Está en la página 1de 36

La Investigación en Proteínas

en el Área de Biofisicoquímica
Rafael A. Zubillaga
Departamento de Química
UAM-Iztapalapa
20 !-aminoácidos
Transportación
Encapsulación
Iluminación
Transducción
Estructural
Defensa
!-aminoácidos
Polares sin carga
Nopolares, alifáticos
Aromáticos
Negativamente cargados
Positivamente cargados
ARNDCQEGGEQCKLMFPSGMDCQEPFQDDKMCNRILKFCNQQEF
ARNDCQEGGEQCKLMFPSGMDCQEPFQDDKMCNRILKFCNQQEF
ARNDCQEGGEQCKLMFPSGMDCQEPFQDDKMCNRILKFCNQQEF
ARNDCQEGGEQCKLMFPSGMDCQEPFQDDKMCNRILKFCNQQEF
ARNDCQEGGEQCKLMFPSGMDCQEPFQDDKMCNRILKFCNQQEF
Dos paradigmas centrales en la
Ciencia de Proteínas
1.- El plegamiento de las proteínas: ¿cómo la secuencia
de aminoácidos de una proteína dicta su estructura 3D?
Protein folding
2.- La unión específica de ligandos: ¿cómo con los mismos
grupos químicos de las cadenas laterales de los aminoáci-
dos pueden crearse sitios de unión de alta especificidad?
Protein binding
Las proteínas son producto de la evolución biológica:
MUTACIÓN y SELECCIÓN
TRIOSAFOSFATO ISOMERASA
(TIM)
¿Qué papel que desempeña la CYS126 en la TIM?
TIM Levadura
(Saccharomyces cerevisiae)
TIM
silvestre
C126S
C126A
ulcrolsmo
clrcular
Sonda conformacional
para proteínas
C126 no es indispensable para
adquirir la estructura nativa
CARACTERIZACIÓN FUNCIONAL DE LAS ENZIMAS
Lnzlma k
caL
s
-1
k
m
mM

k
caL
/k
m
1lM SllvesLre 4700 1.1 4.3 L06
1lM C126A 3100 0.80 3.9 L06
1lM C126S 1100 0.30 3.7 L06
CARACTERIZACIÓN FUNCIONAL DE LAS ENZIMAS
Lnzlma k
caL
s
-1
k
m
mM

k
caL
/k
m
1lM SllvesLre 4700 1.1 4.3 L06
1lM C126A 3100 0.80 3.9 L06
1lM C126S 1100 0.30 3.7 L06
C126 no es indispensable
para la función de la TIM
pH 7.4 ScTIM C126S
k
d
, 36.5
o
C (s
-1
) 7.2 x 10
-9
9.3 x 10
-5

k
r
, 36.5
o
C (s
-1
M
-1
) 8.0 x 10
4
2.3 x 10
3

Silvestre
C126A
C126S 51.9 ºC
47.3 ºC
43.8 ºC
30 µg/ml
50 µg/ml
pH 7.4 ScTIM C126S
k
d
, 36.5
o
C (s
-1
) 7.2 x 10
-9
9.3 x 10
-5

k
r
, 36.5
o
C (s
-1
M
-1
) 8.0 x 10
4
2.3 x 10
3

Silvestre
C126A
C126S 51.9 ºC
47.3 ºC
43.8 ºC
30 µg/ml
50 µg/ml
La C126 se requiere para estabilizar
a la TIM y se pliegue rápidamente
Determinado aminoácido
en secuencia
Particular función
Termorresistencia por evolución dirigida
"-Glucosidasa B
Puente salino superficial
NATIVA
DESNATURALIZADA
ESTADO ACTIVADO

E
N
E
R
G
I
A


D
E

G
I
B
B
S

!!G

= 0.95 kcal/mol
Mutante
Silvestre
El costo entrópico de la hidratación
(!S<0) aumenta la barrera energética
Ecuación de Eyring:
ln (k
u
/T) = ln E + "S
N"ET
/R – ("H
N"ET
/R) (1/T)
Misma pendiente, misma "H
N"ET

Interacciones proteína-ligando.
Implicación en farmacología y medicina molecular:
• Diseño de fármacos con actividad inhibitoria de una
proteína (enzima) diana
Modelado molecular: identificación de posibles
sitios de anclaje de un fármaco en una proteína
Cribado virtual de librerías de
moléculas (“virtual screening”)
respecto a su afinidad por los
sitios de unión.
Selección de las moléculas con
mejor anclaje al sitio.
Optimización de interacciones
proteína-ligando y pruebas
de inhibición in vitro.
! Termodinámica del plegamiento y
desplegamiento de proteínas.
! Estabilidad cinética y caracterización del
estado de transición en el plegamiento-
desplegamiento de proteínas.
! Estudios termodinámicos y estructurales
de las interacciones proteína-ligando.
! Bases moleculares de la termorresistencia
enzimática.
! Análisis computacional y modelado de la
estructura de las proteínas.
Líneas de Investigación
Espectroscópicas:
• Absorción UV-Vis
Técnicas Disponibles
• Fluorescencia
• Dicroísmo circular
Bioquímicas:
• Cromatografía de Líquidos
• Electroforesis
• Potenciometría
• Centrifugación
• Ultrafiltración
Calorimétricas:
• Calorimetría Diferencial
de Barrido (DSC)
• Calorimetría de Titulación
Isotérmica (ITC)
Profesores Integrantes del
Área de Biofisicoquímica
Dr. Alfonso Arroyo Reyna
Dr. Andrés Hernández Arana
Dra. Jaqueline Padilla Zúñiga
Dra. Silvia D. Solís Mendiola
Dr. Salvador R. Tello Solís
Dr. Rafael A. Zubillaga Luna
!"#$%&%' )* +&,-./0
1234
Instituto de Agroquímica y
Tecnología de Alimentos
Departamento de
Ciencias Naturales
UNAM
IZTAPA
LAPA
Departamentos de
Biotecnología y
Ciencias de la Salud
Área de Biofisicoquímica
UAMI
Departamento de
Química Física
COLABORACIONES