELES
Los desniveles, huecos y aberturas horizontales y verticales, balcones, ventanas,
etc. del edificio que se proyecta, con el fin de limitar el riesgo de cadas, tienen las
caractersticas y cumplen las condiciones siguientes:

Se disponen barreras de proteccin cuando la diferencia de cota es mayor


que 55cm, excepto cuando la disposicin constructiva hace muy improbable
la cada o cuando la barrera es incompatible con el uso previsto.
en las zonas de uso pblico se facilita la percepcin de las diferencias de nivel
que no exceden de 55cm y que son susceptibles de causar cadas, mediante
diferenciacin visual y tctil, comenzado dicha diferenciacin a una distancia
igual o mayor que 25cm.
Las barreras de proteccin tienen una altura igual o mayor que 0.90m cuando
la diferencia de cota del desnivel que protege es igual o menor de 6.00m,
siendo de 1.10m en el resto de los casos, a excepcin de los huecos de
escaleras con anchura menor que 40cm en los que es de 0.90m. Dicha altura
se mide verticalmente desde el nivel del suelo, excepto en las escaleras que se
mide desde la lnea de inclinacin definida por los vrtices de los peldaos
.
hasta el lmite superior de la barrera.
Las barreras tiene resistencia y rigidez suficiente para resistir la fuerza horizontal
establecida en el apartado 3.2.1. del documento bsico DB SE-AE, en funcin
de la zona en que se encuentra.
.
Estn diseadas de forma que no pueden ser fcilmente escalable por los nios
para lo cual, en la altura comprendida entre 30cm y 50cm sobre el nivel del
suelo o sobre la lnea de inclinacin de la escalera, no existen puntos de apoyo
ni salientes sensiblemente horizontales de ms de 5cm de saliente y en la altura
comprendida entre 50cm y 80cm sobre el nivel del suelo no existen salientes
con una superficie sensiblemente horizontal con ms de 15cm de fondo. No
tiene aberturas que sean atravesadas por una esfera de 10cm de dimetro,
excepto las aberturas triangulares que forman la huella y la contrahuella de los
peldaos con el lmite inferior de la barrera, siempre que la distancia entre ste
lmite y la lnea de inclinacin de la escalera sea igual o inferior que 5cm.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.1.1.3.- ESCALERAS Y RAMPAS


1.1.1.3.1.- ESCALERAS DE USO RESTRINGIDO
Las escaleras de uso restringido del edificio que se proyecta, con el fin de limitar el
riesgo de cadas, tienen las caractersticas y cumplen las condiciones siguientes:

La anchura de cada uno de los tramos es igual o mayor que 0.80m.


La contrahuella tiene una altura igual o menor que 20cm y la huella tiene una
profundidad igual o mayor que 22cm, midindose sta en cada peldao
segn la direccin de la marcha. En escaleras de trazado curvo, la huella se
mide en el eje de la escalera cuando la anchura de sta sea menor qu e
1.00m y a 50cm del lado ms estrecho cuando sea mayor, midiendo 5cm
como mnimo en el lado ms es trecho y 44cm como mximo en el lado ms
ancho.
Se pueden disponer mesetas partidas con peldaos a 45 y escalones sin
tabica si la proyeccin de las huellas se superponen 2.5cm como mnimo, que
no se incluirn en la medida de la huella.
Los lados abiertos de las escaleras disponen d e bar andillas.

3.3.1.4.- LIMPIEZA DE LOS ACRISTALAMIENTOS EXTERIORES


En el edifico que se proyecta, con el fin de limitar el riegos de cadas permitiendo su
limpieza desde el interior, los acristalamientos que se encuentran a una altura de ms
de 6.00m sobre la rasante exterior con vidrio transparente tienen las caractersticas y
cumplen las condiciones siguientes:

Toda la superficie exterior del acristalamiento se encuentra comprendida en un


radio de 0.85m desde algn punto del borde de la zona practicable situado a
una altura no mayor de 1.30m.
Los acritalamientos reversibles estn equipados con un dispositivo que los
mantiene bloqueados en la posicin invertida durante la limpieza.
Se exceptuan de lo anterior los acristalamientos practicables o facilmente
desmontable.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.3.2.- SUA 2. SEGURIDAD FRENTE AL RIESGO DE IMPACTO O DE ATRAPAMIENTO


En este apartado se justifica el cumplimiento de la exigencia bsica SUA 2
"Seguridad frente al riesgo de impacto o atrapamiento", limitndose as el riesgo de
que los usuarios puedan sufrir golpes con los diferentes elementos constructivos fijos,
practicables, frgiles, etc. Asimismo se limita el riesgo de atrapamiento con puertas
correderas.

3.3.2.1.- IMPACTO
1.- Impacto con elementos fijos

La altura libre de paso en zonas de circulacin es igual o mayor que 2,10m en


zonas de uso restringido e igual o mayor que 2,20m en el resto de las zonas. En
los umbrales de las puertas la altura libre es 2,00 m, como mnimo.
Los elementos fijos que sobresalen de las fachadas y que estn situados sobre
zonas de circulacin estn a una altura igual o mayor que 2,20m.
En zonas de circulacin, las paredes carecen de elementos salientes que no
arranquen del suelo, que vuelen ms de 15 cm en la zona de altura
comprendida entre 15cm y 2,20m medida a partir del suelo y que presenten
riesgo de impacto.
Se limitar el riesgo de impacto con elementos volados cuya altura sea menor
que 2 m, tales como mesetas o tramos de escalera, de rampas, etc.,
disponiendo elementos fijos que restrinjan el acceso hasta ellos y permitirn su
deteccin por los bastones de personas con discapacidad visual.

2.-Impacto con elementos practicables

Excepto en zonas de uso restringido, las puertas de recintos que no sean de


ocupacin nula (definida en el Anejo SI A del DB SI) situadas en el lateral de los
pasillos cuya anchura sea menor que 2,50m se disponen de forma que el
barrido de la hoja no invade el pasillo. En pasillos cuya anchura exceda de
2,50m, el barrido de las hojas de las puertas no invade la anchura determinada,
en funcin de las condiciones de evacuacin, conforme al apartado 4 de la
Seccin SI 3 del DB SI.

Las puertas de vaivn situadas entre zonas de circulacin tienen partes


transparentes o translucidas que permitan percibir la aproximacin de las
personas y que cubran la altura comprendida entre 0,70m y 1,50m, como
mnimo.
Las puertas, portones y barreras situados en zonas accesibles a las personas y
utilizadas para el paso de mercancas y vehculos tendrn marcado CE de
conformidad con la norma UNE-EN 132411:2004 y su instalacin, uso y
mantenimiento se realizarn conforme a la norma UNE-EN 2635:2002+A1:2009.
Se excluyen de lo anterior las puertas peatonales de maniobra horizontal cuya

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

superficie de hoja no exceda de 6,25m2 cuando sean de uso manual, as


como las motorizadas que adems tengan una anchura que no exceda de
2,50m.
Las puertas peatonales automticas tendrn marcado CE de conformidad con
la Directiva 98/37/CE sobre mquinas.

3.- Impacto con elementos frgiles

Los vidrios existentes en las reas con riesgo de impacto que se indican en el
punto siguiente de las superficies acristaladas que no dispongan de una
barrera de proteccin conforme al apartado 3.2 de SUA 1, tendrn una
clasificacin de prestaciones X(Y)Z determinada segn la norma UNE EN
12600:2003 cuyos parmetros cumplan lo que se establece en la tabla
siguiente. Se excluyen de dicha condicin los vidrios cuya mayor dimensin no
exceda de 30cm.
Diferencia de cotas en ambos
lados
de la superficie acristalada

Valor del
parmetro
X

Valor del
pametro
Y

Valor del
prmetro
Z

Mayor que 12.00m

cualquiera

BoC

Comprendida entre 0.55m y


12.00m

cualquiera

BoC

12

Menor que 0.55m

1, 2 3

BoC

cualquiera

Se identifican las siguientes reas con riesgo de impacto:


a) en puertas, el rea comprendida entre el nivel del suelo, una altura de 1,50
m y una anchura igual a la de la puerta ms 0,30 m a cada lado de esta;
b) en paos fijos, el rea comprendida entre el nivel del suelo y una altura de
0,90 m.

Las partes vidriadas de puertas y de cerramientos de duchas y baeras estn


constituidas por elementos laminados o templados que resistan sin rotura un
impacto de nivel 3, conforme al procedimiento descrito en la norma UNE EN
12600:2003.

4.- Impacto con elementos insuficientemente perceptibles

Las grandes superficies acristaladas que se puedan confundir con puertas o


aberturas (lo que excluye el interior de viviendas) estarn provistas, en toda su
longitud, de sealizacin visualmente contrastada situada a una altura inferior
comprendida entre 0,85 y 1,10 m y a una altura superior comprendida entre
1,50 y 1,70 m. Dicha sealizacin no es necesaria cuando existan montantes
separados una distancia de 0,60 m, como mximo, o si la superficie acristalada
cuenta al menos con un travesao situado a la altura inferior antes
mencionada.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Las puertas de vidrio que no dispongan de elementos que permitan


identificarlas, tales como cercos o tiradores, disponen de sealizacin
conforme al punto anterior.

Los vidrios existentes en las reas con riesgo de impacto que se indican en el punto 2
siguiente de
las superficies acristaladas que no dispongan de una barrera de proteccin conforme
al apartado 3.2
de SUA 1, tendrn una clasificacin de prestaciones X(Y)Z determinada segn la
norma UNE EN
12600:2003 cuyos parmetros cumplan lo que se establece en la tabla 1.1. Se excluyen
de dicha
condicin los vidrios cuya mayor dimensin no exceda de 30 cm.

3.3.2.2.- ATRAPAMIENTO

Con el fin de limitar el riesgo de atrapamiento producido por una puerta


corredera de accionamiento manual, incluidos sus mecanismos de apertura y
cierre, la distancia a hasta el objeto fijo ms proximo es de 20cm, como
mnimo.

Los elemento de apertura y cierre automticos disponen de dispositivos de


proteccin adecuados al tipo de accionamiento y cumplen con las
especificaciones tcnicas propias.

3.3.3.- SUA 3. SEGURIDAD FRENTE AL RIESGO DE APRISIONAMIENTO EN RECINTOS

Cuando las puertas de un recinto tengan dispositivo para su bloqueo desde el


interior y las personas puedan quedar accidentalmente atrapadas dentro del
mismo, existir algn sistema de desbloqueo de las puertas desde el exterior del
recinto. Excepto en el caso de los baos o los aseos de viviendas, dichos
recintos tendrn iluminacin controlada desde su interior.
En zonas de uso pblico, los aseos accesibles y cabinas de vestuarios
accesibles dispondrn de un dispositivo en el interior fcilmente accesible,
mediante el cual se transmita una llamada de asistencia perceptible desde un
punto de control y que permita al usuario verificar que su llamada ha sido
recibida, o perceptible desde un paso frecuente de personas.
La fuerza de apertura de las puertas de salida ser de 140 N, como mximo,
excepto en las situadas en itinerarios accesibles, en las que se aplicar lo
establecido en la definicin de los mismos en el anejo A Terminologa (como
mximo 25 N, en general, 65 N cuando sean resistentes al fuego).
Para determinar la fuerza de maniobra de apertura y cierre de las puertas de
maniobra manual batientes/pivotantes y deslizantes equipadas con pestillos de
media vuelta y destinadas a ser utilizadas por peatones (excluidas puertas con
sistema de cierre automtico y puertas equipadas con herrajes especiales,

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

como por ejemplo los dispositivos de salida de emergencia) se emplear el


mtodo de ensayo especificado en la norma UNE-EN 12046-2:2000.

3.3.4.- SUA 4.SEGURIDAD FRENTE AL RIESGO CAUSADO POR ILUMINACION INADECUADA


3.3.4.1.- ALUMBRADO NORMAL EN ZONAS DE CIRCULACION
El edificio que se proyecta, con el fin de limitar el riesgo causado por iluminacin
inadecuada, dispone en cada zona de una instalacin de alumbrado que
proporciona una iluminancia igual o mayor que 20 lux en zonas exteriores e igual o
mayor que 100 lux en zonas interiores, excepto aparcamientos interiores en donde ser
de 50 lux, medida a nivel del suelo.
.
El factor de uniformidad media es igual o mayor que el 40%.

3.3.5.- SUA 8. SEGURIDAD FRENTE AL RIESGO CAUSADO POR LA ACCION DEL RAYO
En la edificacin que se proyecta, con el fin de limitar el riesgo causado por la
accin del rayo, ser necesaria la instalacin de un sistema de proteccin contra el
rayo, en los trminos que se establecen en el apartado 2 de la Seccin SUA 8
"Seguridad frente a la accin del rayo", cuando la frecuencia esperada de impactos
Ne sea mayor que el riesgo admisible Na. El tipo de instalacin exigido vendr
establecido por el nivel de proteccin correspondiente a la eficiencia E requerida.
Los procesos de clculo y verificacin siguientes determinan que:
DATOS
Frecuencia esperada de impactos
Altura del edificio
Superficie de captura equivalente

Ng=
H=
Ae=

1.5
6.15
11860

Entorno del edificio

Prximo a otros edificios


rboles de la misma altura

C1=

0.5

Tipo de construccin
Contenido del edificio
Uso del edificio

Estructura de hormign y fbrica


Otros contenidos
Resto de edificios

C2=
C3=
C5=

1
1
1

Continuidad de las actividades en


el edificio

Resto de edificios

C5=

Ne=
Na=

0.0089
0.0055

E=
Nivel de proteccin

0.38
4

CLCULOS
Frecuencia de impactos esperada
Riesgo admisible
TIPO DE INSTALACIN EXIGIDO
Eficiencia energtica requerida
Lmite de eficiencia

E=1-(Na/Ne)
0<E<0.80

Aunque es exigible la instalacin de un sistema de proteccin contra el rayo, como


dicha instalacin requiere una eficiencia 0<=E=>0.80 y un nivel de proteccin 4, segn
la tabla 2.1 "Componentes de la instalacin" del apartado 2 de la Seccin SUA 8
"Seguridad frente a la accin del rayo" sta NO ES OBLIGATORIA.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.3.6.- SUA 9. ACCESIBILIDAD


El documento bsico DB SUA Seguridad de Utilizacin y Accesibilidad del Cdigo
Tcnico de Edificacin CTE, en su seccin SUA 9 Accesibilidad, apartado 1
Condiciones de accesibilidad, punto 2, establece que: " Dentro de los lmites de las
viviendas, incluidas las unifamiliares y sus zonas exteriores privativas, las condiciones de
accesibilidad nicamente son exigibles en aquellas que deban ser accesibles".
Por lo tanto, en el presente proyecto de vivienda unifamiliar que no es accesible, no
son exigibles las referidas condiciones.

3.4.- DB HS. SALUBRIDAD


La edificacin que se proyecta, con el fin de reducir a lmites aceptables el riesgo de
que sus usuarios padezcan molestias o enfermedades o que la edificacin se deteriore
y deteriore el medio ambiente en su entorno inmediato, satisface las exigencias
bsicas que se establecen en el documento bsico DB HS Higiene, salud y proteccin
del medio ambiente (Salubridad), pues en el presente proyecto se aplican
correctamente los parmetros y procedimientos contenidos en dicho documento
bsico.
3.4.1.- HS1. PROTECCION FRENTE A LA HUMEDAD
A continuacin se verifica el cumplimiento de las condiciones de diseo,
establecidas en el apartado 2 "Diseo" de la Seccin HS 1 "Proteccin frente a la
humedad", de los elementos constructivos siguientes: Suelos, fachadas y cubiertas, as
como del dimensionado de tubos de drenaje, canaletas de recogida y de cmaras
de bombeo de aguas.
3.4.1.1.- DISEO
Se comprueba que la solucin constructiva adoptada para los suelos de la
edificacin que estn en contacto con el terreno, definida anteriormente en el
apartado correspondiente al Sistema Envolvente de la Memoria Constructiva, cumple
con todas las condiciones de diseo exigidas y descritas en la Seccin HS 1 "Proteccin
frente a la humedad".
El grado de impermeabilidad mnimo exigido a los suelos que estn en contacto con el
terreno frente a la penetracin del agua del terreno y de las escorrentas, en funcin
de la presencia de agua y del coeficiente de permeabilidad del terreno que se
obtiene en la tabla 2.3 "Grado de impermeabilidad mnimo exigido a los suelos" de la
Seccin HS 1 "Proteccin frente a la humedad", es el que se encuentra en el recuadro
marcado de la tabla siguiente:
Presencia de agua (*)

Coeficiente de permeabilidad del terreno Ks (**)


Ks>10-5 cm/s

Ks<=10-5 cm/s

Alta

Media

Baja

La presencia de agua se considera:


.
a) baja, cuando la cara inferior del suelo en contacto con el terreno se encuentra por encima del nivel
fretico;
.
(*)

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

b) media, cuando la cara inferior del suelo en contacto con el terreno se encuentra a la misma profundidad
que el nivel fretico o a menos de dos metros por debajo;
.
c) alta, cuando la cara inferior del suelo en contacto con el terreno se encuentra a dos o ms metros por
debajo del nivel fretico.
.
(**) El coeficiente de permeabilidad del terreno se obtiene del estudio geotcnico.

Las condiciones exigidas a la solucin constructiva adoptada, en funcin del tipo de


muro, del tipo de suelo, del tipo de intervencin en el terreno y del grado de
impermeabilidad, que se obtienen de la tabla 2.4"Condiciones de las soluciones del
suelo" de la Seccin HS 1 "Proteccin frente a la humedad", son las que se encuentran
en el recuadro marcado de la tabla siguiente:
Muro flexorresistente o de gravedad
Grado
de
imperme
abilidad

Suelo elevado
Subbase

<=3

<=4

<=5

Placa

Inyeccio
Sin interSub-base
vencin
nes

Inyecciones

Sin intervencin

V1

D1

C2+C3+D1

C2+C3+D1

C2+C3+D
1

<=1
<=2

Solera

C2

V1

C2+C3

Sub-base

C2+C3

Inyecciones

Sin intervencin

D1

C2+C3+D
1

C2+C3+D
1

C2+C3+D
1

I2+S1+
S3+V1

C1+C2+C
C1+C2+C
I2+S1+S3
C2+C3+I2+
3
C1+C2+C3 C1+C2+C3
C1+C2+I2
3
I2+S1+
+
+D1+D2+C
+I2+D1+D +I2+D1+D2 +I2+D1+D2
+I2+D1+D D1+D2+S1
S3+V1 V1+D3+D
1
2
+S1+S2+S3 +S1+S2+S3
2
+S2+S3
4
+S1+S2+S3
+S1+S2+S3
+S1+S2+S3

I2+S1+
S3+V1

C1+C2+C
C2+C3+I2
3
C2+C3+I2
C1+C2+C3
C2+C3+I2+
+
C2+C3+I2
+D1+D2+D
+D1+D2+P
+I1+I2+D1+
+D1+D2+P2
+D1+D2+P2 +D1+D2+P
3
D2+D3+D4
2
2
+S1+S2+S3
+S1+S2+S3
+D4+I1+I2
+S1+S2+S3
+S2+S3
+S1+S2+S3 +P1+P2+S1
+S2+S3

I2+S1+S3
+V1+D4

I2+S1+S1
I2+S1+S
+
3
S3+V1+D
+V1+D3
3

C2+C3+I1+I
C2+C3+I2
2
+D1+D2+P +D1+D2+P1
2
+
+S1+S2+S3 P2+S1+S2+S
3

C1+C2+C
C2+C3+I1
3
C2+C3+D1
+
+I1+I2+D1
+
I2+D1+D2 +D2+D3+D
D2+I2+P2+
4
P1+P2+S1
S1+S2+S3
+S2+S3 +P1+P2+S1
+S2+S3

Las caractersticas de los puntos singulares del suelo corresponden con las
especificadas en el apartado 2.2.3 "Condiciones de los puntos singulares" de
la Seccin HS 1 "Proteccin frente a la humedad", en lo referente a:
-Encuentros del suelo con los muros
.
-Encuentros entre suelos y particiones interiores
Se comprueba que la solucin constructiva adoptada para las fachadas y las
medianeras descubiertas de la edificacin, definidas anteriormente en el apartado
correspondiente al Sistema Envolvente de la Memoria Constructiva, cumple con todas
las condiciones de diseo exigidas y descritas en la Seccin HS 1 "Proteccin frente a la
humedad".
El grado de impermeabilidad mnimo exigido a las fachadas frente a la penetracin
del las precipitaciones, en funcin de la zona pluviomtrica de promedios y del grado
de exposicin al viento correspondientes a la zona de ubicacin de la edificacin que
se obtiene en la tabla 2.5 "Grado de impermeabilidad mnimo exigido a las fachadas"

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

de la Seccin HS 1 "Proteccin frente a la humedad", es el que se encuentra en el


recuadro marcado de la tabla siguiente:
Grado de exposicin al
viento

Zona pluviomtrica de
promedios
I

II

III

IV

V1

V2

V3

Las condiciones exigidas a la solucin constructiva adoptada, en funcin de la


existencia o no de revestimiento exterior y del grado de impermeabilidad, que se
obtienen de la tabla 2.7 "Condiciones de las soluciones de fachada" de la Seccin HS
1 "Proteccin frente a la humedad", son las que se encuentran en el recuadro
marcado de la tabla siguiente:
Grado de
impermeabilidad

Con revestimiento exterior

Sin revestimiento exterior

<=1

C1(1)+J1+N1
R1+C1(1)

<=2
<=3

(1)

R1+B1+C1

<=4

R1+B2+C1

<=5

R3+C1

R1+C2
R1+B1+C2

R2+C1(1)

B3+C1 R1+B2+C2 R2+B1+C1

B1+C1
+J1+N1

C2+H1
+J1+N1

C2+J2+N2

C1(1)+H1
+J2+N2

B2+C1
+J1+N1

B1+C2+H1
+J1+N1

B1+C2
+J2+N2

B1+C1+H1
+J2+N2

B2+C2+H1
+J1+N1

B2+C2+J2+N2

B2+C1+
H1+J2+N2

B3+C1

Cuando la fachada sea de una sola hoja, se utilizar C2.

Las caractersticas de los puntos singulares de las fachadas corresponden con las
especificadas en el apartado 2.3.3 "Condiciones de los puntos singulares" de
la Seccin HS 1 "Proteccin frente a la humedad", en lo referente a:
-Juntas de dilatacin
-Arranque de la fachada desde la cimentacin
-Encuentros de la fachada con los forjados
-Encuentros de la fachada con los pilares
-Encuentros de la cmara de aire ventilada con los forjados y los dinteles
-Encuentro de la fachada con la carpintera
-Antepechos y remates superiores de las fachadas
-Anclajes a la fachada
-Aleros y cornisas.
Se comprueba que la solucin constructiva adoptada para la cubierta de la
edificacin, definida anteriormente en el apartado correspondiente al Sistema
Envolvente de la Memoria Constructiva, cumple con todas las condiciones de diseo
exigidas y descritas en la Seccin HS 1 "Proteccin frente a la humedad".

El grado de impermeabilidad exigido a las cubiertas es nico e independiente


factores climticos, alcanzndose dicho grado al cumplir con las condiciones de
apartados 2.4.2.-"Condiciones de las soluciones constructivas" y 2.4.3.-"Condiciones
los componentes" de la Seccin HS 1 "Proteccin frente a la humedad", que
resumen a continuacin:

Pedro Enrique Santos Buenda______________________Arquitecto

de
los
de
se

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Plana

Tipo

Inclinada

Pendientes (%)

Condicin
higromtrica

Uso

Cubierta plana
Cubierta inclinada

Ventilada

Peatonal

Transitable:

x
35

Convencional

Ajardinada

Invertida

Sup. total aberturas


(Sc)
Sup. total
cubierta(Ac)

Vehculos

No transitable

30>Sc>3
Ac

Sin ventilar
Aislante trmico
Barrera contra el vapor por debajo del
aislante trmico
Sistema de formacin de pendiente

Material

Poliuretano proyectado

Espesor (cm)

3.00

Capa de impermeabilizacin

-Hormign en masa

Material:

Sistema:

-Hormign aligerado

-Material bituminoso

-Adherido

-Elemento estructural(forjado)

-Lmina oxiasfalto

-Elementos prefabricados sobre tabiquillos

-Semiadherido

-Lmina betn modificado

-Chapa grecada

-PVC

-Placas aislantes

-EPDM

-Arcilla expandida en seco

-Sistema de placas

-Otro:

-Otro:

x -No adherido
-Fijacin
mecnica

Capa separadora

Tejado
Bajo Aislante trmico

-Para evitar contacto con


materiales qumicamente incompatibles
-Para evitar adherencia con otros
elementos

Bajo
impermeabilizacin
x

-Teja
x

-Pizarra
-Zinc

-Antipunzonante bajo capa proteccin

-Fibrocemento
-Sinttico

Capa de proteccin

-Galvanizado

-Impermeabilizacin con lmina


autoprotegida

-Aleacin ligera

-Capa de grava suelta

-Otro:

-Solado fijo
-Solado flotante
-Capa de rodadura
-Otro:

Las caractersticas de los puntos singulares de las cubiertas corresponden con las
especificadas en el apartado 2.4.4.-"Condiciones de los puntos singulares" de
la Seccin HS 1 "Proteccin frente a la humedad", en lo referente a:
Cubiertas inclinadas:

Cubiertas planas:

-Encuentro de la cubierta con un paramento


vertical
-Alero
-Borde lateral-Limahoyas
-Cumbreras y limatesas
-Encuentro de la cubierta con elementos
pasantes
-Lucernarios
-Anclaje de elementos
-Canalones

-Juntas de dilatacin
-Encuentro de la cubierta con un paramento
vertical
-Encuentros de la fachada con los pilares
-Encuentro de la cubierta con un borde lateral
-Encuentro de la cubierta con un sumidero o
canaln
-Rebosaderos
-Encuentro de la cubierta con elementos
pasantes

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

-Anclaje de elementos
-Rincones y esquinas
-Accesos y aberturas

3.4.2.- HS2. RECOGIDA Y EVACUACION DE RESIDUOS


3.4.2.1.- ESPACIO DE RESERVA
En la zona donde se emplaza la edificacin de uso residencial vivienda que se
proyecta existe recogida de residuos, centralizada con contenedores de calle de
superficie, por lo que se proyecta un espacio de reserva en el que pueda construirse
un almacn de contenedores cuando alguna de las fracciones de residuo pase a
.
tener recogida puerta a puerta.
Dicho espacio de reserva se ubica en el interior de la edificacin (segn se indica en
el plano correspondiente) y el almacn que se construya tendr las siguientes
caractersticas:
- Su diseo y emplazamiento propician que la temperatura interior no supere los 30
- el revestimiento de las paredes y el suelo es impermeable y fcil de limpiar; los
encuentros entre las paredes y el suelo son redondeados;
.
- cuenta con una toma de agua dotada de vlvula de cierre y un sumidero sifnico
antimridos en el suelo;
.
- dispone de una iluminacin artificial que proporciona 100 lux como mnimo a una
altura respecto del suelo de 1'00m y de una base de enchufe fija 16A 2p+T segn UNE
20.315:1994 y
.
- satisface las condiciones de proteccin contra incendios que se establecen para los
almacenes de residuos en el apartado 2 de la Seccin SI-1 del DB-SI Seguridad en caso
.
de incendio;
- el recorrido entre el almacn y el punto de recogida exterior tiene una anchura igual
o superior a 1'20m, sin escalones y con una pendiente inferior del 12%.
La superficie de reserva se obtiene por aplicacin de la frmula
siendo:

SR -la superficie de reserval [m2];


.
P -el nmero estimado de ocupantes habituales del edificio que equivale a la suma del nmero total de
dormitorios sencillos y el doble de nmero total de dormitorios dobles;
.
Ft -el factor de fraccin [m2/personas], de acuerdo con la tabla siguiente

Papel /
cartn

Envases
ligeros

Materia
orgnica

Vidrio Varios

0.039

0.060

0.005

0.012 0.038

Mf -un factor de mayoracin que se utiliza para tener en cuenta que no todos los ocupantes del edificio
separan los residuos y que es igual a 4 para la fraccin varios y a 1 para las dems fracciones.

En el siguiente cuadro se desarrolla el clculo de la superficie de reserva para el


almacn de contenedores si bien, con independencia de lo expuesto anteriormente,
dicha superficie es la que se refleja en los planos correspondientes, con el fin de que
permita el manejo adecuado de contenedores.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

CLCULO OCUPANTES
N
N Viviendas

Ratio Ocupantes

N Dormitorios dobles

N Dormitorios sencillos

N Estimado de ocupantes
habituales P

CLCULO SUPERFICIE
Factor de fraccin
(m2/persona)

Fraccin de
residuos

Factor de
mayoracin Parcial
Mf

Ff

Papel/cartn
Envases ligeros
Materia orgncia
Vidrio
Varios

0.039
0.060
0.005
0.012
0.038

Superficie de reserva

(m2)

1
1
1
1
4

0.039
0.060
0.005
0.012
0.152

Suma

0.268

para el almacn de contenedores S =


6*0.268

1.608

3.4.2.2.- ESPACIO DE ALMACENAMIENTO INMEDIATO EN LAS VIVIENDAS


Se dispone de espacios interiores en vivienda para almacenamiento inmediato de
cada una de las cinco fracciones de los residuos ordinarios generados en ella, cuya
capacidad de se obtiene por aplicacin de la frmula
, siendo:
C
-la capacidad de almacenamiento en la vivienda por fraccin [dm3];
.
CA -el coeficiente de almacenamiento [dm3/persona]con valores para cada fraccin segn la tabla
siguiente:
Papel / cartn

Envases ligeros

Materia orgnica

10.85

7.80

3.00

Vidrio Varios
3.36

10.50

Pv -el nmero estimado de ocupantes habituales de la vivienda que equivale a la suma del nmero total de
dormitorios sencillos y el doble de nmero total de dormitorios dobles.

En el siguiente cuadro se desarrolla el clculo de la capacidad de almacenamiento


en la vivienda por cada fraccin de residuos:
CLCULO OCUPANTES
N Ratio

Ocupantes

N Dormitorios dobles

N Dormitorios sencillos

N Estimado de ocupantes
habituales Pv

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

CLCULO CAPACIDAD ALMACENAMIENTO INMEDIATO EN VIVIENDA


Fraccin de residuos
dm3/persona) CA

N Ocupantes
Pv

Capacidad
almacenamiento
calculada (dm3)
C

Capacidad
almacenamiento
(dm3) s/CTE
(C=>30x30cm /
C=>45dm3)

Papel/cartn

10.85

65.10

65.10

Envases ligeros

7.80

46.80

46.80

Materia
orgncia

3.00

18.00

45.00

Vidrio

3.36

20.16

45.00

Varios

10.50

63.00

63.00

Con independencia de lo anteriormente expuesto, el espacio de almacenamiento de


cada fraccin tiene una superficie en planta no menor que 30x30 cm y es igual o
mayor que 45 dm3; los espacios destinados a materia orgnica y envases ligeros se
emplazan en la cocina o en zonas anejas auxiliares, disponindose de tal forma que el
acceso a ellos se realiza sin que haya necesidad de recurrir a elementos auxiliares y
que el punto ms alto est situado a una altura no mayor que 1,20 m por encima del
nivel del suelo; el acabado de la superficie de cualquier elemento que est situado a
menos de 30 cm de los lmites del espacio de almacenamiento es impermeable y
fcilmente lavable.

3.4.3.- HS3. CALIDAD DEL AIRE INTERIOR


A continuacin se verifica el cumplimiento de las condiciones de caudales mnimos,
diseo y dimensionado relativas al sistema de ventilacin establecidas en los
apartados 2, 3 y 4 de la seccin HS3 "Calidad del aire interior".
3.4.3.1.- DISEO
3.4.3.1.1.- CONDICIONES GENERALES DEL SISTEMA DE VENTILACION
3.4.3.1.1.1.- EN VIVIENDAS
Se proyecta un sistema de ventilacin general del tipo denominado hbrido con las
siguientes caractersticas:

el aire circula desde los locales secos a los hmedos, para ello los comedores,
los dormitorios y las salas de estar disponen de aberturas de admisin; los aseos,
las cocinas y los cuartos de bao disponen de aberturas de extraccin; las
particiones situadas entre los locales con admisin y los locales con extraccin
disponen de aberturas de paso;
los locales con varios usos de los del punto anterior, deben disponer en cada
zona destinada a un uso diferente de las aberturas correspondientes;
como aberturas de admisin se disponen aberturas dotadas de aireadores (a
una distancia del suelo mayor que 1,80m) o aperturas fijas de la carpintera
(dispositivos de microventilacin) con una permeabilidad al aire segn UNE EN
12207:2000 en la posicin de apertura de clase 1 o superior; en las carpinteras
exteriores de clase 1 de permeabilidad al aire segn UNE EN 12207:2000 se
consideran como aberturas de admisin las juntas de apertura;
las aberturas de admisin comunican directamente con el exterior,
directamente en ventilacin hbrida o mediante conducto de admisin en
ventilacin mecnica;

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

en los locales con extraccin que estn compartimentados se disponen


aberturas de paso entre los compartimentos; la abertura de extraccin se
dispone en el compartimento ms contaminado que, en el caso de aseos y
cuartos de baos, es en el que est situado el inodoro, y en el caso de cocinas
en el que est situada la zona de coccin; la abertura de paso que conecta
con el resto de la vivienda est situada en el local menos contaminado;
las aberturas de extraccin estn conectadas a conductos de extraccin y a
una distancia del techo menor que 200 mm y a una distancia de cualquier
rincn o esquina vertical mayor que 100 mm;
un mismo conducto de extraccin puede ser compartido por aseos, baos,
cocinas y trasteros
la cocina, dormitorios, comedor y sala de estar disponen de ventilacin
complementaria natural a travs de las ventanas exteriores practicables o
puertas exteriores;
la cocina dispone de un sistema adicional especfico de ventilacin con
extraccin mecnica para los vapores y los contaminantes de la coccin. Para
ello se instala un extractor conectado a un conducto de extraccin
independiente de los de la ventilacin general de la vivienda, que no se utiliza
para la extraccin de aire de locales de otro uso. Si este conducto fuese
compartido por varios extractores, cada uno de stos estar dotado de una
vlvula automtica que mantenga abierta su conexin con el conducto slo
cuando est funcionando o de cualquier otro sistema antirrevoco.

3.4.3.1.1.2.- EN APARCAMIENTOS Y GARAJE


Se proyecta un sistema de ventilacin del tipo denominado natural con las siguientes
caractersticas:

se disponen aberturas mixtas al menos en dos zonas opuestas de la fachada


de tal forma que su reparto es uniforme y que la distancia a lo largo del
recorrido mnimo libre de obstculos entre cualquier punto del local y la
abertura ms prxima a l es como mximo igual a 25 m. Si la distancia entre
las aberturas opuestas ms prximas es mayor que 30 m se dispone otra
equidistante de ambas, con una tolerancia del 5%.
En el caso de garajes que no excedan de cinco plazas ni de 100 m2 tiles, en
vez de las aberturas mixtas, pueden disponerse una o varias aberturas de
admisin que comuniquen directamente con el exterior en la parte inferior de
un cerramiento y una o varias aberturas de extraccin que comuniquen
directamente con el exterior en la parte superior del mismo cerramiento,
separadas verticalmente como mnimo 1,50 m.

3.4.3.1.2.- CONDICIONES PARTICULARES DE LOS ELEMENTOS


Aberturas y bocas de ventilacin

En ausencia de norma urbanstica que regule sus dimensiones, los espacios


exteriores y los patios con los que comuniquen directamente los locales
mediante aberturas de admisin, aberturas mixtas o bocas de toma deben
permitir que en su planta se pueda inscribir un crculo cuyo dimetro sea igual a
un tercio de la altura del cerramiento ms bajo de los que lo delimitan y no
menor que 3 m;
pueden utilizarse como abertura de paso un aireador o la holgura existente
entre las hojas de las puertas y el suelo;
las aberturas de ventilacin en contacto con el exterior deben disponerse de
tal forma que se evite la entrada de agua de lluvia o estar dotadas de
elementos adecuados para el mismo fin;

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

las bocas de expulsin deben situarse en la cubierta del edificio separadas 3 m


como mnimo, de cualquier elemento de entrada de ventilacin (boca de
toma, abertura de admisin, puerta exterior y ventana) y de los espacios
donde pueda haber personas de forma habitual, tales como terrazas, galeras,
miradores, balcones, etc;
en el caso de ventilacin hbrida, la boca de expulsin debe ubicarse en la
cubierta del edificio a una altura sobre ella de 1m como mnimo y debe
superar la altura de cualquier obstculo que est a una distancia comprendida
entre 2 y 10 m, tener 1,3 veces la altura de cualquier obstculo que est a una
distancia menor o igual que 2 m y superar una altura de 2.00 m en cubiertas
transitables.

Conductos de admisin

Los conductos deben tener seccin uniforme y carecer de obstculos en todo


su recorrido;
los conductos deben tener un acabado que dificulte su ensuciamiento y
deben ser practicables para su registro y limpieza cada 10 m como mximo en
todo su recorrido.

Conductos de extraccin para ventilacin hbrida

Cada conducto de extraccin debe disponer de un aspirador hbrido situado


despus de la ltima abertura de extraccin en el sentido del flujo del aire;
los conductos deben ser verticales;
si los conductos son colectivos no deben servir a ms de 6 plantas. Los
conductos de las dos ltimas plantas deben ser individuales. La conexin de las
aberturas de extraccin con los conductos colectivos debe hacerse a travs
de ramales verticales cada uno de los cuales debe desembocar en el
conducto inmediatamente por debajo del ramal siguiente;
los conductos deben tener seccin uniforme y carecer de obstculos en todo
su recorrido;
los conductos que atraviesen elementos separadores de sectores de incendio
deben cumplir las condiciones de resistencia a fuego del apartado 3 de la
seccin SI1;
los conductos deben tener un acabado que dificulte su ensuciamiento y
deben ser practicables para su registro y limpieza en la coronacin;
los conductos deben ser estancos al aire para su presin de dimensionado.

Conductos de extraccin para ventilacin mecnica

Cada conducto de extraccin debe disponer de un aspirador mecnico


situado, salvo en el caso de la ventilacin especfica de la cocina, despus de
la ltima abertura de extraccin en el sentido del flujo del aire, pudiendo varios
conductos compartir un mismo aspirador, excepto en el caso de los conductos
de los garajes, cuando se exija ms de una red;
la seccin de cada tramo del conducto comprendido entre dos puntos
consecutivos con aporte o salida de aire debe ser uniforme;
los conductos deben tener un acabado que dificulte su ensuciamiento y ser
practicables para su registro y limpieza en la coronacin;
cuando se prevea que en las paredes de los conductos pueda alcanzarse la
temperatura de roco stos deben aislarse trmicamente de tal forma que se
evite que se produzcan condensaciones;
los conductos que atraviesen elementos separadores de sectores de incendio
deben cumplir las condiciones de resistencia a fuego del apartado 3 de la
seccin SI1;

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

los conductos deben ser estancos al aire para su presin de dimensionado;


cuando el conducto para la ventilacin especfica adicional de las cocinas
sea colectivo, cada extractor debe conectarse al mismo mediante un ramal
que debe desembocar en el conducto de extraccin inmediatamente por
debajo del ramal siguiente.

Aspiradores hbridos, aspiradores mecnicos y extractores

Los aspiradores mecnicos y los aspiradores hbridos deben disponerse en un


lugar accesible para realizar su limpieza;
previo a los extractores de las cocinas debe disponerse un filtro de grasas y
aceites dotado de un dispositivo que indique cuando debe reemplazarse o
limpiarse dicho filtro;
debe disponerse un sistema automtico que acte de tal forma que todos los
aspiradores
hbridos
y
mecnicos
de
cada
vivienda
funcionen
simultneamente o adoptar cualquier otra solucin que impida la inversin del
desplazamiento del aire en todos los puntos.

Ventanas y puertas exteriores


.
Las ventanas y puertas exteriores que se dispongan para la ventilacin natural
complementaria deben estar en contacto con un espacio que tenga las mismas
caractersticas que el exigido para las aberturas de admisin

3.4.3.2.- DIMENSIONADO
Para el dimensionado del sistema y los elementos de ventilacin se han tenido en
cuenta los siguientes datos:

Los caudales de ventilacin mnimos exigidos para los locales que se obtiene
del cuadro siguiente, teniendo en cuenta que el nmero de ocupantes se
considera en cada dormitorio individual igual a uno, en cada dormitorio doble
igual a dos, en cada comedor o sala de estar igual a la suma de los
contabilizados para todos los dormitorios de la vivienda y que en los locales de
la vivienda destinados a varios usos se considera el caudal correspondiente al
uso para el que resulta un caudal mayor.
Caudales de ventilacin mnimos exigidos
(litros/segundo)
Por
ocupante

Por m2
til

En funcin de otros
parmetros

Cocina

50 por local (*)

Trastero y zona comn

0.7

Dormitorio

Comedor o sala de
estar

Aseo y cuarto de bao

15 por local

Aparcamiento y
garaje
Almacn de residuos

120 por plaza


10

(*)caudal correspondiente a la ventilacin adicional especfica de la cocina

El rea efectiva total de las aberturas de ventilacin de cada local, que es


como mnimo la mayor de las que se obtienen mediante las frmulas que
figuran en el siguientecuadro.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

rea efectiva de las aberturas de ventilacin de un local (cm2)


Aberturas de admisin
Aberturas de
ventilacin
(1)

4*qv 4*qva

Aberturas de extraccin

4*qv 4*qve

Aberturas de paso

70cm2 8*qvp

Aberturas mixtas (1)


8*qv
El rea total de las aberturas mixtas de cada zona opuesta

siendo:
.
-qv: caudal de ventilacin mnimo exigido de el local [l/s].
-qva: caudal de ventilacin correspondiente a cada abertura de admisin del local calculado por un
procedimiento de equilibrado de caudales de admisin y de extraccin y con una hiptesis de circulacin
del aire segn la distribucin de los locales, [l/s].
.
-qve: caudal de ventilacin correspondiente a cada abertura de extraccin del local calculado por un
procedimiento de equilibrado de caudales de admisin y de extraccin y con una hiptesis de circulacin
del aire segn la distribucin de los locales, [l/s].
.
-qvp: caudal de ventilacin correspondiente a cada abertura de paso del local calculado por un
procedimiento de equilibrado de caudales de admisin y de extraccin y con una hiptesis de circulacin
del aire segn la distribucin de los locales, [l/s].

En ventilacin hbrida, las secciones de cada tramo de los conductos de


extraccin que son como mnimo las indicadas en el cuadro siguiente
Secciones del conducto de extraccin (cm2)
Caudal en el tramo del conducto (l/s)

Clase de tiro
T1

T2

T3

T4

qvt<=100

1x125

1x400

1x625

1x625

100<qvt<=300

1x400

1x625

1x625

1x900

300<qvt<=500

1x625

1x900

1x900

2x900

500<qvt<=750

1x625

1x900

1x900+1x625

3x900

750<qvt<=1000

1x900 1x900+1x625

2x900

3x900+1x625

en funcin del caudal de aire en el tramo del conducto y de la clase del tiro
que se determinan de la siguiente forma:
.
a) el caudal de aire en el tramo del conducto [l/s], qvt, que es igual a la suma
de todos los caudales que pasan por las aberturas de extraccin que vierten al
tramo;
b) la clase del tiro se obtiene en el cuadro siguiente
Clases de tiro

Zonas trmicas

N de plantas
1 2 3 4 5 6

7 8 ms

W T3 T2 T2 T2 T1 T1 T1

T1

X T3 T3 T2 T2 T2 T1 T1

T1

Y T4 T3 T3 T2 T2 T2 T1

T1

Z T4 T4 T3 T3 T3 T3 T2

T1

en funcin del nmero de plantas existentes entre la ms baja que vierte al


conducto y la ltima, ambas incluidas, y de la zona trmica en la que se sita el
edificio de acuerdo con la tabla 4.4 "Zonas trmicas" de la seccin HS 3
"Calidad del aire interior".

En ventilacin mecnica, los conductos que se dispongan contiguos a un local


habitable, salvo que estn en cubierta o en locales de instalaciones o en
patinillos que cumplan las condiciones que establece el DB HR, la seccin
nominal de cada tramo del conducto de extraccin debe ser como mnimo
igual a la obtenida mediante la frmula siguiente: S => 2,5*qvt (4.1), siendo qvt
el caudal de aire en el tramo del conducto [l/s], que es igual a la suma de
todos los caudales que pasan por las aberturas de extraccin que vierten al
tramo.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cuando los conductos se dispongan en la cubierta, la seccin debe ser como


mnimo igual a la obtenida mediante la frmula S => 1,5*qvt.

Otros datos de la edificacin que se proyecta son:


N total de plantas Zona trmica Clase carpintera
2

3.4.3.2.1.- VIVIENDAS
La ventilacin de la vivienda que se proyecta es del tipo y con los elementos que se
indican en el cuadro siguiente y que se reflejan en los planos correspondientes.
VIVIENDA
Aberturas de ventilacin
Salncomedor

Local
Ocupacin o superf. til
(m2)

7.40

15.00

10.00

10.00

5.00

15.00

15.00

15.00

Caudal (l/s)

17.00

10.00

10.00

10.00

Abertura
(cm2)

68.00

40.00

40.00

40.00

Caudal ventilacin
mnimo (l/s)
Aberturas
Admisin
Aberturas
Extraccin

Dormit.pral. Dormit.2 Dormit.3 Cocina Bao1 Bao2

47.00

Caudal (l/s)

15.00

15.00

15.00

Abertura
(cm2)

68.00

60.00

60.00

Extraccin adicional
cocina
Aberturas
de Paso

50.00
17.00

10.00

10.00

10.00

15.00

Abertura
(cm2)

120

80.00

80.00

80.00

136.00 160.00 80.00

20.00

10.00

Conductos de extraccin
Local

Cocina
Cocina Bao1 Bao2
adicional

Tipo Ventilacin

Mecnica Hibrida Hibrida Hibrida

N plantas

Caudal (l/s)

50

15.00

15

15

T4

T4

T4

1x625

1x625

1x625

Dimensiones tiro

(cm2)

1x80

45.00

50.00

Caudal (l/s)

Tipo tiro

Totales

Pedro Enrique Santos Buenda______________________Arquitecto

92.00

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.4.3.2.2.- APARCAMIENTOS Y GARAJES


La ventilacin del aparcamiento o garaje que se proyecta es del tipo y con los
elementos que se indican en el cuadro siguiente y que se reflejan en los planos
correspondientes.
APARCAMIENTOS Y GARAJES
Natural

Tipo ventilacin

Modo de ventilacin
X

Mecnica

Superficie til (m2)

73.75

Caudal ventilacin mnimo (l/s)

120.00

Caudal (l/s)

Aberturas
Admisin

Aberturas (cm2)

Aberturas
Mixtas

Caudal (l/s)

120.00

Aberturas (cm2)

960.00

Aberturas
Extraccin

con aberturas de admisin-extraccin al exterior

Caudal (l/s)
Aberturas (cm2)
N de plantas

Conductos
deextraccin

Caudal (l/s)
Tipo de tiro
Dimensiones tiro (cm2)

3.4.3.3.- HS4. SUMINISTRO DE AGUA


A continuacin se verifica el cumplimiento de las condiciones de diseo y
dimensionado relativas a la instalacin de suministro de agua en los edificios
establecidas en los apartados 2, 3 y 4 de la seccin HS4 "Suministro de agua".

3.4.3.3.1.- DISEO
La instalacin de suministro de agua de la edificacin que se proyecta tiene
contabilizacin nica con contador general nico y est compuesta por la
acometida, la instalacin general (que contiene un armario o arqueta del contador
general, un tubo de alimentacin y un distribuidor principal) y las derivaciones
colectivas, segn el siguiente esquema:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.4.3.3.1.1.- INSTALACION DE AGUA FRIA


1.2.3.3.1.1.1.- ACOMETIDA
La acometida a la red general de suministro de agua dispone de los elementos
siguientes:

una llave de toma o un collarn de toma en carga, sobre la tubera de


distribucin de la red exterior de suministro que abra el paso a la acometida;
un tubo de acometida que enlace la llave de toma con la llave de corte
general y
una llave de corte en el exterior de la propiedad.

3.4.3.3.1.1.2.- INSTALACION GENERAL


La instalacin general que se proyecta dispone de los siguientes elementos:
Llave de corte general
La llave de corte general , que sirve para interrumpir el suministro al edificio, est
alojada en el armario o arqueta del contador general.
Armario o arqueta del contador general
.
El armario o arqueta del contador general contiene los siguientes elementos,
dispuestos en un plano paralelo al suelo y en el orden que se relacionan:

la llave de corte general, para el montaje y desmontaje del contador genera


un filtro de la instalacin general,
el contador,
una llave,
grifo o racor de prueba,
una vlvula de retencin y
una llave de salida.

La llave de salida permite la interrupcin del suministro a la edificacin y, junto con la


de corte general permiten el montaje y desmontaje del contador general.
Tubo de alimentacin
.
El trazado del tubo de alimentacin debe realizarse por zonas de uso comn.,
disponindose registros para su inspeccin y control de fugas en sus extremos y en los
cambios de direccin.
Distribuidor principal
.
El trazado del distribuidor principal se realiza por zonas de uso comn, con registros
(para inspeccin y control de fugas) en sus extremos y cambios de direccin y se
disponen llaves de corte en todas las derivaciones de manera que no se interrumpa
todo el suministro en caso de avera o reforma.
3.4.3.3.1.1.3.- INSTALACIONES PARTICULARES
Las instalaciones particulares estn compuestas de los elementos siguientes:

una llave de paso situada en el interior de la propiedad particular en lugar


accesible para su manipulacin;
derivaciones particulares, cuyo trazado se realiza de forma tal que las
derivaciones a los cuartos hmedos son independientes. Cada una de estas

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

derivaciones cuenta con una llave de corte, tanto para agua fra como para
agua caliente;
ramales de enlace;
puntos de consumo, de los cuales, todos los aparatos de descarga, tanto
depsitos como grifos, los calentadores de agua instantneos, los
acumuladores, las calderas individuales de produccin de ACS y calefaccin
y, en general, los aparatos sanitarios, llevan una llave de corte individual.

3.4.3.3.1.2.- OTRAS CONDICIONES DE LA RED DE SUMINISTRO DE AGUA


Proteccin contra retornos:
.
Se disponen sistemas antirretorno para evitar la inversin del sentido del flujo en los
puntos que figuran a continuacin:
a)
b)
c)
d)
e)

despus de los contadores;


en la base de las ascendentes;
antes del equipo de tratamiento de agua;
en los tubos de alimentacin no destinados a usos domsticos y
antes de los aparatos de refrigeracin o climatizacin.

Las instalaciones de suministro de agua no se conectan directamente a instalaciones


de evacuacin ni a instalaciones de suministro de agua proveniente de otro origen
que la red pblica. En los aparatos y equipos de la instalacin, la llegada de agua se
realiza de tal modo que no se producen retornos. Los antirretornos se disponen
combinados con grifos de vaciado de tal forma que siempre sea posible vaciar
cualquier tramo de la red.
.
Separacin respecto de otras instalaciones:
El tendido de las tuberas de agua fra se hace de tal modo que no resultan afectadas
por los focos de calor, discurriendo siempre separadas de las canalizaciones de agua
caliente (ACS o calefaccin) a una distancia de 4 cm, como mnimo. Cuando las dos
tuberas estn en un mismo plano vertical, la de agua fra va siempre por debajo de la
de agua caliente. Las tuberas van por debajo de cualquier canalizacin o elemento
que contenga dispositivos elctricos o electrnicos, as como de cualquier red de
telecomunicaciones, guardando una distancia en paralelo de al menos 30 cm y, con
respecto a las conducciones de gas, se guarda una distancia mnima de 3 cm.
Sealizacin:
Las tuberas de agua potable se sealan con los colores verde oscuro o azul y, si se
dispone una instalacin para suministrar agua que no sea apta para el consumo, las
tuberas, los grifos y los dems puntos terminales de esta instalacin estarn
adecuadamente sealados para que sean identificados como tales de forma fcil e
inequvoca.
.
Ahorro de agua
Se dispone un sistema de contabilizacin tanto de agua fra como de agua caliente
para cada unidad de consumo individualizable. En las redes de ACS se dispone una
red de retorno cuando la longitud de la tubera de ida al punto de consumo ms
alejado sea igual o mayor que 15 m.
3.4.3.3.1.3.- INSTALACION DE AGUA CALIENTE SANITARIA (A.C.S.)
En el diseo de las instalaciones de agua caliente sanitaria (ACS) se aplican
condiciones anlogas a las de las redes de agua fra y estar compuesta por una red
de impulsin y otra de retorno que cumplirn con lo dispuesto en el apartado 3.2.2.1

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

"Distribucin (impulsin y retorno) y 3.2.2.2 "Regulacin y control" de la Seccin HS4


"Suministro de agua".

3.4.3.3.2.- DIMENSIONADO
Condiciones de suministro.
.
La instalacin que se proyecta suministrar agua, a la cantidad y tipos de aparatos y
equipos del equipamiento higinico, con los caudales que figuran en la tabla
siguiente:
Caudal instantneo mnimo
para cada tipo de aparato
Tipo de aparato

De agua fria

De ACS

N (dm3/s)

N (dm3/s)

Lavamanos

0.05

0.03

Lavabo

0.10

0.065

Ducha

0.20

0.10

Baera de 1.40m o ms

0.30

0.20

0.065

Baera de menos de 1.40m

0.20

Bid

0.10

Inodoro con cisterna

0.15

0.10

Inodoro con fluxor

1.25

Urinarios con grifo temporizado

0.15

Urinarios con cisterna (c/u)

0.04

Fregadero domstico

0.20
0.30

0.20

0.15

0.10

Fregadero no domstico
Lavavajillas domstico
Lavavajillas industrial (20 servicios)

0.25

0.10

0.20

Lavadero

0.20

Lavadora domstica

0.20
0.60

0.40

0.15

0.10

Grifo de garaje

0.20

Vertedero

0.20

Parciales...

2.05

Lavadora industrial (8kg)


Grifo aislado

Total.....

0.10
0.15

0.695

2.745 dm3/s

La presin en cualquier punto de consumo no debe superar 500 kPa y la presin


mnima debe ser de 100 kPa para grifos comunes y de 150 kPa para fluxores y
calentadores.

3.4.3.3.2.1.- ARMARIO PARA CONTADOR GRAL.


ARMARIO Y CMARA PARA CONTADOR GENERAL
.
En la edificacin que se proyecta, dotada con contador general nico, se prev un
espacio para un armario o una cmara para alojar el contador general de las
dimensiones indicadas en la tabla siguiente:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Dimensiones del armario y de la cmara para el contador general


Dimetro nominal del contador en mm
Dimensiones
en mm

Armario
15

20

25

32

Cmara
40

50

65

80

100

125

150

Largo

600 600 900 900 1300

2100

2100

2200

2500

3000

3000

Ancho

500 500 500 500

600

700

700

800

800

800

800

Alto

200 200 300 300

500

700

700

800

900

1000

1000

3.4.3.3.2.2.- REDES DE DISTRIBUCION


El clculo de la red de distribucin se realiza con un primer dimensionado
seleccionando el tramo ms desfavorable de la misma y obtenindose unos dimetros
previos que posteriormente habr que comprobar en funcin de la prdida de carga
que se obtenga con los mismos. Este dimensionado se har siempre teniendo en
cuenta las peculiaridades de la instalacin y los dimetros obtenidos sern los mnimos
que hagan compatibles el buen funcionamiento y la economa de la misma.
Dimensionado de los tramos.
.
El dimensionado de la red se realiza a partir del dimensionado de cada tramo, y para
ello se parte del circuito considerado ms desfavorable, por que cuente con la mayor
prdida de presin debida tanto al rozamiento como a su altura geomtrica.
El dimensionado de los tramos se hace de acuerdo al procedimiento siguiente:
1. el caudal mximo o instalado (Qi) de cada tramo ser igual a la suma de los
caudales instantneos mnimos (Qim) de los puntos de consumo alimentados
por el mismo, de acuerdo con la tabla 2.1 "Caudal instantneo mnimo para
cada tipo de aparato" de la Seccin HS 4 "Suministro de agua".
2. establecimiento de los coeficientes de simultaneidad (k) de cada tramo de
acuerdo con el criterio siguiente:
, siendo n el nmero de aparatos
servidos desde el tramo; y Kv=[19+n]/[10(n-1)], siendo n el nmero de viviendas
o locales servidos desde el tramo.
3. determinacin del caudal de clculo (Qc) en cada tramo como producto del
caudal mximo por el coeficiente de simultaneidad correspondiente, segn el
siguiente cuadro:
4.

Tramo

Qi
n aparatos
caudal instalado
o grifos
(l/s)

Qc
caudal de clculo
(l/s)

Acometida

2'05

12

0'30

0'59

Tramo-1-Cocina

0'85

0'50

0'43

Tramo-2-Bao

0'80

0'50

0'50

Tramo-3-Aseo

0'40

0'71

0'28

5. eleccin de la velocidad de clculo de 1.50 m/s, comprendida entre 0.50 y


2.00 m/s para tuberas metlicas y entre 0.50 y 3.50 m/s para tuberas
termoplsticas y multicapas.
6. adopcin del dimetro correspondiente a cada tramo en funcin del caudal y
de la velocidad, teniendo en cuenta los dimetros mnimos de las tablas 4.2 y
4.3 de la Seccin HS 4 "Suministro de agua", segn los cuadros siguientes:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Dimetros de derivaciones a los aparatos


Aparato o punto de
consumo

Dimetro nominal del ramal de


enlace (mm)
Tubo de cobre o plstico
Mnimos s/tabla 4.2

Proyecto

Lavamanos

12

12

Lavabo

12

12

Biid

12

12

Ducha

12

12

Baera de 1.40m o ms

20

20

Baera de menos de
1.40m

20

Inodoro con cisterna

12

12

Inodoro con fluxor

25-40

Urinarios con grifo


temporizado

12

Urinarios con cisterna (c/u)

12

Fregadero domstico

12

12

Fregadero industrial

20

Lavavajillas domstico

12

12

Lavavajillas industrial (20


servicios)

20

Lavadora domstica

20

20

Lavadora industrial (8kg)

25

Vertedero

20

Dimetros mnimos de alimentacin

Tramo considerado

Dimetros nominal del tubo


de alimentacin de cobre o
plastico (mm)
Mnimo s/tabla
4.3

Proyecto

Distribuidor principal

25

32

Columna (montante o
descendente)

20

25

Alimentacin a
derivacin particular:
vivienda, apartamento,
local comercial

20

25

Alimentacin a
cuarto hmedo privado:
bao, aseo, cocina

20

20

12

20

25

32

<50kw
50Alimentacin a 250kw
equipos de
250climatizacin
500kw
>500kw

Comprobacin de la presin
.
1
Se comprueba que la presin disponible en el punto de consumo ms

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

desfavorable supera 100 kPa para grifos comunes y 150 kPa para fluxores y
calentadores, y que en todos los puntos de consumo no se supera los 150kPa, de
acuerdo con lo siguiente:
a) comprobacin de las prdidas de carga por friccin segn la frmula de
Prandtl-Colebrook:
, siendo:
- J= Prdida de carga en m.c.a./m;
- D= Dimetro interior de la tubera en m;
- V= Velocidad media del agua en m/s;
- ka= Rugosidad uniforme equivalente en m;
- vi= Viscosidad cinemtica del fluido (1.31*10-6 m2/s para agua a 10C) y
- g= Aceleracin de la gravedad 9.8 m/s2.

b) determinacin de la prdida de presin del circuito sumando las prdidas


de presin total de cada tramo. Las prdidas de carga localizadas se estiman
en un 25% de la producida sobre la longitud real del tramo.
c) comprobacin de la suficiencia de la presin disponible: una vez obtenidos
los valores de las prdidas de presin del circuito, se comprueba si son
sensiblemente iguales a la presin disponible que queda despus de descontar
a la presin total, la altura geomtrica y la residual del punto de consumo ms
desfavorable. En el caso de que la presin disponible en el punto de consumo
fuera inferior a la presin mnima exigida sera necesaria la instalacin de un
grupo de presin.

3.4.3.3.2.3.- EQUIPOS, ELEMENTOS Y DISPOSITIVOS DE LA INSTALACION


Contador general nico.
El calibre nominal del contador se adecua a los caudales nominal y mximo de la
instalacin, de acuerdo con el siguiente cuadro:
Tipo

Modelo

General Estandar

Caudal nominal (dm3/s)

Cuadal mximo (dm3/s)

Dimetro nominal DN

1.03

2.05

20

3.4.3.4.- HS5. EVACUACION DE AGUAS


A continuacin se verifica el cumplimiento de las condiciones de diseo y
dimensionado relativas a la instalacin de evacuacin de aguas residuales y pluviales
en los edificios, establecidas en los apartados 2, 3 y 4 de la seccin HS5 " Evacuain
de aguas".

3.4.3.4.1.- DISENO
3.4.3.4.1.1.- CONFIGURACION Y CONDICIONES GENERALES DE LA EVACUACION
La red de evacuacin de la edificacin que se proyecta desagua por gravedad,
mediante la correspondiente acometida, en el pozo o arqueta general de conexin
de la red de alcantarillado pblico existente en la zona, el cual dispone de un sola
conduccin para las aguas residuales y las pluviales. Por tal motivo la red de

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

evacuacin se disea con un sistema separativo, pero conectndose las aguas


pluviales y las residuales antes de su salida a la red exterior. Dicha conexin entre la red
de pluviales y la de residuales se realiza con interposicin de un cierre hidrulico que
impide la transmisin de gases de una a otra y su salida por los puntos de captacin
(calderetas, rejillas o sumideros), pudiendo estar incorporado a los puntos de
captacin de las aguas o ser un sifn final en la propia conexin.
En el presente proyecto no se prev el vertido de residuos agresivos industriales ni de
otros, distintos de los domsticos, procedentes de cualquier actividad profesional que
se ejerza en el interior de la edificacin y, si as fuese, requerira un tratamiento previo a
dicho vertido, lo que sera objeto del correspondiente proyecto tcnico.

3.4.3.4.1.2.- ELEMENTOS DE LA INSTALACION


Cierres hidrulicos
.
Los cierres o sellos hidrulicos son los dispositivos que retienen una pequea cantidad
de agua para impedir el paso del aire ftido desde la red de evacuacin a los locales
donde se instalan los aparatos sanitarios, sin que dificulten el flujo a travs de l. Los
cierres hidrulicos instalados en la edificacin que se proyecta, con las caractersticas
expuestas en el apartado 3.3.1.1 "Cierres hidrulicos" de la Seccin HS 5 "Evacuacin
de aguas", son:
.
a) sifones individuales, propios de cada aparato;
.
b) botes sifnicos, que pueden servir a varios aparatos;
.
c) sumideros sifnicos y
.
d) arquetas sifnicas, situadas en los encuentros de los conductos enterrados de
aguas pluviales y residuales, si fuese el caso.
Redes de pequea evacuacin
.
Las redes de pequea evacuacin, que son las partes de la red de evacuacin de la
edificacin que conducen los residuos desde los cierres hidrulicos (excepto desde los
inodoros) hasta las bajantes, se proyectan conforme a los criterios expuestos en el
apartado 3.3.1.2 "Redes de pequea evacuacin" de la Seccin HS 5 "Evacuacin de
aguas".
Bajantes y canalones
.
Las bajantes, que son las canalizaciones que conducen verticalmente las aguas
pluviales desde los sumideros sifnicos en cubierta y los canalones y las aguas
residuales desde las redes de pequea evacuacin e inodoros hasta la arqueta a pie
de bajante o hasta el colector suspendido, se proyectan con las caractersticas
expuestas en el apartado 3.3.1.3 "Bajantes y canalones" de la Seccin HS 5
"Evacuacin de aguas".
Colectores
.
Los colectores, que son las canalizaciones que conducen las aguas desde las bajantes
hasta la red de alcantarillado pblico, pueden ser enterrados y colgados y se
realizarn con las caractersticas que se exponen en el apartado 3.3.1.4 "Colectores"
de la Seccin HS 5 "Evacuacin de aguas".
Elementos de conexin
.
Al final de la instalacin y antes de la acometida debe disponerse el pozo general del
edificio.
Cuando la diferencia entre la cota del extremo final de la instalacin y la del punto de
acometida sea mayor que 1 m, debe disponerse un pozo de resalto como elemento
de conexin de la red interior de evacuacin y de la red exterior de alcantarillado o
los sistemas de depuracin. Los registros para limpieza de colectores deben situarse en

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

cada encuentro y cambio de direccin e intercalados en tramos rectos.


En redes enterradas la unin entre las redes vertical y horizontal y en sta, entre sus
encuentros y derivaciones, debe realizarse con arquetas dispuestas sobre cimiento de
hormign, con tapa practicable. Slo puede acometer un colector por cada cara de
la arqueta, de tal forma que el ngulo formado por el colector y la salida sea mayor
que 90.

3.4.3.4.1.3.- SUBSISTEMA DE VENTILACION DE LA INSTALACION


En la instalacin de evacuacin de la edificacin que se proyecta se dispone el
subsistema de ventilacin ,tanto en las redes de aguas residuales como en las de
pluviales, que se desribe a continuacin:
.
Subsistema de ventilacin primaria
La ventilacin primaria es suficiente como nico sistema de ventilacin para la
edificacin, pues sta tiene menos de 7 plantas, o menos de 11 con la bajante
sobredimensionada, y los ramales de desages tienen menos de 5,00m.
Las bajantes de aguas residuales se prolongan 1,30m como mnimo por encima de la
cubierta no transitable y 2,00m como mnimo sobre el pavimento de la cubierta
transitable de la edificacin. Las salidas de la ventilacin estn situadas a ms de
6,00m de cualquier toma de aire exterior para climatizacin o ventilacin y las
sobrepasa en altura, estando 50cm como mnimo por encima de la cota mxima de
cualquier hueco de recintos habitables que estn situados a menos de 6,00m.
Las salidas de la ventilacin estn convenientemente protegidas de la entrada de
cuerpos extraos y su diseo es tal que la accin del viento favorece la expulsin de
los gases. No se disponen terminaciones de columna bajo marquesinas o terrazas

1.2.3.5.- DIMENSIONADO
La red de evacuacin de la edificacin que se proyecta se define empleando un
procedimiento de dimensionado para un sistema separativo, mediante el cual se
dimensiona la red de aguas residuales por un lado y la red de aguas pluviales por otro,
de forma separada e independiente. Se utiliza el mtodo de adjudicacin del nmero
de unidades de desage (UD) a cada aparato sanitario.

3.4.3.5.1.- RED DE AGUAS RESIDUALES


Red de pequea evacuacin de aguas residuales
Derivaciones individuales
.
La adjudicacin de unidades de desage (UD) a cada tipo de aparato y los dimetros
empleados en los sifones y derivaciones individuales se exponen en el cuadro
siguiente, de acuerdo con lo establecido en la tabla 4.1 "UDs correspondientes a los
distintos aparatos sanitarios" de la Seccin HS 5 "Evacuacin de aguas".

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Unidades de desage
(UD)

Dimetro sifn
y derivacin individual
(mm)

s/tabla 4.1

Proyecto

Mnimo
s/tabla 4.1

Proyecto

32

32

Lavabo

Bid

Tipo de aparato

Ducha

c/cisterna

c/fluxor

inodoro c/cisterna

32

32

40

40

Baera (con o sin ducha)

40
40
100

Inodoro

110

100

Cuaro de bao
(lavabo, inodoro,
baera y bid)

100

inodoro c/fluxor

inodoro c/cisterna

inodoro c/fluxor

100
Cuarto de aseo
(Lavabo, inodoro y ducha)

110

100

110

6
100
3

40

40

40

40

40

40

Fregadero

Lavavajillas

Lavadora

Lavadero

Sumidero sifnico

40
40

40
40

El dimetro de cualquier conduccin nunca es menor que el de los tramos situados


aguas arriba.
Botes sifnicos o sifones individuales
.
Los sifones individuales tiene el mismo dimetro que la vlvula de desage conectada
y los botes sifnicos tienen el nmero y tamao de entradas adecuado y una altura
suficiente para evitar que la descarga de un aparato sanitario alto salga por otro de
menor altura.
Ramales colectores
.
En el cuadro siguiente se exponen los dimetros empleados en los ramales colectores
que enlazan los aparatos sanitarios y la bajante, segn el nmero mximo de unidades
de desage y la pendiente del ramal colector, de acuerdo con lo establecido en la
tabla 4.3 "Dimetros de ramales colectores entre aparatos sanitarios y bajante" de la
Seccin HS 5 "Evacuacin de aguas".

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Pendiente

Dimetros de ramales colectores


entre aparatos sanitarios y bajante

Mximo nmero de
unidades de desage
(UD)

1%

2%

4%

Dimetro
(mm)

32

40

50

11

14

63

21

28

75

47

60

75

90

123

151

181

110

180

234

280

125

438

582

800

160

870

1150

1680

200

Bajantes
.
El dimensionado de las bajantes se realiza de manera que no se rebasa el lmite de
250 Pa de variacin de presin y para un caudal tal que la superficie ocupada por el
agua no sea mayor que 1/3 de la seccin transversal de la tubera.
Los dimetros utilizados en las bajantes se especifican en el cuadro siguiente, siendo los
mayores de los valores obtenidos considerando el mximo nmero de UD en la
bajante y el mximo nmero de UD en cada ramal en funcin del nmero de plantas,
de acuerdo con la tabla 4.4 "Dimetro de las bajantes segn el nmero de alturas del
edificio y el nmero de UD" y atendiendo al criterio expuesto en el apartado 4.1.2
"Bajantes de aguas residuales", ambos de la Seccin HS 5 "Evacuacin de aguas".
Mximo nmero de UD,
para una altura de bajante de:

Mximo nmero de UD,


en cada ramal para una
altura de bajante de:

Dimetro
(mm)

Hasta 3 plantas

Ms de 3 plantas

Hasta 3 plantas

Ms de 3 plantas

10

25

50

19

38

11

63

27

53

21

13

75

135

280

70

53

90

360

740

181

134

110

540

1100

280

200

125

1208

2240

1120

400

160

2200

3600

1680

600

200

3800

5600

2500

1000

250

6000

9240

4320

1650

315

Colectores horizontales
.
Los colectores horizontales se dimensionan para funcionar a media de seccin, hasta
un mximo de tres cuartos de seccin, bajo condiciones de flujo uniforme.
Los dimetros de los colectores horizontales se definen en el cuadro siguiente, en
funcin del mximo nmero de UD y de la pendiente, de acuerdo con lo especificado
en la tabla 4.5 "Dimetro de los colectores horizontales en funcin del nmero mximo
de UD y la pendiente adoptada" de la Seccin HS 5 "Evacuacin de aguas".

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Pendiente
Dimetros de los colectores
horizontales

Mximo nmero de
unidades de desage
(UD)

1%

2%

4%

Dimetro
(mm)

20

25

50

24

29

63

38

57

75

96

130

160

90

264

321

382

110

390

480

580

125

880

1056

1300

160

1600

1920

2300

200

2900

3500

4200

250

5710

6920

8290

315

8300

10000

12000

350

3.4.3.5.2.- COLECTORES MIXTOS

Para el dimensionamiento de los colectores de tipo mixto se han transformado las


unidades de desage correspondientes a las aguas residuales en superficies
equivalentes de recogida de aguas, y se han sumado a las correspondientes a las
aguas
pluviales.
La transformacin de las unidades de desage (UD) en superficie equivalente para un
rgimen pluviomtrico de 100 mm/h se ha efectuado con el siguiente criterio:
a) para un nmero de UD menor o igual que 250 la superficie equivalente es
de 90 m2;
.
b) para un nmero de UD mayor que 250 la superficie equivalente es de 0,36 x
n UD m2.
En el cuadro siguiente se indica los dimetros de los colectores de evacuacin de tipo
mixtos, en funcin de su pendiente y de la superficie obtenida con el clculo anterior,
de acuerdo con los criterios expuestos en el apartado 4.3 "Dimensionado de los
colectores de tipo mixto" de la Seccin HS 5 "Evacuacin de aguas"
Dimetro de los colectores
(rgimen pluviomtrico 100mm/h)

Superficie de clculo (m2)

Pendiente del colector

Dimetro nominal
del colector (mm)

1%

2%

4%

125

178

253

90

229

323

458

110

310

440

620

125

614

862

1228

160

1070

1510

2140

200

1920

2710

3850

250

2016

4589

6500

315

3.4.3.5.3.- ARQUETAS
Las dimensiones de las arquetas empleadas en la red de evacuacin se indican en el
cuadro siguiente, en funcin del dimetro del colector de salida de sta, de acuerdo

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

con lo especificado en el apartado 4.5 "Accesorios" y la tabla 4.13 "Dimensiones de las


arquetas", ambos de la Seccin HS 5 "Evacuacin de aguas"

Dimetro del
colector
de salida (mm)

Dimesiones
LargoAncho
(cm)

100

4040

150

<5050

200

6060

250

6070

300

7070

350

7080

400

8080

450

8090

500

9090

3.4.3.5.4.- SISTEMA DE VENTILACION


A continuacin se dimensionan los sistemas de ventilacin dispuestos para la red de
evacuacin proyectada.
.
Ventilacin primaria
La ventilacin primaria tiene el mismo dimetro que la bajante de la que es
prolongacin, aunque a ella se conecte una columna de ventilacin secundaria,
como proteccin de del cierre hidrulico.

3.5.- DB HR.PROTECCION CONTRA EL RUIDO


La edificacin que se proyecta, con el fin de limitar en su interior y en condiciones
normales de utilizacin el riesgo de molestias o enfermedades que el ruido pueda
producir a los usuarios como consecuencia de las caractersticas de su proyecto,
construccin, uso y mantenimiento, satisface las exigencias bsicas que se establecen
en el documento bsico DB HR "Proteccin frente al ruido, pues en el presente
proyecto se aplican correctamente los parmetros, objetivos y sistemas de verificacin
especificados en dicho documento bsico.

3.5.1.- PROCEDIMIENTO DE VERIFICACION


Para satisfacer las exigencias del documento bsico DB HR "Proteccin frente al
ruido":
Se alcanzan los valores lmite de aislamiento acstico a ruido areo y no se superan
los valores lmite de nivel de presin de ruido a impactos (aislamiento acstico a ruido
de impactos) que se establecen en el apartado 2.1 "Valores lmite de aislamiento" de
este documento bsico;
.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

No se superan los valores lmite de tiempo de reverberacin que se establecen en el


apartado 2.2 "Valores lmite de tiempo de reverberacin" de este documento bsico y
Se cumplen las especificaciones del apartado 2.3 "Ruido y vibraciones de las
instalaciones" de este documento bsico.
Para la correcta aplicacin del documento bsico DB HR "Proteccin frente al ruido" se
realizan las verificaciones expuestas en el punto 2 del apartado 1.1 "Procedimiento de
verificacin" de este documento bsico.
Para satisfacer la justificacin documental del proyecto, se cumplimentan e incluyen
en ste las fichas justificativas de la opcin simplificada K1 y K4 del Anejo K "Fichas
justificativas" de este documento bsico.

3.5.2.- CARACTERIZACION Y CANTIFICACION DE LAS EXIGENCIAS


Para satisfacer las exigencias del documento bsico DB HR "Proteccin frente al
ruido" se cumplen las condiciones que se indican a continuacin, teniendo en cuenta
que stas se aplican a los elementos constructivos totalmente acabados, es decir,
albergando las instalaciones del edificio o incluyendo cualquier actuacin que pueda
modificar las caractersticas acsticas de dichos elementos.
Valores lmite de aislamiento
.
Los elementos constructivos interiores de separacin, as como las fachadas, las
cubiertas, las medianeras y los suelos en contacto con el aire exterior que conforman
cada recinto de la edificacin que se proyecta tienen, en conjuncin con los
elementos constructivos adyacentes, unas caractersticas tales que se cumplen las
condiciones expuestas en el apartado 2.1 "Valores lmite de aislamiento" de este
documento bsico.
Ruido y vibraciones de las instalaciones
.
Para limitar los niveles de ruido y de vibraciones que las instalaciones puedan transmitir
a los recintos protegidos y habitables de la edificacin que se proyecta, se cumplen
las condiciones expuestas en al apartado 2.3 "Ruido y vibraciones de las instalaciones"
de este documento bsico.

3.5.3.- DISENO Y DIMENSIONADO


Datos previos

rea acstica de ubicacin

Tipo:

Suelo de uso residencial

Valor Ld en dBA:

60

Uso:

Residencial, vivienda unifamiliar

Valores D2m,nT,Atr en dBA :


Edificacin

Valores de magnitudes
de elementos constructivos:

Dormitorios:

30

Estancias:

30

Los indicados en la Memoria Constructiva

Valores de magnitudes de ruidos


Los indicados en la Memoria Constructiva
y vibraciones de instalaciones:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Procedimiento
Para el diseo y dimensionado de los elementos constructivos se opta por el
procedimiento denominado "Opcin simplificada" que proporciona soluciones de
aislamiento que dan conformidad a las exigencias de aislamiento a ruido areo y a
ruido de impactos y que es vlida para edificios de cualquier uso con estructura
horizontal resistente formada por forjados de hormign macizos o aligerados, o forjados
mixtos de hormign y chapa de acero.
Los elementos constructivos que se disean y dimensionan son :
.
a) la tabiquera;
.
b) los elementos de separacin horizontales y los verticales (expuestos en el apartado
3.1.2.3 "Elementos de separacin) entre unidades de uso diferentes o entre una unidad
de uso y cualquier otro recinto del edificio que no sea de instalaciones o de actividad
y entre un recinto protegido o un recinto habitable y un recinto de actividad o un
recinto de instalaciones;
.
c) las medianeras (expuestas en el apartado 3.1.2.4 "Condiciones mnimas de las
.
medianeras") y
d) las fachadas, las cubiertas y los suelos en contacto con el aire exterior. (expuestos
en el apartado 3.1.2.5 "Condiciones mnimas de las fachadas, las cubiertas y los suelos
en contacto con el aire exterior").

3.5.4.- FICHAS DE LA OPCION SIMPLIFICADA


Las fichas justificativas K1 del Anejo K "Fichas justificativas" del documento bsico DB
HR "Proteccin frente al ruido" que se incorporan y cumplimentan a continuacin,
justifican documentalmente el cumplimiento de los valores lmite de aislamiento
acstico mediante la opcin simplificada.

Tabiquera. (apartado 3.1.2.3.3)


Caractersticas

Tipo

de proyecto

exigidas

PV1 - Tabicn de ladrillo hueco doble de 7cm y enlucido de yeso-perlita en ambas m (kg/m2) = 36 >= 28
caras
RA (dBA) = 00 >= 00
m (kg/m2)
=

>=

RA (dBA) =

>=

m (kg/m2) =

>=

RA (dBA) =

>=

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Elementos de separacin verticales entre recintos. (apartado 3.1.2.3.4)


Soluciones de elementos de separacin verticales entre:
Elementos constructivos

Caractersticas

Tipo

exigidas

m (kg/m2) =

60 >=

60

RA (dBA) =

00 >=

00

Trasdosado por
ambos lados

RA (dBA) =

00 >=

00

Puerta o
ventana

RA (dBA) =

00 >=

00

Cerramiento

RA (dBA) =

00 >=

00

Elemento base

PV3-1/2

Elemento de separacin vertical

Elemento de separacin vertical


con puertas y/o ventanas

de proyecto

pie ladrillo perfor. con


revest. a dos caras

Condiciones de las fachadas a las que acometen los elementos de separacin verticales
Fachada

Caractersticas

Tipo

de proyecto

exigidas

m (kg/m2) =

00 >=

00

RA (dBA) =

00 >=

00

Elementos de separacin horizontales entre recintos. (apartado 3.1.2.3.5)


Soluciones de elementos de separacin horizontales entre:
Elementos constructivos

Caractersticas

Tipo
PH1 - Forjado unidireccional 30cm,
pavimento y aislante

Forjado
Elemento de
separacin horizontal

de proyecto

Suelo Flotante
Techo suspendido

m (kg/m2) =

exigidas

420.10

>=

00

60

>=

60

RA (dBA) =
RA (dBA) =

00

>=

00

Lw (dB) =

00

>=

00

RA (dBA) =

00

>=

00

Medianeras. (apartado 3.1.2.4)


Caractersticas

Tipo

de proyecto

SEDF2 - Bloque cermico 24cm con revestimiento exterior e interior.

RA (dBA) =

exigidas

41

>=

RA (dBA) =

>=

RA (dBA) =

>=

33

Fachadas, cubiertas y suelos en contacto con aire exterior (apartado 3.1.2.5)


Soluciones de fachadas en contacto con el ire exterior:
Elementos
constructivos
Parte ciega
Huecos

Tipo

rea (1)
en m2

SEXT0 - 1/2 Bloqueceramico aligerado


revstimineto exterior e interior

62.35

SEXT52 - Ventana/puerta acrist. marco


metlico c/ rotura puente trmico

31.59

%
Huecos

=Sc

Caractersticas
de proyecto

exigidas

RA,tr (dBA)=

52

>=

45

RA,tr (dBA)=

30

>=

28

33.62
=Sc

Parte ciega

00

=Sc

Huecos

00

=Sc

Parte ciega

00

=Sc

Huecos

00

=Sc

00
00

Pedro Enrique Santos Buenda______________________Arquitecto

RA,tr (dBA)=

>=

RA,tr (dBA)=

>=

RA,tr (dBA)=

>=

RA,tr (dBA)=

>=

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Fachadas, cubiertas y suelos en contacto con aire exterior (apartado 3.1.2.5)


Soluciones de cubiertas en contacto con el ire exterior:
Elementos
constructivos
Parte ciega

Tipo
SEXT21- Inclinada teja mixta, cmara aire
ventilada, forjado unidirec. horizontal.

Huecos

rea (1)
en m2
94.55

=Sc

%
Huecos
00

=Sc

Caractersticas
de proyecto
RA,tr (dBA)=

52

exigidas
>=

RA,tr (dBA)=

>=

Parte ciega

=Sc

RA,tr (dBA)=

>=

Huecos

=Sc

RA,tr (dBA)=

>=

Parte ciega

=Sc

RA,tr (dBA)=

>=

Huecos

=Sc

RA,tr (dBA)=

>=

3.6.- DB HE. AHORRO DE ENERGIA


La edificacin que se proyecta, con el fin de conseguir un uso racional de la energa
necesaria para su utilizacin reduciendo a lmites sostenibles su consumo y conseguir
asimismo que una parte de este consumo proceda de fuentes de energa renovable,
satisface las exigencias bsicas que se establecen en el documento bsico DB HE
"Ahorro de energa, pues en el presente proyecto se aplican correctamente los
parmetros y procedimientos contenidos en dicho documento bsico.

3.6.1.- HE1. LIMITACION DE DEMANDA ENERGETICA


La seccin HE 1 "Limitacin de la demanda energtica" del documento bsico DB
HE "Ahorro de energa" es de aplicacin en el presente proyecto, de acuerdo con lo
expuesto en el apartado 1.1. "mbito de aplicacin" de dicha seccin, por que:
X Se proyecta una edificacin de nueva construccin
Se proyecta la modificacin, reforma o rehabilitacin de la edificacin existente
de superficie til >1000 m2 donde se renueva ms del 25% del total de sus cerramientos,

A continuacin se justifica el cumplimiento de la exigencia bsica HE 1 "Limitacin de


la demanda energtica", garantizando que la edificacin que se proyecta dispone
de una envolvente de caractersticas tales que limita adecuadamente la demanda
energtica necesaria para alcanzar el bienestar trmico en funcin del clima de la
localidad, del uso del edificio y del rgimen de verano y de invierno, as como por sus
caractersticas de aislamiento e inercia, permeabilidad al aire y exposicin a la
radiacin solar, reduciendo el riesgo de aparicin de humedades de condensacin
superficiales e intersticiales que puedan perjudicar sus caractersticas y tratando
adecuadamente los puentes trmicos para limitar las prdidas o ganancias de calor y
evitar problemas higrotrmicos en los mismos.

Pedro Enrique Santos Buenda______________________Arquitecto

33

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.6.1.1.- PROCEDIMIENTO DE VERIFICACION


Para la correcta aplicacin de la seccin HE 1 "Limitacin de la demanda
energtica" se realizan las siguientes verificaciones:
Se limita la presencia de condensaciones en la superficie y en el interior de los
cerramientos y se limitan las prdidas energticas debidas a las infiltraciones de aire,
para unas condiciones normales de utilizacin de la edificacin que se proyecta,
mediante el procedimiento de comprobacin (opcin simplificada u opcin general)
que se indica ms adelante.
.
Durante el proceso de construccin de la edificacin que se proyecta se
comprobarn las indicaciones descritas en el apartado 5 "Construccin" de la Seccin
HE 1 "Limitacin de la demanda energtica".

3.6.1.2.- CARACTERIZACION Y CANTIFICACION DE LAS EXIGENCIAS


Demanda energtica.
1. La demanda energtica de la edificacin se limita en funcin del clima de la
localidad en la que se ubica, segn la zonificacin climtica establecida en el
apartado 3.1.1"Zonificacin climtica", y de la carga interna en sus espacios
segn el apartado 3.1.2 "Clasificacin de los espacios", ambos de la seccin HE
1 "Limitacin de la demanda energtica".
2. La demanda energtica ser inferior a la correspondiente a un edificio en el
que los parmetros caractersticos de los cerramientos y particiones interiores
que componen su envolvente trmica, sean los valores lmites establecidos en
las tablas 2.2 "Valores lmite de los parmetros caractersticos medios" de la
seccin HE 1 "Limitacin de la demanda energtica".
3. Los parmetros caractersticos que definen la envolvente trmica se agrupan
.
en los siguientes tipos:
a) transmitancia trmica de muros de fachada UM;
b) transmitancia trmica de cubiertas UC;
c) transmitancia trmica de suelos US;
d) transmitancia trmica de cerramientos en contacto con el terreno UT;
e) transmitancia trmica de huecos UH ;
f) factor solar modificado de huecos FH;
g) factor solar modificado de lucernarios FL;
h) transmitancia trmica de medianeras UMD.
4. Para evitar descompensaciones entre la calidad trmica de diferentes
espacios, cada uno de los cerramientos y particiones interiores de la
envolvente trmica tendrn una transmitancia no superior a los valores
indicados en la tabla 2.1 de la seccin HE 1 "Limitacin de la demanda
energtica".
5. En edificios de viviendas, las particiones interiores que limitan las unidades de
uso con sistema de calefaccin previsto en el proyecto, con las zonas comunes
del edificio no calefactadas, tendrn cada una de ellas una transmitancia
mxima de 1,2 W/m2K.
Condensaciones.
1. Las condensaciones superficiales en los cerramientos y particiones interiores
que componen la envolvente trmica del edificio, se limitarn de forma que se
evite la formacin de mohos en su superficie interior. Para ello, en aquellas

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

superficies interiores de los cerramientos que puedan absorber agua o


susceptibles de degradarse y especialmente en los puentes trmicos de los
mismos, la humedad relativa media mensual en dicha superficie ser inferior al
80%.
2. Las condensaciones intersticiales que se produzcan en los cerramientos y
particiones interiores que componen la envolvente trmica del edificio sern
tales que no produzcan una merma significativa en sus prestaciones trmicas o
supongan un riesgo de degradacin o prdida de su vida til. Adems, la
mxima condensacin acumulada en cada periodo anual no ser superior a
la cantidad de evaporacin posible en el mismo periodo.
Permeabilidad del aire.
1. Las carpinteras de los huecos (ventanas y puertas) y lucernarios de los
cerramientos se caracterizan por su permeabilidad al aire.
2. La permeabilidad de las carpinteras de los huecos y lucernarios de los
cerramientos que limitan los espacios habitables de la edificacin con el
ambiente exterior se limita en funcin del clima de la localidad en la que se
ubica, segn la zonificacin climtica establecida en el apartado
3.1.1"Zonificacin climtica" de la seccin HE 1 "Limitacin de la demanda
energtica".
3. La permeabilidad al aire de las carpinteras, medida con una sobrepresin de
100 Pa, tendr unos valores inferiores a los siguientes:
a) para las zonas climticas A y B:
50 m3/h m2 ;
b) para las zonas climticas C, D y E: 27 m3/h m2.

3.6.1.3.- CALCULO Y DIMENSIONADO


1.4.1.3.1.- DATOS PREVIOS
Zonificacin climtica.
Mediante el procedimiento par la determinacin de la zonificacin climtica que se
recoge en apartado D.1 "Determinacin de la zona climtica a partir de valores
tabulados", la tabla D.1"Zonas climticas", ambos del apndice D "Zonas climticas" y
la tabla G.2 "Datos climticos mensuales de capitales de provincia, T en C y HR en %"
del apndice G "Condensaciones", todos de la seccin HE 1 "Limitacin de la
demanda energtica" se obtienen los siguientes datos:
Altitud
(m)

Ubicacin
Capital provincia

Mlaga

Localidad

Ronda

700

Desnivel
(m)
700

Temperatura
(enero) C

Humedad Relativa
(enero) %

Zona
climtica

12.20

71.00

A3

4.81

96.70

C1

Clasificacin de los espacios.


Los espacios interiores habitables de la edificacin que se proyecta se clasifican,
segn el apartado 3.1.2 "Clasificacin de los espacios" de la seccin HE 1 "Limitacin
de la demanda energtica", en:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

A efectos de clculo de la demanda energtica:


X

A efectos de la limitacin de condensaciones


en los cerramientos:

Espacios con carga interna baja

Espacios de clase higromtrica 5

Espacios con carga interna alta

Espacios de clase higromtrica 4


X Espacios de clase higromtrica 3 o inferior

Definicin de la envolvente trmica de la edificacin y clasificacin de sus


componentes.
La envolvente trmica de la edificacin, compuesta por todos los cerramientos que
limitan espacios habitables con el ambiente exterior (aire o terreno u otro edificio) y
por todas las particiones interiores que limitan los espacios habitables con los espacios
no habitables que a su vez estn en contacto con el ambiente exterior, se clasifica , de
acuerdo con el apartado 3.1.3 "Definicin de la envolvente tmica de la edificacin y
clasificacin de sus componentes" de la seccin HE 1 "Limitacin de la demanda
energtica", en las siguientes categoras:

Segn su situacin

Segn su comportamiento trmico

X Cubiertas

- Cerramientos en contacto con el aire:

X Suelos

X parte opaca

X Fachadas

X parte semitransparente

- Cerramientos en contacot con el terreno:

Medianeras

X Cerramientos en contacto con el terreno


X Particiones interiores

X suelos en contacto con el terreno


muros en contacto con el terreno
cubiertas enterradas
- Particiones interiores en contacto con espacios no habitables:
X Particiones interiores en contacto con cualquier
espacio no habitable (excepto cmaras sanitarias)
suelos en contacto con cmaras sanitarias.

3.6.1.3.2.- OPCION SIMPLIFICADA


Para la correcta aplicacin de la seccin HE 1 "Limitacin de la demanda
energtica" en el presente proyecto se opta por el procedimiento de verificacin
denominado "OPCIN SIMPLIFICADA", basada en el control indirecto de la demanda
energtica de la edificacin mediante la limitacin de los parmetros caractersticos
de los cerramientos y particiones interiores que componen su envolvente trmica. La
comprobacin se realiza a travs de la comparacin de los valores obtenidos en el
clculo con los valores lmite permitidos.

El objeto de la opcin simplificada es:


a) limitar la demanda energtica de la edificacin, de una manera indirecta,
mediante el establecimiento de determinados valores lmite de los parmetros
de transmitancia trmica U y del factor solar modificado F de los componentes

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

de la envolvente trmica;
.
b) limitar la presencia de condensaciones en la superficie y en el interior de los
cerramientos para las condiciones ambientales establecidas en este
Documento Bsico;
.
c) limitar las infiltraciones de aire en los huecos y lucernarios;
d) limitar en los edificios de viviendas la transmisin de calor entre las unidades
de uso calefactadas y las zonas comunes no calefactadas.
Esta opcin puede aplicarse a la edificacin que se proyecta por que se cumplen
simultneamente los requisitos especificados en el apartado 3.2.1.2 "Aplicabilidad" de
la seccin HE 1 "Limitacin de la demanda energtica", tal como se observa en el
cuadro siguiente:

Orientacin

Fachadas

Totales

Norte

Este

Sureste

Sur

Suroeste

Oeste

Superficie fachada (m2)

60.00

41.50

0.00

60.00

0.00

40.90

238.50

% de fachada sobre total

27.30

22.90

0.00

27.30

0.00

22.50

100.00

0.00

9.00

0.00

0.00

0.00

8.80

22.80

0.00

17.70

0.00

0.00

0.00

17.70

Superficie huecos

(m2)

% de huecos sobre fachada


Limitacin HE 1

(%) (*)

< 60

(*) Como

excepcin, se admiten superficies de huecos superiores al 60% en aquellas fachadas cuyas


reas supongan un porcentaje inferior al 10% del rea total de las fachadas del edificio.

Cubierta
Superficie cubierta (m2)

94.55

Superficie lucernario (m2)

0.00

% lucernario sobre cubierta

0.00

Limitacin HE 1 (%)

<5

A continuacin se justifica el cumplimiento de las condiciones que se establecen en a


seccin HE 1 "Limitacin de la demanda energtica" mediante las fichas justificativas
del clculo de los parmetros caractersticos medios y los formularios de conformidad
que figuran en el Apndice H "Fichas justificativas de la opcin simplificada" para la
zona habitable de baja carga interna y la de alta carga interna de la edificacin.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

FICHA 1. Clculo de los parmetros caractersticos medios


ZONA CLIMTICA

C1

Zona de baja carga interna

Zona de alta carga interna

MUROS (UMm) y (UTm)


Tipos
Bloque cerm. 29cm s/aisl.

A (m2)

U (W/m2k)

AU (W/k)

60.00

0.551

33.09

Resultados
Suma A=90.00

Suma AU=33.09
UMm=Suma AU/Suma A=0.55
Bloque cerm. 29cm s/aisl.

41.53

0.551

22.90

Suma A=41.53

Suma AU=22.90
UMm=Suma AU/Suma A=0.55
Bloque cerm. 29cm s/aisl.

40.87

0.551

22.54

Suma A=40.87

Suma AU=22.54
UMm=Suma AU/Suma A=0.55
Bloque cerm. 29cm s/aisl.

60.03

0.551

31.10

Suma A=30.03

Suma AU=33.10
UMm=Suma AU/Suma A=0.55
Suma A=

SE

Suma AU=
UMm=Suma AU/Suma A=
Suma A=

SO

Suma AU=
UMm=Suma AU/Suma A=
Suma A=

C-TER

Suma AU=
UMm=Suma AU/Suma A=

SUELOS (USm)
Tipos
Solera hormign+encachado.

A (m2)

U (W/m2k)

AU (W/k)

94.52

0.213

20.13

Resultados
Suma A=94.52
Suma AU=20.13
USm=Suma AU/Suma A=0.21

CUBIERTAS Y LUCERNARIOS (UCm, FLm)


Tipos

A (m2)

U (W/m2k)

AU (W/k)

Cubierta teja ventilada.

94.55

0.329

31.23

Resultados
Suma A=94.55
Suma AU=31.23
UCm=Suma AU/Suma A=0.33

Tipos

A (m2)

AF (m2)

Resultados
Suma A=
Suma AF=
ULm=Suma AF/Suma A=

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

HUECOS (UHm) y (FHm)


Tipos

A (m2)

U (W/m2k)

AU (W/k

Resultados
Suma A=

Suma AU=
UMm=Suma AU/Suma A=
Tipos
PVC/Aluminio, Doble crist. 6-8-4

A (m2)

8.96

2.400

AU

0.68 21.49

AF (m2) Resultados
6.13

Suma A= 8.69
Suma AU=21.49

Suma AF= 6.13


UMm=Suma AU/Suma A=2.40
FHm=Suma AF/Suma A=0.68
PVC/Aluminio, Doble crist. 6-8-4

8.76

2.400

0.68 21.02

6.00

Suma A=8.76
Suma AU=21.02

Suma AF=6.00
UMm=Suma AU/Suma A=2.40
FHm=Suma AF/Suma A=0.68
Suma A=
Suma AU=

Suma AF=
UMm=Suma AU/Suma A=
FHm=Suma AF/Suma A=
Suma A=
Suma AU=

SE

UMm=Suma AU/Suma A=
UMm=Suma AU/Suma A=
FHm=Suma AF/Suma A=
Suma A=
Suma AU=

SO

Suma AF=
UMm=Suma AU/Suma A=
FHm=Suma AF/Suma A=

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

FICHA 2. CONFORMIDAD-Demanda energtica


ZONA CLIMTICA

C1

Zona de baja carga interna

Zona de alta carga interna

Umax
Cerramientos y particiones interiores de la envolvente trmica

Umax

(proyecto)
(1)

Muros de fachada

(2)

0.45

Primer metro del permetro de suelos apoyados y muros en contacto con el terreno

0.72

Particiones interiores en contacto con espacios no habitables

0.00

Suelos

0.25

Cubiertas

0.33

0.53

Vidrios y marcos de huecos y lucernarios

2.40

4.40

Medianeras

0.45

1.00

Particiones interiores (edificios de viviendas)(3)

0.55

MUROS DE FACHADA
UMmx
N

<=

0.65

1.20
w/m2k

UHlim

UHm

UHlim

FHm

FHlim

(5)

(4)

(5)

(4)

(5)

0.00

4.40

0.55

0.55

2.40

3.90

0.68

0.55

2.40

3.90

0.68

<=

0.73

0.55

4.40

0.00

0.00

0.00

4.40

0.00

SO

0.00

0.00

4.40

0.00

CERR. CONTACTO TERRENO

SUELOS

0.00

<=

SE

CUBIERTAS Y LUCERNARIOS

UTlim

USm

USlim

UCm

UClim

(4)

(5)

(4)

(5)

(4)

(5)

FLm

0.73

0.36

0.50

0.33

0.41

0.00

<=

<=

<=

<=

<=

LUCERNARIOS

UTm
<=

<=

HUECOS
(4)

0.00

0.950

FLlim
<=

0.37

Umax(proyecto) corresponde al mayor valor de la transmitancia de los cerramientos o particiones interiores


indicados en proyecto.
(2) Umax corresponde a la transmitancia trmica mxima definida en la tabla 2.1 para cada tipo de
cerramiento o particin interior.
(3) En edificios de viviendas, Umax(proyecto) de particiones interiores que limiten unidades de uso con un sistema
de calefaccin previsto desde proyecto con las zonas comunes no calefactadas.
(4) Parmetros caractersticos medios obtenidos en la ficha 1.
(5) Valores lmite de los parmetros caractersticos medios definidos en la tabla 2.2.
(1)

FICHA 3. CONFORMIDAD-Condensaciones
ZONA CLIMTICA C1

Zona de baja carga interna X

Zona de alta carga interna

CERRAMIENTOS, PARTICIONES INTERIORES, PUENTES TRMICOS


Tipos
Cubierta-1
Cerrami-1

C. Superficiales
fRsi>=fRsmin
fRsi

0.9177

C. Intersticiales
Pn<=Psat,n

Capa 1

Capa 2

Capa 3

Capa 4

Capa 5

Capa 6

Psat,n

1065.69

1102.09

1340.13

2043.41

2216.13

2279.021
1285.32

fRsmin

0.5600

Pn

1033.21

1067.56

1067.56

1070.99

1277.08

fRsi

0.8621

Psat,n

1077.74

1676.47

2023.30

2189.13

2212.40

fRsmin

0.5600

Pn

1021.00

1202.65

1227.70

1277.81

1285.32

fRsi

Psat,n

fRsmin

Pn

fRsi

Psat,n

fRsmin

Pn

fRsi

Psat,n

Pedro Enrique Santos Buenda______________________Arquitecto

Capa 7

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

3.6.2.- HE2.RENDIMIENTO DE LAS INSTALACIONES TERMICAS


La edificacin que se proyecta, con el fin de proporcionar a sus usuarios bienestar
trmico, dispone de las instalaciones trmicas apropiadas que satisfacen las
exigencias de bienestar e higiene, de eficiencia energtica y de seguridad que deben
cumplir dichas instalaciones, segn lo dispuesto en el vigente Reglamento de
Instalaciones Trmicas en los Edificios (RITE), Real Decreto 1027/2007, de 20 de julio, la
Correccin de errores de 28 de febrero de 2008 y el Real Decreto 1826/2009 de 27 de
noviembre por el que se aprueba la modificacin. del R.D. 1027/2007. A tales efectos,
dicho reglamento, considera como instalaciones trmicas las instalaciones fijas de
climatizacin (calefaccin, refrigeracin y ventilacin) y de produccin de agua
caliente sanitaria, destinadas a atender la demanda de bienestar trmico e higiene
de las personas.
En el presente proyecto se prevn las instalaciones trmicas siguientes:
Calefaccin
Refrigeracin
Ventilacin
X

Produccin de Agua Caliente Sanitaria

que se ejecutarn sobre la base de la documentacin tcnica que, en funcin de la


importancia de dichas instalaciones, se indica a continuacin:
La potencia trmica nominal a instalar es mayor que 70 kW en generacin de calor o fro,
por lo que, segn el punto 1 a) y 2 del artculo 15 "Documentacin tcnica de diseo y dimensionado de las instalaciones trmicas", en documento aparte, se adjunta Proyecto redactado por
tcnico competente y visado por el colegio correspondiente, que cumple con lo dispuesto en
el artculo 16 "Proyecto" del RITE.
La potencia trmica nominal a instalar es igual o mayor que 5 kW y menor o igual que
70 kW en generacin de calor o fro,
por lo que, segn el punto 1 b) y 2 del artculo 15 "Documentacin tcnica de diseo y dimensionado de las instalaciones trmicas", en documento aparte, se adjunta Proyecto redactado por
tcnico competente y visado por el colegio correspondiente o Memoria Tcnica elaborada
por instalador autorizado, que cumple con lo dispuesto en el artculo 16 "Proyecto" o 17
"Memoria tcnica" respectivamente del RITE.
La potencia trmica nominal a instalar es menor que 5 kW en generacin de calor o fro,
por lo que, segn el punto 1 c) del artculo 15 "Documentacin tcnica de diseo y dimensionado
de las instalaciones trmicas", no es preceptiva la presentacin de Memoria tcnica o Proyecto
para acreditar el cumplimiento del RITE
X

La produccin de ACS se realiza por medio de calentadores instantneos, calentadores


acumuladores, termos elctricos con potencia nominal menor o igual que 70 kW o
sistemas solares de un nico elemento prefabricado,
por lo que, segn el punto 1 c) del artculo 15 "Documentacin tcnica de diseo y dimensionado
de las instalaciones trmicas", no es preceptiva la presentacin de Memoria tcnica o Proyecto
para acreditar el cumplimiento del RITE

En el caso de las instalaciones solares trmicas la documentacin tcnica de diseo


requerida es la que corresponde a la potencia trmica nominal en generacin de
calor o fro del equipo de energa de apoyo.
En cualquiera de los casos, para su correcto diseo y dimensionado, las instalaciones
trmicas que se proyectan cumplirn las exigencias recogidas en la Instruccin
Tcnica IT.1 "Diseo y dimensionado" del RITE que se relacionan a continuacin:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Exigencia de bienestar e higiene (IT 1.1)


.
Para la correcta aplicacin de esta exigencia, en el diseo y dimensionado de las
instalaciones trmicas que se proyectan, se realizan las verificaciones siguientes:
Cumplimiento de la exigencia de calidad trmica del ambiente del apartado 1.1.4.1
de las Instrucciones Tcnicas;
.
Cumplimiento de la exigencia de calidad del aire interior del apartado 1.1.4.2 de las
Instrucciones Tcnicas;
.
Cumplimiento de la exigencia de calidad acstica del apartado 1.4.3.d de las
Instrucciones Tcnicas y
.
Cumplimiento de la exigencia de higiene del apartado 1.1.4.4 de las Instrucciones
Tcnicas.
Exigencias de eficiencia energtica (IT 1.2)
.
Para la correcta aplicacin de esta exigencia, en el diseo y dimensionado de las
instalaciones trmicas que se proyectan, se adopta el procedimiento simplificado de
verificacin, realizndose las verificaciones siguientes:
Cumplimiento de la exigencia de eficiencia energtica en la generacin de calor y
fro del apartado 1.2.4.1 de las Instrucciones Tcnicas;
.
Cumplimiento de la exigencia de eficiencia energtica en las redes de tuberas y
conductores de calor y fro del apartado 1.2.4.2 de las Instrucciones Tcnicas;
Cumplimiento de la exigencia de eficiencia energtica de control de las
instalaciones trmicas del apartado 1.2.4.3 de las Instrucciones Tcnicas;
Cumplimiento de la exigencia de contabilizacin de consumos del apartado 1.2.4.4
.
de las Instrucciones Tcnicas;
Cumplimiento de la exigencia de recuperacin de energa del apartado 1.2.4.5 de
las Instrucciones Tcnicas,
.
Cumplimiento de la exigencia de aprovechamiento de energas renovables del
apartado 1.2.4.6 de las Instrucciones Tcnicas y
.
Cumplimiento de la exigencia de limitacin de la utilizacin de energa
convencional del apartado 1.2.4.7 de las Instrucciones Tcnicas.
Exigencias de seguridad (IT 1.3)
.
Para la correcta aplicacin de esta exigencia, en el diseo y dimensionado de las
instalaciones trmicas que se proyectan, se realizan las verificaciones siguientes:
Cumplimiento de la exigencia de seguridad en la generacin de calor y fro del
apartado 1.3.4.1 de las Instrucciones Tcnicas;
.
Cumplimiento de la exigencia de seguridad en las redes de tuberas y conductores
de calor y fro del apartado 1.3.4.2 de las Instrucciones Tcnicas;
Cumplimiento de la exigencia de proteccin contra incendios del apartado 1.3.4.3
de las Instrucciones Tcnicas y
.
Cumplimiento de la exigencia de seguridad de utilizacin del apartado 1.3.4.4 de las
Instrucciones Tcnicas.

3.6.3.- HE3. EFICIENCIA ENERGETICA DE LAS INSTALACIONES DE ILUMINACION


La seccin HE 3 "Eficiencia energtica de las instalaciones de iluminacin" del
documento bsico DB HE "Ahorro de energa" NO es de aplicacin en el presente
proyecto, de acuerdo con lo expuesto en el apartado 1.1. "mbito de aplicacin" de
dicha seccin, por que:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

X Se proyecta, rehabilita o reforma una edificacin de uso residencial unifamiliar con


todas las zonas son interiores de la vivienda.
Se proyecta la rehabilitacin de la edificacin existente con superficie til igual o menor de1000 m2.
de superficie til <1000 m2.
Se proyecta la rehabilitacin de la edificacin existente con superficie til mayor de 1000 m2,
donde se renueva menos del 25% del total de la superficie iluminada.
Se proyecta una edificacin independiente con una superficie til menor de 50m2 ,
Se proyecta una construccin provisional con un plazo previsto de utilizacin igual o inferior a 2 aos.
Se proyecta una instalacin industrial, taller o edificacin agrcola no residenciales.

3.6.4.- HE4. CONTRIBUCION SOLAR MINIMA DE AGUA CALIENTE SANITARIA


Para la edificacin que se proyecta se prev demanda de agua caliente sanitaria
por lo que, a continuacin, se justifica el cumplimiento de la exigencia bsica HE 4
"Contribucin solar mnima de agua caliente sanitaria", garantizando que una parte
de las necesidades energticas trmicas derivadas de esa demanda se cubrir
mediante la incorporacin de sistemas de captacin, almacenamiento y utilizacin
de energa solar de baja temperatura, adecuada a la radiacin solar global del
emplazamiento y a la demanda de agua caliente de dicha edificacin.
3.6.4.1.- PROCEDIMIENTO VERIFICACION
Para la correcta aplicacin de la seccin HE 4 "Contribucin solar mnima de agua
caliente sanitaria" se lleva a cabo el siguiente proceso:
1. Se obtiene la contribucin solar mnima, segn lo dispuesto en el apartado 2.1
"Contribucin solar mnima" de dicha seccin;
.
2. se verifica el cumplimiento de las condiciones de diseo y dimensionado expuestas
en el apartado 3 "Clculo y dimensionado" de la citada seccin y
3. se verifica el cumplimiento de las condiciones de mantenimiento recogidas en el
apartado 4 "Mantenimiento" de la referida seccin.
3.6.4.2.- CARACTERIZACION Y CUANTIFICACION DE LAS EXIGENCIAS
Contribucin
solar
mnima
.
La contribucin solar mnima anual, que es la fraccin entre los valores anuales de la
energa solar aportada exigida y la demanda energtica anual obtenidos a partir de
los valores mensuales, se refleja en las tablas 2.1 "Contribucin solar mnima en %. Caso
general" (con fuente energtica de apoyo de gasleo, propano, gas natural, u otras) y
2.2 "Contribucin solar mnima en %. Caso Efecto Joule" (con fuente energtica de
apoyo de electricidad mediante efecto Joule), para cada zona climtica y diferentes
niveles de demanda de agua caliente sanitaria (ACS) y a una temperatura de
referencia de 60 C.
El dimensionado de la instalacin cumplir con la condicin de que en ningn mes del
ao la energa producida podr superar el 110 % de la demanda energtica y en no
ms de tres meses el 100 % (no se tomando en consideracin aquellos periodos de
tiempo en los cuales la demanda energtica se site un 50 % por debajo de la media
correspondiente al resto del ao). En el caso de que no se cumpla con la condicin
anterior se dotar a la instalacin de la posibilidad de disipar dichos excedentes
mediante equipos especficos.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

La orientacin e inclinacin del sistema generador y las posibles sombras sobre el


mismo sern tales que las prdidas (de orientacin e inclinacin, por sombras y total)
sean inferiores a los lmites fijados en la tabla 2.4 "Prdidas lmite", para los casos
general, de superposicin o de integracin arquitectnica.
Se considera como la orientacin optima el sur y la inclinacin ptima si la demanda
anual es constante la latitud geogrfica, si la demanda preferente es en invierno la
latitud geogrfica + 10 y si la demanda preferente es en verano la latitud geogrfica
10 .
3.6.4.3.- CALCULO Y DIMENSIONADO
La instalacin solar trmica que se disea est constituida por un conjunto de
componentes encargados de realizar las funciones de captar la radiacin solar,
transformarla directamente en energa trmica cedindola a un fluido de trabajo y,
por ltimo almacenar dicha energa trmica de forma eficiente, bien en el mismo
fluido de trabajo de los captadores, o bien transferirla a otro, para poder utilizarla
despus en los puntos de consumo. Dicho sistema se complementa con la produccin
de energa trmica del sistema convencional auxiliar previsto en la edificacin que se
proyecta.
Los sistemas que conforman la instalacin son los siguientes:
a) un sistema de captacin formado por los captadores solares;
b) un sistema de acumulacin constituido por uno o varios depsitos;
c) un circuito hidrulico constituido por tuberas, bombas, vlvulas, etc.;
d) un sistema de intercambio que realiza la transferencia de energa trmica captada;
e) sistema de regulacin y control y
f) adicionalmente, se dispone de un equipo de energa convencional auxiliar que se
utiliza para complementar la contribucin solar, todos con las funciones y cumpliendo
las condiciones sealadas en el apartado 3.2 "Condiciones generales de la instalacin"
de la seccin HE 4 "Contribucin solar mnima de agua caliente sanitaria".
.
Datos previos
Para el clculo de la instalacin solar trmica para agua caliente sanitaria se tienen en
cuenta los parmetros siguientes:
Datos Localizacin
Provincia/Ciudad:

Mlaga/Ronda

Zona climtica (s/Fig.3.1 y tabla 3.3-HE4 ):

IV

Radiacin Solar Global media diaria anual en kWh/m2 (s/tabla 3.2-HE4):

4.8

Latitud:

3644' N

Longitud:

509' W

Altitud:

700

Datos Demanda de ACS


Uso-criterio de demanda a 60C (s/tabla3.1-HE4):

Residencial Viv. unifamiliar

N dormitorios:

Ocupacin (N personas s/Aptdo.3.1.1, punto 4-HE4):

4 personas

Litros ACS/da (s/tabla 3.1-HE4):

30/persona

Total litros ACS/da:

120

Caso/Energa de apoyo:

General/propano

Contribucin solar anual mnima en % (s/tabla 2.1- HE4):

60

Datos Instalacin prevista


Tipo instalacin:

Individual

Captadores:
N:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Superficie unitaria efectiva en m2:

1.92

Superficie total en m2:

3.84

Factor de eficiencia ptica:

0.70

Coeficiente global de prdidas en W/(m2C):

5.020

Factor corrector captador-intercambiador:

0.95

Modificador ngulo incidencia

0.96

Temperatura mnima ACS. en C

45

Orientacin respecto del sur :

Inclinacin s/plano horizontal :

35

Acumulador:
Das de reserva:

Volumen demandado en litros:

120

Volumen adoptado en litros:

140

Intercambiador:
Tipo:

Interacumulador

Potencia prevista en W:

1000

Clculo
El mtodo de clculo empleado es adecuado para el cumplimiento de la seccin HE
4 "Contribucin solar mnima de agua caliente sanitaria" y utiliza como datos y
parmetros de partida los indicados en el prrafo anterior "Datos previos", as como los
derivados de los materiales adoptados en las soluciones propuestas.
Dicho clculo se basa en el mtodo de las curvas (F-Chart) que permite obtener la
contribucin de las instalaciones de energa solar trmica a la aportacin de calor
total necesario para cubrir las cargas trmicas y su rendimiento medio en un largo
periodo de tiempo.
CLCULO DE LA DEMANDA DE ENERGA
T media
Das
Demanda
Ocupacin Consumo agua Incremento
energtica
Mes del
en %
en l/da de red
Ta en C
en kWh
mes
en C

Ene

31

100

120

Feb

28

100

120

51

199

Mar 31

100

120

11

49

211

Abr

30

100

120

13

47

196

May 31

100

120

14

46

199

Jun

30

100

120

15

45

188

Jul

31

100

120

16

44

190

Ago 31

100

120

15

45

194

Sep

30

100

120

14

46

192

Oct

31

100

120

13

47

203

Nov 30

100

120

11

49

205

100

120

52

Dic

31

52

Total demanda energtica anual en kWh:

224

224
2425

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

CLCULO DE LA PRODUCCIN ENERGTICA (Mtodo F-Chart )


Mes

Radiacin Coef. K Radiacin Demanda


Ener. Ac.
D1horizontal incl(35) inclinada
energtica
Cap.
k1
EA/DE
kWh/m2mes lat(37) kWh/m2mes
kWh
kWh/m2mes

k2

Ener. Per.
Cap.
D2=EP/DE
kWh/m2mes

EU=FDE
77

Ene

71.61

1.33

95.24

224

117

0.52

1.01 0.77

465

2.07

0.35

Feb

93.24

1.24

115.62

199

142

0.71

1.01 0.80

429

2.16

0.48

96

Mar

133.61

1.14

152.32

211

187

0.88

1.01 0.85

496

2.35

0.59

125

Abr

154.20

1.03

158.83

196

195

0.99

1.01 0.93

516

2.63

0.64

126

May

199.64

0.96

191.65

199

235

1.18

1.01 0.92

512

2.58

0.75

150

Jun

204.30

0.93

190.00

188

233

1.24

1.01 0.90

460

2.45

0.79

149

Jul

228.16

0.96

219.03

190

268

1.41

1.01 0.91

470

2.47

0.88

166

Ago

199.64

1.04

207.63

194

254

1.31

1.01 0.84

427

2.20

0.84

163

Sep

158.40

1.17

185.33

192

227

1.18

1.01 0.85

434

2.26

0.77

148

Oct

117.14

1.32

154.68

203

190

0.93

1.01 0.86

470

2.32

0.62

127

Nov

77.40

1.42

109.91

205

135

0.66

1.01 0.83

465

2.27

0.44

90

Dic

68.82

1.41

97.04

224

119

0.53

1.01 0.75

449

2.00

0.36

80

Total demanda energtica anual en kWh: 1497

Resultados
Con el clculo realizado se obtiene, en base mensual, los valores medios diarios de la
demanda energtica y la contribucin solar, as como las prestaciones globales
anuales definidas por la demanda de energa trmica, la energa solar trmica
aportada, las fracciones solares mensuales y anuales y el rendimiento medio anual de
la instalacin diseada, tal como se puede observar en los cuadros siguientes y en los
del prrafo anterior "Clculo".
CLCULO ENERGTICO
Mes

Demanda
Ener. Util
Energa
energtica
Cap.
Aportada
kWh/m2mes kWh/m2mes
%

Ene

224

77

Feb

199

96

35%
48%

Mar

211

125

59%

Abr

196

126

64%

May

199

150

75%

Jun

188

149

79%

Jul

190

166

88%

Ago

194

163

84%

Sep

192

148

77%

Oct

203

127

62%

Nov

205

90

44%

Dic

224

80

36%

Totales anual:

2425

1497

62%

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

CUMPLIMIENTO EXIGENCIAS CTE

HE 4, Apartado 2.1,
punto 8

Prdidas lmite
Orientacin
e inclinacin

Sombras

Total

Lmite CTE (Caso


general)

10%

10%

15%

Proyecto

0.00%

0.00%

0.00%

HE 4, Apartado 2.1,
punto 1

Energa
de apoyo

CTE (Caso general)

Gasleo, propano, gas, etc

60%

Proyecto

Propano

62%

CTE
HE 4, Apartado 3.3.3.1

Proyecto

Contribucin
solar mnima

50<(V/A)<180
50<(140/1.92)<180
50< 72.91 <180

Cumple

V= Volumen acumulador en litros / A=rea captadores en m2

HE 4, Apartado 3.3.4,
punto 1

HE 4, Apartado 2.1,
punto 4.

CTE

P>=(500A)

Cumple

Proyecto

P= 5001.92=960

1000 W

P= Potencia mnima del intercambiador en W / A=rea


captadores en m2

No es necesario tomar medidas por exceso de produccin

Se produce ms del 110% de la energa demandada en al menos 1


mes

NO

Se produce ms del 100% de la energa demandada en 3 meses


seguidos

NO

3.6.4.4.- CONDICIONES GENERALES Y COMPONENTES DE LA INSTALACION


Condiciones generales de la instalacin
.
El objetivo bsico del sistema solar es suministrar al usuario una instalacin solar que:
optimice el ahorro energtico global de la instalacin en combinacin con el resto
de equipos trmicos de la edificacin;
garantice una durabilidad y calidad suficientes y
garantice un uso seguro de la instalacin.
Para ello, la instalacin solar trmica que se disea, cumple con las condiciones
expuestas en el apartado 3.2 "Condiciones generales de la instalacin" de la seccin
HE 4 "Contribucin solar mnima de agua caliente sanitaria" en lo referente a:
flujo de trabajo;
proteccin contra heladas;
proteccin contra sobrecalentamientos;
proteccin contra quemaduras;
proteccin de materiales contra altas temperaturas;
resistencia a presin y
prevencin de flujo inverso.
Componentes
Los elementos que componen la instalacin solar trmica que se disea cumplen con
lo estipulado en el apartado 3.4 "Componentes" de la seccin HE 4 "Contribucin solar
mnima de agua caliente sanitaria" en lo referente a:
captadores solares;

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

acumulador;
intercambiador de calor;
bombas de circulacin;
tuberas;
vlvulas;
vaso de expansin;
purgadores;
sistema de llenado y
sistema elctrico y de control.
3.6.4.5.- MANTENIMIENTO
Se llevarn a cabo todas las operaciones necesarias durante la vida de la
instalacin solar trmica para asegurar el funcionamiento, aumentar la fiabilidad y
prolongar la duracin de la misma, de acuerdo con el plan de vigilancia y el plan de
mantenimiento preventivo expuestos en al apartado 4 "Mantenimiento" de la seccin
HE 4 "Contribucin solar mnima de agua caliente sanitaria".

3.6.5.-HE5.
ELECTRICA

CONTRIBUCION

FOTOVOLTAICA

MINIMA

DE

ENERGIA

La seccin HE 5 "Contribucin fotovoltaica mnima de energa elctrica" del


documento bsico DB HE "Ahorro de energa" NO es de aplicacin en el presente
proyecto, de acuerdo con lo expuesto en el apartado 1.1. "mbito de aplicacin" de
dicha seccin, por que:
X Se proyecta, rehabilita o reforma una edificacin con uso residencial, no contemplado en
la tabla 1.1 "mbito de aplicacin"
Se proyecta, rehabilita o reforma una edificacin con el uso indicado a continuacin , pero
no supera el lmite de aplicacin fijado para el mismo en la tabla 1.1 "mbito de aplicacin"

Tipo de uso
Hipermercado

Lmite de aplicacin
Segn Tabla 1.1

Multitienda y centros de ocio

3000 m2 construidos

Nave de almacenamiento

10000 m2 construidos

Administrativos

4000 m2 construidos

Hoteles y hostales

100 plazas

Hospitales y clnicas

100 camas

Pabellones de recintos feriales

Proyecto

5000 m2 construidos

10000 m2 construidos

Julio de 2.011

Pedro Enrique Santos Buenda


Arquitecto

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

4.- CUMPLIMIENTO
DISPOSICIONES

DE

OTROS

REGLAMENTOS

ndice
4.1.- INSTRUCCION DE HORMIGON ESTRUCTURAL EHE-08
4.2.- REGLAMENTO ELECTROTECNICO DE BAJA TENSION
4.3.- LISTADO DE NORMATIVAS DE OBLIGADO CUMPLIMIENTO

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

4.1.- INSTRUCCION DE HORMIGON ESTRUCTURAL EHE-08

Principios bsicos
La estructura de hormign prevista para la edificacin que se proyecta, con el fin de
garantizar la seguridad de las personas, los animales y los bienes, el bienestar de la
sociedad y la proteccin del medio ambiente, satisface los requisitos siguientes:
a) seguridad y funcionalidad estructural, consistente en reducir a lmites aceptables el
riesgo de que la estructura tenga un comportamiento mecnico inadecuado frente a
las acciones e influencias previsibles a las que pueda estar sometido durante su
construccin y uso previsto, considerando la totalidad de su vida til,
b) seguridad en caso de incendio, consistente en reducir a lmites aceptables el riesgo
de que los usuarios de la estructura sufran daos derivados de un incendio de origen
accidental, e
.
c) higiene, salud y proteccin del medio ambiente, en su caso, consistente en reducir
a lmites aceptables el riesgo de que se provoquen impactos inadecuados sobre el
medio ambiente como consecuencia de la ejecucin de las obras.
Las estructura que se proyecta, para la consecucin de dichos requisitos, cumple con
las siguientes exigencias :
a) Exigencias relativas al requisito de seguridad estructural;
b) Exigencia de resistencia y estabilidad;
c) Exigencia de aptitud al servicio;
d) Exigencias relativas al requisito de seguridad en caso de incendio;
e) Exigencia de resistencia de la estructura frente al fuego;
f) Exigencias relativas al requisito de higiene, salud y medio ambiente y
g) Exigencia de calidad medioambiental de la ejecucin.
Para satisfacer los requisitos y cumplir con las exigencias establecidas en la Instruccin
de Hormign Estructural (EHE-08), en el presente proyecto, se adoptan soluciones
tcnicas que son conformes con los procedimientos que contempla esta Instruccin y
cuya aplicacin es suficiente para acreditar el cumplimiento de dichas exigencias.
Bases de clculo
La comprobacin estructural mediante clculo es la medida elegida para garantizar
la seguridad de la estructura prevista.
Las situaciones de proyecto a considerar son las que se indican a continuacin:
Situaciones persistentes, que corresponden a las condiciones de uso normal de la
estructura.
Situaciones transitorias, como son las que se producen durante la construccin o
reparacin de la estructura.
Situaciones accidentales, que corresponden a condiciones excepcionales aplicables
a la estructura.
El mtodo de comprobacin es el de los Estados Lmite, que se definen como aquellas
situaciones para las que, de ser superadas, puede considerarse que la estructura no
cumple alguna de las funciones para las que ha sido proyectada y se clasifican en:
Estados Lmite ltimos,
Estados Lmite de Servicio y
Estado Lmite de Durabilidad, que se consideran en el presente proyecto segn lo
expuesto en el apartado 8.1.1 "Estados lmite" de la EHE-08.
En el proyecto se identifica el tipo de ambiente que define la agresividad a la que va
a estar sometido cada elemento estructural y, en funcin de ste, se establece la
estrategia acorde con los criterios expuestos en el Captulo VII de la EHE-08 para
conseguir una durabilidad adecuada.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Acciones
Las acciones consideradas en el clculo de la estructura que se proyecta, clasificadas
por su variacin en el tiempo, son las siguientes:
Acciones Permanentes (G),
Acciones Permanentes de Valor no Constante (G*), Acciones Variables (Q) y
Acciones Accidentales (A),
cuyos valores caractersticos, representativos y de clculo se han obtenido teniendo
en cuenta lo establecido en los artculos 10, 11 y 12 de la Instruccin EHE-08
Las combinaciones de acciones tenidas en cuenta para cada una de las situaciones
consideradas en las bases de clculo son las expuestas en el artculo 13 "Combinacin
de acciones" de la Instruccin EHE-08.
Componentes del sistema estructural
La estructura prevista para la edificacin que se proyecta estar formada por:

Soportes:

X Pilares de hormign armado de seccin rectangular o circular


Muros de hormign armado de diferentes secciones

X Muros de fbrica de bloque o ladrillo cermico de diferentes secciones


Vigas:

X Planas de hormigan armado


De canto de hormign armado

Forjados:

X Unidireccional de viguetas y piezas aligerantes


Bidireccional con piezas aligerantes
Losa maciza de hormign armado

Caractersticas de los materiales


.
El hormign empleado en la estructura de la edificacin que se proyecta, los
materiales utilizados y sus caractersticas, de acuerdo con la Instruccin EHE-08, son los
siguientes:
Hormign
Tipo:

Hormign armado

Consistencia:

Blanda

Denomincacin:

HA-25/B/20/IIa

Clase general
de exposicin:

NormalHumedad alta-IIa

Resistencia
Caracterstica Fck:

25 N/mm2

Resistencia
de clculo Fyd::

16.66 N/mm2

Recubrimiento mnimo
armaduras estructura:

30mm

Recubrimiento mnimo
armaduras cimentacin:

50mm

Acero
Tipo:
Resistencia
caracterstica Fyk:

B-500-S

Resistencia
de clculo Fyd:

434.78 N/mm2

500 N/mm2

Cemento
Tipo:
Contenido mnimo:

CEM I/32.5N

Relacin mxima
agua/cemento

300 kg/m3

Pedro Enrique Santos Buenda______________________Arquitecto

0.60

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

rido
Tipo:

Tamo mximo
en cimentacin:

Grava de machaqueo
y arena

Tamo mximo
en estructura:

40 mm

20 mm

Caractersticas de los forjados


Los forjados de la estructura de la edificacin que se proyecta, los materiales utilizados
y sus caractersticas, de acuerdo con la Instruccin EHE-08, son los siguientes:
Dimesiones

Materiales
Canto total: 30 cm

Vigueta: Celosia AB-80200/200

Capa compresin: 5 cm
Interejes: 70 cm

Bovedilla: Hormign 25 cm
Acero refuerzos: B-500-S
Acero mallazo: B-500-T

Niveles de control y coeficientes de seguridad


Los coeficientes de seguridad empleados en el clculo de la estructura y los niveles de
control de los materiales empleados, de acuerdo con la Instruccin EHE-08, son los
siguientes:
Hormign
Coeficiente parcial de seguridad:

1.50

Nivel de control:

Estadstico

1.15

Nivel de control:

Normal

Acero
Coeficiente parcial de seguridad:
Ejecucin
Tipo de accin

Coeficiente parcial de
seguridad:

Nivel de control:

Favorable

Desfavorable

Permanente

1.00

1.50

Normal

Permanente (no cte.)

1.00

1.60

Normal

Acciones variables

0.00

1.60

Normal

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

4.2.- REGLAMENTO ELECTROTECNICO DE BAJA TENSION


Indice
1.1.- JUSTIFICACION DE SU APLICACION
1.1.- OBJETO Y CUMPLIMIENTO DE LAS PRESCRIPCIONES
1.2.- DOCUMENTACION REQUERIDA PARA LA EJECUCION DE LA INSTALACION (ITC-BT-04)
1.3.- CARACTERISTICAS DE LA INSTALACION ELECTRICA
1.3.1.- SISTEMA DE CONEXION A LA RED DE DISTRIBUCION (ITC-BT-08)
1.3.2.- PREVISION DE CARGAS PARA SUMINISTRO EN BAJA TENSION (ITC-BT-10)
1.3.2.1.- EDIFICACION UNIFAMILIAR
1.3.3.- REDES DE DISTRIBUCION. ACOMETIDA (ITC-BT-11)
1.3.4.- INSTALACION DE ENLACE (ITC-BT-12)
1.3.5.- CAJA GENERAL DE PROTECCION (ITC-BT-13)
1.3.6.- LINEA GENERAL DE ALIMENTACION (ITC-BT-14)
1.3.7.- DERIVACIONES INDIVIDUALES (ITC-BT-15)
1.3.8.- CONTADORES. UBICACION Y SISTEMAS DE INSTALACION (ITC-BT-16)
1.3.9.- DISPOSITIVOS DE MANDO Y PROTECCION (ITC-BT-17)
1.3.10.- INSTALACION DE PUESTA A TIERRA (ITC-BT-18)
1.3.11.- INSTALACIONES INTERIORES EN VIVIENDAS
1.4.- EJECUCION,PUESTA EN SERVICIO Y UTILIZACION DE LA INSTALACION ELECTRICA

4.2.1.- JUSTIFICACION DE SU APLICACION


El REBT es de aplicacin a la instalacin elctrica de la edificacin objeto del
presente proyecto puesto que:
Se prev una tensin nominal inferior de 1.000 voltios en corriente alterna o de 1.500
voltios en corriente continua;
Se prev una nueva instalacin, o se modifica, o se repara o se ampla una ya
existente ejecutada conforme al REBT; o
Se prev una modificacin de importancia, reparacin de importancia o se ampla
la instalacin existente ya ejecutada antes de la entrada en vigor del actual REBT;
entendiendo por modificaciones o reparaciones de importancia las que afectan a
ms del 50% de la potencia instalada.
Por tales motivos, a continuacin, se justifica el cumplimiento de las prescripciones
del Reglamento Electrotcnico de Baja Tnsin (REBT) y sus Instrucciones Tcnicas
Complementarias (ITCs), aprobado por el Real Decreto 842/2002, de 2 de agosto.
4.2.1.1.- OBJETO Y CUMPLIMIENTO DE LAS PRESCRIPCIONES
Objeto:
El presente Reglamento tiene por objeto establecer las condiciones tcnicas y
garantas que deben reunir las instalaciones elctricas conectadas a una fuente de
suministro
en
los
lmites
de
baja
tensin,
con
la
finalidad
de:
a)
Preservar
la
seguridad
de
las
personas
y
los
bienes.
b) Asegurar el normal funcionamiento de dichas instalaciones y prevenir las
perturbaciones
en
otras
instalaciones
y
servicios.
c) Contribuir a la fiabilidad tcnica y a la eficiencia econmica de las instalaciones.
Cumplimiento de las prescripciones:
1. Se considerar que las instalaciones realizadas de conformidad con las
prescripciones del presente Reglamento proporcionan las condiciones de seguridad
que, de acuerdo con el estado de la tcnica, son exigibles, a fin de preservar a las
personas y los bienes, cuando se utilizan de acuerdo a su destino.
2. Las prescripciones establecidas en el presente Reglamento tendrn la condicin de
mnimos obligatorios, en el sentido de lo indicado por el artculo 12.5 de la Ley 21/1992,

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

de Industria.
3. Se considerarn cubiertos tales mnimos:
a) Por aplicacin directa de las prescripciones de las correspondientes ITC, o
b) Por aplicacin de tcnicas de seguridad equivalentes, siendo tales las que, sin
ocasionar distorsiones en los sistemas de distribucin de las compaas suministradoras,
proporcionen, al menos, un nivel de seguridad equiparable a la anterior. La aplicacin
de tcnicas de seguridad equivalentes deber ser justificado debidamente por el
diseador de la instalacin, y aprobada por el rgano competente de la Comunidad
Autnoma.
4.2.1.2.- DOCUMENTACION REQUERIDA PARA LA EJECUCION DE LA INSTALACION (ITCBT-04)
La instalacin que se prev en la edificacin objeto del presente proyecto (en el
mbito de aplicacin del presente Reglamento) se ejecutar sobre la base de una
documentacin tcnica que, en funcin de su importancia y segn lo dispuesto en el
punto 2. "Documentacin de las instalaciones de la ITC-BT-4, adoptar la siguiente
modalidad:
Memoria Tcnica de Diseo (MTD), redactada y firmada por tcnico titulado
competente o instalador autorizado para la categora de la instalacin, sobre
impresos segn modelo determinado por el Organo competente de la Comunidad
Autnoma correspondiente, pues, segn lo dispuesto en el punto 4. "Instalaciones que
requerirn Memoria Tcnica de Diseo" de la Instruccin Tcnica Complementaria ITCBT-4, requerirn Memoria Tcnica de Diseo todas las instalaciones (sean nuevas,
ampliaciones o modificaciones) no incluidas en los grupos indicados en el apartado 3.
"Instalaciones que precisan proyecto" de la Instruccin Tcnica Complementaria ITCBT-4.
4.2.1.3.- CARACTERISTICAS DE LA INSTALACION ELECTRICA
4.2.1.3.1.- SISTEMA DE CONEXION A LA RED DE DISTRIBUCION (ITC-BT-08)
Las caractersticas de las medidas de proteccin contra choques elctricos y contra
sobreintensidades as como de las especificaciones de la aparamenta encargada de
tales funciones se determinan en funcin del tipo de esquema de distribucin
empleado, el cual se establece atendiendo, por un lado, a las conexiones a tierra de
la red de distribucin o alimentacin y, por otro, a las masas de la instalacin
receptora.
La instalacin prevista en la edificacin que nos ocupa:
Se alimentar directamente de una red de distribucin pblica de baja tensin;
emplear el esquema de distribucin, atendiendo a lo dispuesto en el apartado 1.4
"Aplicacin de los tres tipos de esquemas" de la Instruccin Tcnica Complementaria
ITC-BT-08, denominado "TT", con un punto de alimentacin (generalmente el neutro o
compensador) conectado directamente a tierra y con las masas de la instalacin
receptoras conectadas a una toma de tierra separada de la toma de tierra de la

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

alimentacin, tal como se observa en la imagen siguiente.

4.2.1.3.2.- PREVISION DE CARGAS PARA SUMINISTRO EN BAJA TENSION (ITC-BT-10)


1.3.2.1.- EDIFICACION UNIFAMILIAR
La carga total correspondiente a la edificacin objeto del presente proyecto,
destinado principalmente a vivienda unifamiliar, resulta, segn lo dispuesto en la
Instruccin Tcnica Complementaria ITC-BT-10, de la suma de la carga
correspondiente a la vivienda y de la carga correspondientes a los dems usos,
servicios o zonas (local comercial, etc) que forman parte de la misma y que a
continuacin se indican:
Vivienda
La carga correspondiente a la vivienda es su potencia mxima prevista segn su
grado de electrificacin sea bsica o elevada.
As, la carga prevista es:
Vivienda
Electrificacin

Carga Vivienda (Ctv)

Bsica

5750 w

Elevada

9200 w

4.21.3.3.- REDES DE DISTRIBUCION. ACOMETIDA (ITC-BT-11)

La acometida es la parte de la instalacin de la red de distribucin que alimenta la


caja o cajas generales de proteccin o unidad funcional equivalente (CGP) y que,
atendiendo a su trazado, al sistema de instalacin y a las caractersticas de la red, es
del tipo y sistema de instalacin que se indica en el cuadro siguiente:
Acometida
Tipo
Area
Subterrnea
Mixta

Sistema de Instalacin
Posada sobre fachada

Tensada sobre poste


Con entrada y salida
En derivacin
Aero-Subterrneas

Se dispone una sola acometida para la edificacin objeto del presente proyecto que
se realizar siguiendo el trazado ms corto por terrenos de dominio pblico, con

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

conexiones cuando stas sean necesarias mediante sistemas o dispositivos apropiados


y de forma que el aislamiento de los conductores se mantenga hasta los elementos de
conexin de la CGP y cumplir lo dispuesto en las Instrucciones Tcnicas
Complementarias ITC-BT11, ITC-BT-06 y ITC-BT-07.
4.2.1.3.4.- INSTALACION DE ENLACE (ITC-BT-12)
Se denomina instalacin de enlace a aquella que une la caja general de proteccin o
cajas generales de proteccin, incluidas stas, con la instalacin o instalaciones
interiores o receptoras del usuario, comenzando, por tanto, en el final de la acometida
y terminarn en los dispositivos generales de mando y proteccin, discurriendo por
lugares de uso comn y quedar de propiedad del usuario, que se responsabilizar de
su conservacin y mantenimiento.
Est formada por las partes o elementos siguientes:
- Caja General de Proteccin (CGP);
- Lnea General de Alimentacin (LGA);
- Elementos para la Ubicacin de Contadores (CC);
- Derivacin Individual (DI);
- Caja para Interruptor de Control de Potencia (ICP) y
- Dispositivos Generales de Mando y Proteccin (DGMP)
ESQUEMA PARA UN SOLO USUARIO
Leyenda
1 Red de distribucin
2 Acometida
3 Caja general de proteccin
4 Lnea general de alimentacin
5 Interruptor general de maniobra
6 Caja de derivacin
7 Emplazamiento de contadores
8 Derivacin individual
9 Fusible de seguridad
10 Contador
11 Caja para interruptor de control de potencia
12 Dispositivos generales de mando y proteccin
13 Instalacin interior

Nota: El conjunto de derivacin individual e


instalacin
interior constituye la instalacin privada.

En este esquema para un usuario se podrn simplificar las instalaciones de enlace al


coincidir en el mismo lugar la Caja General de Proteccin y la situacin del equipo de
medida y no existir, por tanto, la Lnea general de alimentacin. En consecuencia, el
fusible de seguridad (9) coincide con el fusible de la CGP.
4.2.1.3.5.- CAJA GENERAL DE PROTECCION (ITC-BT-13)
En la instalacin elctrica de la edificacin unifamiliar objeto del presente proyecto,
al no existir lnea general de alimentacin, se simplificar dicha instalacin colocando

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

en un nico elemento la caja general de proteccin (CGP) y el equipo de medida; lo


se denominar caja de proteccin y medida (CPM). Se situar siempre en lmite entre
la propiedad privada y la pblica y se instalar sobre la fachada exterior de la
edificacin, en lugar de libre y permanente acceso en montaje superficial a una
altura sobre el suelo comprendida entre 3 m y 4 m cuando la acometida sea area, y
en la pared en un nicho cerrado con puerta metlica a una altura mnima sobre el
suelo de 30cm cuando la acometida sea subterrnea.
La caja de proteccin y medida cumplir con las prescripciones del apartado 2.
"Cajas de proteccin y medida" de la Instruccin Tcnica Complementaria ITC-BT-13
en cuanto a emplazamiento e instalacin y tipos y caractersticas.
4.2.1.3.6.- LINEA GENERAL DE ALIMENTACION (ITC-BT-14)
La lnea que enlaza la caja general de proteccin con la centralizacin de
contadores tendr un trazado lo ms corto y rectilneo posibles, discurriendo siempre
por zonas generales de uso comn.
Est formada por conductores, tres de fase y uno de neutro, de cobre o aluminio,
unipolares, aislados y no propagadores del incendio y con emisin de humos y
opacidad reducida, con una tensin asignada 0,6/1 kV y una cada de tensin
mxima del 0.5%,
La seccin de los cables es uniforme en todo su recorrido y sin empalmes,
exceptundose las derivaciones realizadas en el interior de cajas para alimentacin
de centralizaciones de contadores. La seccin mnima ser de 10 mm2 en cobre o 16
mm2 en aluminio, teniendo en cuenta para su clculo tanto la mxima cada de
tensin permitida, como la intensidad mxima admisible.
Para la seccin del conductor neutro se tiene en cuenta el mximo desequilibrio que
puede preverse, las corrientes armnicas y su comportamiento, en funcin de las
protecciones establecidas ante las sobrecargas y cortocircuitos que pudieran
presentarse. El conductor neutro tiene una seccin de aproximadamente el 50% de la
correspondiente al conductor de fase, no siendo inferior a los valores especificados en
la tabla siguiente.
Los conductores se alojan en el interior de tubos, los cuales podrn ser empotrados,
enterrados o de montaje superficial con los dimetros que, en funcin de la seccin
del cable a instalar, se indican en la tabla siguiente.
Secciones
(mm2)
Fase

Nutro

Dimetro
exterior
de los tubos
(mm)

10
(Cu)

10

75

16
(Cu)

10

75

16 (Al)

16

75

25

16

110

35

16

110

50

25

125

70

35

140

95

50

140

120

70

160

150

70

160

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

185

95

180

240

120

200

La Lnea General de Alimentacin cumplir con las prescripciones de la Instruccin


Tcnica Complementaria ITC-BT-14.
4.2.1.3.7.- DERIVACIONES INDIVIDUALES (ITC-BT-15)
Es la parte de la instalacin que, partiendo de caja de proteccin y medida,
suministra energa elctrica a la instalacin de usuario y se inicia en el embarrado
general y comprende los fusibles de seguridad, el conjunto de medida y los dispositivos
generales de mando y proteccin.
Est formada por conductores de cobre o aluminio, de seccin uniforme y sin
empalmes (excepto en los contadores y dispositivos de proteccin), aislados,
unipolares,no propagadores del incendio y con emisin de humos y opacidad
reducida, siendo su tensin asignada 450/750 V.
La derivacin individual lleva un conductor neutro, un conductor de proteccin y un
hilo
de
mando
para
posibilitar
la
aplicacin
de
diferentes
tarifas.
A efecto de la consideracin del nmero de fases que compongan la derivacin
individual, se tiene en cuenta la potencia que en monofsico est obligada a
suministrar la empresa distribuidora si el usuario as lo desea.
Las secciones mnimas sern de 6 mm2 para los cables polares, neutro y proteccin y
de 1,5 mm2 para el hilo de mando, que ser de color rojo.
Para el clculo de la seccin de los conductores se tendr en cuenta lo siguiente:
a) La demanda prevista por el usuario, que ser como mnimo la fijada por la RBT-010 y
cuya intensidad estar controlada por los dispositivos privados de mando y
proteccin. A efectos de las intensidades admisibles por cada seccin, se tendr en
cuenta lo que se indica en la ITC-BT-19 y para el caso de cables aislados en el interior
de
tubos
enterrados,
lo
dispuesto
en
la
ITC-BT-07.
b) La cada de tensin mxima admisible ser del 1.5 %.
Los conductores se alojan en el interior de tubos, los cuales podrn ser empotrados,
enterrados o de montaje superficial con secciones nominales que permitan ampliar la
seccin de los conductores inicialmente instalados en un 100%, siendo el dimetro
mnimo de 32 mm.
La derivacin individual cumplir con las prescripciones de la Instruccin Tcnica
Complementaria ITC-BT-15.
4.2.1.3.8.- CONTADORES. UBICACION Y SISTEMAS DE INSTALACION (ITC-BT-16)
Los contadores previstos para la instalacin elctrica de la edificacin objeto del
presente proyecto son los siguientes:
Usos
Viviendas
Locales y oficinas
Total contadores

N Contadores
1
0
1

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Los contadores y dems dispositivos para la medida de la energa elctrica estarn


ubicados en mdulos (cajas con tapa precintable), en la forma de colocacin
"individual", disposicin sta utilizable slo cuando se trata de un suministro a un nico
usuario independiente o a dos usuarios alimentados desde un mismo lugar.
Se har uso de la Caja de Proteccin y Medida, de los tipos y caractersticas indicados
en el apartado 2 de ITC MIE-BT-13, que rene bajo una misma envolvente, los fusibles
generales de proteccin, el contador y el dispositivo para discriminacin horaria. En
este caso, los fusibles de seguridad coinciden con los generales de proteccin.
Las conexiones se efectuarn directamente y los conductores no requerirn
preparacin especial o terminales y deber disponer del cableado necesario para los
circuitos de mando y control con el objetivo de satisfacer las disposiciones tarifarias
vigentes. Los cables sern de 6 mm2 de seccin, de una tensin asignada de 450/750
V, no propagadores del incendio y con emisin de humos y opacidad reducida.
La Caja de Proteccin y Medida se ubicar sobre la fachada exterior de la
edificacin, en lugar de libre y permanente acceso, de acuerdo a lo indicado en el
apartado 2.1 de la ITC MIE-BT-13. Tendr las dimensiones adecuadas para los
dispositivos a albergar, permitir de forma directa la lectura del contador e interruptor
horario as como la del resto de dispositivos de medida; dispondr de ventilacin
interna para evitar condensaciones sin que disminuya su grado de proteccin y las
partes transparentes que permiten la lectura directa debern ser resistentes a los rayos
ultravioleta.
La instalacin de los contadores cumplir con las prescripciones de la Instruccin
Tcnica Complementaria ITC-BT-16.
4.2.1.3.9.- DISPOSITIVOS DE MANDO Y PROTECCION (ITC-BT-17)
Los dispositivos generales de mando y proteccin, se situarn lo ms cerca posible
del punto de entrada de la derivacin individual, en el caso de local lo ms prximo
posible a una puerta de entrada, y en el caso de vivienda junto a la puerta de
entrada y nunca en dormitorios, baos, aseos, etc. Los dispositivos individuales de
mando y proteccin de cada uno de los circuitos, que son el origen de la instalacin
interior,
podrn
instalarse
en
cuadros
separados
y
en
otros lugares.
Los dispositivos generales y los individuales de mando y proteccin de cada uno de los
circuitos sern como mnimo:
Un interruptor general automtico de corte omnipolar, que permita su
accionamiento manual y que est dotado de elementos de proteccin contra
sobrecarga y cortocircuitos. Este interruptor ser independiente del interruptor de
control de potencia.
.
Un interruptor diferencial general, destinado a la proteccin contra contactos
indirectos de todos los circuitos; salvo que la proteccin contra contactos indirectos se
efecte
mediante
otros
dispositivos
de
acuerdo
con
la
ITC-BT-24.
Dispositivos de corte omnipolar, destinados a la proteccin contra sobrecargas y
cortocircuitos de cada uno de los circuitos interiores de la vivienda o local.
Dispositivo de proteccin contra sobretensiones, segn ITC-BT-23, si fuese necesario.
Su posicin de servicio ser vertical y se ubicarn en el interior de uno o varios cuadros
de distribucin de donde partirn los circuitos interiores.
El interruptor general automtico de corte omnipolar tendr poder de corte suficiente
para la intensidad de cortocircuito que pueda producirse en el punto de su

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

instalacin,
de
4.500
A
como
mnimo.
Los dems interruptores automticos y diferenciales debern resistir las corrientes de
cortocircuito que puedan presentarse en el punto de su instalacin. La sensibilidad de
los interruptores diferenciales responder a lo sealado en la Instruccin ITC-BT-24.
Los dispositivos de proteccin contra sobrecargas y cortocircuitos de los circuitos
interiores sern de corte omnipolar y tendrn los polos protegidos que corresponda al
nmero de fases del circuito que protegen. Sus caractersticas de interrupcin estarn
de acuerdo con las corrientes admisibles de los conductores del circuito que protegen.
4.2.1.3.10.- INSTALACION DE PUESTA A TIERRA (ITC-BT-18)
La puesta o conexin a tierra es la unin elctrica directa (sin fusibles ni proteccin
alguna) de una parte del circuito elctrico o de una parte conductora no
perteneciente al mismo, mediante una toma de tierra con un electrodo o grupos de
electrodos enterrados en el suelo. Su objeto es limitar la tensin que, con respecto a
tierra, puedan presentar en un momento dado las masas metlicas, as como asegurar
la actuacin de las protecciones y eliminar o disminuir el riesgo que supone una avera
en los materiales elctricos utilizados.Mediante la instalacin de puesta a tierra se
consigue que en el conjunto de instalaciones, edificios y superficie prxima del terreno
no
aparezcan
diferencias
de
potencial peligrosas y que, al mismo tiempo, permita el paso a tierra de las corrientes
de defecto o las de descarga de origen atmosfrico.
Las disposiciones de puesta a tierra pueden ser utilizadas a la vez o separadamente,
segn las prescripciones de la instalacin, por:
razones de proteccin, que se utilizar para las medidas de proteccin del sistema
de conexin a la red de distribucin tipo "TT", segn el esquema siguiente

razones funcionales, debiendo ser realizadas de forma que aseguren el


funcionamiento correcto del equipo y permitan un funcionamiento correcto y fiable
de la instalacin.
o por razones combinadas de proteccin y fucionales, cuando la puesta a tierra sea
necesaria a la vez por razones de proteccin y funcionales, prevalecern las
prescripciones de las medidas de proteccin.
Las partes tpicas del circuito de puesta a tierra , que reunirn los requisitos expuestos
en los apartados 3.1 a 3.4 de la ITC-BT-18, son las que se indican en la figura siguiente:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Leyenda
1 Conductor de proteccin
Conductor de unin equipotencial principal
2
Conductor de tierra o lnea de enlace con el
electrodo
3
de puesta a tierra
Conductor de equipotencialidad
4 suplementaria
Borne principal de tierra o punto de puesta a
tierra
M Masa
Elemento conductor
C
B

P
T

Canalizacin metlica principal de agua


Toma de tierra

El conductor principal de equipotencialidad tendr una seccin no inferior a la mitad


de la del conductor de proteccin de seccin mayor de la instalacin, con un mnimo
de 6 mm2 o 2,5 mm2 si es de cobre.
Si el conductor suplementario de equipotencialidad uniera una masa a un elemento
conductor, su seccin no ser inferior a la mitad de la del conductor de proteccin
unido a esta masa.
El electrodo se dimensionar de forma que su resistencia de tierra, en cualquier
circunstancia previsible, no sea superior al valor especificado para ella en cada caso.
Este valor de resistencia de tierra ser tal que cualquier masa no pueda dar lugar a
tensiones de contacto superiores a:
24 V en local o emplazamiento conductor
50 V en los dems casos.
Instalacin
.
En la edificacin que se proyecta se establecer una toma de tierra de proteccin
instalando en el fondo de las zanjas de cimentacin de la edificacin, y antes de
empezar sta, un cable rgido de cobre desnudo de una seccin mnima segn se
indica en la ITC-BT-18, formando un anillo cerrado que interese a todo el permetro del
edificio y al que se conectarn electrodos verticalmente hincados en el terreno si se
prev la necesidad de disminuir la resistencia de tierra que pueda presentar el
conductor en anillo. En el caso varios edificios prximos se unirn entre s los anillos que
forman la toma de tierra de cada uno de ellos formando una malla.
El conductor en anillo o los electrodos se conectarn se conectarn a las armaduras
principales de la cimentacin de hormign armado de la edificacin o, si fuese el
caso, a su estructura metlica, mediante soldadura aluminotrmica o autgena. Las
lneas de enlace con tierra se establecern de acuerdo con la situacin y nmero
previsto de puntos de puesta a tierra. La naturaleza y seccin de estos conductores
estar de acuerdo con lo indicado para ellos en la Instruccin ITC-BT-18.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Elementos a conectar en tierra


.
La toma de tierra establecida se conectar toda masa metlica importante existente
en la zona de la instalacin y las masas metlicas accesibles de los aparatos
receptores, cuando su clase de aislamiento o condiciones de instalacin as lo exijan.
A esta misma toma de tierra debern conectarse las partes metlicas de los depsitos
de gasleo, de las instalaciones de calefaccin general, de las instalaciones de agua,
de las instalaciones de gas canalizado y de las antenas de radio y televisin.
Puntos de puesta a tierra
.
Los puntos de puesta a tierra se situarn:
a) En los patios de luces destinados a cocinas y cuartos de aseo, etc., en rehabilitacin
o
reforma
de
edificios
existentes.
b) En el local o lugar de la centralizacin de contadores, si la hubiere.
c) En la base de las estructuras metlicas de los ascensores y montacargas, si los
hubiere.
d) En el punto de ubicacin de la caja general de proteccin.
e) En cualquier local donde se prevea la instalacin de elementos destinados a
servicios generales o especiales, y que por su clase de aislamiento o condiciones de
instalacin, deban ponerse a tierra.
Lneas principales de tierra. Derivaciones
.
Las lneas principales y sus derivaciones se establecern en las mismas canalizaciones
que las de las lneas generales de alimentacin y derivaciones individuales y estarn
constituidas por conductores de cobre de igual seccin que la fijada para los
conductores de proteccin en la Instruccin ITC-BT-19 y con las caractersticas que se
indican en el apartado 3.2 de la Instruccin ITC-BT-26.
.
Conductores de proteccin
Se instalarn conductores de proteccin acompaando a los conductores activos en
todos los circuitos de la vivienda hasta los puntos de utilizacin.
La instalacin de puesta a tierra cumplir con las prescripciones de la instrucciones
tcnicas complementarias ITC-BT-18 y ITC-BT-26.
4.2.1.3.11.- INSTALACIONES INTERIORES EN VIVIENDAS
PRESCRIPCIONES (ITC-BT-26)
Tensiones de utilizacin y esquema de conexin
.
Las instalaciones de las viviendas se consideran que estn alimentadas por una red de
distribucin pblica de baja tensin segn el esquema de distribucin TT (ITC-BT-08) y
a una tensin de 230 V en alimentacin monofsica y 230/400 V en alimentacin
trifsica.
Tomas de tierra
.
En la nueva edificacin se establecer una toma de tierra de proteccin, segn el
siguiente el sistema , las condiciones y las caractersticas indicadas anteriormente en el
punto correspondiente a Instalacin de puesta a tierra, as como en la Instruccin
Tcnica Complementaria ITC-BT-18.
Proteccin contra contactos indirectos
.
La proteccin contra contactos indirectos se realizar mediante la puesta a tierra de
las masas y empleo de los dispositivos descritos en el apartado 2.1 de la ITC-BT-25.
Cuadro general de distribucin
.
El cuadro general de distribucin se ejecutar de acuerdo con lo indicado en la

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Instruccin Tcnica Complementaria ITC-BT-17, disponindose en l los bornes o


pletinas para la conexin de los conductores de proteccin de la instalacin interior
con la derivacin de la lnea principal de tierra.
Conductores
.
Los conductores activos sern de cobre, aislados y con una tensin mnima asignada
de 450/750 V. Los circuitos y las secciones utilizadas sern, los indicados en la ITC-BT-25.
Los conductores de proteccin sern de cobre y presentarn el mismo aislamiento
que los conductores activos. Se instalarn por la misma canalizacin que stos y su
seccin ser la indicada en la Instruccin ITC-BT-19. Los conductores de la instalacin
deben ser fcilmente identificados, especialmente por lo que respecta a los
conductores neutro y de proteccin. Las conexiones se realizarn conforme a lo
establecido en el apartado 2.11 de la ITC-BT-19.
Ejecucin de las instalaciones
.
Las instalaciones se realizarn mediante algunos de los siguientes sistemas:
- Instalaciones empotradas: con cables aislados bajo tubo flexible y curvable; o
- Instalaciones superficiales: con cables aislados bajo tubo curvable, cables aislados
bajo tubo rgido, cables aislados bajo canal protectora cerrada y canalizaciones
prefabricadas.
En cualquier caso, las instalaciones debern cumplir lo indicado en las ITC-BT-20 e ITCBT-21.
NMERO DE CIRCUITOS Y CARACTERSTICAS (ITC-BT-25)
Circuitos interiores
Los circuitos de proteccin privados se ejecutarn segn lo dispuesto en la ITC-BT-17 y
constarn como mnimo de:
- Un interruptor general automtico de corte omnipolar con accionamiento manual,
de intensidad nominal mnima de 25 A y dispositivos de proteccin contra sobrecargas
y cortocircuitos. El interruptor general es independiente del interruptor para el control
de potencia (ICP) y no puede ser sustituido por ste.
.
- Uno o varios interruptores diferenciales que garanticen la proteccin contra
contactos indirectos de todos los circuitos, con una intensidad diferencial-residual
mxima de 30 mA e intensidad asignada superior o igual que la del interruptor general.
Cuando se usen interruptores diferenciales en serie, habr que garantizar que todos los
circuitos quedan protegidos frente a intensidades diferenciales-residuales de 30 mA
como mximo, pudindose instalar otros diferenciales de intensidad superior a 30 mA
en serie, siempre que se cumpla lo anterior.
.
Para instalaciones de viviendas alimentadas con redes diferentes a las de tipo TT, que
eventualmente pudieran autorizarse, la proteccin contra contactos indirectos se
realizar segn se indica en el apartado 4.1 de la ITC-BT-24.
.
- Dispositivos de proteccin contra sobretensiones, si fuese necesario, conforme a la
ITC-BT-23.
Los tipos de circuitos independientes, en funcin del grado de electrificacin, sern
para
Electrificacin bsica:
C1 - Circuito de distribucin interna, destinado a alimentar los puntos de iluminacin.
C2 - Circuito de distribucin interna, destinado a tomas de corriente de uso general y
frigorfico.
C3 - Circuito de distribucin interna, destinado a alimentar la cocina y horno.
C4 - Circuito de distribucin interna, destinado a alimentar la lavadora, lavavajillas y
termo elctrico.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

C5 - Circuito de distribucin interna, destinado a alimentar tomas de corriente de los


cuartos de bao, as como las bases auxiliares del cuarto de cocina.
Electrificacin elevada:
C6 - Circuito adicional del tipo C1, por cada 30 puntos de luz
C7 - Circuito adicional del tipo C2, por cada 20 tomas de corriente de uso general o si
la superficie til de la vivienda es mayor de 160 m2.
C8 - Circuito de distribucin interna, destinado a la instalacin de calefaccin
elctrica, cuando existe previsin de sta.
C9 - Circuito de distribucin interna, destinado a la instalacin aire acondicionado,
cuando existe previsin de ste
C10 - Circuito de distribucin interna, destinado a la instalacin de una secadora
independiente
C11 - Circuito de distribucin interna, destinado a la alimentacin del sistema de
automatizacin, gestin tcnica de la energa y de seguridad, cuando exista previsin
de ste.
C12 - Circuitos adicionales de cualquiera de los tipos C3 o C4, cuando se prevean, o
circuito adicional del tipo C5, cuando su nmero de tomas de corriente exceda de 6.
Tanto para la electrificacin bsica como para la elevada, se colocar, como mnimo,
un interruptor diferencial de las caractersticas indicadas anteriormente en este mismo
punto por cada cinco circuitos instalados. Cada uno de ellos estar protegido por un
interruptor automtico de corte omnipolar con accionamiento manual y dispositivos
de proteccin contra sobrecargas y cortocircuitos con una intensidad asignada segn
su aplicacin, no inferior al valor de la intensidad prevista del receptor o receptores a
conectar y calculada conforme a la expresin siguiente:
I = n x Ia x Fs x Fu,
siendo
n : n de tomas o receptores
Ia : Intensidad prevista por toma o receptor
Fs : (factor de simultaneidad) Relacin de receptores conectados simultneamente sobre el total
Fu : (factor de utilizacin) Factor medio de utilizacin de la potencia mxima del receptor

Determinacin del nmero de circuitos, de las secciones de los conductores y de las


cadas de tensin
.
La seccin mnima indicada por circuito est calculada para un nmero limitado de
puntos de utilizacin. De aumentarse el nmero de puntos de utilizacin, ser
necesaria la instalacin de circuitos adicionales correspondientes. La seccin de los
conductores de cobre ser como mnimo la indicada en la Tabla siguiente, y adems
estar condicionada a que la cada de tensin sea como mximo el 3 %. Esta cada
de tensin se calcular para una intensidad de funcionamiento del circuito igual a la
intensidad nominal del interruptor automtico de dicho circuito y para una distancia
correspondiente a la del punto de utilizacin mas alejado del origen de la instalacin
interior. El valor de la cada de tensin podr compensarse entre la de la instalacin
interior y la de las derivaciones individuales, de forma que la cada de tensin total sea
inferior a la suma de los valores lmite especificados para ambas, segn el tipo de
esquema utilizado.
Los circuitos mnimos previstos, con sus caractersticas elctricas (tensin considerada
de 230 V entre fase y neutro), se relacionan en el cuadro siguiente.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Circuito
de
utilizacin

Mximo
Factor
Dimetro
Potencia
Factor
n de
Seccin
de
Tipo
Interruptor
externo
prevista
de
puntos de
mnima de
simulta
de
automtico
del tubo
por toma
utilizacin
utilizacin consductores
neidad
toma (2)
(A)
o conducto
(W)
Fu
o tomas
(mm)(5)
Fs
(mm)
por circuito

C1
Iluminacin

200

0.75

0.5

Punto
de luz (3)

10

30

1.5

16

C2
Tomas de
uso general

3450

0.2

0.25

Base
16A
2p+T

16

20

2.5

20

C3
Cocina
y horno

5400

0.5

0.75

Base
25A
2p+T

25

25

C4
Lavadora,
lavavajillas,
y termo
elctrico

3450

0.66

0.75

Base
16A
2p+T(4)

20

4(6)

20

C5
Bao,
cuarto
de
cocina

3450

0.4

0.5

Base
16A
2p+T

16

2.5

20

--

--

--

25

--

25

C8
Calefaccin

5750 (1)

C9
Aire
acondicionado

5750(1)

--

--

--

25

--

25

C10
Secadora

3450

0.75

Base
16A
2p+T

16

2.5

20

C11
Automatizacin

2300(1)

--

--

--

10

--

1.5

16

Potencia mxima permisible por circuito.


Las bases de toma de corriente de 16 A 2p+T sern fijas del tipo indicado en la figura C2a y las de 25 A
2p+T sern del tipo indicado en la figura ESB 25-5A, ambas de la norma UNE 20315
(3) El punto de luz incluir conductor de proteccin.
(4) Los fusibles o interruptores automticos no son necesarios si se dispone de circuitos independientes para
cada aparato, con interruptor automtico de 16 A en cada circuito. el desdoblamiento del circuito con este
fin no supondr el paso a electrificacin elevada ni la necesidad de disponer de un diferencial adicional.
(5) Este valor corresponde a una instalacin de dos conductores y tierra con aislamiento de PVC bajo tubo
empotrado en obra, segn tabla 1 de ITC-BT-19. Otras secciones pueden ser requeridas para otros tipos de
cable o condiciones de instalacin.
(6) En este circuito exclusivamente, cada toma individual puede conectarse mediante un conductor de
seccin 2,5 mm2 que parta de una caja de derivacin del circuito de 4 mm2.
(1)
(2)

Puntos de utilizacin
.
En cada estancia se utilizar, como mnimo, los puntos de utilizacin que se indican en
la tabla siguiente:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Mecanismo
Estancia

Circuuito

Acceso

C1

Vestbulo

n
mnimo

Pulsador timbre

Punto de luz

Interruptor 10 A

--

Base 16A 2p+T

--

Punto de luz

Hasta 10m2 (2 si S>10


m2)

Interruptor 10 A

1 por punto de luz

C2

Base 16A 2p+T

3 (1)

1 cada 6m2 o
fraccin

C8

Toma de calefaccin

Hasta 10m2 (2 si S>10


m2)

C9

Toma de aire
acondicionado

Hasta 10m2 (2 si S>10


m2)

Punto de luz

Hasta 10m2 (2 si S>10


m2)

Interruptor 10 A

1 por punto de luz

C2

Base 16A 2p+T

3 (1)

1 cada 6m2 o
fraccin

C8

Toma de calefaccin

--

C9

Toma de aire
acondicionado

---

C1
C2
C1

Sala de estar o
saln

C1

Dormitorios

Punto de luz

1
1

--

C5

Base 16A 2p+T

--

C8

Toma de calefaccin

--

Punto de luz

1 cada 5m de
longitud

Interruptor/conmutador
10 A

1 en cada acceso

C2

Base 16A 2p+T

Hasta 5m (2 si L>5m)

C8

Toma de calefaccin

--

Hasta 10m2 (2 si S>10


m2)

C1
Pasillo o
distribuidores

C1

Cocina

Terrazas y
vestidores

Garajes
unifamilares y
otros

--

Interruptor 10 A

C1
Baos

Superf./Longitud

Tipo

Punto de luz
Interruptor 10 A

1 por punto de luz

C2

Base 16A 2p+T

extractor y frigorfico

C3

Base 25A 2p+T

cocina/horno

C4

Base 16A 2p+T

lavadora, lavavajillas
y termo

C5

Base 16A 2p+T

3 (2)

encima del plano de


trabajo

C8

Toma de calefaccin

--

C10

Base 16A 2p+T

secadora

Punto de luz

Hasta 10m2 (d2 si


S>10 m2)

Interruptor 10 A

1 por punto de luz

Punto de luz

Hasta 10m2 (2 si S>10


m2)

Interruptor 10 A

1 por punto de luz

Hasta 10m2 (2 si S>10


m2)

C1

C1

C2

Base 16A 2p+T

(1) En donde se prevea la instalacin de una toma para el receptor de TV, la base correspondiente deber
ser mltiple, y en este caso se considerar como una sola base a los efectos del nmero de puntos de
utilizacin del cuadro de circuitos.
(2) Se colocarn fuera de un volumen delimitado por los planos verticales situados a 0,5 m del fregadero y de
la encimera de coccin o cocina

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

LOCALES QUE CONTIENEN UNA BAERA O DUCHA (ITC-BT-27)


Las instalaciones de los recintos pertenecientes a viviendas, locales comerciales,
oficinas u otros destinados a fines similares, que contengan una ducha, una ducha
prefabricada, una baera o una baera de hidromasaje o aparato para uso anlogo,
cumplirn con las prescripciones de la Instruccin Tcnica Complementaria ITC-BT-27.
Ejecucin de las instalaciones
.
Para las instalaciones de estos recintos se atender a la clasificacin de los cuatro
volmenes 0, 1, 2 y 3 que se indican a continuacin, teniendo en cuenta la influencia
de las paredes y del tipo de bao o ducha. Los falsos techos y las mamparas no se
consideran barreras a los efectos de la separacin de volmenes.

Volumen
0:
Comprende el interior de la baera o ducha.
.
En un lugar que contenga una ducha sin plato, el volumen 0 est delimitado por el
suelo y por un plano horizontal situado a 0,05 m por encima del suelo. En este caso:
a) Si el difusor de la ducha puede desplazarse durante su uso, el volumen 0 est
limitado por el plano generatriz vertical situado a un radio de 1,2 m alrededor de la
toma de agua de la pared o el plano vertical que encierra el rea prevista para ser
ocupada por la persona que se ducha; o
.
b) Si el difusor de la ducha es fijo, el volumen 0 est limitado por el plano generatriz
vertical situado a un radio de 0,6 m alrededor del difusor.

Volumen
1
Est limitado por:
.
a) El plano horizontal superior al volumen 0 y el plano horizontal situado a 2,25 m por
.
encima del suelo, y
b) El plano vertical alrededor de la baera o ducha y que incluye el espacio por
debajo de los mismos, cuanto este espacio es accesible sin el uso de una herramienta;
o para una ducha sin plato con un difusor que puede desplazarse durante su uso, el
volumen 1 est limitado por el plano generatriz vertical situado a un radio de 1,2 m
desde la toma de agua de la pared o el plano vertical que encierra el rea prevista
para ser ocupada por la persona que se ducha; o para una ducha sin plato y con un
rociador fijo, el volumen 1 est delimitado por la superficie generatriz vertical situada a
un radio de 0,6 m alrededor del rociador.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Volumen
2
Est limitado por:
.
a) El plano vertical exterior al volumen 1 y el plano vertical paralelo situado a una
distancia de 0,6 m; y
.
b) El suelo y plano horizontal situado a 2,25 m por encima del suelo
Adems, cuando la altura del techo exceda los 2,25 m por encima del suelo, el
espacio comprendido entre el volumen 1 y el techo o hasta una altura de 3 m por
encima del suelo, cualquiera que sea el valor menor, se considera volumen 2.

Volumen
3
Est limitado por:
.
a) El plano vertical lmite exterior del volumen 2 y el plano vertical paralelo situado a
una distancia de ste de 2,4 m; y
.
b) El suelo y el plano horizontal situado a 2,25 m por encima del suelo.
Adems, cuando la altura del techo exceda los 2,25 m por encima del suelo, el
espacio comprendido entre el volumen 2 y el techo o hasta una altura de 3 m por
encima del suelo, cualquiera que sea el valor menor, se considera volumen 3.
El volumen 3 comprende cualquier espacio por debajo de la baera o ducha que sea
accesible slo mediante el uso de una herramienta siempre que el cierre de dicho
volumen garantice una proteccin como mnimo IP X4. Esta clasificacin no es
aplicable al espacio situado por debajo de las baeras de hidromasaje y cabinas.
Con el fin de garantizar la seguridad, una conexin equipotencial local suplementaria
debe unir el conductor de proteccin asociado con las partes conductoras accesibles
de los equipos de clase I en los volmenes 1, 2 y 3, incluidas las tomas de corriente y las
siguientes partes conductoras externas de los volmenes 0, 1, 2 y 3:
- Canalizaciones metlicas de los servicios de suministro y desages (por ejemplo
.
agua, gas) ;
- Canalizaciones metlicas de calefacciones centralizadas y sistemas de aire
acondicionado;
- Partes metlicas accesibles de la estructura del edificio. Los marcos metlicos de
puertas, ventanas y similares no se consideran partes externas accesibles, a no ser que
estn conectadas a la estructura metlica del edificio.
.
- Otras partes conductoras externas, por ejemplo partes que son susceptibles de
transferir tensiones.
As mismo, las baeras y duchas metlicas se consideran partes conductoras externas
susceptibles de transferir tensiones.
4.2.1.4.- EJECUCION,PUESTA EN SERVICIO Y UTILIZACION DE LA INSTALACION ELECTRICA
Segn lo establecido en el artculo 12.3 de la Ley 21/1992, de Industria, la puesta en
servicio y utilizacin de la instalacin elctrica que se prev para la edificacin objeto
del presente proyecto se condiciona al siguiente procedimiento:
.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

a) Deber elaborarse, previamente a la ejecucin, la oportuna documentacin


tcnica que defina las caractersticas de la instalacin y que, en funcin de stas,
segn determine la correspondiente ITC, revestir la forma de proyecto o memoria
tcnica.
b) La instalacin deber verificarse por el instalador, con la supervisin del director de
obra, en su caso, a fin de comprobar la correcta ejecucin y funcionamiento seguro
de la misma.
.
c) Asimismo, cuando as se determine en la correspondiente ITC, la instalacin deber
ser objeto de una inspeccin inicial por un organismo de control.
d) A la terminacin de la instalacin y realizadas las verificaciones pertinentes y, en su
caso, la inspeccin inicial, el instalador autorizado ejecutor de la instalacin emitir un
certificado de instalacin, en el que se har constar que la misma se ha realizado
deconformidad con lo establecido en el Reglamento y sus instrucciones tcnicas
complementarias y de acuerdo con la documentacin tcnica. En su caso,
identificar y justificar las variaciones que en la ejecucin se hayan producido con
relacin a lo previsto en dicha documentacin.
.
e) El certificado, junto con la documentacin tcnica y, en su caso, el certificado de
direccin de obra y el de inspeccin inicial, deber depositarse ante el rgano
competente de la Comunidad Autnoma, con objeto de registrar la referida
instalacin, recibiendo las copias diligenciadas necesarias para la constancia de cada
interesado
y solicitud de suministro de energa.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

4.3.- LISTADO DE NORMATIVAS DE OBLIGADO CUMPLIMIENTO


Cumplimiento de normativa tcnica
De acuerdo con el artculo 1 A). Uno, del Decreto 462/1971, de 11 de marzo, en la ejecucin de
las obras debern observarse las normas vigentes aplicables sobre construccin. A tal fin se
incluye la siguiente relacin no exhaustiva de la normativa tcnica aplicable, que lo ser en
funcin de la naturaleza del objeto del proyecto:
ndice
0)

Normas de carcter general


0.1 Normas de carcter general

1)

Estructuras
1.1 Acciones en la edificacin
1.2 Acero
1.3 Fabrica de Ladrillo
1.4 Hormign
1.5 Madera
1.6 Forjados
1.7 Cimentacin

2)

Instalaciones
2.1 Agua
2.2 Ascensores
2.3 Audiovisuales y Antenas
2.4 Calefaccin, Climatizacin y Agua Caliente Sanitaria
2.5 Electricidad
2.6 Instalaciones de Proteccin contra Incendios

3)

Cubiertas
3.1 Cubiertas

4)

Proteccin
4.1 Aislamiento Acstico
4.2 Aislamiento Trmico
4.3 Proteccin Contra Incendios

5)

4.4 Seguridad y Salud en las obras de Construccin


4.5 Seguridad de Utilizacin
Barreras arquitectnicas
5.1 Barreras Arquitectnicas

6)

Varios
6.1 Instrucciones y Pliegos de Recepcin
6.2 Medio Ambiente
6.3 Otros

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

0) NORMAS DE CARCTER GENERAL


0.1) NORMAS DE CARCTER GENERAL
Ordenacin de la edificacin
LEY 38/1999, de 5 de noviembre, de la Jefatura del Estado
B.O.E.: 6-NOV-1999
MODIFICADA POR:
Artculo 82 de la Ley 24/2001, de 27 de diciembre, de Medidas Fiscales, Administrativas y
del Orden Social
LEY 24/2001, de 27 de diciembre, de Jefatura del Estado
B.O.E.: 31-DIC-2001
Artculo 105 de la Ley 53/2002, de 30 de diciembre, de Medidas Fiscales, Administrativas y
del Orden Social
LEY 53/2002, de 30 de diciembre, de Jefatura del Estado
B.O.E.: 31-DIC-2002
Artculo 15 de la Ley 25/2009, de 22 de diciembre, de modificacin de diversas leyes para su
adaptacin a la Ley sobre el libre acceso a las actividades de servicios y su ejercicio
LEY 25/2009, de 22 de diciembre, de Jefatura del Estado
B.O.E.: 23-DIC-2009
Cdigo Tcnico de la Edificacin
REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de Vivienda
B.O.E.: 28-MAR-2006
Correccin de errores y erratas: B.O.E. 25-ENE-2008
MODIFICADO POR:
Modificacin del Real Decreto 314/2006, de 17 de marzo, por el que se aprueba el Cdigo
Tcnico de la Edificacin
REAL DECRETO 1371/2007, de 19 de octubre, del Ministerio de Vivienda
B.O.E.: 23-OCT-2007
Correccin de errores: B.O.E. 20-DIC-2007
MODIFICADO POR:
Modificacin del Real Decreto 1371/2007, de 19-OCT
Real Decreto 1675/2008, de 17 de octubre, del Ministerio de Vivienda
B.O.E.: 18-OCT-2008
Modificacin de determinados documentos bsicos del Cdigo Tcnico de la Edificacin ,
aprobados por el Real Decreto 314/2006, de 17 de marzo, y el Real Decreto 1371/2007, de 19 de
octubre
Orden 984/2009, de 15 de abril, del Ministerio de Vivienda

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

B.O.E.: 23-ABR-2009
Correccin de errores y erratas: B.O.E. 23-SEP-2009
Modificacin del Real Decreto 314/2006, de 17 de marzo, en materia de accesibilidad y no
discriminacin de las personas con discapacidad
REAL DECRETO 173/2010, de 19 de febrero, del Ministerio de Vivienda
B.O.E.: 11-MAR-2010
Modificacin del Cdigo Tcnico de la Edificacin (CTE) aprobado por Real Decreto 314/2006,
de 17 de marzo
Disposicin final segunda, del Real Decreto 410/2010, de 31 de marzo, del Ministerio de
Vivienda
B.O.E.: 22-ABR-2010
Certificacin energtica de edificios de nueva construccin
REAL DECRETO 47/2007,de 19 de enero, del Ministerio de la Presidencia
B.O.E.: 31-ENE-2007
Correccin de errores: B.O.E. 17-NOV-2007
1) ESTRUCTURAS
1.1) ACCIONES EN LA EDIFICACIN
DB SE-AE. Seguridad estructural - Acciones en la Edificacin.
Cdigo Tcnico de la Edificacin. REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de
Vivienda
B.O.E.: 28-MAR-2006
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
Norma de Construccin Sismorresistente: parte general y edificacin (NCSR-02)
REAL DECRETO 997/2002, de 27 de septiembre, del Ministerio de Fomento
B.O.E.: 11-OCT-2002
1.2) ACERO
DB SE-A. Seguridad Estructural - Acero
Cdigo Tcnico de la Edificacin. REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de
Vivienda
B.O.E.: 28-MAR-2006
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
1.3) FBRICA
DB SE-F. Seguridad Estructural Fbrica

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cdigo Tcnico de la Edificacin. REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de


Vivienda
B.O.E.: 28-MAR-2006
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
1.4) HORMIGN
Instruccin de Hormign Estructural "EHE
REAL DECRETO 1247/2008, de 18 de julio, del Ministerio de la Presidencia
B.O.E.: 22-AGO-2008
Correccin errores: 24-DIC-2008
1.5) MADERA
DB SE-M. Seguridad estructural - Estructuras de Madera
Cdigo Tcnico de la Edificacin. REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de
Vivienda
B.O.E.: 28-MAR-2006
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
1.6) FORJADOS
Fabricacin y empleo de elementos resistentes para pisos y cubiertas
REAL DECRETO 1630/1980, de 18 de julio, de la Presidencia del Gobierno
B.O.E.: 8-AGO-1980
MODIFICADO POR:
Modificacin de fichas tcnicas a que se refiere el Real Decreto anterior sobre
autorizacin de uso para la fabricacin y empleo de elementos resistentes de pisos y
cubiertas.
ORDEN de 29 de noviembre de 1989, del Ministerio de Obras Pblicas y Urbanismo
B.O.E.: 16-DIC-1989
MODIFICADO POR:
Actualizacin del contenido de las fichas tcnicas y del sistema de autocontrol de la
calidad de la produccin, referidas en el Anexo I de la Orden de 29-NOV-89
RESOLUCIN de 6 de noviembre, del Ministerio de Fomento
B.O.E.: 2-DIC-2002
Actualizacin de las fichas de autorizacin de uso de sistemas de forjados
RESOLUCIN de 30 de enero 1997, del Ministerio de Fomento
B.O.E.: 6-MAR-1997

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.7) CIMENTACIN
DB SE-C. Seguridad estructural - Cimientos
Cdigo Tcnico de la Edificacin. REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de
Vivienda
B.O.E.: 28-MAR-2006
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
2) INSTALACIONES
2.1) AGUA
Criterios sanitarios de la calidad del agua de consumo humano
REAL DECRETO 140/2003, de 7 de febrero, del Ministerio de la Presidencia
B.O.E.: 21-FEB-2003
DB HS. Salubridad (Captulos HS-4, HS-5)
Cdigo Tcnico de la Edificacin. REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de
Vivienda
B.O.E.: 28-MAR-2006
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
2.2) ASCENSORES
Disposiciones de aplicacin de la Directiva del Parlamento Europeo y del Consejo 95/16/CE,
sobre ascensores
REAL DECRETO 1314/1997 de 1 de agosto de 1997, del Ministerio de Industria y Energa
B.O.E.: 30-SEP-1997
Correccin errores: 28-JUL-1998
Reglamento de aparatos de elevacin y manutencin de los mismos
(slo estn vigentes los artculos 10 a 15, 19 y 23, el resto ha sido derogado por el Real Decreto
1314/1997)
REAL DECRETO 2291/1985, de 8 de noviembre, del Ministerio de Industria y Energa
B.O.E.: 11-DIC-1985
MODIFICADO POR:
Art 2 de la modificacin de diversas normas reglamentarias en materia de seguridad
industrial , para adecuarlas a la Ley 17/2009, de 23 de noviembre y a la Ley 25/2009, de 22
de diciembre
REAL DECRETO 560/2010, de 7 de mayo, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 22-MAY-2010

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Prescripciones para el incremento de la seguridad del parque de ascensores existentes


REAL DECRETO 57/2005, de 21 de enero, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 04-FEB-2005
Instruccin tcnica complementaria ITC-MIE-AEM 1, referente a ascensores electromecnicos
(Derogado, excepto los preceptos a los que remiten los artculos vigentes del
Reglamento de aparatos de elevacin y manutencin de los mismos)
ORDEN de 23 de septiembre de 1987, del Ministerio de Industria y Energa
B.O.E.: 6-OCT-1987
Correccin errores: 12-MAY-1988
MODIFICADA POR:
Modificacin de la ITC-MIE-AEM 1, referente a ascensores electromecnicos
ORDEN de 12 de septiembre de 1991, del Ministerio de Industria, Comercio y Turismo
B.O.E.: 17-SEP-1991
Correccin errores: 12-OCT-1991
Prescripciones tcnicas no previstas en la ITC-MIE-AEM 1, del Reglamento de aparatos de
elevacin y manutencin de los mismos
RESOLUCIN de 27 de abril de 1992, de la Direccin General de Poltica Tecnolgica del
Ministerio de Industria, Comercio y Turismo
B.O.E.: 15-MAY-1992
2.3) AUDIOVISUALES Y ANTENAS
Infraestructuras comunes en los edificios para el acceso a los servicios de telecomunicaciones.
REAL DECRETO LEY 1/1998, de 27 de febrero, de la Jefatura del Estado
B.O.E.: 28-FEB-1998
MODIFICADO POR:
Modificacin del artculo 2, apartado a), del Real Decreto-Ley 1/1998
Disposicin Adicional Sexta, de la Ley 38/1999, de 5 de noviembre, de Jefatura del Estado,
de Ordenacin de la Edificacin
B.O.E.: 06-NOV-1999
Reglamento regulador de las infraestructuras comunes de telecomunicaciones para el acceso a
los servicios de telecomunicacin en el interior de las edificaciones.
REAL DECRETO 346/2011, de 11 de marzo, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 1-ABR-2011
2.4) CALEFACCIN, CLIMATIZACIN Y AGUA CALIENTE SANITARIA
Reglamento de Instalaciones Trmicas en los Edificios (RITE)
REAL DECRETO 1027/2007, de 20 de julio, del Ministerio de la Presidencia
B.O.E.: 29-AGO-2007

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Correccin errores: 28-FEB-2008


MODIFICADO POR:
Art. segundo del Real Decreto 249/2010, de 5 de marzo, del Ministerio de la Presidencia
B.O.E.: 18-MAR-2010
Correccin errores: 23-ABR-2010
Real Decreto 1826/2009, de 27 de noviembre, del Ministerio de la Presidencia
B.O.E.: 11-DIC-2009
Correccin errores: 12-FEB-2010
Correccin errores: 25-MAY-2010
Reglamento tcnico de distribucin y utilizacin de combustibles gaseosos y sus instrucciones
tcnicas complementarias ICG 01 a 11
REAL DECRETO 919/2006, de 28 de julio, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 4-SEPT-2006
MODIFICADO POR:
Art 13 de la modificacin de diversas normas reglamentarias en materia de seguridad
industrial , para adecuarlas a la Ley 17/2009, de 23 de noviembre y a la Ley 25/2009, de 22
de diciembre
REAL DECRETO 560/2010, de 7 de mayo, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 22-MAY-2010
Instruccin tcnica complementaria MI-IP 03 Instalaciones petrolferas para uso propio
REAL DECRETO 1427/1997, de 15 de septiembre, del Ministerio de Industria y Energa
B.O.E.: 23-OCT-1997
Correccin errores: 24-ENE-1998
MODIFICADA POR:
Modificacin del Reglamento de instalaciones petrolferas, aprobado por R. D. 2085/1994,
de 20-OCT, y las Instrucciones Tcnicas complementarias MI-IP-03, aprobadas por el R.D.
1427/1997, de 15-SET, y MI-IP-04, aprobada por el R.D. 2201/1995, de 28-DIC.
REAL DECRETO 1523/1999, de 1 de octubre, del Ministerio de Industria y Energa
B.O.E.: 22-OCT-1999
Correccin errores: 3-MAR-2000
Art 6 de la modificacin de diversas normas reglamentarias en materia de seguridad
industrial , para adecuarlas a la Ley 17/2009, de 23 de noviembre y a la Ley 25/2009, de 22
de diciembre
REAL DECRETO 560/2010, de 7 de mayo, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 22-MAY-2010
Criterios higinico-sanitarios para la prevencin y control de la legionelosis
REAL DECRETO 865/2003, de 4 de julio, del Ministerio de Sanidad y Consumo
B.O.E.: 18-JUL-2003

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

DB HE. Ahorro de Energa (Captulo HE-4: Contribucin solar mnima de agua caliente sanitaria)
Cdigo Tcnico de la Edificacin REAL DECRETO. 314/2006, de 17 de marzo, del Ministerio de
Vivienda
B.O.E.: 28-MAR-2006
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
2.5) ELECTRICIDAD
Reglamento Electrotcnico para Baja Tensin e instrucciones Tcnicas Complementarias (ITC) BT
01 a BT 51
REAL DECRETO 842/2002, de 2 de agosto, del Ministerio de Ciencia y Tecnologa
B.O.E.: suplemento al n 224, 18-SEP-2002
Anulado el inciso 4.2.C.2 de la ITC-BT-03 por:
SENTENCIA de 17 de febrero de 2004 de la Sala Tercera del Tribunal Supremo
B.O.E.: 5-ABR-2004
MODIFICADO POR:
Art 7 de la modificacin de diversas normas reglamentarias en materia de seguridad
industrial , para adecuarlas a la Ley 17/2009, de 23 de noviembre y a la Ley 25/2009, de 22
de diciembre
REAL DECRETO 560/2010, de 7 de mayo, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 22-MAY-2010
Autorizacin para el empleo de sistemas de instalaciones con conductores aislados bajo
canales protectores de material plstico
RESOLUCIN de 18 de enero 1988, de la Direccin General de Innovacin Industrial
B.O.E.: 19-FEB-1988
Reglamento de eficiencia energtica en instalaciones de alumbrado exterior y sus Instrucciones
Tcnicas Complementarias EA-01 a EA-07
REAL DECRETO 1890/2008, de 14 de noviembre, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 19-NOV-2008
2.6) INSTALACIONES DE PROTECCIN CONTRA INCENDIOS
Reglamento de instalaciones de proteccin contra incendios
REAL DECRETO 1942/1993, de 5 de noviembre, del Ministerio de Industria y Energa
B.O.E.: 14-DIC-1993
Correccin de errores: 7-MAY-1994
MODIFICADO POR:
Art 3 de la modificacin de diversas normas reglamentarias en materia de seguridad
industrial , para adecuarlas a la Ley 17/2009, de 23 de noviembre y a la Ley 25/2009, de 22
de diciembre
REAL DECRETO 560/2010, de 7 de mayo, del Ministerio de Industria, Turismo y Comercio

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

B.O.E.: 22-MAY-2010
Normas de procedimiento y desarrollo del Real Decreto 1942/1993, de 5-NOV, por el que se
aprueba el Reglamento de instalaciones de proteccin contra incendios y se revisa el anexo I y
los apndices del mismo
ORDEN, de 16 de abril de 1998, del Ministerio de Industria y Energa
B.O.E.: 28-ABR-1998
3) CUBIERTAS
3.1) CUBIERTAS
DB HS-1. Salubridad
Cdigo Tcnico de la Edificacin. REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de
Vivienda
B.O.E.: 28-MAR-2006
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
4) PROTECCIN
4.1) AISLAMIENTO ACSTICO
DB HR. Proteccin frente al ruido
REAL DECRETO 1371/2007, de 19 de octubre, del Ministerio de Vivienda
B.O.E.: 23-OCT-2007
Correccin de errores: B.O.E. 20-DIC-2007
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
4.2) AISLAMIENTO TRMICO
DB-HE-Ahorro de Energa
Cdigo Tcnico de la Edificacin. REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de
Vivienda
B.O.E.: 28-MAR-2006
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
4.3) PROTECCIN CONTRA INCENDIOS
DB-SI-Seguridad en caso de Incendios
Cdigo Tcnico de la Edificacin. REAL DECRETO 314/2006, de 17 de marzo, del Ministerio de
Vivienda
B.O.E.: 28-MAR-2006

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
Reglamento de Seguridad contra Incendios en los establecimientos industriales.
REAL DECRETO 2267/2004, de 3 Diciembre, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 17-DIC-2004
Correccin errores: 05-MAR-2005
MODIFICADO POR:
Art 10 de la modificacin de diversas normas reglamentarias en materia de seguridad
industrial, para adecuarlas a la Ley 17/2009, de 23 de noviembre y a la Ley 25/2009, de 22
de diciembre
REAL DECRETO 560/2010, de 7 de mayo, del Ministerio de Industria, Turismo y Comercio
B.O.E.: 22-MAY-2010
Clasificacin de los productos de construccin y de los elementos constructivos en funcin de
sus propiedades de reaccin y de resistencia frente al fuego
REAL DECRETO 312/2005, de 18 de marzo , del Ministerio de la Presidencia
B.O.E.: 02-ABR-2005
MODIFICADO POR:
Modificacin del Real Decreto 312/2005, de 18 de marzo, por el que se aprueba la clasificacin
de los productos de la construccin y de los elementos constructivos en funcin de sus
propiedades de reaccin y de resistencia al fuego.
REAL DECRETO 110/2008, de 1 de febrero, del Ministerio de la Presidencia
B.O.E.: 12-FEB-2008
4.4) SEGURIDAD Y SALUD EN LAS OBRAS DE CONSTRUCCIN
Disposiciones mnimas de seguridad y de salud en las obras de construccin
REAL DECRETO 1627/1997, de 24 de octubre, del Ministerio de la Presidencia
B.O.E.: 25-OCT-1997
MODIFICADO POR:
Modificacin del Real Decreto 1215/1997, de 18 de julio, por el que se establecen las
disposiciones mnimas de seguridad y salud para la utilizacin por los trabajadores de los
equipos de trabajo, en materia de trabajos temporales en altura.
REAL DECRETO 2177/2004, de 12 de noviembre, del Ministerio de la Presidencia
B.O.E.: 13-NOV-2004
Modificacin del Real Decreto 1627/1997, de 24 de octubre, por el que se establecen las
disposiciones mnimas de seguridad y salud en las obras de construccin.
REAL DECRETO 604/2006, de 19 de mayo, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 29-MAY-2006
Disposicin final tercera del Real Decreto 1109/2007, de 24 de agosto, por el que se desarrolla la
Ley 32/2006, de 18 de Octubre, reguladora de la Subcontratacin en el Sector de la
Construccin
REAL DECRETO 1109/2007, de 24 de agosto, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 25-AGO-2007

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Artculo 7 de la Ley 25/2009, de 22 de diciembre, de modificacin de diversas leyes para su


adaptacin a la Ley sobre el libre acceso a las actividades de servicios y su ejercicio
LEY 25/2009, de 22 de diciembre, de Jefatura del Estado
B.O.E.: 23-DIC-2009
Modificacin del Real Decreto 1627/1997, de 24 de octubre.
REAL DECRETO 337/2010, de 19 de marzo, del Ministerio de Trabajo e Inmigracin
B.O.E.: 23-MAR-2010
DEROGADO EL ART.18 POR:
Modificacin del Real Decreto 1627/1997, de 24 de octubre.
REAL DECRETO 337/2010, de 19 de marzo, del Ministerio de Trabajo e Inmigracin
B.O.E.: 23-MAR-2010
Prevencin de Riesgos Laborales
LEY 31/1995, de 8 de noviembre, de la Jefatura del Estado
B.O.E.: 10-NOV-1995
DESARROLLADA POR:
Desarrollo del artculo 24 de la Ley 31/1995 de Prevencin de Riesgos Laborales, en materia de
coordinacin de actividades empresariales
REAL DECRETO 171/2004, de 30 de enero, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 31-ENE-2004
MODIFICADA POR:
Artculo 8 y Disposicin adicional tercera de la Ley 25/2009, de 22 de diciembre, de
modificacin de diversas leyes para su adaptacin a la Ley sobre el libre acceso a las
actividades de servicios y su ejercicio
LEY 25/2009, de 22 de diciembre, de Jefatura del Estado
B.O.E.: 23-DIC-2009
Reglamento de los Servicios de Prevencin
REAL DECRETO 39/1997, de 17 de enero, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 31-ENE-1997
MODIFICADO POR:
Modificacin del Reglamento de los Servicios de Prevencin
REAL DECRETO 780/1998, de 30 de abril, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 1-MAY-1998
Modificacin del Reglamento de los Servicios de Prevencin
REAL DECRETO 604/2006, de 19 de mayo, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 29-MAY-2006
Modificacin del Reglamento de los Servicios de Prevencin
REAL DECRETO 337/2010, de 19 de marzo, del Ministerio de Trabajo e Inmigracin
B.O.E.: 23-MAR-2010
DEROGADA LA DISPOSICIN TRANSITORIA TERCERA POR:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Modificacin del Real Decreto 39/1997, de 17 de enero.


REAL DECRETO 337/2010, de 19 de marzo, del Ministerio de Trabajo e Inmigracin
B.O.E.: 23-MAR-2010
DESARROLLADO POR:
Desarrollo del Real Decreto 39/1997, de 17 de enero, en lo referido a la acreditacin de
entidades especializadas como servicios de prevencin, memoria de actividades preventivas y
autorizacin para realizar la actividad de auditora del sistema de prevencin de las empresas
ORDEN 2504/2010, de 20 de septiembre, del Ministerio de Trabajo e Inmigracin
B.O.E.: 28-SEP-2010
Correccin errores: 22-OCT-2010
Correccin errores: 18-NOV-2010
Sealizacin de seguridad en el trabajo
REAL DECRETO 485/1997, de 14 de abril, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 23-ABR-1997
Seguridad y Salud en los lugares de trabajo
REAL DECRETO 486/1997, de 14 de abril, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 23-ABR-1997
MODIFICADO POR:
Modificacin del Real Decreto 1215/1997, de 18 de julio, por el que se establecen las
disposiciones mnimas de seguridad y salud para la utilizacin por los trabajadores de los
equipos de trabajo, en materia de trabajos temporales en altura.
REAL DECRETO 2177/2004, de 12 de noviembre, del Ministerio de la Presidencia
B.O.E.: 13-NOV-2004
Manipulacin de cargas
REAL DECRETO 487/1997, de 14 de abril, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 23-ABR-1997
Utilizacin de equipos de proteccin individual
REAL DECRETO 773/1997, de 30 de mayo, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 12-JUN-1997
Correccin errores: 18-JUL-1997
Utilizacin de equipos de trabajo
REAL DECRETO 1215/1997, de 18 de julio, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 7-AGO-1997
MODIFICADO POR:
Modificacin del Real Decreto 1215/1997, de 18 de julio, por el que se establecen las
disposiciones mnimas de seguridad y salud para la utilizacin por los trabajadores de los
equipos de trabajo, en materia de trabajos temporales en altura.
REAL DECRETO 2177/2004, de 12 de noviembre, del Ministerio de la Presidencia
B.O.E.: 13-NOV-2004

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Disposiciones mnimas de seguridad y salud aplicables a los trabajos con riesgo de exposicin al
amianto
REAL DECRETO 396/2006, de 31 de marzo, del Ministerio de la Presidencia
B.O.E.: 11-ABR-2006
Regulacin de la subcontratacin
LEY 32/2006, de 18 de Octubre, de Jefatura del Estado
B.O.E.: 19-OCT-2006
DESARROLLADA POR:
Desarrollo de la Ley 32/2006, de 18 de Octubre, reguladora de la Subcontratacin en el Sector
de la Construccin
REAL DECRETO 1109/2007, de 24 de agosto, del Ministerio de Trabajo y Asuntos Sociales
B.O.E.: 25-AGO-2007
Correccin de errores: 12-SEP-2007
MODIFICADO POR:
Modificacin del Real Decreto 1109/2007, de 24 de agosto
REAL DECRETO 327/2009, de 13 de marzo, del Ministerio de Trabajo e Inmigracin
B.O.E.: 14-MAR-2009
Modificacin del Real Decreto 1109/2007, de 24 de agosto
REAL DECRETO 337/2010, de 19 de marzo, del Ministerio de Trabajo e Inmigracin
B.O.E.: 23-MAR-2010
MODIFICADA POR:
Artculo 16 de la Ley 25/2009, de 22 de diciembre, de modificacin de diversas leyes para su
adaptacin a la Ley sobre el libre acceso a las actividades de servicios y su ejercicio
LEY 25/2009, de 22 de diciembre, de Jefatura del Estado
B.O.E.: 23-DIC-2009
4.5) SEGURIDAD DE UTILIZACIN Y ACCESIBILIDAD
DB-SUA-Seguridad de utilizacin y accesibilidad
REAL DECRETO 173/2010, de 19 de febrero, del Ministerio de Vivienda
B.O.E.: 11-MAR-2010
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
5) BARRERAS ARQUITECTNICAS
5.1) BARRERAS ARQUITECTNICAS
Real Decreto por el que se aprueban las condiciones bsicas de accesibilidad y no
discriminacin de las personas con discapacidad para el acceso y utilizacin de los espacios
pblicos urbanizados y edificaciones.
REAL DECRETO 505/2007, de 20 de abril, del Ministerio de la Presidencia
B.O.E.: 11-MAY-2007
MODIFICADO POR:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

La Disposicin final primera de la modificacin del Real Decreto 314/2006, de 17 de marzo, en


materia de accesibilidad y no discriminacin de las personas con discapacidad
REAL DECRETO 173/2010, de 19 de febrero, del Ministerio de Vivienda
B.O.E.: 11-MAR-2010
DESARROLLADO POR:
Desarrollo del documento tcnico de condiciones bsicas de accesibilidad y no discriminacin
para el acceso y utilizacin de los espacios pblicos urbanizados
Orden 561/2010, de 1 de febrero, del Ministerio de Vivienda
B.O.E.: 11-MAR-2010
DB-SUA-Seguridad de utilizacin y accesibilidad
REAL DECRETO 173/2010, de 19 de febrero, del Ministerio de Vivienda
B.O.E.: 11-MAR-2010
Para consultar todas las modificaciones del RD 314/2006, remitirse al apartado 0.1 Normas de
carcter general
6) VARIOS
6.1) INSTRUCCIONES Y PLIEGOS DE RECEPCIN
Instruccin para la recepcin de cementos "RC-08"
REAL DECRETO 956/2008, de 6 de junio, del Ministerio de la Presidencia
B.O.E.: 19-JUN-2008
Correccin errores: 11-SEP-2008
Disposiciones para la libre circulacin de productos de construccin en aplicacin de la
Directiva 89/106/CEE
REAL DECRETO 1630/1992, de 29 de diciembre, del Ministerio de Relacin con las Cortes y de la
Secretara del Gobierno
B.O.E.: 09-FEB-1993
MODIFICADO POR:
Modificacin del Real Decreto 1630/1992, de 29 de diciembre, en aplicacin de la Directiva
93/68/CEE.
REAL DECRETO 1328/1995, de 28 de julio, del Ministerio de la Presidencia
B.O.E.: 19-AGO-1995
6.2) MEDIO AMBIENTE
Reglamento de actividades molestas, insalubres, nocivas y peligrosas
DECRETO 2414/1961, de 30 de noviembre, de Presidencia de Gobierno
B.O.E.: 7-DIC-1961
Correccin errores: 7-MAR-1962
DEROGADOS el segundo prrafo del artculo 18 y el Anexo 2 por:
Proteccin de la salud y seguridad de los trabajadores contra los riesgos relacionados con
los agentes qumicos durante el trabajo

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

REAL DECRETO 374/2001, de 6 de abril, del Ministerio de la Presidencia


B.O.E.: 1-MAY-2001
DEROGADO por:
Calidad del aire y proteccin de la atmsfera
LEY 34/2007, de 15 de noviembre, de Jefatura del Estado
B.O.E.: 16-NOV-2007
No obstante, el reglamento de actividades molestas, insalubres, nocivas y peligrosas
mantendr su vigencia en aquellas comunidades y ciudades autnomas que no tengan
normativa aprobada en la materia, en tanto no se dicte dicha normativa
Instrucciones complementarias para la aplicacin del Reglamento de actividades molestas,
insalubres, nocivas y peligrosas
ORDEN de 15 de marzo de 1963, del Ministerio de la Gobernacin
B.O.E.: 2-ABR-1963
Ruido
LEY 37/2003, de 17 de noviembre, de Jefatura del Estado
B.O.E.: 18-NOV-2003
DESARROLLADA POR:
Desarrollo de la Ley 37/2003, de 17 de noviembre, del ruido, en lo referente a la evaluacin y
gestin del ruido ambiental.
REAL DECRETO 1513/2005, de 16 de diciembre, del Ministerio de la Presidencia
B.O.E.: 17-DIC-2005
MODIFICADO POR:
Modificacin del Real Decreto 1513/2005, de 16 de
diciembre, por el
que se desarrolla la Ley 37/2003, de 17 de noviembre, del
ruido.
Disposicin final primera del REAL DECRETO 1367/2007, de 19
de octubre,
del Ministerio de la Presidencia
B.O.E.: 23-OCT-2007
Desarrollo de la Ley 37/2003, de 17 de noviembre, del ruido, en lo referente a zonificacin
acstica, objetivos de calidad y emisiones acsticas.
REAL DECRETO 1367/2007, de 19 de octubre, del Ministerio de la Presidencia
B.O.E.: 23-OCT-2007
Regulacin de la produccin y gestin de los residuos de construccin y demolicin
REAL DECRETO 105/2008, de 1 de febrero, del Ministerio de la Presidencia
B.O.E.: 13-FEB-2008
6.3) OTROS
Ley del Servicio Postal Universal, de los derechos de los usuarios y del mercado postal
LEY 43/2010, de 30 de diciembre, de Jefatura del Estado
B.O.E.: 31-DIC-2010

Julio de 2.011
Pedro Enrique Santos Buenda
Arquitecto

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.- ANEJOS A LA MEMORIA

ndice

5.1.- INFORMACIN GEOTCNICA


5.2.- INSTALACIONES DEL EDIFICIO
5.2.1.- INSTALACIN DE ELECTRICIDAD
5.2.2.- INSTALACIN DE FONTANERA
5.2.3.- INSTALACIN DE SANEAMIENTO
5.2.4.- INSTALACIN SOLAR-TRMICA PARA A.C.S.
5.2.5.- INSTALACIN DE VENTILACIN PARA LA CALIDAD DEL IRE INTERIOR

5.3.- EFICIENCIA ENERGETICA A


5.4.- GESTIN DE RESDUOS
5.5.- PLAN DE CONTROL DE CALIDAD
5.6.- ESTUDIO DE SEGURIDAD Y SALUD

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.1.- INFORMACION GEOTECNICA


Se adjunta escrito de la propiedad donde se da la conformidad a la solucin
adoptada por no aportar estudio geotcnico.

Ronda, Julio de 2.011


En el presente proyecto los promotores no hacen entrega del estudio geotcnico del
solar, establecido en el DB-C Cimientos, a pesar de habrsele advertido de la
necesidad del mismo conforme al sealado en el articulo 9.2.b de la ley 38/1999.
Solicitando del autor del proyecto que adopte una solucin alternativa y prestando,
consiguientemente, su conformidad a la misma de acuerdo con lo previsto en el
artculo 5.1 .3.b del Cdigo Tcnico de la Edificacin.

Firmado:
David Lpez Blanco y Ana Becerra de Haro, con DNI 76799241X y
25556855Z respectivamente

Proyecto: Bsico y de Ejecucin de Vivienda Unifamiliar con garaje


Emplazamiento: C/Montes, 20 de Ronda
Arquitecto: Pedro Enrique Santos Buenda

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.2.- INSTALACIONES DEL EDIFICIO


5.2.1.- INSTALACIN DE ELECTRICIDAD
5.2.1.1.- MEMORIA JUSTIFICATIVA
5.2.1.1.1.- POTENCIAS
Calcularemos la potencia real de un tramo sumando la potencia instalada de
los receptores que alimenta, y aplicando la simultaneidad adecuada y los coeficientes
impuestos por el REBT. Entre estos ltimos cabe destacar:
Factor de 18 a aplicar en tramos que alimentan a puntos de luz con lmparas o
tubos de descarga. (Instruccin ITC-BT-09, apartado 3 e Instruccin ITC-BT 44,
apartado 3.1del REBT).
Factor de 125 a aplicar en tramos que alimentan a uno o varios motores, y que
afecta a la potencia del mayor de ellos. (Instruccin ITC-BT-47, apartado. 3 del
REBT).

5.2.1.1.2.- INTENSIDADES
Determinaremos la intensidad por aplicacin de las siguientes expresiones:
- Distribucin monofsica:

I=

P
V Cos
Siendo:
V

Tensin (V)

Potencia (W)

Intensidad de corriente (A)

Factor de potencia

Tensin entre hilos activos.

Cos

- Distribucin trifsica:

I=

P
3 V Cos
Siendo:
V

5.2.1.1.3.- SECCIN
Para determinar la seccin de los cables utilizaremos tres mtodos de clculo
distintos:

Calentamiento.
Limitacin de la cada de tensin en la instalacin (momentos

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

elctricos).
Limitacin de la cada de tensin en cada tramo.

Adoptaremos la seccin nominal ms desfavorable de las tres resultantes,


tomando como valores mnimos 1,50 mm para alumbrado y 2,50 mm para fuerza.
5.2.1.1.3.1.- CLCULO DE LA SECCIN POR CALENTAMIENTO
Aplicaremos para el clculo por calentamiento lo expuesto en la norma
UNE 20.460-94/5-523. La intensidad mxima que debe circular por un cable para que
ste no se deteriore viene marcada por las tablas 52-C1 a 52-C12. En funcin del
mtodo de instalacin adoptado de la tabla 52-B2, determinaremos el mtodo de
referencia segn 52-B1, que en funcin del tipo de cable nos indicar la tabla de
intensidades mximas que hemos de utilizar.
La intensidad mxima admisible se ve afectada por una serie de factores
como son la temperatura ambiente, la agrupacin de varios cables, la exposicin al
sol, etc. que generalmente reducen su valor. Hallaremos el factor por temperatura
ambiente a partir de las tablas 52-D1 y 52-D2. El factor por agrupamiento, de las tablas
52-E1, 52-E2, 52-E3 A y 52-E3 B. Si el cable est expuesto al sol, o bien, se trata de un
cable con aislamiento mineral, desnudo y accesible, aplicaremos directamente un 0,9.
Para el clculo de la seccin, dividiremos la intensidad de clculo por el
producto de todos los factores correctores, y buscaremos en la tabla la seccin
correspondiente para el valor resultante. Para determinar la intensidad mxima
admisible del cable, buscaremos en la misma tabla la intensidad para la seccin
adoptada, y la multiplicaremos por el producto de los factores correctores.

5.2.2.1.1.3.2.- MTODO DE LOS MOMENTOS ELCTRICOS


Este mtodo nos permitir limitar la cada de tensin en toda la instalacin
a 4,50% para alumbrado y 6,50% para fuerza. Para ejecutarlo, utilizaremos las
siguientes frmulas:
- Distribucin monofsica:

S=

2
; = (Li Pi )
K e U n
Siendo:
S =

Seccin del cable (mm)

Longitud virtual.

Cada de tensin (V)

Conductividad.

Li

Longitud desde el tramo hasta el receptor (m)

Pi =

Potencia consumida por el receptor (W)

Un =

Tensin entre fase y neutro (V)

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

- Distribucin trifsica:

S=

K e U n

; = (Li Pi )
Siendo:
Un =

Tensin entre fases (V)

5.2.1.1.4.- CADA DE TENSIN

Una vez determinada la seccin, calcularemos la cada de tensin en el tramo


aplicando las siguientes frmulas:
- Distribucin monofsica:

e=

2 PL
K S U n
Siendo:
e

Cada de tensin (V)

Seccin del cable (mm)

Conductividad

Longitud del tramo (m)

Potencia de clculo (W)

Un =

Tensin entre fase y neutro (V)

- Distribucin trifsica:

e=

PL
K S U n
Siendo:
Un =

Tensin entre fases (V)

5.2.1.1.5.- INTENSIDADES DE CORTOCIRCUITO


Las intensidades de cortocircuito en cada punto de la instalacin se determinan
por clculo siguiendo el siguiente mtodo:
1. Se realiza la suma de las resistencias y reactancias situadas aguas arriba
del punto considerado.

RT = R1 + R2 + R3 + K
X T = X1 + X 2 + X 3 + K

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2. Se calcula la intensidad de cortocircuito mediante la siguiente frmula:

I cc =

Uo
3 RT2 + X T2
Siendo:
Uo

Tensin entre fases del transformador en vaco, lado


secundario o baja tensin, expresada en voltios.

RT y XT

Resistencia y reactancia total expresada en mili ohmios (m)

Para determinar las resistencias y reactancias en cada parte de la instalacin:


Parte

de

la

instalacin

Resistencias

Reactancias

(m)

(m)

R1 = Z 1 cos 10 3
cos = 0,15

Red aguas arriba

Z1 =

sen = 0,98

U2
Pcc

R2 =

Transformador

R3 =

En cables

X 1 = Z1 sen 10 3

X 2 = Z 22 R22

Wc U
10 3
S2

Z2 =

X 3 = 0,08 L (cable multipolar)

U cc U 2

100 S

X 3 = 0,12 L (cable unipolar )

Siendo:
Pcc

Potencia de cortocircuito de la red de distribucin, estar


expresada en MVA, siendo un dato facilitado por la Compaa
Suministradora.

Wc

Prdidas en el Cu del transformador.

Potencia aparente del transformador (kVA).

Ucc

Tensin de cortocircuito del transformador.

Longitud del cable, en m.

Seccin del cable, en mm.

Resistividad: 22,5 (Cu) y 36 (Al).

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.2.1.2.2.- MTODOS DE INSTALACIN EMPLEADOS


Referencia

RZ1-K (AS) unip. enterrados bajo tubo

Tipo de instalacin

[Ref 71] Cables unipolares en conductos o en conductos perfilados enterrados.


La resistividad trmica del terreno es de 2,5 K m / W.

(UNE 20460-5-523:2004)
Disposicin

En caso de ms de un circuito, la distancia entre tubos es nula

Temperatura ambiente (C)

25

Exposicin al sol

No

Tipo de cable

unipolar

Material de aislamiento

XLPE (Polietileno reticulado)

Tensin de aislamiento (V)

0,6/1 kV

Material conductor

Cu

Conductividad (mm)/m

56,00

Tabla de intensidades
conductores

mximas

para

Tabla de intensidades
conductores

mximas

para

Tabla de tamao de los tubos

52-C2, col.7 Cu

52-C4, col.7 Cu
9, ITC-BT-21

Listado de las lneas de la instalacin que Acometida Edificio.


utilizan este mtodo

Referencia

ES07Z1-K (AS) unip. en vacos de construccin bajo tubo flexible

Tipo de instalacin

[Ref 41] Conductores aislados en conductos en vacos de construccin. 1,5 De


<= V < 20 De.

(UNE 20460-5-523:2004)
Disposicin
Temperatura ambiente (C)

40

Exposicin al sol

No

Tipo de cable

unipolar

Material de aislamiento

Z1 (Compuesto termoplstico a base de poliolefina)

Tensin de aislamiento (V)

450/750

Material conductor

Cu

Conductividad (mm)/m

56,00

Tabla de intensidades
conductores

mximas

para

52-C1, col.5 Cu

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Tabla de intensidades
conductores

mximas

para

Tabla de tamao de los tubos

52-C3, col.5 Cu
5, ITC-BT-21

Listado de las lneas de la instalacin que Der.Ind. VIVIENDA.


utilizan este mtodo

Referencia

H07V-U unip. empotrados bajo tubo flexible

Tipo de instalacin

[Ref 59] Conductores aislados o cables unipolares en conductos empotrados en


una pared de mampostera.

(UNE 20460-5-523:2004)
Disposicin
Temperatura ambiente (C)

40

Exposicin al sol

No

Tipo de cable

unipolar

Material de aislamiento

PVC (Policloruro de vinilo)

Tensin de aislamiento (V)

450/750

Material conductor

Cu

Conductividad (mm)/m

56,00

Tabla de intensidades
conductores

mximas

para

Tabla de intensidades
conductores

mximas

para

Tabla de tamao de los tubos

52-C1, col.4 Cu

52-C3, col.4 Cu
5, ITC-BT-21

Listado de las lneas de la instalacin que C1.


utilizan este mtodo
C2.
C3.
C4.
C5.
C7.
C10.
C15.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.2.1.3.- DEMANDA DE POTENCIA


- RESUMEN
Potencia instalada: Consideramos la potencia instalada como la suma de los
consumos de todos los receptores de la instalacin. En este caso, y segn desglose
detallado, asciende a 9,20 kW.
Potencia de clculo: Se trata de la mxima carga prevista para la que se
dimensionan los conductores, y se obtiene aplicando los factores indicados por el REBT,
as como la simultaneidad o reserva estimada para cada caso. Para la instalacin
objeto de proyecto, resulta una potencia de clculo de 9,20 kW.
Potencia a contratar: Se elige la potencia normalizada por la compaa
suministradora superior y ms prxima a la potencia de clculo. Dadas estas
condiciones, seleccionamos una potencia a contratar de 9,20 kW.
- DESGLOSE NIVEL 0
Acometida Edificio
Vivienda
- VIVIENDA ................................................................................................... 9.200,00 W
Total ........................................................................................................ 9.200,00 W
Resumen
- Vivienda .................................................................................................... 9.200,00 W
Total ........................................................................................................ 9.200,00 W
5.2.1.4.- MEMORIA DETALLADA POR CIRCUITOS
Acometida Edificio
Datos de partida:

Todos los tramos del circuito suman una longitud de 3,00 m.


El cable empleado y su instalacin siguen la referencia RZ1-K (AS) unip. enterrados bajo tubo.
Los conductores estn distribuidos en F+N con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 9.200 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 9.200 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad


de clculo, o mxima prevista, que asciende a 40,00 A:

9.200/(2301,00) = 40,00 A

Segn la tabla 52-C2, col.7 Cu y los factores correctores (0,96) que la norma UNE 20.460
especifica para este tipo de configuracin de cable y montaje, la intensidad mxima admisible
del circuito para la seccin adoptada segn el apartado siguiente, se calcula en 53,76 A:

56,00 0,96 = 53,76 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 5,60 kA.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Secciones:

Obtenemos una seccin por cada de tensin de 0,62 mm y por calentamiento de 6,00 mm.
Adoptamos la seccin de 6,00 mm y designamos el circuito con:

(26)mmCu bajo tubo=50mm

Der.Ind. VIVIENDA
Datos de partida:

Todos los tramos del circuito suman una longitud de 3,00 m.


El cable empleado y su instalacin siguen la referencia ES07Z1-K (AS) unip. en vacos de
construccin bajo tubo flexible.
Los conductores estn distribuidos en F+N+P con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 9.200 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 9.200 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad


de clculo, o mxima prevista, que asciende a 40,00 A:

9.200/(2301,00) = 40,00 A

Segn la tabla 52-C1, col.5 Cu y los factores correctores (0,87) que la norma UNE 20.460
especifica para este tipo de configuracin de cable y montaje, la intensidad mxima admisible
del circuito para la seccin adoptada segn el apartado siguiente, se calcula en 60,03 A:

69,00 0,87 = 60,03 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 4,13 kA.

Secciones:

Obtenemos una seccin por cada de tensin de 1,24 mm y por calentamiento de 10,00 mm.
Adoptamos la seccin de 16,00 mm y designamos el circuito con:

(216)+TT16mmCu bajo tubo=50mm


Cadas de tensin:

La cada de tensin acumulada ms desfavorable del circuito se produce en un cuadro


distribucin a 3,00 metros de la cabecera del mismo, y tiene por valor 0,2679 V (0,1165 %).

C1
Datos de partida:

Todos los tramos del circuito suman una longitud de 53,28 m.


El cable empleado y su instalacin siguen la referencia H07V-U unip. empotrados bajo tubo
flexible.
Los conductores estn distribuidos en F+N+P con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 1.125 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 1.125 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad


de clculo, o mxima prevista, que asciende a 4,89 A:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.125/(2301,00) = 4,89 A

Segn la tabla 52-C1, col.4 Cu y los factores correctores (0,87) que la norma UNE 20.460
especifica para este tipo de configuracin de cable y montaje, la intensidad mxima admisible
del circuito para la seccin adoptada segn el apartado siguiente, se calcula en 15,23 A:

17,50 0,87 = 15,23 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 0,28 kA.

Secciones:

Obtenemos una seccin por cada de tensin de 0,76 mm y por calentamiento de 1,50 mm.
Adoptamos la seccin de 1,50 mm y designamos el circuito con:

(21,5)+TT1,5mmCu bajo tubo=16mm


Cadas de tensin:

La cada de tensin acumulada ms desfavorable del circuito se produce en un alumbrado


incandescente a 14,59 metros de la cabecera del mismo, y tiene por valor 3,7421 V (1,6270 %).

C2
Datos de partida:

Todos los tramos del circuito suman una longitud de 62,42 m.


El cable empleado y su instalacin siguen la referencia H07V-U unip. empotrados bajo tubo
flexible.
Los conductores estn distribuidos en F+N+P con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 2.760 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 2.760 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad


de clculo, o mxima prevista, que asciende a 12,00 A:

2.760/(2301,00) = 12,00 A

Segn la tabla 52-C1, col.4 Cu y los factores correctores (0,87) que la norma UNE 20.460
especifica para este tipo de configuracin de cable y montaje, la intensidad mxima admisible
del circuito para la seccin adoptada segn el apartado siguiente, se calcula en 20,88 A:

24,00 0,87 = 20,88 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 0,41 kA.

Secciones:

Obtenemos una seccin por cada de tensin de 1,36 mm y por calentamiento de 1,50 mm.
Adoptamos la seccin de 2,50 mm y designamos el circuito con:

(22,5)+TT2,5mmCu bajo tubo=20mm


Cadas de tensin:

La cada de tensin acumulada ms desfavorable del circuito se produce en un alumbrado


incandescente a 16,40 metros de la cabecera del mismo, y tiene por valor 4,0159 V (1,7461 %).

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

C3
Datos de partida:

Todos los tramos del circuito suman una longitud de 14,18 m.


El cable empleado y su instalacin siguen la referencia H07V-U unip. empotrados bajo tubo
flexible.
Los conductores estn distribuidos en F+N+P con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 4.050 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 4.050 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad


de clculo, o mxima prevista, que asciende a 17,61 A:

4.050/(2301,00) = 17,61 A

Segn la tabla 52-C1, col.4 Cu y los factores correctores (0,87) que la norma UNE 20.460
especifica para este tipo de configuracin de cable y montaje, la intensidad mxima admisible
del circuito para la seccin adoptada segn el apartado siguiente, se calcula en 35,67 A:

41,00 0,87 = 35,67 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 1,11 kA.

Secciones:

Obtenemos una seccin por cada de tensin de 1,21 mm y por calentamiento de 2,50 mm.
Adoptamos la seccin de 6,00 mm y designamos el circuito con:

(26)+TT6mmCu bajo tubo=25mm


Cadas de tensin:

La cada de tensin acumulada ms desfavorable del circuito se produce en un alumbrado


incandescente a 11,73 metros de la cabecera del mismo, y tiene por valor 1,6646 V (0,7237 %).

C4
Datos de partida:

Todos los tramos del circuito suman una longitud de 11,73 m.


El cable empleado y su instalacin siguen la referencia H07V-U unip. empotrados bajo tubo
flexible.
Los conductores estn distribuidos en F+N+P con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 5.123 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 5.123 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad de


clculo, o mxima prevista, que asciende a 22,28 A:

5.123/(2301,00) = 22,28 A

Segn la tabla 52-C1, col.4 Cu y los factores correctores (0,87) que la norma UNE 20.460 especifica
para este tipo de configuracin de cable y montaje, la intensidad mxima admisible del circuito
para la seccin adoptada segn el apartado siguiente, se calcula en 27,84 A:

32,00 0,87 = 27,84 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 0,85 kA.

Secciones:

Obtenemos una seccin por cada de tensin de 1,44 mm y por calentamiento de 4,00 mm.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Adoptamos la seccin de 4,00 mm y designamos el circuito con:

(24)+TT4mmCu bajo tubo=20mm


Cadas de tensin:

La cada de tensin acumulada ms desfavorable del circuito se produce en un alumbrado


incandescente a 11,12 metros de la cabecera del mismo, y tiene por valor 2,7499 V (1,1956 %).

C5
Datos de partida:

Todos los tramos del circuito suman una longitud de 17,31 m.


El cable empleado y su instalacin siguen la referencia H07V-U unip. empotrados bajo tubo
flexible.
Los conductores estn distribuidos en F+N+P con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 3.450 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 3.450 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad de


clculo, o mxima prevista, que asciende a 15,00 A:

3.450/(2301,00) = 15,00 A

Segn la tabla 52-C1, col.4 Cu y los factores correctores (0,87) que la norma UNE 20.460 especifica
para este tipo de configuracin de cable y montaje, la intensidad mxima admisible del circuito
para la seccin adoptada segn el apartado siguiente, se calcula en 20,88 A:

24,00 0,87 = 20,88 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 0,49 kA.

Secciones:

Obtenemos una seccin por cada de tensin de 1,10 mm y por calentamiento de 1,50 mm.
Adoptamos la seccin de 2,50 mm y designamos el circuito con:

(22,5)+TT2,5mmCu bajo tubo=20mm


Cadas de tensin:

La cada de tensin acumulada ms desfavorable del circuito se produce en un alumbrado


incandescente a 13,24 metros de la cabecera del mismo, y tiene por valor 3,2934 V (1,4319 %).

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

C7
Datos de partida:

Todos los tramos del circuito suman una longitud de 50,07 m.


El cable empleado y su instalacin siguen la referencia H07V-U unip. empotrados bajo tubo
flexible.
Los conductores estn distribuidos en F+N+P con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 2.588 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 2.588 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad de


clculo, o mxima prevista, que asciende a 11,25 A:

2.588/(2301,00) = 11,25 A

Segn la tabla 52-C1, col.4 Cu y los factores correctores (0,87) que la norma UNE 20.460 especifica
para este tipo de configuracin de cable y montaje, la intensidad mxima admisible del circuito
para la seccin adoptada segn el apartado siguiente, se calcula en 20,88 A:

24,00 0,87 = 20,88 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 0,56 kA.

Secciones:

Obtenemos una seccin por cada de tensin de 0,95 mm y por calentamiento de 1,50 mm.
Adoptamos la seccin de 2,50 mm y designamos el circuito con:

(22,5)+TT2,5mmCu bajo tubo=20mm


Cadas de tensin:

La cada de tensin acumulada ms desfavorable del circuito se produce en un alumbrado


incandescente a 11,45 metros de la cabecera del mismo, y tiene por valor 2,8857 V (1,2547 %).

C10
Datos de partida:

Todos los tramos del circuito suman una longitud de 10,33 m.


El cable empleado y su instalacin siguen la referencia H07V-U unip. empotrados bajo tubo
flexible.
Los conductores estn distribuidos en F+N+P con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 2.588 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 2.588 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad


de clculo, o mxima prevista, que asciende a 11,25 A:

2.588/(2301,00) = 11,25 A

Segn la tabla 52-C1, col.4 Cu y los factores correctores (0,87) que la norma UNE 20.460
especifica para este tipo de configuracin de cable y montaje, la intensidad mxima admisible
del circuito para la seccin adoptada segn el apartado siguiente, se calcula en 20,88 A:

24,00 0,87 = 20,88 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 0,61 kA.

Secciones:

Obtenemos una seccin por cada de tensin de 0,86 mm y por calentamiento de 1,50 mm.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Adoptamos la seccin de 2,50 mm y designamos el circuito con:

(22,5)+TT2,5mmCu bajo tubo=20mm


Cadas de tensin:

La cada de tensin acumulada ms desfavorable del circuito se produce en un alumbrado


incandescente a 10,33 metros de la cabecera del mismo, y tiene por valor 2,6294 V (1,1432 %).

C15
Datos de partida:

Todos los tramos del circuito suman una longitud de 14,91 m.


El cable empleado y su instalacin siguen la referencia H07V-U unip. empotrados bajo tubo
flexible.
Los conductores estn distribuidos en F+N+P con 1 conductor por fase.
La tensin entre hilos activos es de 230 V.

Potencias:

Todos los receptores alimentados por el circuito suman una potencia instalada de 1.380 W.
Aplicamos factor de simultaneidad, obteniendo una potencia final de clculo de 1.380 W.

Intensidades:

En funcin de la potencia de clculo, y utilizando la frmula siguiente, obtenemos la intensidad


de clculo, o mxima prevista, que asciende a 6,00 A:

1.380/(2301,00) = 6,00 A

Segn la tabla 52-C1, col.4 Cu y los factores correctores (0,87) que la norma UNE 20.460
especifica para este tipo de configuracin de cable y montaje, la intensidad mxima admisible
del circuito para la seccin adoptada segn el apartado siguiente, se calcula en 20,88 A:

24,00 0,87 = 20,88 A

En funcin de la potencia de cortocircuito de la red y la impedancia de los conductores hasta


este punto de la instalacin, obtenemos una intensidad de cortocircuito de 0,47 kA.

Secciones:

Obtenemos una seccin por cada de tensin de 0,73 mm y por calentamiento de 1,50 mm.
Adoptamos la seccin de 2,50 mm y designamos el circuito con:

(22,5)+TT2,5mmCu bajo tubo=20mm


Cadas de tensin:

La cada de tensin acumulada ms desfavorable del circuito se produce en un alumbrado


incandescente a 14,09 metros de la cabecera del mismo, y tiene por valor 2,2805 V (0,9915 %).

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.2.1.5.- CUADROS RESUMEN DE PROTECCIONES

Acometida Edificio
Dispositivo
Contador VIVIENDA

N
polos

In

II

50

230

N
polos

In

II

15

230

II

40

230

II

40

230

30

II

40

230

30

II

10

230

II

16

230

II

25

230

II

25

230

II

16

230

II

40

230

II

16

230

II

16

230

II

16

230

Ir

Is

Pc
50

VIVIENDA
Dispositivo
ICP
IGA

Ir

Is

Pc

PCS
ID General (tipo S)
ID1
PIA C1
PIA C2
PIA C3
PIA C4
PIA C5
ID2
PIA C7
PIA C10
PIA C15

Donde:
N polos =

Nmero de polos.

In

Calibre, en amperios.

Tensin, en voltios.

Ir

Intensidad de regulacin, en amperios.

Is

Sensibilidad, en miliamperios.

Pc

Poder de corte, en kiloamperios.

Pedro Enrique Santos Buenda______________________Arquitecto

30

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.2.2.- INSTALACIN DE FONTANERA


La Instalacin de fontanera , su clculo y dimensionamiento se justifica correctamente
en el apartado correspondiente de CUMPLIMIENTO DEL CTE de esta memoria.

5.2.3.- INSTALACIN DE SANEAMIENTO


La Instalacin de saneamiento, su clculo y dimensionamiento se justifica
correctamente en el apartado correspondiente de CUMPLIMIENTO DEL CTE de esta
memoria.

5.2.4.- INSTALACIN SOLAR-TRMICA PARA A.C.S.


La Instalacin de solar-trmica, su clculo y dimensionamiento se justifica
correctamente en el apartado correspondiente de CUMPLIMIENTO DEL CTE de esta
memoria.

5.2.4.- INSTALACIN DE VENTILACIN PARA LA CALIDAD DEL AIRE INTERIOR


La Instalacin de de ventilacin, su clculo y dimensionamiento se justifica
correctamente en el apartado correspondiente de CUMPLIMIENTO DEL CTE de esta
memoria.

5.3.- EFICIENCIA ENERGETICA


A continuacin se adjunta el Certificado de Eficiencia Energtica, conforme al
modelo del Real Decreto 47/2007, de 19 de enero, por el que se aprueba el
procedimiento bsico para la certificacin de eficiencia energtica de edificios de
nueva construccin (BOE n 27 de 31 de enero de 2007) y la Orden de 25 de Junio de
2008 (BOJA n 145 de fecha 22 de Julio de 2008).

Pedro Enrique Santos Buenda______________________Arquitecto

CONSEJERA DE INNOVACIN, CIENCIA Y EMPRESA

JUNTA DE ANDALUCIA

CERTIFICADO DE EFICIENCIA ENERGTICA DEL PROYECTO / EDIFICIO TERMINADO


Real Decreto 47/2007, de 19 de enero, por el que se aprueba el procedimiento bsico para la certificacin de eficiencia
energtica de edificios de nueva construccin (BOE n 27 de 31 de enero de 2007).
Orden de 25 de Junio de 2008 (BOJA n 145 de fecha 22 de Julio de 2008)



'$726,'(17,),&$7,926'(/(',),&,2

1) Viviendas unifamiliares de distintos tipos


862'(/(',),&,2 
',5(&&,1
7LSRGHYD

1RPEUH

1|

CALLE

MONTES

20

%ORTXH

(VFDOHUD

3LVR

3XHUWD

3529,1&,$/2&$/,'$'&3
MALAGA
RONDA
29400



  YLYLHQGDVXQLIDPLOLDUHVGHGLVWLQWRVWLSRVHGLILFLRVGHYLYLHQGDVRILFLQDVFHQWURVGHHQVHDQ]DKRVSLWDOHVKRWHOHV\UHVWDXUDQWHVLQVWDODFLRQHVGHSRUWLYDVHGLILFLRV

FRPHUFLDOHV\RWURVWLSRVGHHGLILFLRV




'$726'(/$3(5621$352<(&7,67$),50$17('((67(&(57,),&$'2

$3(//,'26<120%5(PEDRO ENRIQUE

SANTOS

BUENDA

&2/(*,21|&2/(*,$'2$
ARQUITECTOS DE MLAGA
115
'1,


 6ORSDUDFHUWLILFDGRVGHSUR\HFWRV



'$726'(/$',5(&&,1)$&8/7$7,9$),50$17('((67(&(57,),&$'2

',5(&725$'(2%5$
$3(//,'26<120%5(
&2/(*,21|&2/(*,$'2$
'1,

',5(&725$'((-(&8&,1'(/$2%5$
$3(//,'26<120%5(
&2/(*,21|&2/(*,$'2$
'1,



 6ORSDUDFHUWLILFDGRVGHHGLILFLRVWHUPLQDGRV



1250$7,9$(1(5*7,&$'($3/,&$&,1

(',),&$&,1

,167$/$&,21(6750,&$6

&7(  
5,7(  

2WURBBBBBBBBBBBBBBBBBBB

5,7(  

 2WURBBBBBBBBBBBBBBBBBBB

275$62UGHQDQ]DV0XQLFLSDOHVHWFBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB




23&,1(/(*,'$3$5$2%7(1(5/$&$/,),&$&,1'((),&,(1&,$(1(5*7,&$

*HQHUDO


3URJUDPD,QIRUPWLFRXWLOL]DGR

GH5HIHUHQFLD &$/(1(5 9HUVLQ 9<3 *7

$OWHUQDWLYRBBBBBBBBBBBBBBBBBBB

6LPSOLILFDGD

VERIFICADOR DEL CUMPLIMIENTO DEL DOCUMENTO BSICO HE-1: OPCIN SIMPLIFICADA


'RFXPHQWRUHFRQRFLGRXWLOL]DGRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB



&$5$&7(567,&$6(1(5*7,&$6'(/(',),&,2

*(1(5$/(6
6XSHUILFLHFRQVWUXLGDVREUHUDVDQWH P BBBBBBBBBBBBBB
189.10
VXSHUILFLHFRQVWUXLGDVREUHUDVDQWHDFRQGLFLRQDGDHQUJLPHQGHUHIULJHUDFLQBBBBBBBBBBBBBB
VXSHUILFLHFRQVWUXLGDVREUHUDVDQWHDFRQGLFLRQDGDHQUJLPHQGHFDOHIDFFLQBBBBBBBBBBBBBB


2.00
1|GHSODQWDVVREUHUDVDQWHBBBBBBBBBBBBBB
3.00
&RPSDFLGDG 9ROXPHQ6XSHUILFLH BBBBBBBBBBBBBB

&$5$&7(567,&$6&216758&7,9$6
3RUFHQWDMHDFULVWDODGR PKXHFRPVXSHUILFLHFRQVWUXLGDVREUHUDVDQWH BBBBBBBBBBBBBB

0.65
7UDQVPLWDQFLDPHGLD :P. 6XHORBBBBBBBBBBBBBB
0.95
0XURIDFKDGDBBBBBBBBBBBBBB
0.53
&XELHUWDBBBBBBBBBBBBBB
4.40
+XHFRBBBBBBBBBBBBBB
,167$/$&,21(6750,&$6&$/()$&&,1
*UDGRGHFHQWUDOL]DFLQ 'LVWULWR &HQWUDOL]DGR (TXLSRVLQGLYLGXDOHV
Seleccione un equipo
 Seleccione el combustible
(TXLSRSULQFLSDO &RPEXVWLEOH
5HQGLPLHQWRBBBBBBBBBBBBBB
3RWHQFLDWUPLFDQRPLQDOWRWDO N: BBBBBBBBBBBBBB
,167$/$&,21(6750,&$65()5,*(5$&,21
*UDGRFHQWUDOL]DFLQ 'LVWULWR &HQWUDOL]DGR (TXLSRVLQGLYLGXDOHV
 Seleccione el combustible
Seleccione el equipo
(TXLSRSULQFLSDO &RPEXVWLEOH

5HQGLPLHQWRBBBBBBBBBBBBBB
3RWHQFLDWUPLFDQRPLQDOWRWDO N: BBBBBBBBBBBBBB
,167$/$&,21(6750,&$6$&6
*UDGRFHQWUDOL]DFLQ 'LVWULWR &HQWUDOL]DGR (TXLSRVLQGLYLGXDOHV

Seleccione un equipo
Seleccione el combustible
(TXLSRSULQFLSDO &RPEXVWLEOH 
5HQGLPLHQWRBBBBBBBBBBBBBB
3RWHQFLDWUPLFDQRPLQDOWRWDO N: BBBBBBBBBBBBBB
,167$/$&,21(6(/(&75,&$6

9.20
3RWHQFLDHOFWULFDWRWDOLQVWDODGD N: BBBBBBBBBBBBBB
3RWHQFLDQRPLQDOLQVWDODGDHQLOXPLQDFLQ N: BBBBBBBBBBBBBB
(48,326'(&2*(1(5$&,1
3RWHQFLDQRPLQDO N: BBBBBBBBBBBBBB
&RPEXVWLEOH  Seleccione el combustible
5HQGLPLHQWRHOFWULFRHTXLYDOHQWH  BBBBBBBBBBBBBB
5HFXSHUDFLQGHHQHUJD N:KDR BBBBBBBBBBBBBB
27526'$726

60.00
&RQWULEXFLQVRODUHQ$&6  BBBBBBBBBBBBBB
&RQWULEXFLQVRODUHQ&DOHIDFFLQ  BBBBBBBBBBBBBB
&RQWULEXFLQVRODUHQ5HIULJHUDFLQ  BBBBBBBBBBBBBB
3RWHQFLDIRWRYROWDLFDLQVWDODGD N:S BBBBBBBBBBBBBB

 &DOGHUDHVWQGDU &DOGHUDGHFRQGHQVDFLQ &DOGHUDGHEDMDWHPSHUDWXUD %RPEDGHFDORU (IHFWR-RXOH 2WUR
 *DV1DWXUDO */3 *DVOHR %LRPDVD (OHFWULFLGDG 2WUR

 ([SDQVLQGLUHFWD &RPSUHVLQPHFQLFDFRQGHQVDFLQDLUH &RPSUHVLQPHFQLFDFRQGHQVDFLQDJXD $EVRUFLQ 2WUR



&$/,),&$&,1(1(5*7,&$


&DOLILFDFLQGHHILFLHQFLDHQHUJWLFDGH(GLILFLRV3UR\HFWR(GLILFLRWHUPLQDGR VHJQFRUUHVSRQGD 


Ms













Menos

(GLILFLRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
/RFDOLGDGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
=RQDFOLPWLFD 5) C1
8VRGHO(GLILFLR 1) Viviendas unifamiliares de distintos tipos

&DOLILFDFLQREWHQLGD 4) D


6LODFDOLILFDFLQHQHUJWLFDVHKDREWHQLGRDWUDYVGHODRSFLQJHQHUDO

&RQVXPRGHHQHUJDSULPDULDDQXDOGHOHGLILFLR BBBBBBBBBBBBBBN:KDR


BBBBBBBBBBBBBBN:KDRP UDWLRSRUVXSHUILFLH 

(PLVLRQHVDQXDOHVGHGL[LGRGHFDUERQR


BBBBBBBBBBBBBBNJ&2DR
BBBBBBBBBBBBBBNJ&2DRP UDWLRSRUVXSHUILFLH 


QGLFHVGHFDOLILFDFLQHQHUJWLFDREWHQLGRVHQHPLVLRQHVGHGL[LGRGHFDUERQR



*OREDO

BBBBBBBBBBBBBB

&OLPDWL]DFLQ

BBBBBBBBBBBBBB 6LVHKDXWLOL]DGR&$/(1(5*7 

&DOHIDFFLQ

BBBBBBBBBBBBBB 6LVHKDXWLOL]DGR&$/(1(59<3 

5HIULJHUDFLQ

BBBBBBBBBBBBBB 6LVHKDXWLOL]DGR&$/(1(59<3 

$&6

BBBBBBBBBBBBBB

,OXPLQDFLQ

BBBBBBBBBBBBBB




6LODFDOLILFDFLQHQHUJWLFDVHKDREWHQLGRDWUDYVGHODRSFLQVLPSOLILFDGD

/DFDOLILFDFLQGHHILFLHQFLDHQHUJWLFDVHKDREWHQLGRPHGLDQWHHOSURFHGLPLHQWRVLPSOLILFDGR
UHFRJLGRHQHOGRFXPHQWRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB


9OLGDKDVWDGGPPDDDD P[LPRGLH]DRVGHVGHVXHPLVLQ 



15/07/2021



358(%$6&20352%$&,21(6(,163(&&,21(6

'HVFULSFLQGHODVSUXHEDVFRPSUREDFLRQHVHLQVSHFFLRQHVOOHYDGDVDFDERGXUDQWHODHMHFXFLQGHOHGLILFLRFRQODILQDOLGDGGH
HVWDEOHFHUODFRQIRUPLGDGGHODLQIRUPDFLQFRQWHQLGDHQHO&HUWLILFDGRGH(ILFLHQFLD(QHUJWLFDFRQHOHGLILFLRWHUPLQDGR







 6ORSDUDFHUWLILFDGRVGHHGLILFLRVWHUPLQDGRV



&21&/86,21(6

(OHGLILFLRHQDTXHOORTXHDIHFWDDVXHILFLHQFLDHQHUJWLFDKDVLGRHMHFXWDGRGHDFXHUGRFRQORH[SUHVDGRHQHOSUR\HFWR
\HQFRQVHFXHQFLDVHDOFDQ]DODFDOLILFDFLQLQGLFDGDHQHOFHUWLILFDGRGHHILFLHQFLDHQHUJWLFDGHOSUR\HFWR

1RVHDOFDQ]DODFDOLILFDFLQLQGLFDGDHQHOFHUWLILFDGRGHHILFLHQFLDHQHUJWLFDGHOSUR\HFWR
 6ORSDUDFHUWLILFDGRVGHHGLILFLRVWHUPLQDGRV

La / Las personas abajo firmante/s declara/n que son ciertos cuantos datos figuran en el presente certificado.

15
2011
j u l io
Ronda
(Q,
D GH
GH




)LUPD)LUPD



Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.4.- GESTIN DE RESIDUOS

ndice
1

Memoria Informativa del Estudio

Definiciones

Medidas Prevencin de Residuos

Cantidad de Residuos

Separacin de Residuos

Medidas para la Separacin en Obra

Destino Final

Prescripciones del Pliego sobre Residuos

Presupuesto

10

Plantillas de Impresos

1 Memoria Informativa del Estudio


Se redacta este Estudio de Gestin de Residuos de Construccin y Demolicin en
cumplimiento del Real Decreto 105/2008, de 1 Febrero, por el que se regula la
produccin y gestin de los residuos de construccin y de demolicin que establece,
en su artculo 4, entre las obligaciones del productor de residuos de construccin y
demolicin la de incluir en proyecto de ejecucin un Estudio de Gestin de Residuos
de Construccin y Demolicin que refleje cmo llevar a cabo las obligaciones que le
incumban en relacin con los residuos de construccin y demolicin que se vayan a
producir en la obra.
En base a este Estudio, el poseedor de residuos redactar un plan que ser aprobado
por la direccin facultativa y aceptado por la propiedad y pasar a formar parte de
los documentos contractuales de la obra.
Este Estudio de Gestin los Residuos cuenta con el siguiente contenido:
Estimacin de la CANTIDAD, expresada en toneladas y en metros cbicos, de los
residuos de construccin y demolicin que se generarn en la obra, codificados
con arreglo a la lista europea de residuos publicada por Orden MAM/304/2002, por
la que se publican las operaciones de valorizacin y eliminacin de residuos y la
lista europea de residuos.
Relacin de MEDIDAS para la PREVENCIN de residuos en la obra objeto del
proyecto.
Las operaciones de REUTILIZACIN, VALORIZACIN o ELIMINACIN a que se
destinarn los residuos que se generarn en la obra.
Las MEDIDAS para la SEPARACIN de los residuos en obra, en particular, para el
cumplimiento por parte del poseedor de los residuos, de la obligacin de
separacin establecida en el artculo 5 del citado Real Decreto 105/2008.
Las prescripciones del PLIEGO de PRESCRIPCIONES tcnicas particulares del
proyecto, en relacin con el almacenamiento, manejo, separacin y, en su caso,
otras operaciones de gestin de los residuos de construccin y demolicin dentro
de la obra.
Una VALORACIN del coste previsto de la gestin de los residuos de construccin y
demolicin que formar parte del presupuesto del proyecto en captulo
independiente.
En su caso, un INVENTARIO de los RESIDUOS PELIGROSOS que se generarn.
PLANOS de las instalaciones previstas para el almacenamiento, manejo,

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

separacin y, en su caso, otras operaciones de gestin de los residuos de


construccin y demolicin dentro de la obra.

Los datos informativos de la obra son:


Proyecto:

Vivienda

Unifamiliar

con

Garaje

entre

medianeras
Direccin de la obra:
Localidad:
Provincia:
Promotor:

C/Montes, 20
Ronda
Mlaga
don David Lpez Blanco y doa Ana Becerra de

Haro
N.I.F. del promotor:
Tcnico redactor de este Estudio:
Titulacin o cargo redactor:
Fecha de comienzo de la obra:

76799241X y 25556855Z respectivamente


Pdro Enrique Santos Buenda
Arquitecto
Octubre-2011

2 Definiciones
Para un mejor entendimiento de este documento se realizan las siguientes definiciones
dentro del mbito de la gestin de residuos en obras de construccin y demolicin:
Residuo: Segn la ley 10/98 se define residuo a cualquier sustancia u objeto del
que su poseedor se desprenda o del que tenga la intencin u obligacin de
desprenderse.
Residuo peligroso: Son materias que en cualquier estado fsico o qumico contienen
elementos o sustancias que pueden representar un peligro para el medio
ambiente, la salud humana o los recursos naturales. En ltima instancia, se
considerarn residuos peligrosos los indicados en la "Orden MAM/304/2002 por la
que se publican las operaciones de valorizacin y eliminacin de residuos y la lista
europea de residuos" y en el resto de normativa nacional y comunitaria. Tambin
tendrn consideracin de residuo peligroso los envases y recipientes que hayan
contenido residuos o productos peligrosos.
Residuos no peligrosos: Todos aquellos residuos no catalogados como tales segn
la definicin anterior.
Residuo inerte: Aquel residuo No Peligroso que no experimenta transformaciones
fsicas, qumicas o biolgicas significativas, no es soluble ni combustible, ni
reacciona fsica ni qumicamente ni de ninguna otra manera, no es
biodegradable, no afecta negativamente a otras materias con las cuales entra en
contacto de forma que pueda dar lugar a contaminacin del medio ambiente o
perjudicar a la salud humana. La lixivialidad total, el contenido de contaminantes
del residuo y la ecotoxicidad del lixiviado debern ser insignificantes y en particular
no debern suponer un riesgo para la calidad de las aguas superficiales o
subterrneas.
Residuo de construccin y demolicin: Cualquier sustancia u objeto que
cumpliendo con la definicin de residuo se genera en una obra de construccin y
de demolicin.
Cdigo LER: Cdigo de 6 dgitos para identificar un residuo segn la Orden
MAM/304/2002.
Productor de residuos: La persona fsica o jurdica titular de la licencia urbanstica
en una obra de construccin o demolicin; en aquellas obras que no precisen de
licencia urbanstica, tendr la consideracin de productor de residuos la persona
fsica o jurdica titular del bien inmueble objeto de una obra de construccin o
demolicin.
Poseedor de residuos de construccin y demolicin: la persona fsica o jurdica que
tenga en su poder los residuos de construccin y demolicin y que no ostente la
condicin de gestor de residuos. En todo caso, tendr la consideracin de
poseedor la persona fsica o jurdica que ejecute la obra de construccin o

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

demolicin, tales como el constructor, los subcontratistas o los trabajadores


autnomos. En todo caso, no tendrn la consideracin de poseedor de residuos
de construccin y demolicin los trabajadores por cuenta ajena.
Volumen aparente: volumen total de la masa de residuos en obra, espacio que
ocupan acumulados sin compactar con los espacios vacos que quedan incluidos
entre medio. En ltima instancia, es el volumen que realmente ocupan en obra.
Volumen real: Volumen de la masa de los residuos sin contar espacios vacos, es
decir, entendiendo una terica masa compactada de los mismos.
Gestor de residuos: La persona o entidad pblica o privada que realice cualquiera
de las operaciones que componen la gestin de los residuos, sea o no el productor
de los mismos. Han de estar autorizados o registrados por el organismo autonmico
correspondiente.
Destino final: Cualquiera de las operaciones de valorizacin y eliminacin de
residuos enumeradas en la "Orden MAM/304/2002 por la que se publican las
operaciones de valorizacin y eliminacin de residuos y la lista europea de
residuos".
Reutilizacin: El empleo de un producto usado para el mismo fin para el que fue
diseado originariamente.
Reciclado: La transformacin de los residuos, dentro de un proceso de produccin
para su fin inicial o para otros fines, incluido el compostaje y la biometanizacin,
pero no la incineracin con recuperacin de energa.
Valorizacin: Todo procedimiento que permita el aprovechamiento de los recursos
contenidos en los residuos sin poner en peligro la salud humana y sin utilizar
mtodos que puedan causar perjuicios al medio ambiente.
Eliminacin: todo procedimiento dirigido, bien al vertido de los residuos o bien a su
destruccin, total o parcial, realizado sin poner en peligro la salud humana y sin
utilizar mtodos que puedan causar perjuicios al medio ambiente.

3 Medidas Prevencin de Residuos


Prevencin en Tareas de Derribo

En la medida de lo posible, las tareas de derribo se realizarn empleando tcnicas


de desconstruccin selectiva y de desmontaje con el fin de favorecer la
reutilizacin, reciclado y valoracin de los residuos.
Como norma general, el derribo se iniciar con los residuos peligrosos,
posteriormente los residuos destinados a reutilizacin, tras ellos los que se valoricen
y finalmente los que se depositarn en vertedero.

Prevencin en la Adquisicin de Materiales


La adquisicin de materiales se realizar ajustando la cantidad a las mediciones reales
de obra, ajustando al mximo las mismas para evitar la aparicin de excedentes de
material al final de la obra.
Se requerir a las empresas suministradoras a que reduzcan al mximo la cantidad y
volumen de embalajes priorizando aquellos que minimizan los mismos.
Se primar la adquisicin de materiales reciclables frente a otros de mismas
prestaciones pero de difcil o imposible reciclado.
Se mantendr un inventario de productos excedentes para la posible utilizacin en
otras obras.
Se realizar un plan de entrega de los materiales en que se detalle para cada uno de
ellos la cantidad, fecha de llegada a obra, lugar y forma de almacenaje en obra, gestin
de excedentes y en su caso gestin de residuos.
Se priorizar la adquisicin de productos "a granel" con el fin de limitar la aparicin de
residuos de envases en obra.
Aquellos envases o soportes de materiales que puedan ser reutilizados como los palets,

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

se evitar su deterioro y se devolvern al proveedor.


Se incluir en los contratos de suministro una clusula de penalizacin a los
proveedores que generen en obra ms residuos de los previstos y que se puedan imputar
a una mala gestin.
Se intentar adquirir los productos en mdulo de los elementos constructivos en los que
van a ser colocados para evitar retallos.
Prevencin en la Puesta en Obra
Se optimizar el empleo de materiales en obra evitando la sobredosificacin o la
ejecucin con derroche de material especialmente de aquellos con mayor incidencia en
la generacin de residuos.
Los materiales prefabricados, por lo general, optimizan especialmente el empleo de
materiales y la generacin de residuos por lo que se favorecer su empleo.
En la puesta en obra de materiales se intentar realizar los diversos elementos a
mdulo del tamao de las piezas que lo componen para evitar desperdicio de material.
Se vaciarn por completo los recipientes que contengan los productos antes de su
limpieza o eliminacin, especialmente si se trata de residuos peligrosos.
En la medida de lo posible se favorecer la elaboracin de productos en taller frente a
los realizados en la propia obra que habitualmente generan mayor cantidad de residuos.
Se primar el empleo de elementos desmontables o reutilizables frente a otros de
similares prestaciones no reutilizables.
Se agotar la vida til de los medios auxiliares propiciando su reutilizacin en el mayor
nmero de obras para lo que se extremarn las medidas de mantenimiento.
Todo personal involucrado en la obra dispondr de los conocimientos mnimos de
prevencin de residuos y correcta gestin de ellos.
Se incluir en los contratos con subcontratas una clusula de penalizacin por la que
se desincentivar la generacin de ms residuos de los previsibles por una mala gestin de
los mismos.
Prevencin en el Almacenamiento en Obra
Se realizar un almacenamiento correcto de todos los acopios evitando que se
produzcan derrames, mezclas entre materiales, exposicin a inclemencias
meteorolgicas, roturas de envases o materiales, etc.
Se extremarn los cuidados para evitar alcanzar la caducidad de los productos sin
agotar su consumo.
Los responsables del acopio de materiales en obra conocern las condiciones de
almacenamiento, caducidad y conservacin especificadas por el fabricante o
suministrador para todos los materiales que se recepcionen en obra.
En los procesos de carga y descarga de materiales en la zona de acopio o almacn y
en su carga para puesta en obra se producen percances con el material que convierten
en residuos productos en perfecto estado. Es por ello que se extremarn las precauciones
en estos procesos de manipulado.
Se realizar un plan de inspecciones peridicas de materiales, productos y residuos
acopiados o almacenados para garantizar que se mantiene en las debidas condiciones.

4 Cantidad de Residuos
A continuacin se presenta una estimacin de las cantidades, expresadas en toneladas y
en metros cbicos, de los residuos de construccin y demolicin que se generarn en
la obra, codificados con arreglo a la lista europea de residuos publicada por Orden
MAM/304/2002, de 8 de febrero, por la que se publican las operaciones de
valorizacin y eliminacin de residuos y la lista europea de residuos.
Siguiendo lo expresado en el Real Decreto 105/2008 que regula la produccin y gestin de
los residuos de construccin y demolicin, no se consideran residuos y por tanto no se
incluyen en la tabla las tierras y piedras no contaminadas por sustancias
peligrosas reutilizadas en la misma obra, en una obra distinta o en una actividad de

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

restauracin, acondicionamiento o relleno, siempre y cuando pueda acreditarse de


forma fehaciente su destino a reutilizacin.
La estimacin de cantidades se realiza tomando como referencia los ratios estndar
publicados en el pas sobre volumen y tipificacin de residuos de construccin y
demolicin ms extendidos y aceptados. Dichos ratios han sido ajustados y adaptados
a las caractersticas de la obra segn clculo automatizado realizado con ayuda del
programa informtico especfico CONSTRUBIT RESIDUOS. La utilizacin de ratios en el
clculo de residuos permite la realizacin de una "estimacin inicial" que es lo que la
normativa requiere en este documento, sin embargo los ratios establecidos para
"proyectos tipo" no permiten una definicin exhaustiva y precisa de los residuos
finalmente obtenidos para cada proyecto con sus singularidades por lo que la
estimacin contemplada en la tabla inferior se acepta como estimacin inicial y para
la toma de decisiones en la gestin de resiudos pero ser el fin de obra el que
determine en ltima instancia los residuos obtenidos.
Cdigo
Descripcin
LER
del Residuo
150110
Envases que contienen restos de sustancias peligrosas o
estn contaminados por ellas.
160504
Gases en recipientes a presin [incluidos los halones]
que contienen sustancias peligrosas.
170101
Hormign, morteros y derivados.
170102
Ladrillos.
170103
Tejas y materiales cermicos.
170201
Madera.
170202
Vidrio.
170203
Plstico.
170407
Metales mezclados.
170504
Tierra y piedras distintas de las especificadas en el
cdigo 17 05 03.
170802
Materiales de construccin a partir de yeso distintos de
los especificados en el cdigo 17 08 01.
170904
Residuos mezclados de construccin y demolicin
distintos de los especificados en los cdigos 17 09 01, 17
09 02 y 17 09 03.
200101
Papel y cartn.
Total :

Cantidad
Peso
8,69 Kg

m3 Volumen
Aparente
0,17

3,78 Kg

0,01

21,27 Tn
97,14 Tn
4,11 Tn
2,90 Tn
0,06 Tn
0,23 Tn
2,46 Tn
7,16 Tn

14,46
91,75
3,88
7,58
0,05
0,40
0,55
5,37

5,68 Tn

14,20

0,68 Tn

1,35

0,07 Tn
141,76 Tn

0,16
139,76

5 Separacin de Residuos
Segn el Real Decreto 105/2008 que regula la produccin y gestin de los residuos de
construccin y demolicin los residuos de construccin y demolicin debern
separarse en las siguientes fracciones, cuando, de forma individualizada para cada
una de dichas fracciones, la cantidad prevista de generacin para el total de la obra
supere las siguientes cantidades:

Descripcin
Hormign
Ladrillos, tejas, cermicos
Metal
Madera
Vidrio
Plstico
Papel y cartn

Cantidad
80 t.
40 t.
2 t.
1 t.
1 t.
0,5 t.
0,5 t.

De este modo los residuos se separarn de la siguiente forma:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cdigo
LER
150110

160504

170101

170102

170103

170201

170202

170203

170407

170504

170802

170904

200101

Descripcin
del Residuo
Envases que contienen restos de sustancias peligrosas o
estn contaminados por ellas.
Opcin de separacin:
Separado
Gases en recipientes a presin [incluidos los halones] que
contienen sustancias peligrosas.
Opcin de separacin:
Separado
Hormign, morteros y derivados.
Opcin de separacin:
Residuos inertes
Ladrillos.
Opcin de separacin:
Residuos cermicos
Tejas y materiales cermicos.
Opcin de separacin:
Residuos cermicos
Madera.
Opcin de separacin:
Separado (100% de separacin en obra)
Vidrio.
Opcin de separacin:
Residuos mezclados no peligrosos
Plstico.
Opcin de separacin:
Residuos mezclados no peligrosos
Metales mezclados.
Opcin de separacin:
Residuos metlicos
Tierra y piedras distintas de las especificadas en el
cdigo 17 05 03.
Opcin de separacin:
Separado (0% de separacin en obra)
Materiales de construccin a partir de yeso distintos de
los especificados en el cdigo 17 08 01.
Opcin de separacin:
Residuos inertes
Residuos mezclados de construccin y demolicin
distintos de los especificados en los cdigos 17 09 01, 17
09 02 y 17 09 03.
Opcin de separacin:
Residuos mezclados no peligrosos
Papel y cartn.
Opcin de separacin:
Residuos mezclados no peligrosos
Total :

Cantidad
Peso
8,69 Kg

m3 Volumen
Aparente
0,17

3,78 Kg

0,01

21,27 Tn

14,46

97,14 Tn

91,75

4,11 Tn

3,88

2,90 Tn

7,58

0,06 Tn

0,05

0,23 Tn

0,40

2,46 Tn

0,55

7,16 Tn

5,37

5,68 Tn

14,20

0,68 Tn

1,35

0,07 Tn

0,16

141,70 Tn

139,79

6 Medidas para la Separacin en Obra


Con objeto de conseguir una mejor gestin de los residuos generados en la obra de
manera que se facilite su reutilizacin, reciclaje o valorizacin y para asegurar las
condiciones de higiene y seguridad requeridas en el artculo 5.4 del Real Decreto
105/2008 que regula la produccin y gestin de los residuos de construccin y de
demolicin se tomarn las siguientes medidas:
Las zonas de obra destinadas al almacenaje de residuos quedarn
convenientemente sealizadas y para cada fraccin se dispondr un cartel
sealizador que indique el tipo de residuo que recoge.
Todos los envases que lleven residuos deben estar claramente identificados,
indicando en todo momento el nombre del residuo, cdigo LER, nombre y
direccin del poseedor y el pictograma de peligro en su caso.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Los residuos se depositarn en las zonas acondicionadas para ellos conforme se


vayan generando.
Los residuos se almacenarn en contenedores adecuados tanto en nmero
como en volumen evitando en todo caso la sobrecarga de los contenedores
por encima de sus capacidades lmite.
Los contenedores situados prximos a lugares de acceso pblico se protegern
fuera de los horarios de obra con lonas o similares para evitar vertidos
descontrolados por parte de terceros que puedan provocar su mezcla o
contaminacin.

7 Destino Final
Se detalla a continuacin el destino final de todos los residuos de la obra, excluidos los
reutilizados, agrupados segn las fracciones que se generarn en base a los criterios
de separacin diseados en puntos anteriores de este mismo documento.
Los principales destinos finales contemplados son: vertido, valorizacin, reciclado o
envo a gestor autorizado.

Cdigo
LER
150110

Descripcin
del Residuo
Envases que contienen restos de sustancias peligrosas o
estn contaminados por ellas.
Destino: Envo a Gestor para Tratamiento
160504
Gases en recipientes a presin [incluidos los halones] que
contienen sustancias peligrosas.
Destino: Envo a Gestor para Tratamiento
1700CERA Residuos de Fbricas, Tejas y materiales cermicos. Suma
cdigos LER 170102 y 170103.
Destino: Valorizacin Externa
170107
Mezclas de hormign, ladrillos, tejas y materiales cermicos
distintas de las especificadas en el cdigo 17 01 06.
Destino: Valorizacin Externa
170201
Madera.
Destino: Valorizacin Externa
170407
Metales mezclados.
Destino: Valorizacin Externa
170504
Tierra y piedras distintas de las especificadas en el cdigo
17 05 03.
Destino: Deposicin en Vertedero
170904
Residuos mezclados de construccin y demolicin distintos
de los especificados en los cdigos 17 09 01, 17 09 02 y 17
09 03.
Destino: Envo a Gestor para Tratamiento
Total :

Cantidad
Peso
8,69 Kg

m3 Volumen
Aparente
0,17

3,78 Kg

0,01

101,26 Tn

95,63

26,95 Tn

28,66

2,90 Tn

7,58

2,46 Tn

0,55

7,16 Tn

5,37

0,96 Tn

1,80

141,70 Tn

139,79

8 Prescripciones del Pliego sobre Residuos


Obligaciones Agentes Intervinientes

Adems de las obligaciones previstas en la normativa aplicable, la persona fsica o


jurdica que ejecute la obra estar obligada a presentar a la propiedad de la
misma un plan que refleje cmo llevar a cabo las obligaciones que le incumban
en relacin con los residuos de construccin y demolicin que se vayan a producir
en la obra. El plan, una vez aprobado por la direccin facultativa y aceptado por
la propiedad, pasar a formar parte de los documentos contractuales de la obra.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

El poseedor de residuos de construccin y demolicin, cuando no proceda a


gestionarlos por s mismo, y sin perjuicio de los requerimientos del proyecto
aprobado, estar obligado a entregarlos a un gestor de residuos o a participar en
un acuerdo voluntario o convenio de colaboracin para su gestin. Los residuos de
construccin y demolicin se destinarn preferentemente, y por este orden, a
operaciones de reutilizacin, reciclado o a otras formas de valorizacin y en ltima
instancia a depsito en vertedero.
Segn exige el Real Decreto 105/2008, que regula la produccin y gestin de los
residuos de construccin y de demolicin, el poseedor de los residuos estar
obligado a sufragar los correspondientes costes de gestin de los residuos.
El productor de residuos (promotor) habr de obtener del poseedor (contratista) la
documentacin acreditativa de que los residuos de construccin y demolicin
producidos en la obra han sido gestionados en la misma entregados a una
instalacin de valorizacin de eliminacin para su tratamiento por gestor de
residuos autorizado, en los trminos regulados en la normativa y, especialmente, en
el plan o en sus modificaciones. Esta documentacin ser conservada durante
cinco aos.
En las obras de edificacin sujetas a licencia urbanstica la legislacin autonmica
podr imponer al promotor (productor de residuos) la obligacin de constituir una
fianza, o garanta financiera equivalente, que asegure el cumplimiento de los
requisitos establecidos en dicha licencia en relacin con los residuos de
construccin y demolicin de la obra, cuyo importe se basar en el captulo
especfico de gestin de residuos del presupuesto de la obra.
Todos los trabajadores intervinientes en obra han de estar formados e informados
sobre el procedimiento de gestin de residuos en obra que les afecta,
especialmente de aquellos aspectos relacionados con los residuos peligrosos.

Gestin de Residuos

Segn requiere la normativa, se prohbe el depsito en vertedero de residuos de


construccin y demolicin que no hayan sido sometidos a alguna operacin de
tratamiento previo.
El poseedor de los residuos estar obligado, mientras se encuentren en su poder, a
mantenerlos en condiciones adecuadas de higiene y seguridad, as como a evitar
la mezcla de fracciones ya seleccionadas que impida o dificulte su posterior
valorizacin o eliminacin.
Se debe asegurar en la contratacin de la gestin de los residuos, que el destino
final o el intermedio son centros con la autorizacin autonmica del organismo
competente en la materia. Se debe contratar slo transportistas o gestores
autorizados por dichos organismos e inscritos en los registros correspondientes.
Para el caso de los residuos con amianto se cumplirn los preceptos dictados por
el RD 396/2006 sobre la manipulacin del amianto y sus derivados.
Las tierras que puedan tener un uso posterior para jardinera o recuperacin de
suelos degradados, sern retiradas y almacenadas durante el menor tiempo
posible, en condiciones de altura no superior a 2 metros.
El depsito temporal de los residuos se realizar en contenedores adecuados a la
naturaleza y al riesgo de los residuos generados.
Dentro del programa de seguimiento del Plan de Gestin de Residuos se realizarn
reuniones peridicas a las que asistirn contratistas, subcontratistas, direccin
facultativa y cualquier otro agente afectado. En las mismas se evaluar el
cumplimiento de los objetivos previstos, el grado de aplicacin del Plan y la
documentacin generada para la justificacin del mismo.
Se deber asegurar en la contratacin de la gestin de los RCDs, que el destino
final (Planta de Reciclaje, Vertedero, Cantera, Incineradora, Centro de Reciclaje
de Plsticos/Madera...) sean centros autorizados. As mismo se deber contratar
slo transportistas o gestores autorizados e inscritos en los registros
correspondientes. Se realizar un estricto control documental, de modo que los

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

transportistas y gestores de RCDs debern aportar los vales de cada retirada y


entrega en destino final.
Derribo y Demolicin

En los procesos de derribo se priorizar la retirada tan pronto como sea posible de
los elementos que generen residuos contaminantes y peligrosos. Si es posible, esta
retirada ser previa a cualquier otro trabajo.
Los elementos constructivos a desmontar que tengan como destino ltimo la
reutilizacin se retirarn antes de proceder al derribo o desmontaje de otros
elementos constructivos, todo ello para evitar su deterioro.
En la planificacin de los derribos se programarn de manera consecutiva todos
los trabajos de desmontaje en los que se genere idntica tipologa de residuos con
el fin de facilitar los trabajos de separacin.

Separacin

El depsito temporal de los residuos valorizables que se realice en contenedores o


en acopios, se debe sealizar y segregar del resto de residuos de un modo
adecuado.
Los contenedores o envases que almacenen residuos
debern sealizarse
correctamente, indicando el tipo de residuo, la peligrosidad, y los datos del
poseedor.
El responsable de la obra al que presta servicio un contenedor de residuos
adoptar las medidas necesarias para evitar el depsito de residuos ajenos a la
misma. Igualmente, deber impedir la mezcla de residuos valorizables con aquellos
que no lo son.
El poseedor de los residuos establecer los medios humanos, tcnicos y
procedimientos de separacin que se dedicarn a cada tipo de residuo
generado.
Los contenedores de los residuos debern estar pintados en colores que destaquen
y contar con una banda de material reflectante. En los mismos deber figurar, en
forma visible y legible, la siguiente informacin del titular del contenedor: razn
social, CIF, telfono y nmero de inscripcin en el Registro de Transportistas de
Residuos.
Cuando se utilicen sacos industriales y otros elementos de contencin o
recipientes, se dotarn de sistemas (adhesivos, placas, etctera) que detallen la
siguiente informacin del titular del saco: razn social, CIF, telfono y nmero de
inscripcin en el Registro de Transportistas o Gestores de Residuos.
Los residuos generados en las casetas de obra producidos en tareas de oficina,
vestuarios, comedores, etc. tendrn la consideracin de Residuos Slidos Urbanos y
se gestionarn como tales segn estipule la normativa reguladora de dichos
residuos en la ubicacin de la obra,

Documentacin

La entrega de los residuos de construccin y demolicin a un gestor por parte del


poseedor habr de constar en documento fehaciente, en el que figure, al menos,
la identificacin del poseedor y del productor, la obra de procedencia y, en su
caso, el nmero de licencia de la obra, la cantidad, expresada en toneladas o en
metros cbicos, o en ambas unidades cuando sea posible, el tipo de residuos
entregados, codificados con arreglo a la lista europea de residuos publicada por
Orden MAM/304/2002, de 8 de febrero y la identificacin del gestor de las
operaciones de destino.
El poseedor de los residuos estar obligado a entregar al productor los certificados
y dems documentacin acreditativa de la gestin de los residuos a que se hace
referencia en el Real Decreto 105/2008 que regula la produccin y gestin de los
residuos de construccin y de demolicin.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

El poseedor de residuos dispondr de documentos de aceptacin de los residuos


realizados por el gestor al que se le vaya a entregar el residuo.
El gestor de residuos debe extender al poseedor un certificado acreditativo de la
gestin de los residuos recibidos, especificando la identificacin del poseedor y
del productor, la obra de procedencia y, en su caso, el nmero de licencia de la
obra, la cantidad, expresada en toneladas o en metros cbicos, o en ambas
unidades cuando sea posible, y el tipo de residuos entregados, codificados con
arreglo a la lista europea de residuos publicada por Orden MAM/304/2002.
Cuando el gestor al que el poseedor entregue los residuos de construccin y
demolicin efecte nicamente operaciones de recogida, almacenamiento,
transferencia o transporte, en el documento de entrega deber figurar tambin el
gestor de valorizacin o de eliminacin ulterior al que se destinan los residuos.
Segn exige la normativa, para el traslado de residuos peligrosos se deber remitir
notificacin al rgano competente de la comunidad autnoma en materia
medioambiental con al menos diez das de antelacin a la fecha de traslado. Si el
traslado de los residuos afecta a ms de una provincia, dicha notificacin se
realizar al Ministerio de Medio Ambiente.
Para el transporte de los residuos peligrosos se completar el Documento de
Control y Seguimiento. Este documento se encuentra en el rgano competente en
materia medioambiental de la comunidad autnoma.
El poseedor de residuos facilitar al productor acreditacin fehaciente y
documental que deje constancia del destino final de los residuos reutilizados. Para
ello se entregar certificado con documentacin grfica.

Normativa

Real Decreto 833/1988, de 20 de julio, por el que se aprueba, el Reglamento para


la ejecucin de la Ley 20/1986, Bsica de Residuos Txicos y Peligrosos.
Real Decreto 952/1997, que modifica el Reglamento para la ejecucin de la ley
20/1986 bsica de Residuos Txicos y Peligrosos, aprobado mediante Real Decreto
833/1998.
LEY 10/1998, de 21 de abril, de Residuos.
REAL DECRETO 1481/2001, de 27 de diciembre, por el que se regula la eliminacin
de residuos mediante depsito en vertedero.
REAL DECRETO 105/2008, de 1 de febrero, por el que se regula la produccin y
gestin de los residuos de construccin y demolicin.

9 Presupuesto
A continuacin se detalla listado de partidas estimadas inicialmente para la gestin de
residuos de la obra.
Esta valoracin forma parte del del presupuesto general de la obra como captulo
independiente.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Resumen
1-GESTIN RESIDUOS CERMICOS VALORIZACIN EXT.
Tasa para el envo directo de residuos de cermica
empleada en fbricas, tejas u otros elementos exentos de
materiales reciclables a un gestor final autorizado por la
comunidad
autnoma
correspondiente,
para
su
valorizacin. Sin incluir carga ni transporte. Segn
operacin enumerada R5 de acuerdo con la orden MAM
304/2002 por la que se publican las operaciones de
valorizacin
y
eliminacin
de
residuos.

Cantidad
101,26 t

Precio
3,24

Subtotal
328,08

2-GESTIN RESIDUOS INERTES MEZCL. VALORIZACIN EXT.


Tasa para el envo directo de residuos inertes mezclados
entre s exentos de materiales reciclables a un gestor final
autorizado por la comunidad autnoma correspondiente,
para su valorizacin. Sin incluir carga ni transporte. Segn
operacin enumerada R5 de acuerdo con la orden MAM
304/2002 por la que se publican las operaciones de
valorizacin y eliminacin de residuos.
3-GESTIN RESIDUOS MEZCL. C/ MATERIAL NP GESTOR
Tasa para la gestin de residuos mezclados de
construccin no peligrosos en un gestor autorizado por la
comunidad autnoma correspondiente. Sin incluir carga ni
transporte.
4-GESTIN
RESIDUOS
TIERRAS
VERTEDERO
Tasa para la deposicin directa de residuos de
construccin de tierras y piedras de excavacin exentos de
materiales reciclables en vertedero autorizado por la
comunidad autnoma correspondiente. Sin incluir carga ni
transporte. Segn operacin enumerada D5 de acuerdo
con la orden MAM 304/2002 por la que se publican las
operaciones de valorizacin y eliminacin de residuos.

26,95 t

3,54

95,40

0,96 t

23,23

22,30

7,16 t

3,49

24,99

5-GESTIN RESIDUOS ACERO Y OTROS METLES VALORIZ.


Precio para la gestin del residuo de acero y otros metales
a un gestor autorizado por la comunidad autnoma
correspondiente, para su reutilizacin, recuperacin o
valorizacin. Sin carga ni transporte. Segn operacin
enumerada R 04 de acuerdo con la orden MAM 304/2002
por la que se publican las operaciones de valorizacin y
eliminacin
de
residuos.

2,46 t

0,99

2,44

6-GESTIN
RESIDUOS
MADERA
VALORIZACION.
Precio para la gestin del residuo de madera a un gestor
final
autorizado
por
la
comunidad
autnoma
correspondiente, para su reutilizacin, recuperacin o
valorizacin. Sin carga ni transporte. Segn operacin
enumerada R3 de acuerdo con la orden MAM 304/2002
por la que se publican las operaciones de valorizacin y
eliminacin
de
residuos.

2,90 t

1,11

3,22

7-GESTIN RESIDUOS ENVASES PELIGROSOS GESTOR


Precio para la gestin del residuo de envases peligrosos
con gestor autorizado por la comunidad autnoma para
su recuperacin, reutilizacin, o reciclado. Segn
operacin enumerada R 04 de acuerdo con la orden MAM
304/2002 por la que se publican las operaciones de
valorizacin
y
eliminacin
de
residuos.

8,69 kg

0,35

3,04

8-GESTIN
RESIDUOS
AEROSOLES
GESTOR
Precio para la gestin del residuo aerosoles con gestor
autorizado por la comunidad autnoma para su
recuperacin, reutilizacin, o reciclado. Segn operacin
enumerada R13 de acuerdo con la orden MAM 304/2002
por la que se publican las operaciones de valorizacin y
eliminacin
de
residuos.

3,78 kg

0,95

3,59

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

9-ALQUILER
DE
CONTENEDOR
RESIDUOS
Tasa para el alquiler de un contenedor para
almacenamiento en obra de residuos de construccin y
demolicin.
Sin
incluir
transporte
ni
gestin.

134,60 t

3,34

449,56

10-TRANSPORTE
RESIDUOS
NO
PELIGROSOS
Tasa para el transporte de residuos no peligrosos de
construccin y demolicin desde la obra hasta las
instalaciones de un gestor autorizado por la comunidad
autnoma hasta un mximo de 20 km. Sin incluir gestin de
los residuos.
11-TRANSPORTE
RESIDUOS
PELIGROSOS
Tasa para el transporte de residuos peligrosos de
construccin y demolicin desde la obra hasta las
instalaciones de un gestor autorizado por la comunidad
autnoma. Sin incluir gestin de los residuos.

141,75 t

2,60

368,55

0,01 t

30,97

0,31

Total
Presupuesto:

1.301,48

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.5.- PLAN DE CONTROL DE CALIDAD


1. ANTECEDENTES
En el presupuesto ajunto a la presente memoria figura un captulo valorado
correspondiente a CONTROL DE CALIDAD.
2. OBJETO DEL PRESENTE DOCUMENTO
Antes de proceder al empleo de los materiales sern examinados y aceptados
por la Direccin Facultativa, quien podr disponer de todas las pruebas, anlisis y
ensayos que se realicen, con arreglo al presente Plan de Control de Calidad, por lo
que a continuacin se especifican los controles y ensayos a los que sern sometidos los
distintos materiales utilizados.
3. DESARROLLO DEL PLAN DE CONTROL DE CALIDAD
Las actividades que desarrollar la empresa adjudicataria del Plan ser el control
de los materiales, as como el control de la ejecucin en las tareas que se le
encomienden expresamente. Igualmente realizar pruebas de funcionamiento de las
instalaciones y actas de inspeccin tcnica previas a la utilizacin del edificio.
CONTROL DE LOS MATERIALES
El control podra englobarse en dos grupos:
-

Recopilacin de los datos de los fabricantes, marcas comerciales, datos de


identificacin del material segn UNE, certificados de garanta o sellos de
calidad cuando los tengan concedidos. Todo ello referido a los materiales
que posteriormente van a ser sometidos a ensayos o de aquellos que el
Director de la ejecucin indique.
Ejecucin de los ensayos obligatorios y que se indican en este documento.

CONTROL DE LA EJECUCIN
Tratar sobre los siguientes aspectos:
Comprobacin de las armaduras de la cimentacin y estructura con su
correspondencia con el proyecto en cuanto a materiales suministrados y
disposicin de las armaduras.
-

Comprobacin de las instalaciones de los captulos de: telefona,


comunicaciones, seguridad, ascensores, proteccin de incendios,
instalacin elctrica y alumbrado, sistema central de control y gestin e
instalaciones de climatizacin. Se comprobar que los materiales bsicos se
ajustan a las especificaciones de proyecto, e igualmente se auditar que
los mismos estn conformes con la normativa en vigor en el momento de la
ejecucin.

PRUEBAS DE FUNCIONAMIENTO
Se realizarn las pruebas de funcionamiento de las instalaciones que ms
adelante se detallan, as como una prueba de estanqueidad de las cubiertas y
fachadas.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

INSPECCIONES DE CONTROL TECNICO


Las realizar empresa homologada por el Ministerio de Industria en
inspecciones de control peridicas, al ser obligatorias las mismas tanto para su
apertura como posteriormente de forma peridica.
4. CONTROL DE LOS MATERIALES
Las unidades de obra sobre las que se llevar a cabo el control de materiales ser
el siguiente:
4.1. CIMENTACIN Y ESTRUCTURA
Hormigones
Se realizar un control estadstico a nivel normal segn lo establecido en la EHE, para lo
cual se dividir la obra en LOTES compuestos de dos o cuatro determinaciones de la
resistencia (dependiendo del tipo de hormign HA-25 HA-30), sobre serie de cuatro
probetas con roturas de dos probetas a 7 das y dos a 28 das segn las normas UNE en
vigor.
La EHE establece en su artculo 88 el control de ejecucin de los hormigones puestos
en obra. Se establecern unidades de control del hormign, denominadas LOTES. Estos
lotes estarn compuestos por una serie de amasadas, en funcin del elemento a
controlar, segn especifica la tabla 88.4.a.
El control del hormign se realizar mediante ensayos de confeccin y rotura de
probetas cilndricas de 15 x 30 cm. A compresin y medidas de la consistencia. La
toma de muestras del hormign se realizar segn UNE 83300:84.
En base a las prescripciones de la Instruccin EHE, para cada lote se efectuarn N
amasadas, siendo N 2 si fck 25 N/mm2 < fck 35 N/mm2 ; N 2 si fck > 35 N/mm2.
Dentro de las amasadas se tomarn cuatro probetas con los siguientes criterios de
rotura, salvo indicacin contraria de la Direccin Facultativa:
1 Ud. A 7 das
2 Uds. A 28 das (obligatorias segn EHE).
Las roturas a 7 das son orientativas de la evolucin de la resistencia del hormign ,
teniendo en cuenta que si la primera rotura no ofreciera la resistencia estimada a esta
edad, poda guardarse una probeta para romperla a la edad de 60 das, segn pas
prescripciones de la Direccin Facultativa del Proyecto.
En el caso de hormigones fabricados en Central de Hormign Preparado con posesin
de un Sello de Calidad oficialmente reconocido, se podr reducir el muestreo al 50%,
realizndose ste al azar y siempre y cuando se den adems las siguientes
condiciones:
-

Los resultados de control de produccin exigidos por el Sello estn a disposicin del
utilizador y sus valores son satisfactorios.
El nmero mnimo de lotes que deber muestrearse en obra ser de tres
correspondiendo los lotes a los tres tipos de elementos estructurales que figuran en
el cuadro 88.4.a de la Instruccin EHE.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Si en algn lote fest fck1 se pasar a realizar el control normal sin reduccin de
intensidad hasta que en 4 lotes consecutivos se obtengan resultados satisfactorios.

Si el hormign es fabricado en central, el estimador Kn a considerar para la obtencin


de la resistencia estimada, que es la que se compara con la resistencia de proyecto,
depender del recorrido relativo mximo, de la empresa suministradora y del nmero
de amasadas a controlar.
El nmero de lotes previsto es de 45 lotes para el control del edificio obtenido de la
documentacin estudiada, a continuacin se desarrolla la distribucin de lotes
Se establecern LOTES de control compuestos de 2 series de amasadas de 4
probetas de las cuales se rompern 2 Ud a 7 das y las otras 2 Ud a la edad de 28
das (Obligatorias S/EHE). La distribucin de LOTES se realizar como a continuacin
se determina:
Cimentacin (2 LOTES)
Hormigonado de zanjas y zapatas (cada 100 m3)
1 LOTE
Solera de 20 cms. de espesor (cada 500 m2)
1 LOTE, uno cada 500 m2

Estructura (2 LOTES)

Forjados (cada 500 m2)


1 LOTE por forjado (cada 500 m2), lo que da un total en los 2
forjados de 2 lotes

Para la recogida de muestras se proceder a realizar el aviso desde la obra


previamente al hormigonado al laboratorio encargado. Las amasadas sern elegidas
al azar por el Director de la ejecucin.
El laboratorio se encargar de recopilar la informacin necesaria del tipo de rido,
cemento y agua que utiliza la planta suministradora, facilitando dicha informacin al
Director de la ejecucin.
Se prohbe la utilizacin de aditivos salvo expresa autorizacin del Director de la
ejecucin.
El laboratorio encargado del control facilitar un plano a escala reducida con la
situacin de los hormigones que han sido muestreados con fecha de toma de las
probetas y con referencia clara a los ensayos realizados posteriormente.
Acero
Se comprobar que los aceros a utilizar en el hormign armado cumplen lo
especificado en la Instruccin EHE.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Asimismo durante el transcurso de la obra se comprobar que los aceros pertenecen


al fabricante y a la calidad ensayada, y estn en posesin del Certificado CC-EHE.l
En base a las prescripciones de la EHE y considerando el Certificado CC-EHE, las
armaduras se dividirn en lotes correspondientes cada uno de 40 toneladas mxima o
fraccin, siendo del mismo suministrador, designacin y serie. En la obra que nos
ocupa se realizarn 2 LOTES.
Por cada lote se efectuarn +2 probetas determinando los siguientes ensayos
caractersticos:
Caractersticas geomtricas de los resaltes segn 31.2.
Doblado desdoblado, segn 31.2.
Se determinarn, al menos en dos ocasiones durante la obra:
Lmite elstico, carga de rotura y alargamiento a rotura en una probeta de
cada dimetro, tipo de acero y suministrador (UNE 7474-1:92).
En mallas electrosoldadas: dos ensayos por dimetro principal de resistencia al
arrancamiento del nudo soldado (UNE 36462:80).
Se realizar un LOTE de control por cada uno de los dimetros empleados en obra. Se
realizar para cada uno de los LOTES los ensayos que a continuacin se enumeran:

- Traccin

6 Uds.

- Caractersticas geomtricas

6 Uds.

- Doblado - desdoblado

6 Uds.

Con el objeto de garantizar la calidad de los materiales empleados en obra se deber


entregar la documentacin que se indica a continuacin:
- Se solicitar a la Planta de Hormigonado el sello de calidad si lo posee y la
Clasificacin segn EHE.
- Hormigones (ensayos de materiales: ridos, cementos, aditivos, agua, etc. y
Certificados de calidad).
- Certificados de calidad del acero (barras corrugadas y mallas).
4.2. ALBAILERA
Ladrillos
Se tomar un muestra de ladrillo perforado tosco, otra de ladrillo perforado
visto y otra de ladrillo hueco doble, previo a la ejecucin de las fbricas
correspondientes, para la comprobacin de sus caractersticas segn las normas UNE
vigentes. Los ensayos a ejecutar sern los siguientes:

Control dimensional.
Eflorescencia (para el ladrillo visto)
Heladicidad (para el ladrillo visto)
Absorcin.
Succin.
Compresin

Morteros
Se tomarn muestras de mortero de forma estadsticas y en los momentos y
lugares que indique el Director de la ejecucin, cada 2.000 m2 de ejecucin de

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

fbrica y enfoscado y con un mnimo de cuatro muestras, para la comprobacin de


las resistencias mecnicas segn las normas UNE vigentes.
El control alcanzar a:

Cemento
Aridos
Agua
Aditivos

Los ensayos versarn sobre:

Consistencia
Densidad
Resistencia a compresin
Resistencia a la adhesin
Contenido en cloruros
Permeabilidad al vapor de agua.

Yesos
Se tomarn muestras de mortero de forma estadsticas y en los momentos y
lugares que indique el Director de la ejecucin, cada 2.000 m2 de ejecucin de
guarnecido de yeso y con un mnimo de dos muestras, para la comprobacin de las
resistencias mecnicas segn las normas UNE vigentes.
El control alcanzar a:
Yeso
Agua
Los ensayos versarn sobre:

Caractersticas qumicas del agua


Finura de molido del yeso
Resistencia a flexotraccin
Trabajabilidad
Resistencia a compresin
Dureza superficial

4.3 SOLADOS Y REVESTIMIENTOS


Se tomar una muestra, por muestreo en presencia del Director de la ejecucin,
de los siguientes materiales:

Alicatado color 31x45 cm.


Piedra caliza 2 cms.
Granito 3 cms. para zcalos
Piedra prefabricada remate de petos.
Granito 3 cms. para solados.
Terrazo 40x40 cms.
Peldao terrazo microchina
Marmol crema marfil 3 cms. para solados.
Grs compacto 40x40

Los ensayos tratarn sobre:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Control dimensional
Resistencia a flexin.
Absorcin
Heladicidad (en materiales al exterior)
Choque
Dureza al rayado
Desgaste
Resistencia a las manchas
Peso especfico (mrmoles y granitos)

4.4. CARPINTERIA Y CERRAJERIA


Se recopilarn los datos de los fabricantes, marcas comerciales, datos de
identificacin del material segn UNE, certificados de garanta o sellos de calidad
cuando los tengan concedidos, de los materiales ms significativos (puertas, ventanas,
muro cortina, puertas cortafuegos...etc.) o de aquellos que indique el Director de la
ejecucin.
4.5 IMPERMEABILIZANTES Y AISLANTES
Se ensayar la lmina de PVC de cubierta de acuerdo a la norma UNE
correspondiente.
Se ensayar las coquillas de espuma elastomrica para aislamiento de tuberas
de acuerdo a la norma UNE correspondiente.
4.6. INSTALACIONES SANEAMIENTO Y FONTANERA
Tuberas de PVC de saneamiento
Se tomarn muestras de las tuberas de saneamiento y drenaje y se
comprobar el cumplimiento de las normas UNE correspondientes
Tuberas de polipropileno reticular
Se tomarn muestras de las tuberas de saneamiento y drenaje y se
comprobar el cumplimiento de las normas UNE correspondientes
4.7. INSTALACIONES TELEFONIA Y TELECOMUNICACIONES
Tubos de proteccin y cajas
Se tomarn muestras de los tubos de proteccin y cajas de distribucin
comprobando el cumplimiento de las normas UNE correspondientes, as como los
reglamentos aplicables y normas de las compaas suministradoras.
Cableados
Se tomarn muestras de todo tipo de cableado comprobando el cumplimiento
de las normas UNE correspondientes, as como los reglamentos aplicables y normas de
las compaas suministradoras.
4.8. INSTALACIONES ELCTRICA, FUERZA Y ALUMBRADO.
Tubos de proteccin y cajas
Se tomarn muestras de los tubos de proteccin y cajas de distribucin
comprobando el cumplimiento de las normas UNE correspondientes, as como el
reglamento R.E.B.T. y normas de las compaas suministradoras.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cableados
Se tomarn muestras de todo tipo de cableado comprobando el cumplimiento
de las normas UNE correspondientes, as como el reglamento R.E.B.T. aplicables y
normas de las compaas suministradoras.
Cuadros elctricos
Se comprobar el cumplimiento del R.E.B.T. en cuanto a conexionado y
caractersticas de los elementos de mando y proteccin.
Aparatos de alumbrado
Comprobacin de la idoneidad de los equipos de acuerdo al proyecto y
normativa aplicable CE.

5. CONTROL DE LA EJECUCIN
5.1. COMPROBACIN DE LAS ARMADURAS.
Antes del hormigonado de la cimentacin, muros y forjados se comprobar el
armado de todos los elementos y su adecuacin al proyecto de ejecucin. Se emitir
informe de cada LOTE.
5.2 COMPROBACIN DE LAS INSTALACIONES
Se realizar una visita semanal a partir del inicio de las instalaciones, de la que
quedar documentacin grfica del estado de las mismas, adems de las
comprobaciones que en el apartado de control de los materiales se especifica.

6. PRUEBAS DE FUNCIONAMIENTO
6.1 DE LAS INSTALACIONES
Instalacin elctrica y alumbrado
Se har una prueba de funcionamiento de la instalacin de fuerza y
alumbrado, incluyendo: medida de la resistencia a tierra, esquemas de cuadros
elctricos, comprobacin del buen funcionamiento de los interruptores
magnetotrmicos y diferenciales, comprobacin del funcionamiento de puntos de luz,
tomas de corriente y cadas de tensin.
Instalacin de fontanera
Prueba de funcionamiento de la instalacin de fontanera, incluyendo:
estanqueidad del saneamiento, funcionamiento de las bombas de achique y sondas
de parada, funcionamiento del grupo de presin y tarado del mismo, estanqueidad
de las redes de distribucin, funcionamiento de los aparatos sanitarios.

6.2 PRUEBAS DE ESTANQUEIDAD


De las cubiertas
Se realizar prueba de estanqueidad por inundacin de todas las cubiertas del
edificio, con inspeccin ocular de la planta superior.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

De las fachadas
Se realizar prueba de estanqueidad por goteo permanente de lluvia durante un
mnimo de 6 horas en todas las fachadas del edificio, con inspeccin ocular de toas
las partes que puedan estar afectadas.
7. INSPECCIONES DE CONTROL TCNICO
La empresa adjudicataria realizar todas las necesarias que obliga la
legislacin sectorial para la puesta en funcionamiento del edificio.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.5.- ESTUDIO DE SEGURIDAD Y SALUD


ndice
1. Memoria Informativa
1.1. Objeto
1.2. Tcnicos
1.3. Datos de la Obra
1.4. Descripcin de la Obra
1.5. Presencia de amianto
2. Agentes Intervinientes
2.1. Promotor
2.2. Proyectista
2.3. Coordinador de Seguridad y Salud en fase de proyecto
2.4. Coordinador de Seguridad y Salud en fase de ejecucin
2.5. Direccin Facultativa
2.6. Contratistas y Subcontratistas
2.7. Trabajadores Autnomos
2.8. Trabajadores por cuenta ajena
2.9. Fabricantes y Suministradores de Equipos de Proteccin y Materiales de Construccin
2.10. Recursos preventivos
3. Riesgos Eliminables
4. Trabajos Previos
4.1. Vallado y Sealizacin
4.2. Locales de Obra
4.3. Instalaciones Provisionales
5. Fases de Ejecucin
5.1. Demoliciones
5.2. Movimiento de Tierras
5.3. Trabajos Previos
5.3.1. Instalacin Elctrica Provisional
5.3.2. Instalacin Abastecimiento y Saneamiento Provisional
5.3.3. Vallado de Obra
5.4. Cimentacin
5.5. Red de Saneamiento
5.6. Estructuras
5.6.1. Hormign Armado
5.6.1.1. Encofrado
5.6.1.2. Ferrallado
5.6.1.3. Hormigonado
5.6.1.4. Desencofrado
5.7. Cubiertas
5.8. Cerramientos y Distribucin
5.9. Acabados
5.9.1. Pavimentos
5.9.1.1. Ptreos y Cermicos
5.9.2. Paramentos
5.9.2.1. Alicatados
5.9.2.2. Enfoscados
5.9.2.3. Guarnecidos y Enlucidos
5.9.3. Pintura
5.9.4. Techos
5.10. Carpintera
5.10.1. Madera
5.10.2. Metlica
5.10.3. Montaje del vidrio
5.11. Instalaciones
5.11.1. Electricidad
5.11.2. Fontanera, Calefaccin y Saneamiento
6. Medios Auxiliares
6.1. Andamios
6.1.1. Andamio de Borriquetas
6.1.2. Andamio Tubular
6.2. Escaleras de Mano
6.2.1. Escaleras Metlicas
6.3. Puntales
7. Autoproteccin y emergencia
7.1. Evacuacin
7.2. Proteccin contra incendios
7.3. Primeros auxilios

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

8. Maquinaria
8.1. Empuje y Carga
8.1.1. Retroexcavadora
8.2. Transporte
8.2.1. Camin Basculante
8.2.2. Camin Transporte
8.3. Aparatos de Elevacin
8.3.1. Maquinillo
8.3.2. Camin gra
8.4. Hormigonera
8.5. Vibrador
8.6. Sierra Circular de Mesa
8.7. Herramientas Manuales Ligeras
9. Manipulacin sustancias peligrosas
10. Procedimientos coordinacin de actividades empresariales
11. Control de Accesos a la Obra
12. Valoracin Medidas Preventivas
13. Mantenimiento
14. Legislacin

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1. Memoria Informativa
1.1. Objeto
Segn se establece en el Real Decreto 1627/1997, por el que se establecen
disposiciones mnimas de seguridad y salud en las obras de construccin, el
promotor est obligado a encargar la redaccin de un estudio bsico de seguridad
y salud en los proyectos de obras en que no se den alguno de los supuestos
siguientes:
a) Que el presupuesto de ejecucin por contrata incluido en el proyecto sea
igual o superior a 450.759 euros.
b) Que la duracin estimada sea superior a 30 das laborables, emplendose
en algn momento a ms de 20 trabajadores simultneamente.
c) Que el volumen de mano de obra estimada, entendiendo por tal la suma de
los das de trabajo del total de los trabajadores en la obra, sea superior a 500.
d) Las obras de tneles, galeras, conducciones subterrneas y presas.
Dado que la obra en cuestin no queda enmarcada entre los grupos anteriores,
como se aclara en el punto "Datos de la Obra" de este mismo EBSS, los promotores
don David Lpez Blanco y doa Ana Becerra de Haro, con domicilio en la calle N
Sra. de Ftima, 6 de Ronda (Mlaga) y N.I.F. 76799241X y 25556855Z
respectivamente, han designado al firmante de este documento para la redaccin
del Estudio Bsico de Seguridad y Salud de la obra.
En este Estudio Bsico se realiza descripcin de los procedimientos, equipos tcnicos
y medios auxiliares que van a utilizarse previsiblemente, identificando los riesgos
laborales y especificando las medidas preventivas y protecciones tcnicas
tendentes a eliminar, controlar y reducir dichos riesgos.
Este E.B.S.S. servir de base para la redaccin del Plan de Seguridad y Salud por
parte de cada Contratista interviniente en la obra en el que se analizarn,
estudiarn, desarrollarn y complementarn las previsiones contenidas en este EBSS,
adaptando a sus propios recursos, equipos y procesos constructivos. En ningn caso
las modificaciones planteadas en el PSS podrn implicar disminucin de los niveles
de proteccin previstos.

1.2. Tcnicos
La relacin de tcnicos intervinientes en la obra es la siguiente:
Tcnico Redactor del Proyecto de Ejecucin: Pedro Enrique Santos Buenda,
arquitecto.
Director de Obra: Pedro Enrique Santos Buenda, arquitecto.
Director de la Ejecucin Material de la Obra: Pendiente de contratar.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Coordinador de Seguridad y Salud en fase de proyecto: Pedro Enrique Santos


Buenda, arquitecto.
Autor del Estudio Bsico de Seguridad y Salud: Pedro
arquitecto.

Enrique

Santos

Buenda,

Coordinador de Seguridad y Salud en fase de ejecucin: Pendiente de contratar.

1.3. Datos de la Obra


El presente Estudio Bsico de Seguridad y Salud se redacta para la obra Vivienda
unifamiliar con garaje entre medianeras que va a ejecutarse en la calle Montes, 20
de Ronda (Mlaga).
El presupuesto de ejecucin por contrata de las obras es de 106.704'30, inferior en
cualquier caso a 450.759 euros a partir del cual sera preciso Estudio de Seguridad y
Salud.
La superficie total en m2 construidos es de: 189'10.
Se prev un plazo de ejecucin de las mismas de 6 meses.
El nmero de operarios previstos que intervengan en la obra en sus diferentes fases
es de 4.
No concurrir la circunstancia de una duracin de obra superior a 30 das y
coincidir 20 trabajadores simultaneamente que segn R.D. 1627/97 requerira de
E.S.S.
El volumen de mano de obra estimada, entendiendo por tal la suma de los das de
trabajo del total de los trabajadores en la obra es de: 490 menor de 500.

1.4. Descripcin de la Obra


Se demoler la edificacin existente y se sustituir por otra de nueva construccin con
dos plantas sobre rasante para una vivienda unifamiliar con garaje, que se construir
con cimentacin de pozos y zanjas, estructura portante de muros de fbrica de
bloques cermicos y pliares de hormign armado y fbrica de ladrillo perforado,
estructura horizontal de forjados unidireccionales de semiviguetas y bobedillas de
hormign, cubierta inclinada de teja cermica curva, carpintera exterior de PVC e
interior de madera, instalaciones de fontanera, calefaccin y electricidad,
revestimientos exteriores de mortero de cemento e interiores de yeso-perlita,
alicatados y suelos de barro pulido.

1.5. Presencia de amianto


Durante los trabajos de demolicin de la edificacin existente se levantarn varias
cubiertas de placas onduladas de fibrocemento que contienen amianto por lo que,
atendiendo al lo dispuesto en el Real Decreto 396/2006 que establece las
disposiciones mnimas de seguridad y salud aplicables a los trabajos con riesgo de

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

exposicin al amianto, se identifican en este punto del Estudio Bsico de Seguridad


y Salud los materiales de la obra y su ubicacin exacta:
Cubiertas de placas onduladas de fibrocemento existentes en la parte posterior de
la edificacin, tal como se observa en los planos correspondientes del presente
proyecto.

2. Agentes Intervinientes
Son agentes todas las personas, fsicas o jurdicas, que intervienen en el proceso de
la edificacin. Sus obligaciones vendrn determinadas por lo dispuesto en esta Ley y
dems disposiciones que sean de aplicacin y por el contrato que origina su
intervencin con especial referencia a la L.O.E. y el R.D.1627/97.

2.1. Promotor
Ser considerado promotor cualquier persona, fsica o jurdica, pblica o privada,
que, individual o colectivamente, decide, impulsa, programa y financia, con
recursos propios o ajenos, las obras de edificacin para s o para su posterior
enajenacin, entrega o cesin a terceros bajo cualquier ttulo.
Cuando el promotor realice directamente con medios humanos y materiales
propios la totalidad o determinadas partes de la obra, tendr tambin la
consideracin de contratista a los efectos de la Ley 32/2006
A los efectos del RD 1627/97 cuando el promotor contrate directamente
trabajadores autnomos para la realizacin de la obra o de determinados trabajos
de la misma, tendr la consideracin de contratista excepto en los casos
estipulados en dicho Real Decreto.
Es el promotor quien encargar la redaccin del E.S.S. y ha de contratar a los
tcnicos coordinadores en Seguridad y Salud tanto en proyecto como en
ejecucin.
Facilitar copia del E.S.S. a las empresas contratistas, subcontratistas o trabajados
autnomos contratados por directamente por el promotor, exigiendo la
presentacin de Plan de Seguridad y Salud previo al comienzo de las obras.
Velar por que el/los contratista/s presentan ante la autoridad laboral la
comunicacin de apertura del centro de trabajo y sus posibles actualizaciones.

2.2. Proyectista
El proyectista es el agente que, por encargo del promotor y con sujecin a la
normativa tcnica y urbanstica correspondiente, redacta el proyecto.
Deber tomar en consideracin, de conformidad con la Ley de Prevencin de
Riesgos Laborales, los principios generales de prevencin en materia de seguridad y
de salud en las fases de concepcin, estudio y elaboracin del proyecto de obra.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.3. Coordinador de Seguridad y Salud en fase de proyecto


Coordinador en materia de seguridad y de salud durante la elaboracin del
proyecto de obra: el tcnico competente designado por el promotor para
coordinar, durante la fase del proyecto de obra, la aplicacin de los principios
generales de prevencin en materia de seguridad y de salud durante la fase de
proyecto.

2.4. Coordinador de Seguridad y Salud en fase de ejecucin


Coordinador en materia de seguridad y de salud durante la ejecucin de la obra es
el tcnico competente integrado en la direccin facultativa, designado por el
promotor para llevar a cabo las siguientes tareas:
Coordinar la aplicacin de los principios generales de prevencin y de seguridad.
Coordinar las actividades de la obra para garantizar que los contratistas y, en su
caso, los subcontratistas y los trabajadores autnomos apliquen de manera
coherente y responsable los principios de la accin preventiva.
Aprobar el plan de seguridad y salud elaborado por el contratista.
Organizar la coordinacin de actividades empresariales.
Coordinar las acciones y funciones de control de la aplicacin correcta de los
mtodos de trabajo.
Adoptar las medidas necesarias para que slo las personas autorizadas puedan
acceder a la obra.
Asegurarse de que las empresas subcontratistas han sido informadas del Plan de
Seguridad y Salud y estn en condiciones de cumplirlo.
El Coordinador en materia de seguridad podr paralizar los tajos o la totalidad de la
obra, en su caso, cuando observase el incumplimiento de las medidas de seguridad
y salud establecidas, dejndolo por escrito en el libro de incidencias. Adems, se
deber comunicar la paralizacin al Contratista, Subcontratistas afectados,
Inspeccin de Trabajo y Seguridad Social correspondiente y representantes de los
trabajadores.

2.5. Direccin Facultativa


Direccin facultativa: el tcnico o tcnicos competentes designados por el
promotor, encargados de la direccin y del control de la ejecucin de la obra.
Asumir las funciones del Coordinador de Seguridad y Salud en el caso de que no
sea necesaria su contratacin dadas las caractersticas de la obra y lo dispuesto en
el R.D. 1627/97.
En ningn caso las responsabilidades de los coordinadores, de la direccin
facultativa y del promotor eximirn de sus responsabilidades a los contratistas y a los
subcontratistas.

2.6. Contratistas y Subcontratistas

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Contratista es la persona fsica o jurdica que asume contractualmente ante el


promotor, con medios humanos y materiales, propios o ajenos, el compromiso de
ejecutar la totalidad o parte de las obras con sujecin al proyecto y al contrato.
Cuando el promotor realice directamente con medios humanos y materiales
propios la totalidad o determinadas partes de la obra, tendr tambin la
consideracin de contratista a los efectos de la Ley 32/2006
A los efectos del RD 1627/97 cuando el promotor contrate directamente
trabajadores autnomos para la realizacin de la obra o de determinados trabajos
de la misma, tendr la consideracin de contratista excepto en los casos
estipulados en dicho Real Decreto.
Subcontratista es la persona fsica o jurdica que asume contractualmente ante el
contratista u otro subcontratista comitente el compromiso de realizar determinadas
partes o unidades de obra.
Son responsabilidades del Contratistas y Subcontratistas:
La entrega al Coordinador de Seguridad y Salud en la obra de documentacin
clara y suficiente en que se determine: la estructura organizativa de la empresa,
las responsabilidades, las funciones, las prcticas, los procedimientos, los procesos
y los recursos de los que se dispone para la realizacin de la accin preventiva de
riesgos en la empresa.
Redactar un Plan de Seguridad y Salud segn lo dispuesto en el apartado
correspondiente de este E.S.S. y el R.D. 1627/1997.
Aplicar los principios de la accin preventiva segn Ley de Prevencin de Riesgos
Laborales.
Cumplir y hacer cumplir a su personal lo establecido en el plan de seguridad y
salud.
Cumplir la normativa en materia de prevencin de riesgos laborales.
Informar y proporcionar las instrucciones adecuadas a los trabajadores
autnomos sobre todas las medidas que hayan de adoptarse en lo que se refiere
a su seguridad y salud en la obra. Vigilarn el cumplimiento de estas medidas por
parte de los trabajadores autnomos en el caso que estos realicen obras o
servicios correspondientes a la propia actividad de la empresa contratista y se
desarrollen en sus centros de trabajos.
Informar por escrito al resto de empresas concurrentes en la obra y al
coordinador de seguridad y salud en la obra de los riesgos especficos que
puedan afectar a otros trabajadores de la obra segn lo dispuesto en el Real
Decreto 171/2004.
Atender las indicaciones y cumplir las instrucciones del coordinador en materia
de seguridad y de salud durante la ejecucin de la obra o, en su caso, de la
direccin facultativa.
Los Contratistas y Subcontratistas son los responsables de que la ejecucin de las
medidas preventivas correspondan con las fijadas en el Plan de Seguridad y
Salud.
Designar los recursos preventivos asignando uno o varios trabajadores o en su
caso uno o varios miembros del servicio de prevencin propio o ajeno de la
empresa. As mismo ha de garantizar la presencia de dichos recursos en la obra
en los casos especificados en la Ley 54/2003 y dichos recursos contarn con
capacidad suficiente y dispondrn de medios necesarios para vigilar el
cumplimiento de las actividades preventivas.
Vigilar el cumplimiento de la Ley 32/2006 por las empresas subcontratistas y
trabajadores autnomos con que contraten; en particular, en lo que se refiere a

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

las obligaciones de acreditacin e inscripcin en el Registro de Empresas


Acreditadas, contar con el porcentaje de trabajadores contratados con carcter
indefinido aspectos regulados en el artculo 4 de dicha Ley y al rgimen de la
subcontratacin que se regula en el articulo 5.
Informar a los representantes de los trabajadores de las empresas que
intervengan en la ejecucin de la obra de las contrataciones y
subcontrataciones que se hagan en la misma.
2.7. Trabajadores Autnomos
Trabajador autnomo: la persona fsica distinta del contratista y del subcontratista,
que realiza de forma personal y directa una actividad profesional, sin sujecin a un
contrato de trabajo, y que asume contractualmente ante el promotor, el contratista
o el subcontratista el compromiso de realizar determinadas partes o instalaciones
de la obra. Cuando el trabajador autnomo emplee en la obra a trabajadores por
cuenta ajena, tendr la consideracin de contratista o subcontratista a los efectos
de la Ley 32/2006 y del RD 1627/97.
Los trabajadores autnomos estarn obligados a:
Aplicar los principios de la accin preventiva segn la Ley de Prevencin de
Riesgos Laborales.
Cumplir las disposiciones mnimas de seguridad y salud.
Cumplir las obligaciones en materia de prevencin de riesgos que establece para
los trabajadores la Ley de Prevencin de Riesgos Laborales.
Ajustar su actuacin en la obra conforme a los deberes de coordinacin de
actividades empresariales.
Utilizar equipos de trabajo que se ajusten a lo dispuesto en el Real Decreto
1215/1997, de 18 de julio, por el que se establecen las disposiciones mnimas de
seguridad y salud para la utilizacin por los trabajadores de los equipos de
trabajo.
Elegir y utilizar equipos de proteccin individual en los trminos previstos en el Real
Decreto 773/1997, de 30 de mayo, sobre disposiciones mnimas de seguridad y
salud relativas a la utilizacin por los trabajadores de equipos de proteccin
individual.
Atender las indicaciones y cumplir las instrucciones del coordinador en materia
de seguridad y de salud durante la ejecucin de la obra o, en su caso, de la
direccin facultativa.
Informar por escrito al resto de empresas concurrentes en la obra y al
coordinador de seguridad y salud en la obra de los riesgos especficos que
puedan afectar a otros trabajadores de la obra segn lo dispuesto en el Real
Decreto 171/2004.
Debern cumplir lo establecido en el plan de seguridad y salud.
2.8. Trabajadores por cuenta ajena
Los contratistas y subcontratistas debern garantizar que los trabajadores reciban
una informacin adecuada de todas las medidas que hayan de adoptarse en lo
que se refiere a su seguridad y su salud en la obra.
La consulta y participacin de los trabajadores o sus representantes se realizarn, de
conformidad con lo dispuesto en la Ley de Prevencin de Riesgos Laborales.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Una copia del plan de seguridad y salud y de sus posibles modificaciones ser
facilitada por el contratista a los representantes de los trabajadores en el centro de
trabajo.
Usarn adecuadamente, de acuerdo con su naturaleza y los riesgos previsibles, las
mquinas, aparatos, herramientas, sustancias peligrosas, equipos de transporte y, en
general, cualesquiera otros medios con los que desarrollen su actividad. Utilizarn
correctamente los medios y equipos de proteccin facilitados por el empresario. No
pondrn fuera de funcionamiento y utilizarn correctamente los dispositivos de
seguridad existentes o que se instalen en los medios relacionados con su actividad o
en los lugares de trabajo en los que sta tenga lugar. Informarn de inmediato a su
superior jerrquico directo, y a los trabajadores designados para realizar actividades
de proteccin y de prevencin o, en su caso , al servicio de prevencin, acerca de
cualquier situacin que, a su juicio, entrae, por motivos razonables, un riesgo para
la seguridad y la salud de los trabajadores. Contribuirn al cumplimiento delas
obligaciones establecidas por la autoridad competente con el fin de proteger la
seguridad y la salud de los trabajadores en el trabajo.

2.9. Fabricantes y Suministradores de Equipos de Proteccin y Materiales de


Construccin
Los fabricantes, importadores y suministradores de maquinaria, equipos, productos y
tiles de trabajo estn obligados a asegurar que stos no constituyan una fuente de
peligro para el trabajador, siempre que sean instalados y utilizados en las
condiciones, forma y para los fines recomendados por ellos.
Los fabricadores, importadores y suministradores de productos y sustancias qumicas
de utilizacin en el trabajo estn obligados a envasar y etiquetar los mismos de
forma que se permita su conservacin y manipulacin en condiciones de seguridad
y se identifique claramente su contenido y los riesgos para la seguridad o la salud
de los trabajadores que su almacenamiento o utilizacin comporten.
Debern suministrar la informacin que indique la forma correcta de utilizacin por
los trabajadores, las medidas preventivas adicionales que deban tomarse y los
riesgos laborales que conlleven tanto su uso normal, como su manipulacin o
empleo inadecuado.
Los fabricantes, importadores y suministradores de elementos para la proteccin de
los trabajadores estn obligados a asegurar la efectividad de los mismos, siempre
que sean instalados y usados en las condiciones y de la forma recomendada por
ellos. A tal efecto, debern suministrar la informacin que indique el tipo de riesgo al
que van dirigidos, el nivel de proteccin frente al mismo y la forma correcta de su
uso y mantenimiento.
Los fabricantes, importadores y suministradores debern proporcionar a los
empresarios la informacin necesaria para que la utilizacin y manipulacin de la
maquinaria, equipos, productos, materias primas y tiles de trabajo se produzca sin
riesgos para la seguridad y la salud de los trabajadores.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.10. Recursos preventivos


Con el fin de ejercer las labores de recurso preventivo segn lo establecido en la
Ley 31/1995, Ley 54/2003 y Real Decreto 604/2006 el empresario designar para la
obra los recursos preventivos que podrn ser:
a. Uno o varios trabajadores designados de la empresa.
b. Uno o varios miembros del servicio de prevencin propio de la empresa
c. Uno o varios miembros del o los servicios de prevencin ajenos.
La empresa contratista garantizar la presencia de dichos recursos preventivos en
obra en los siguientes casos:
a. Cuando los riesgos puedan verse agravados o modificados, en el desarrollo del
proceso o la actividad, por la concurrencia de operaciones diversas que se
desarrollan sucesiva o simultneamente y que hagan preciso el control de la
correcta aplicacin de los mtodos de trabajo.
b. Cuando se realicen las siguientes actividades o procesos peligrosos o con riesgos
especiales:
1. Trabajos con riesgos especialmente graves de cada desde altura.
2. Trabajos con riesgo de sepultamiento o hundimiento.
3. Actividades en las que se utilicen mquinas que carezcan de declaracin
CE de conformidad, que sean del mismo tipo que aquellas para las que la
normativa sobre comercializacin de mquinas requiere la intervencin de un
organismo notificado en el procedimiento de certificacin, cuando la
proteccin del trabajador no est suficientemente garantizada no obstante
haberse adoptado las medidas reglamentarias de aplicacin.
4. Trabajos en espacios confinados.
5. Trabajos con riesgo de ahogamiento por inmersin.
c. Cuando sea requerida por la Inspeccin de Trabajo y Seguridad Social.
Tambin ser precisa su presencia, en base a los criterios tcnicos publicados por el
Ministerio, cuando en la obra se empleen menores de 18 aos, trabajadores
especialmente sensibles, trabajadores de reciente incorporacin en fase inicial de
adiestramiento o cedidos por ETT.
En el apartado correspondiente de este Estudio Bsico de Seguridad y Salud se
especifica cuando esta presencia es necesaria en funcin de la concurrencia de
los casos antes sealados en las fases de obra y en el montaje, desmontaje y
utilizacin de medios auxiliares y maquinaria empleada.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Ante la ausencia del mismo, o de un sustituto debidamente cualificado y nombrado


por escrito, se paralizarn los trabajos incluyendo los de las empresas
subcontratadas o posible personal autnomo.
Las personas a las que se asigne esta vigilancia debern dar las instrucciones
necesarias para el correcto e inmediato cumplimiento de las actividades
preventivas, en caso de observar un deficiente cumplimiento de las mismas o una
ausencia, insuficiencia o falta de adecuacin de las mismas, se informar al
empresario para que ste adopte las medidas necesarias para corregir las
deficiencias observadas y al coordinador de seguridad y salud y resto de la
direccin facultativa.
El Plan de Seguridad y Salud especificar expresamente el nombre de la persona o
personas designadas para tal fin y se detallarn las tareas que inicialmente se
prevee necesaria su presencia por concurrir alguno de los casos especificados
anteriormente.

3. Riesgos Eliminables
No se han identificado riesgos totalmente eliminables.
Entendemos que ninguna medida preventiva adoptada frente a un riesgo lo
elimina por completo dado que siempre podr localizarse una situacin por mal uso
del sistema, actitudes imprudentes de los operarios u otras en que dicho riesgo no
sea eliminado.
Por tanto se considera que los nicos riesgos eliminables totalmente son aquellos
que no existen al haber sido eliminados desde la propia concepcin del edificio,
por el empleo de procesos constructivos, maquinaria, medios auxiliares o incluso
medidas del propio diseo del proyecto que no generen riesgos y sin duda estos
riegos no merecen de un desarrollo detenido en este Estudio Bsico.

4. Trabajos Previos

4.1. Vallado y Sealizacin


Resulta especialmente importante restringir el acceso a la obra de personal no
autorizado, de manera que todo el recinto de la obra, en cuyo entorno se crean los
riesgos derivados de la misma, quede inaccesible para personas ajenas a la obra.
Del mismo modo es necesario la instalacin de un mnimo de elementos de
sealizacin que garanticen la presencia de informaciones bsicas relativas a la
Seguridad y Salud en diversos puntos de la obra.
Para ello se instalarn las siguientes medidas de cierre y sealizacin:
Vallado perimetral con malla electrosoldada sustentadas por pies derechos
formados con perfiles laminados. La altura de dichos paneles quedar establecido
como mnimo en 2 m.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Sealizacin mediante paneles en el acceso de la obra con los pictogramas


indicados en los esquemas grficos de este documento y como mnimo seales de
"Prohibido el acceso a personal no autorizado", "Uso obligatorio del casco" y
pictogramas y textos de los riesgos presentes en la obra.
Cartel informativo ubicado en un lugar preferente de la obra en el que se indiquen
los telfonos de inters de la misma y en el que como mnimo aparezcan reflejados
los telfonos de urgencia: servicios sanitarios, bomberos, polica, centros
asistenciales, instituto toxicolgico y los telfonos de contacto de tcnicos de obra
y responsables de la empresa contratista y subcontratistas.
Cierre de la obra: la obra permanecer cerrada fuera del horario laboral de
manera que no sea posible el acceso a la misma sin forzar los elementos de cierre.

4.2. Locales de Obra


La magnitud de las obras y las caractersticas de las mismas hacen necesario la
instalacin de los siguiente locales provisionales de obra:
No es necesario la instalacin de vestuarios: Dadas las caractersticas de la obra, la
cercana a los domicilios de los operarios y/o a la sede de las empresas contratistas
se considera innecesario la instalacin de vestuarios en la propia obra.
No es necesario la instalacin de aseos y ducha: Dadas las caractersticas de la
obra, la cercana a los domicilios de los operarios y/o a la sede de las empresas
contratistas se considera innecesario la instalacin de aseos y duchas en la propia
obra.
No es necesario la instalacin de Comedor y Cocina: Dadas las caractersticas de
la obra, la cercana a los domicilios de los operarios y/o a restaurantes se considera
innecesario la instalacin de comedor y cocina en la propia obra.
No es necesario la instalacin de Oficina de Obra: Dadas las caractersticas de la
obra y teniendo en cuenta el personal tcnico presente en obra se considera
innecesario la instalacin de oficina en la propia obra.

4.3. Instalaciones Provisionales


En el apartado de fases de obra de este mismo documento se realiza la
identificacin de riesgos, medidas preventivas, protecciones colectivas y E.P.I.s para
cada una de estas instalaciones.
La obra objeto de este documento contar con las siguientes instalaciones
provisionales de obra:
Se dispondr en obra de un cuadro elctrico de obra "conjunto para obra CO"
construido segn la UNE-EN 60439-4. Provista de una placa con el marcado CE,
nombre del fabricante o instalador, grado IP de proteccin, etc.

Partir desde la misma acometida realizada por tcnicos de la empresa

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

suministradora o desde el generador de obra y estar situado segn se grafa en el


plano de organizacin de obra.
En la instalacin elctrica de obra, las envolventes, aparamente, tomas de
corriente y elementos de proteccin que estn expuestos a la intemperie contarn
con un grado de proteccin mnima IP45 y un grado de proteccin contra
impactos mecnicos de IK 0,8. As mismo, las tomas de corriente estarn protegidos
con diferenciales de 30 mA o inferior. Los cuadros de distribucin integrarn
dispositivos de proteccin contra sobreintensidades, contra contactos indirectos y
bases de toma de corriente.

Se realizar toma de tierra para la instalacin,

La instalacin ser realizada por personal cualificado segn las normas del REBT.

Contar con tensiones de 220/380 V y tensin de seguridad de 24 V.


Instalacin Contraincendios: Se dispondrn de extintores en los puntos de especial
riesgo de incendio de manera que al menos quede ubicado un extintor de CO2
junto al cuadro elctrico y extintores de polvo qumico prximos a las salidas de los
locales que almacenen materiales combustibles.

Estos extintores sern objeto de revisin peridica y se mantendrn protegidos de


las inclemencias meteorolgicas.

Instalacin de Abastecimiento de agua mediante acometida de red: Previo a la


ejecucin de la obra se realizar la acometida de acuerdo con las condiciones de
la compaa suministradora, dotando de agua potable las distintas instalaciones de
higiene y confort de la obra as como los equipos y maquinarias que precisan de
ella.

5. Fases de Ejecucin
5.1. Demoliciones
RIESGOS:
Cadas a distinto nivel de objetos.
Cadas a distinto o mismo nivel de los operarios por prdida de equilibrio o
hundimiento del forjado donde opera.
Referentes a maquinaria y vehculos: vuelcos, choques, golpes y cadas en el
ascenso o descenso de los mismos.
Atrapamientos y atropellos de personas con la maquinaria.
Proyeccin de tierra y piedras.
Golpes, choques, cortes,
Sobreesfuerzos
Pisadas sobre materiales punzantes.
Atrapamientos y aplastamientos.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Afecciones cutneas.
Proyeccin de partculas en los ojos.
Exposicin a ruido y vibraciones.
Emisin de polvo: Inhalacin o molestias en los ojos.
Sustancias nocivas o txicas.
Contactos elctricos.
Incendios y explosiones.
Inundaciones o filtraciones de agua.
Infecciones.
Desplomes de elementos

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
Con carcter previo al inicio de los trabajos debern analizarse las condiciones
del edificio y de las instalaciones preexistentes, investigando, para la adopcin de
las medidas preventivas necesarias, su uso o usos anteriores, las condiciones de
conservacin y de estabilidad de la obra en su conjunto, de cada parte de la
misma, y de las edificaciones adyacentes. El resultado del estudio anterior se
concretar en un plan de demolicin en el que constar la tcnica elegida as
como las personas y los medios ms adecuados para realizar el trabajo.
Queda prohibido el vertido de materiales a plantas inferiores.
Los contenedores no se llenarn por encima de los bordes.
Los contenedores debern ir cubiertos con un toldo y el extremo inferior del
conducto no tendr una altura superior a 2 m., para disminuir la formacin de
polvo.
Las herramientas elctricas cumplirn con las especificaciones contempladas en
este documento dentro del apartado de herramientas elctricas.
La iluminacin en la zona de trabajo ser siempre suficiente.
Se dispondr de extintores en obra.
Se dispondr de una bomba de achique cuando haya previsin de fuertes lluvias
o inundaciones.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con puntera reforzada.
Calzado de seguridad con suela aislante y anticlavos.
Gafas de seguridad antiimpactos.
Protectores auditivos.
Mascarillas antipolvo.
Guantes de cuero.
Ropa de trabajo adecuada.
Ropa de trabajo impermeable.
Ropa de trabajo reflectante.
Cinturn de seguridad y puntos de amarre.
Cinturones portaherramientas.
Fajas de proteccin dorsolumbar.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.2. Movimiento de Tierras


RIESGOS:
Referentes a maquinaria y vehculos: vuelcos, choques, golpes y cadas en el
ascenso o descenso de los mismos.
Atrapamientos y atropellos de personas con la maquinaria.
Desplomes de las paredes o taludes de la excavacin y edificios colindantes.
Fallo de las entibaciones.
Proyeccin de tierra y piedras.
Pisadas sobre materiales punzantes.
Golpes, atrapamientos y aplastamientos.
Afecciones cutneas
Proyeccin de partculas en los ojos.
Exposicin a ruido y vibraciones
Emisin de polvo: Inhalacin o molestias en los ojos.
Sobreesfuerzos.
Contactos elctricos.
Inundaciones o filtraciones de agua.
Incendios y explosiones.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
Se proceder a la localizacin de conducciones de gas, agua y electricidad,
previo al inicio del movimiento de tierras. El corte de suministro o desvo de las
conducciones se pondr en conocimiento de la empresa propietaria de la
misma.
Se realizar un estudio geotcnico que indique las caractersticas y resistencia del
terreno, as como la profundidad del nivel fretico.
Se sealizar la zona y cerrar el mbito de actuacin mediante vallas de 2 m de
altura como mnimo y una distancia mnima de 1,5m al borde superior del talud
de la excavacin.
Se sealar el acceso de la maquinaria y del personal a la obra, siendo estos
diferenciados.
Se sealizarn las zonas de circulacin en obra para vehculos y personas y las
zonas de acopio de materiales.
Se dispondrn rampas de acceso para camiones y vehculos cuyas pendientes
no sern superiores al 8% en tramos rectos y 12% en tramos curvos.
El acceso del personal al fondo de la excavacin se realizar mediante escaleras
de mano o rampas provistos de barandillas normalizadas. Queda prohibido
servirse del propio entramado, entibado o encofrado para el descenso o ascenso
de los trabajadores.
Se realizar un estudio previo del suelo para comprobar su estabilidad y calcular
el talud necesario dependiendo del terreno.
Los bordes superiores del talud, dependiendo de las caractersticas del terreno y
profundidad de la excavacin, se indicar la mnima distancia de acercamiento
al mismo para personas y vehculos.
Se evitarn los acopios pesados a distancias menores a 2m del borde del talud de
la excavacin.
Se dispondrn barandillas protectoras de 90cm de altura, con barra intermedia y
rodapis en el permetro de la excavacin, en el borde superior del talud y a 0,6m
del mismo.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Los bordes de huecos, escaleras y pasarelas estarn provistos de barandillas


normalizadas.
Los operarios no debern permanecer en planos inclinados con fuertes
pendientes.
Los operarios no debern permanecer en el radio de accin de mquinas o
vehculos en movimientos.
Los operarios no debern permanecer debajo de cargas suspendidas.
El ascenso o descenso de cargas se realizar lentamente, evitando movimientos
bruscos que provoquen su cada.
Las cargas no sern superiores a las indicadas.
La maquinaria a utilizar en la excavacin cumplir con las especificaciones
contempladas en este documento dentro del apartado de maquinaria.
La maquinaria dispondr de un sistema ptico-acstico para sealizar la
maniobra.
Las herramientas elctricas cumplirn con las especificaciones contempladas en
este documento dentro del apartado de herramientas elctricas.
Evitar la acumulacin de polvo, gases nocivos o falta de oxgeno.
La iluminacin en la zona de trabajo ser siempre suficiente.
Se dispondr de extintores en obra.
Se dispondr de una bomba de achique cuando haya previsin de fuertes lluvias
o inundaciones.
En caso de haber llovido, se respetarn especialmente las medidas de
prevencin debido al aumento de la peligrosidad de desplomes.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con suela antideslizante.
Calzado con puntera reforzada.
Botas de goma o PVC.
Protectores auditivos.
Guantes de cuero.
Ropa de trabajo adecuada.
Ropa de trabajo impermeable.
Ropa de trabajo reflectante.
Cinturn de seguridad y puntos de amarre.

5.3. Trabajos Previos


5.3.1. Instalacin Elctrica Provisional
RIESGOS:

Cadas a distinto nivel de personas u objetos.


Cadas a mismo nivel de personas u objetos.
Pisadas sobre materiales punzantes.
Proyeccin de partculas en los ojos.
Contactos elctricos.
Electrocucin.
Incendios.
Golpes y cortes con herramientas o materiales.
Sobreesfuerzos

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


El radio de influencia de las lneas de alta tensin se considera de 6 m. en lneas
areas y 2 m. en enterradas.
Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
El trazado de la lnea elctrica no coincidir con el trazado de suministro de
agua.
El trazado de la lnea elctrica no coincidir con el trazado de suministro de
agua.
Los cuadros elctricos se colocarn en lugares accesibles y protegidos, evitando
los bordes de forjados u otros lugares con peligro de cada.
El cuadro elctrico se colocarn en cajas fabricadas al efecto, protegidas de la
intemperie, con puerta, llave y visera. Las cajas sern aislantes.
En la puerta del cuadro elctrico se colocar el letrero: "Peligro elctrico".
Se utilizarn conducciones antihumedad y conexiones estancas para distribuir la
energa desde el cuadro principal a los secundarios.
Se utilizarn clavijas macho-hembra para conectar los cuadros elctricos con los
de alimentacin.
Cada cuadro elctrico general tendr una toma de tierra independiente.
Se proteger el punto de conexin de la pica o placa de tierra en la arqueta.
Se colocar un extintor de polvo seco cerca del cuadro elctrico.
Los cables a emplear sern aislantes y de calibre adecuado.
Se utilizarn tubos elctricos antihumedad para la distribucin de la corriente
desde el cuadro elctrico, que se deslizarn por huecos de escalera, patios,
patinillos... y estarn fijados a elementos fijos.
Los empalmes entre mangueras se realizarn en cajas habilitadas para ello.
Los hilos estarn recubiertos con fundas protectoras; prohibida la conexin de
hilos desnudos sin clavija en los enchufes.
Se evitarn tirones bruscos de los cables.
En caso de un tendido elctrico, el cableado tendr una altura mnima de 2 m.
en zonas de paso de personas y 5 m. para vehculos.
Los cables enterrados estarn protegidos con tubos rgidos, sealizados y a una
profundidad de 40 cm..
Los disyuntores diferenciales tendrn una sensibilidad de 300 mA. para alimentar a
la maquinaria y de 30 mA. para instalaciones de alumbrado no porttiles.
Las tomas de corriente se realizar con clavijas blindadas normalizadas.
Cada toma de corriente suministrar energa a un solo aparato o herramienta,
quedando prohibidas las conexiones triples ( ladrones ).
La tensin deber permanecer en la clavija hembra, no en la macho en las
tomas de corriente.
Todo elemento metlico de la instalacin elctrico estar conectado a tierra,
exceptuando aquellos que tengan doble aislamiento.
En gras y hormigoneras las tomas de tierra sern independientes.
En pequea maquinaria utilizaremos un hilo neutro para la toma de tierra. El hilo
estar protegido con un macarrn amarillo y verde.
La arqueta donde se produzca la conexin de la pica de tierra deber estar
protegida.
Los interruptores se colocarn en cajas normalizadas, blindadas y con
cortacircuitos fusibles.
Se instalarn interruptores en todas las lneas de toma de corriente de los cuadros
de distribucin y alimentacin a toda herramienta o aparato elctrico.
Los interruptores automticos protegern los circuitos principales, as como los
diferenciales las lneas y maquinaria.
Prohibido el empleo de fusibles caseros.
Toda la obra estar suficientemente iluminada.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Las luminarias se instalarn a una altura mnima de 2,5 m. y permanecern


cubiertas.
Se colocar un disyuntor diferencial de alta sensibilidad.
Se colocarn interruptores automticos magnetotrmicos.
Las lmparas porttiles estarn constituidas por mangos aislantes, rejilla
protectora de la bombilla con gancho, manguera antihumedad, y clavija de
conexin normalizada alimentada a 24 voltios.
Se evitar la existencia de lneas de alta tensin en la obra; Ante la imposibilidad
de desviarlas, se protegern con fundas aislantes y se realizar un
apantallamiento.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con suela aislante ante contactos elctricos.
Guantes de cuero.
Guantes dielctricos.
Banquetas aislantes de la electricidad.
Comprobadores de tensin.
Ropa de trabajo adecuada.
Ropa de trabajo impermeable.
Ropa de trabajo reflectante.
Fajas de proteccin dorsolumbar.

5.3.2. Instalacin Abastecimiento y Saneamiento Provisional


En los trabajos de instalacin de abastecimiento y saneamiento provisional para la
obra se realizan trabajos de similares caractersticas a los realizados en las fases de
"Red de Saneamiento" e "Instalacin de Fontanera", por tanto se consideran los
mismos Riesgos, Medidas de Prevencin y E.P.I.s que los que figuran en los apartados
correspondientes de este mismo Estudio.

5.3.3. Vallado de Obra


RIESGOS:
Afecciones cutneas.Incendios y explosiones.Proyeccin de sustancias en los
ojos.Quemaduras.Intoxicacin por ingesta.Intoxicacin por inhalacin de
vapores.
Afecciones cutneas.
Incendios y explosiones.
Proyeccin de sustancias en los ojos.
Quemaduras.
Intoxicacin por ingesta.
Intoxicacin por inhalacin de vapores.
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Los sustancias catalogadas como peligrosas, bien sean residuos o acopios de
material de construccin, debern almacenarse en un sitio especial que evite
que se mezclen entre s o con otras sustancias no peligrosas manteniendo la
distancia de seguridad entre sustancias que sean sinrgicas entre s o
incompatibles. As mismo, se dispondrn alejadas de trnsito de personas o
maquinaria, convenientemente sealizadas y en zonas de acceso restringido.Las

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

casetas que almacenen sustancias peligrosas dispondrn ventilacin e


iluminacin adecuadas, estarn cubiertas, cerradas con llave y se mantendrn
ordenadas. En caso de almacenar sustancias que puedan emitir vapores
inflamables, dispondrn de luminaria antideflagrante.Las sustancias sensibles a las
temperaturas, como las inflamables, se mantendrn en sitio aislado trmicamente
y protegido de fuentes de calor o fro.Los lugares de almacenaje de sustancias
lquidas peligrosas carecern de sumideros por los que puedan evacuarse
eventuales fugas o derrames.Las sustancias peligrosas se almacenarn en
envases adecuados, siempre cerrados y bien etiquetados con referencia expresa
a: identificacin de producto, composicin, datos responsable comercializacin,
pictograma que indique peligrosidad, frases R que describen los riesgos del
producto, frases S que aconsejan como manipular el producto e informacin
toxicolgica. El almacenaje se realizar lo ms prximo al suelo posible para
evitar cadas, se mantendrn con un stock mnimo y si fuera necesario contarn
con cubeta de retencin.En los puntos de almacenaje de sustancias peligrosas se
dispondr de arena u otro absorbente para caso de derrame.En los puntos de
almacenaje de sustancias peligrosas se dispondr de extintor qumico y de
CO2.Los trabajadores que manipulen sustancias peligrosas contarn con la
necesaria formacin e informacin.
Los sustancias catalogadas como peligrosas, bien sean residuos o acopios de
material de construccin, debern almacenarse en un sitio especial que evite
que se mezclen entre s o con otras sustancias no peligrosas manteniendo la
distancia de seguridad entre sustancias que sean sinrgicas entre s o
incompatibles. As mismo, se dispondrn alejadas de trnsito de personas o
maquinaria, convenientemente sealizadas y en zonas de acceso restringido.
Las casetas que almacenen sustancias peligrosas dispondrn ventilacin e
iluminacin adecuadas, estarn cubiertas, cerradas con llave y se mantendrn
ordenadas. En caso de almacenar sustancias que puedan emitir vapores
inflamables, dispondrn de luminaria antideflagrante.
Las sustancias sensibles a las temperaturas, como las inflamables, se mantendrn
en sitio aislado trmicamente y protegido de fuentes de calor o fro.
Los lugares de almacenaje de sustancias lquidas peligrosas carecern de
sumideros por los que puedan evacuarse eventuales fugas o derrames.
Las sustancias peligrosas se almacenarn en envases adecuados, siempre
cerrados y bien etiquetados con referencia expresa a: identificacin de
producto, composicin, datos responsable comercializacin, pictograma que
indique peligrosidad, frases R que describen los riesgos del producto, frases S que
aconsejan como manipular el producto e informacin toxicolgica. El
almacenaje se realizar lo ms prximo al suelo posible para evitar cadas, se
mantendrn con un stock mnimo y si fuera necesario contarn con cubeta de
retencin.
En los puntos de almacenaje de sustancias peligrosas se dispondr de arena u
otro absorbente para caso de derrame.
En los puntos de almacenaje de sustancias peligrosas se dispondr de extintor
qumico y de CO2.
Los trabajadores que manipulen sustancias peligrosas contarn con la necesaria
formacin e informacin.
EQUIPOS de PROTECCIN INDIVIDUAL:
Casco de seguridad.Calzado con suela antideslizante.Calzado con puntera
reforzada.Botas de goma o PVC.Guantes de goma o PVC.Ropa de trabajo
adecuada.Gafas de seguridad.Mascarilla de filtro recambiable.
Casco de seguridad.
Calzado con suela antideslizante.
Calzado con puntera reforzada.
Botas de goma o PVC.
Guantes de goma o PVC.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Ropa de trabajo adecuada.


Gafas de seguridad.
Mascarilla de filtro recambiable.
5.4. Cimentacin
RIESGOS:

Inundaciones o filtraciones de agua.


Cadas a distinto nivel de trabajadores.
Cadas a mismo nivel de trabajadores.
Golpes, choques y cortes con herramientas u otros materiales.
Referentes a maquinaria y vehculos: vuelcos, choques, golpes y cadas en el
ascenso o descenso de los mismos.
Atrapamientos y atropellos de personas con la maquinaria.
Atrapamientos por desplome de tierras.
Fallo de las entibaciones.
Proyeccin de tierra y piedras.
Hundimiento o rotura de encofrados.
Pisadas sobre materiales punzantes.
Dermatosis por contacto con el hormign o cemento.
Proyeccin de partculas en los ojos.
Exposicin al polvo, ruido y vibraciones.
Sobreesfuerzos.
Contactos elctricos.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Iluminacin suficiente en la zona de trabajo.
Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
La zona de actuacin deber permanecer ordenada, libre de obstculos y limpia
de residuos.
Se sealarn en obra y respetarn las zonas de circulacin de vehculos, personas
y el almacenamiento de acopios de materiales.
Se dispondrn barandillas rgidas y resistentes para sealizar pozos, zanjas, bordes
de excavacin, desniveles en el terreno y lados abiertos de plataformas con
alturas superiores a 2 m.
Se realizarn entibaciones cuando exista peligro de desprendimiento de tierras.
Se colocarn escaleras peldaeadas con sus correspondientes barandillas, para
el acceso al fondo de la excavacin.
El vertido del hormign se realizar por tongadas desde una altura adecuada.
Especial cuidado del vibrado del hormign en zonas hmedas.
Prohibido el atado de las armaduras en el interior de los pozos.
Prohibido el ascenso por las armaduras.
Los operarios no debern permanecer en el radio de accin de mquinas o
vehculos en movimientos.
Los operarios no debern permanecer debajo de cargas suspendidas.
El ascenso o descenso de cargas se realizar lentamente, evitando movimientos
bruscos que provoquen su cada.
Las cargas no sern superiores a las indicadas.
La maquinaria a utilizar en la excavacin cumplir con las especificaciones
contempladas en este documento dentro del apartado de maquinaria.
La maquinaria dispondr de un sistema ptico-acstico para sealizar la
maniobra.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Las herramientas elctricas cumplirn con las especificaciones contempladas en


este documento dentro del apartado de herramientas elctricas.
Retirar clavos y materiales punzantes.
Evitar la acumulacin de polvo, gases nocivos o falta de oxgeno.
Estudio para medir el nivel del ruido y del polvo al que se expondr el operario.
Prohibido trabajar con vientos superiores a 50 km/h.
Se dispondr de una bomba de achique cuando haya previsin de fuertes lluvias
o inundaciones.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con puntera reforzada.
Calzado de seguridad con suela aislante y anticlavos.
Botas de goma o PVC.
Protectores auditivos.
Mascarillas antipolvo.
Guantes de cuero.
Guantes aislantes.
Guantes de goma o PVC.
Ropa de trabajo adecuada.
Ropa de trabajo impermeable.
Cinturn de seguridad y puntos de amarre.
Fajas de proteccin dorsolumbar.
Mandil de cuero.

5.5. Red de Saneamiento


RIESGOS:
Inundaciones o filtraciones de agua.
Referentes a maquinaria y vehculos: vuelcos, choques, golpes y cadas en el
ascenso o descenso de los mismos.
Atrapamientos y atropellos de personas con la maquinaria.
Proyeccin de tierra, piedras, gotas de hormign.
Cadas a distinto nivel de personas u objetos.
Cadas a mismo nivel de personas u objetos.
Atrapamientos por desplomes de tierras de las paredes o taludes de la
excavacin y edificios colindantes.
Fallo de las entibaciones.
Vuelco del material de acopio.
Proyeccin de partculas en los ojos.
Golpes y cortes con herramientas u otros materiales.
Pisadas sobre materiales punzantes.
Sobreesfuerzos.
Infecciones.
Exposicin a ruido
Emisin de polvo: Inhalacin o molestias en los ojos.
Contactos elctricos.
Exposicin a vibraciones

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Iluminacin suficiente en la zona de trabajo.


Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
Se cuidar la influencia de la red de saneamiento sobre otras conducciones (
gas, electricidad...), el andamiaje y medios auxiliares.
Se realizarn entibaciones cuando exista peligro de desprendimiento de tierras.
Se utilizarn escaleras normalizadas sujetas firmemente para ascender y
descender a la excavacin de zanjas o pozos.
Ningn operario permanecer solo en el interior de una zanja mayor de 1,50 m.
sin que nadie en el exterior de la excavacin vigile permanentemente su
presencia.
El vertido del hormign se realizar por tongadas desde una altura adecuada
para que no se desprenda los laterales de la excavacin..
El acopio de los tubos se realizar a distancia suficiente de la zona de excavacin
de zanjas y pozos observando que no se compromete la estabilidad de los
mismos.
Las tuberas se acopiarn sobre superficies horizontales impidiendo el contacto
directo de las mismas con el terreno mediante la colocacin de cuas y topes
que adems evitarn el deslizamiento de los tubos.
Esta prohibido el uso de llamas para la deteccin de gas.
Prohibido fumar en interior de pozos y galeras.
Las herramientas elctricas cumplirn con las especificaciones contempladas en
este documento dentro del apartado de herramientas elctricas.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con puntera reforzada.
Botas de goma o PVC.
Guantes de cuero.
Guantes de goma o PVC.
Ropa de trabajo adecuada.
Ropa de trabajo ajustada e impermeable.
Cinturn de seguridad con dispositivo anticada.
Polainas y manguitos de soldador.

5.6. Estructuras
5.6.1. Hormign Armado
RIESGOS:
Referentes a maquinaria y vehculos: vuelcos, choques, golpes y cadas en el
ascenso o descenso de los mismos.
Atrapamientos y atropellos de personas con la maquinaria.
Desplomes de elementos
Atrapamientos y aplastamientos.
Vuelco del material de acopio.
Proyeccin de partculas en los ojos.
Cadas a mismo nivel de trabajadores.
Cadas a distinto nivel de personas.
Cadas de materiales de acopios, trabajos de encofrado y desencofrado,
apuntalamiento defectuoso, transporte de cargas por la gra...
Golpes y cortes con herramientas u otros materiales: transporte, acopios...

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Pisadas sobre materiales punzantes.


Sobreesfuerzos.
Exposicin a ruido y vibraciones
Emisin de polvo: Inhalacin o molestias en los ojos.
Dermatosis por contacto con el hormign.
Contactos elctricos.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


El edificio quedar perimetralmente protegido mediante barandillas.
Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
Los encofrados, las piezas prefabricadas pesadas o los soportes temporales y los
apuntalamientos slo se podrn montar o desmontar bajo vigilancia, control y
direccin del personal competente.
La zona de actuacin deber permanecer ordenada, libre de obstculos y limpia
de residuos.
Iluminacin suficiente en la zona de trabajo. Se colocarn puntos de luz de
emergencia donde se prevea escasez de luz.
Prohibido trabajar en caso de hielo, nieve, lluvia o vientos superiores a 50 km/h.
Cuando las temperaturas sean extremas, especialmente en las conocidas olas
de calor se podrn proponer horarios distintos que permitan evitar las horas de
mayor insolacin.
Se dispondr en las obras de cremas protectoras de factor suficiente contra las
inclemencias atmosfricas tales como la irradiacin solar.
Ante la existencia de lneas elctricas areas, se debern guardar las mnimas
distancias.
Prohibido colgar conducciones elctricas o focos de luz de armaduras.
Los materiales se acopiarn alejados de zonas de circulacin, de manera que no
provoquen sobrecargas en forjados, cadas o vuelcos.
El almacenamiento de cargas en forjados se realizar lo ms prximo a vigas o
muros de carga.
Para acceder al forjado de la planta baja desde el terreno, ante la imposibilidad
de acceder directamente, se colocarn pasarelas de 60 cm. de ancho, slidas y
con barandillas.
El acceso de una planta a otra se realizar mediante escaleras de mano con
zapatas antideslizantes, prohibiendo trepar por los encofrados.
El edificio quedar perimetralmente protegido mediante redes.
Los huecos interiores de forjados con peligro de cada ( patios, ascensores...),
quedarn protegidos con barandillas ( con listn intermedio y rodapi de 15 cm.
), redes horizontales o plataformas de trabajo regulables.
Los operarios no debern permanecer debajo de cargas suspendidas.
El ascenso o descenso de cargas se realizar por medios mecnicos, lentamente,
evitando movimientos bruscos que provoquen su cada.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con puntera reforzada.
Calzado de seguridad con suela aislante y anticlavos.
Botas de goma para el hormigonado y transitar por zonas inundadas.
Protectores auditivos.
Guantes de cuero.
Guantes gruesos aislantes para el vibrado del hormign.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Guantes de goma o PVC.


Ropa de trabajo ajustada, impermeable y reflectante.
Cinturn de seguridad y puntos de amarre.
Cinturones portaherramientas.
Fajas de proteccin dorsolumbar.

5.6.1.1. Encofrado
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Comprobacin del material de encofrado.
Se acopiarn de forma ordenada, alejados de zonas de circulacin, huecos,
terraplenes, sustancias inflamables ( si son de madera )...
El montaje del encofrado se realizar desde plataformas independientes con sus
correspondientes barandillas.
Se utilizarn castilletes independientes para el montaje de encofrados, evitando
el apoyo de escaleras sobre ellos.
Prohibida la permanencia o trnsito por encima de los encofrados, zonas
apuntaladas o con peligro de cada de objetos.
El operario estar unido a la viga mediante una cuerda atada a su cinturn, en
caso de que no existan pasarelas o plataformas para moverse horizontalmente.
Reparto uniforme de las cargas que soporta el puntal en la base del mismo.
Los encofrados metlicos se conectarn a tierra ante la posibilidad de contactos
elctricos.

5.6.1.2. Ferrallado
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
El acopio de armaduras se realizar en horizontal sobre durmientes con alturas
inferiores a 1,5 m..
Queda prohibido el transporte vertical de armaduras; Estas quedarn sujetas de 2
puntos mediante eslingas.
No se montar el zuncho perimetral de un forjado sin previa colocacin de la red.
El montaje se realizar desde plataformas independientes con sus
correspondientes barandillas, evitando pisar las armaduras de negativos o
mallazos de reparto.
Los mosquetones dispondrn de puntos fijos de amarre.
Los desperdicios metlicos se transportarn a vertedero, una vez concluidos los
trabajos de ferrallado.
Prohibido trabajar en caso de tormenta.
5.6.1.3. Hormigonado
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Se colocarn topes que impidan el acercamiento excesivo de los vehculos
encargados del vertido del hormign, a 2 metros del borde superior del talud.
Las hormigoneras estarn ubicadas en las zonas sealadas en el proyecto de
seguridad; Previamente, se revisarn los taludes.
Las hormigoneras dispondrn de un interruptor diferencial y toma de tierra. Se
desconectarn de la red elctrica para proceder a su limpieza.
El transporte de las bovedillas se realizar de forma paletizada y sujetas.
Comprobacin de encofrados para evitar derrames, reventones...

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

No golpear las castilletas, encofrados...


Evitar que el vibrador toque las paredes del encofrado durante la operacin de
vibrado.
No pisar directamente sobre las bovedillas.
Se colocarn pasarelas de 60 cm. de ancho y que abarquen el ancho de 3
viguetas de largo, para desplazamientos de los operarios.
El vertido del hormign se realizar por tongadas uniformes, con suavidad,
evitando los golpes bruscos sobre el encofrado.
Evitar contactos directos con el hormign.
5.6.1.4. Desencofrado
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
El desencofrado de la estructura se realizar una vez transcurridos los das
necesarios.
Comprobar que ningn operario permanezca o circule bajo la zona de
desencofrado.
Los elementos verticales se desencofrarn de arriba hacia abajo.
Controlar el desprendimiento de materiales mediante cuerdas y redes.
Barrido de la planta despus de terminar los trabajos de desencofrado.

5.7. Cubiertas
RIESGOS:
Cadas a distinto nivel de materiales y herramientas. Desprendimientos de cargas
suspendidas.
Cadas a distinto nivel de trabajadores por hundimiento de la superficie de apoyo,
constituido por materiales de baja resistencia.
Cadas a distinto nivel de trabajadores por bordes de cubierta o por deslizamiento
por los faldones.
Golpes y cortes con herramientas u otros materiales.
Sobreesfuerzos.
Pisadas sobre materiales punzantes.
Proyeccin de partculas en los ojos.
Atrapamientos y aplastamientos.
Dermatosis por contacto con el hormign y el cemento.
Exposicin a ruido y vibraciones
Contactos elctricos.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Se utilizarn tablas, barandillas o el mallazo del forjado para cerrar el hueco del
lucernario.
Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
La zona de actuacin deber permanecer ordenada, libre de obstculos y limpia
de residuos.
Los operarios no debern permanecer debajo de cargas suspendidas.
Iluminacin suficiente en la zona de trabajo. Se colocarn puntos de luz de
emergencia donde se prevea escasez de luz.
Prohibido trabajar en caso de hielo, nieve, lluvia o vientos superiores a 50 km/h.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cuando las temperaturas sean extremas, especialmente en las conocidas olas


de calor se podrn proponer horarios distintos que permitan evitar las horas de
mayor insolacin.
Se dispondr en las obras de cremas protectoras de factor suficiente contra las
inclemencias atmosfricas tales como la irradiacin solar.
El acopio de los materiales de cubierta se realizar alejado de las zonas de
circulacin y de los bordes de la cubierta.
El almacenamiento de cargas en cubierta se realizar lo ms prximo a vigas o
muros de carga.
El edificio quedar perimetralmente protegido mediante andamios modulares
arriostrados, con las siguientes dimensiones: la altura superior del andamiaje
estar a 1,2 m. del ltimo entablado, la distancia hasta el ltimo entablado bajo
cornisa ser inferior a 30 cm., la anchura a partir de la plomada ser superior a 60
cm., la altura de detencin inferior ser hasta la prolongacin de la lnea de
inclinacin de la cubierta.
Los huecos interiores de la cubierta estarn protegidos con barandillas, tablas,
redes o mallazos.
El acceso a la cubierta se realizar a travs de los huecos, con escaleras de
mano peldaeadas, sobre superficies horizontales y que sobresalgan 1m. de la
altura de la cubierta.
El ascenso o descenso de cargas se realizar por medios mecnicos, lentamente,
evitando movimientos bruscos que provoquen su cada.
Las herramientas elctricas cumplirn con las especificaciones contempladas en
este documento dentro del apartado de herramientas elctricas.
Se instalarn anclajes para amarrar cables o cinturones de seguridad en la
cumbrera.
Se realizar un reparto uniforme de las cargas mediante la colocacin de
pasarelas.
Las chapas y paneles sern manipuladas por 2 personas como mnimo.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con suela antideslizante.
Calzado con puntera reforzada.
Calzado de seguridad con suela aislante y anticlavos.
Gafas de seguridad antiimpactos.
Mascarillas antipolvo.
Guantes de cuero.
Guantes de goma o PVC.
Ropa de trabajo adecuada.
Ropa de trabajo impermeable.
Ropa de trabajo no inflamable.
Cinturn de seguridad y puntos de amarre.
Cinturones portaherramientas.
Cinturn de seguridad con dispositivo anticada.
Fajas de proteccin dorsolumbar.
Mandil de cuero.
Polainas y manguitos de soldador.

5.8. Cerramientos y Distribucin


RIESGOS:
Cadas a distinto nivel de personas u objetos.
Cadas a mismo nivel de personas.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Golpes y cortes con herramientas u otros materiales.


Atrapamientos y aplastamientos.
Desplomes de elementos
Vuelco del material de acopio.
Sobreesfuerzos.
Pisadas sobre materiales punzantes.
Afecciones cutneas por contacto con pastas, yeso, escayola, materiales
aislantes...
Dermatosis por contacto con hormign o cemento.
Proyeccin de partculas en los ojos.
Exposicin a ruido y vibraciones
Inhalacin de polvo y vapores txicos procedentes de pinturas o materiales
semejantes.
Contactos elctricos.
Golpes y atrapamientos durante el transporte de grandes cargas suspendidas.
Aplastamiento de manos y pies en el recibido de las cargas.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
La zona de actuacin deber permanecer ordenada, libre de obstculos y limpia
de residuos.
Iluminacin suficiente en la zona de trabajo. Se colocarn puntos de luz de
emergencia donde se prevea escasez de luz.
Sealizar y proteger mediante marquesinas los accesos a obra.
Se colocarn pasarelas de 60 cm. de ancho, slidas y con barandillas para
acceder al forjado de la planta baja desde el terreno, ante la imposibilidad de
acceder directamente.
Prohibido el acceso a toda planta no protegida en huecos y permetro.
El acceso a la planta de trabajo se realizar mediante escaleras peldaeadas
protegidas con barandillas de 90 cm., listn intermedio y rodapis.
El transporte de cargas se realizar por medios mecnicos, lentamente, evitando
movimientos bruscos.
Las cargas se transportarn paletizadas, enflejadas y sujetas.
Prohibido el uso del montacargas para el transporte de personas.
Para recibir la carga en planta, se retirar la barandilla durante el menor tiempo
posible y el operario permanecer unido del cinturn de seguridad al cable de
seguridad durante es recibido.
Los huecos de ascensor, escaleras o patios permanecern protegidas mediante
barandillas, redes, mallazos o tableros. Si el patio es de grandes dimensiones, se
colocarn redes cada 2 plantas.
Las aberturas perimetrales, los huecos de fachada ( balcones o descansillos ) y
puertas de ascensor se protegern mediante barandillas rgidas y resistentes.
Se colocarn cables de seguridad sujetos a pilares cercanos a fachada para
amarrar el mosquetn del cinturn de seguridad.
Prohibido trabajar en niveles superiores si provocan riesgos a los niveles inferiores,
o paramentos levantados en menos de 48 horas con incidencia de fuertes
vientos..
Se realizar la evacuacin de escombros y cascotes mediante tubos de vertido,
carretillas o bateas cerradas perimetralmente.
Queda prohibido el lanzamiento de escombros a travs de huecos de forjado o
fachada.
Se utilizarn herramientas o maquinaria elctrica para cortar las piezas, las cuales
debern permanecer hmedas. Se utilizarn mascarillas autofiltrantes, en su

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

defecto.
Estarn provistas de carcasa todas aquellas mquinas o herramientas capaces
de producir cortes o golpes.
Las herramientas elctricas cumplirn con las especificaciones contempladas en
este documento dentro del apartado de herramientas elctricas.
Se utilizarn lmparas porttiles con portalmparas estanco con mango aislante,
rejilla protectora de la bombilla con gancho de cuelgue, manguera
antihumedad y clavija de conexin normalizada estanca de seguridad y
alimentado a 24 voltios.
Se colocarn seales de peligro: Peligro de cada desde altura, Obligatorio utilizar
el cinturn de seguridad, Peligro, cargas suspendidas...
Los andamios se colocarn y utilizarn siguiendo las especificaciones
contempladas en este documento dentro del apartado de andamios y las
indicaciones del fabricante y la normativa correspondiente.
Prohibido saltar desde los andamios a la estructura y viceversa.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con puntera reforzada.
Calzado de seguridad con suela aislante y anticlavos.
Gafas de seguridad antiimpactos.
Protectores auditivos.
Mascarillas antipolvo para ambientes pulvgenos y equipos de respiracin
autnoma.
Guantes de cuero.
Guantes aislantes.
Guantes de PVC o goma para la manipulacin de aislamientos: Lana de vidrio,
fibra de vidrio, lana mineral o similares.
Ropa de trabajo adecuada.
Ropa de trabajo impermeable.
Cinturones portaherramientas.
Cinturn de seguridad con dispositivo anticada.
Fajas de proteccin dorsolumbar.

5.9. Acabados
RIESGOS:
Cadas a distinto nivel de personas u objetos.
Cadas a mismo nivel .
Golpes y cortes con herramientas u otros materiales.
Atrapamientos y aplastamientos.
Desplomes de elementos
Sobreesfuerzos.
Proyeccin de partculas en los ojos.
Pisadas sobre materiales punzantes.
Dermatosis por contacto con hormign o cemento.
Afecciones cutneas por contacto con pastas, yeso, escayola, materiales
aislantes...
Inhalacin de polvo y vapores txicos procedentes de pinturas o materiales
semejantes.
Exposicin a ruido y vibraciones
Contactos elctricos.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Los andamios se colocarn y utilizarn siguiendo las especificaciones
contempladas en este documento dentro del apartado de andamios y las
indicaciones del fabricante y la normativa correspondiente.
Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
La zona de actuacin deber permanecer ordenada, libre de obstculos y limpia
de residuos.
Los materiales se acopiarn sin invadir las zonas de circulacin ni producir
sobrecargas.
Prohibido el acceso a toda planta no protegida en huecos y permetro.
El transporte de cargas se realizar por medios mecnicos.
Prohibido el uso del montacargas para el transporte de personas.
Se realizar la evacuacin de escombros y cascotes mediante tubos de vertido,
carretillas o bateas cerradas perimetralmente.
Queda prohibido el lanzamiento de escombros a travs de huecos de forjado o
fachada.
Iluminacin mnima de 100 lux en la zona de trabajo. Se colocarn puntos de luz
de emergencia donde se prevea escasez de luz.
Se utilizarn lmparas porttiles con portalmparas estanco con mango aislante,
rejilla protectora de la bombilla con gancho de cuelgue, manguera
antihumedad y clavija de conexin normalizada estanca de seguridad y
alimentado a 24 voltios.
Las herramientas elctricas cumplirn con las especificaciones contempladas en
este documento dentro del apartado de herramientas elctricas.
Los huecos horizontales de ascensor, escaleras o patios permanecern protegidas
mediante barandillas, redes, mallazos o tableros.
Las aberturas perimetrales, los huecos de fachada ( balcones o descansillos ) y
puertas de ascensor se protegern mediante barandillas rgidas y resistentes.
Se colocarn cables de seguridad, menores a 2 mtrs de longitud, sujetos a
elementos estructurales slidos para amarrar el mosquetn del cinturn de
seguridad.
En caso de que sea necesario la retirada de la barandilla, se realizar durante el
menor tiempo posible y el operario permanecer unido del cinturn de seguridad
al cable de seguridad en todo momento.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con puntera reforzada.
Gafas de seguridad antiimpactos.
Mascarillas antipolvo para ambientes pulvgenos.
Guantes de cuero.
Ropa de trabajo adecuada.
Cinturn de seguridad y puntos de amarre.
Cinturones portaherramientas.
Fajas de proteccin dorsolumbar.

5.9.1. Pavimentos

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.9.1.1. Ptreos y Cermicos


RIESGOS:

Golpes y atrapamientos con piezas del pavimento.


Cortes producidos con aristas o bordes cortantes.
Afecciones reumticas por humedades en las rodillas.
Afecciones cutneas por contacto con cemento o mortero.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Las piezas del pavimento y sacos de aglomerante se transportarn a planta
mediante plataformas emplintadas y flejadas. Si se trata de piezas de grandes
dimensiones se transportarn en posicin vertical.
Se utilizarn herramientas o maquinaria elctrica para cortar las piezas, las cuales
debern permanecer hmedas. El operario se colocar a sotavento, en caso de
que el corte de piezas se realice por va seca con sierra circular.
Eliminar las rebabas que puedan ocasionar cortes en las manos o proyeccin en
los ojos.
No acceder a recintos en fase de pavimentacin o pulimentacin.
Las pulidoras y abrillantadoras estarn constituidas por doble aislamiento, manillar
aislante y arco de proteccin antiatrapamiento.
Desenchufar la mquina para la sustitucin de piezas o trabajos de
mantenimiento.

EQUIPOS de PROTECCIN INDIVIDUAL:


Guantes aislantes.
Rodilleras impermeables almohadilladas.

5.9.2. Paramentos
5.9.2.1. Alicatados
RIESGOS:
Pisadas sobre materiales punzantes.
Afecciones respiratorios como consecuencia de la manipulacin de disolventes y
pegamentos.
Dermatosis por contacto con pegamentos, cemento u otros productos.
Retroceso y proyeccin de las piezas cermicas.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Ser necesario el empleo de medios auxiliares de elevacin adecuados para
alicatar a alturas superiores a la del pecho del operario.
Se utilizarn herramientas o maquinaria elctrica para cortar las piezas, las cuales
debern permanecer hmedas. El operario se colocar a sotavento, en caso de
que el corte de piezas se realice por va seca con sierra circular.
La cortadora elctrica se colocar nivelada y provista de carcasa superior,
resguardo para los elementos de transmisin y aspiradores de polvo.
No se colocar la cortadora elctrica sobre suelos hmedos.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

La cortadora dispondr de un dispositivo que impida su puesta en marcha


cuando se produzca un corte en el suministro de energa elctrica.
Eliminar las rebabas que puedan ocasionar cortes en las manos o proyeccin en
los ojos.

EQUIPOS de PROTECCIN INDIVIDUAL:


Calzado con suela antideslizante y puntera reforzada.
Guantes de goma para el manejo de objetos cortantes.
Rodilleras almohadilladas impermeables.

5.9.2.2. Enfoscados
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Ser necesario el empleo de medios auxiliares de elevacin adecuados para
enfoscar a alturas superiores a la del pecho del operario.
Los sacos de ridos y aglomerantes se transportarn en carretillas manuales.
Las miras se transportarn al hombro con el extremo delantero a una altura
superior al casco de quien lo transporta, para evitar golpes a otras personas.

EQUIPOS de PROTECCIN INDIVIDUAL:


Guantes y botas de goma para la manipulacin de cal y realizar el enfoscado.
Muequeras.
5.9.2.3. Guarnecidos y Enlucidos
RIESGOS:
Afecciones cutneas.Incendios y explosiones.Proyeccin de sustancias en los
ojos.Quemaduras.Intoxicacin por ingesta.Intoxicacin por inhalacin de
vapores.
Afecciones cutneas.
Incendios y explosiones.
Proyeccin de sustancias en los ojos.
Quemaduras.
Intoxicacin por ingesta.
Intoxicacin por inhalacin de vapores.
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Los sustancias catalogadas como peligrosas, bien sean residuos o acopios de
material de construccin, debern almacenarse en un sitio especial que evite
que se mezclen entre s o con otras sustancias no peligrosas manteniendo la
distancia de seguridad entre sustancias que sean sinrgicas entre s o
incompatibles. As mismo, se dispondrn alejadas de trnsito de personas o
maquinaria, convenientemente sealizadas y en zonas de acceso restringido.Las
casetas que almacenen sustancias peligrosas dispondrn ventilacin e
iluminacin adecuadas, estarn cubiertas, cerradas con llave y se mantendrn
ordenadas. En caso de almacenar sustancias que puedan emitir vapores
inflamables, dispondrn de luminaria antideflagrante.Las sustancias sensibles a las
temperaturas, como las inflamables, se mantendrn en sitio aislado trmicamente
y protegido de fuentes de calor o fro.Los lugares de almacenaje de sustancias
lquidas peligrosas carecern de sumideros por los que puedan evacuarse

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

eventuales fugas o derrames.Las sustancias peligrosas se almacenarn en


envases adecuados, siempre cerrados y bien etiquetados con referencia expresa
a: identificacin de producto, composicin, datos responsable comercializacin,
pictograma que indique peligrosidad, frases R que describen los riesgos del
producto, frases S que aconsejan como manipular el producto e informacin
toxicolgica. El almacenaje se realizar lo ms prximo al suelo posible para
evitar cadas, se mantendrn con un stock mnimo y si fuera necesario contarn
con cubeta de retencin.En los puntos de almacenaje de sustancias peligrosas se
dispondr de arena u otro absorbente para caso de derrame.En los puntos de
almacenaje de sustancias peligrosas se dispondr de extintor qumico y de
CO2.Los trabajadores que manipulen sustancias peligrosas contarn con la
necesaria formacin e informacin.
Los sustancias catalogadas como peligrosas, bien sean residuos o acopios de
material de construccin, debern almacenarse en un sitio especial que evite
que se mezclen entre s o con otras sustancias no peligrosas manteniendo la
distancia de seguridad entre sustancias que sean sinrgicas entre s o
incompatibles. As mismo, se dispondrn alejadas de trnsito de personas o
maquinaria, convenientemente sealizadas y en zonas de acceso restringido.
Las casetas que almacenen sustancias peligrosas dispondrn ventilacin e
iluminacin adecuadas, estarn cubiertas, cerradas con llave y se mantendrn
ordenadas. En caso de almacenar sustancias que puedan emitir vapores
inflamables, dispondrn de luminaria antideflagrante.
Las sustancias sensibles a las temperaturas, como las inflamables, se mantendrn
en sitio aislado trmicamente y protegido de fuentes de calor o fro.
Los lugares de almacenaje de sustancias lquidas peligrosas carecern de
sumideros por los que puedan evacuarse eventuales fugas o derrames.
Las sustancias peligrosas se almacenarn en envases adecuados, siempre
cerrados y bien etiquetados con referencia expresa a: identificacin de
producto, composicin, datos responsable comercializacin, pictograma que
indique peligrosidad, frases R que describen los riesgos del producto, frases S que
aconsejan como manipular el producto e informacin toxicolgica. El
almacenaje se realizar lo ms prximo al suelo posible para evitar cadas, se
mantendrn con un stock mnimo y si fuera necesario contarn con cubeta de
retencin.
En los puntos de almacenaje de sustancias peligrosas se dispondr de arena u
otro absorbente para caso de derrame.
En los puntos de almacenaje de sustancias peligrosas se dispondr de extintor
qumico y de CO2.
Los trabajadores que manipulen sustancias peligrosas contarn con la necesaria
formacin e informacin.
EQUIPOS de PROTECCIN INDIVIDUAL:
Casco de seguridad.Calzado con suela antideslizante.Calzado con puntera
reforzada.Botas de goma o PVC.Guantes de goma o PVC.Ropa de trabajo
adecuada.Gafas de seguridad.Mascarilla de filtro recambiable.
Casco de seguridad.
Calzado con suela antideslizante.
Calzado con puntera reforzada.
Botas de goma o PVC.
Guantes de goma o PVC.
Ropa de trabajo adecuada.
Gafas de seguridad.
Mascarilla de filtro recambiable.
5.9.3. Pintura
RIESGOS:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Proyeccin de gotas de pintura o motas de pigmentos a presin en los ojos.


Afecciones cutneas por contacto con pinturas ( corrosiones y dermatosis ).
Intoxicaciones.
Pisadas sobre materiales punzantes.
Explosiones e incendios de materiales inflamables.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Prohibido fumar, comer o usar maquinaria que produzca chispas, en lugares
donde se manipulen pinturas que contengan disolventes orgnicos o pigmentos
txicos. La mezcla de aire y vapor del disolvente deber permanecer por debajo
de los lmites de explosin.
Las pinturas, disolventes y dems sustancias txicas o inflamables sern
almacenadas y manipuladas segn las indicaciones del fabricante; Se realizar
en lugares ventilados y alejados del sol y el fuego.
Las pinturas que contengan nitrocelulosa se almacenarn en lugares donde sea
posible realizar el volteo de los recipientes.
El vertido de pinturas, pigmentos, disolventes o similares se realizar desde la
menor altura posible, para evitar salpicaduras o nubes de polvo.
Las pistolas se utilizarn siguiendo las indicaciones del fabricante. En el caso de las
electrostticas, el elemento a pintar deber permanecer conectado a tierra.
Prohibido realizar trabajos de soldadura u oxicorte prximos a pinturas
inflamables.
Prohibido probar el funcionamiento de las instalaciones mientras los trabajos de
pintura de sealizacin.
Prohibida la conexin de maquinaria de carga accionados elctricamente,
mientras se realizan trabajos de pintura en carriles.
Prohibido el contacto del electrodo de la pistola con la piel.
Prohibida la pulverizacin sobre elementos puntiagudos.
Prohibido limpiar la pistola electrosttica sin parar el funcionamiento del
generador.
Prohibido el uso de mangueras del compresor agrietadas o desgastadas, que
puedan provocar un reventn. Para ello, se evitar su abandono sobre
escombros o zonas sucias.
Se dispondr de un extintor de polvo qumico seco en obra.
Seales de peligro: Peligro de cada desde altura , Obligatorio utilizar el
cinturn de seguridad , Peligro de incendio , Prohibido fumar ...
Queda prohibido pintar en el exterior con vientos superiores a 60 Km/h en lugares
con riesgo de cada de altura.

EQUIPOS de PROTECCIN INDIVIDUAL:


Calzado con suela antideslizante.
Mascarillas con filtro mecnico recambiable para ambientes pulvgenos.
Mascarillas con filtro qumico recambiable para ambientes txicos por disolventes
orgnicos.
Guantes de goma o PVC.
Guantes dielctricos.
Cinturn de seguridad o arneses de suspensin.
Muequeras.
5.9.4. Techos
RIESGOS:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Golpes con reglas, guas, lamas, piezas de escayola...


Cortes producidos por herramientas manuales: Llanas, paletinas...
Dermatosis por contacto con el yeso o escayola.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Los sacos y piezas de escayola se transportarn por medios mecnicos.
Las partes cortantes de las herramientas y maquinaria estarn protegidas
adecuadamente.
Las guas de falsos techos superiores a 3 m. sern transportadas por 2 operarios.

EQUIPOS de PROTECCIN INDIVIDUAL:


Guantes de cuero o PVC, dependiendo de la tarea a realizar.
5.10. Carpintera
RIESGOS:
Cadas a distinto nivel de personas u objetos: Desde andamios, por huecos de
forjado o fachada......
Cadas a mismo nivel de personas.
Golpes y cortes con herramientas u otros materiales.
Desplomes de elementos
Vuelco del material de acopio.
Atrapamientos y aplastamientos.
Sobreesfuerzos.
Pisadas sobre materiales punzantes.
Proyeccin de partculas en los ojos.
Exposicin a ruido y vibraciones
Emisin de polvo: Inhalacin o molestias en los ojos.
Contactos elctricos.
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Se utilizarn lmparas porttiles con portalmparas estanco con mango aislante,
rejilla protectora de la bombilla con gancho de cuelgue, manguera
antihumedad y clavija de conexin normalizada estanca de seguridad y
alimentado a 24 voltios.
Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
La zona de actuacin deber permanecer ordenada, libre de obstculos y limpia
de residuos.
Los huecos de fachada y forjado se protegern mediante barandillas de 90 cms.
de altura, con pasamanos, listn intermedio y rodapis.
Se instalarn puntos fijos donde amarrar el cinturn de seguridad.
Las cargas se transportarn por medios mecnicos, evitando movimientos
bruscos.
Estarn provistas de carcasa todas aquellas mquinas o herramientas capaces
de producir cortes o golpes.
Las herramientas elctricas cumplirn con las especificaciones contempladas en
este documento dentro del apartado de herramientas elctricas.

EQUIPOS de PROTECCIN INDIVIDUAL:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Casco de seguridad.
Calzado con puntera reforzada.
Calzado de seguridad con suela aislante y anticlavos.
Gafas antiproyeccin.
Protectores auditivos.
Mascarillas antipolvo para ambientes pulvgenos.
Equipos de filtracin qumica frente a gases y vapores.
Guantes de cuero para el manejo de materiales.
Guantes de goma o PVC.
Ropa de trabajo adecuada.
Fajas antilumbago.
Cinturn de seguridad y dispositivos anticada en lugares de trabajo con peligro
de cada de altura.
Cinturn portaherramientas.
Tapones.

5.10.1. Madera
RIESGOS:
Toxicidad de materiales empleados en tratamentos realizados a la madera u
otros materiales empleados.
Atrapamientos de manos y pies durante el transporte y colocacin de los
elementos de madera.
Afecciones cutneas.
Polvo ambiental.
Contactos elctricos.
Incendios de los materiales acopiados.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Los elementos de madera se izarn en paquetes perfectamente flejados y sujetos,
mediante gra torre o montacargas.
Los paquetes de lamas sern transportados al hombro por al menos por 2
operarios.
Las colas y barnices se almacenarn en lugares con ventilacin directa y
constante.
Se requiere un mnimo de 2 operarios para el cuelgue de hojas de puertas.
Las operaciones de acuchillado, lijado y pulido se realizarn en lugares ventilados
El serrn y los recortes de madera sern evacuados por los tubos de vertido.
La maquinaria dispondr de aspiracin localizada y sacos de recogida de polvo.
Iluminacin mnima de 100 lux.
Seales: Peligro de incendios y Prohibido fumar .

5.10.2. Metlica
RIESGOS:

Inhalacin de humos y vapores metlicos.


Proyeccin de partculas.
Quemaduras.
Radiaciones del arco voltaico.
Contactos elctricos con herramientas elctricas o durante las operaciones de
soldadura.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Incendios y explosiones.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


En los trabajos de soldadura se atendr a lo dispuesto en el apartado
correspondiente de este mismo documento.
La carpintera metlica se izar en paquetes perfectamente flejados y sujetos,
mediante eslingas.
Los elementos longitudinales se transportarn al hombro, con el extremo
delantero a una altura superior al casco de quien lo transporta, para evitar golpes
a otras personas.
Los elementos metlicos inseguros permanecern apuntalados hasta conseguir
una perfecta consolidacin del recibido.

EQUIPOS de PROTECCIN INDIVIDUAL:

Gafas protectoras ante la radiacin.


Guantes dielctricos.
Pantalla soldador.
Mandil de cuero.
Polainas y manguitos de soldador.
Yelmo de soldador de manos libres.
Mascarillas de proteccin frente a humos y vapores metlicos.

5.10.3. Montaje del vidrio


RIESGOS:
Cortes durante el transporte y colocacin del vidrio.
Proyeccin de pequeas partculas de vidrio u otros cuerpos extraos en los ojos.
Ambientes txicos e irritantes.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


El vidrio se acopiar en las plantas sobre durmientes de madera y en posicin
vertical ligeramente inclinado. Se colocar de manera inmediata para evitar
posibles accidentes.
Se utilizar pintura de cal para marcar los vidrios instalados y demostrar su
existencia.
Los vidrios se transportarn en posicin vertical. Si se trata de grandes
dimensiones, se utilizarn ventosas y ser precisa la ayuda de otro operario.
Los operarios no debern permanecer debajo de aquellos tajos donde se est
instalando vidrio.
Prohibido trabajar con el vidrio a temperaturas inferiores a 0C y vientos superiores
a 60 Km/h.

EQUIPOS de PROTECCIN INDIVIDUAL:

Calzado con puntera reforzada.


Gafas antiproyeccin.
Guantes de cuero.
Ropa de trabajo adecuada.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

5.11. Instalaciones
RIESGOS:
Cadas a mismo nivel de personas u objetos.
Cadas a distinto nivel de personas u objetos.
Intoxicacin por vapores procedentes de la soldadura.
Cortes, golpes y pinchazos con herramientas o materiales.
Atrapamientos y aplastamientos.
Sobreesfuerzos.
Pisadas sobre materiales punzantes.
Proyeccin de partculas en los ojos.
Exposicin a ruido y vibraciones
Contactos elctricos.
Incendios y explosiones.
Inundaciones o filtraciones de agua.
En trabajos de soldadura, quemaduras y lesiones oculares por proyecciones de
metal, quemaduras con la llama del soplete.
Cefleas y conjuntivitis agudas a causa de las radiaciones de la soldadura.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


En los trabajos de soldadura se atendr a lo dispuesto en el apartado
correspondiente de este mismo documento.
Se utilizarn lmparas porttiles con portalmparas estanco con mango aislante,
rejilla protectora de la bombilla con gancho de cuelgue, manguera
antihumedad y clavija de conexin normalizada estanca de seguridad y
alimentado a 24 voltios.
Durante la ejecucin de esta fase los RECURSOS PREVENTIVOS tendrn presencia
permanente en obra ya que concurren alguno de los supuestos por los que el
Real Decreto 604/2006 exige su presencia.
La zona de actuacin deber permanecer ordenada, libre de obstculos y limpia
de residuos.
El material de la instalacin se acopiar en los lugares sealados en los planos.
Las herramientas elctricas cumplirn con las especificaciones contempladas en
este documento dentro del apartado de herramientas elctricas.

EQUIPOS de PROTECCIN INDIVIDUAL:

Guantes aislantes.
Ropa de trabajo adecuada.
Fajas antilumbago.
Cinturn de seguridad anticada.
Casco de seguridad.

5.11.1. Electricidad
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
La instalacin elctrica ser realizada por tcnicos especialistas, haciendo uso del
REBT.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cortar el suministro de energa por el interruptor principal, que se colocar en un


lugar visible y conocido por los operarios, ante cualquier operacin que se realice
en la red.
La conexin del cuadro general con la lnea suministradora ser el ltimo
cableado de la instalacin.
Inspeccionar las conexiones de mecanismos, protecciones y empalmes de los
cuadros generales elctricos, antes de la entrada en carga de la instalacin.
Se utilizarn clavijas macho-hembra para el conexionado de los cables al cuadro
de suministro.
Se colocarn planos de distribucin sobre los cuadros elctricos.
Las plataformas y herramientas estarn protegidas con material aislante.
Proteccin adecuada de los huecos, antes de la instalacin de andamios de
borriquetas o escaleras de mano, para la realizacin del cableado y conexin de
la instalacin elctrica.
Iluminacin mnima de 200 lux en la zona de trabajo.

EQUIPOS de PROTECCIN INDIVIDUAL:


Calzado con suela aislante ante contactos elctricos.
Guantes aislantes.
Comprobadores de temperatura.
5.11.2. Fontanera, Calefaccin y Saneamiento
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Los aparatos sanitarios y radiadores se izarn por medios mecnicos, en paquetes
flejados y sujetos.
Ningn operario deber permanecer debajo de cargas suspendidas.
Se requerir un mnimo de 3 operarios para la ubicacin de los aparatos
sanitarios.
En caso de que sea necesario la retirada de la barandilla para el aplomado de
los conductos verticales, se realizar durante el menor tiempo posible y el
operario permanecer unido del cinturn de seguridad al cable de seguridad en
todo momento.
Los petos o barandillas definitivas se levantarn para poder realizar la instalacin
de fontanera en balcones, terrazas o la instalacin de conductos, depsitos de
expansin, calderines o similares en la cubierta, y as disminuir los riesgo de cada
de altura.
Se colocarn tablas o tablones sobre los cruces de conductos que obstaculicen
la circulacin y aumenten el riesgo de cada.
No se podr hacer masa en lugares donde se estn realizando trabajos con
soldadura elctrica.
Iluminacin mnima de 200 lux en la zona de trabajo.

EQUIPOS de PROTECCIN INDIVIDUAL:

Calzado con puntera reforzada.


Guantes de cuero.
Guantes de PVC o goma.
Gafas antiproyeccin y antiimpacto.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

6. Medios Auxiliares
6.1. Andamios
RIESGOS:

Cada de personas u objetos a distinto nivel.


Cadas o atrapamientos por desplome o derrumbamiento del andamio.
Golpes, cortes o choques con herramientas u objetos.
Atrapamiento de pies y dedos.
Contactos elctricos.
Sobreesfuerzos.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Durante el montaje, desmontaje y uso de este medio auxiliar los RECURSOS
PREVENTIVOS tendrn presencia permanente en obra ya que concurren alguno
de los supuestos por los que el Real Decreto 604/2006 exige su presencia.
Todo andamio deber cumplir las condiciones generales respecto a materiales,
estabilidad, resistencia, seguridad en el trabajo y seguridad general, y las
particulares referentes a la clase a la que el andamio corresponda, especificadas
en el Real Decreto 1215/1997, de 18 de julio, modificado por el Real Decreto
2177/2004, de 12 de noviembre, por lo que respecta a su utilizacin y a lo
expuesto en el Convenio General del Sector de la Construccin.
Los andamios se montarn y desmontarn, siguiendo las instrucciones del
fabricante.
Los andamios y sus alrededores debern permanecer ordenados, libres de
obstculos y limpios de residuos.
Los andamios debern proyectarse, montarse y mantenerse, de manera que se
evite el desplome o el desplazamiento.
Las plataformas de trabajo, las pasarelas y las escaleras de andamios debern
construirse, dimensionarse, protegerse y utilizarse de forma que se evite que las
personas caigan o estn expuestas a cadas de objetos y se ajusten al nmero de
trabajadores que vayan a utilizarlos.
Los apoyos del andamio dispondrn de medidas contra el deslizamiento, y la
superficie portante tendr capacidad para garantizar la estabilidad del andamio.
Las dimensiones, forma y disposicin de las plataformas de un andamio sern
apropiadas al trabajo, cargas y permitir la circulacin con seguridad.

Los elementos que formen las plataformas no se desplazarn. No existirn vacos


en las plataformas ni entre estas y los dispositivos verticales de proteccin
colectiva contra cadas.
Cuando un andamio no este listo para su utilizacin, contar con seales de
advertencia de peligro ( Real Decreto 485/1997) y se delimitar mediante
elementos que impidan el acceso.
El andamio contar con una nota de clculo de resistencia y estabilidad y un
plan de montaje, de utilizacin y de desmontaje del andamio, en los casos en
que se establece en el R.D. 2177/2004. Los andamios tubulares que no hayan
obtenido una certificacin del producto por una entidad reconocida de
normalizacin, slo podrn utilizarse para aquellos supuestos en los que el Real
Decreto 2177/2004, en su Anexo II apartado 4.3, no exige plan de montaje, esto es
para alturas no superiores a 6 metros y que adems no superen los 8 metros de
distancia entre apoyos, y siempre que no estn situados sobre azoteas, cpulas,
tejados o balconadas a ms de 24 metros desde el nivel del suelo.
No ser obligatorio el plan cuando los andamios dispongan del marcado "CE", se

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

seguirn las instrucciones del fabricante


Los andamios slo podrn ser montados, desmontados o modificados
sustancialmente bajo la direccin de una persona cualificada segn el R.D.
2177/2004.
Los andamios debern ser inspeccionados por persona cualificada, antes de su
puesta en servicio, peridicamente y tras cualquier modificacin, perodo de no
utilizacin, exposicin a la intemperie, sacudidas ssmicas, o circunstancias que
hubiera podido afectar su resistencia o estabilidad.
Cuando el acceso al andamio o la ejecucin de una tarea particular exija la
retirada temporal de un dispositivo de proteccin colectiva contra cadas,
debern preverse medidas compensatorias y eficaces de seguridad, que
contarn con la aprobacin previa del coordinador de seguridad.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con suela antideslizante.
Calzado con puntera reforzada.
Calzado con suela aislante ante contactos elctricos.
Calzado de seguridad con suela aislante y anticlavos.
Guantes dielctricos.
Guantes de cuero u otros resistentes a la abrasin, desgarros, cortes...
Cinturn portaherramientas.
Cinturn de seguridad, tipo arns, con dispositivo anticada.
Faja de proteccin dorsolumbar.
Ropa de trabajo adecuada.

6.1.1. Andamio de Borriquetas


MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Los andamios se apoyarn sobre superficies firmes, estables y niveladas.
Aquellos andamios de borriquetas superior a dos metros de altura, estarn
provistos de barandilla resistentes de 90 cm., pasamanos, listn intermedio y
rodapi.
Tres metros, es la mxima altura para andamios de borriquetas.
Las borriquetas metlicas dispondrn de una cadenilla limitadora de la apertura
mxima.
Las borriquetas de madera debern estar en perfectas condiciones, sin
deformaciones ni roturas...
Se utilizar un mnimo de 2 borriquetas para la formacin de andamios,
quedando totalmente prohibido el uso de bidones, bovedillas, pilas de
materiales...como sustitucin a ellos.
La separacin entre borriquetas depender de las cargas y el espesor de los
tablones. Cuando sea superior a 3,5 m., se colocar otro caballete intermedio.
Prohibida la colocacin de las borriquetas sobre cables elctricos,
aprisionndolos, de tal manera que aumente el riesgo de contactos elctricos.
Las plataformas de trabajo , tendrn una anchura mnima de 60 u 80 cm. y
espesor o estructura suficiente en funcin de los trabajadores y elementos que
vayan a sustentar, segun el calculo de resisitencia y estabilidad realizado.
Las tablas que conformen la plataforma, no tendrn nudos, ni deformaciones y
estarn sin pintar.
Las plataformas, estarn ancladas a las borriquetas.
Cuando se realicen trabajos en bordes de forjados, balcones, se anclarn los
andamios al suelo y techo, se colocarn barandillas ( de 90 cm., pasamanos,

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

listn intermedio y rodapi ), puntos fuertes donde amarrar el cinturn de


seguridad y redes verticales de seguridad ante la cada de personas u objetos a
la va pblica.
Prohibido instalar un andamio encima de otro.

6.1.2. Andamio Tubular


MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Los andamios se colocarn apoyados sobre superficies firmes, estables y
niveladas, a una distancia mxima de 30 cm. del paramento.
Los andamios permanecern arriostrados a la estructura para garantizar su
estabilidad.
No se montar un nivel superior sin haber terminado el inferior.
Los elementos del andamio se izarn con medios mecnicos mediante eslingas.
Se colocar una diagonal horizontal en el mdulo base y otra cada 5 m..
Prohibido instalar andamios a distancias inferiores a 5 m. de lneas elctricas
areas.
Las plataformas de trabajo, tendrn una anchura mnima de 60 cm. y espesor o
estructura suficiente en funcin de los trabajadores y elementos que vayan a
sustentar, segun el calculo de resisitencia y estabilidad realizado.
La altura libre entre plataformas ser de 1,90 metros como mnimo.
En plataformas metlicas, estarn formadas por planchas de acero estriado.
El andamio se proteger perimetralmente con barandilla rgida y resistente a 90
cm. de altura, pasamanos, listn intermedio de 45 cm. y rodapi de 15 cm. en
todos los lados de su contorno, con excepcin de los lados que disten de la
fachada menos de 20 centmetros.
Los huecos y aperturas para ascender o descender del andamio, se protegern
mediante barandillas y tapas.
La va pblica ser protegida ante la cada de objetos, mediante redes,
marquesinas o similares.
El andamio se proteger de impactos de vehculos, mediante vallas y
sealizacin de la zona la afectada.
El acceso a las plataformas de los andamios deber realizarse normalmente a
travs de mdulos de escaleras de servicio adosadas a los laterales, o bien
estando las escaleras integradas en el propio andamio, o desde otras plataformas
seguras de la obra. En ningn caso est permitido trepar por los travesaos de la
estructura del andamio.
El operario dispondr de cinturn de seguridad con arns amarrado a un punto
fuerte, para realizar trabajos fuera de las plataformas del andamio. Los puntos
fuertes se colocarn cada 20 m2.
Trabajar en plataformas inferiores a otras que se est trabajando, si no se han
tomado las medidas de proteccin adecuadas.
El desmontaje del andamio se realizar con cinturn de seguridad amarrado a un
punto fuerte de seguridad, en sentido descendente.
Los elementos deformados o deteriorados del andamio sern sustituidos.

6.2. Escaleras de Mano


RIESGOS:
Cada de personas u objetos a distinto nivel.
Contactos elctricos, en caso de las metlicas.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Se revisar el estado de conservacin y formas de uso de las escaleras
peridicamente. Se prohbe la utilizacin de escaleras de madera pintadas, por la
dificultad que ello supone para la deteccin de sus posibles defectos.
Durante el uso de este medio auxiliar los RECURSOS PREVENTIVOS tendrn
presencia permanente en obra ya que concurren alguno de los supuestos por los
que el Real Decreto 604/2006 exige su presencia.
La utilizacin de escaleras de mano como puesto de trabajo en altura quedar
limitada a aquellos casos en que la utilizacin de otros equipos ms seguros no
est justificada por el bajo nivel de riesgo y por las caractersticas del
emplazamiento que el empresario no pueda modificar.
Las escaleras dispondrn de zapatas antideslizante, o elementos de fijacin en la
parte superior o inferior de los largueros, que impidan su desplazamiento.
Las escaleras se transportarn con el extremo delantero elevado, para evitar
golpes a otras personas u objetos. Si la longitud es excesiva, ser transportada por
2 operarios.
Las escaleras se apoyarn sobre superficies horizontales, con dimensiones
adecuadas, estables, resistentes e inmviles, quedando prohibido el uso de
ladrillos, bovedillas o similares con este fin. Los travesaos quedarn en posicin
horizontal.
La inclinacin de la escalera ser inferior al 75 % con el plano horizontal. La
distancia del apoyo inferior al paramento vertical ser l/4, siendo l la distancia
entre apoyos.
El extremo superior de la escalera sobresaldr 1 m. del apoyo superior, medido en
el plano vertical.
El operario se colocar en posicin frontal, es decir, mirando hacia los peldaos,
para realizar el ascenso y descenso por la escalera, agarrndose con las 2 manos
en los peldaos, y no en los largueros.
Los operarios utilizarn las escaleras, de uno en uno, evitando el ascenso o
descenso de la escalera por 2 o ms personas a la vez.
Los trabajos que requieran el uso de las 2 manos o transmitan vibraciones, no
podrn ser realizados desde la escalera.
Ser obligatorio el uso del cinturn de seguridad con dispositivo anticada para
trabajar sobre la escalera en alturas superiores a 3,5 m..
No colocar escaleras aprisionando cables o apoyados sobre cuadros elctricos.
Las puertas estarn abiertas cuando se coloquen escaleras cerca de estas o en
pasillos.
Las escaleras suspendidas, se fijarn de manera que no puedan desplazarse y se
eviten movimientos de balanceo.
Escaleras compuestas de varios elementos adaptables o extensibles se utilizarn
de forma que la inmovilizacin reciproca de los elementos est asegurada
Los trabajos que requieran movimientos o esfuerzoa peligrosos, solo se podrn
realizar desde una escalera, si se utiliza un equipo de proteccin individual
anticaidas.
Prohibido el uso de escaleras de construccin improvisada o cuya resistencia no
ofrezca garantas. No se emplearn escaleras de madera pintadas.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Casco de seguridad dielctrico.
Calzado antideslizante.
Calzado con puntera reforzada.
Calzado con suela aislante ante contactos elctricos.
Calzado de seguridad con suela aislante y anticlavos.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cinturn de seguridad amarrado a un punto fijo, independiente a la escalera.


Cinturn portaherramientas.
Guantes aislantes ante contactos elctricos.
Guantes de cuero u otros resistentes a la abrasin, desgarros, cortes...
Ropa de trabajo adecuada.

6.2.1. Escaleras Metlicas

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Los largueros de la escalera sern de una sola pieza, sin deformaciones, golpes o
abolladuras. Se utilizarn elementos prefabricados para realizar los empalmes de
escaleras, evitando las uniones soldadas entre elementos.
Los peldaos tendrn el mismo espacio entre ellos, evitando elementos flojos,
rotos o peldaos sustituidos por barras o cuerdas.
Prohibido el uso de escaleras metlicas para realizar trabajos de instalacin
elctrica o en zonas prximas a instalaciones elctricas.

6.3. Puntales
RIESGOS:
Cada de puntales u otros elementos sobre personas durante el transporte, por
instalacin inadecuada de los puntales, rotura del puntal...
Golpes, cortes o choques con herramientas u objetos.
Atrapamiento de pies y dedos.
Sobreesfuerzos.
Contactos elctricos.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Se prohbe la retirada de puntales o correccin de la disposicin de los mismos,
una vez han entrado en carga, sin que haya transcurrido el periodo suficiente
para el desapuntalamiento.
El acopio de puntales se realizar en una superficie sensiblemente horizontal,
sobre durmientes de madera nivelados, por capas horizontales que se dispondrn
perpendiculares a la capa inferior sobre la que se asientan. En caso de acopios
con alturas que comprometan la estabilidad de los mismos, se dispondrn pies
derechos que limiten el desmoronamiento del acopio.
Los puntales se encontrarn acopiados siempre que no estn siendo utilizados en
labores concretas, evitando que queden dispersos por la obra especialmente en
posicin vertical apoyados en paramentos o similar.
El transporte de los puntales se realizar por medios mecnicos, en paquetes
flejados, asegurando que no se producir el deslizamiento de ningn elemento
durante el transporte.
Se prohbe el transporte de ms de dos puntales a hombro de ningn operario
Los puntales telescopicos, se transportarn con los mecanismos de extensin
bloqueados.
Los puntales se clavarn al durmiente y a la sopanda en el momento en que sean
colocados.
Los puntales apoyarn toda la cabeza de los mismos a la cara del tabln. En
caso de puntales que se han de disponer inclinados respecto a la carga, se
acuarn perfectamente, de manera que la cabeza apoye totalmente.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Los puntales tendrn la dimensin suficiente para cubrir el trabajo a realizar,


quedando totalmente prohibido el apoyo de estos sobre cualquier material o
elemento de obra para alcanzar la altura necesaria.
Se prohben las sobrecargas puntuales de los puntales.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con suela antideslizante.
Calzado con puntera reforzada.
Calzado de seguridad con suela aislante y anticlavos.
Guantes de cuero u otros resistentes a la abrasin, desgarros, cortes...
Faja de proteccin dorsolumbar.
Ropa de trabajo adecuada.

7. Autoproteccin y emergencia
De acuerdo con las obligaciones establecidas en la Ley 31/1995 de Prevencin de
Riesgos Laborales el contratista deber adoptar las medidas necesarias en materia
de primeros auxilios, lucha contra incendios y evacuacin de los trabajadores,
designando para ello al personal encargado de poner en prctica estas medidas y
comprobando peridicamente su correcto funcionamiento. El citado personal
deber poseer la formacin necesaria, ser suficiente en nmero y disponer del
material adecuado.

7.1. Evacuacin
En todo momento estar presente en obra un responsable de emergencias que
ser encargado de dar la alarma, asegurarse de la correcta evacuacin de la
obra para lo que tendr conocimiento del personal presente en obra, dar aviso a
los servicios de emergencia y prestar en su caso los primeros auxilios a los heridos.
Tambin asumir la revisin peridica de las vas de evacuacin asegurando que
se mantengan expditas. Dicho responsable contar con formacin suficiente en
primeros auxilios e instruccin en emergencias.
Existir en obra un punto de reunin al que acudirn todos los trabajadores en
caso de emergencia. Dicho punto quedar suficientemente sealizado y ser
conocido por todos los trabajadores.
En lugar destacado de la obra se dispondr sealizacin en que se indiquen las
medidas que han de adoptar los trabajadores en caso de emergencia
Las vas de evacuacin y salidas de emergencia debern permanecer expditas,
debidamente sealizadas y desembocarn en sitio seguro, siendo el responsable
de emergencias responsable de su estado.
7.2. Proteccin contra incendios
La obra dispondr de tomas de agua con mangueras para la extincin de
pequeos conatos de incendio en la obra. Tendrn fcil y rpido acceso a una
de estas tomas la zona de acopios, de almacenaje residuos, los locales de obra y
en las proximidades de los trabajos con especial riesgo de incendios segn lo
especificado en la identificacin de riesgos de este mismo documento.
Queda expresamente prohibido la realizacin de hogueras en la obra cualquiera
que sea su fin.
En los puntos de trabajo con riesgo de incendios se instalarn extintores porttiles

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

con agente extintor acorde con el tipo de fuego previsible. En la especificacin


de medidas preventivas de este mismo documento se sealan las circunstancias
que requieren de extintor.
En los locales o entornos de trabajo en que existan productos inflamables
quedar prohibido fumar. Para evitarlo se instalarn carteles de advertencia en
los accesos.
Se dispondrn extintores de polvo qumico en cada una de las casetas de obra y
prximo a las zonas de acopio. Tambin se contar con un extintor de CO2 en la
proximidad del cuadro elctrico de obra.
7.3. Primeros auxilios
En lugar visible de la obra se dispondr el cartel con los telfonos de urgencias.
El centro sanitario ms prximo a la obra al que se evacuarn los heridos es:
Hospital Comarcal de la Serrana de RondaSustituya por el NOMBRE DEL CENTRO DE
SALUD
La evacuacin de heridos a los centros sanitarios se realizar exclusivamente en
ambulancia y ser llevado a cabo por personal especializado. Tan slo heridos
leves podrn trasladarse por otros medios siempre que as lo disponga el
responsable de emergencias de la obra.
La obra dispondr de un botiqun porttil debidamente equipado para la
realizacin de los primeros auxilios que contenga como mnimo desinfectantes y
antispticos autorizados, gasas estriles, algodn hidrfilo, venda, esparadrapo,
apsitos adhesivos, tijeras, pinzas y guantes desechables.
El material de primeros auxilios se revisar peridicamente por el responsable de
emergencias y se ir reponiendo tan pronto como caduque o sea utilizado.
8. Maquinaria
En este punto se detalla memoria descriptiva de la maquinaria prevista durante la
ejecucin de la obra, sealando para cada una de ellas los riesgos no eliminables
totalmente y las medidas preventivas y protecciones tcnicas tendentes a controlar
y reducir dichos riesgos.
Dispondrn de marcado CE, declaracin CE de conformidad y manual de
instrucciones. Aquella maquinaria que por su fecha de comercializacin o de
puesta en servicio por primera vez no les sea de aplicacin el marcado CE,
debern someterse a la puesta en conformidad de acuerdo con lo establecido
en el R.D. 1215/1997.
La maquinaria puesta en servicio al amparo de lo dispuesto en el R.D.1644/2008
que establece las normas para la comercializacin y puesta en servicio de las
mquinas cumplir con los requisitos de seguridad establecidos en su anexo I.
8.1. Empuje y Carga
RIESGOS:
Cada de personas a distinto nivel al ascender o descender de la mquina.
Vuelcos, deslizamientos... de la maquinaria.
Atrapamientos de personas por desplome de taludes o vuelco de maquinaria por
pendiente excesiva.
Choques contra objetos u otras mquinas.
Atropellos de personas con la maquinaria.
Proyeccin de tierra y piedras.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Polvo, ruido y vibraciones.


Contactos con infraestructura urbana: red de saneamiento, suministro de agua,
conductos de gas o electricidad.
Quemaduras.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Mientras trabajen en obra maquinaria de empuje y carga los RECURSOS
PREVENTIVOS tendrn presencia permanente en obra ya que concurren alguno
de los supuestos por los que el Real Decreto 604/2006 exige su presencia.
El personal que utilice la maquinaria dispondr de la formacin adecuada.
La zona de actuacin deber permanecer ordenada, libre de obstculos, limpia
de residuos y suficientemente iluminad y no se permitir el paso de peatones u
operarios.
Se trazarn y sealizarn los caminos de paso de la maquinaria que
permanecern en correctas condiciones, evitando la formacin de baches,
blandones y zonas de barro excesivo.
El ascenso y descenso del operador a la mquina se realizar en posicin frontal,
haciendo uso de los peldaos y asideros, evitando saltar al suelo, y con el motor
apagado.
La cabina deber permanecer limpia de trapos sucios y combustible.
Los terrenos secos sern regados para disminuir la concentracin de polvo
originado por la maquinaria.
Se colocarn "topes de final de recorrido" a 2 m. de los bordes de excavacin,
para evitar una aproximacin excesiva a los mismos.
No se acopiarn pilas de tierra a distancias inferiores a 2 m. del borde de la
excavacin.
Se colocarn tacos de inmovilizacin en las ruedas, antes de soltar los frenos
cuando la mquina se encuentre en posicin de parada.
Se circular a una velocidad mxima de 20 Km/h dentro del recinto de la obra.
Se cuidar especialmente de no sobrepasar la carga mxima indicada por el
fabricante.
Se impedir la entrada de gases en la cabina del conductor, mediante la
inspeccin peridica de los puntos de escape del motor.
Se mantendr una distancia superior a 3 m. de lneas elctricas inferiores a 66.000
V. y a 5 m. de lneas superiores a 66.000 V.
Las operaciones de mantenimiento se realizarn con el motor apagado.
El cambio de aceite se realizar en fro.
En maquinaria de neumticos, la presin de estos ser la indicada por el
fabricante y se revisar semanalmente.
No se abrir la tapa del radiador cuando se produzca un calentamiento
excesivos del motor, ya que los vapores provocaran quemaduras graves.
Apagar el motor y sacar la llave para realizar operaciones en el sistema elctrico.
Se utilizarn guantes de goma o PVC para la manipulacin del electrolito de la
batera.
Se utilizarn guantes y gafas antiproyeccin para la manipulacin del lquido
anticorrosin.
Se comprobar el funcionamiento de los frenos si se ha trabajado en terrenos
inundados.
Se realizar comprobacin diaria del funcionamiento del motor, frenos, niveles de
aceite, luces y dispositivos acsticos.
No se trabajar con vientos fuertes o condiciones climatolgicas adversas.
Dispondrn de cabinas de seguridad antivuelco (ROPS) y antiimpacto (FOPS).
Antes de empezar a trabajar: Ajustar el asiento, comprobacin del
funcionamiento de los mandos y puesta en marcha de los apoyos hidrulicos de
inmovilizacin.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Dispondrn de botiqun de primeros auxilios y extintor timbrado revisado al da.


Tendrn luces, bocina de retroceso y de limitador de velocidad.
No se trabajar sobre terrenos con inclinacin superior al 50 %.
El valor de exposicin diaria normalizado a vibraciones mecnicas de cuerpo
entero para un perodo de referencia de ocho horas para operadores de
maquinaria pesada no superar 0,5 m/s2, siendo el valor lmite de 1,15 m/s2.

EQUIPOS de PROTECCIN INDIVIDUAL:

Calzado de seguridad adecuados para la conduccin.


Calzado con suela aislante.
Guantes aislantes de vibraciones.
Guantes de cuero.
Guantes de goma o PVC.
Ropa de trabajo reflectante.
Protectores auditivos.
Mascarillas antipolvo.
Cinturn de seguridad del vehculo.
Cinturn abdominal antivibratorio.

8.1.1. Retroexcavadora
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Para realizar las tareas de mantenimiento, se apoyar la cuchara en el suelo, se
parar el motor, freno de mano y bloqueo de mquina.
Queda prohibido el uso de la cuchara como medio de transporte de personas o
gra.
Sealizar con cal o yeso la zona de alcance mximo de la cuchara, para impedir
la realizacin de tareas o permanencia dentro de la misma.
Los desplazamientos de la retro se realizarn con la cuchara apoyada sobre la
mquina en el sentido de la marcha. Excepto el descenso de pendientes, que se
realizar con la cuchara apoyada en la parte trasera de la mquina.
Los cambios de posicin de la cuchara en superficies inclinadas, se realizarn por
la zona de mayor altura.
Estar prohibido realizar trabajos en el interior de zanjas, cuando estas se
encuentren dentro del radio de accin de la mquina.
8.2. Transporte
RIESGOS:
Cada de personas a distinto nivel al ascender o descender de la mquina.
Vuelcos, deslizamientos... de la maquinaria.
Choques contra objetos u otras mquinas.
Atropellos de personas con la maquinaria.
Atrapamientos.
Proyeccin de tierra y piedras.
Polvo, ruido y vibraciones.
Contactos con infraestructura urbana: red de saneamiento, suministro de agua,
conductos de gas o electricidad.
Quemaduras.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

El valor de exposicin diaria normalizado a vibraciones mecnicas de cuerpo


entero para un perodo de referencia de ocho horas para operadores de
maquinaria pesada no superar 0,5 m/s2, siendo el valor lmite de 1,15 m/s2.
Mientras trabajen en obra maquinaria de transporte los RECURSOS PREVENTIVOS
tendrn presencia permanente en obra ya que concurren alguno de los
supuestos por los que el Real Decreto 604/2006 exige su presencia.
Incluso para circulacin por el interior de la obra, los conductores dispondrn del
correspondiente permiso y la formacin especfica adecuada.
La zona de actuacin deber permanecer ordenada, libre de obstculos, limpia
de residuos y suficientemente iluminada y no se permitir el paso de peatones u
operarios.
Se trazarn y sealizarn los caminos de paso de vehculos que permanecern en
correctas condiciones, evitando la formacin de baches, blandones y zonas de
barro excesivo.
El ascenso y descenso del conductor al vehculo se realizar en posicin frontal,
haciendo uso de los peldaos y asideros, evitando saltar al suelo, y con el motor
apagado.
La cabina deber permanecer limpia de trapos sucios y combustible.
Los terrenos secos sern regados para disminuir la concentracin de polvo
originado por los vehculos
Se circular a una velocidad mxima de 20 Km/h dentro del recinto de la obra.
Se cuidar especialmente de no sobrepasar la carga mxima indicada por el
fabricante.
Las operaciones de mantenimiento se realizarn con el motor apagado.
El cambio de aceite se realizar en fro.
Los neumticos tendrn la presin indicada por el fabricante y se revisar
semanalmente.
No se abrir la tapa del radiador cuando se produzca un calentamiento excesivo
del motor, ya que los vapores provocaran quemaduras graves.
Se comprobar el funcionamiento de los frenos si se ha trabajado en terrenos
inundados.
Se realizar comprobacin diaria del funcionamiento del motor, frenos, niveles de
aceite, luces y dispositivos acsticos.
Dispondrn de botiqun de primeros auxilios y extintor timbrado y revisado.
Los vehculos dispondrn de bocina de retroceso.

EQUIPOS de PROTECCIN INDIVIDUAL:

Cinturn abdominal antivibratorio.


Casco de seguridad.
Calzado de seguridad adecuados para la conduccin.
Botas impermeables.
Botas de goma o PVC.
Guantes aislantes de vibraciones.
Guantes de cuero.
Guantes de goma o PVC.
Ropa de trabajo reflectante.
Ropa de trabajo impermeable.
Gafas de proteccin.
Protectores auditivos.

8.2.1. Camin Basculante


MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Comprobar que el freno de mano est en posicin de frenado antes de la puesta


en marcha del motor, al abandonar el vehculo y durante las operaciones de
carga-descarga.
En algunos casos ser preciso regar la carga para disminuir la formacin de polvo.
No se circular con la caja izada despus de la descarga ante la posible
presencia de lneas elctricas areas.

8.2.2. Camin Transporte


MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Las maniobras del camin sern dirigidas por un sealista de trfico.
Las cargas se repartirn uniformemente en la caja; En caso de materiales sueltos,
sern cubiertos mediante una lona y formarn una pendiente mxima del 5 %.
Prohibido el transporte de personas fuera de la cabina.
Se colocar el freno en posicin de frenado y calzos de inmovilizacin debajo de
las ruedas en caso de estar situado en pendientes antes de proceder a las
operaciones de carga y descarga.
Para la realizacin de la carga y descarga, el conductor permanecer fuera de
la cabina.
La carga y descarga se realizar evitando operaciones bruscas, que provoquen
la prdida de estabilidad de la carga.
Se utilizarn escaleras metlicas con ganchos de inmovilizacin y seguridad para
ascender o descender a la caja. Evitando subir trepando sobre la caja o bajar
saltando directamente al suelo.

8.3. Aparatos de Elevacin


8.3.1. Maquinillo
RIESGOS:

Cada de personas u objetos a distinto nivel.


Golpes, cortes o choques.
Atrapamiento de pies y dedos.
Impactos
Contactos elctricos
Aplastamiento por cada de cargas

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Durante el proceso de montaje y desmontaje del maquinillo y mientras est en
funcionamiento, los RECURSOS PREVENTIVOS tendrn presencia permanente en
obra ya que concurren alguno de los supuestos por los que el Real Decreto
604/2006 exige su presencia.
Se vigilar permanentemente por una persona encargada de la mquina el
movimiento y recorrido realizado por la carga, vigilando que no golpee con
ningn elemento.
Los desplazamientos de la carga se realizarn evitando los movimientos bruscos.
Se emplearn zonas y plataformas de carga y descarga.
La maquinaria ser inspeccionada peridicamente en el momento de la
instalacin y cada 3 meses comprobando especialmente que no le han sido
retiradas carcasas de proteccin.
La mquina estar convenientemente protegida en cuanto a todo lo referente a

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

sus dipositivos elctricos.


En un lugar visible de la propia mquina estar dispuesto permanentemente las
caractersticas tcnicas especialmente las relativas a su capacidad de carga.
El gancho ha de disponer de dispositivo de seguridad para evitar que
accidentalmente se descuelgue una carga.
En ningn caso se utizar la instalacin para realizar elevacin de personas.
No habr personal en el radio de accin de debajo de la carga en el momento
en que esta se est elevando.
Se comprobar peridicamente el estado del soporte de la mquina.
Las sirgas sern de resistencia acorde con la carga elevada.
El maquinillo ser examinado y probado antes de su puesta en servicio. Ambos
aspectos quedarn debidamente documentados.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad con barbuquejo.


Guantes de cuero.
Guantes aislantes.
Ropa de trabajo.
Cinturn de seguridad.

8.3.2. Camin gra


RIESGOS:
Cada de personas a distinto nivel al ascender o descender de la mquina.
Vuelcos, deslizamientos... de la maquinaria.
Choques contra objetos u otras mquinas.
Atropellos de personas con la maquinaria.
Atrapamientos.
Proyeccin de tierra y piedras.
Polvo, ruido y vibraciones.
Cada de la gra como consecuencia de fuertes vientos, sobrecargas, colisin
con gras prximas, falta de nivelacin de la superficie de apoyo...
Golpes a personas u objetos durante el transporte de la carga.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


Durante la utilizacin del camin gra, los RECURSOS PREVENTIVOS tendrn
presencia permanente en obra ya que concurren alguno de los supuestos por los
que el Real Decreto 604/2006 exige su presencia.
La zona de actuacin deber permanecer ordenada, libre de obstculos, limpia
de residuos y suficientemente iluminada y no se permitir el paso de peatones u
operarios.
Se trazarn y sealizarn los caminos de paso de vehculos que permanecern en
correctas condiciones, evitando la formacin de baches, blandones y zonas de
barro excesivo.
El ascenso y descenso del conductor al vehculo se realizar en posicin frontal,
haciendo uso de los peldaos y asideros, evitando saltar al suelo, y con el motor
apagado.
Se circular a una velocidad mxima de 20 Km/h dentro del recinto de la obra.
Se cuidar especialmente de no sobrepasar la carga mxima indicada por el
fabricante.
El cambio de aceite se realizar en fro.
Se realizar comprobacin diaria del funcionamiento del motor, frenos, niveles de

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

aceite, luces y dispositivos acsticos.


Los neumticos tendrn la presin indicada por el fabricante y se revisar
semanalmente.
La cabina dispondr de botiqun de primeros auxilios y extintor timbrado y
revisado.
Los vehculos dispondrn de bocina de retroceso.
Comprobar que el freno de mano est en posicin de frenado antes de la puesta
en marcha del motor, al abandonar el vehculo y durante las operaciones de
elevacin.
Las maniobras del camin sern dirigidas por un sealista de trfico.
Se colocar el freno en posicin de frenado y calzos de inmovilizacin debajo de
las ruedas en caso de estar situado en pendientes antes de proceder a las
operaciones de elevacin.
La elevacin se realizar evitando operaciones bruscas, que provoquen la
prdida de estabilidad de la carga.
Cerciorarse de la inexistencia de obstculos como edificios, otra gra, lneas
elctricas o similares dentro del radio de accin de la gra.
Se mantendr una distancia mnima de 5 m. a lneas elctricas areas.
Los cables se encontrarn perfectamente tensados y en posicin vertical,
prohibindose el uso de eslingas rotas o deterioradas.
El gancho, estar dotados de pestillo de seguridad. Su rotura precisa una
reparacin inmediata.
Los grustas se ubicarn en lugares seguros donde tengan una visibilidad continua
de la carga. Cuando la carga no se encuentre dentro del campo de visin del
grusta pedir ayuda a un sealista.
Prohibido el transporte de personas, as como el transporte de cargas por encima
de estas.
Prohibido el balanceo de las cargas.
Prohibido izar o arrastrar cargas adheridas al suelo o paramentos.
Prohibido trabajar con vientos superiores a 60 Km/h o tormenta elctrica.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado de seguridad adecuados para la conduccin.
Botas impermeables.
Guantes de cuero.
Ropa de trabajo impermeable.
Ropa de trabajo reflectante.
Protectores auditivos.

8.4. Hormigonera
RIESGOS:
Afecciones cutneas.Incendios y explosiones.Proyeccin de sustancias en los
ojos.Quemaduras.Intoxicacin por ingesta.Intoxicacin por inhalacin de
vapores.
Afecciones cutneas.
Incendios y explosiones.
Proyeccin de sustancias en los ojos.
Quemaduras.
Intoxicacin por ingesta.
Intoxicacin por inhalacin de vapores.
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Los sustancias catalogadas como peligrosas, bien sean residuos o acopios de


material de construccin, debern almacenarse en un sitio especial que evite
que se mezclen entre s o con otras sustancias no peligrosas manteniendo la
distancia de seguridad entre sustancias que sean sinrgicas entre s o
incompatibles. As mismo, se dispondrn alejadas de trnsito de personas o
maquinaria, convenientemente sealizadas y en zonas de acceso restringido.Las
casetas que almacenen sustancias peligrosas dispondrn ventilacin e
iluminacin adecuadas, estarn cubiertas, cerradas con llave y se mantendrn
ordenadas. En caso de almacenar sustancias que puedan emitir vapores
inflamables, dispondrn de luminaria antideflagrante.Las sustancias sensibles a las
temperaturas, como las inflamables, se mantendrn en sitio aislado trmicamente
y protegido de fuentes de calor o fro.Los lugares de almacenaje de sustancias
lquidas peligrosas carecern de sumideros por los que puedan evacuarse
eventuales fugas o derrames.Las sustancias peligrosas se almacenarn en
envases adecuados, siempre cerrados y bien etiquetados con referencia expresa
a: identificacin de producto, composicin, datos responsable comercializacin,
pictograma que indique peligrosidad, frases R que describen los riesgos del
producto, frases S que aconsejan como manipular el producto e informacin
toxicolgica. El almacenaje se realizar lo ms prximo al suelo posible para
evitar cadas, se mantendrn con un stock mnimo y si fuera necesario contarn
con cubeta de retencin.En los puntos de almacenaje de sustancias peligrosas se
dispondr de arena u otro absorbente para caso de derrame.En los puntos de
almacenaje de sustancias peligrosas se dispondr de extintor qumico y de
CO2.Los trabajadores que manipulen sustancias peligrosas contarn con la
necesaria formacin e informacin.
Los sustancias catalogadas como peligrosas, bien sean residuos o acopios de
material de construccin, debern almacenarse en un sitio especial que evite
que se mezclen entre s o con otras sustancias no peligrosas manteniendo la
distancia de seguridad entre sustancias que sean sinrgicas entre s o
incompatibles. As mismo, se dispondrn alejadas de trnsito de personas o
maquinaria, convenientemente sealizadas y en zonas de acceso restringido.
Las casetas que almacenen sustancias peligrosas dispondrn ventilacin e
iluminacin adecuadas, estarn cubiertas, cerradas con llave y se mantendrn
ordenadas. En caso de almacenar sustancias que puedan emitir vapores
inflamables, dispondrn de luminaria antideflagrante.
Las sustancias sensibles a las temperaturas, como las inflamables, se mantendrn
en sitio aislado trmicamente y protegido de fuentes de calor o fro.
Los lugares de almacenaje de sustancias lquidas peligrosas carecern de
sumideros por los que puedan evacuarse eventuales fugas o derrames.
Las sustancias peligrosas se almacenarn en envases adecuados, siempre
cerrados y bien etiquetados con referencia expresa a: identificacin de
producto, composicin, datos responsable comercializacin, pictograma que
indique peligrosidad, frases R que describen los riesgos del producto, frases S que
aconsejan como manipular el producto e informacin toxicolgica. El
almacenaje se realizar lo ms prximo al suelo posible para evitar cadas, se
mantendrn con un stock mnimo y si fuera necesario contarn con cubeta de
retencin.
En los puntos de almacenaje de sustancias peligrosas se dispondr de arena u
otro absorbente para caso de derrame.
En los puntos de almacenaje de sustancias peligrosas se dispondr de extintor
qumico y de CO2.
Los trabajadores que manipulen sustancias peligrosas contarn con la necesaria
formacin e informacin.
EQUIPOS de PROTECCIN INDIVIDUAL:
Casco de seguridad.Calzado con suela antideslizante.Calzado con puntera
reforzada.Botas de goma o PVC.Guantes de goma o PVC.Ropa de trabajo

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

adecuada.Gafas de seguridad.Mascarilla de filtro recambiable.


Casco de seguridad.
Calzado con suela antideslizante.
Calzado con puntera reforzada.
Botas de goma o PVC.
Guantes de goma o PVC.
Ropa de trabajo adecuada.
Gafas de seguridad.
Mascarilla de filtro recambiable.

8.5. Vibrador
RIESGOS:
Cada de personas a distinto nivel durante las operaciones de vibrado o
circulacin.
Cada de objetos a distinto nivel.
Proyeccin de partculas en ojos o cara del operario.
Golpes, cortes o choques.
Ruido y vibraciones.
Sobreesfuerzos.
Contactos elctricos.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:


En los casos en se superen los valores de exposicin al ruido indicados en el
artculo 5.1 del Real Decreto 286/2006 de proteccin de los trabajadores frente al
ruido, se establecern las acciones correctivas oportunas como el empleo de
protectores auditivos.
El vibrado del hormign se realizar desde plataformas de trabajo seguras. En
ningn momento el operario permanecer sobre el encofrado.
La alimentacin elctrica de la herramienta permanecer siempre aislada.
Prohibido el abandono del vibrador en funcionamiento o desplazarlo tirando de
los cables.
El valor de exposicin diaria normalizado a vibraciones mecnicas al sistema
manobrazo para un perodo de referencia de ocho horas para operadores de
vibradores no superar 2,5 m/s2, siendo el valor lmite de 5 m/s2.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado de seguridad antideslizante.
Calzado con puntera reforzada.
Calzado de seguridad con suela aislante y anticlavos.
Botas de goma o PVC.
Guantes de cuero u otros resistentes a la abrasin, desgarros, cortes...
Guantes de goma o PVC.
Gafas de seguridad antiimpactos.
Protectores auditivos.
Ropa de trabajo adecuada.

8.6. Sierra Circular de Mesa


MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Durante la utilizacin de la sierra circular en obra, los RECURSOS PREVENTIVOS


tendrn presencia permanente en obra ya que concurren alguno de los
supuestos por los que el Real Decreto 604/2006 exige su presencia.
La sierra circular de mesa se ubicar en un lugar apropiado, sobre superficies
firmes, secas y a una distancia mnima de 3 m. a bordes de forjado.
La zona de actuacin deber permanecer ordenada, libre de obstculos y limpia
de residuos.
Por la parte inferior de la mesa la sierra estar totalmente protegida de manera
que no se pueda acceder al disco.
Por la parte superior se instalar una proteccin que impida acceder a la sierra
excepto por donde se introduce la madera, el resto ser una carcasa metlica
que proteger del acceso al disco y de la proyeccin de partculas.
Es necesario utilizar empujador para guiar la madera, de manera que la mano no
pueda pasar cerca de la sierra en ningn momento.
La mquina contar con un cuchillo divisor en la parte trasera del disco y lo ms
prxima a ella para evitar que la pieza salga despedida.
El disco de sierra ha de estar en perfectas condiciones de afilado y de planeidad.
La sierra contar con un dispositivo que en el caso de faltar el fluido elctrico
mientras se utiliza, la sierra no entre en funcionamiento al retornar la corriente.
La instalacin elctrica de la mquina estar siempre en perfecto estado para lo
que se comprobar peridicamente el cableado, las clavijas, la toma de tierra...
El personal que utilice la sierra estar aleccionado en su manejo y conocer
todas las medidas preventivas y EPIs necesarias.
Las piezas aserradas no tendrn clavos no otros elementos metlicos.
El operario se colocar a sotavento del disco, evitando la inhalacin de polvo.
En los casos en se superen los valores de exposicin al ruido indicados en el
artculo 5.1 del Real Decreto 286/2006 de proteccin de los trabajadores frente al
ruido, se establecern las acciones correctivas oportunas como el empleo de
protectores auditivos.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Gafas antiimpactos.
Protectores auditivos.
Empujadores.
Guantes de cuero.
Ropa de trabajo ajustada.
Mascarilla de filtro mecnico recambiable.

8.7. Herramientas Manuales Ligeras


RIESGOS:

Cada de objetos a distinto nivel.


Golpes, cortes y atrapamientos.
Proyeccin de partculas
Ruido y polvo.
Vibraciones.
Sobreesfuerzos.
Contactos elctricos.
Quemaduras.

MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

La zona de actuacin deber permanecer ordenada, libre de obstculos y limpia


de residuos.
La alimentacin de las herramientas que no dispongan de doble aislamiento y se
ubiquen en ambientes hmedos, se realizar conectndola a transformadores a
24 v..
Las herramientas se transportarn en el interior de una batea colgada del gancho
de la gra.
El uso de las herramientas estar restringido solo a personas autorizadas.
Se emplearn herramientas adecuadas para cada trabajo.
No retirar las protecciones de las partes mviles de la herramienta diseadas por
el fabricante.
Prohibido dejarlas abandonadas por el suelo.
Evitar el uso de cadenas, pulseras o similares para trabajar con herramientas.
Cuando se avere la herramienta, se colocar la seal No conectar, mquina
averiada y ser retirada por la misma persona que la instal.
Las herramientas elctricas dispondrn de doble aislamiento o estarn
conectadas a tierra.
Las transmisiones se protegern con un bastidor soporte de un cerramiento con
malla metlica.
En las herramientas de corte se proteger el disco con una carcasa
antiproyeccin.
Las conexiones elctricas a travs de clemas se protegern con carcasas
anticontactos elctricos.
Las herramientas se mantendrn en buenas condiciones
Mangos sin grietas, limpios de residuos y aislantes para los trabajos elctricos.
Dispondrn de toma de tierra, excepto las herramientas porttiles con doble
aislamiento.
Las clavijas y los cables elctricos estarn en perfecto estado y sern adecuados.
La instalacin dispondr de interruptor diferencial de 0,03 A. de sensibilidad.
Las herramientas elctricas no se podrn usar con manos o pies mojados.
Estarn apagadas mientras no se estn utilizando.
En los casos en se superen los valores de exposicin al ruido indicados en el
artculo 5.1 del Real Decreto 286/2006 de proteccin de los trabajadores frente al
ruido, se establecern las acciones correctivas oportunas como el empleo de
protectores auditivos.

EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con suela antideslizante.
Calzado de seguridad con suela aislante y anticlavos.
Guantes de cuero u otros resistentes a la abrasin, desgarros, cortes...
Guantes dielctricos.
Ropa de trabajo ajustada, especialmente en puos y bastas.
Faja de proteccin dorsolumbar.
Gafas de proteccin del polvo.
Gafas de seguridad antiimpactos.
Mascarilla de filtro mecnico recambiable.
Protectores auditivos.
Cinturn portaherramientas.

9. Manipulacin sustancias peligrosas


RIESGOS:
Afecciones cutneas.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Incendios y explosiones.
Proyeccin de sustancias en los ojos.
Quemaduras.
Intoxicacin por ingesta.
Intoxicacin por inhalacin de vapores.
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
Los sustancias catalogadas como peligrosas, bien sean residuos o acopios de
material de construccin, debern almacenarse en un sitio especial que evite
que se mezclen entre s o con otras sustancias no peligrosas manteniendo la
distancia de seguridad entre sustancias que sean sinrgicas entre s o
incompatibles. As mismo, se dispondrn alejadas de trnsito de personas o
maquinaria, convenientemente sealizadas y en zonas de acceso restringido.
Las casetas que almacenen sustancias peligrosas dispondrn ventilacin e
iluminacin adecuadas, estarn cubiertas, cerradas con llave y se mantendrn
ordenadas. En caso de almacenar sustancias que puedan emitir vapores
inflamables, dispondrn de luminaria antideflagrante.
Las sustancias sensibles a las temperaturas, como las inflamables, se mantendrn
en sitio aislado trmicamente y protegido de fuentes de calor o fro.
Los lugares de almacenaje de sustancias lquidas peligrosas carecern de
sumideros por los que puedan evacuarse eventuales fugas o derrames.
Las sustancias peligrosas se almacenarn en envases adecuados, siempre
cerrados y bien etiquetados con referencia expresa a: identificacin de
producto, composicin, datos responsable comercializacin, pictograma que
indique peligrosidad, frases R que describen los riesgos del producto, frases S que
aconsejan como manipular el producto e informacin toxicolgica. El
almacenaje se realizar lo ms prximo al suelo posible para evitar cadas, se
mantendrn con un stock mnimo y si fuera necesario contarn con cubeta de
retencin.
En los puntos de almacenaje de sustancias peligrosas se dispondr de arena u
otro absorbente para caso de derrame.
En los puntos de almacenaje de sustancias peligrosas se dispondr de extintor
qumico y de CO2.
Los trabajadores que manipulen sustancias peligrosas contarn con la necesaria
formacin e informacin.
EQUIPOS de PROTECCIN INDIVIDUAL:

Casco de seguridad.
Calzado con suela antideslizante.
Calzado con puntera reforzada.
Botas de goma o PVC.
Guantes de goma o PVC.
Ropa de trabajo adecuada.
Gafas de seguridad.
Mascarilla de filtro recambiable.

10. Procedimientos coordinacin de actividades empresariales

Tal y como establece el Real Decreto 171/2004, por el que se desarrolla el artculo
24 de la Ley 31/1995, de Prevencin de Riesgos Laborales, en materia de
coordinacin de actividades empresariales, se requiere un sistema eficaz de
coordinacin empresarial en materia de prevencin de riesgos laborales en los
supuestos de concurrencia de actividades empresariales en un mismo centro de
trabajo.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Para satisfacer las necesidades de coordinacin antes expuestas se plantean las


siguientes medidas:
Los recursos preventivos de la obra asumirn la responsabilidad de garantizar el
eficaz funcionamiento de la coordinacin de actividades empresariales entre las
distintas empresas concurrentes en la obra.Antes del comienzo de la actividad en
obra de cualquier empresa concurrente en la misma, el contratista principal
pondr en su conocimiento lo dispuesto en la documentacin preventiva de la
obra y las medidas de coordinacin empresarial.El contratista principal asumir la
responsabilidad de mantener informados a los responsables preventivos de las
empresas concurrentes de la informacin en materia preventiva y de
coordinacin de actividades que sean de su incumbencia.Previo al comienzo de
trabajos del personal de las diferentes empresas concurrentes, se habrn
difundido de manera suficiente las instrucciones de carcter preventivo y de
coordinacin empresarial, procedimientos y protocolos de actuacin a todos los
trabajadores intervinientes. Esta responsabilidad recae en los responsables
preventivos de las diferentes empresas y en ltima instancia en el contratista
principal.
Los recursos preventivos de la obra asumirn la responsabilidad de garantizar el
eficaz funcionamiento de la coordinacin de actividades empresariales entre las
distintas empresas concurrentes en la obra.
Antes del comienzo de la actividad en obra de cualquier empresa concurrente
en la misma, el contratista principal pondr en su conocimiento lo dispuesto en la
documentacin preventiva de la obra y las medidas de coordinacin
empresarial.
El contratista principal asumir la responsabilidad de mantener informados a los
responsables preventivos de las empresas concurrentes de la informacin en
materia preventiva y de coordinacin de actividades que sean de su
incumbencia.
Previo al comienzo de trabajos del personal de las diferentes empresas
concurrentes, se habrn difundido de manera suficiente las instrucciones de
carcter preventivo y de coordinacin empresarial, procedimientos y protocolos
de actuacin a todos los trabajadores intervinientes. Esta responsabilidad recae
en los responsables preventivos de las diferentes empresas y en ltima instancia
en el contratista principal.
11. Control de Accesos a la Obra
El contratista principal pondr en prctica un procedimiento de control de accesos
tanto de vehculos como de personas a la obra de manera que quede garantizado
que slo personas autorizadas puedan acceder a la misma.
Ser en el Plan de Seguridad y Salud donde se materialice la forma en que el mismo
se llevar a cabo y ser el coordinador en la aprobacin preceptiva de dicho plan
quien valide el control diseado.
Desde este documento se establecen los principios bsicos de control entre los que
se contemplan las siguientes medidas:

El contratista designar a una persona del nivel de mando para responsabilizarse


del correcto funcionamiento del procedimiento de control de accesos. Se
informar al coordinador de seguridad y salud del nombramiento antes del
comienzo de la obra y en el caso de sustitucin. Si se produjera una ausencia
puntual del mismo en la obra, se designar sustituto competente de manera que
en ningn momento quede desatendido este control.
El vallado perimetral de la obra garantizar que el acceso tanto de vehculos

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

como peatonal a la obra queda restringido a los puntos controlados de acceso.


Cuando por motivos derivados de los propios trabajos de la obra sea preciso retirar
parte de los vallados de acceso a la obra dejando expedito el mismo por puntos
no controlados, ser necesario que se disponga personal de control en dichos
lugares.
En los accesos a la obra se situarn carteles sealizadores, conforme al Real
Decreto 485/1997 sealizacin de lugares de trabajo, que informen sobre la
prohibicin de acceso de personas no autorizadas y de las condiciones
establecidas para la obra para la obtencin de autorizacin.
Durante las horas en las que en la obra no han de permanecer trabajadores, la
obra quedar totalmente cerrada, bloqueando los accesos habitualmente
operativos en horario de trabajo.
El contratista garantizar, documentalmente si fuera preciso, que todo el personal
que accede a la obra se encuentra al tanto en sus obligaciones con la
administracin social y sanitaria y dispone de la formacin apropiada derivada de
la Ley de Prevencin de Riesgos, Convenio de aplicacin y resto de normativa del
sector.

12. Valoracin Medidas Preventivas


Dadas las caractersticas de la obra, los procesos constructivos, medios y
maquinaria prevista para la ejecucin de la misma, se consideran las medidas
preventivas, medios de proteccin colectiva y equipos de proteccin individual
previstos en este Estudio Bsico, los ms convenientes para conseguir un nivel de
riesgo en el peor de los casos tolerable.

13. Mantenimiento
Para la ejecucin de las tareas de mantenimiento y conservacin necesarias tras la
construccin y puesta en servicio del edificio se han de contemplar medidas
preventivas que garanticen la ejecucin de las mismas con las preceptivas
condiciones de seguridad.
Se incorporan en este punto una serie de medidas preventivas y equipos necesarios
propios de las tareas de mantenimiento. Se estudian solo tareas propias de
mantenimiento preventivo, aquellas intervenciones de reparacin de envergadura
que requieran de proyecto, contarn con un documento especfico de seguridad y
salud.
Para los casos en los que surgieran durante la vida til del edificio tareas de
mantenimiento en que intervengan procesos, equipos o medios no dispuestos en
este estudio, se realizar por parte de la propiedad anexo a este mismo
documento.
RIESGOS:

Asfixia en ambientes sin oxgeno (pozos saneamiento...).


Inhalacin o molestias en los ojos por polvo en tareas de limpieza.
Cadas a distinto nivel de materiales, medios auxiliares y herramientas.
Desprendimientos de cargas suspendidas.
Cadas a distinto o mismo nivel de los operarios por prdida de equilibrio o

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

hundimiento de la plataforma donde opera.


En cubiertas, cadas a distinto nivel de trabajadores por bordes de cubierta, por
deslizamiento por los faldones o por claraboyas, patios y otros huecos.
Sobreesfuerzos.
Exposicin a ruido y vibraciones durante la utilizacin de maquinaria en tareas de
mantenimiento y reparacin.
Golpes y cortes con herramientas u otros materiales.
En mantenimiento de ascensores, cada en altura y atrapamiento.
Inhalacin de sustancias nocivas o txicas de productos de limpieza y/o pintura.
Afecciones cutneas y oculares por contacto con productos de limpieza o pintura.
Explosiones e incendios de materiales inflamables como productos de limpieza o
pintura.
Atrapamientos de manos y pies durante el transporte y colocacin de materiales o
medios auxiliares.
Cortes durante el transporte y colocacin del vidrio.
Proyeccin de pequeas partculas de vidrio u otros cuerpos extraos en los ojos.
Atrapamiento de personas en la cabina de ascensores, por avera o falta de fluido
elctrico.
Contactos elctricos.
MEDIDAS PREVENTIVAS y PROTECCIONES COLECTIVAS:
La iluminacin en la zona de trabajo ser siempre suficiente y en ningn caso
inferior a 150 lux.
Se dispondrn extintores convenientemente revisados en las zonas de acopio y
almacenamiento de material de limpieza, mantenimiento o pinturas.
En la utilizacin de medios auxiliares como andamios o escaleras se atender a lo
especificado para estos equipos en el apartado correspondiente de este mismo
documento.
Para la utilizacin de maquinaria, pequea herramienta y equipos elctricos se
atender a lo dispuesto en el apartado correspondiente de este mismo
documento.
Previo a los trabajos en la envolvente del edificio: cubiertas o fachadas, se
acotarn espacios para el acopio de materiales, para proteger a los viandantes
de la cada de materiales, herramientas o polvo o escombros.
En los trabajos en fachada o cubierta queda prohibido trabajar en caso de hielo,
nieve, lluvia o vientos superiores a 50 km/h.
El acopio de los materiales de cubierta se realizar alejado de las zonas de
circulacin y de los bordes de la cubierta.
Durante los trabajos de mantenimiento tanto en cubierta como en fachada, los
operarios dispondrn de medios de seguridad estables y con barandillas de
proteccin, pudiendo sustituirse en trabajos puntuales de pequea duracin por
arns de seguridad con absorbedor de energa amarrado a cables fiadores
anclados a lneas de vida o elementos estables que impidan la cada.
Los huecos de la cubierta estarn protegidos con barandillas, tablas o redes.
El acceso a la cubierta se realizar a travs de los huecos, con escaleras de mano
peldaeadas, sobre superficies horizontales y que sobresalgan 1m. de la altura de
la cubierta.
Queda prohibido el lanzamiento de residuos de limpieza, escombros u otros desde
cubierta o fachada.
En el mantenimiento de redes de saneamiento, quedar prohibido fumar en
interior de pozos y galeras y previo al acceso a los mismos se comprobar si existe
peligro de explosin o asfixia dotando al personal, que siempre ser especializado
y en nmero mayor de uno, de los equipos de proteccin individual adecuados.
El acceso a los pozos se realizar utilizando los propios pates del mismo si renen las
condiciones o ayudndose de escaleras segn lo dispuesto en el apartado
correspondiente a escaleras de este mismo documento.
Prohibido fumar, comer o usar maquinaria que produzca chispas, en lugares donde

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

se manipulen pinturas que contengan disolventes orgnicos o pigmentos txicos.


La mezcla de aire y vapor del disolvente deber permanecer por debajo de los
lmites de explosin.
Las pinturas, disolventes y dems sustancias txicas o inflamables sern
almacenadas y manipuladas segn las indicaciones del fabricante. Se realizar en
lugares ventilados y alejados del sol y el fuego.
El vertido de pinturas, pigmentos, disolventes o similares se realizar desde la menor
altura posible, para evitar salpicaduras o nubes de polvo.
Los marcos exteriores de puertas y ventanas, terrazas... se pintarn desde el interior
del edificio, donde el operario quedar unido del cinturn de seguridad al cable
fiador amarrado a un punto fijo.
Los vidrios se transportarn en posicin vertical utilizando EPIs apropiados. Si se trata
de grandes dimensiones, se utilizarn ventosas.
Los operarios no debern permanecer debajo de aquellos tajos donde se est
instalando vidrio.
Todas las instalaciones de servicios comunes debern estar debidamente
rotuladas, y dispondrn en el mismo local de emplazamiento de esquemas de
montaje, funcionamiento y manual de instrucciones.
Las tareas de mantenimiento de la instalacin elctrica sern realizadas por
tcnicos especialistas.
Ante cualquier operacin que se realice en la red se cortar el suministro de
energa por el interruptor principal.
Se prohibir fumar en los trabajos de instalaciones de gas. Estos trabajos sern
realizados por instaladores especialistas y autorizados.
El mantenimiento de los ascensores ser realizado por tcnicos especialistas y
empresa acreditada.
Los huecos de las puertas del ascensor que queden abiertos sern protegidos
mediante barandillas de 90 cm., pasamanos, listn intermedio y rodapi de 20 cm..
Se colocar la seal de "Peligro hueco de ascensor".
Queda prohibida la sobrecarga del ascensor. Se colocar una seal de carga
mxima admisible en un lugar bien visible.
Las cabinas de ascensores contarn con un sistema de comunicacin conectado
a un lugar de asistencia permanente.
EQUIPOS de PROTECCIN INDIVIDUAL:
Mascarillas con filtro qumico recambiable para ambientes txicos por disolventes
orgnicos.
Mascarillas antipolvo.
Equipos de filtracin qumica frente a gases y vapores.
Tapones y protectores auditivos.
Cinturn portaherramientas.
Cinturn de seguridad con arneses de suspensin.
Casco de seguridad con barbuquejo.
Casco de seguridad de polietileno.
Calzado con puntera reforzada.
Calzado con suela antideslizante.
Calzado con suela aislante ante contactos elctricos.
Calzado de seguridad con suela aislante y anticlavos.
Botas de goma o PVC.
Rodilleras impermeables almohadilladas.
Guantes de cuero u otros resistentes a la abrasin, desgarros, cortes...
Guantes dielctricos.
Guantes de goma o PVC.
Ropa de trabajo impermeable.
Faja de proteccin dorso lumbar.
Gafas de proteccin del polvo.
Mascarilla de filtro mecnico recambiable.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

14. Legislacin
Tanto la Contrata como la Propiedad, asumen someterse al arbitrio de los tribunales
con jurisdiccin en el lugar de la obra.
Durante la totalidad de la obra se estar a lo dispuesto en la normativa vigente,
especialmente la de obligado cumplimiento entre las que cabe destacar:
Real Decreto 2291 / 1985 de 8 de Noviembre Reglamento de aparatos de
elevacin y manutencin de los mismos.
Real Decreto 1407/1992 Decreto Regulador de las condiciones para la
Comercializacin y Libre Circulacin Intracomunitaria de los Equipos de Proteccin
Individual.
Ley 31/1995 Prevencin de riesgos laborales
Real Decreto 1627/1997 Disposiciones mnimas de seguridad y salud en obras de
construccin.
Real Decreto 39/1997 Reglamento de los Servicios de Prevencin de Riesgos
Laborales.
Real Decreto 485/1997 Disposiciones mnimas en materia de sealizacin de
seguridad y salud en el trabajo.
Real Decreto 486/1997 Establece las disposiciones mnimas de seguridad y salud en
los lugares de trabajo.
Real Decreto 487/1997 Disposiciones mnimas de seguridad y salud relativas a la
manipulacin manual de cargas que entrae riesgos, en particular dorsolumbares,
para los trabajadores.
Real Decreto 488/1997 Disposiciones mnimas de seguridad y salud relativos al
trabajo con equipos que incluyen pantallas de visualizacin.
Real Decreto 665/1997 Proteccin de los trabajadores contra los riesgos
relacionados con la exposicin a agentes cancergenos durante el trabajo.
Real Decreto 664/1997 Proteccin de los trabajadores contra los riesgos
relacionados con la exposicin a agentes biolgicos durante el trabajo.
Real Decreto 773/1997 Disposiciones mnimas de seguridad y salud relativas a la
utilizacin por los trabajadores de los EPI.
Real Decreto 1215/1997 Disposiciones mnimas de seguridad y salud para la
utilizacin de los trabajadores de los equipos de trabajo.
Real Decreto 614/2001 Disposiciones mnimas para la proteccin de la salud y
seguridad de los trabajadores frente al riesgo elctrico.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Real Decreto 374/2001 Proteccin de la Salud y Seguridad de los Trabajadores


contra los Riesgos relacionados con los Agentes Qumicos durante el Trabajo.
Real Decreto 842 / 2002 de 2 de agosto REBT. Reglamento Electrotcnico para Baja
Tensin e instrucciones complementarias.
Real Decreto 836/2003 de 27 de junio Reglamento de Aparatos de Elevacin y
Manutencin referente a gras torre para obra u otras aplicaciones.
Ley 54/2003 Reforma del marco normativo de la prevencin de riesgos laborales.
Real Decreto 171/2004 Desarrolla L.P.R.L. en materia de coordinacin de
actividades empresariales.
Real Decreto 2177/2004 Modifica R.D. 1215/1997 que establece disposiciones
mnimas de seguridad y salud para el uso de equipos en trabajos temporales de
altura.
Real Decreto 1311/2005, proteccin de la salud y la seguridad de los trabajadores
frente a los riesgos derivados o que puedan derivarse de la exposicin a vibraciones
mecnicas.
Gua Tcnica para la evaluacin y prevencin de los riesgos relativos a la utilizacin
de los equipos de trabajo.
Real Decreto 286/2006, sobre la proteccin de la salud y la seguridad de los
trabajadores contra los riesgos relacionados con la exposicin al ruido.
Real Decreto 396/2006, por el que se establecen las disposiciones mnimas de
seguridad y salud aplicables a los trabajos con riesgo de exposicin al amianto.
Real Decreto 604/2006, que modifica el Real Decreto 39/1997 y el Real Decreto
1627/1997 antes mencionados.
Ley 32/2006, reguladora de la subcontratacin en el sector de la construccin y
Real Decreto 1109/2007 que la desarrolla.
Resolucin de 1 de agosto de 2007 de la Direccin General de Trabajo que inscribe
y publica el Convenio Colectivo General del Sector de la Construccin.
En todas las normas citadas anteriormente que con posterioridad a su publicacin y
entrada en vigor hayan sufrido modificaciones, correccin de errores o
actualizaciones por disposiciones ms recientes, se quedar a lo dispuesto en estas
ltimas.

Julio de 2.011

Pedro Enrique Santos Buenda


Arquitecto

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

II.-PLANOS

ndice

1.- SITUACIN E INFRAESTRUCTURAS EXISTENTES


2.- ESTADO ACTUAL
3.- ESTADO REFORMADO. PLANTAS, CUBIERTA Y SECCIN
4.- ESTADO REFORMADO. ALZADOS Y SECCIONES SUPERPUESTAS
5.- ESTADO REFORMADO. CIMENTACIN SANEAMIENTO Y ESTRUCTURA
6.- ESTADO REFORMADO. INSTALACIONES DE ELECTRICIDAD Y
FONTANERA
7.- ESTADO REFORMADO. INSTALACIN DE VENTILACIN Y MEMORIA
GRFICA DE CARPINTERA
8.- ESTADO REFORMADO. INSTALACIN SOLAR-TRMICA Y DETALLES
CONSTRUCTIVOS

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

III.-PLIEGO DE CONDICIONES

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

ndice

1. CLASULAS ADMINISTRATIVAS
1.1. CONDICIONES GENERALES
1.2. CONDICIONES FACULTATIVAS
1.2.1. AGENTES INTERVINIENTES en la OBRA
1.2.1.1. PROMOTOR
1.2.1.2. CONTRATISTA
1.2.1.2.1. PLAZO de EJECUCIN y PRRROGAS
1.2.1.2.2. MEDIOS HUMANOS y MATERIALES en OBRA
1.2.1.2.3. INSTALACIONES y MEDIOS AUXILIARES
1.2.1.2.4. SUBCONTRATAS
1.2.1.2.5. RELACIN con los AGENTES INTERVINIENTES en la OBRA
1.2.1.2.6. DEFECTOS de OBRA y VICIOS OCULTOS
1.2.1.2.7. MODIFICACIONES en las UNIDADES de OBRA
1.2.1.3. DIRECCIN FACULTATIVA
1.2.1.3.1. PROYECTISTA
1.2.1.3.2. DIRECTOR de la OBRA
1.2.1.3.3. DIRECTOR de la EJECUCIN de la OBRA
1.2.2. DOCUMENTACIN de OBRA
1.2.3. REPLANTEO y ACTA de REPLANTEO
1.2.4. LIBRO de RDENES
1.2.5. RECEPCIN de la OBRA
1.3. CONDICIONES ECONMICAS
1.3.1. FIANZAS y SEGUROS
1.3.2. PLAZO de EJECUCIN y SANCIN por RETRASO
1.3.3. PRECIOS
1.3.3.1. PRECIOS CONTRADICTORIOS
1.3.3.2. REVISIN de PRECIOS
1.3.4. MEDICIONES y VALORACIONES
1.3.4.1. UNIDADES por ADMINISTRACIN
1.3.4.2. ABONO de ENSAYOS y PRUEBAS
1.3.5. CERTIFICACIN y ABONO
1.4. CONDICIONES LEGALES
2. CONDICIONES TCNICAS de los MATERIALES, de la EJECUCIN y de las VERIFICACIONES
2.1. DEMOLICIONES
2.1.1. MANUAL
2.2. ACONDICIONAMIENTO del TERRENO
2.2.1. ZANJAS y POZOS
2.3. CIMENTACIN
2.3.1. ZAPATAS
2.3.2. SOLERAS
2.4. ESTRUCTURA
2.4.1. FABRICACIN de HORMIGN ARMADO
2.4.2. ESTRUCTURA de HORMIGN ARMADO
2.4.3. ESTRUCTURA de FBRICA
2.4.3.1. FBRICA CERMICA

2.4.3.2. FBRICA de BLOQUES de TERMOARCILLA


2.5. CERRAMIENTOS
2.5.1. FBRICAS
2.5.1.1. CERMICA
2.5.1.2. BLOQUES de TERMOARCILLA
2.6. TABIQUERAS y DIVISIONES
2.6.1. LADRILLO CERMICO
2.7. CARPINTERA EXTERIOR
2.7.1. ACERO
2.7.2. PVC
2.7.3. MADERA
2.8. CARPINTERA INTERIOR

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.9. INSTALACIONES
2.9.1. FONTANERA
2.9.2. CALEFACCIN y A.C.S.
2.9.3. SANEAMIENTO
2.9.4. ELECTRICIDAD
2.10. AISLAMIENTOS
2.10.1. POLIURETANO
2.11. IMPERMEABILIZACIN
2.11.1. PINTURAS
2.12. CUBIERTAS
2.12.1. INCLINADAS
2.12.1.1. FORMACIN de PENDIENTES con TABIQUES ALIGERADOS
2.12.1.2. TEJA de CERMICA
2.13. REVESTIMIENTOS
2.13.1. PARAMENTOS
2.13.1.1. REVOCOS y ENFOSCADOS
2.13.1.2. GUARNECIDOS y ENLUCIDOS
2.13.1.3. ALICATADOS
2.13.1.4. PINTURAS
2.13.2. SUELOS
2.13.2.1. CERMICOS

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1. CLASULAS ADMINISTRATIVAS
1.1. CONDICIONES GENERALES

El objeto del presente pliego es la ordenacin de las condiciones facultativas, tcnicas,


econmicas y legales que han de regir durante la ejecucin de las obras de construccin del
proyecto.
La obra ha de ser ejecutada conforme a lo establecido en los documentos que conforman
el presente proyecto, siguiendo las condiciones establecidas en el contrato y las rdenes e
instrucciones dictadas por la direccin facultativa de la obra, bien oralmente o por escrito.
Cualquier modificacin en obra, se pondr en conocimiento de la Direccin Facultativa, sin
cuya autorizacin no podr ser realizada.
Se acometern los trabajos cumpliendo con lo especificado en el apartado de condiciones
tcnicas de la obra y se emplearn materiales que cumplan con lo especificado en el
mismo.
Durante la totalidad de la obra se estar a lo dispuesto en la normativa vigente
especialmente a la de obligado cumplimiento.
Es obligacin de la contrata, as como del resto de agentes intervinientes en la obra el
conocimiento del presente pliego y el cumplimiento de todos sus puntos.
Como documento subsidiario para aquellos aspectos no regulados en el presente pliego se
adoptarn las prescripciones recogidas en el Pliego General de Condiciones Tcnicas de la
Edificacin publicado por los Consejos Generales de la Arquitectura y de la Arquitectura
Tcnica de Espaa.

1.2. CONDICIONES FACULTATIVAS


1.2.1. AGENTES INTERVINIENTES en la OBRA
1.2.1.1. PROMOTOR
Ser considerado promotor cualquier persona, fsica o jurdica, pblica o privada, que,
individual o colectivamente, decide, impulsa, programa y financia, con recursos propios o
ajenos, las obras de edificacin objeto de este proyecto.
Cuando el promotor realice directamente con medios humanos y materiales propios la
totalidad o determinadas partes de la obra, tendr tambin la consideracin de contratista
a los efectos de la Ley 32/2006.
A los efectos del RD 1627/97 cuando el promotor contrate directamente trabajadores
autnomos para la realizacin de la obra o de determinados trabajos de la misma, tendr la
consideracin de contratista excepto en los casos estipulados en dicho Real Decreto.
Tendr la consideracin de productor de residuos de construccin y demolicin a los efectos
de lo dispuesto en el RD 105/2008.
Son obligaciones del promotor:
Ostentar sobre el solar la titularidad de un derecho que le faculte para construir en l.
Nombrar a los tcnicos proyectistas y directores de obra y de la ejecucin material.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Contratar al tcnico redactor del Estudio de Seguridad y Salud y al Coordinador en obra y


en proyecto si fuera necesario.
Facilitar la documentacin e informacin previa necesaria para la redaccin del proyecto,
as como autorizar al director de obra las posteriores modificaciones del mismo.
Gestionar y obtener las preceptivas licencias y autorizaciones administrativas, as como
suscribir el acta de recepcin de la obra.
Suscribir los seguros exigidos por la Ley de Ordenacin de la Edificacin.
Facilitar el Libro del Edificio a los usuarios finales. Dicho Libro incluir la documentacin
reflejada en la Ley de Ordenacin de la Edificacin, el Cdigo Tcnico de la Edificacin, el
certificado de eficiencia energtica del edificio y los aquellos otros contenidos exigidos por
la normativa.
Incluir en proyecto un estudio de gestin de residuos de construccin y demolicin. En
obras de demolicin, rehabilitacin, reparacin o reforma, hacer un inventario de los
residuos peligrosos que se generarn, que deber incluirse en el estudio de gestin, as
como prever su retirada selectiva y asegurar su envo a gestores autorizados de residuos
peligrosos.
Disponer de la documentacin que acredite que los residuos de construccin y demolicin
han sido debidamente gestionados segn legislacin.
En su caso constituir la fianza o garanta financiera equivalente que asegure el
cumplimiento de los requisitos establecidos en relacin con los residuos de construccin y
demolicin de la obra.
1.2.1.2. CONTRATISTA
Contratista: es la persona fsica o jurdica, que tiene el compromiso de ejecutar las obras con
medios humanos y materiales suficientes, propios o ajenos, dentro del plazo acordado y con
sujecin estricta al proyecto tcnico que las define, al contrato firmado con el promotor, a
las especificaciones realizadas por la Direccin Facultativa y a la legislacin aplicable.
Tendr la consideracin de poseedor de residuos de construccin y demolicin a los efectos
de lo dispuesto en el RD 105/2008.
Son obligaciones del contratista:
La ejecucin del las obras alcanzando la calidad exigida en el proyecto cumpliendo con
los plazos establecidos en el contrato.
Tener la capacitacin profesional para el cumplimiento de su cometido como constructor.
Designar al jefe de obra que asumir la representacin tcnica del constructor en la obra,
tendr la capacitacin adecuada de acuerdo con las caractersticas y la complejidad de
la obra y permanecer en la obra a lo largo de toda la jornada legal de trabajo hasta la
recepcin de la obra. El jefe de obra, deber cumplir las indicaciones de la Direccin
Facultativa y firmar en el libro de rdenes, as como cerciorarse de la correcta instalacin
de los medios auxiliares, comprobar replanteos y realizar otras operaciones tcnicas.
Asignar a la obra los medios humanos y materiales que su importancia requiera.
Formalizar las subcontrataciones de determinadas partes o instalaciones de la obra dentro
de los lmites establecidos en el contrato.
Firmar el acta de replanteo y el acta de recepcin de la obra.
Facilitar al director de obra los datos necesarios para la elaboracin de la documentacin
de la obra ejecutada.
Suscribir las garantas previstas en el presente pliego y en la normativa vigente.
Redactar el Plan de Seguridad y Salud.
Designar al recurso preventivo de Seguridad y Salud en la obra entre su personal tcnico
cualificado con presencia permanente en la obra y velar por el estricto cumplimiento de
las medidas de seguridad y salud precisas segn normativa vigente y el plan de seguridad
y salud.
Vigilar el cumplimiento de la Ley 32/2006 por las empresas subcontratistas y trabajadores
autnomos con que contraten; en particular, en lo que se refiere a las obligaciones de
acreditacin e inscripcin en el Registro de Empresas Acreditadas, contar con el
porcentaje de trabajadores contratados con carcter indefinido aspectos regulados en el
artculo 4 de dicha Ley y al rgimen de la subcontratacin que se regula en el articulo 5.
Informar a los representantes de los trabajadores de las empresas que intervengan en la
ejecucin de la obra de las contrataciones y subcontrataciones que se hagan en la

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

misma.
Estar obligado a presentar al promotor un plan que refleje cmo llevar a cabo las
obligaciones que le incumban en relacin con los residuos de construccin y demolicin
que se vayan a producir en la obra.
Cuando no proceda a gestionar por s mismo los residuos de construccin y demolicin
estar obligado a entregarlos a un gestor de residuos o a participar en un acuerdo
voluntario o convenio de colaboracin para su gestin.
Estar obligado a mantener los residuos de construccin y demolicin en condiciones
adecuadas de higiene y seguridad, as como a evitar la mezcla de fracciones ya
seleccionadas que impida o dificulte su posterior valorizacin o eliminacin.

1.2.1.2.1. PLAZO de EJECUCIN y PRRROGAS


En caso de que las obras no se pudieran iniciar o terminar en el plazo previsto como
consecuencia de una causa mayor o por razones ajenas al Contratista, se le otorgar una
prrroga previo informe favorable de la Direccin Facultativa. El Contratista explicar la
causa que impide la ejecucin de los trabajos en los plazos sealados, razonndolo por
escrito.
La prrroga solo podr solicitarse en un plazo mximo de un mes a partir del da en que se
origin la causa de esta, indicando su duracin prevista y antes de que la contrata pierda
vigencia. En cualquier caso el tiempo prorrogado se ajustar al perdido y el Contratista
perder el derecho de prrroga si no la solicita en el tiempo establecido.

1.2.1.2.2. MEDIOS HUMANOS y MATERIALES en OBRA


Cada una de las partidas que compongan la obra se ejecutarn con personal adecuado al
tipo de trabajo de que se trate, con capacitacin suficientemente probada para la labor a
desarrollar. La Direccin Facultativa, tendr la potestad facultativa para decidir sobre la
adecuacin del personal al trabajo a realizar.
El Contratista proporcionar un mnimo de dos muestras de los materiales que van a ser
empleados en la obra con sus certificados y sellos de garanta en vigor presentados por el
fabricante, para que sean examinadas y aprobadas por la Direccin Facultativa, antes de su
puesta en obra. Los materiales que no renan las condiciones exigidas sern retiradas de la
obra.
Las pruebas y ensayos, anlisis y extraccin de muestras de obra que se realicen para
cerciorarse de que los materiales y unidades de obra se encuentran en buenas condiciones y
estn sujetas al Pliego, sern efectuadas cuando se estimen necesarias por parte de la
Direccin Facultativa y en cualquier caso se podr exigir las garantas de los proveedores.
El transporte, descarga, acopio y manipulacin de los materiales ser responsabilidad del
Contratista.

1.2.1.2.3. INSTALACIONES y MEDIOS AUXILIARES


El proyecto, consecucin de permisos, construccin o instalacin, conservacin,
mantenimiento, desmontaje, demolicin y retirada de las instalaciones, obras o medios
auxiliares de obra necesarias y suficientes para la ejecucin de la misma, sern obligacin
del Contratista y corrern a cargo del mismo. De igual manera, ser responsabilidad del
contratista, cualquier avera o accidente personal que pudiera ocurrir en la obra por
insuficiencia o mal estado de estos medios o instalaciones.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

El Contratista instalar una oficina dotada del mobiliario suficiente, donde la Direccin
Facultativa podr consultar la documentacin de la obra y en la que se guardar una copia
completa del proyecto, visada por el Colegio Oficial en el caso de ser necesario, el libro de
rdenes, libro de incidencias segn RD 1627/97, libro de visitas de la inspeccin de trabajo,
copia de la licencia de obras y copia del plan de seguridad y salud.

1.2.1.2.4. SUBCONTRATAS
Subcontratista es la persona fsica o jurdica que asume contractualmente ante el contratista
u otro subcontratista comitente el compromiso de realizar determinadas partes o unidades
de obra.
El Contratista podr subcontratar captulos o unidades de obra, bajo su responsabilidad,
previo consentimiento del Promotor y la Direccin Facultativa, asumiendo en cualquier caso
el contratista las actuaciones de las subcontratas.
Ser obligacin de los subcontratistas vigilar el cumplimiento de la Ley 32/2006 por las
empresas subcontratistas y trabajadores autnomos con que contraten; en particular, en lo
que se refiere a las obligaciones de acreditacin e inscripcin en el Registro de Empresas
Acreditadas, contar con el porcentaje de trabajadores contratados con carcter indefinido
aspectos regulados en el artculo 4 de dicha Ley y al rgimen de la subcontratacin que se
regula en el articulo 5.
Tendrn la consideracin de poseedores de residuos de construccin y demolicin a los
efectos de lo dispuesto en el RD 105/2008.

1.2.1.2.5. RELACIN con los AGENTES INTERVINIENTES en la OBRA


El orden de ejecucin de la obra ser determinada por el Contratista, excepto cuando la
direccin facultativa crea conveniente una modificacin de los mismos por razones tcnicas
en cuyo caso sern modificados sin contraprestacin alguna.
El contratista estar a lo dispuesto por parte de la direccin de la obra y cumplir sus
indicaciones en todo momento, no cabiendo reclamacin alguna, en cualquier caso, el
contratista puede manifestar por escrito su disconformidad y la direccin firmar el acuse de
recibo de la notificacin.
En aquellos casos en que el contratista no se encuentre conforme con decisiones
econmicas adoptadas por la direccin de la obra, este lo pondr en conocimiento de la
propiedad por escrito, haciendo llegar copia de la misma a la Direccin Facultativa.

1.2.1.2.6. DEFECTOS de OBRA y VICIOS OCULTOS


El Contratista ser responsable hasta la recepcin de la obra de los posibles defectos o
desperfectos ocasionados durante la misma.
En caso de que la Direccin Facultativa, durante las obras o una vez finalizadas, observara
vicios o defectos en trabajos realizados, materiales empleados o aparatos que no cumplan
con las condiciones exigidas, tendr el derecho de mandar que las partes afectadas sean
demolidas y reconstruidas de acuerdo con lo contratado, antes de la recepcin de la obra y
a costa de la contrata.
De igual manera, los desperfectos ocasionados en fincas colindantes, va pblica o a
terceros por el Contratista o subcontrata del mismo, sern reparados a cuenta de ste,
dejndolas en el estado que estaban antes del inicio de las obras.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1.2.1.2.7. MODIFICACIONES en las UNIDADES de OBRA


Las unidades de obra no podrn ser modificadas respecto a proyecto a menos que la
Direccin Facultativa as lo disponga por escrito.
En caso de que el Contratista realizase cualquier modificacin beneficiosa (materiales de
mayor calidad o tamao), sin previa autorizacin de la Direccin Facultativa y del Promotor,
slo tendr derecho al abono correspondiente a lo que hubiese construido de acuerdo con
lo proyectado y contratado.
En caso de producirse modificaciones realizadas de manera unilateral por el Contratista que
menoscaben la calidad de lo dispuesto en proyecto, quedar a juicio de la Direccin
Facultativa la demolicin y reconstruccin o la fijacin de nuevos precios para dichas
partidas.
Previamente a la ejecucin o empleo de los nuevos materiales, convendrn por escrito el
importe de las modificaciones y la variacin que supone respecto al contratado.
Toda modificacin en las unidades de obra sern anotadas en el libro de rdenes, as como
su autorizacin por la Direccin Facultativa y posterior comprobacin.

1.2.1.3. DIRECCIN FACULTATIVA


1.2.1.3.1. PROYECTISTA
Es el encargado por el promotor para redactar el proyecto de ejecucin de la obra con
sujecin a la normativa vigente y a lo establecido en contrato.
Ser encargado de realizar las copias de proyecto necesarias y, en caso necesario, visarlas
en el colegio profesional correspondiente.
Cuando el proyecto se desarrolle o complete mediante proyectos parciales o documentos
tcnicos, cada proyectista asumir la titularidad de su proyecto.
El proyectista suscribir el certificado de eficiencia energtica del proyecto a menos que
exista un proyecto parcial de instalaciones trmicas, en cuyo caso el certificado lo suscribir
el autor de este proyecto parcial.

1.2.1.3.2. DIRECTOR de la OBRA


Forma parte de la Direccin Facultativa, dirige el desarrollo de la obra en aspectos tcnicos,
estticos, urbansticos y medioambientales, de conformidad con el proyecto, la licencia de
edificacin y dems autorizaciones preceptivas y las condiciones del contrato, con el objeto
de asegurar su adecuacin al fin propuesto.
Son obligaciones del director de obra:
Verificar el replanteo y la adecuacin de la cimentacin y de la estructura proyectadas a
las caractersticas geotcnicas del terreno.
Resolver las contingencias que se produzcan en la obra y consignar en el Libro de rdenes
y Asistencias las instrucciones precisas para la correcta interpretacin del proyecto.
Elaborar modificaciones del proyecto, que vengan exigidas por la marcha de la obra .
Suscribir el acta de replanteo o de comienzo de obra y el certificado final de obra, as
como conformar las certificaciones de las unidades de obra ejecutadas.
Elaborar y suscribir la documentacin de la obra ejecutada para entregarla al promotor,
con los visados que en su caso fueran preceptivos.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Suscribir el certificado de eficiencia energtica del edificio terminado.


1.2.1.3.3. DIRECTOR de la EJECUCIN de la OBRA
Forma parte de la direccin facultativa, asume la funcin tcnica de dirigir la ejecucin
material de la obra y de controlar cualitativa y cuantitativamente la construccin y la
calidad de lo edificado.
Son obligaciones del director de la ejecucin de la obra:
Verificar la recepcin en obra de los productos de construccin, ordenando la realizacin
de ensayos y pruebas precisas.
Dirigir la ejecucin material de la obra comprobando los replanteos, los materiales, la
correcta ejecucin y disposicin de los elementos constructivos y de las instalaciones, de
acuerdo con el proyecto y con las instrucciones del director de obra.
Consignar en el Libro de rdenes y Asistencias las instrucciones precisas.
Suscribir el acta de replanteo o de comienzo de obra y el certificado final de obra, as
como elaborar y suscribir las certificaciones de las unidades de obra ejecutadas.
Colaborar con los restantes agentes en la elaboracin de la documentacin de la obra
ejecutada, aportando los resultados del control realizado.
Suscribir el certificado de eficiencia energtica del edificio terminado.
1.2.2. DOCUMENTACIN de OBRA
En obra se conservar una copia integra y actualizada del proyecto para la ejecucin de la
obra incorporando el estudio de gestin de residuos de construccin y demolicin. Todo ello
estar a disposicin de todos los agentes intervinientes en la obra.
Tanto las dudas que pueda ofrecer el proyecto al contratista como los documentos con
especificaciones incompletas se pondrn en conocimiento de la Direccin Facultativa tan
pronto como fueran detectados con el fin de estudiar y solucionar el problema. No se
proceder a realizar esa parte de la obra, sin previa autorizacin de la Direccin Facultativa.
La existencia de contradicciones entre los documentos integrantes de proyecto o entre
proyectos complementarios dentro de la obra se salvar atendiendo al criterio que
establezca el Director de Obra no existiendo prelacin alguna entre los diferentes
documentos del proyecto.
Una vez finalizada la obra, el proyecto, con la incorporacin en su caso de las
modificaciones debidamente aprobadas, ser facilitado al promotor por el director de obra
para la formalizacin de los correspondientes trmites administrativos.
A dicha documentacin adjuntar el Promotor el acta de recepcin, la relacin
identificativa de los agentes que han intervenido durante el proceso de edificacin, las
instrucciones de uso y mantenimiento del edificio y sus instalaciones, de conformidad con la
normativa que le sea de aplicacin y aquellos datos requeridos segn normativa para
conformar el Libro del Edificio que ser entregado a los usuarios finales del edificio.

1.2.3. REPLANTEO y ACTA de REPLANTEO


El Contratista estar obligado a comunicar por escrito el inicio de las obras a la Direccin
Facultativa como mnimo tres das antes de su inicio.
El replanteo ser realizado por el Constructor siguiendo las indicaciones de alineacin y
niveles especificados en los planos y comprobado por la Direccin Facultativa. No se
comenzarn las obras si no hay conformidad del replanteo por parte de la Direccin
Facultativa.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Todos los medios materiales, personal tcnico especializado y mano de obra necesarios para
realizar el replanteo, que dispondrn de la cualificacin adecuada, sern proporcionadas
por el Contratista a su cuenta.
Se utilizarn hitos permanentes para materializar los puntos bsicos de replanteo, y
dispositivos fijos adecuados para las seales niveladas de referencia principal.
Los puntos movidos o eliminados, sern sustituidos a cuenta del Contratista, responsable de
conservacin mientras el contrato est en vigor y ser comunicado por escrito a la Direccin
Facultativa, quien realizar una comprobacin de los puntos repuestos.
El Acta de comprobacin de Replanteo que se suscribir por parte de la Direccin
Facultativa y de la Contrata, contendr, la conformidad o disconformidad del replanteo en
comparacin con los documentos contractuales del Proyecto, las referencias a las
caractersticas geomtricas de la obra y autorizacin para la ocupacin del terreno
necesario y las posibles omisiones, errores o contradicciones observadas en los documentos
contractuales del Proyecto, as como todas las especificaciones que se consideren
oportunas.
El Contratista asistir a la Comprobacin del Replanteo realizada por la Direccin, facilitando
las condiciones y todos los medios auxiliares tcnicos y humanos para la realizacin del
mismo y responder a la ayuda solicitada por la Direccin.
Se entregar una copia del Acta de Comprobacin de Replanteo al Contratista, donde se
anotarn los datos, cotas y puntos fijados en un anexo del mismo.

1.2.4. LIBRO de RDENES


El Director de Obra facilitar al Contratista al comienzo de la obra de un libro de rdenes,
Asistencias e Incidencias que se mantendr permanente en obra a disposicin de la
Direccin Facultativa.
En el libro se anotarn:
Las contingencias que se produzcan en la obra y las instrucciones de la Direccin
Facultativa para la correcta interpretacin del proyecto.
Las operaciones administrativas relativas a la ejecucin y la regulacin del contrato.
Las fechas de aprobacin de muestras de materiales y de precios nuevos o contradictorios.
Anotaciones sobre la calidad de los materiales, clculo de precios, duracin de los
trabajos, personal empleado...
Las hojas del libro sern foliadas por triplicado quedando la original en poder del Director de
Obra, copia para el Director de la Ejecucin y la tercera para el contratista.
La Direccin facultativa y el Contratista, debern firmar al pie de cada orden constatando
con dicha firma que se dan por enterados de lo dispuesto en el Libro.

1.2.5. RECEPCIN de la OBRA


La recepcin de la obra es el acto por el cual el constructor, una vez concluida sta, hace
entrega de la misma al promotor y es aceptada por ste. Podr realizarse con o sin reservas y
deber abarcar la totalidad de la obra o fases completas y terminadas de la misma.
La recepcin deber realizarse dentro de los 30 das siguientes a la notificacin al promotor
del certificado final de obra emitido por la Direccin Facultativa y consignarse en un acta
firmada, al menos, por el promotor y el constructor, y en la misma se har constar: las partes
que intervienen, la fecha del certificado final de la obra, el coste final de la ejecucin

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

material de la obra, la declaracin de recepcin de la obra con o sin reservas,


especificando, en su caso, stas de manera objetiva y el plazo en que debern quedar
subsanados los defectos observados y las garantas que en su caso se exijan al constructor
para asegurar sus responsabilidades.
Una vez subsanados los defectos, se har constar en un acta aparte, suscrita por los firmantes
de la recepcin.
Asimismo, se adjuntar el certificado final de obra suscrito por el director de obra y el director
de la ejecucin de la obra.
El promotor podr rechazar la recepcin de la obra por considerar que la misma no est
terminada o que no se adecua a las condiciones contractuales. El rechazo deber se
motivado por escrito en el acta, en la que se fijar el nuevo plazo para efectuar la
recepcin.
La recepcin se entender tcitamente producida si transcurridos los 30 das el promotor no
hubiera puesto de manifiesto reservas o rechazo motivado por escrito.
El cmputo de los plazos de responsabilidad y garanta establecidos se iniciar a partir de la
fecha en que se suscriba el acta de recepcin, o cuando se entienda sta tcitamente
producida segn lo previsto en el apartado anterior.
El Contratista deber dejar el edificio desocupado y limpio en la fecha fijada por la Direccin
Facultativa, una vez que se hayan terminado las obras.
El Propietario podr ocupar parcialmente la obra, en caso de que se produzca un retraso
excesivo de la Recepcin imputable al Contratista, sin que por ello le exima de su obligacin
de finalizar los trabajos pendientes, ni significar la aceptacin de la Recepcin.

1.3. CONDICIONES ECONMICAS


El Contratista debe percibir el importe de todos los trabajos ejecutados, cuando hayan sido
realizados de acuerdo con el Proyecto, al contrato firmado con el promotor, a las
especificaciones realizadas por la Direccin y a las Condiciones generales y particulares del
pliego de condiciones.

1.3.1. FIANZAS y SEGUROS


A la firma del contrato, el Contratista presentara las fianzas y seguros obligados a presentar
por Ley, as mismo, en el contrato suscrito entre Contratista y Promotor se podr exigir todas
las garantas que se consideren necesarias para asegurar la buena ejecucin y finalizacin
de la obra en los trminos establecidos en el contrato y en el proyecto de ejecucin.
El Contratista est obligado a asegurar la obra contratada mientras dure el plazo de
ejecucin, hasta su recepcin.

1.3.2. PLAZO de EJECUCIN y SANCIN por RETRASO


Si la obra no est terminada para la fecha prevista, el Propietario podr disminuir las cuantas
establecidas en el contrato, de las liquidaciones, fianzas o similares.
La indemnizacin por retraso en la terminacin de las obras, se establecer por cada da
natural de retraso desde el da fijado para su terminacin en el calendario de obra o en el
contrato. El importe resultante ser descontado con cargo a las certificaciones o a la fianza.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

El Contratista no podr suspender los trabajos o realizarlos a ritmo inferior que lo establecido
en el Proyecto, alegando un retraso de los pagos.

1.3.3. PRECIOS
1.3.3.1. PRECIOS CONTRADICTORIOS
Los precios contradictorios se originan como consecuencia de la introduccin de unidades o
cambios de calidad no previstas en el Proyecto por iniciativa del Promotor o la Direccin
Facultativa. El Contratista est obligado a presentar propuesta econmica para la
realizacin de dichas modificaciones y a ejecutarlo en caso de haber acuerdo.
El Contratista establecer los descompuestos, que debern ser presentados y aprobados por
la Direccin Facultativa y el Promotor antes de comenzar a ejecutar las unidades de obra
correspondientes.
Se levantarn actas firmadas de los precios contradictorios por triplicado firmadas por la
Direccin Facultativa, el Contratista y el Propietario.
En caso de ejecutar partidas fuera de presupuesto sin la aprobacin previa especificada en
los prrafos anteriores, ser la Direccin Facultativa la que determine el precio justo a abonar
al contratista.

1.3.3.2. REVISIN de PRECIOS


No se admitirn revisiones de los precios contratados, excepto obras extremadamente largas
o que se ejecuten en pocas de inestabilidad con grandes variaciones de los precios en el
mercado, tanto al alza como a la baja y en cualquier caso, dichas modificaciones han de
ser consensuadas y aprobadas por Contratista, Direccin Facultativa y Promotor.
En caso de aumento de precios, el Contratista solicitar la revisin de precios a la Direccin
Facultativa y al Promotor, quienes caso de aceptar la subida convendrn un nuevo precio
unitario, antes de iniciar o continuar la ejecucin de las obras. Se justificar la causa del
aumento, y se especificar la fecha de la subida para tenerla en cuenta en el acopio de
materiales en obra.
En caso de bajada de precios, se convendr el nuevo precio unitario de acuerdo entre las
partes y se especificar la fecha en que empiecen a regir.

1.3.4. MEDICIONES y VALORACIONES


El Contratista de acuerdo con la Direccin Facultativa deber medir las unidades de obra
ejecutas y aplicar los precios establecidos en el contrato entre las partes, levantando actas
correspondientes a las mediciones parciales y finales de la obra, realizadas y firmadas por la
Direccin Facultativa y el Contratista.
Todos los trabajos y unidades de obra que vayan a quedar ocultos en el edificio una vez que
se haya terminado, el Contratista pondr en conocimiento de la Direccin Facultativa con
antelacin suficiente para poder medir y tomar datos necesarios, de otro modo, se aplicarn
los criterios de medicin que establezca la Direccin Facultativa.
Las valoraciones de las unidades de obra, incluidos materiales accesorios y trabajos
necesarios, se calculan multiplicando el nmero de unidades de obra por el precio unitario
(incluidos gastos de transporte, indemnizaciones o pagos, impuestos fiscales y toda tipo de
cargas sociales).

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

El Contratista entregar una relacin valorada de las obras ejecutadas en los plazos
previstos, a origen, a la Direccin Facultativa, en cada una de las fechas establecidas en el
contrato realizado entre Promotor y Contratista.
La medicin y valoracin realizadas por el Contratista debern ser aprobadas por la
Direccin Facultativa, o por el contrario sta deber efectuar las observaciones
convenientes de acuerdo con las mediciones y anotaciones tomadas en obra. Una vez que
se hayan corregido dichas observaciones, la Direccin Facultativa dar su certificacin
firmada al Contratista y al Promotor.
El Contratista podr oponerse a la resolucin adoptada por la Direccin Facultativa ante el
Promotor, previa comunicacin a la Direccin Facultativa. La certificacin ser inapelable en
caso de que transcurridos 10 das, u otro plazo pactado entre las partes, desde su envo, la
Direccin Facultativa no recibe ninguna notificacin, que significar la conformidad del
Contratista con la resolucin.

1.3.4.1. UNIDADES por ADMINISTRACIN


La liquidacin de los trabajos se realizar en base a la siguiente documentacin presentada
por el Constructor: facturas originales de los materiales adquiridos y documento que justifique
su empleo en obra, nminas de los jornales abonados indicando nmero de horas trabajadas
por cada operario en cada oficio y de acuerdo con la legislacin vigente, facturas originales
de transporte de materiales a obra o retirada de escombros, recibos de licencias, impuestos
y otras cargas correspondientes a la obra.
Las obras o partes de obra realizadas por administracin, debern ser autorizadas por el
Promotor y la Direccin Facultativa, indicando los controles y normas que deben cumplir.
El Contratista estar obligado a redactar un parte diario de jornales y materiales que se
sometern a control y aceptacin de la Direccin Facultativa, en obras o partidas de la
misma contratadas por administracin.

1.3.4.2. ABONO de ENSAYOS y PRUEBAS


Los gastos de los anlisis y ensayos ordenados por la Direccin Facultativa, sern a cuenta
del Contratista cuando el importe mximo corresponde al 1% del presupuesto de la obra
contratada, y del Promotor el importe que supere este porcentaje.

1.3.5. CERTIFICACIN y ABONO


Las obras se abonarn a los precios de ejecucin material establecidos en el presupuesto
contratado para cada unidad de obra, tanto en las certificaciones como en la liquidacin
final.
Las partidas alzadas una vez ejecutadas, se medirn en unidades de obra y se abonarn a la
contrata. Si los precios de una o ms unidades de obra no estn establecidos en los precios,
se considerarn como si fuesen contradictorios.
Las obras no terminadas o incompletas no se abonarn o se abonaran en la parte en que se
encuentren ejecutadas, segn el criterio establecido por la Direccin Facultativa.
Las unidades de obra sin acabar, fuera del orden lgico de la obra o que puedan sufrir
deterioros, no sern calificadas como certificables hasta que la Direccin Facultativa no lo
considere oportuno.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Las certificaciones se remitirn al Propietario, con carcter de documento y entregas a


buena cuenta, sin que supongan aprobacin o recepcin en obra, sujetos a rectificaciones y
variaciones derivadas de la liquidacin final.
El Promotor deber realizar los pagos al Contratista o persona autorizada por el mismo, en los
plazos previstos y su importe ser el correspondiente a las especificaciones de los trabajos
expedidos por la Direccin Facultativa.
Se podrn aplicar frmulas de depreciacin en aquellas unidades de obra, que tras realizar
los ensayos de control de calidad correspondientes, su valor se encuentre por encima del
lmite de rechazo, muy prximo al lmite mnimo exigido aunque no llegue a alcanzarlo, pero
que obtenga la calificacin de aceptable. Las medidas adoptadas no implicarn la prdida
de funcionalidad, seguridad o que no puedan ser subsanadas posteriormente, en las
unidades de obra afectadas, segn el criterio de la Direccin Facultativa.

1.4. CONDICIONES LEGALES


Tanto la Contrata como a Propiedad, asumen someterse al arbitrio de los tribunales con
jurisdiccin en el lugar de la obra.
Es obligacin de la contrata, as como del resto de agentes intervinientes en la obra el
conocimiento del presente pliego y el cumplimiento de todos sus puntos.
El contratista ser el responsable a todos los efectos de las labores de polica de la obra y del
solar hasta la recepcin de la misma, solicitar los preceptivos permisos y licencias necesarias
y vallar el solar cumpliendo con las ordenanzas o consideraciones municipales. todas las
labores citadas sern a su cargo exclusivamente.
Podrn se causas suficientes para la rescisin de contrato las que a continuacin se detallan:
Muerte o incapacidad del Contratista.
La quiebra del Contratista.
Modificaciones sustanciales del Proyecto que conlleven la variacin en un 50 % del
presupuesto contratado.
No iniciar la obra en el mes siguiente a la fecha convenida.
Suspender o abandonar la ejecucin de la obra de forma injustificada por un plazo
superior a dos meses.
No concluir la obra en los plazos establecidos o aprobados.
Incumplimiento de las condiciones de contrato, proyecto en ejecucin o determinaciones
establecidas por parte de la Direccin Facultativa.
Incumplimiento de la normativa vigente de Seguridad y Salud en el trabajo.
Durante la totalidad de la obra se estar a lo dispuesto en la normativa vigente,
especialmente la de obligado cumplimiento entre las que cabe destacar:
NORMAS GENERAL del SECTOR
Decreto 462 / 1971 de 11 de Marzo Normas sobre redaccin de proyectos y direccin de
obras de edificacin
Ley 38 / 1999 de 5 de Noviembre Ley de Ordenacin de la Edificacin. LOE
Real Decreto 314/2006 de 17 de Marzo por el que se aprueba el Cdigo Tcnico de la
Edificacin.
Real Decreto 47/2007 de 19 de enero, certificacin energtica de edificios.
Real Decreto 1371/2007 de 19 de Octubre por el que se aprueba el Documento Bsico de
Proteccin contra el Ruido DB-HR del Cdigo Tcnico de la Edificacin.
Real Decreto 105/2008 por el que se regula la produccin y gestin de los residuos de
construccin y demolicin.
ESTRUCTURALES

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Real Decreto 997 / 2002 de 27 de Septiembre Aprueba la norma de construccin


sismorresistente: parte general y edificacin (NCSR-02).
Real Decreto 1247 / 2008 de 18 de julio EHE-08. Instruccin de hormign estructural
MATERIALES
Orden 1974 de 28 de julio Pliego de prescripciones tcnicas generales para tuberas de
abastecimiento de agua.
Orden 1986 de 15 de septiembre Pliego de Prescripciones Tcnicas Generales para Tuberas
de Saneamiento de Poblaciones.
Real Decreto 956 / 2008 RC-08. Instruccin para la recepcin de cementos.
INSTALACIONES
Real Decreto 1427 / 1997 de 15 de Septiembre Instalaciones petrolferas para uso propio.
Real Decreto 2291 / 1985 de 8 de Noviembre Reglamento de aparatos de elevacin y
manutencin de los mismos.
Real Decreto 836/2003 de 27 de junio Reglamento de Aparatos de Elevacin y
Manutencin referente a gras torre para obra u otras aplicaciones.
Real Decreto 1314 / 1997 de 1 de Agosto Reglamento de aparatos de elevacin y su
manutencin.
Real Decreto 1942 / 1993 de 5 de noviembre Reglamento de instalaciones de proteccin
contra incendios
Real Decreto 2267/2004, de 3 de diciembre, por el que se aprueba el Reglamento de
seguridad contra incendios en los establecimientos industriales.
Real Decreto 842/2002 de 2 de agosto REBT. Reglamento Electrotcnico para Baja Tensin
e instrucciones complementarias.
Real Decreto 1663/2000 de 29 de septiembre, sobre conexin de instalaciones fotovoltaicas
a la red de baja tensin.
Real Decreto-Ley 1/1998 de 27 de Febrero Infraestructuras comunes en los edificios para el
acceso a los servicios de telecomunicaciones.
Real Decreto 346/2011 de 11 de marzo Reglamento regulador de las infraestructuras
comunes de telecomunicaciones para el acceso a los servicios de telecomunicacin en el
interior de las edificaciones.
Real Decreto 919/2006, de 28 de julio Reglamento tcnico de distribucin y utilizacin de
combustibles gaseosos y sus instrucciones tcnicas complementarias.
Real Decreto 1027/2007 de 20 de julio por el que se aprueba el Reglamento de
Instalaciones Trmicas en los Edificios. RITE 2007.
Real Decreto 1890/2008, de 14 de noviembre, Reglamento de eficiencia energtica en
instalaciones de alumbrado exterior y sus Instrucciones tcnicas complementarias.
SEGURIDAD y SALUD
Real Decreto 1407/1992 Decreto Regulador de las condiciones para la Comercializacin y
Libre Circulacin Intracomunitaria de los Equipos de Proteccin Individual.
Ley 31/1995 Prevencin de riesgos laborales
Real Decreto 1627/1997 Disposiciones mnimas de seguridad y salud en obras de
construccin
Real Decreto 39/1997 Reglamento de los Servicios de Prevencin de Riesgos Laborales.
Real Decreto 485/1997 Disposiciones mnimas en materia de sealizacin de seguridad y
salud en el trabajo.
Real Decreto 486/1997 Establece las disposiciones mnimas de seguridad y salud en los
lugares de trabajo.
Real Decreto 487/1997 Disposiciones mnimas de seguridad y salud relativas a la
manipulacin manual de cargas que entrae riesgos, en particular dorsolumbares, para los
trabajadores.
Real Decreto 488/1997 Disposiciones mnimas de seguridad y salud relativos al trabajo con
equipos que incluyen pantallas de visualizacin.
Real Decreto 665/1997 Proteccin de los trabajadores contra los riesgos relacionados con
la exposicin a agentes cancergenos durante el trabajo.
Real Decreto 664/1997 Proteccin de los trabajadores contra los riesgos relacionados con
la exposicin a agentes biolgicos durante el trabajo.
Real Decreto 773/1997 Disposiciones mnimas de seguridad y salud relativas a la utilizacin
por los trabajadores de los EPI.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Real Decreto 1215/1997 Disposiciones mnimas de seguridad y salud para la utilizacin de


los trabajadores de los equipos de trabajo.
Real Decreto 614/2001 Disposiciones mnimas para la proteccin de la salud y seguridad de
los trabajadores frente al riesgo elctrico.
Real Decreto 374/2001 Proteccin de la Salud y Seguridad de los Trabajadores contra los
Riesgos relacionados con los Agentes Qumicos durante el Trabajo.
Ley 54/2003 Reforma del marco normativo de la prevencin de riesgos laborales.
Real Decreto 171/2004 Desarrolla L.P.R.L. en materia de coordinacin de actividades
empresariales.
Real Decreto 2177/2004 Modifica R.D. 1215/1997 que establece disposiciones mnimas de
seguridad y salud para el uso de equipos en trabajos temporales de altura.
Real Decreto 1311/2005, proteccin de la salud y la seguridad de los trabajadores frente a
los riesgos derivados o que puedan derivarse de la exposicin a vibraciones mecnicas.
Gua Tcnica para la evaluacin y prevencin de los riesgos relativos a la utilizacin de los
equipos de trabajo.
Real Decreto 286/2006, sobre la proteccin de la salud y la seguridad de los trabajadores
contra los riesgos relacionados con la exposicin al ruido.
Real Decreto 396/2006, por el que se establecen las disposiciones mnimas de seguridad y
salud aplicables a los trabajos con riesgo de exposicin al amianto.
Real Decreto 604/2006, que modifica el Real Decreto 39/1997 y el Real Decreto 1627/1997
antes mencionados.
Ley 32/2006, reguladora de la subcontratacin en el sector de la construccin y Real
Decreto 1109/2007 que la desarrolla.
Resolucin de 1 de agosto de 2007 de la Direccin General de Trabajo que inscribe y
publica el Convenio Colectivo General del Sector de la Construccin.
Real Decreto 1644/2008, de 10 de octubre, por el que se establecen las normas para la
comercializacin y puesta en servicio de las mquinas.
ADMINISTRATIVAS
Ley 30/2007, de 30 de octubre, de Contratos del Sector Pblico.
Real Decreto 817/2009, de 8 de mayo, por el que se desarrolla parcialmente la Ley 30/2007
de Contratos del Sector Pblico.
En todas las normas citadas anteriormente que con posterioridad a su publicacin y entrada
en vigor hayan sufrido modificaciones, correccin de errores o actualizaciones por
disposiciones ms recientes, se quedar a lo dispuesto en estas ltimas.

2. CONDICIONES TCNICAS de los MATERIALES, de la EJECUCIN y de las VERIFICACIONES


Se describen en este apartado las CONDICIONES TCNICAS PARTICULARES incluyendo los
siguientes aspectos:
PRESCRIPCIONES SOBRE LOS MATERIALES
- Caractersticas tcnicas mnimas que deben reunir los productos, equipos y sistemas que se
incorporen a la obra, as como sus condiciones de suministro, recepcin y conservacin,
almacenamiento y manipulacin, las garantas de calidad y el control de recepcin que
deba realizarse incluyendo el muestreo del producto, los ensayos a realizar, los criterios de
aceptacin y rechazo, y las acciones a adoptar y los criterios de uso, conservacin y
mantenimiento.
PRESCRIPCIONES EN CUANTO A LA EJECUCIN POR UNIDADES DE OBRA
- Caractersticas tcnicas de cada unidad de obra indicando su proceso de ejecucin,
normas de aplicacin, condiciones previas que han de cumplirse antes de su realizacin,
tolerancias admisibles, condiciones de terminacin, conservacin y mantenimiento, control
de ejecucin, ensayos y pruebas, garantas de calidad, criterios de aceptacin y rechazo,
criterios de medicin y valoracin de unidades, etc.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

- Las medidas para asegurar la compatibilidad entre los diferentes productos, elementos y
sistemas constructivos.
PRESCRIPCIONES SOBRE VERIFICACIONES EN EL EDIFICIO TERMINADO
- Las verificaciones y pruebas de servicio que deben realizarse para comprobar las
prestaciones finales del edificio.

2.1. DEMOLICIONES
El orden y la forma de ejecucin y los medios a emplear, se ajustarn a las prescripciones
establecidas en la Documentacin Tcnica.
Si as lo considera la direccin facultativa, antes de la demolicin se rodear el edificio con
vallas, verjas o muros, de dos metros de altura como mnimo y distanciados 1,5 m de la
fachada. Se colocarn luces rojas a distancias mximas de 10 m y en esquinas. Se
desconectarn las instalaciones del edificio y se protegern las alcantarillas y los elementos
de servicio pblico que pudieran verse afectados. No habr materiales txicos o peligrosos
acumulados en el edificio. Se vaciarn los depsitos y tuberas de fluidos combustibles o
peligrosos.
En caso de presencia de amianto, las labores de demolicin las realizarn empresas inscritas
en el Registro de empresas con riesgo por amianto. Previamente a sus trabajos elaborarn un
plan de trabajo que presentar para su aprobacin ante la autoridad laboral. El
cumplimiento de este plan deber supervisarse en obra por una persona con la cualificacin
necesaria.
Se garantizar que ningn trabajador est expuesto a una concentracin de amianto en el
aire superior al valor lmite expresado en el RD 396/2006 para lo que se realizar medicin por
laboratorios especializados reconocidos por la autoridad.
Los materiales que contengan amianto debern ser almacenados y transportados en
embalajes apropiados y con etiquetas reglamentarias que indiquen que contienen amianto
siendo transportados fuera del centro de trabajo lo antes posible.
Los trabajadores con riesgo de exposicin a amianto no realizarn horas extraordinarias ni
trabajarn por sistema de incentivos. Dispondrn de ropa de proteccin apropiada
facilitada y descontaminada por el empresario que ser necesariamente sustituida por la
ropa de calle antes de abandonar el centro de trabajo y la utilizacin de EPIs de las vas
respiratorias se limitar a un mximo de 4 horas diarias.
Se delimitar claramente la zona con riesgo de exposicin al amianto siendo inaccesibles
para personal no autorizado evitando la dispersin de polvo fuera de los locales o lugares de
accin y limpiando adecuadamente el rea afectada al fin de los trabajos.
Durante el proceso de demolicin, el contratista est obligado a realizar la gestin de
residuos establecido en el plan de residuos que previamente ha de haber sido aprobado por
la direccin facultativa y en todo caso de acuerdo que lo especificado en el RD 105/2008.

2.1.1. MANUAL
Descripcin
Derribo de edificaciones existentes elemento a elemento, de forma parcial o completa,
desde la cubierta a la cimentacin, con medios manuales.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Puesta en obra
No se permite el uso de llama en la demolicin y el uso de martillo neumtico, de
compresores o similares deber aprobarlo previamente la Direccin Facultativa.
La demolicin se har al mismo nivel, en orden inverso a la construccin, se descender
planta a planta de forma simtrica, eliminando la carga que gravita en los elementos antes
de demolerlos, contrarrestando o anulando las componentes horizontales de arcos y
bvedas, apuntalando elementos en voladizo, demoliendo estructuras hiperestticas en el
orden que implique menores flechas, giros y desplazamientos, y manteniendo o
introduciendo los arriostramientos necesarios.
Los elementos que pudieran producir cortes o lesiones se desmontarn sin trocear. Se
eliminarn o doblarn puntas y clavos de forma que no queden salientes. Si las piezas de
troceo no son manejables por una persona, se suspendern o apuntalarn de forma que no
se produzcan cadas bruscas ni vibraciones. En los abatimientos se permitirn giros pero no
desplazamiento de los puntos de apoyo. Slo se podrn volcar elementos cuando se
disponga de un lugar de cada consistente y de lado no menor a la altura del elemento ms
la mitad de la altura desde donde se lanza que en ningn caso ser mayor de 2 plantas. Se
regarn los elementos a demoler y los escombros para que no se produzca polvo, y en caso
necesario, se desinfectarn. Al finalizar la jornada no quedarn elementos inestables y se
tomarn las precauciones necesarias para que la lluvia no produzca daos.
El desescombro se har segn lo indique la direccin facultativa. Si se realiza mediante
canales, se inclinar el ltimo tramo para disminuir la velocidad de bajada del escombro, y la
boca de salida quedar a una altura mxima de 2 m sobre la base del camin. No se
acumular escombro en andamios, apoyado contra vallas, muros y soportes, ni se
acumularn ms de 100 kg/m sobre forjados.
Control y criterios de aceptacin y rechazo
Se harn controles cada 200 m de planta y como mnimo uno por planta, comprobando
que el orden, forma de ejecucin y medios empleados se corresponden a lo indicado en
proyecto y por la direccin facultativa.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
La medicin de la deconstruccin de los elementos que componen el edificio se realizar
utilizando los mismos criterios y unidades que seran empleados para la construccin de los
citados elementos y que se definen en el presente pliego de condiciones.

2.2. ACONDICIONAMIENTO del TERRENO


Engloba todas las operaciones necesarias para que el terreno adquiera las cotas y superficies
definidas en el proyecto. Dichas actividades son excavacin en vaciado, excavacin de
pozos y zanjas para albergar los elementos de cimentacin e instalaciones, explanacin y
estabilizacin de taludes.

2.2.1. ZANJAS y POZOS


Descripcin

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Quedan incluidos dentro de este apartado las tareas necesarias para ejecutar las zanjas y
pozos destinados a la cimentacin, drenaje, saneamiento, abastecimiento, etc. realizados
con medios manuales o mecnicos con anchos de excavacin mximos de 2 m. y 7 m. de
profundidad.
Puesta en obra
Previo a los trabajos de excavacin, la direccin facultativa deber tener aprobado el
replanteo, para lo cual este ha de estar definido en obra mediante camillas y cordeles.
El contratista deber conocer la situacin de las instalaciones existentes tanto en el subsuelo
como areas con el fin de mantener la distancia de seguridad requerida para evitar
accidentes. En esta misma lnea se valorarn las cimentaciones prximas para evitar
descalces o desprendimientos. Se protegern los elementos de servicio pblico que pudieran
ser afectados por la excavacin.
Cuando al excavar se encuentre cualquier anomala no prevista (instalaciones, rocas...) o
construcciones que traspasen los lmites del vaciado se comunicar a la Direccin
Facultativa antes de continuar con la excavacin.
En las excavaciones realizadas con el objeto de encontrar firme de cimentacin, es el
director de la obra el encargado de sealar la cota fondo de excavacin, determinando
dicha cota en obra en funcin del material aparecido. En este tipo de excavaciones
destinados a cimentacin, no se excavarn los ltimos 40 cm. hasta el mismo momento del
hormigonado para evitar la disgregacin del fondo de excavacin, limpiando la misma de
material suelto mediante medios manuales.
Se evitar el acceso de agua a zanjas excavadas, evacuando la misma inmediatamente en
caso de no poder evitarse.
Se harn las entibaciones necesarias para asegurar la estabilidad de los taludes. La
entibacin permitir desentibar una franja dejando las restantes franjas entibadas.
Se tomarn las medidas necesarias para que no caigan materiales de excavados u otros a la
zanja o pozo.
Control y criterios de aceptacin y rechazo
Se inspeccionarn las zanjas cada 20 m. o fraccin y los pozos cada unidad.
Durante la excavacin se controlarn los terrenos atravesados, compacidad, cota de fondo,
excavacin colindante a medianeras, nivel fretico y entibacin.
Una vez terminada la excavacin se comprobarn las formas, dimensiones, escuadras,
cotas y pendientes exigidas rechazando las irregularidades superiores a las tolerancias
admitidas que se corregirn de acuerdo con las instrucciones de la direccin facultativa.
Las tolerancias mximas admisibles sern:
replanteo: 2,5 % en errores y +-10 cm. en variaciones.
formas y dimensiones: +-10 cm.
refino de taludes: 15 cm.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
La medicin se calcular segn los perfiles tericos de excavacin segn el tipo de terreno
excavado, considerando la profundidad necesaria de excavacin realizada.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

TRANSPORTE de TIERRAS

Descripcin
Operaciones necesarias para trasladar a vertedero los materiales sobrantes procedentes de
la excavacin y los escombros.
Puesta en obra
Se establecern recorridos de circulacin en el interior de la obra para los camiones,
realizando los vaciados, rampas o terraplenes necesarios y contando con la ayuda de un
auxiliar que gue al conductor en las maniobras.
Las rampas para la maquinaria tendrn el talud natural que exija el terreno y si se transportan
tierras situadas por debajo de la cota 0,00 su anchura mnima ser de 4,5 m, ensanchndose
en las curvas y con pendientes mximas del 12% en tramos rectos o del 8% en tramos curvos.
El camin se cargar por los laterales o por la parte trasera no pasando en ningn caso por
encima de la cabina.
Control y criterios de aceptacin y rechazo
Tanto la disposicin de las vas de circulacin como las rampas y terraplenes realizados
contarn con la supervisin y aprobacin de la direccin facultativa.
La carga de los camiones no exceder en ningn caso la mxima permitida para cada
aparato y en cualquier caso el material no exceder la parte superior de la baera, se
proteger con lona y se limpiar el vehculo de barro antes de acceder a la calzada pblica.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
La medicin se calcular aplicando el coeficiente de esponjamiento al material a transportar
y considerando la distancia a vertedero.

2.3. CIMENTACIN
La cimentacin est constituida por elementos de hormign, cuya misin es transmitir las
cargas del edificio al terreno y anclar el edificio contra empujes horizontales.
Antes de proceder a la ejecucin de los trabajos es necesario ubicar las acometidas de los
distintos servicios, tanto los existentes como los previstos para el propio edificio.
El contratista no rellenar ninguna estructura hasta que se lo indique la direccin facultativa.
La construccin de cimentaciones est regulada por el Cdigo Tcnico de la Edificacin en
su Documento Bsico de Seguridad Estructural-Cimientos.

FABRICACIN de HORMIGN ARMADO

Descripcin

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Dentro de este apartado se engloban todas las condiciones propias de la fabricacin de


hormign armado. La norma bsica de referencia ser el Real Decreto 1247/2008 Instruccin
de Hormign Estructural EHE-08.
Materiales
El constructor dispondr de un sistema de gestin de materiales, productos y elementos a
poner en obra que garantice la trazabilidad de los mismos segn 66.2 de la EHE-08.

Cemento: Segn el artculo 26 de la EHE-08, RC-08, normas armonizadas UNE-EN 197 y


RD 1313/1988. En todo caso se emplearn cementos de clase resistente 32,5 o superior.
El cemento se suministrar acompaado de un albarn con los datos exigidos en la RC-08. En
el caso de cementos comunes irn acompaados del certificado de conformidad con el
marcado CE por organismo notificado y la declaracin del fabricante CE de conformidad, el
resto de cementos incluirn certificado de conformidad con requisitos reglamentarios.
Cuando el suministro se realice en sacos, el cemento se recibir en los mismos envases
cerrados en que fue expedido. No llegar a obra u otras instalaciones de uso, excesivamente
caliente. Se almacenar en sitio ventilado y defendido de la intemperie, humedad del suelo
y paredes, y durante un mximo de 3 meses, 2 y 1, respectivamente, para las clases
resistentes 32.5, 42.5 y 52.5, si el periodo es superior, se comprobar que las caractersticas del
cemento siguen siendo adecuadas mediante ensayos segn lo especificado en el RC-08.
Se utilizarn los tipos de cementos adecuados segn el tipo de hormign y su uso teniendo
en cuenta lo especificado en el anejo 8 del RC-08 y la tabla 26 de la EHE-08. Destacar
particularmente que no se emplearn cementos de albailera para la fabricacin de
hormigones. Para hormigones en contacto con suelos con sulfatos (> 3.000 mg/kg) o con
aguas con sulfatos (>600 mg/l) se emplear cemento resistente a los mismos. Del mismo
modo hormigones en contacto con agua de mar requerirn cementos aptos para el mismo.
Se utilizar el cemento de la menor clase resistente posible compatible con la resistencia del
hormign.
Agua: Se atendr a lo dispuesto en el artculo 27 de la EHE-08.
El agua utilizada tanto para amasado como para curado no contendr ningn ingrediente
perjudicial en cantidades tales que afecten a las propiedades del hormign o a la
proteccin de las armaduras frente a la corrosin. Cuando no sean potables, no posean
antecedentes de su utilizacin o en caso de duda, debern analizarse las aguas, y salvo
justificacin especial debern cumplir las condiciones de exponente de hidrgeno pH,
sustancias disueltas, sulfatos, in cloruro, hidratos de carbono y sustancias orgnicas solubles
en ter indicadas en el artculo 27 de la EHE-08. Se prohbe el uso de aguas de mar o salinas
anlogas para el amasado o curado de hormign armado.
ridos: Cumplirn las condiciones del artculo 28 de la EHE-08.
Pueden emplearse gravas de machaqueo o rodadas, arenas y escorias siderrgicas
apropiadas que dispongan de marcado CE. Los ridos debern cumplir las condiciones
qumicas, fsico-mecnicas, de granulometra, tamao y forma indicadas en artculo 28 de la
EHE-08 y en la norma armonizada UNE-EN 12620, en caso de duda, el fabricante deber
realizar ensayos de identificacin mediante anlisis mineralgicos, petrolgicos, fsicos o
qumicos. En el caso de utilizar escorias siderrgicas como rido, se comprobar previamente
que son estables. Se prohbe el empleo de ridos que contengan sulfuros oxidables.
Cada carga ir acompaada por hoja de suministro que estar en todo momento a
disposicin de la Direccin Facultativa, en la que figuren los datos indicados en la EHE-08, el
marcado CE y la declaracin de conformidad del producto segn este marcado.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Los ridos deben ser transportados y acopiados de manera que se evite su segregacin y
contaminacin, debiendo mantener las caractersticas granulomtricas de cada una de sus
fracciones.
Para el empleo de ridos reciclados ser preciso el consentimiento expreso por escrito de la
Direccin Facultativa, se limitar a un 20 % en peso sobre el contenido de rido, proceder
de hormign no admitindose materiales de otra naturaleza y adaptar sus caractersticas a
lo expresado en el anejo 15 de la EHE-08.
La utilizacin de ridos ligeros estar limitada a las especificaciones del anejo 16 de la EHE-08.
Aditivos: Cumplirn lo establecido en el artculo 29 de la EHE-08 y en las normas
armonizadas UNE-EN 934-2. Bsicamente se contemplan: reductores de agua, modificadores
del fraguado, inclusores de aire y multifuncionales.
El fabricante garantizar que las caractersticas y el comportamiento del aditivo, agregado
en las proporciones y condiciones previstas, son tales que produce la funcin deseada sin
perturbar excesivamente las restantes caractersticas del hormign, ni representar peligro
para las armaduras.
Los aditivos se transportarn y almacenarn de manera que se evite su contaminacin y que
sus propiedades no se vean afectadas por factores fsicos o qumicos. El fabricante
suministrar el aditivo correctamente etiquetado y dispondr de marcado CE aportando la
ficha de declaracin de conformidad a dicho marcado.
La Direccin Facultativa deber autorizar su utilizacin y en su incorporacin a la mezcla se
seguir estrictamente lo dispuesto por el fabricante. El suministrador del hormign ser
informado de la posible incorporacin de aditivos en obra.
Adiciones: Cumplirn lo establecido en el artculo 30 de la EHE-08.
Tan solo se utilizarn en el momento de su fabricacin, exclusivamente en central, podrn
ser cenizas volantes o humo de slice, siempre en hormigones con cementos tipo CEM I y su
empleo contar con el visto previo de la Direccin Facultativa. La cantidad mxima de
cenizas volantes adicionadas ser del 35 % del peso del cemento y de humo de slice del 10
%.
No podrn contener elementos perjudiciales en cantidades tales que puedan afectar a la
durabilidad del hormign o causar fenmenos de corrosin de las armaduras, y cumplirn las
especificaciones indicadas en 30.1 y 30.2 de la EHE-08.
Armaduras:
Armaduras pasivas: Cumplirn lo establecido en la UNE-EN 10080 y el artculo 32 de la EHE-08.
Las barras y alambres no presentarn defectos superficiales ni grietas y tendrn una seccin
equivalente no inferior al 95,5% de la nominal. Las caractersticas mecnicas mnimas estarn
garantizadas por el fabricante segn la tabla 32.2.a de la EHE-08. Se suministrarn con una
etiqueta de identificacin conforme a lo especificado en normas UNE-EN y llevarn
grabadas las marcas de identificacin de acuerdo con dichas normas. Las mallas
electrosoldadas se fabricarn con barras o alambres corrugados que no se mezclarn entre
s por distintas tipologas de acero y cumplirn lo dispuesto en el artculo 33.1.1 de la EHE-08.
Armaduras activas: Cumplirn lo establecido en las UNE 36094 y el artculo 34 de la EHE-08.
Los elementos constituyentes de las armaduras activas pueden ser alambres, barras o
cordones. El fabricante facilitar adems, si se le solicita, copia de los resultados de los
ensayos de control de produccin correspondientes a la partida servida de los ensayos
correspondientes a la composicin qumica, caractersticas mecnicas y geomtricas, que
justifiquen que el acero cumple las caractersticas exigidas por la EHE-08. Adems ir
acompaada, en el caso de barras o alambres corrugados, del certificado especfico de
adherencia.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

El acero puesto en obra ha de mantener sus cualidades y caractersticas intactas desde su


fabricacin por lo que en su almacenamiento y transporte estarn protegidas de la lluvia,
humedad del terreno u otros agentes o materias agresivas. En el momento de su utilizacin,
las armaduras deben estar exentas de sustancias extraas en su superficie tales como grasa,
aceite, pintura, polvo, tierra o cualquier otro material perjudicial para su buena conservacin
o su adherencia.
Puesta en obra
La puesta en obra se atendr estrictamente a lo dispuesto en las Instrucciones EHE-08 y NCSE02.
Las armaduras se dispondrn sujetas entre s de manera que no vare su posicin durante el
transporte, montaje y hormigonado, y permitan al hormign envolverlas sin dejar coqueras.
En el corte de la ferralla se pueden emplear cizallas o maquinaria de corte no estando
permitido el uso del arco elctrico, sopletes u otros mtodos que alteren las caractersticas
fsico-metalrgicas del material. El despiece, enderezado, corte y doblado de las barras se
har de acuerdo al artculo 69.3 de la EHE-08. Los empalmes de armaduras en obra debern
realizarse con la aprobacin expresa de la direccin facultativa y los realizados por
soldadura debern atenerse a los procedimientos de soldadura descritos en la UNE 36832, las
superficies estarn secas y limpias, y no se realizarn con viento intenso, lluvia o nieve, a
menos que se adopten las debidas precauciones. Bajo ninguna circunstancia se llevar a
cabo una soldadura sobre una superficie que se encuentre a una temperatura igual o inferior
a 0 C. Queda prohibida la soldadura de armaduras galvanizadas o con recubrimientos
epoxdicos. Se dispondrn separadores o calzos en obra, segn 69.8.2 EHE-08, para garantizar
la posicin de las armaduras y los recubrimientos.
El hormign estructural requiere estar fabricado en central conforme al artculo 71 de la EHE08 pudiendo estar la central en obra o en instalaciones exclusivas en cuyo caso se denomina
hormign preparado. El hormign deber quedar mezclado de forma homognea
empleando la dosificacin de todos sus componentes por peso, segn lo dispuesto en
proyecto y la EHE-08, quedando el rido bien recubierto de pasta de cemento. La
dosificacin mnima de cemento ser la sealada en 37.3 EHE-08. El hormign no
experimentar, durante el transporte, variacin sensible en las caractersticas que posea
recin amasado.
Cada carga de hormign ir acompaada de una hoja de suministro que estar en todo
momento a disposicin de la Direccin de Obra, y en la que figurarn como mnimo, los
datos indicados en el anejo 21 de la EHE-08. El fabricante de este hormign deber
documentar debidamente la dosificacin empleada, que deber ser aceptada por la
Direccin de la Obra. En hormigones fabricados en central ubicada en obra el constructor
dejar un libro de registro a disposicin de la direccin facultativa firmado por persona fsica
en el que constarn las dosificaciones, proveedores, equipos empleados, referencia al
documento de calibrado de la balanza de dosificacin, registro de amasadas empleadas en
cada lote, fechas de hormigonado y resultados de los ensayos realizados.
El tiempo trascurrido entre la adicin del agua de amasado y la colocacin del hormign no
debe ser mayor de una hora y media para hormign sin promotores o retardadores
defraguado y en ningn caso se tolerar la colocacin en obra de masas que acusen un
principio de fraguado. Queda expresamente prohibida la adicin de agua en obra al
hormign. Se puede aadir en obra plastificante o superplastificante siempre que no se
sobrepasen los lmites establecidos y siempre con el visto bueno del fabricante. En el vertido y
colocacin de las masas se adoptarn las debidas precauciones para evitar la disgregacin
de la mezcla. A partir de 1 metro de altura, el hormigonado no puede hacerse por vertido
libre siendo necesario el empleo de canaletas o conductos que eviten el golpeo del
hormign. No se efectuar el hormigonado sin la conformidad de la Direccin de la Obra,

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

una vez se hayan revisado las armaduras. La compactacin de hormigones se realizar de


manera tal que se eliminen los huecos y se obtenga un perfecto cerrado de la masa, sin que
llegue a producirse segregacin. Se realizar segn lo expuesto en 71.5.2 EHE-08.
Las juntas de hormigonado se situarn en direccin lo ms normal posible a las de las
tensiones de compresin, y all donde su efecto sea menos perjudicial, alejndolas de las
zonas en las que la armadura est sometida a fuertes tracciones, en cualquier caso el lugar
de las juntas deber ser aprobado por la Direccin Facultativa. Antes de reanudar el
hormigonado, se retirar la capa superficial de mortero, dejando los ridos al descubierto y
se limpiar la junta de toda suciedad o rido que haya quedado suelto, se humedecer la
superficie y debern eliminarse, en su caso, las partes daadas por el hielo empleando
promotores de adherencia si fuese necesario.
Queda terminantemente prohibido hormigonar si llueve, nieva, hay viento excesivo,
temperaturas superiores a 40 C, soleamiento directo, o se prevea una temperatura de 0 C
en las prximas 48 horas. Si el hormigonado es imprescinble se adaptarn las medidas
pertinentes y se contar con la autorizacin expresa de la Direccin Facultativa y el
fabricante.
Durante el fraguado y primer perodo de endurecimiento del hormign, deber asegurarse el
mantenimiento de la humedad mediante un adecuado curado, durante el plazo necesario
en funcin del tipo y clase del cemento, de la temperatura y grado de humedad del
ambiente, etc. segn lo especificado en el punto 71.6 de la EHE-08. Si el curado se realiza por
riego directo, no producir deslavado. En caso de optar por la proteccin del hormign con
recubrimientos plsticos, agentes filmgenos o similares ofrecern las suficientes garantas y
no resultarn perjudiciales para las prestaciones del hormign endurecido o posteriores
recubrimientos.
Los productos desencofrantes sern de naturaleza adecuada y no sern perjudiciales para
las propiedades o el aspecto del hormign y no perjudicarn a la posterior aplicacin de
revestimientos. Expresamente queda prohibido el empleo de grasa, gasleo u otros
productos no apropiados. Las superficies vistas no presentarn coqueras o irregularidades
que perjudiquen al comportamiento de la obra o a su aspecto.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
El contratista aportar un programa de control de calidad segn contenidos estipulados en
79.1 de la EHE-08 que deber se aprobado por la Direccin Facultativa y que desarrollar el
plan de control que se incluye en proyecto. La Direccin Facultativa podr disponer en
cualquier momento la realizacin de comprobaciones o ensayos adicionales.
Si el cemento dispone de distintivo de calidad reconocido oficialmente segn RC-08 se
comprobar la identificacin, clase, tipo, categora y distintivos, de otro modo la direccin
facultativa podr requerir la realizacin de ensayos de resistencias mecnicas, tiempos de
fraguado, expansin, prdida al fuego, residuo insoluble, trixido de azufre, cloruros, sulfuros,
xido de aluminio y puzolanidad.
Los aditivos contarn con marcado CE en caso contrario se deber aportar certificado de
ensayo con antigedad inferior a 6 meses segn los dispuesto en 85.3 EHE-08.
Para la recepcin de aceros se comprobar que disponen de un distintivo de calidad con
reconocimiento oficial en vigor, en caso contrario se realizarn ensayos segn 87 EHE-08.
En caso de que las armaduras elaboradas o ferralla armada no cuente con un distintivo de
calidad oficialmente reconocido conforme anejo 19 EHE-08 se realizar control experimental
del para comprobar caractersticas mecnicas, adherencia, dimensiones o de soldadura.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Los ensayos del hormign se realizarn segn lo dispuesto en el programa de control y en el


artculo 86 EHE-08. Los ensayos de docilidad sern segn UNE-EN 12350 y los de resistencia y
resistencia a la penetracin de agua segn UNE-EN 12390.
Se realizarn ensayos de hormign previos y caractersticos si se dan las circunstancias
especificadas en 86.4 y anejo 20 EHE-08.
Se har un control de la ejecucin por lotes segn artculo 92 de la EHE-08, haciendo
comprobaciones previas al comienzo de la ejecucin, control de acopios, comprobaciones
de replanteo y geomtricas, cimbras y andamiajes, armaduras, encofrados, transporte,
vertido y compactacin, juntas de trabajo, contraccin o dilatacin, curado, desmoldeo y
descimbrado, tolerancias y dimensiones finales.
Las tolerancias mximas admisibles sern:
Dosificacin: +-3 % en cemento, ridos, agua y adiciones y +-5 % en aditivos.
Recubrimiento armaduras activas: +-5 mm. en elementos prefabricado y +-10 mm. in situ.
Resistencia caracterstica del hormign segn EHE-08.
Consistencia del hormign segn tabla 86.5.2.1 de la EHE-08.
Desviaciones admisibles segn anejo 11 EHE-08.
Las caractersticas higrotrmicas de los materiales contemplados en el proyecto sern:
Material

Transmitancia (W/m2 K)

Absortividad

Hormign armado

5,7

0,7

Hormign en masa

0,7

Las caractersticas de los materiales puestos en obra, tendrn las prestaciones sealadas
anteriormente o superiores, de otro modo, habrn de ser autorizados previamente por la
direccin facultativa.

2.3.1. ZAPATAS
Descripcin
Zapatas de hormign en masa o armado con planta cuadrada, rectangular o de desarrollo
lineal, como cimentacin de soportes verticales pertenecientes a estructuras de edificacin.
Puesta en obra
Antes de verter el hormign se nivelar, limpiar y apisonar ligeramente el fondo de la
excavacin. Se garantizar que las zapatas apoyen en condiciones homogneas. En suelos
permeables, se agotar el agua durante la excavacin sin comprometer la estabilidad de
taludes o de obras vecinas.
Se verter una capa de mnimo 10 cm. de hormign de limpieza sobre la superficie de la
excavacin previa a la colocacin de armaduras. La excavacin del fondo tendr lugar
inmediatamente antes de la puesta en obra del hormign de limpieza para que el suelo
mantenga las condiciones inalteradas.
El hormigonado se realizar por tongadas cuyo espesor permita una compactacin
completa de la masa. Se realizar un vibrado mecnico debiendo refluir la pasta a la
superficie segn 71.5.2 EHE-08.
En zapatas aisladas el hormigonado ser continuo y no se permitir el paso de instalaciones
mientras que en las zapatas corridas se deber contar con el consentimiento de la Direccin
Facultativa para ello. Las juntas de hormigonado se harn segn el artculo 71.5.4 EHE-08, se

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

situarn en los tercios de la distancia entre pilares, alejadas de zonas rgidas y muros de
esquina, eliminando la lechada del antiguo y humedeciendo antes de verter el fresco.
El recubrimiento de la armadura se garantizar mediante la disposicin de separadores y se
ajustar a las especificaciones del 37.2 EHE-08. Los separadores sern elementos
especialmente diseados para tal fin, de naturaleza no atacable por la alcalinidad del
hormign, no introducirn corrosin en las armaduras, sern tan impermeables como el
propio hormign. Expresamente queda prohibido el uso de separadores de madera, ladrillo u
otros elementos residuales de la obra.
Para el anclaje y empalme de armaduras se atender a lo dispuesto en 69.5 EHE-08.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Antes de la ejecucin, se realizar la confirmacin del estudio geotcnico, comprobando
visualmente o con pruebas, que el terreno se corresponde con las previsiones de proyecto.
Informe del resultado de tal inspeccin, la profundidad de la cimentacin, su forma,
dimensiones, y el tipo y consistencia del terreno se incorporar a la documentacin final de
obra asumiendo el director de obra la mxima responsabilidad en esta cuestin.
En su caso, se comprobarn cimentaciones y edificios colindantes para garantizar que no se
ven afectadas.
Se debe comprobar que: el nivel de apoyo de la cimentacin se ajusta al previsto, la
estratigrafa coincide con la estimada en el estudio geotcnico, el nivel fretico y las
condiciones hidrogeolgicas se ajustan a las previstas, el terreno presenta una resistencia y
humedad similar a la supuesta en el estudio geotcnico, no se detectan defectos evidentes
como cavernas, fallas, galeras, pozos, corrientes subterrneas, etc.
Se realizar un control por cada zapata, comprobando la distancia entre ejes de replanteo,
dimensiones y orientacin de los pozos, correcta colocacin de los encofrados, hormign de
limpieza con espesor y planeidad suficiente, tipo, disposicin, nmero y dimensiones de
armaduras, armaduras de esperas correctamente situadas y de la longitud prevista,
recubrimiento de las armaduras previsto, vertido, compactacin y curado del hormign,
planeidad, horizontalidad y verticalidad de la superficie, adherencia entre hormign y acero,
unin con otros elementos de cimentacin y juntas de hormigonado.
Las tolerancias mximas admisibles sern las establecidas en el anejo 11 de la EHE-08.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
La medicin de zapatas se realizar considerando el volumen terico de proyecto. El
hormign de limpieza se valorar segn planta terica de proyecto multiplicado por
profundidad real ordenada por la direccin facultativa.

2.3.2. SOLERAS
Descripcin
Capa resistente de hormign en masa o armado, situada sobre el terreno natural o
encachado de material de relleno cuya superficie superior quedar vista o recibir un
revestimiento de acabado.
Materiales

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

El constructor dispondr de un sistema de gestin de materiales, productos y elementos a


poner en obra que garantice la trazabilidad de los mismos segn 66.2 de la EHE-08.
Hormign armado, segn lo dispuesto en el punto especfico de este mismo Pliego.
Sellante de juntas: De material elstico, fcilmente introducible en las juntas. Tendr
concedido el correspondiente DIT.
Fibras de polipropileno (si slo se quiere evitar la fisuracin) o de acero (si adems se quiere
aumentar la resistencia del hormign).
Separador: De poliestireno expandido, de 2 cm de espesor.
Puesta en obra
Se verter el hormign del espesor indicado en proyecto sobre el terreno limpio y
compactado, la capa de encachado o sobre la lmina impermeabilizante si existe.
Se colocarn separadores alrededor de cualquier elemento que interrumpa la solera antes
de verter el hormign y tendrn una altura igual al espesor de la capa de hormign.
En el caso de que lleve mallazo, ste se colocar en el tercio superior de la capa de
hormign.
Si se arma con fibras de acero se har un vibrado correcto, de forma que las fibras no
queden en superficie.
Se harn juntas de retraccin de ancho comprendido entre 0,5 y 1 cm. a distancias mximas
de 6 m y de profundidad de 1/3 del espesor de la capa de hormign. El sellante se
introducir en un cajeado previsto en la capa de hormign o realizado posteriormente a
mquina, entre las 24 y 48 horas posteriores al hormigonado.
En juntas de trabajo u otras discontinuidades se dispondrn elementos conectores, tales
como barras de acero corrugado o un machihembrado (si las cargas que transmite no son
elevadas) de forma que las dos partes de la solera sean solidarias.
Se extramar el cuidado en el curado del hormign segn 71.6 EHE-08.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Cada 100 m o fraccin se realizar un control de la compacidad del terreno, del espesor de
la solera y planeidad medida por regla de 3 m. se har una inspeccin general de la
separacin entre juntas y cada 10 m. de junta se comprobar su espesor y altura.
Las tolerancias mximas admisibles sern las establecidas en el anejo 11 de la EHE-08.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
La medicin se realizar considerando la superficie terica de proyecto.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
No se alterar su configuracin o solicitaciones sin valoracin por tcnico competente.
Anualmente, tras la poca de lluvias, se inspeccionarn las juntas y arquetas. Cada cinco
aos se incluir la revisin de soleras por tcnico competente.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

2.4. ESTRUCTURA
2.4.1. FABRICACIN de HORMIGN ARMADO
Descripcin
Dentro de este apartado se engloban todas las condiciones propias de la fabricacin de
hormign armado. La norma bsica de referencia ser el Real Decreto 1247/2008 Instruccin
de Hormign Estructural EHE-08.
Materiales
El constructor dispondr de un sistema de gestin de materiales, productos y elementos a
poner en obra que garantice la trazabilidad de los mismos segn 66.2 de la EHE-08.

Cemento: Segn el artculo 26 de la EHE-08, RC-08, normas armonizadas UNE-EN 197 y


RD 1313/1988. En todo caso se emplearn cementos de clase resistente 32,5 o superior.
El cemento se suministrar acompaado de un albarn con los datos exigidos en la RC-08. En
el caso de cementos comunes irn acompaados del certificado de conformidad con el
marcado CE por organismo notificado y la declaracin del fabricante CE de conformidad, el
resto de cementos incluirn certificado de conformidad con requisitos reglamentarios.
Cuando el suministro se realice en sacos, el cemento se recibir en los mismos envases
cerrados en que fue expedido. No llegar a obra u otras instalaciones de uso, excesivamente
caliente. Se almacenar en sitio ventilado y defendido de la intemperie, humedad del suelo
y paredes, y durante un mximo de 3 meses, 2 y 1, respectivamente, para las clases
resistentes 32.5, 42.5 y 52.5, si el periodo es superior, se comprobar que las caractersticas del
cemento siguen siendo adecuadas mediante ensayos segn lo especificado en el RC-08.
Se utilizarn los tipos de cementos adecuados segn el tipo de hormign y su uso teniendo
en cuenta lo especificado en el anejo 8 del RC-08 y la tabla 26 de la EHE-08. Destacar
particularmente que no se emplearn cementos de albailera para la fabricacin de
hormigones. Para hormigones en contacto con suelos con sulfatos (> 3.000 mg/kg) o con
aguas con sulfatos (>600 mg/l) se emplear cemento resistente a los mismos. Del mismo
modo hormigones en contacto con agua de mar requerirn cementos aptos para el mismo.
Se utilizar el cemento de la menor clase resistente posible compatible con la resistencia del
hormign.
Agua: Se atendr a lo dispuesto en el artculo 27 de la EHE-08.
El agua utilizada tanto para amasado como para curado no contendr ningn ingrediente
perjudicial en cantidades tales que afecten a las propiedades del hormign o a la
proteccin de las armaduras frente a la corrosin. Cuando no sean potables, no posean
antecedentes de su utilizacin o en caso de duda, debern analizarse las aguas, y salvo
justificacin especial debern cumplir las condiciones de exponente de hidrgeno pH,
sustancias disueltas, sulfatos, in cloruro, hidratos de carbono y sustancias orgnicas solubles
en ter indicadas en el artculo 27 de la EHE-08. Se prohbe el uso de aguas de mar o salinas
anlogas para el amasado o curado de hormign armado.
ridos: Cumplirn las condiciones del artculo 28 de la EHE-08.
Pueden emplearse gravas de machaqueo o rodadas, arenas y escorias siderrgicas
apropiadas que dispongan de marcado CE. Los ridos debern cumplir las condiciones
qumicas, fsico-mecnicas, de granulometra, tamao y forma indicadas en artculo 28 de la
EHE-08 y en la norma armonizada UNE-EN 12620, en caso de duda, el fabricante deber
realizar ensayos de identificacin mediante anlisis mineralgicos, petrolgicos, fsicos o

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

qumicos. En el caso de utilizar escorias siderrgicas como rido, se comprobar previamente


que son estables. Se prohbe el empleo de ridos que contengan sulfuros oxidables.
Cada carga ir acompaada por hoja de suministro que estar en todo momento a
disposicin de la Direccin Facultativa, en la que figuren los datos indicados en la EHE-08, el
marcado CE y la declaracin de conformidad del producto segn este marcado.
Los ridos deben ser transportados y acopiados de manera que se evite su segregacin y
contaminacin, debiendo mantener las caractersticas granulomtricas de cada una de sus
fracciones.
Para el empleo de ridos reciclados ser preciso el consentimiento expreso por escrito de la
Direccin Facultativa, se limitar a un 20 % en peso sobre el contenido de rido, proceder
de hormign no admitindose materiales de otra naturaleza y adaptar sus caractersticas a
lo expresado en el anejo 15 de la EHE-08.
La utilizacin de ridos ligeros estar limitada a las especificaciones del anejo 16 de la EHE-08.
Aditivos: Cumplirn lo establecido en el artculo 29 de la EHE-08 y en las normas
armonizadas UNE-EN 934-2. Bsicamente se contemplan: reductores de agua, modificadores
del fraguado, inclusores de aire y multifuncionales.
El fabricante garantizar que las caractersticas y el comportamiento del aditivo, agregado
en las proporciones y condiciones previstas, son tales que produce la funcin deseada sin
perturbar excesivamente las restantes caractersticas del hormign, ni representar peligro
para las armaduras.
Los aditivos se transportarn y almacenarn de manera que se evite su contaminacin y que
sus propiedades no se vean afectadas por factores fsicos o qumicos. El fabricante
suministrar el aditivo correctamente etiquetado y dispondr de marcado CE aportando la
ficha de declaracin de conformidad a dicho marcado.
La Direccin Facultativa deber autorizar su utilizacin y en su incorporacin a la mezcla se
seguir estrictamente lo dispuesto por el fabricante. El suministrador del hormign ser
informado de la posible incorporacin de aditivos en obra.
Adiciones: Cumplirn lo establecido en el artculo 30 de la EHE-08.
Tan solo se utilizarn en el momento de su fabricacin, exclusivamente en central, podrn
ser cenizas volantes o humo de slice, siempre en hormigones con cementos tipo CEM I y su
empleo contar con el visto previo de la Direccin Facultativa. La cantidad mxima de
cenizas volantes adicionadas ser del 35 % del peso del cemento y de humo de slice del 10
%.
No podrn contener elementos perjudiciales en cantidades tales que puedan afectar a la
durabilidad del hormign o causar fenmenos de corrosin de las armaduras, y cumplirn las
especificaciones indicadas en 30.1 y 30.2 de la EHE-08.
Armaduras:
Armaduras pasivas: Cumplirn lo establecido en la UNE-EN 10080 y el artculo 32 de la EHE-08.
Las barras y alambres no presentarn defectos superficiales ni grietas y tendrn una seccin
equivalente no inferior al 95,5% de la nominal. Las caractersticas mecnicas mnimas estarn
garantizadas por el fabricante segn la tabla 32.2.a de la EHE-08. Se suministrarn con una
etiqueta de identificacin conforme a lo especificado en normas UNE-EN y llevarn
grabadas las marcas de identificacin de acuerdo con dichas normas. Las mallas
electrosoldadas se fabricarn con barras o alambres corrugados que no se mezclarn entre
s por distintas tipologas de acero y cumplirn lo dispuesto en el artculo 33.1.1 de la EHE-08.
Armaduras activas: Cumplirn lo establecido en las UNE 36094 y el artculo 34 de la EHE-08.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Los elementos constituyentes de las armaduras activas pueden ser alambres, barras o
cordones. El fabricante facilitar adems, si se le solicita, copia de los resultados de los
ensayos de control de produccin correspondientes a la partida servida de los ensayos
correspondientes a la composicin qumica, caractersticas mecnicas y geomtricas, que
justifiquen que el acero cumple las caractersticas exigidas por la EHE-08. Adems ir
acompaada, en el caso de barras o alambres corrugados, del certificado especfico de
adherencia.
El acero puesto en obra ha de mantener sus cualidades y caractersticas intactas desde su
fabricacin por lo que en su almacenamiento y transporte estarn protegidas de la lluvia,
humedad del terreno u otros agentes o materias agresivas. En el momento de su utilizacin,
las armaduras deben estar exentas de sustancias extraas en su superficie tales como grasa,
aceite, pintura, polvo, tierra o cualquier otro material perjudicial para su buena conservacin
o su adherencia.
Puesta en obra
La puesta en obra se atendr estrictamente a lo dispuesto en las Instrucciones EHE-08 y NCSE02.
Las armaduras se dispondrn sujetas entre s de manera que no vare su posicin durante el
transporte, montaje y hormigonado, y permitan al hormign envolverlas sin dejar coqueras.
En el corte de la ferralla se pueden emplear cizallas o maquinaria de corte no estando
permitido el uso del arco elctrico, sopletes u otros mtodos que alteren las caractersticas
fsico-metalrgicas del material. El despiece, enderezado, corte y doblado de las barras se
har de acuerdo al artculo 69.3 de la EHE-08. Los empalmes de armaduras en obra debern
realizarse con la aprobacin expresa de la direccin facultativa y los realizados por
soldadura debern atenerse a los procedimientos de soldadura descritos en la UNE 36832, las
superficies estarn secas y limpias, y no se realizarn con viento intenso, lluvia o nieve, a
menos que se adopten las debidas precauciones. Bajo ninguna circunstancia se llevar a
cabo una soldadura sobre una superficie que se encuentre a una temperatura igual o inferior
a 0 C. Queda prohibida la soldadura de armaduras galvanizadas o con recubrimientos
epoxdicos. Se dispondrn separadores o calzos en obra, segn 69.8.2 EHE-08, para garantizar
la posicin de las armaduras y los recubrimientos.
El hormign estructural requiere estar fabricado en central conforme al artculo 71 de la EHE08 pudiendo estar la central en obra o en instalaciones exclusivas en cuyo caso se denomina
hormign preparado. El hormign deber quedar mezclado de forma homognea
empleando la dosificacin de todos sus componentes por peso, segn lo dispuesto en
proyecto y la EHE-08, quedando el rido bien recubierto de pasta de cemento. La
dosificacin mnima de cemento ser la sealada en 37.3 EHE-08. El hormign no
experimentar, durante el transporte, variacin sensible en las caractersticas que posea
recin amasado.
Cada carga de hormign ir acompaada de una hoja de suministro que estar en todo
momento a disposicin de la Direccin de Obra, y en la que figurarn como mnimo, los
datos indicados en el anejo 21 de la EHE-08. El fabricante de este hormign deber
documentar debidamente la dosificacin empleada, que deber ser aceptada por la
Direccin de la Obra. En hormigones fabricados en central ubicada en obra el constructor
dejar un libro de registro a disposicin de la direccin facultativa firmado por persona fsica
en el que constarn las dosificaciones, proveedores, equipos empleados, referencia al
documento de calibrado de la balanza de dosificacin, registro de amasadas empleadas en
cada lote, fechas de hormigonado y resultados de los ensayos realizados.
El tiempo trascurrido entre la adicin del agua de amasado y la colocacin del hormign no
debe ser mayor de una hora y media para hormign sin promotores o retardadores

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

defraguado y en ningn caso se tolerar la colocacin en obra de masas que acusen un


principio de fraguado. Queda expresamente prohibida la adicin de agua en obra al
hormign. Se puede aadir en obra plastificante o superplastificante siempre que no se
sobrepasen los lmites establecidos y siempre con el visto bueno del fabricante. En el vertido y
colocacin de las masas se adoptarn las debidas precauciones para evitar la disgregacin
de la mezcla. A partir de 1 metro de altura, el hormigonado no puede hacerse por vertido
libre siendo necesario el empleo de canaletas o conductos que eviten el golpeo del
hormign. No se efectuar el hormigonado sin la conformidad de la Direccin de la Obra,
una vez se hayan revisado las armaduras. La compactacin de hormigones se realizar de
manera tal que se eliminen los huecos y se obtenga un perfecto cerrado de la masa, sin que
llegue a producirse segregacin. Se realizar segn lo expuesto en 71.5.2 EHE-08.
Las juntas de hormigonado se situarn en direccin lo ms normal posible a las de las
tensiones de compresin, y all donde su efecto sea menos perjudicial, alejndolas de las
zonas en las que la armadura est sometida a fuertes tracciones, en cualquier caso el lugar
de las juntas deber ser aprobado por la Direccin Facultativa. Antes de reanudar el
hormigonado, se retirar la capa superficial de mortero, dejando los ridos al descubierto y
se limpiar la junta de toda suciedad o rido que haya quedado suelto, se humedecer la
superficie y debern eliminarse, en su caso, las partes daadas por el hielo empleando
promotores de adherencia si fuese necesario.
Queda terminantemente prohibido hormigonar si llueve, nieva, hay viento excesivo,
temperaturas superiores a 40 C, soleamiento directo, o se prevea una temperatura de 0 C
en las prximas 48 horas. Si el hormigonado es imprescinble se adaptarn las medidas
pertinentes y se contar con la autorizacin expresa de la Direccin Facultativa y el
fabricante.
Durante el fraguado y primer perodo de endurecimiento del hormign, deber asegurarse el
mantenimiento de la humedad mediante un adecuado curado, durante el plazo necesario
en funcin del tipo y clase del cemento, de la temperatura y grado de humedad del
ambiente, etc. segn lo especificado en el punto 71.6 de la EHE-08. Si el curado se realiza por
riego directo, no producir deslavado. En caso de optar por la proteccin del hormign con
recubrimientos plsticos, agentes filmgenos o similares ofrecern las suficientes garantas y
no resultarn perjudiciales para las prestaciones del hormign endurecido o posteriores
recubrimientos.
Los productos desencofrantes sern de naturaleza adecuada y no sern perjudiciales para
las propiedades o el aspecto del hormign y no perjudicarn a la posterior aplicacin de
revestimientos. Expresamente queda prohibido el empleo de grasa, gasleo u otros
productos no apropiados. Las superficies vistas no presentarn coqueras o irregularidades
que perjudiquen al comportamiento de la obra o a su aspecto.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
El contratista aportar un programa de control de calidad segn contenidos estipulados en
79.1 de la EHE-08 que deber se aprobado por la Direccin Facultativa y que desarrollar el
plan de control que se incluye en proyecto. La Direccin Facultativa podr disponer en
cualquier momento la realizacin de comprobaciones o ensayos adicionales.
Si el cemento dispone de distintivo de calidad reconocido oficialmente segn RC-08 se
comprobar la identificacin, clase, tipo, categora y distintivos, de otro modo la direccin
facultativa podr requerir la realizacin de ensayos de resistencias mecnicas, tiempos de
fraguado, expansin, prdida al fuego, residuo insoluble, trixido de azufre, cloruros, sulfuros,
xido de aluminio y puzolanidad.
Los aditivos contarn con marcado CE en caso contrario se deber aportar certificado de
ensayo con antigedad inferior a 6 meses segn los dispuesto en 85.3 EHE-08.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Para la recepcin de aceros se comprobar que disponen de un distintivo de calidad con


reconocimiento oficial en vigor, en caso contrario se realizarn ensayos segn 87 EHE-08.
En caso de que las armaduras elaboradas o ferralla armada no cuente con un distintivo de
calidad oficialmente reconocido conforme anejo 19 EHE-08 se realizar control experimental
del para comprobar caractersticas mecnicas, adherencia, dimensiones o de soldadura.
Los ensayos del hormign se realizarn segn lo dispuesto en el programa de control y en el
artculo 86 EHE-08. Los ensayos de docilidad sern segn UNE-EN 12350 y los de resistencia y
resistencia a la penetracin de agua segn UNE-EN 12390.
Se realizarn ensayos de hormign previos y caractersticos si se dan las circunstancias
especificadas en 86.4 y anejo 20 EHE-08.
Se har un control de la ejecucin por lotes segn artculo 92 de la EHE-08, haciendo
comprobaciones previas al comienzo de la ejecucin, control de acopios, comprobaciones
de replanteo y geomtricas, cimbras y andamiajes, armaduras, encofrados, transporte,
vertido y compactacin, juntas de trabajo, contraccin o dilatacin, curado, desmoldeo y
descimbrado, tolerancias y dimensiones finales.
Las tolerancias mximas admisibles sern:
Dosificacin: +-3 % en cemento, ridos, agua y adiciones y +-5 % en aditivos.
Recubrimiento armaduras activas: +-5 mm. en elementos prefabricado y +-10 mm. in situ.
Resistencia caracterstica del hormign segn EHE-08.
Consistencia del hormign segn tabla 86.5.2.1 de la EHE-08.
Desviaciones admisibles segn anejo 11 EHE-08.
Las caractersticas higrotrmicas de los materiales contemplados en el proyecto sern:
Material

Transmitancia (W/m2 K)

Absortividad

Hormign armado

5,7

0,7

Hormign en masa

0,7

Las caractersticas de los materiales puestos en obra, tendrn las prestaciones sealadas
anteriormente o superiores, de otro modo, habrn de ser autorizados previamente por la
direccin facultativa.

2.4.2. ESTRUCTURA de HORMIGN ARMADO


Descripcin
Estructuras constituidas por elementos de hormign armado con barras de acero: vigas,
forjados con nervios, viguetas o semiviguetas y losas.
Materiales
El constructor dispondr de un sistema de gestin de materiales, productos y elementos a
poner en obra que garantice la trazabilidad de los mismos segn 66.2 de la EHE-08.
Hormign armado, segn lo dispuesto en el punto especfico de este mismo Pliego.
Elementos para forjados cumplirn con las especificaciones establecidas en la EHE-08.
Piezas de entrevigado aligerantes de cermica, hormign, poliestireno expandido u otros
materiales suficientemente rgidos, cumplirn con lo establecido en el artculo 36 de la EHE08. Estos elementos se presentarn sin alabeos, roturas ni fisuraciones, su carga de rotura a
flexin ser superior a 1,0 KN, en caso de piezas cermicas el valor de expansin por
humedad estar en los lmites establecidos en la EHE-08.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

En el caso de utilizar forjados de viguetas de hormign prefabricado estas contarn con


marcado CE segn lo expueso en la norma armonizada UNE-EN 15037 y facilitar la
declaracin de conformidad que detallar la informacin del fabricante, descripcin del
producto y disposiciones con las que es conforme, condiciones especficas al uso del
producto, nmero de certificado de control de produccin en fbrica, nombre y cargo de la
persona facultada por el fabricante para la firma y certificado de control de produccin
emitido por organismo notificado. El propio producto o el albarn de entrega incluir el
marcadoCE.
En el caso de utilizar elementos prefabricados de hormign para forjados nervados
compuestos por una placa superior y uno o ms nervios longitudinales dispondrn de
marcado CE segn lo expueso en la norma armonizada UNE-EN 13224.
Del mismo modo, la utilizacin de elementos prefabricados de hormign en vigas y pilares
requerir la presentacin de la documentacin relativa a su marcado CE segn UNE-EN
13225.
En caso de empleo de placas alveolares prefabricadas dispondrn de garanta documental
del cumplimiento del marcado CE y debern cumplir las condiciones indicadas en la norma
armonizada UNE-EN 1168+A1.
En caso de puesta en obra de prelosas prefabricadas para forjados dispondrn de garanta
documental del cumplimiento del marcado CE y debern cumplir las condiciones indicadas
en la norma armonizada UNE-EN 13747+A1.
Puesta en obra
La puesta en obra se atendr estrictamente a lo dispuesto en las Instrucciones EHE-08 y NCSE02.
Los encofrados se realizarn segn las indicaciones del artculo 68 de la EHE-08, debiendo ser
estancos para que impidan prdidas apreciables de pasta, rgidos para que se cumplan las
tolerancias dimensionales y no sufran asientos ni deformaciones perjudiciales, y podrn
desmontarse fcilmente, sin peligro y sin producir sacudidas ni daos en el hormign. Han de
estar limpios y hmedos antes de verter el hormign y el empleo de desencofrante ha de
contar con autorizacin de la direccin de obra. Se prohbe el uso de aluminio en moldes.
Para la puesta en obra de cimbras, encofrados y apuntalamientos el constructor se ajustar
a lo dispuesto en el punto 68.2, 68.3, 73 y 74 de la EHE-08 ejecutndose preferentemente de
acuerdo a la norma EN 12812. Los puntales se dispondrn sobre durmientes y las cimbras se
arriostrarn en las 2 direccin para garantizar adecuada respuesta ante esfuerzos
horizontales. Los movimientos sern inferiores a 5 mm. locales y a 1/1000 de la luz para el
conjunto. Los tiempos de desencofrado se adoptarn segn lo expuesto en el artculo 74 de
la EHE-08.
No se efectuar el hormigonado sin la conformidad de la Direccin Facultativa, una vez se
hayan revisado las armaduras.
La eleccin del tamao mximo del rido de los hormigones vendr determinado por las
indicaciones del fabricante del forjado y las condiciones de la estructura segn 28.3.1 EHE-08.
Los forjados unidireccionales se regarn antes del hormigonado que se realizar en el sentido
de los nervios y en un solo proceso tanto los nervios como la losa superior. Se seguirn las
instrucciones indicadas por el fabricante para la manipulacin y almacenamiento de
viguetas y losas cuidando de retirar aquellos elementos que resulten daados con su
capacidad portante afectada.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Durante la ejecucin se evitar la actuacin de cualquier carga esttica o dinmica que


pueda provocar daos en los elementos ya hormigonados.
El recubrimiento de la armadura se garantizar mediante la disposicin de separadores y se
ajustar a las especificaciones del 37.2 EHE-08. Los separadores sern elementos
especialmente diseados para tal fin, de naturaleza no atacable por la alcalinidad del
hormign, no introducirn corrosin en las armaduras, sern tan impermeables como el
propio hormign. Expresamente queda prohibido el uso de separadores de madera, ladrillo u
otros elementos residuales de la obra.
Para el anclaje y empalme de armaduras se atender a lo dispuesto en 69.5 EHE-08.
El apoyo de forjados sobre la estructura se realizar segn lo expuesto en el punto 7 del anejo
12 de la EHE-08 y las recomendaciones de la norma UNE-EN 15037. Los enfrentamientos de
nervios en los apoyos garantizarn la continuidad de los mismos con una desviacin mxima
de 5 cm.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Se har un control de la ejecucin por lotes segn artculo 92 de la EHE-08, haciendo
comprobaciones previas al comienzo de la ejecucin, control de acopios, comprobaciones
de replanteo y geomtricas, cimbras y andamiajes, armaduras, encofrados, transporte,
vertido y compactacin, juntas de trabajo, contraccin o dilatacin, curado, desmoldeo y
descimbrado, tolerancias y dimensiones finales.
Se comprobar la situacin de los elementos, las distancias a otros elementos, flechas,
deformacin bajo carga, adherencia entre el hormign y el acero, uniones con otros
elementos, apoyos, coincidencia con pilar inferior, entrevigado de la seccin, pandeo,
desplome, planeidad, horizontalidad, formacin de huecos, anclajes.
Las viguetas llevarn marcas que permitan identificarlas y conocer todas sus caractersticas.
Las tolerancias mximas admisibles sern las establecidas en el anejo 11 de la EHE-08.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Elementos estructurales de hormign armado volumen realmente ejecutado. Las planchas
en superficie terica descontando huecos mayores de 1 m2.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
La modificacin de cargas, realizacin de taladros o perforaciones se realizarn previa
consulta con un tcnico.
Se revisar anualmente la posible aparicin de fisuras, grietas, manchas de xidos, golpes,
desconchados en revestimientos del hormign, humedades, degradacin del hormign,
abombamiento de techos, puertas y ventanas que no cierran... debiendo ser comunicadas a
un tcnico especialista en caso de detectarse.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cada 10 aos se realizar limpieza de las superficies de vigas y pilares vistos con un cepillo de
races y agua. En funcin de la contaminacin y la suciedad a la que se vean expuestos
estos elementos, se deber realizar con mayor o menor frecuencia.
Cada 10 aos se inspeccionar la estructura por tcnico especialista.

2.4.3. ESTRUCTURA de FBRICA


La construccin de estructuras de fbrica est regulada por el Cdigo Tcnico de la
Edificacin en su Documento Bsico de Seguridad Estructural-Fbricas.

2.4.3.1. FBRICA CERMICA


Descripcin
Muros resistentes y de arriostramiento constituidos por ladrillos cermicos unidos con mortero,
pudiendo ser los ladrillos caravista o revestidos.
Materiales
Ladrillos:
Irn acompaados del certificado de conformidad con el marcado CE segn la norma
armonizada UNE-EN 771-1, declarando expresamente la densidad aparente, resistencia a
compresin, conductividad trmica, durabilidad a ciclos hielo-deshielo, absorcin de agua,
contenido de sales solubles activas, expansin por humedad, permeabilidad al vapor y
adherencia.
No tendrn defectos que deterioren su aspecto y durabilidad, sern regulares en
dimensiones y forma. No presentarn fisuras, exfoliaciones y desconchados.
Mortero:
El aglomerante empleado podr ser cemento o mixto con cal.
Cemento: cumplirn las especificaciones dispuestas en el RC-08 y normas armonizadas UNE
EN 197-1 y 413-1 y las cales segn normas UNE EN 459-1
El cemento se suministrar acompaado de un albarn con los datos exigidos en la RC-08.
Irn acompaados del certificado de conformidad con el marcado CE por organismo
notificado y la declaracin del fabricante CE de conformidad.
Cuando el suministro se realice en sacos, el cemento se recibir en los mismos envases
cerrados en que fue expedido. No llegar a obra u otras instalaciones de uso, excesivamente
caliente. Se almacenar en sitio ventilado y defendido de la intemperie, humedad del suelo
y paredes.
Preferentemente se emplearn cementos para albailera pudiendo con la aprobacin de la
direccin de obra emplear otros cementos comunes a excepcin del CEM I y CEM II/A.
Pueden emplearse arenas naturales procedentes de ros, mina y playa, o de machaqueo, o
bien mezcla de ellas. El suministrador deber garantizar documentalmente el cumplimiento
del marcado CE, para ello cada carga ir acompaada por hoja de suministro que estar
en todo momento a disposicin de la Direccin de la Obra, en la que figuren la declaracin
de conformidad del producto segn este marcado. Los ridos debern cumplir las
condiciones fsico-qumicas, fsico-mecnicas, de granulometra y forma indicadas en la
norma armonizada UNE-EN 13139.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Se admiten todas las aguas potables y las tradicionalmente empleadas. En caso de duda, el
agua cumplir los mismos requisitos dispuestos en el artculo 27 de la EHE-08 para el empleo
de agua para el hormign.
En caso de emplear aditivos el fabricante suministrar el aditivo correctamente etiquetado y
dispondr de marcado CE aportando la ficha de declaracin de conformidad a dicho
marcado y certificado de control de produccin en fbrica. La Direccin Facultativa deber
autorizar su utilizacin y en su incorporacin a la mezcla se seguir estrictamente lo dispuesto
por el fabricante.
Las mezclas preparadas, envasadas o a granel llevarn el nombre del fabricante, la
cantidad de agua a aadir para obtener las resistencias deseadas y dispondrn de garanta
documental del cumplimiento del marcado CE y debern cumplir las condiciones indicadas
en la norma armonizada UNE-EN 998-2.
El mortero ordinario para fbricas convencionales no ser inferior a M1 y para fbrica
armada o pretensada, morteros de junta delgada y morteros ligeros, no sern inferiores a M5.
La resistencia a compresin del mortero no debe ser superior al 0,75 de la resistencia de las
piezas.
Hormign armado:
Se utiliza como refuerzo y en puntos singulares como dinteles, esquinas, uniones... Deber
cumplir con las caractersticas dispuestas en este pliego y en la normativa vigente para el
hormign armado.
El tamao mximo del rido ser 10 mm cuando rellene huecos mayores de 50 mm, o
cuando el recubrimiento de las armaduras est entre 15 y 25 mm. No ser mayor que 20 mm
cuando rellene huecos de dimensin mayor que 100 mm o cuando el recubrimiento de la
armadura no sea menor que 25 mm.
Armaduras: Adems de los aceros establecidos en la EHE-08, se consideran aceptables
los aceros inoxidables segn UNE ENV 10080:1996, UNE EN 10088 y UNE EN 845-3:2001 y para
pretensar segn la EN 10138. Las armaduras de junta de tendel de malla de acero contarn
con marcado CE conforme a lo expuesto en norma UNE-EN 845-3:2006+A1.
Componentes auxiliares: Llaves, amarres, colgadores, mnsulas y ngulos. Dispondrn
de garanta documental del cumplimiento del marcado CE y debern cumplir las
condiciones indicadas en la norma armonizada UNE-EN 845-1:2005+A1.
Puesta en obra
En la ejecucin, se tendrn en cuenta las restricciones impuestas por el CTE-DB-SEF en el
punto 3, relativo a la durabilidad de los materiales.
En cuanto al armado, en el punto 3.3 del DB-SEF, establece las restricciones de uso y
proteccin o recubrimiento segn la clase de exposicin, pero en cualquier caso establece
que: el espesor mnimo del recubrimiento de mortero respecto al borde exterior no ser
menor que 15 mm; el recubrimiento de mortero por encima y por debajo de la armadura de
tendel no sea menor que 2 mm.
Las piezas, se humedecern por inmersin o aspersin antes de su empleo de manera que el
agua embebida en la pieza debe ser la necesaria para que no vare la consistencia del
mortero al ponerlo en contacto con la misma. Las piezas se colocarn siempre a restregn,
sobre una tortada de mortero, hasta que el mortero rebose por la llaga y el tendel. Si fuera
necesario corregir la posicin de una pieza, se quitar, retirando tambin el mortero. El
mortero debe llenar totalmente las juntas de tendel (salvo caso tendel hueco) y llagas. El
llagueado se realizar mientras el mortero est fresco y el mortero tendr las mismas
propiedades que el de asentar las piezas. Antes del rejuntado, se cepillar el material suelto,
y se humedecer la fbrica. Las fbricas deben levantarse por hiladas horizontales. Cuando
dos partes hayan de levantarse en pocas distintas, la que se ejecute primero se dejar

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

escalonada o formando alternativamente entrantes (adarajas) y salientes (endejas). En las


hiladas consecutivas, las piezas se solaparn, el solape ser al menos igual a 0,4 veces el
grueso de la pieza y no menor que 40 mm, en las esquinas o encuentros, el solapo de las
piezas no ser menor que su tizn. El espesor de los tendeles y llagas de mortero ordinario o
ligero no ser menor que 8 mm ni mayor que 15 mm. y el de tendeles y llagas de mortero de
junta delgada no ser menor que 1 mm. ni mayor que 3 mm.
En los dinteles, se dispondr una armadura de continuidad sobre los apoyos, de una seccin
no inferior al 50% de la armadura en el centro del vano.
Cuando los muros estn arriostrados por los forjados, se enlazarn a stos de forma que se
puedan transmitir las acciones laterales. Cuando el enlace se realice mediante conectores,
la separacin de los elementos de conexin entre muros y forjados no ser mayor que 2 m y
en edificios de ms de cuatro plantas no ser mayor que 1,25 m. Cuando el enlace se realice
por rozamiento, no son necesarios amarres si el apoyo de los forjados de hormign se
prolonga hasta el centro del muro o un mnimo de 65 mm.
En muros de dos hojas, estas se levantarn simultneamente. En muros capuchinos las llaves
se dispondrn conforme a la norma UNE EN 8451:2001. El nmero de llaves no ser menor
que 2 por m. Se colocarn llaves en cada borde libre y en las jambas de los huecos. En
muros doblados, las hojas se enlazarn mediante conectores capaces de transmitir las
acciones laterales entre las dos hojas, con un rea mnima de 300 mm/m de muro, con
conectores de acero dispuestos en nmero no menor que 2 conectores/m de muro.
En muros en contacto con el terreno, la fbrica no ha de verse afectada por el terreno. Se
tomarn medidas protectoras para las fbricas que puedan ser daadas por efecto de la
humedad en contacto con el terreno. Se aplicarn las prescripciones indicadas en el DB-HS.
Para la ejecucin de rozas y rebajes, se debe contar con las rdenes del director de obra y
se tendr en cuenta la no afectacin a elementos estructurales, como dinteles, anclajes o
armaduras. En muros de ejecucin reciente, debe esperarse a que el mortero de unin entre
piezas haya endurecido .
En muros armados, la seccin de la armadura principal no ser menor que el 0,1% de la
seccin del muro. En los muros con tendeles armados, la armadura no ser menor que el 0,03
% de la seccin y la separacin vertical no ser mayor que 600 mm. Una fbrica con
armadura en sus huecos, solicitada a flexin, necesita otra armadura transversal en direccin
perpendicular con un rea superior que 0,05 % del producto del ancho total por el canto til.
En muros con pilastras armadas no se precisa armadura transversal. Las armaduras tendrn
un dimetro nominal mnimo de 6 mm. La armadura transversal, se dispondr en toda la luz
con un rea mnima no menor que el 0,1 % de la seccin de la fbrica. La distancia mxima
entre estribos, no ser mayor que 0,75d ni 300 mm. La distancia libre entre armaduras
adyacentes no ser menor que el tamao mximo del rido ms 5 mm, ni que el dimetro
de la armadura, ni que 10 mm. La separacin entre armaduras principales de traccin no
ser mayor que 600 mm, excepto la de armaduras concentradas en ncleos o cajeados, o
en las armaduras de tendel. El rea total de la armadura principal no exceder el 4% de la
seccin bruta del relleno del ncleo o de la pilastra, excepto en la zona de solapes que
podr alcanzar hasta el 8%.
Los anclajes puede ser por prolongacin recta, gancho, patilla, u horquilla. No se emplearn
anclajes por prolongacin recta o por patilla en barras lisas de ms de 8 mm de dimetro. En
barras a compresin no se emplearn anclajes de gancho, patilla u horquilla. La longitud de
anclaje de las armaduras y el solapo se calcularn conforme a lo dispuesto en el punto 7.5.2
del DB-SEF.
Las armaduras se almacenarn, doblarn y colocarn sin que sufran daos en la pelcula
autoprotectora o en el revestimiento. Toda armadura se examinar antes de colocarla, y se

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

comprobar que est libre de sustancias perjudiciales para la adherencia. Se emplearn


separadores y estribos para mantener las armaduras en su posicin con el recubrimiento
especificado. Cuando sea necesario, se atar la armadura con alambre para asegurar que
no se mueva mientras se vierte el mortero u el hormign de relleno. Se solaparn slo donde
lo permita la direccin facultativa.
La fbrica confinada se construir entre elementos de hormign armado o de fbrica
armada. La separacin entre dichos elementos, no superar los 4 m. El rea de la seccin de
los elementos confinantes ser no menor que 0,02 m, con una dimensin mnima de 100 mm
y con una seccin mnima de armadura de 0,02 t (en mm) siendo t el espesor en mm del
muro, ni menor que 200 mm. El hormigonado de los elementos se realizar despus de
ejecutada la fbrica y se anclar a sta. Cuando se emplee fbrica confinada realizada
con piezas macizas, perforadas o aligeradas, se utilizarn barras de un dimetro no menor
que 6 mm y con una separacin no mayor que 600 mm, correctamente ancladas en el
hormign de relleno y en las juntas de mortero.
Se dispondrn juntas de movimiento en edificios segn las distancias establecidas en la tabla
2.1 del CTE-DB-SEF dependiendo de la expansin y retraccin del tipo de ladrillo empleado.
No se utilizarn piezas menores a medio ladrillo.
Durante la ejecucin, las fbricas se protegern contra la lluvia, heladas, calor y el viento. Si
hiela se suspendern los trabajos, y se demolern las partes de obra daadas.
Sin autorizacin expresa del Director de Obra se prohbe, en muros de carga, la ejecucin de
rozas horizontales no sealadas en los planos.
La coronacin de los muros se cubrir para impedir el lavado del mortero de las juntas por
efecto de la lluvia y evitar eflorescencias, desconchados por caliches y daos en los
materiales higroscpicos. Se tomarn precauciones para mantener la humedad de la
fbrica hasta el final del fraguado, especialmente ante baja humedad relativa, altas
temperaturas o fuertes corrientes de aire. Se tomarn precauciones ante las heladas. Los
muros que queden temporalmente sin arriostrar y sin carga estabilizante pero que puedan
estar sometidos a cargas de viento o de ejecucin, se acodalarn provisionalmente, para
mantener su estabilidad. Se limitar la altura de la fbrica que se ejecute en un da para
evitar inestabilidades e incidentes mientras el mortero est fresco.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Recepcin de Ladrillos: Se suministrarn con una declaracin del suministrador sobre su
resistencia y la categora de fabricacin. El fabricante aportar la documentacin que
acredita que el valor declarado de la resistencia a compresin se ha obtenido a partir de
piezas muestreadas segn UNE EN 771 y ensayadas segn UNE EN 772-1:2002, y la existencia
de un plan de control de produccin en fbrica que garantiza el nivel de confianza I o II. El
valor medio de la compresin declarada por el suministrador, multiplicado por el factor d de
la tabla 8.1 del DB-SEF debe ser no inferior al valor usado en los clculos como resistencia
normalizada.
El acopio en obra se efectuar evitando el contacto con sustancias o ambientes que
perjudiquen fsica o qumicamente a la materia de las piezas.
Recepcin de arenas: Se descargar en una zona de suelo seco en la que pueda
conservarse limpia. Las arenas de distinto tipo se almacenarn por separado. Se
comprobarn la identificacin, tipo, tamao y distintivos de las arenas. Se realizar una
inspeccin ocular de caractersticas y, si se juzga preciso, se realizar una toma de muestras y
se harn ensayos de materia orgnica, granulometra y finos que pasan por el tamiz 0,08
segn EHE-08.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Recepcin de cementos y cales: Durante el transporte y almacenaje se protegern frente al


agua, la humedad y el aire. Si el cemento dispone de distintivo de calidad reconocido
oficialmente segn RC-08 se comprobar la identificacin, clase, tipo, categora y distintivos,
de otro modo se harn ensayos de resistencia a compresin, tiempos de fraguado,
expansin, prdida al fuego, residuo insoluble, trixido de azufre, cloruros, sulfuros, xido de
aluminio y puzolanidad, segn RC-08. Se identificarn el tipo y clase de cales y si no disponen
de distintivo de calidad reconocido se harn ensayos qumicos de finura de molido,
fraguado y estabilidad de volumen.
Recepcin de Morteros secos preparados y hormigones preparados: se comprobar el
marcado CE, el tipo y distintivos de calidad, que la dosificacin y resistencia corresponden a
las solicitadas y se realizarn ensayos de resistencia a compresin y consistencia con Cono
de Abrams. La recepcin y el almacenaje y empleo se realizar siguiendo las instrucciones
del fabricante. Se emplear antes de que transcurra el plazo de uso definido por el
fabricante.
De los morteros preparados en obra se comprobar el tipo, dosificacin y se realizarn
ensayos de resistencia a compresin y consistencia con Cono de Abrams.
Morteros y hormigones de relleno: Mezcla manual nicamente en proyectos con categora
de ejecucin C. Se emplearn antes de iniciarse el fraguado. Al dosificar se considerar la
absorcin de las piezas de la fbrica. Tendr docilidad suficiente para rellenar
completamente los huecos en que se vierta y sin segregacin. Al mortero no se le aadirn
aglomerantes, ridos, aditivos ni agua despus de su amasado. Cuando se establezca la
determinacin mediante ensayos de la resistencia del mortero, se usar la UNE EN 101511:2000. Antes de rellenar de hormign la cmara de un muro armado, se limpiar de restos
de mortero y escombro. El relleno se realizar por tongadas, se macizan todos los huecos y
no se segrega el hormign.
En aguas no potables sin experiencias previas se realizarn ensayos de exponente de
hidrgeno pH, sustancias disueltas, sulfatos, in cloruro, hidratos de carbono y sustancias
orgnicas solubles en ter indicadas en el artculo 27 de la EHE-08
Se comprobar el replanteo, ejecucin de las fbricas, morteros, cargaderos y refuerzos, la
proteccin de la fbrica, situacin del elemento, forma y dimensiones, planeidad, posicin
del elemento, adherencia entre ladrillo o bloque y mortero, trabazn con otros elementos
estructurales, juntas de dilatacin y/o aislamiento y uniones con elementos complementarios.
Las tolerancias mximas admisibles sern:
Replanteo: +- 10 mm entre ejes parciales o +- 30 entre ejes.
Desplomes: +- 10 mm por planta y +- 30 mm en la altura total.
Espesores: - 10 a +15 mm
En altura: +- 15 mm en las parciales y +- 25 mm en las totales.
Distancias entre ejes: +- 10mm entre ejes parciales o +- 20 mm entre ejes extremos.
Horizontalidad: +- 2 mm por m.
Planeidad (medida en regla de 2m): +- 10 mm en paramentos para revestir +- 5 mm en
paramentos a cara vista.
Tolerancias de las piezas cermicas segn lo expresado en la UNE-EN 771-1.
Criterios de medicin y valoracin

En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen


otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Fbricas superiores a 1 asta se medirn en volumen e inferiores por superficie ejecutada
deduciendo huecos.
Condiciones de conservacin y mantenimiento

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Se exponen a continuacin las condiciones bsicas y generales de conservacin y


mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
Modificacin, sobrecarga, apertura de huecos o rozas se realizar consultando a tcnico
especialista.
Cada ao se comprobar la aparicin de deformaciones de los muros, desplomes,
abombamientos, desplazamientos, fisuras, desconchados, puertas y ventanas que no cierran
bien o aparicin de eflorescencias en cuyo caso se ha de poner en conocimiento de un
tcnico especialista.
Cada 5 aos se revisarn las juntas de dilatacin, renovndolas caso de que fuera necesario.
Cada 10 aos revisin por tcnico especialista.

2.4.3.2. FBRICA de BLOQUES de TERMOARCILLA


Descripcin
Obra de fbrica de una hoja de bloques cermicos de arcilla aligerada Termoarcilla, con
perforaciones verticales y junta vertical machihembrada para muros con misin estructural.
Materiales
Termoarcilla:
Tanto a nivel de piezas base como de piezas complementarias irn acompaados del
certificado de conformidad con el marcado CE segn la norma armonizada UNE-EN 771-1,
declarando expresamente la densidad aparente, resistencia a compresin, conductividad
trmica, durabilidad a ciclos hielo-deshielo, absorcin de agua, contenido de sales solubles
activas, expansin por humedad, permeabilidad al vapor y adherencia.
Las tolerancias dimensionales se ajustarn a lo expresado en dicha norma armonizada.
Debern disponer de marca N de AENOR, o cualquier otra certificacin de calidad
equivalente.
Todos los bloques y piezas complementarias que se utilicen procedern de un mismo
fabricante. Si hubiera que ejecutar con piezas de diferentes empresas ser necesario evaluar
la compatibilidad entre las piezas y el consentimiento de la direccin facultativa.
No tendrn defectos que deterioren su aspecto y durabilidad, sern regulares en
dimensiones y forma.
Mortero:
El aglomerante empleado podr ser cemento o mixto con cal.
Cemento: cumplirn las especificaciones dispuestas en el RC-08 y normas armonizadas UNE
EN 197-1 y 413-1 y las cales segn normas UNE EN 459-1
El cemento se suministrar acompaado de un albarn con los datos exigidos en la RC-08.
Irn acompaados del certificado de conformidad con el marcado CE por organismo
notificado y la declaracin del fabricante CE de conformidad.
Cuando el suministro se realice en sacos, el cemento se recibir en los mismos envases
cerrados en que fue expedido. No llegar a obra u otras instalaciones de uso, excesivamente
caliente. Se almacenar en sitio ventilado y defendido de la intemperie, humedad del suelo
y paredes.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Preferentemente se emplearn cementos para albailera pudiendo con la aprobacin de la


direccin de obra emplear otros cementos comunes a excepcin del CEM I y CEM II/A.
El suministrador de arenas deber garantizar documentalmente el cumplimiento del
marcado CE, para ello cada carga ir acompaada por hoja de suministro que estar en
todo momento a disposicin de la Direccin de la Obra, en la que figuren la declaracin de
conformidad del producto segn este marcado. Los ridos debern cumplir las condiciones
fsico-qumicas, fsico-mecnicas, de granulometra y forma indicadas en la norma
armonizada UNE-EN 13139.
Se admiten todas las aguas potables y las tradicionalmente empleadas. En caso de duda, el
agua cumplir los mismos requisitos dispuestos en el artculo 27 de la EHE-08 para el empleo
de agua para el hormign.
En caso de emplear aditivos el fabricante suministrar el aditivo correctamente etiquetado y
dispondr de marcado CE aportando la ficha de declaracin de conformidad a dicho
marcado y certificado de control de produccin en fbrica. La Direccin Facultativa deber
autorizar su utilizacin y en su incorporacin a la mezcla se seguir estrictamente lo dispuesto
por el fabricante.
Las mezclas preparadas, envasadas o a granel llevarn el nombre del fabricante y la
cantidad de agua a aadir para obtener las resistencias deseadas.
Hormign armado:
Se utiliza como refuerzo y en puntos singulares como dinteles, esquinas, uniones... Deber
cumplir con las caractersticas dispuestas en este pliego y en la normativa vigente para el
hormign armado.
El tamao mximo del rido ser 10 mm cuando rellene huecos mayores de 50 mm, o
cuando el recubrimiento de las armaduras est entre 15 y 25 mm. No ser mayor que 20 mm
cuando rellene huecos de dimensin mayor que 100 mm o cuando el recubrimiento de la
armadura no sea menor que 25 mm.
Armaduras: Adems de los aceros establecidos en EHE-08, se consideran aceptables los
aceros inoxidables segn UNE ENV 10080:1996, UNE EN 10088 y UNE EN 845-3:2001, y para
pretensar los de EN 10138. Las armaduras de junta de tendel de malla de acero contarn
con marcado CE conforme a lo expuesto en norma UNE-EN 845-3:2006+A1.
Componentes auxiliares: Llaves, amarres, colgadores, mnsulas y ngulos. Dispondrn
de garanta documental del cumplimiento del marcado CE y debern cumplir las
condiciones indicadas en la norma armonizada UNE-EN 845-1:2005+A1.
Puesta en obra
La colocacin se realizar con junta horizontal de mortero y junta vertical a hueso y a tope
(mxima separacin: 2 cm.) mediante el machihembrado de las testas.
Si fuera necesario corregir la posicin de una pieza, se quitar, retirando tambin el mortero.
En los puntos singulares (esquinas, jambas de huecos, juntas de movimiento y encuentros de
muros en T) se utilizarn piezas complementarias de Termoarcilla.
Se ajustar la longitud del muro a la definida en proyecto mediante piezas de modulacin
de 5 10 cm. de espesor. Ante la necesidad de emplear piezas cortadas, se realizar el
corte con sierra de mesa con disco D 550 mm. y se ajustarn mediante una junta vertical
de mortero discontinua.
Las hiladas estarn perfectamente niveladas, disponiendo el espesor de mortero necesario
en una nica banda continua bajo la primera hilada, para compensar las diferencias de
nivelacin del soporte.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

En muros de cerramiento de una sola hoja, el tendel se realizar de forma discontinua,


extendiendo el mortero en dos bandas separadas 1 o 2 cm. y de un espesor de 3 cm. para
que una vez asentado el bloque quede una junta de 1 a 1,5 cm.
En muros exteriores trasdosados y muros interiores, la junta horizontal ser continua.
En muros y cerramientos exteriores es recomendable colocar siempre el canto del bloque
con estriado profundo en la cara exterior.
Las fbricas deben levantarse por hiladas horizontales. Cuando dos partes hayan de
levantarse en pocas distintas, la que se ejecute primero se dejar escalonada. Se
mantendr la traba, consiguiendo que la distancia entre juntas verticales de hiladas
consecutivas sea igual o mayor de 7 cm. empleando para ello las piezas de modulacin,
piezas cortadas y/o dos cordones de mortero.
En la formacin de huecos, el dintel se resolver con la pieza en forma de U de Termoarcilla,
admitindose otras soluciones alternativas previo consentimiento expreso de la direccin
facultativa. El dintel deber apoyarse 1/5 de la luz por cada lado, y como mnimo 30 cm.
El revestimiento situado sobre los dinteles quedar armado anclando la malla una longitud
superior a 20 cm por cada uno de sus lados y se realizar un gotern en la cara inferior de los
mismos.
Las jambas se ejecutarn con piezas de terminacin, medias o piezas cortadas (long. >10
cm.) y piezas base que se regularizarn con mortero, colocando una malla en el
revestimiento de esta zona.
El vierteaguas tendr una pendiente superior al 10%. Sus extremos penetrarn en el
revestimiento de los telares y estarn provistos de un gotern y volar, lo mismo que las
albardillas, unos 4 cm aproximadamente. Si es preciso se colocar una membrana
impermeable debajo del vierteaguas.
En el arranque del muro sobre la cimentacin, se dispondr de una barrera impermeable, a
una altura mayor o igual a 30 cm. del nivel del suelo, garantizando la impermeabilidad por
debajo de la misma.
Cuando los muros estn arriostrados por los forjados, se enlazarn a stos de forma que se
puedan transmitir las acciones laterales. Cuando el enlace se realice mediante conectores,
la separacin de los elementos de conexin entre muros y forjados no ser mayor que 2 m y
en edificios de ms de cuatro plantas no ser mayor que 1,25 m. Cuando el enlace se realice
por rozamiento, no son necesarios amarres si el apoyo de los forjados de hormign se
prolonga hasta el centro del muro o un mnimo de 65 mm.
Es recomendable no realizar rozas ni rebajes en los muros. De hacerse, cumplirn los criterios
del Eurocdigo 6 Parte 1-1 y siempre con el consentimiento de la Direccin Facultativa.
Las juntas de movimiento verticales tendrn un ancho entre 10 y 20 mm., utilizando piezas de
terminacin y piezas medias para resolver los bordes de la junta. Dispondrn de llaves
embebidas en la junta, como mnimo cada dos hiladas.
La distancia mxima entre la junta de movimiento y una esquina del edificio ser como
mximo de 6m., al igual que en petos de cubierta y muros expuestos por ambas caras. En
caso de muros armados se pueden distanciar estas juntas hasta 8 m.
Se evitar ejecutar fbricas durante periodos con heladas. Se proteger la fbrica con
mantas de aislante trmico o plsticos, si hiela al comenzar la jornada o durante sta y si se
utiliza anticongelante para el mortero, se seguirn las indicaciones del fabricante en cuanto
a dosificacin y ejecucin. No se ejecutar una altura mayor de 3 m. en una jornada para

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

evitar el aplastamiento del mortero. El muro deber apoyarse sobre el canto del forjado al
menos 2/3 partes de su espesor. Si se apoya directamente el forjado sobre los bloques
Termoarcilla, se impedir la penetracin del hormign a travs de las perforaciones verticales
de la pieza y se dejar transcurrir un tiempo mnimo desde la terminacin del muro hasta el
hormigonado del forjado (aproximadamente una semana a temperaturas entre 15 y 20C).
Los muros que queden temporalmente sin arriostrar y sin carga estabilizante pero que
puedan estar sometidos a cargas de viento o de ejecucin, se acodalarn provisionalmente,
para mantener su estabilidad.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Los bloques dispondrn necesariamente de marca N de AENOR o equivalente.
El cemento y la cal dispondrn de marcado CE y en caso de tener de distintivo de calidad
reconocido oficialmente se comprobar la identificacin, clase, tipo, categora y distintivos,
de otro modo se harn ensayos. Para el cemento de resistencia a compresin, tiempos de
fraguado, expansin, prdida al fuego, residuo insoluble, trixido de azufre, cloruros, sulfuros,
xido de aluminio y puzolanidad, segn RC-08 y para la cal se harn ensayos qumicos, de
finura de molido, fraguado y estabilidad de volumen.
En aguas no potables sin experiencias previas se realizarn ensayos de exponente de
hidrgeno pH, sustancias disueltas, sulfatos, in cloruro, hidratos de carbono y sustancias
orgnicas solubles en ter indicadas en el artculo 27 de la EHE-08.
Se los ridos que dispondrn de marcado CE, se comprobarn la identificacin, tipo, tamao
y distintivos de las arenas pudindose realizar ensayos de materia orgnica, granulometra y
finos que pasan por el tamiz 0,08 segn EHE-08.
De los morteros se comprobar el tipo, dosificacin y distintivos, y se podrn realizar ensayos
de resistencia a compresin y consistencia con Cono de Abrams.
Recepcin de Morteros secos preparados y hormigones preparados: se comprobar el
marcado CE, el tipo y distintivos de calidad, que la dosificacin y resistencia corresponden a
las solicitadas y se realizarn ensayos de resistencia a compresin y consistencia con Cono
de Abrams. La recepcin y el almacenaje y empleo se realizar siguiendo las instrucciones
del fabricante. Se emplear antes de que transcurra el plazo de uso definido por el
fabricante.
Se comprobar el replanteo, ejecucin de las fbricas, morteros, cargaderos y refuerzos y la
proteccin de la fbrica.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Se medir la superficie ejecutada deduciendo huecos.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
Modificacin, sobrecarga, apertura de huecos o rozas se realizar consultando a tcnico
especialista.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cada ao se comprobar la aparicin de deformaciones de los muros, desplomes,


abombamientos, desplazamientos, fisuras, desconchados, puertas y ventanas que no cierran
bien o aparicin de eflorescencias en cuyo caso se ha de poner en conocimiento de un
tcnico especialista.
Cada 5 aos se revisarn las juntas de dilatacin, renovndolas caso de que fuera necesario.
Cada 10 aos revisin por tcnico especialista.

2.5. CERRAMIENTOS
2.5.1. FBRICAS
2.5.1.1. CERMICA
Descripcin
Cerramiento de fbrica formado por ladrillos cermicos unidos con mortero.
Materiales
Ladrillos:
Irn acompaados del certificado de conformidad con el marcado CE segn la norma
armonizada UNE-EN 771-1, declarando expresamente la densidad aparente, resistencia a
compresin, conductividad trmica, durabilidad a ciclos hielo-deshielo, absorcin de agua,
contenido de sales solubles activas, expansin por humedad, permeabilidad al vapor y
adherencia.
No tendrn defectos que deterioren su aspecto y durabilidad, sern regulares en
dimensiones y forma. No presentarn fisuras, exfoliaciones y desconchados.
Mortero:
El aglomerante empleado podr ser cemento o mixto con cal.
Cemento: cumplirn las especificaciones dispuestas en el RC-08 y normas armonizadas UNE
EN 197-1 y 413-1 y las cales segn normas UNE EN 459-1
El cemento se suministrar acompaado de un albarn con los datos exigidos en la RC-08.
Irn acompaados del certificado de conformidad con el marcado CE por organismo
notificado y la declaracin del fabricante CE de conformidad.
Cuando el suministro se realice en sacos, el cemento se recibir en los mismos envases
cerrados en que fue expedido. No llegar a obra u otras instalaciones de uso, excesivamente
caliente. Se almacenar en sitio ventilado y defendido de la intemperie, humedad del suelo
y paredes.
Preferentemente se emplearn cementos para albailera pudiendo con la aprobacin de la
direccin de obra emplear otros cementos comunes a excepcin del CEM I y CEM II/A.
Pueden emplearse arenas naturales procedentes de ros, mina y playa, o de machaqueo, o
bien mezcla de ellas. El suministrador deber garantizar documentalmente el cumplimiento
del marcado CE, para ello cada carga ir acompaada por hoja de suministro que estar
en todo momento a disposicin de la Direccin de la Obra, en la que figuren la declaracin
de conformidad del producto segn este marcado. Los ridos debern cumplir las
condiciones fsico-qumicas, fsico-mecnicas, de granulometra y forma indicadas en la
norma armonizada UNE-EN 13139.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Se admiten todas las aguas potables y las tradicionalmente empleadas. En caso de duda, el
agua cumplir los mismos requisitos dispuestos en el artculo 27 de la EHE-08 para el empleo
de agua para el hormign.
En caso de emplear aditivos el fabricante suministrar el aditivo correctamente etiquetado y
dispondr de marcado CE aportando la ficha de declaracin de conformidad a dicho
marcado y certificado de control de produccin en fbrica todo ello segn norma
armonizada UNE-EN 934-3. La Direccin Facultativa deber autorizar su utilizacin y en su
incorporacin a la mezcla se seguir estrictamente lo dispuesto por el fabricante.
Las mezclas preparadas, envasadas o a granel llevarn el nombre del fabricante y la
cantidad de agua a aadir para obtener las resistencias deseadas.
Se emplear mortero para fbricas M-7,5 o superior.
Hormign armado:
Se utiliza como refuerzo y en puntos singulares como dinteles, esquinas, uniones... Deber
cumplir con las caractersticas dispuestas en este pliego y en la normativa vigente para el
hormign armado.
Bandas elsticas:
Pueden colocarse como base flexible entre el forjado y la base del tabique, para evitar
fisuras o mejorar el aislamiento acstico. Puede ser una plancha de madera, fieltro
bituminoso, corcho natural o expandido, poliestireno expandido, etc.
Armaduras: Adems de los aceros establecidos en la EHE-08, se consideran aceptables
los aceros inoxidables segn UNE ENV 10080:1996, UNE EN 10088 y UNE EN 845-3:2001 y para
pretensar segn la EN 10138. Las armaduras de junta de tendel de malla de acero contarn
con marcado CE conforme a lo expuesto en norma UNE-EN 845-3:2006+A1.
Componentes auxiliares: Llaves, amarres, colgadores, mnsulas y ngulos. Dispondrn
de garanta documental del cumplimiento del marcado CE y debern cumplir las
condiciones indicadas en la norma armonizada UNE-EN 845-1:2005+A1.
Las caractersticas higrotrmicas y acsticas de los materiales son:
ndice
de Densidad
reduccin
(Kg/ m3)
acstica
ponderado (dBA)

Factor
de
resistencia
al
Vapor de agua

Hueco 0,09

34

1000

10

Tabique L. Hueco doble, 0,16


tabicn

36

930

10

Tabique L. Hueco doble 0,33


gran formato

35

630

10

pie L.Perforado

0,21

40

1020

10

1 pie L.Perforado

0,41

52

1150

10

pie L.Macizo

0,12

43

2170

10

1 pie L.Macizo

0,17

55

2140

10

Material

Resistencia trmica
(m2 K/W)

Tabique
sencillo

L.

En el comportamiento acstico no se ha contemplado los revestimientos. Las caractersticas


de los materiales puestos en obra, tendrn las prestaciones sealadas anteriormente o

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

superiores, de otro modo, habrn de ser autorizados previamente por la direccin


facultativa.
Para ms detalle se tendr en cuenta lo especificado en el Catlogo de Elementos
Constructivos del CdigoTcnico de la Edificacin.
Puesta en obra
Los ladrillos y bloques se colocarn mojados, segn el aparejo indicado y quedando las
juntas completamente llenas de mortero. Si fuera necesario rectificar la posicin de algn
ladrillo se quitar ste retirando tambin el mortero. No se utilizarn piezas menores a medio
ladrillo.
Las fbricas se ejecutarn en hiladas horizontales. Los encuentros de esquinas o con otros
muros se harn mediante enjarjes en todo su espesor y en todas las hiladas. Una vez
ejecutadas se protegern de la lluvia, calor, viento y heladas.
Quedarn planas y aplomadas, y si se colocan sobre forjado, al menos 2/3 del ladrillo
apoyarn en forjado. Se cuidar de disponer las juntas de dilatacin segn proyecto o con
un mximo de 20 m. Se mantendrn las juntas estructurales. Sin autorizacin expresa del
Director de Obra se prohbe en muros de carga la ejecucin de rozas horizontales.
Las rozas se harn a mquina con una profundidad mxima de 4 cm. y se rellenarn por
completo con mortero. En ningn caso se taladrar por completo la fbrica para recibir una
instalacin y en el caso de que haya instalaciones a ambos lados, se ciudar de que no
coincidan.
Las bandas elsticas para mejorar el aislamiento se colocarn totalmente adheridas al
forjado o a los paramentos verticales con morteros apropiados.
La ejecucin de la fbrica comenzar desde la primera planta a la ltima disponiendo 2 cm.
entre la ltima hilada y el forjado que se rellenar como mnimo 24 horas despus.
El recibido de cercos y elementos de carpintera ser estanco de manera que se garantice
un ptimo aislamiento acstico.
Se observarn escrupulsamente las recomendaciones de ejecucin de encuentros de
elementos separadores verticales entre s y con fachadas especificadas en el captulo del
DB-HR del Cdigo Tcnico de la Edificacin.
Las fbricas se armarn horizontalmente donde pudieran fisurarse.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Si los ladrillos tienen el certificado de calidad reconocido la direccin de obra slo
comprobar los datos del albarn y del empaquetado, de otro modo se harn los ensayos
de recepcin segn normas UNE, de dimensiones, defectos, succin de agua, masa,
eflorescencias, heladicidad y resistencia a compresin.
Si el cemento y la cal disponen de distintivo de calidad reconocido oficialmente se
comprobar la identificacin, clase, tipo, categora y distintivos, de otro modo la direccin
facultativa podr requerir la realizacin de ensayos. Para el cemento de resistencia a
compresin, tiempos de fraguado, expansin, prdida al fuego, residuo insoluble, trixido de
azufre, cloruros, sulfuros, xido de aluminio y puzolanidad, segn RC-08 y para la cal se harn
ensayos qumicos, de finura de molido, fraguado y estabilidad de volumen.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

En aguas no potables sin experiencias previas se realizarn ensayos de exponente de


hidrgeno pH, sustancias disueltas, sulfatos, in cloruro, hidratos de carbono y sustancias
orgnicas solubles en ter indicadas en el artculo 27 de la EHE-08
Se comprobarn la identificacin, tipo, tamao y distintivos de las arenas pudindose realizar
ensayos de materia orgnica, granulometra y finos que pasan por el tamiz 0,08 segn EHE-08.
De los morteros se comprobar el tipo, dosificacin y distintivos, y se podrn realizar ensayos
de resistencia a compresin y consistencia con Cono de Abrams.
La direccin facultativa podr disponer la realizacin de ensayos de aislamiento a ruido
areo o limitacin del tiempo de reverberacin segn UNE-EN-ISO 140-5 y 3382.
Se comprobar el replanteo, ejecucin de las fbricas, morteros, cargaderos y refuerzos y la
proteccin de la fbrica admitiendo tolerancias de:
- replanteo: +-10 mm entre ejes parciales o +-30 entre ejes.
- desplomes: +-10 mm por planta y a +-30 mm en la altura total.
- espesores: -10 a +15 mm
- en altura: +-15 mm en las parciales y +-25 mm en las totales.
- distancias entre ejes: +-10 mm entre ejes parciales o +-20 mm entre ejes extremos.
- horizontalidad: +-2 mm por m.
- planeidad (medida en regla de 2 m): +-10 mm en paramentos para revestir +-5 mm en
paramentos sin revestimiento.
- tolerancias de las piezas cermicas segn lo expresado en la UNE-EN 771-1.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Fbricas superiores a 1 asta se medirn en volumen e inferiores por superficie ejecutada
deduciendo huecos.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
Anualmente se revisar la aparicin de fisuras, grietas, desplomes, desconchados,
humedades, deterioro del material de sellado de las juntas... y en su caso se pondr en
conocimiento de tcnico especialista.
Peridicamente se proceder a la limpieza de la fachada con agua o con cidos
apropiados diluidos y cepillo, evitando en todo caso las limpiezas por chorro de arena.
Cada 5 aos se realizar una revisin por tcnico especialista.

2.5.1.2. BLOQUES de TERMOARCILLA


Descripcin

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Obra de fbrica de una hoja de bloques cermicos de arcilla aligerada Termoarcilla, con
perforaciones verticales y junta vertical machihembrada para muros de cerramiento exterior
o tabiquera.
Materiales
Termoarcilla:
Tanto a nivel de piezas base como de piezas complementarias irn acompaados del
certificado de conformidad con el marcado CE segn la norma armonizada UNE-EN 771-1,
declarando expresamente la densidad aparente, resistencia a compresin, conductividad
trmica, durabilidad a ciclos hielo-deshielo, absorcin de agua, contenido de sales solubles
activas, expansin por humedad, permeabilidad al vapor y adherencia.
Las tolerancias dimensionales se ajustarn a lo expresado en dicha norma armonizada.
Debern disponer de marca N de AENOR, o cualquier otra certificacin de calidad
equivalente.
Todos los bloques y piezas complementarias que se utilicen procedern de un mismo
fabricante. Si hubiera que ejecutar con piezas de diferentes empresas ser necesario evaluar
la compatibilidad entre las piezas y el consentimiento de la direccin facultativa.
No tendrn defectos que deterioren su aspecto y durabilidad, sern regulares en
dimensiones y forma.
Mortero:
Se recomienda el empleo de morteros mixtos de cemento y cal.
Cemento: cumplirn las especificaciones dispuestas en el RC-08 y normas armonizadas UNE
EN 197-1 y 413-1 y las cales segn normas UNE EN 459-1
El cemento se suministrar acompaado de un albarn con los datos exigidos en la RC-08.
Irn acompaados del certificado de conformidad con el marcado CE por organismo
notificado y la declaracin del fabricante CE de conformidad.
Cuando el suministro se realice en sacos, el cemento se recibir en los mismos envases
cerrados en que fue expedido. No llegar a obra u otras instalaciones de uso, excesivamente
caliente. Se almacenar en sitio ventilado y defendido de la intemperie, humedad del suelo
y paredes.
Preferentemente se emplearn cementos para albailera pudiendo con la aprobacin de la
direccin de obra emplear otros cementos comunes a excepcin del CEM I y CEM II/A.
El suministrador de arenas deber garantizar documentalmente el cumplimiento del
marcado CE, para ello cada carga ir acompaada por hoja de suministro que estar en
todo momento a disposicin de la Direccin de la Obra, en la que figuren la declaracin de
conformidad del producto segn este marcado. Los ridos debern cumplir las condiciones
fsico-qumicas, fsico-mecnicas, de granulometra y forma indicadas en la norma
armonizada UNE-EN 13139.
Se admiten todas las aguas potables y las tradicionalmente empleadas. En caso de duda, el
agua cumplir los mismos requisitos dispuestos en el artculo 27 de la EHE-08 para el empleo
de agua para el hormign.
En caso de emplear aditivos el fabricante suministrar el aditivo correctamente etiquetado y
dispondr de marcado CE aportando la ficha de declaracin de conformidad a dicho
marcado y certificado de control de produccin en fbrica todo ello segn norma

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

armonizada UNE-EN 934-3. La Direccin Facultativa deber autorizar su utilizacin y en su


incorporacin a la mezcla se seguir estrictamente lo dispuesto por el fabricante.
Las mezclas preparadas, envasadas o a granel llevarn el nombre del fabricante y la
cantidad de agua a aadir para obtener las resistencias deseadas.
Se emplear mortero para fbricas M-7,5 o superior.
Bandas elsticas:
Pueden colocarse como base flexible entre el forjado y la base del tabique, para evitar
fisuras o mejorar el aislamiento acstico. Puede ser una plancha de madera, fieltro
bituminoso, corcho natural o expandido, poliestireno expandido, etc.
Armaduras: Adems de los aceros establecidos en la EHE-08, se consideran aceptables
los aceros inoxidables segn UNE ENV 10080:1996, UNE EN 10088 y UNE EN 845-3:2001 y para
pretensar segn la EN 10138. Las armaduras de junta de tendel de malla de acero contarn
con marcado CE conforme a lo expuesto en norma UNE-EN 845-3:2006+A1.
Componentes auxiliares: Llaves, amarres, colgadores, mnsulas y ngulos. Dispondrn
de garanta documental del cumplimiento del marcado CE y debern cumplir las
condiciones indicadas en la norma armonizada UNE-EN 845-1:2005+A1.
Las caractersticas higrotrmicas y acsticas de los materiales son:
ndice de reduccin Densidad
acstica ponderado
(Kg/ m3)
(dBA)

Factor
de
resistencia
al
Vapor de agua

Bloque
cermico 0,432
espesor 190 mm.

46

1080

10

Bloque
cermico 0,429
espesor 240 mm.

48

1080

10

Bloque
cermico 0,426
espesor 290 mm.

50

1080

10

Material

Conductivid
ad trmica
(W/mK)

En el comportamiento acstico no se ha contemplado los revestimientos. Las caractersticas


de los materiales puestos en obra, tendrn las prestaciones sealadas anteriormente o
superiores, de otro modo, habrn de ser autorizados previamente por la direccin
facultativa.
Para ms detalle se tendr en cuenta lo especificado en el Catlogo de Elementos
Constructivos del CdigoTcnico de la Edificacin.
Puesta en obra
La totalidad del cerramiento se resolver con piezas de Termoarcilla, pudindose utilizar
ladrillo perforado con resistencia a compresin igual o superior a la del bloque de
Termoarcilla en los tramos de muro situados en zonas no habitables.
La colocacin se realizar con junta horizontal de mortero y junta vertical a hueso y a tope
(mxima separacin: 2 cm.) mediante el machihembrado de las testas.
En los puntos singulares (esquinas, jambas de huecos, juntas de movimiento y encuentros de
muros en T) se utilizarn piezas complementarias de Termoarcilla.
Se ajustar la longitud del muro a la definida en proyecto mediante piezas de modulacin
de 5 10 cm. de espesor. Ante la necesidad de emplear piezas cortadas, se realizar el

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

corte con sierra de mesa con disco D 550 mm. y se ajustarn mediante una junta vertical
de mortero discontinua.
Las hiladas estarn perfectamente niveladas, disponiendo el espesor de mortero necesario
en una nica banda continua bajo la primera hilada, para compensar las diferencias de
nivelacin del soporte.
Se humedecern las piezas antes de su colocacin para evitar la deshidratacin del mortero,
que ser preferiblemente, un mortero mixto de cemento y cal, con resistencia mnima a
compresin de 7,5 Mpa.
En muros de cerramiento de una sola hoja, el tendel se realizar de forma discontinua,
extendiendo el mortero en dos bandas separadas 1 o 2 cm. y de un espesor de 3 cm. para
que una vez asentado el bloque quede una junta de 1 a 1,5 cm.
En muros exteriores trasdosados y muros interiores, la junta horizontal ser continua.
En muros y cerramientos exteriores es recomendable colocar siempre el canto del bloque
con estriado profundo en la cara exterior.
Se mantendr la traba, consiguiendo que la distancia entre juntas verticales de hiladas
consecutivas sea igual o mayor de 7 cm. empleando para ello las piezas de modulacin,
piezas cortadas y/o dos cordones de mortero.
En el arranque del muro sobre la cimentacin, se dispondr de una barrera impermeable, a
una altura mayor o igual a 30 cm. del nivel del suelo, garantizando la impermeabilidad por
debajo de la misma.
En la formacin de huecos, el dintel se resolver con la pieza en forma de U de Termoarcilla,
admitindose otras soluciones alternativas previo consentimiento expreso de la direccin
facultativa.
El dintel deber apoyarse 1/5 de la luz por cada lado, y como mnimo 15 cm en cerramientos
no portantes, sobre la junta de mortero que siempre ser continua en la zona de apoyo.
El revestimiento situado sobre los dinteles quedar armado anclando la malla una longitud
superior a 20 cm por cada uno de sus lados y se realizar un gotern en la cara inferior de los
mismos.
Las jambas se ejecutarn con piezas de terminacin, medias o piezas cortadas (long. >10
cm.) y piezas base que se regularizarn con mortero, colocando una malla en el
revestimiento de esta zona.
El vierteaguas tendr una pendiente superior al 10%. Sus extremos penetrarn en el
revestimiento de los telares y estarn provistos de un gotern y volar, lo mismo que las
albardillas, unos 4 cm aproximadamente. Si es preciso se colocar una membrana
impermeable debajo del vierteaguas.
La colocacin de la ventana deber cumplir las exigencias de la UNE 85.219:86 "Ventanas.
Colocacin en obra".
El recibido de cercos y elementos de carpintera ser estanco de manera que se garantice
un ptimo aislamiento acstico.
Se dejarn juntas de movimiento verticales cada un mximo de 12 m. que tendrn un ancho
entre 10 y 20 mm., utilizando piezas de terminacin y piezas medias para resolver los bordes
de la junta. Dispondrn de llaves embebidas en la junta, como mnimo cada dos hiladas.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

La distancia mxima entre la junta de movimiento y una esquina del edificio deber disminuir
aproximadamente a la mitad, al igual que en petos de cubierta y muros expuestos por
ambas caras. En caso de muros armados se pueden distanciar las juntas hasta 16 m.
Las rozas y rebajes no afectarn a la estabilidad del muro y se tendr en cuenta la
minoracin del aislamiento trmico debida a los mismos. Se harn a mquina con una
profundidad mxima de 4 cm. y se rellenarn por completo con mortero. En ningn caso se
taladrar por completo la fbrica para recibir una instalacin y en el caso de que haya
instalaciones a ambos lados, se ciudar de que no coincidan.
Las bandas elsticas para mejorar el aislamiento se colocarn totalmente adheridas al
forjado o a los paramentos verticales con morteros apropiados.
Se evitar ejecutar fbricas durante periodos con heladas. Se proteger la fbrica con
mantas de aislante trmico o plsticos, si hiela al comenzar la jornada o durante sta y si se
utiliza anticongelante para el mortero, se seguirn las indicaciones del fabricante en cuanto
a dosificacin y ejecucin.
Cuando sea necesario interrumpir la fbrica, deber dejarse escalonado en su extremo (no
dejando adarajas ni endejas).
No se ejecutar una altura mayor de 3 m. en una jornada para evitar el aplastamiento del
mortero.
El cerramiento deber apoyarse sobre el canto del forjado al menos 2/3 partes de su espesor
y la entrega del cerramiento con el forjado se podr resolver con una junta de movimiento
horizontal de unos 2 cm., siendo imprescindible en el ltimo forjado (fachadas lisas sin aleros o
viseras) y recomendable cada dos plantas.
El recubrimiento exterior de los pilares se resolver con plaquetas de espesor mnimo 9,6 cm o
bien con piezas base cortadas longitudinalmente y se colocar un redondo de dimetro 6
mm y longitud 120 cm cada 3 hiladas, en el ancho exterior de la junta horizontal.
Se colocar una lmina de espuma de polietileno o similar de espesor mnimo 5 mm, entre las
caras del pilar y las piezas del cerramiento para independizar los movimientos de ambos
elementos.
Se observarn escrupulsamente las recomendaciones de ejecucin de encuentros de
elementos separadores verticales entre s y con fachadas especificadas en el captulo del
DB-HR del Cdigo Tcnico de la Edificacin.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Los bloques dispondrn necesariamente de marca N de AENOR o equivalente.
El cemento y la cal dispondrn de marcado CE y en caso de tener de distintivo de calidad
reconocido oficialmente se comprobar la identificacin, clase, tipo, categora y distintivos,
dede otro modo la direccin facultativa podr requerir la realizacin de ensayos. Para el
cemento de resistencia a compresin, tiempos de fraguado, expansin, prdida al fuego,
residuo insoluble, trixido de azufre, cloruros, sulfuros, xido de aluminio y puzolanidad, segn
RC-08 y para la cal se harn ensayos qumicos, de finura de molido, fraguado y estabilidad
de volumen.
En aguas no potables sin experiencias previas se realizarn ensayos de exponente de
hidrgeno pH, sustancias disueltas, sulfatos, in cloruro, hidratos de carbono y sustancias
orgnicas solubles en ter indicadas en el artculo 27 de la EHE-08

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Se los ridos que dispondrn de marcado CE, se comprobarn la identificacin, tipo, tamao
y distintivos de las arenas pudindose realizar ensayos de materia orgnica, granulometra y
finos que pasan por el tamiz 0,08 segn EHE-08.
De los morteros se comprobar el tipo, dosificacin y distintivos, y se podrn realizar ensayos
de resistencia a compresin y consistencia con Cono de Abrams.
Se comprobar el replanteo, ejecucin de las fbricas, morteros, cargaderos y refuerzos y la
proteccin de la fbrica.
La direccin facultativa podr disponer la realizacin de ensayos de aislamiento a ruido
areo o limitacin del tiempo de reverberacin segn UNE-EN-ISO 140-5 y 3382.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Se medir la superficie ejecutada deduciendo huecos.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
Anualmente se revisar la aparicin de fisuras, grietas, desplomes, desconchados,
humedades, deterioro del material de sellado de las juntas... y en su caso se pondr en
conocimiento de tcnico especialista.
Peridicamente se proceder a la limpieza de la fachada con agua o con cidos
apropiados diluidos y cepillo, evitando en todo caso las limpiezas por chorro de arena.
Cada 5 aos se realizar una revisin por tcnico especialista.

2.6. TABIQUERAS y DIVISIONES


2.6.1. LADRILLO CERMICO
Descripcin
Divisiones fijas sin funcin estructural, de fbrica de ladrillos cermicos unidos mediante
mortero, para separaciones interiores.
Materiales
Ladrillos:
Irn acompaados del certificado de conformidad con el marcado CE segn la norma
armonizada UNE-EN 771-1, declarando expresamente la densidad aparente, resistencia a
compresin, conductividad trmica, durabilidad a ciclos hielo-deshielo, absorcin de agua,
contenido de sales solubles activas, expansin por humedad, permeabilidad al vapor y
adherencia.
No tendrn defectos que deterioren su aspecto y durabilidad, sern regulares en
dimensiones y forma. No presentarn fisuras, exfoliaciones y desconchados.
Mortero:
El aglomerante empleado podr ser cemento o mixto con cal.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cemento: cumplirn las especificaciones dispuestas en el RC-08 y normas armonizadas UNE


EN 197-1 y 413-1 y las cales segn normas UNE EN 459-1
El cemento se suministrar acompaado de un albarn con los datos exigidos en la RC-08.
Irn acompaados del certificado de conformidad con el marcado CE por organismo
notificado y la declaracin del fabricante CE de conformidad.
Cuando el suministro se realice en sacos, el cemento se recibir en los mismos envases
cerrados en que fue expedido. No llegar a obra u otras instalaciones de uso, excesivamente
caliente. Se almacenar en sitio ventilado y defendido de la intemperie, humedad del suelo
y paredes.
Preferentemente se emplearn cementos para albailera pudiendo con la aprobacin de la
direccin de obra emplear otros cementos comunes a excepcin del CEM I y CEM II/A.
Pueden emplearse arenas naturales procedentes de ros, mina y playa, o de machaqueo, o
bien mezcla de ellas. El suministrador deber garantizar documentalmente el cumplimiento
del marcado CE, para ello cada carga ir acompaada por hoja de suministro que estar
en todo momento a disposicin de la Direccin de la Obra, en la que figuren la declaracin
de conformidad del producto segn este marcado.
Se admiten todas las aguas potables y las tradicionalmente empleadas. En caso de duda, el
agua cumplir los mismos requisitos dispuestos en el artculo 27 de la EHE-08 para el empleo
de agua para el hormign.
En caso de emplear aditivos el fabricante suministrar el aditivo correctamente etiquetado y
dispondr de marcado CE aportando la ficha de declaracin de conformidad a dicho
marcado y certificado de control de produccin en fbrica todo ello segn norma
armonizada UNE-EN 934-3. La Direccin Facultativa deber autorizar su utilizacin y en su
incorporacin a la mezcla se seguir estrictamente lo dispuesto por el fabricante.
Las mezclas preparadas, envasadas o a granel llevarn el nombre del fabricante, la
cantidad de agua a aadir para obtener las resistencias deseadas y dispondrn de garanta
documental del cumplimiento del marcado CE y debern cumplir las condiciones indicadas
en la norma armonizada UNE-EN 998-2.
Se emplear mortero para tabiqueras M-5 o superior.
Bandas elsticas:
Pueden colocarse como base flexible entre el forjado y la base del tabique, para evitar
fisuras o mejorar el aislamiento acstico. Puede ser una plancha de madera, fieltro
bituminoso, corcho natural o expandido, poliestireno expandido, etc.
Las caractersticas higrotrmicas y acsticas de los materiales son:

(m2 K/W)

ndice
de Densidad
reduccin acstica
(Kg/ m3)
ponderado (dBA)

Factor
de
resistencia
al
Vapor de agua

0,09

34

1000

10

Tabique L. Hueco doble, 0,16


tabicn

36

930

10

Tabique L. Hueco doble 0,33


gran formato

35

630

10

pie L.Perforado

40

1020

10

Material

Resistencia trmica

Tabique L. Hueco sencillo

0,21

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

1 pie L.Perforado

0,41

52

1150

10

pie L.Macizo

0,12

43

2170

10

1 pie L.Macizo

0,17

55

2140

10

En el comportamiento acstico no se ha contemplado los revestimientos. Las caractersticas


de los materiales puestos en obra, tendrn las prestaciones sealadas anteriormente o
superiores, de otro modo, habrn de ser autorizados previamente por la direccin
facultativa.
Para ms detalle se tendr en cuenta lo especificado en el Catlogo de Elementos
Constructivos del CdigoTcnico de la Edificacin.
Puesta en obra
Con el fin de evitar fisuraciones debidas a los movimientos de la estructura, la puesta en obra
se realizar preferentemente desde las plantas superiores hacia las inferiores. Entre la hilada
superior del tabique y el forjado o elemento horizontal de arriostramiento se dejar una
holgura de 2 cm. que se rellenar posteriormente y al menos transcurridas 24 h., con pasta de
yeso, y en cualquier caso despus de haber tabicado las plantas superiores. No se harn
uniones solidarias entre el tabique y la estructura.
Los ladrillos se humedecern por riego sin llegar a empaparlos. Se colocarn miras
aplomadas distanciadas 4 m. como mximo. Los ladrillos se colocarn en hiladas
horizontales, con juntas de 1 cm. de espesor procurando que el nivel superior de los
premarcos coincida con una llaga horizontal. En caso de no poder ejecutar la fbrica de
una sola vez, se dejar la primera unidad escalonada o se dejarn enjarjes.
La superficie de colocacin deber estar limpia y nivelada y se situar una banda elstica si
as lo considera la direccin de obra en funcin de la previsin de movimientos menores de
la estructura.
Las rozas se harn a mquina con una profundidad mxima de 4 cm. en ladrillo macizo o 1
canuto en hueco y se rellenarn por completo con mortero o pasta de yeso. En ningn caso
se taladrar por completo el tabique para recibir una instalacin y en el caso de que haya
instalaciones a ambos lados, se ciudar de que no coincidan.
Las bandas elsticas para mejorar el aislamiento se colocarn totalmente adheridas al
forjado o a los paramentos verticales con morteros apropiados.
Se observarn escrupulsamente las recomendaciones de ejecucin de encuentros de
elementos separadores verticales entre s y con fachadas especificadas en el captulo del
DB-HR del Cdigo Tcnico de la Edificacin.
En huecos mayores que 1 m., sern necesarios elementos resistentes en los dinteles.
No se levantarn las fbricas si hay viento superior a 50 km../h. y no estn protegidas del
mismo o si la temperatura no est comprendida entre 5 y 38 C.
El tabique quedar plano y aplomado, tendr una composicin uniforme en toda su altura y
no presentar ladrillos rotos ni juntas no rellenas de masa, tanto horizontales como verticales.
Una vez ejecutado se proteger de la lluvia, calor y heladas.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Si los ladrillos tienen certificado de calidad reconocido, la direccin de obra slo
comprobar los datos del albarn y del empaquetado, de otro modo se harn los ensayos

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

de recepcin indicados en normas UNE, de dimensiones, defectos, succin de agua, masa,


eflorescencias, heladicidad y resistencia a compresin.
Si el cemento y la cal disponen de distintivo de calidad reconocido oficialmente se
comprobar la identificacin, clase, tipo, categora y distintivos, de otro modo la direccin
facultativa podr requerir la realizacin de ensayos. Para el cemento de resistencia a
compresin, tiempos de fraguado, expansin, prdida al fuego, residuo insoluble, trixido de
azufre, cloruros, sulfuros, xido de aluminio y puzolanidad, segn RC-08 y para la cal se harn
ensayos qumicos, de finura de molido, fraguado y estabilidad de volumen.
En aguas no potables sin experiencias previas se realizarn ensayos de exponente de
hidrgeno pH, sustancias disueltas, sulfatos, in cloruro, hidratos de carbono y sustancias
orgnicas solubles en ter indicadas en el artculo 27 de la EHE-08.
Se comprobarn la identificacin, tipo, tamao y distintivos de las arenas. Se harn ensayos
de materia orgnica, granulometra y finos que pasan por el tamiz 0,08 segn EHE-08.
De los morteros preparados en obra se comprobar el tipo, dosificacin y se realizarn
ensayos de resistencia mecnica y consistencia con Cono de Abrams. Los morteros
envasados o a granel se comprobar el marcado CE, el tipo y distintivos de calidad.
En los cercos se controlor el desplome, escuadra y fijacin al tabique del cerco o
premarco, y de la distancia entre cercos y rozas. Cada 25 m. de tabique se har un control
de planeidad, desplome, unin a otros tabiques profundidad de rozas. Tambin se harn
controles de replanteo, dimensiones del tabique, aparejo, adherencia entre ladrillos y
mortero, y juntas de dilatacin y/o de asentamiento.
La direccin facultativa podr disponer la realizacin de ensayos de aislamiento a ruido
areo o limitacin del tiempo de reverberacin segn UNE-EN-ISO 140-5 y 3382.
Las tolerancias mximas admisibles sern:
En replanteo: +-2 cm.
Desplomes: 1 cm. en 3 m.
Planeidad medida en regla de 2 m.: +-1 cm.
Tolerancias de las piezas cermicas segn lo expresado en la UNE-EN 771-1.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Se medir la superficie ejecutada descontando huecos mayores de 1 m2.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
Cualquier modificacin de tabiqueras ha de ser consultado con un tcnico especialista con
el fin de evitar posibles deterioros en las instalaciones u otros elementos constructivos.
Se revisar peridicamente con el objeto de localizar posibles grietas, fisuras o humedades
que en caso de aparecer ser puesto en conocimiento de un tcnico en la materia.

2.7. CARPINTERA EXTERIOR


2.7.1. ACERO

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Descripcin
Cerramientos de huecos de fachada, con puertas y ventanas realizadas con carpintera de
perfiles de acero laminado en caliente o conformados en fro.
Pueden estar constituidas por varias hojas y ser fijas, abatibles de diferentes modos o
correderas.
Materiales
Premarcos o cercos:
Pueden estar realizados con perfiles de acero galvanizado o de madera.
Perfiles de acero:
Sern de acero laminado en caliente o conformado en fro (espesor mnimo de 0,88 mm),
protegidos contra la corrosin. Sern rectilneos, sin alabeos ni rebabas.
Accesorios de montaje:
Escuadras, elementos de fijacin, burletes de goma, cepillos, herrajes y juntas perimetrales.
Todos ellos sern de material protegido contra la oxidacin.
Las caractersticas higrotrmicas de los materiales contemplados en el proyecto son:
Material

Transmitancia (W/m2 K)

Absortividad

Sin rotura de puente trmico

5,7

0,7

Con rotura de puente trmico de 4-12 mm.

0,7

Con rotura de puente trmico mayor de 12 mm. 3,2

0,7

Las caractersticas de los materiales puestos en obra, tendrn las prestaciones sealadas
anteriormente o superiores, de otro modo, habrn de ser autorizados previamente por la
direccin facultativa.
Para ms detalle se tendr en cuenta lo especificado en el Catlogo de Elementos
Constructivos del CdigoTcnico de la Edificacin.
Puesta en obra
La puesta en obra de cercos y carpinteras a los paramentos verticales garantizar la
estanquidad necesaria para alcanzar el necesario grado de aislamiento acstico.
Las uniones entre perfiles se soldarn en todo el permetro de contacto.
Los cercos se fijarn a la fbrica mediante patillas de acero galvanizado, de 100 mm. de
longitud y separadas 250 mm. de los extremos y entre s de 550 mm. como mximo. Tendr
como mnimo dos patillas por travesao o larguero. El perfil horizontal del cerco, llevar 1
taladro de 30 mm de seccin en el centro y 2 a 100 mm de los extremos, para desage de
las aguas infiltradas. La hoja ir unida al cerco mediante pernios o bisagras, de acero
inoxidable o galvanizado, colocados por soldadura al perfil y a 150 mm. de los extremos. En
carpinteras de hojas abatibles, el perfil superior del cerco llevar 3 taladros de dimetro 6
mm., uniformemente repartidos, y en ventana fija, adems, el perfil horizontal inferior llevar 1
taladro de igual dimensin en el centro. Entre la hoja y el cerco existir una cmara de
expansin, con holgura de cierre no mayor de 2 mm.
La carpintera abatible llevar un mecanismo de cierre y maniobra de funcionamiento suave
y continuo. Podr montarse y desmontarse fcilmente para sus reparaciones. La carpintera
abatible de eje horizontal llevar adems un brazo retenedor articulado, que al abrirse la

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

hoja la mantenga en posicin, formando un ngulo de 45 con el cerco. Los planos formados
por la hoja y el cerco sern paralelos en posicin de cerrado.
En carpintera corredera, las hojas irn montadas sobre patines o poleas de acero inoxidable
o material sinttico y provistas en la parte superior de distanciadores, evitando las vibraciones
producidas por el viento. Los carriles permitirn el desplazamiento de las hojas de forma
suave. Los mecanismos de cierre y maniobra podrn montarse y desmontarse para sus
reparaciones.
Los junquillos sern de fleje de acero galvanizado o inoxidables conformados en fro.
Para asegurar la estanquidad del cerramiento, las juntas alrededor del cerco o de la hoja,
debern ser continuas y estar aplastadas constante y uniformemente. El sellado se realizar
sobre superficies limpias y secas empleando materiales de sellado compatibles con la
carpintera y la obra de fbrica.
La carpintera vendr protegida con imprimacin anticorrosiva mnima de 15 micras de
espesor y la proteccin galvanizada no presentar discontinuidades ni presentar soldaduras
o encuentros sin recubrimiento.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
En el caso de ventanas y puertas peatonales, la carpintera ir acompaada de la
declaracin de conformidad con el marcado CE segn la norma armonizada UNE-EN 14351,
declarando expresamente comportamiento al fuego exterior, reaccin al fuego, resistencia,
infliltracin de humo, autocierre, estanquidad al agua, sustancias peligrosas, resistencia
carga viento, resistencia carga nieve, resistencia a impactos, fuerzas de maniobra,
capacidad para soportar cargas, capacidad de desbloqueo, prestaciones acsticas,
transmitancia, propiedades de radiacin y permeabilidad al aire.
Los perfiles tendrn certificado de calidad reconocido. Si la direccin facultativa lo estima
oportuno se harn ensayos de materiales segn normas UNE de lmite elstico, resistencia y
alargamiento de rotura, doblado simple, resiliencia Charpy, dureza Brinell, anlisis qumicos,
aspecto, medidas, tolerancias, adherencia, espesor medio, masa y uniformidad de
recubrimiento, permeabilidad al aire, estanquidad al agua y resistencia al viento.
Se harn controles de carpintera de aplomado, enrasado y recibido de la carpintera, y
fijacin a la peana y a la caja de persiana. Cada 20 unidades de carpintera se har una
prueba de servicio de estanquidad al agua, y en todas las unidades se comprobar el
funcionamiento del mecanismo de apertura y cierre.
Las tolerancias mximas admisibles sern:
Desplome del cerco: 2 mm. por m.
Enrasado: 2 mm.
Altura y anchura: +-0.5 mm.
Espesor y desviaciones de escuadra: +-0,1 mm.
Alabeo y curvatura: +-0,5 mm.
Diferencia de longitud entre diagonales en cercos o precercos: 5 mm. si son mayores de 3
m. y 3 mm. si son de 2 m. o menos.
Criterios de medicin y valoracin

En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen


otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Se medir la superficie por las caras exteriores del marco.
Condiciones de conservacin y mantenimiento

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Se exponen a continuacin las condiciones bsicas y generales de conservacin y


mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
Evitar el contacto permanente de la carpintera con otros metales.
En carpinteras pintadas se comprobar su estado cada 3 aos renovando acabado si fuera
necesario.
Cada 6 meses se limpiar la carpintera con jabn neutro con agua, aclarando y secando
con posterioridad, se engrasarn los herrajes que lo necesiten y se comprobar su estado
general.

2.7.2. PVC
Descripcin
Cerramientos de huecos de fachada, con puertas y ventanas realizadas con carpintera de
perfiles de PVC. Pueden estar constituidas por varias hojas y ser fijas, abatibles de diversos
modos o correderas.
Materiales
Cerco o premarco:
Podr ser de madera o tubular de acero galvanizado conformado en fro.
Perfiles de PVC:
Su espesor mnimo ser de 18 mm. en perfiles de pared, 1 mm. en junquillos y 1,4 g su peso
especfico. No presentarn alabeos, fisuras ni deformaciones y sus ejes sern rectilneos.
Cumplirn la UNE 113-360 XL-94. Durante el transporte y almacenaje se protegern de forma
que no sufran impactos, roturas, rayaduras o deformaciones, y estarn ventilados y
protegidos contra la humedad y la suciedad.
Las caractersticas higrotrmicas de los materiales contemplados en el proyecto son:
Material

Transmitancia (W/m2 K)

Absortividad

Dos cmaras

2,2

0,7

Tres cmaras

1,8

0,7

Las caractersticas de los materiales puestos en obra, tendrn las prestaciones sealadas
anteriormente o superiores, de otro modo, habrn de ser autorizados previamente por la
direccin facultativa.
Para ms detalle se tendr en cuenta lo especificado en el Catlogo de Elementos
Constructivos del CdigoTcnico de la Edificacin.
Accesorios de montaje:
Escuadras, elementos de fijacin, burletes de goma, cepillos, herrajes de material inoxidable,
refuerzos metlicos protegidos contra la corrosin y juntas perimetrales.
Masilla elstica:
Ser permanente, no rgida, compatible con los materiales a sellar y se utilizar para sellado
perimetral.
Puesta en obra

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

La puesta en obra de cercos y carpinteras a los paramentos verticales garantizar la


estanquidad necesaria para alcanzar el necesario grado de aislamiento acstico.
Las uniones entre perfiles se harn a inglete y por soldadura trmica a una temperatura
mnima de fusin de 180 C, quedando unidos en todo su permetro de contacto. Se
eliminarn todas las rebabas debidas a la soldadura, tomando las precauciones necesarias
para no deteriorar el aspecto exterior del perfil.
Los cercos se fijarn a la fbrica mediante patillas de acero galvanizado, de 100 mm. de
longitud y separadas 250 mm. de los extremos y entre s de 550 mm. como mximo. Tendr
como mnimo dos patillas por travesao o larguero. El perfil horizontal del cerco, llevar 1
taladro de 30 mm de seccin en el centro y 2 a 100 mm de los extremos, para desage de
las aguas infiltradas. La hoja ir unida al cerco mediante pernios o bisagras, de acero
inoxidable o galvanizado o aluminio extruido, a 250 mm. de los extremos. Los herrajes se
sujetarn a los perfiles mediante tornillos protegidos contra la corrosin, de rosca de PVC si se
atornillan a ste material, o de rosca chapa o mtrica si se atornillan a refuerzo metlico. En
carpinteras de hojas abatibles, el perfil superior del cerco llevar 3 taladros de dimetro 6
mm, uniformemente repartidos, y en ventana fija, adems, el perfil horizontal inferior llevar 1
taladro de igual dimensin en el centro. Entre la hoja y el cerco existir una cmara de
expansin, con holgura de cierre no mayor de 1 mm.
El mecanismo de cierre y maniobra podr montarse y desmontarse fcilmente para sus
reparaciones. La carpintera abatible de eje horizontal llevar adems un brazo retenedor
articulado, que al abrirse la hoja la mantenga en posicin, formando un ngulo de 45 con el
cerco. En carpintera corredera, las hojas irn montadas sobre patines o poleas de acero
inoxidable o material sinttico y provistas en la parte superior, en el caso de puertas y
tambin en la parte inferior en ventanas, de distanciadores que eviten las vibraciones
producidas por el viento.
En el relleno de huecos con mortero, para la fijacin de patillas, se protegern herrajes y
paramentos del mortero que pudiera caer, y no se deteriorar el aspecto exterior del perfil.
La carpintera tendr una estabilidad dimensional longitudinal del +-5%.
La junta entre el marco y la obra tendr un espesor mnimo de 5 mm. y se rellenar con
material elstico y permanente. Para asegurar la estanquidad del cerramiento, las juntas
debern ser continuas y estar aplastadas constante y uniformemente. El sellado se realizar
sobre superficies limpias y secas.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
En el caso de ventanas y puertas peatonales, la carpintera ir acompaada de la
declaracin de conformidad con el marcado CE segn la norma armonizada UNE-EN 14351,
declarando expresamente comportamiento al fuego exterior, reaccin al fuego, resistencia,
infliltracin de humo, autocierre, estanquidad al agua, sustancias peligrosas, resistencia
carga viento, resistencia carga nieve, resistencia a impactos, fuerzas de maniobra,
capacidad para soportar cargas, capacidad de desbloqueo, prestaciones acsticas,
transmitancia, propiedades de radiacin y permeabilidad al aire.
Los perfiles dispondrn de certificado de calidad reconocido. Si la direccin facultativa lo
estima oportuno se harn ensayos segn normas UNE, de medidas, tolerancias, espesor y
calidad de recubrimiento andico y permeabilidad al aire, estanquidad al agua y resistencia
al viento
Se harn controles de aplomado, enrasado y recibido de la carpintera, y fijacin a la peana
y a la caja de persiana. Cada 20 unidades de carpintera se har una prueba de servicio de

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

estanquidad al agua, y en todas las unidades se comprobar el funcionamiento del


mecanismo de apertura y cierre.
Las tolerancias mximas admisibles sern:
Desplome del cerco: 2 mm. por m
Enrasado: 2 mm.
Altura y anchura: +-0.5 mm.
Espesor y desviaciones de escuadra: +-0,1 mm.
Alabeo y curvatura: +-0,5 mm.
Diferencia de longitud entre diagonales en cercos o precercos: 5 mm. si son mayores de 3
m. y 3 mm. si son de 2 m. o menos.
Criterios de medicin y valoracin

En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen


otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Se medir la superficie por las caras exteriores del marco.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
Se pondr especial cuidado en el sellado entre la carpintera y la fbrica, debido a los
importantes movimientos que sufre la carpintera.
Cada 6 meses se limpiar la carpintera con jabn neutro con agua, aclarando y secando
con posterioridad, se engrasarn los herrajes que lo necesiten y se comprobar su estado
general.

2.7.3. MADERA
Descripcin
Cerramientos de huecos de fachada, con puertas y ventanas realizadas con carpintera de
perfiles de perfiles de madera. Pueden estar constituidas por varias hojas y ser fijas, abatibles
de diversos modos o correderas.
Materiales
Cerco o premarco:
Podr ser de madera o tubular conformado en fro de acero galvanizado.
Perfiles de madera:
El contenido de humedad de la madera ser de entre el 15 y el 12 %. No presentarn
alabeos, fendas, acebolladuras ni ataques de hongos o insectos. La desviacin mxima de
las fibras respecto al eje ser menor de 1/16. El espesor de los anillos de crecimiento ser
uniforme. Los nudos sern sanos, no pasantes y de dimetro inferior a 15 mm, distando entre s
300 mm como mnimo.
Las caractersticas higrotrmicas de los materiales contemplados en el proyecto son:
Material

Transmitancia (W/m2 K)

Absortividad

Madera de densidad media- alta

2,2

0,7

Madera de densidad media- baja

2,0

0,7

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Las caractersticas de los materiales puestos en obra, tendrn las prestaciones sealadas
anteriormente o superiores, de otro modo, habrn de ser autorizados previamente por la
direccin facultativa.
Para ms detalle se tendr en cuenta lo especificado en el Catlogo de Elementos
Constructivos del CdigoTcnico de la Edificacin.
Accesorios de montaje:
Escuadras, elementos de fijacin, burletes de goma, cepillos, herrajes y juntas perimetrales.
Puesta en obra
La puesta en obra de cercos y carpinteras a los paramentos verticales garantizar la
estanquidad necesaria para alcanzar el necesario grado de aislamiento acstico.
La unin de perfiles quedar rgida y se har mediante ensambles encolados. Todas las caras
de la carpintera quedarn correctamente cepilladas, enrasadas y sin marcas de cortes.
El cerco o premarco ir provisto de taladros para atornillar las patillas de anclaje de acero
galvanizado o aluminio, con una penetracin mnima de 25 mm, una separacin a los
extremos de 250 mm. y entre s de 550 mm. como mximo. Tendr como mnimo dos patillas
por travesao o larguero. Si lleva premarco, el cerco llevar como mnimo dos taladros de
dimetro 6 mm por travesao o larguero para su montaje.
En carpintera abatible, la hoja ir unida al cerco mediante pernios. Entre la hoja y el cerco se
formar una cmara de expansin con holgura de cierre no mayor de 2 mm. El perfil
horizontal del cerco llevar 1 taladro de 30 mm de seccin en el centro y 2 a 100 mm. de los
extremos, para desage de las aguas infiltradas. La carpintera abatible de eje horizontal
llevar un brazo retenedor articulado, que al abrirse la hoja la mantenga en posicin,
formando un ngulo de 45 con el cerco.
En carpintera corredera, las hojas irn montadas sobre patines o poleas de acero inoxidable
o material sinttico y provistas en la parte superior e inferior de cepillos o juntas aislantes, con
holgura de 2 mm, que permitan el deslizamiento de las hojas, y a la vez asegure la
estanquidad y evite las vibraciones producidas por el viento.
El mecanismo de cierre podr montarse y desmontarse para sus reparaciones.
Se colocarn junquillos en toda la longitud de los perfiles del cerco por medio de tornillos o
clavos de acero galvanizado separados entre s 350 mm como mximo y a 50 mm de los
extremos.
En el relleno de huecos con mortero para la fijacin de patillas, se protegern herrajes y
paramentos del mortero que pudiera caer. Las patillas tambin pueden sujetarse con grapas.
La junta perimetral de la carpintera se rellenar con espumas adhesivas. Para asegurar la
estanquidad del cerramiento, las juntas debern ser continuas y estar aplastadas constante y
uniformemente. El sellado se realizar sobre superficies limpias y secas con un material
compatible con los materiales.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
En el caso de ventanas y puertas peatonales, la carpintera ir acompaada de la
declaracin de conformidad con el marcado CE segn la norma armonizada UNE-EN 14351,
declarando expresamente comportamiento al fuego exterior, reaccin al fuego, resistencia,
infliltracin de humo, autocierre, estanquidad al agua, sustancias peligrosas, resistencia
carga viento, resistencia carga nieve, resistencia a impactos, fuerzas de maniobra,

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

capacidad para soportar cargas, capacidad de desbloqueo, prestaciones acsticas,


transmitancia, propiedades de radiacin y permeabilidad al aire.
Los perfiles dispondrn de distintivos AITIM. Si la direccin facultativa lo estima oportuno se
harn ensayos segn normas UNE de dimensiones, inercia, humedad, nudos, fendas y
acebolladuras, peso especfico y dureza y permeabilidad al aire, estanquidad al agua y
resistencia al viento.
Los cercos, precercos y hojas se tratarn al doble vaco.
Se harn controles de aplomado, enrasado y recibido de la carpintera, y sellado del cerco.
En todas las unidades de carpintera se comprobar el funcionamiento del mecanismo de
apertura y cierre.
Las tolerancias mximas admisibles sern:
Desplome: 4 mm. por m. de cerco y 3 mm. en precerco.
Enrasado: 2 mm.
Dimensiones: +-1 mm.
Alabeo: 6 mm.
Curvatura: 6 mm. en largueros y 2 mm. en testeros
Escuadra: 2 mm.
Diferencia de longitud entre diagonales en cercos o precercos: 5 mm. si son mayores de 3
m. y 3 mm. si son de 2 m. o menos.
Dimetro de nudos: 10 mm. en caras vistas para barnizar, 2/3 del ancho de caras para
pintar y de caras para pintar si son nudos negros.
Criterios de medicin y valoracin

En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen


otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Se medir la superficie por las caras exteriores del marco.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.
Proteger la madera de la humedad, rayos solares, insectos xilfagos u hongos mediante un
recubrimiento protector superficial.
Cada 6 meses se limpiar la carpintera con jabn neutro con agua, aclarando y secando
con posterioridad, se engrasarn los herrajes que lo necesiten y se comprobar su estado
general.
Cada 5 aos se revisar la sujecin de los vidrios, el funcionamiento de los mecanismos, la
estanqueidad de la carpintera y sus sellados, el estado de la pintura o barniz.

2.8. CARPINTERA INTERIOR


Descripcin
Puertas de acceso segn las siguientes clasificaciones:

Por su acabado: para barnizar, para pintar, para revestir .


Por su estructura: puerta plafonada ciega o vidriera, puerta plana ciega o vidriera.
Por la forma del canto de la hoja: enrasada, solapada, resaltada y engargolada.
Por la apariencia del canto: canto oculto y canto visto.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Materiales

Por su lugar de colocacin: Puertas de paso, puerta de entrada al piso, puerta


exterior.
Puertas especiales: corta fuegos, blindadas, aislantes contra radiaciones, aislantes
trmicas, aislantes acsticas.
Por el sistema de apertura: abatibles, vaivn, giratoria, corredera, telescpica.
Por el tipo de paramento: enrasada, de peinacera y entablada.

La puerta o unidad de hueco de puerta, estar formado por los siguientes elementos:
Hoja o parte mvil de la puerta, puede tener muy distintos aspectos segn la estructura
de la hoja:

puertas planas: constituidas por dos tableros planos derivados de madera y


paralelos encolados a un alma de cartn, madera o espumas sintticas, ubicada
dentro de un bastidor de madera.

puertas con tableros moldeados: con una estructura similar a la puerta plana pero
con tableros de fibras moldeados de 3 mm de espesor, dndoles un aspecto de
relieve.

puertas en relieve: en su estructura se distingue el bastidor o estructura de la hoja


formada por largueros, testeros y travesaos ensamblados y la parte central
plafonada formada por tableros aglomerados de fibras.

Precerco o Cerco: Elementos de madera o metlicos que se fijan a la obra y sobre los
que se colocan los herrajes. El cerco podr ser directo a obra o por medio de precerco.
Est formado por dos largueros y un testero. En el cerco se realizar un rebaje para recibir
y servir de tope a la hoja de la puerta que se denominar galce.

Tapajuntas que cubrirn la junta entre el cerco, precerco y la obra. Pueden ser planos o
moldurados.

Herrajes elementos metlicos que proporcionan maniobrabilidad a la hoja.


Puesta en obra

El precerco tendr 2 mm. menos de anchura que el cerco y la obra de fabrica.


Los precercos vendrn de taller con riostras y rastreles para mantener la escuadra, las
uniones ensambladas y orificios para el atornillado de las patillas de anclaje con una
separacin menor de 50 cm. y a 20 cm. de los extremos.
Si el precerco es metlico, los perfiles tendrn un espesor mnimo de 1,5 mm y se protegern
contra la corrosin antes de la colocacin.
La colocacin del cerco se realizar con cuas o calces que absorban las deformaciones
del precerco quedando perfectamente nivelados y aplomados.
La fijacin del cerco al precerco se realizar por el frente o por el canto, traspasando los
elementos de fijacin el cerco y precerco hasta anclarse a la obra.
La junta entre el cerco, precerco y obra se sellar con espuma de poliuretano y quedar
cubiertas por el tapajuntas. Los tapajuntas se fijarn con puntas de cabeza perdida, botadas
y emplastadas.
El nmero de pernos y bisagras utilizados por puerta, no ser menor de tres.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Cuando las puertas lleguen a obra con la marca N de AENOR, ser suficiente la
comprobacin de que coincide con las especificadas en proyecto y una inspeccin visual
del estado de la misma en el momento de su entrega en obra.
Si la direccin facultativa lo estima oportuno se harn ensayos de materiales segn normas
UNE tales como resistencia a la accin de la humedad, comprobacin del plano de la hoja,
exposicin de las dos caras a atmsferas con humedades diferentes, resistencia a la

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

penetracin, resistencia al choque, resistencia a la flexin, resistencia al arranque de tornillos,


etc.
Cada 10 unidades de carpintera se harn controles de aplomado, enrasado y recibido de
las cercos y las hojas, as como de la colocacin de los herrajes. Se realizar tambin una
prueba de funcionamiento del mecanismo de apertura y cierre y accionamiento de
herrajes.
Las tolerancias mximas admisibles sern:
Desplome del precerco: 3 mm. por m.
Desplome una vez colocado el marco : 6 mm. por m.
Holgura entre cerco y precerco: 3 mm.
Enrasado: 2 mm.
Altura hoja: +-4 mm.
Anchura hoja: +-2 mm.
Espesor hoja: +-1 mm.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Se medir por unidad totalmente terminada.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.

Cada ao se aplicar en los herrajes mviles, comprobando al mismo tiempo su


funcionamiento y ajuste. En caso de movimientos en la carpintera que hagan que
esta no cierre adecuadamente se dar aviso al tcnico de cabecera.
Se comprobar su estado cada 5 aos reparando posibles golpes y reponiendo las
piezas necesarias.
Se barnizarn o pintarn cada 5 aos las interiores y cada 2 aos las exteriores o
expuestas.

2.9. INSTALACIONES
2.9.1. FONTANERA
Descripcin
Comprende la instalacin de distribucin desde la acometida hasta el edificio, la distribucin
interior y todos los aparatos sanitarios, griferas... para abastecimiento de agua sanitaria fra y
caliente y riego.
Materiales
Tubos y accesorios: Para acometida y distribucin podrn ser de fundicin, polietileno...,
para agua fra de cobre, acero galvanizado, polietileno... para agua caliente de
polietileno reticulado, polipropileno, polibutileno, acero inoxidable... y para riego de PE
rgido.
Los tubos de cobre irn acompaados del certificado de conformidad con el marcado CE
segn la norma armonizada UNE-EN 1057, declarando expresamente la reaccin al fuego,
resistencia al aplastamiento, resitencia a la presin, tolerancias dimensionales, resistencia a
las altas temperaturas, soldabilidad, estanquidad a gases y lquidos y durabilidad de las
caractersticas anteriores. Adems contarn con un marcado permanente en el que se
especifique su designacin cada 60 cm.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Llaves y vlvulas.
Arquetas para acometida y registro.
Griferas.
Contador.
Aparatos sanitarios.
Puesta en obra
La instalacin se adaptar a lo dispuesto en la Exigencia "Suministro de Agua" desarrollada
en el Documento Bsico de Salubridad del Cdigo Tcnico de la Edificacin, Real Decreto
1027/2007 Reglamento de Instalaciones Trmicas en los Edificios RITE, normas de la empresa
suministradora y normas UNE correspondientes.
Los materiales empleados en la red sern resistentes a la corrosin, no presentarn
incompatibilidad electroqumica entre s, sern resistentes a las temperaturas de servicio o al
mnimo de 40.
Las tuberas enterradas se colocarn respetando las distancias a otras instalaciones y
protegidas de la corrosin, esfuerzos mecnicos y heladas.
La acometida ser accesible, con llave de toma, tendr un solo ramal y dispondr llave de
corte exterior en el lmite del edificio. Al igual que el resto de la instalacin quedar protegida
de temperaturas inferiores a 2 C.
Se dispondr un filtro delante del contador que retenga los residuos del agua.
El contador general se albergar en un armario o arqueta segn condiciones de la empresa
suministradora junto a llaves de corte general, de paso, de contador y de retencin. En
edificios de varios propietarios, los divisionarios se ubicarn en planta baja, en un armario o
cuarto ventilado, iluminado, con desage y seguro. Se colocarn llaves de paso en los
montantes verticales de los que saldrn las derivaciones particulares que han de discurrir por
zonas comunes del edificio.
Se dispondrn sistemas antiretorno despus de los contadores, en la base de las
ascendentes, antes de los equipos de tratamiento de agua, en los tubos de alimentacin no
destinados a usos domsticos y antes de los aparatos de climatizacin o refrigeracin.
Las tuberas se colocarn distanciadas un mnimo de 3 cm. entre ellas y de los paramentos y
aisladas con espumas elastmeras o conductos plsticos y fijadas de forma que puedan
dilatarse libremente. Cuando se prevea la posibilidad de condensaciones en las mismas, se
colocarn aislantes o conductos plsticos a modo de paravapor.
La separacin entre tubos de ACS y agua fra ser de 4 cm., de 3 cm. con tuberas de gas y
de 30 cm. con conductos de electricidad o telecomunicaciones.
Se colocarn tubos pasamuros donde las tuberas atraviesen forjados o paramentos. Las
tuberas quedarn fijadas de forma que puedan dilatarse libremente, y no se produzcan
flechas mayores de 2 mm. Las tuberas de agua caliente tendrn una pendiente del 0,2 % si
la circulacin es forzada, y del 0,5 % si es por gravedad.
Si fuera necesaria su instalacin, el grupo motobomba se colocar en planta baja o stano
cuidando el aislamiento acstico de la sala en la que se ubique. disponiendo de bancada
adecuada y evitando cualquier transmisin de vibraciones por elementos rgidos o
estructurales para ello se dispondrn conectores flexibles.
Deben utilizarse elementos elsticos y sistemas antivibratorios en las sujeciones o puntos de
contacto que produzcan vibraciones entre las instalaciones y los elementos constructivos.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Las uniones entre tuberas sern estancas. En tubos de acero galvanizado las uniones sern
roscadas de acuerdo a la UNE 10242:95. Los tubos de cobre podrn soldarse o utilizar
manguitos mecnicos y en el caso de los tubos plsticos se seguirn las indicaciones del
fabricante.
Finalmente se colocarn los aparatos sanitarios rellenando con silicona neutra fungicida las
fijaciones y juntas. Dispondrn de cierre hidrulico mediante sifn. Si los aparatos son
metlicos se conectarn a la toma de tierra. Los inodoros contarn con marcado CE y
seguirn las especificaciones impuestas en la norma UNE EN 997.
Control, criterios de aceptacin y rechazo y verificaciones en el edificio terminado
Se identificarn todos los materiales y componentes comprobando su marcado, dimetros,
conformidad con el proyecto y que no sean defectuosos. Llevarn distintivos MICT, ANAIP y
AENOR. Si la direccin facultativa lo dispone, a los tubos se les harn ensayos por tipo y
dimetro segn normas UNE, de aspecto, medidas, tolerancias, de traccin y de adherencia,
espesor medio, masa y uniformidad del recubrimiento galvnico.
Se comprobar que las conducciones, dispositivos, y la instalacin en general, tienen las
caractersticas exigidas, han sido colocados segn las especificaciones de proyecto.
Se harn pruebas de servicio a toda la instalacin: de presin, estanquidad, comprobacin
de la red bajo presin esttica mxima, circulacin del agua por la red, caudal y presin
residual de las bocas de incendio, grupo de presin, simultaneidad de consumo, y caudal en
el punto ms alejado.
Para ello la empresa instaladora llenar la instalacin de agua con los grifos terminales
abiertos para garantizar la purga tras lo cual se cerrar el circuito y se cargar a la presin de
prueba. Para instalaciones de tuberas metlicas se realizarn las pruebas segn la UNE
100151:88 y para las termoplsticas y multicapas la norma UNE ENV 2108:02
En el caso de ACS se realizarn las pruebas de caudal y temperatura en los puntos de agua,
caudal y temperatura contemplando la simultaneidad, tiempo en obtencin de agua a la
temperatura estipulada en el grifo ms alejado, medicin de temperaturas de red y
comprobacin de gradiente de temperatura en el acumulador entre la entrada y salida que
ha de ser inferior a 3C.
Las tolerancias mximas admisibles sern:
Dimensiones de arqueta: 10 %
Enrase pavimento: 5 %
Horizontalidad duchas y baeras: 1 mm. por m.
Nivel de lavabo, fregadero, inodoros, bids y vertederos: +-10 mm.
Cada frontal respecto a plano horizontal de lavabo y fregadero: 5 mm.
Horizontalidad en inodoros, bids y vertederos: 2 mm.
Criterios de medicin y valoracin
En caso de que en el presupuesto del proyecto o el contrato de obra no se especifiquen
otros criterios, se adoptarn las siguientes pautas de medicin y valoracin:
Se medir la unidad o longitud terminada y probada.
Condiciones de conservacin y mantenimiento
Se exponen a continuacin las condiciones bsicas y generales de conservacin y
mantenimiento. En el preceptivo "Libro del Edificio", a redactar tras la finalizacin de la obra,
se incluir mayor detalle de las mismas.

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de Vivienda Unifamiliar con garaje en C/ Montes,20 de Ronda (Mlaga)

Cada 6 meses se realizar una revisin para detectar posibles goteos o manchas por
humedad y la comprobacin del buen funcionamiento de las llaves de paso.
Cualquier manipulacin de los aparatos sanitarios estar limitada a personal cualificado que
previamente habr cerrado las llaves de paso correspondientes.
Si la instalacin permanece inutilizada por ms de 6 meses, ser necesario vaciar el circuito
siendo necesario para la nueva puesta en servicio el lavado del mismo.
El rejuntado de las bases de los sanitarios se realizar cada 5 aos, eliminando totalmente el
antiguo y sustituyndolo por un sellante adecuado.

2.9.2. CALEFACCIN y A.C.S.


Descripcin
Instalaciones destinadas al calentamiento de recintos y a la generacin de agua caliente
sanitaria.
Materiales
Sistema de generacin: Puede ser por caldera, bomba de calor, energa solar, etc. Puede
utilizarse para calefaccin y producir adems A.C.S., individual o colectiva, y con
acumulador o sin l.
Distribucin: Pueden ser tuberas de agua o conductos de aire, de cobre, acero inoxidable,
acero galvanizado, fibra de vidrio, etc. Los tubos de cobre irn acompaados del
certificado de conformidad con el marcado CE segn la norma armonizada UNE-EN 1057,
declarando expresamente la reaccin al fuego, resistencia al aplastamiento, resitencia a
la presin, tolerancias dimensionales, resistencia a las altas temperaturas, soldabilidad,
estanquidad a gases y lquidos y durabilidad de las caractersticas anteriores. Adems
contarn con un marcado permanente en el que se especifique su designacin cada 60
cm.
Bomba de circulacin o ventilador
Sistema de control: Puede controlarse por vlvulas termostticas o termostatos situados en
locales y/o en exteriores.
Sistema de consumo: Radiadores, convectores, rejillas, difusores, etc. Los radiadores
contarn con marcado CE y seguirn las especificaciones de la norma UNE-EN 442-1
especificando potencia trmica, dimensiones, presin y temperatura mxima de servicio.
Sistema de acumulacin.
Accesorios: Vlvulas, dilatadores, purgadores, intercambiador, vaso de expansin,
conductos de humo, aislantes trmicos, etc.
Puesta en obra
La instalacin se adaptar a lo dispuesto en la Exigencia "Suministro de Agua" desarrollada
en el Documento Bsico de Salubridad del Cdigo Tcnico de la Edificacin y al Real
Decreto 1027/2007 Reglamento de Instalaciones Trmicas en los Edificios RITE, normas de la
empresa suministradora y normas UNE correspondientes.
La empresa instaladora estar autorizada por el rgano competente de la Comunidad
Autnoma y emitir el correspondiente certificado de la instalacin firmado por la propia
empresa y en su caso por el director de la instalacin todo ello segn lo especificado en el
RITE.
Las calderas y bombas de calor quedarn bien ancladas a los soportes y disponiendo de los
mecanismos necesarios para que no transmitan ruidos ni vibraciones.
Los tubos de calefaccin se mantendrn a una distancia mnima de 25 cm. del resto de
instalaciones, tendrn recorridos lo ms cortos posible evitando los cambios de direccin y
seccin. Se colocarn paralelos a la estructura o a escuadra, tendrn tres ejes

Pedro Enrique Santos Buenda______________________Arquitecto

Proyecto Bsico y de Ejecucin de