Está en la página 1de 168

UNIVERSIDAD DE OVIEDO

DEPARTAMENTO DE BIOLOGÍA FUNCIONAL
(Área de Microbiología)




Lactococina 972: caracterización genética, modo de
acción y optimización de la producción en biorreactores.




Memoria presentada por Alma Hernández de Rojas para optar al
grado de Doctor


Este trabajo ha sido realizado en el Instituto de
Productos Lácteos de Asturias (IPLA-CSIC) y en
el Área de Microbiología (Departamento de
Biología Funcional) de la Universidad de Oviedo.

Oviedo, 2005
































Universidad De Oviedo
Departamento
De Biología Funcional




RAMÓN GIRÁLDEZ CEBALLOS-ESCALERA, Director del
Departamento de Biología Funcional de la Universidad de Oviedo,


AUTORIZA:

La presentación ante la Comisión de Doctorado de la Tesis
"Lactococina 972: caracterización genética, modo de acción
y optimización de la producción en biorreactores¨, realizada
por Dña. Alma Hernández de Rojas, y dirigida por la Dra. Ana
Rodríguez González y el Dr. Juan Evaristo Suárez Fernández.



Oviedo, a 17 de Enero de 2005






































Universidad De Oviedo
Departamento
De Biología Funcional



Consejo Superior de
Investigaciones CientiIicas
INSTITUTO DE PRODUCTOS LACTEOS DE
ASTURIAS




ANA RODRÍGUEZ GONZÁLEZ, Científico Titular del C.S.I.C. adscrito
al Instituto de Productos Lácteos de Asturias y JUAN EVARISTO
SUÁREZ FERNÁNDEZ, Catedrático de Microbiología de la
Universidad de Oviedo.

CERTIFICAN:

Que la licenciada en Ciencias Químicas Alma Hernández de
Rojas ha realizado bajo su dirección el trabajo que presenta para
optar al grado de DOCTOR con el título:

'Lactococina 972: caracterización genética, modo de acción y
optimización de la producción en biorreactores¨,


Y para que así conste, firmamos la presente certificación en
Oviedo, a 17 de Enero de 2005.































































A mis padres, hermanos y Miguel.































Deseo expiesai ni gialilud a lodas Ias peisonas que han hecho posilIe Ia
ieaIización de esle lialajo:
A nis Diiecloies Ia Dia. Ana Rodiíguez y eI Di. }uan Lvaiislo Suáiez,
poi su confianza y apoyo incondicionaIes duianle lodos eslos años. A Ia Dia.
ßealiiz Mailínez poi su ineslinalIe ayuda.
AI Di. }uan CaiIos ßada, Diiecloi deI IILA, donde he ieaIizado Ia nayoi
paile de esle lialajo.
AI Di. }uan AyaIa (CßM-SO, Madiid) poi liindaine Ia opoilunidad de
lialajai en su Ialoialoiio y su ayuda en eI áiido lena de Ias IßIs y Ia
foinación de Ia paied lacleiiana.
A lodas Ias peisonas que a Io Iaigo de eslos años he conocido, lanlo en
nis conienzos en VaIIadoIid (en eI IßCM) cono aquí en Asluiias. Todas
eIIas han conliiluido a que ni inleies poi eI nundo de Ia ciencia nunca
decayese. Ioi su apoyo y solie lodo ánino duianle eI lianscuiso deI lienpo
y solie lodo en Ios nonenlos de ¨vacas fIacas¨: nuchas giacias. A lodos
eIIos Ies quieio dedicai eslas paIalias deI Di. Sangei (dolIe pienio NóleI)
solie eslos nonenlos:

LI nejoi anlídolo consisle en seguii niiando hacia adeIanle.
Cuando un expeiinenlo es un fiacaso lolaI, Io nejoi es no
pasaise denasiado lienpo pieocupándose poi eIIo, sino seguii
con Ia pIanificación y pasai aI expeiinenlo siguienle. ResuIla
sienpie nuy excilanle y nuy pionlo se oIvida uno de sus
piolIenas.

Ioi úIlino, y no poi eIIo nenos inpoilanle, quieio dai Ias giacias a ni
faniIia poi su apoyo y áninos en lodo nonenlo y solie lodo a MigueI, que
sienpie ha salido eslai a ni Iado, incIuso en Ios nonenlos nás difíciIes.






































"#$%&'

i













INDICE
ABREVIATURAS GENERALES .......................................................... vii
INDICE DE FIGURAS Y TABLAS ..................................................... xiii

I. INTRODUCCIÓN
1. BACTERIAS DEL ACIDO LACTICO ............................................................ 1
2. METABOLISMO
2.1. Introduccion ............................................................................................ 2
2.2. Principales rutas de fermentacion
2.2.1. Fermentacion de las hexosas ......................................................... 3
2.2.2. Fermentacion de disacaridos ......................................................... 5
3. BACTERIOCINAS
3.1. Introduccion ............................................................................................ 5
3.2. Caracteristicas generales de las bacteriocinas ...................................... 5
3.3. Las bacteriocinas producidas por las BAL ............................................. 6
3.4. Organi:acion genetica ........................................................................... 7
3.5. Modo de accion ..................................................................................... 11
ii
4. LACTOCOCINA 972
4.1. Caracteristicas generales v genetica ..................................................... 15
4.2. Modo de accion ...................................................................................... 15
5. OPTIMIZACIÓN DE LA PRODUCCIÓN DE BACTERIOCINAS
5.1. Introduccion............................................................................................ 18
5.2. Cinetica de la produccion de bacteriocinas por BAL ............................ 19
5.3. Factores que afectan a la produccion de bacteriocinas por BAL
5.3.1. Cepa microbiana .......................................................................... 19
5.3.2. El medio de cultivo ...................................................................... 20
5.3.3. Condiciones de la Iermentacion ................................................... 22
6. TEORIA SOBRE EL CULTIJO EN DISCONTINUO Y EN CONTINUO
6.1. Cultivo en discontinuo
6.1.1. Introduccion ................................................................................. 22
6.1.2. Tasa de crecimiento especiIica ..................................................... 23
6.1.3. Rendimiento en biomasa .............................................................. 23
6.1.4. Productividad en biomasa ............................................................ 24
6.2. Cultivo en continuo
6.2.1. Instrumentacion ........................................................................... 24
6.2.2. Relacion entre la tasa de dilucion y la concentracion celular ....... 25
6.2.3. Relacion entre la tasa de dilucion y la concentracion del sustrato.26
6.2.4. Tasa de dilucion critica................................................................. 26
6.2.5. Productividad................................................................................ 27
6.2.6. Produccion de bacteriocinas .........................................................28
7. PRESENTACIÓN DEL TRABAJO. ANTECEDENTES Y OBJETIJOS .. 29

II. MATERIALES Y MÉTODOS
1. MICROORGANISMOS, JECTORES Y CONDICIONES DE CULTIJO ..... 31
2. TECNICAS DE BIOLOGIA MOLECULAR
2.1. Manipulacion v analisis de acidos nucleicos
2.1.1. Extraccion de ADN plasmidico y electroporacion ...................... 33
iii
2.1.2. Tecnicas electroIoreticas y extraccion de ADN a partir de
geles de agarosa ......................................................................... 34
2.1.3. Reaccion en cadena de la polimerasa (PCR) ............................... 34
2.1.4. Secuenciacion de ADN ............................................................... 35
2.1.5. Analisis de las secuencias ........................................................... 35
2.1.6. Expresion controlada de genes en Lactococcus .......................... 37
2.1.7. Ensayo de actividad del promotor de la lactococina 972 ............ 38
2.2. Proteinas
2.2.1. Obtencion de membranas de L. lactis ......................................... 38
2.2.2. ElectroIoresis de proteinas .......................................................... 39
2.2.3. Marcaje de las PBPs de Lactococcus .......................................... 39
2.2.4. Ensayos de competicion de lactococina 972 y BOCILLIN FL¹ 40
2.2.5. Obtencion y puriIicacion de anticuerpos policlonales ................ 40
2.2.6. Enzyme-linked inmunoabsorbent assay (ELISA) ....................... 41
2.2.7. Hibridacion tipo 'Western¨ ......................................................... 41
2.2.8. Ensayos con el tripeptido antagonista de la vancomicina:
N-N-diacetil-!-Lys-"-Ala-"-Ala |(Ac)2KAA| ..................... 42
3. LACTOCOCINA 972
3.1. Purificacion ......................................................................................... 42
3.2. Deteccion de la actividad inhibitoria .................................................. 42
3.3. Ensavo de induccion de profagos ........................................................ 43
4. PRODUCCIÓN DE LA LACTOCOCINA 972 EN BIORREACTOR
4.1. Instrumentacion ................................................................................... 43
4.2. Cultivo en discontinuo ........................................................................... 45
4.3. Cultivo en continuo ............................................................................... 45
4.4. Medida del crecimiento microbiano ..................................................... 45
4.5. Deteccion de la actividad inhibitoria .................................................... 46
4.6. Cuantificacion de acidos organicos v a:ucares .................................... 46
4.7. Parametros cineticos ............................................................................. 46
4.8. Analisis estadistico ................................................................................ 48

iv
III. RESULTADOS
1. CARACTERIZACIÓN GENETICA DEL OPERÓN DE LA LACTOCOCINA 972
1.1. Analisis de la secuencia del plasmido pBL1 ........................................... 49
1.2. Analisis estructural del operon de la lactococina 972 ........................... 50
1.3. Estudio de las secuencias de proteinas
1.3.1. LclA ............................................................................................ 55
1.3.2. LclB ............................................................................................. 57
1.3.3. LclC ............................................................................................. 58
1.4. Comparacion de las secuencias deducidas de las proteinas Lcl con las
depositadas en las bases de datos........................................................... 60
2. ESTUDIO DEL PROMOTOR DE LA LACTOCOCINA 972 (P
lcn972
) ........... 65
3. ANALISIS FUNCIONAL DEL OPERÓN DE LA LACTOCOCINA 972 ...... 66
4. MODO DE ACCIÓN DE LA LACTOCOCINA 972
4.1. Efecto de la lactococina 972 sobre el crecimiento de L. lactis MG1614 69
4.2. Comparacion con el modo de accion de la vancomicina ...................... 71
4.3. Implicacion de las PBPs en el modo de accion de lcn972 .................... 71
4.4. Efecto de la lactococina 972 sobre la respuesta SOS en
Lactococcus lactis .................................................................................. 78
5. CRECIMIENTO, METABOLISMO Y PRODUCCIÓN DE LACTOCOCINA
972 EN BIORREACTOR
5.1. Influencia de la fuente de carbono en el crecimiento v en la
produccion de lcn972 en cultivo en discontinuo ................................... 80
5.2. Efecto de la tasa de dilucion v la fuente de carbono en el
crecimiento v en la produccion de lcn972 en cultivo en continuo ......... 82
5.3. Metabolismo de la cepa L. lactis IPLA972 en cultivo en
discontinuo v en continuo ..................................................................... 85



v
IV. DISCUSIÓN ............................................................................................ 87
1. ORGANIZACIÓN GENETICA DEL OPERÓN DE LA
LACTOCOCINA 972 ..................................................................................... 88
2. MODO DE ACCIÓN ..................................................................................... 93
3. PRODUCCIÓN DE LA LACTOCOCINA 972 Y METABOLISMO DE
L. lactis IPLA 972 .......................................................................................... 98

V. CONCLUSIONES ................................................................................ 103

VI. BIBLIOGRAFIA
A ................................................................................................................... 107
B .................................................................................................................... 108
C .................................................................................................................... 110
D ................................................................................................................... 111
E .................................................................................................................... 113
F .................................................................................................................... 114
G ................................................................................................................... 115
H ................................................................................................................... 116
I ..................................................................................................................... 117
J ..................................................................................................................... 117
K ................................................................................................................... 117
L .................................................................................................................... 118
M ................................................................................................................... 119
N ................................................................................................................... 122
O ................................................................................................................... 122
P .................................................................................................................... 123
Q ................................................................................................................... 124
R .................................................................................................................... 124
S .................................................................................................................... 126
T .................................................................................................................... 127
vi
U .................................................................................................................... 128
V .................................................................................................................... 128
W ................................................................................................................... 128
Y .................................................................................................................... 129
Z ............................................................................................................................................. 130
vii
ABREVIATURAS GENERALES
!

ABC: ATP Binding Cassette
(Ac)
2
KAA: N

-N

-diacetil-!-Lys-"-Ala-"-Ala
Amp: ampicilina
Amp
r
: resistencia a ampilicina
A+T: contenido del ADN en adenina y timina
#

Bac
+
:

produccion de lactococina 972
Bac
-
: no produccion de lactococina 972
BAL: Bacterias del Acido Lactico
$

CECT: Coleccion Española de Cultivos Tipo
Cm: cloranIenicol
Cm
r
: resistencia a cloranIenicol
CIM: concentracion inhibitoria minima
%

D: tasa de dilucion
DAPI: 4',6-diamidino-2-Ienilindol
D
c
: dilucion critica
Da: Dalton
DHAP: dihidroxiacetona-3-IosIato
viii
: potencial de membrana
&

EDTA: acido etilendiamino tetracetico
ELISA: En:vme-Linked ImmunoabSorbent Assav
EMP: ruta de Embden-MeyerhoI-Parnas
Ery: eritromicina
Ery
r
: resistencia a eritromicina
'

F: Iaradios
FDP: Iructosa-1,6-diIosIato
Fts: Filament ThermoSensitive mutant
(

g
DCW
: gramos de peso seco celular
GAP: gliceraldehido-3-IosIato
GUS: "-glucuronidasa
G+C: contenido del ADN en guanina y citosina
)

HPLC: cromatograIia liquida de alta eIicacia (High Pressure Liquid
Chromatographv)
*

Inm
+
: resistente a la lactococina 972
Inm
-
: sensible a la lactococina 972
ix
+

kb: kilobase
kDa: kilodalton
K
S
: constante de saturacion o de Monod
KV: kilovoltio
,

lcn972: lactococina 972
-

µ: tasa de velocidad de crecimiento o velocidad de crecimiento especiIica
µ
max
: velocidad de crecimiento especiIica maxima
.

NAD
+
: nicotinamida adenina dinucleotido
NBD: dominio de union al nucleotido triIosIato (Nucleotide Binding
Domain)
NICE: sistema de expresion controlado por nisina (NIsin Controlled
Expression svstem)
/

!"#: pauta abierta de lectura (Open Reading Frame)
0

P: cantidad de producto Iormado
pAbPBP3: anticuerpo policlonal Irente a PBP3 de Escherichia Coli
pAblcn972: anticuerpo policlonal Irente a lcn972
x
PAGE: electroIoresis en gel de poliacrilamida
pb: pares de bases
PBP: proteina de union a penicilina (Penicillin Binding Protein)
PCR: reaccion en cadena de la polimerasa (Polimerase Chain Reaction)
PG: peptidoglicano
6-PG/PK: 6-IosIogluconato/IosIocetolasa
pI: punto isoelectrico
P
lcn972
: promotor de la lactococina 972
P
nisA
o P
nis
: promotor de la nisina
pO
2
: presion parcial de oxigeno
p
P
: productividad de los productos
p
X
: productividad en biomasa
1

rbs: sitio de union al ribosoma (Ribosome Binding Site)
rpm: revoluciones por minuto
2

S: cantidad de sustrato
SDS: dodecil sulIato sodico (Sodium Dodecil Sulfate)
SEC: sistema general de secreccion
sp: especie
subsp: subespecie


xi
3

TBE: tris-acido borico-EDTA
TMD: dominio transmembrana (TransMembrane Domain)
t
D
: tiempo de duplicacion celular
4

ufc: unidades Iormadoras de colonias
UA: unidades arbitrarias de actividad
5

X: peso seco celular
X-Gal: 5-bromo 4-cloro 3-indol--D-galactopiranosido
X-Glu: 5-bromo-4-cloro-3-indol--D-glucosido
6

Y
P/S
: rendimiento de produccion de producto
Y
X/S
: rendimiento de biomasa
7

: ohmmio





xii
%&'()*%+,'%- .( /0- %1*2034*.0-
Ala Alanina A Leu Leucina L
Arg Arginina R Lys Lisina K
Asn Asparragina N Met Metionina M
Asp Ac. aspartico D Phe Fenilalanina F
Cys Cisteina C Pro Prolina P
Gln Glutamina Q Ser Serina S
Glu Ac. glutamico E Thr Treonina T
Gly Glicina G Trp TriptoIano W
His Histidina H Tyr Tirosina Y
Ile Isoleucina I Val Valina V



5'(6*70- ,+*/*8%.0- (2 (/ -*-+(1%
*2+('2%4*02%/ .( ,2*.%.(-
Abreviatura PreIijo Multiplo
T tera 10
12
F giga 10
9

M mega 10
6

k kilo 10
3

d deci 10
-1

c centi 10
-2

m mili 10
-3

µ micro 10
-6

N nano 10
-9

P pico 10
-12

F Iemto 10
-15

A atto 10
-18




xiii
INDICE DE FIGURAS Y TABLAS
Figura 1 ..................................... 4
Figura 2 ................................... 10
Figura 3 ....................................13
Figura 4 ................................... 17
Figura 5 ................................... 23
Figura 6 ................................... 37
Figura 7 ................................... 43
Figura 8 ................................... 50
Figura 9 ................................... 53
Figura 10 ................................. 54
Figura 11 ................................. 56
Figura 12 ................................. 58
Figura 13 ................................. 59
Figura 14 ................................. 60
Figura 15 ................................. 61
Figura 16 ................................. 63
Figura 17 ................................. 64
Figura 18 ................................. 65
Figura 19 ................................. 66
Figura 20 ..................................67
Figura 21 ................................. 67
Figura 22 ................................. 68








Figura 23 ................................. 70
Figura 24 ................................. 72
Figura 25 ................................. 74
Figura 26 ................................. 74
Figura 27 ................................. 75
Figura 28 ................................. 76
Figura 29 ................................. 76
Figura 30 ................................. 77
Figura 31 ................................. 78
Figura 32 ................................. 79
Figura 33 ................................. 81
Figura 34 ................................. 83
Figura 35 ................................. 85
Tabla 1 .................................... 10
Tabla 2 .................................... 28
Tabla 3 .................................... 32
Tabla 4 .................................... 33
Tabla 5 .................................... 34
Tabla 6 .................................... 73
Tabla 7 .................................... 81
Tabla 8 .................................... 82





















"#$%&'())"*#

Introduccion 1


















I. INTRODUCCIÓN

!" $%&'()*%+ ,(- .&*,/ -.&'*&/
Las bacterias del acido lactico son microorganismos Grampositivos, no
esporulados, generalmente inmoviles, que estan relacionados entre si por una serie de
propiedades metabolicas y nutricionales. El nombre de bacterias del acido lactico
(BAL) deriva del hecho de que el ATP es sintetizado a traves de la Iermentacion de
los carbohidratos, dando lugar a la Iormacion de acido lactico como producto Iinal
mayoritario (y a veces unico).
Este grupo comprende bacterias de los generos: Lactococcus, Jagococcus,
Leuconostoc, Pediococcus, Aerococcus, Tetragenococcus, Streptococcus,
Enterococcus, Lactobacillus y Carnobacterium. Filogenicamente son miembros de la
division Clostridium-Bacillus de las bacterias Gram-positivas.
Las BAL son organismos anaerobios aerotolerantes. Su unica Iuente de ATP es
la Iermentacion de carbohidratos ya que no pueden regenerar el poder reductor
(NAD
¹
) a traves de rutas respiratorias debido a su incapacidad de sintetizar
citocromos y otras enzimas que posean grupos hemo. Estudios recientes realizados
en el genero Lactococcus (Gaudu et al., 2002) han revelado la capacidad respiratoria
de estas celulas cuando se añaden al medio de cultivo precursores de los grupos
hemo.
Introduccion 2

Las BAL presentan requerimientos complejos de Iactores de crecimiento:
necesitan vitaminas del complejo B y un numero considerable de aminoacidos y de
bases puricas y pirimidinicas (Dellagio et al., 1994). Como resultado de estas
auxotroIias, las BAL se cultivan generalmente en medios que contienen peptona,
extracto de levadura u otro material digerido de origen animal o vegetal, ademas del
carbohidrato Iermentable.
Como corresponde a su metabolismo, las BAL son muy tolerantes al acido, lo
que les permite desplazar a microorganismos que podrian competir con ellas en los
ambientes ricos en que viven. Como resultado de esta capacidad, las BAL ocupan
habitats naturales con unas caracteristicas muy determinadas. Algunas viven en
asociacion con plantas y crecen a expensas de los nutrientes liberados en la
descomposicion de los tejidos vegetales. Otras Iorman parte de la microbiota normal
de las cavidades corporales de los animales: tracto intestinal, vagina y vias
respiratorias altas. Desde estos reservorios, las BAL pueden colonizar los productos
animales (leche, carnes) y vegetales (Irutos, mostos), que se utilizan como materia
prima, induciendo la generacion de los derivados Iermentados: productos lacteos y
embutidos en el primer caso, y encurtidos y bebidas alcoholicas en el segundo.

0" 1('%$/-*+1/
0"!" *234567889:2
Como se indico anteriormente, la generacion de ATP por las BAL tiene lugar
esencialmente mediante la Iermentacion de carbohidratos acoplada a la IosIorilacion
a nivel de sustrato. El producto Iinal del metabolismo es el acido lactico (~ 50 ° de
la Iuente de carbono consumida). Pero debido a su alta capacidad para adaptarse a
condiciones ambientales diversas y, dependiendo de estas, podemos encontrar
cambios en los productos Iinales del metabolismo, dando lugar a diIerentes patrones
de Iermentacion.

Introduccion 3
0"0" ;49289<=>?@ 473=@ 6? A?4B?23=89:2
0"0"!" Fermentación de las hexosas
Las BAL poseen dos vias principales de Iermentacion de las hexosas (Monnet et
al., 1996):
1) VIA HOMOFERMENTATIVA (Figura 1a). Esta via es caracteristica de los
generos Lactococcus, Streptococcus, Enterococcus, Pediococcus y algunas especies
de Lactobacillus de los Grupos I (homoIermentativos obligados) y II
(heteroIermentativos Iacultativos). La hexosa es metabolizada a traves de la ruta
glicolitica o de Embden-MeyerhoI-Parnas (EMP), y se caracteriza por la Iormacion
de Iructosa-1,6-diIosIato (FDP), la cual es convertida mediante el enzima fructosa-
1,6-difosfato aldolasa en gliceraldehido-3-IosIato (GAP) y dihidroxiacetona-3-
IosIato (DHAP). En condiciones normales (exceso de azucar y anaerobiosis), el
piruvato es reducido a acido lactico mediante la accion del enzima lactato
deshidrogenasa dependiente de NADH. Como producto Iinal del metabolismo se
obtienen dos moles de acido lactico y dos moles de ATP por cada mol de hexosa
metabolizada.
2) VIA HETEROFERMENTATIVA (Figura 1b). Encontramos esta via en los
organismos del genero Leuconostoc y en especies del genero Lactobacillus de los
Grupos II y III (heteroIermentativos Iacultativos y estrictos, respectivamente).
Tambien se denomina ruta del 6-fosfogluconato/ fosfocetolasa (6-PG/PK), ya que
este enzima es clave en la ruta (Axelsson, 1993). Los dos primeros pasos de la ruta
consisten en una deshidrogenacion de la glucosa-6-IosIato, para Iormar 6-
IosIogluconato, seguida de una descarboxilacion. La pentosa-5-IosIato asi Iormada
es transIormada, mediante la accion del enzima fosfocetolasa, en GAP y acetil-
IosIato. El GAP es metabolizado de la misma manera que en la ruta glicolitica,
dando lugar a la Iormacion de acido lactico y rindiendo un mol de ATP por mol de
hexosa. Cuando se encuentra disponible un aceptor de electrones, el acetil IosIato es
reducido a etanol, siendo los productos Iinales acido lactico, etanol y CO
2
. En
presencia de oxigeno, el acetil-IosIato es oxidado a acetato, lo que genera un mol
extra de ATP por mol de glucosa.
Introduccion 4


A) GLUCOSA B) GLUCOSA
ATP ATP
C C
ADP ADP
Glucosa-6-P Glucosa-6-P
NAD
¹
©
NADH¹H
¹
Fructosa-6-P 6-IosIo-gluconato
ATP NAD
¹

C
ADP CO
2
NADH¹H
¹

Fructosa-1,6-DP Ribulosa-5-P

C P
i
®



Gliceraldehido-3-P Dihidroxi- Gliceraldehido-3-P acetil-P
2 P
i
acetona-P 2 P
i
CoA
2 NAD
¹
NAD
¹
C C
2 NADH ¹ 2 H
¹
NADH ¹ H
¹
P
i
2× 1,3-diIosIoglicerato 1,3-diIosIoglicerato acetil-CoA
NADH
¹
2 ADP ADP ³ ¹ H
¹

2 ATP ATP CoA NAD
¹
2× 3-IosIoglicerato 3-IosIoglicerato acetaldehido
NADH
¹
¹ H
¹

1
NAD
¹
2× 2-IosIoglicerato 2-IosIoglicerato
ETANOL

2 H
2
O H
2
O

2× IosIoenolpiruvato IosIoenolpiruvato

2 ADP ADP
C C
2 ATP ATP
2× piruvato piruvato

2 NADH ¹ 2 H
¹
2 NADH ¹ 2 H
¹

C C
2 NAD
¹
2 NAD
¹


2 LACTATO LACTATO
Figura 1. Rutas mayoritarias de Iermentacion de la glucosa. A) homoIermentativa; B)
heteroIermentativa. Cglucoquinasa, Cfructosa-1,6-difosfato aldolasa, Cgliceraldehido-3-
fosfatodeshidrogenasa, Cpiruvato quinasa, Clactato deshidrogenasa, ©glucosa-6-fosfato
deshidrogenasa, C6-fosfogluconato deshidrogenasa, ®fosfocetolasa, ³acetaldehido
deshidrogenasa, 1alcohol deshidrogenasa.
Introduccion 5
0"0"0" Fermentación de disacáridos
Dependiendo del modo de transporte, los disacaridos entran en la celula bien
como azucares libres o IosIorilados, hidrolizandose en el interior de la misma por
accion de enzimas especiIicos. Sin duda, la ruta metabolica mejor estudiada en el
caso de las BAL es la de la lactosa, aunque tambien son capaces de Iermentar otros
disacaridos como la maltosa, la sacarosa, la celobiosa, la melibiosa y la trealosa. La
capacidad de Iermentacion de estos azucares diIiere entre las diIerentes especies de
BAL (Desmazeaud y de Roissart, 1994).

C" $%&'()*/&*D%+
C"!" *234567889:2
Durante cientos de años la humanidad ha explotado la Iermentacion de los
alimentos producida por las BAL como un metodo eIectivo para su conservacion.
Este eIecto es debido, principalmente, a la Iermentacion homolactica de los azucares,
la cual da lugar a la produccion de una gran cantidad de acido lactico, que a su vez
provoca un descenso del pH (alcanzando incluso valores inIeriores a 4,0). Este
descenso del pH previene el crecimiento de la mayoria de los microorganismos
potencialmente alterantes.
Algunas BAL son capaces de producir otras sustancias antimicrobianas como
peroxido de hidrogeno, etanol, acetaldehido, diacetilo y bacteriocinas.

C"0" &=4=83?4E@398=@ F?2?4=>?@ 6? >=@ G=83?495892=@
El estudio de las bacteriocinas comenzo en los años 20 del pasado siglo,
describiendose por primera vez en Escherichia coli (Gratia, 1925) y ampliandose
posteriormente a bacterias Gram-positivas (Jacob et al., 1953; Tagg et al., 1976).
Basandose en un estudio sobre colicinas producidas por bacterias Gram-
negativas, Tagg et al. (1976) deIinieron los peptidos antimicrobianos producidos por
los organismos Gram-positivos, como compuestos 'proteinaceos¨ que inhiben el
desarrollo de las bacterias relacionadas taxonomicamente con la cepa productora.
Introduccion 6
Posteriormente, Konisky (1982) propuso la siguiente deIinicion: 'las
bacteriocinas son compuestos de naturale:a proteica v sintesis ribosomal que
inhiben el crecimiento de otros organismos v no provocan la muerte de la celula
productora¨.
Probablemente las BAL sean el grupo de bacterias que producen un mayor
numero de bacteriocinas. Existen numerosas revisiones en la bibliograIia sobre estos
peptidos antimicrobianos (McAuliIIe et al., 2001, entre otros) y sobre los producidos
por las BAL en particular (Eijsink et al., 1998, 2002; Ennahar et al., 1999, 2000;
Cleveland et al., 2001; Garneau et al., 2002, entre otros).

C"C" -=@ G=83?495892=@ <4567896=@ <54 >=@ $%-
Las BAL sintetizan una gran variedad de bacteriocinas, las cuales se han
clasiIicado en los siguientes grupos (Nes et al., 1996 y Cleveland et al., 2001):
(I) CLASE I o LANTIBIÓTICOS: son peptidos pequeños (·5 kDa) que aIectan a
la permeabilidad selectiva de las membranas. Son modiIicados de Iorma post-
traduccional, conteniendo aminoacidos inusuales como lantionina, metil-lantionina,
dehidro-butirina y dehidro-alanina. Se subdividen a su vez en:
a) lantibióticos de Tipo A, peptidos cationicos e hidroIobicos que Iorman poros en
las membranas y poseen estructuras Ilexibles. El ejemplo mas conocido es la
nisina, aunque tambien se incluyen en este grupo otras como la lacticina 481, la
lacticina 3147 y la plantaricina C.
b) lantibióticos de Tipo B, peptidos globulares, estructuralmente rigidos, que no
poseen carga neta o la tienen negativa. No se han detectado bacteriocinas de este
grupo producidas por las BAL, siendo los ejemplos mas notables la mersacidina,
la actagardina y la duramicina.
(II) CLASE II o NO LANTIBIÓTICOS: son peptidos de hasta 10 kDa,
termoestables. No presentan aminoacidos modiIicados post-traduccionalmente. Se
subdividen en:

Introduccion 7
a) Clase IIa, en esta clase se incluyen los peptidos activos Irente a Listeria. Poseen
una secuencia amino-terminal conservada (YGNGVXC), y un puente disulIuro
(S-S) en la mitad amino-terminal del peptido. Ejemplos de este grupo son: la
pediocina PA-1, las sakacinas A y P, la leucocina A, la curvacina A, la
mesentericina Y105 y las carnobacteriocinas BM1 y B2.
b) Clase IIb, se incluyen en esta subdivision bacteriocinas Iormadas por dos
peptidos diIerentes. Entre ellas estan la lactococina G, la lactocina M y la
lactacina F.
c) Clase IIIc, en este grupo se incluyen todas aquellas bacteriocinas que no pueden
incluirse en los dos grupos anteriores. Pertenece a este grupo la lactococina A.
(III) CLASE III: este grupo esta Iormado por proteinas de gran tamaño (~30 kDa),
termolabiles. Ejemplos de este grupo son la helveticina J, la helveticina V-1829, la
acidoIilucina A y las lactacinas A y B.

C"H" /4F=29I=89:2 F?2J398=
Los genes que codiIican para la produccion de bacteriocinas se encuentran
organizados en operones, que se localizan en plasmidos, en transposones (Engelke et
al., 1992) o en el cromosoma bacteriano (Altena et al,. 2000; Diep et al., 1996).
La biosintesis de bacteriocinas depende de una estructura genetica compuesta
generalmente por (Nes et al., 1996):
1. el gen estructural que codiIica la prebacteriocina, aunque en algunos casos
existen varios genes estructurales que codiIican para diIerentes componentes de
la misma,
2. el gen de inmunidad, cuyo producto protege a la celula Irente al eIecto
antimicrobiano de la bacteriocina y que generalmente esta estrechamente ligado
al gen estructural e incluso Iorma parte de la misma unidad de transcripcion,
3. un gen que codiIica para un transportador ABC que excreta la bacteriocina y
cataliza su procesamiento,
Introduccion 8
4. un gen que parece codiIicar para una proteina accesoria que parece ser esencial
para la secrecion de la bacteriocina, pero cuyo papel es todavia desconocido.
En el caso de los lantibioticos, la organizacion del operon es mas compleja ya
que se requiere la presencia de los genes que codiIican para los enzimas implicados
en las modiIicaciones post-traduccionales, tipicas de este grupo.
El gen estructural de la bacteriocina codiIica para un propeptido, es decir, el
peptido mas una secuencia señal amino-terminal que tiene una longitud variable,
entre 14 y 30 aminoacidos (Klaenhammer, 1993; Harvarstein et al., 1994). La
Iuncion de este peptido parece ser:
a) estabilizar el peptido durante la traduccion,
b) evitar que la bacteriocina sea biologicamente activa mientras se encuentra
dentro de la celula productora,
c) proveer una señal de reconocimiento para el sistema de transporte,
d) mantener la conIormacion especiIica de la prebacteriocina.
Cada bacteriocina tiene su propia proteína de inmunidad, la cual se expresa
junto con ella. Las proteinas de inmunidad de las bacteriocinas de Clase II son
normalmente bastante pequeñas (entre 51 150 aminoacidos). La homologia entre
las proteinas de inmunidad es sorprendentemente baja considerando la encontrada
entre las bacteriocinas (Aymerich et al., 1996). Los analisis de hidroIobicidad de
algunas proteinas de inmunidad revelaron que estas poseian posibles segmentos
transmembrana, lo cual nos indicaria que estos Iactores se localizan en el blanco de
accion de la mayoria de las bacteriocinas, llevando a cabo asi una proteccion 'in
situ¨ (Fremaux et al., 1998).
Uno de los problemas que todavia no esta totalmente resuelto en el campo de las
bacteriocinas es el de cual es el mecanismo de inmunidad. Ensayos realizados con
bacteriocinas que pertenecen a la Clase IIa parecen demostrar que la parte C-terminal
de la bacteriocina es la que interacciona con el extremo C-terminal de la proteina de
inmunidad (Fimland et al., 2002; Johnsen et al., 2004). Debido a que dicho extremo
C-terminal de la bacteriocina es el que a su vez interacciona con la parte hidroIobica
de la membrana citoplasmatica bacteriana, pudiera ser que las proteinas de
inmunidad bloquearan, directa o indirectamente, dicha interaccion.
Introduccion 9
En el caso de los lantibioticos, en la inmunidad suelen estar implicados
transportadores ABC (ATP-Binding Cassette), como ocurre por ejemplo con la
epidermina (Peschel y Götz, 1996; Otto et al. 1998), la nisina (Ra et al., 2000), la
lacticina 481 (Rince et al., 1997), la lactacina RM (Yarmus et al., 2000) y LsA y
LsB (Gajic et al., 2003). Aunque no se conoce el papel que juegan estas proteinas en
la inmunidad, se ha postulado que podrian actuar eliminando, de Iorma activa, las
moleculas de bacteriocina de la membrana citoplasmatica. De esta manera la
concentracion de bacteriocina en esta se mantiene por debajo del nivel critico
necesario para la aparicion de poros (Peschel y Götz, 1996).
La mayoria de las bacteriocinas son translocadas Iuera de la celula mediante un
transportador ABC especiIico. La unica excepcion la constituyen unas pocas
pertenecientes a las Clases Ia y II que son exportadas mediante el sistema general de
secrecion de la celula (sistema SEC), como por ejemplo la carnobacteriocina A
(Worobo et al., 1994), la acidocina B (Leer et al., 1995), la bacteriocina 31 (Tomita
et al., 1996), la enterocina P (Cintas et al., 1997), la listeriocina 743A (KalmokoII et
al., 2001) y la lactococina 972 (Martinez et al., 1999). El gen que codiIica para el
transportador ABC puede encontrarse, o bien Iormando parte del operon de la
bacteriocina, o en un operon aparte. Los elementos consenso encontrados en los
peptidos señal se caracterizan por poseer dos residuos de glicina adyacentes y
previos al sitio de procesamiento y dominios de residuos hidroIobicos e hidroIilicos
separados por distancias conservadas (Tabla 1). Los transportadores que reconocen
los peptidos señal del tipo doble glicina (GG) contienen tres dominios (Figura 2), que
pueden estar codiIicados en un mismo polipeptido o en polipeptidos separados:
1. un dominio amino-terminal citoplasmatico, con actividad proteolitica
encargado del procesamiento del prepeptido
2. un dominio de membrana, generalmente Iormado por seis subdominios
transmembrana, y
3. un segundo dominio citoplasmatico de union a ATP, de unos 200
aminoacidos de longitud y cercano a su extremo carboxi-terminal en el que
se observan los Motivos de Walker A y B.
Introduccion 10
Basandose en la estructura de estos transportadores, Harvarstein et al. (1995)
propusieron la siguiente hipotesis para la exportacion de bacteriocinas que contienen
el peptido señal 'tipo doble glicina¨: el precursor de la bacteriocina se une al
dominio proteolitico del transportador ABC, de manera que la hidrolisis de ATP
induce una serie de cambios conIormacionales en el precursor, lo cual da lugar a un
proceso de proteolisis concomitante con el proceso de transporte de la bacteriocina a
traves de la membrana citoplasmatica. Esta teoria indica que este peptido señal
Tabla 1. Secuencias de peptidos señal encontrados en las bacteriocinas de clase II.

A) PEPTIDOS SEÑAL DEPENDIENTES DE TRANSPORTADORES ABC:
secuencia consenso: - - # h - - h h # - - # - - G G
-: cualquier residuo #: residuos hidroIobicos
h: residuos hidroIilicos G: residuos de glicina
B) PEPTIDOS SEÑAL DEPENDIENTES DEL SISTEMA DE SECRECION
GENERAL:
divergicina A: MKKQILKGLVIVVCLSGATFFSTPQASA
acidicina B: MVTKYGRNLBLSKKVELFAIWAVLVVALLLATA
A) Dominios
Dominio Dominio Dominio
proteolitico transmembrana de union ATP




C ~150aa H ~300aa ~250aa

C ÷ motivo rico en cisteina ÷ helices transmembrana
H ÷ motivo rico en histidina ÷ motivo de union a ATP


B) Localización en la membrana
Exterior




Interior Dominio Dominio
proteolitico de union
H ATP C

Figura 2. Transportador ABC de las bacteriocinas de Clase II con peptido señal del 'tipo
doble glicina¨. A) Organizacion de los dominios del transportador; B) supuesta
localizacion de los dominios en relacion con la membrana citoplasmatica

Introduccion 11
serviria como señal de reconocimiento para el transporte y procesamiento de la
bacteriocina.
Muchas de las bacteriocinas de Clase II presentan, junto con estos cuatro genes
basicos, una serie de genes reguladores de su produccion (Diep et al., 1994; 1996;
Axelsson y Holck, 1995; Quadri et al., 1995). Estos genes Iorman un sistema
regulador compuesto por tres componentes: un peptido de induccion (IP), una
histidina quinasa (HPK) y un regulador de la respuesta (RR). El peptido IP Iunciona
como una Ieromona, que cuando se une a HPK provoca la autoIosIorilacion de la
quinasa, y esta a su vez la del RR. El RR IosIorilado actua como un activador
transcripcional del operon de la bacteriocina (Kleerebezem et al., 1997).

C"K" 1565 6? =889:2
En general, la accion de las bacteriocinas producidas por bacterias Gram-
positivas esta restringida principalmente a otras especies de Gram-positivas. El rango
de organismos inhibidos por cada bacteriocina varia considerablemente; por ejemplo,
mientras que la nisina es activa Irente a especies de una gran variedad de generos
bacterianos (Lactococcus, Streptococcus, Staphvlococcus, Listeria y Mvcobacterium,
asi como Irente a las Iormas vegetativas y esporas de Bacillus v Clostridium), la
bacteriocina de Clase II, lactococina A, solamente es activa Irente a Lactococcus.
Para aquellas bacteriocinas de BAL cuyo modo de accion se conoce, se ha
demostrado que, dada su naturaleza cationica e hidroIobica, estas interaccionan con
la membrana plasmatica de las celulas sensibles Iormando poros que anulan su
permeabilidad selectiva (Moll et al., 1999), lo que provoca irremediablemente la
muerte celular. Se ha sugerido que los polimeros anionicos de la superIicie celular,
como los acidos teicoico y lipoteicoico, juegan un papel esencial en la interaccion
con las bacteriocinas cationicas, aunque parecen existir tambien receptores
especiIicos. Sin embargo, no todas las bacteriocinas Iorman poros. Se han descrito
otros modos de accion como la inhibicion de la sintesis de peptidoglicano o de la
Iormacion del septo de division (Hechard y Sahl, 2002).
Introduccion 12
Los lantibioticos de Tipo A, como la nisina, son capaces de Iormar poros de
Iorma transitoria en la membrana celular, provocando la disipacion del potencial de
membrana (A¢) y la perdida rapida de metabolitos pequeños, como aminoacidos,
nucleotidos y ATP, dando lugar a la detencion del metabolismo celular (Brötz et al.,
1998; Hechard y Shal, 2002). En general, estos poros no son selectivos, aunque en
algunos casos, como la lacticina 3147 (McAuliIIe et al., 1998) y la lactococina G
(Moll et al., 1996) Iorman poros que son exclusivos para el ion K
¹
.
Ahora bien, la potente actividad in vivo de la nisina, activa en un rango
nanomolar, contrastaba con la concentracion necesaria, mucho mas alta, para la
Iormacion de poros en membranas artiIiciales. Esta discrepancia se dilucido al
comprobar que los lantibioticos nisina y epidermina (pero no Pep5 o la epilacina
K7), se unen al precursor de la sintesis de peptidoglicano, el Lipido II, como paso
previo a la Iormacion de poros e inhiben, de este modo, la sintesis de pared celular
(Brötz et al., 1998; Breukink et al., 1999).
Estudios mas recientes (Wiedemann et al., 2001) han demostrado que el
lantibiotico nisina permeabiliza las membranas a traves de dos mecanismos
diIerentes:
1. a altas concentraciones (rango µM) los poros se Iormarian sin la participacion del
Lipido II. En este caso, para que se produzca una actividad optima de la nisina,
las membranas deben poseer un contenido del 50 60 ° de IosIolipidos cargados
negativamente, siendo muy importante su extremo carboxi-terminal, cargado
positivamente, para la union inicial (Moll et al., 1999). Los poros Iormados son
selectivos para los aniones (Figura 3A).
2. por el contrario, cuando existe Lipido II disponible, la nisina actua a bajas
concentraciones (rango nM) y el modelo a tener en cuenta es el de la Figura 3B.
La vida media de los poros, en presencia de Lipido II, aumenta de milisegundos
a 6 segundos, e incluso el diametro de los mismos tambien se incrementa de 1 a 2-2,5
nm (Wiedemann et al., 1998). Tambien se ha observado (van Heusden, 2002) que
esta union de la nisina al Lipido II Iavorece el cambio de orientacion de la
bacteriocina en la superIicie de las membranas celulares, pasando de una orientacion
paralela a una orientacion perpendicular respecto a estas membranas.
Introduccion 13






cadena creciente de
peptidoglicano
A)
B)
C)
transglicosilacion
Lipido II
Figura 3. Modo de accion de los lantibioticos de Tipo A y Tipo B: A) a concentraciones
micromoleculares, los peptidos cationicos de Tipo A (nisina, epidermina, Pep5, etc.) Iorman poros sin
necesidad de una diana; B) a concentraciones nanomolares, la nisina y la epidermina Iorman poros a
traves de dianas utilizando el Lipido II como molecula de anclaje; C) la mersacidina y la actagardina
tambien se unen al Lipido II, bloqueando su incorporacion al peptidoglicano. N: N-acetilglucosamina,
G: acido N-acetilmuramico. (Figura tomada de Hechard y Sahl, 2002).
Introduccion 14
Los lantibioticos de Tipo B (mersacidina y actagardina), no producidos por
bacterias lacticas, tambien inhiben la biosintesis del peptidoglicano (Somma et al.,
1971; Brötz et al., 1995), siendo la reaccion bloqueada la transglicosilacion (Brötz et
al., 1997). El sustrato de esta reaccion es nuevamente el Lipido II que, al igual que
ocurria con la nisina, Iorma un complejo de gran aIinidad con la mersacidina (Brötz
et al., 1998). En contraste con lo que ocurre con el glucopeptido vancomicina, el cual
se une al extremo carboxi-terminal !-Ala-!-Ala de la cadena lateral peptidica del
Lipido II, el complejo que Iorma el lantibiotico probablemente implique el nucleo
disacarido, siendo este un lugar de union no utilizado por ningun otro compuesto
antibacteriano (Figura 3C).
De acuerdo con lo descrito, observaciones al microscopio electronico de celulas
tratadas con nisina, Pep5 y plantaricina C mostraron una degradacion masiva de la
pared celular, particularmente en el area del septo. Tambien se observo que la
incubacion de las bacterias con estos lantibioticos producia la liberacion de enzimas
autoliticas (Bierbaum y Sahl, 1985). Este eIecto es mucho mas lento que la
Iormacion de poros y explica la lisis tardia de las celulas sensibles.
El proceso de Iormacion de poros de las bacteriocinas de la clase II no ha sido
tan extensamente estudiado como el de los lantibioticos. Se sabe que la Iacultad de
estas bacteriocinas de adoptar una conIormacion anIipatica o-helicoidal es uno de los
Iactores determinantes para la Iormacion de poros (Ennahar et al., 2000). Ademas,
esta capacidad es dependiente del potencial de membrana (A¢) y parece ser que esta
mediada por algun tipo de receptor (Abee, 1995). En estudios recientes se ha
propuesto que uno de los componentes del sistema multienzimatico de la permeasa
de la manosa (EII
t
man
) es la molecula diana de la mesentericina Y105 (Dalet et al.,
2001; Hechard et al., 2001) y la leucocina A (Rammath et al., 2000).
Por otro lado, estudios realizados con analogos de bacteriocinas han demostrado
que el enantiomero de la leucocina A es inactivo biologicamente (Yan et al, 2000), lo
cual indicaria la necesidad de interacciones quirales con una molecula 'receptora¨
para la actividad de dicha bacteriocina. Ademas, la necesidad de un 'receptor¨
tambien explicaria el espectro restringido de estas bacteriocinas.

Introduccion 15
H" -%&'/&/&*D% LM0
H"!" &=4=83?4E@398=@ F?2?4=>?@ N F?2J398=
La lactococina 972 es una bacteriocina producida por la cepa Lactococcus lactis
subsp. lactis IPLA 972 (lcn972), aislada en nuestro laboratorio (Martinez, 1996), con
caracteristicas muy peculiares respecto a su estructura y modo de accion. Es un
peptido hidroIilico de 66 aminoacidos biologicos, cuya Iorma activa es un
homodimero. Es termosensible, activa en un rango de pH comprendido entre 4,0 y
9,0 y poco susceptible a la accion de proteasas.
La inIormacion genetica tanto de la produccion de la lactococina 972 como de su
inmunidad, se encuentra en un plasmido de 10,9 kb, denominado pBL1. Se
identiIicaron dos orfs, que codiIicaban para la prebacteriocina (lclA) y una proteina
integral de membrana (lclB) (Martinez et al., 1996).
La produccion de lcn972 es maxima durante la Iase exponencial de crecimiento
de la cepa L. lactis IPLA972. Los estudios de los niveles de expresion del ARNm de
los genes lclA y lclB indicaron que ambos genes Iormaban una unica unidad de
transcripcion, siendo la abundancia del transcrito proporcional a la velocidad de
acumulacion de lactococina 972 en el sobrenadante de los cultivos (Martinez et al.,
1999).

H"0" 1565 6? =889:2
La peculiaridad mas destacable de la lactococina 972 reside en su modo de
accion que ha sido parcialmente caracterizado. Esta bacteriocina es bactericida y, en
algunos casos bacteriolitica, para cultivos de Lactococcus en Iase exponencial, no
habiendose aislado hasta el momento ninguna cepa resistente. A diIerencia de otras
bacteriocinas descritas, lcn972 no forma poros en la membrana plasmatica de las
celulas sensibles. De hecho, celulas que previamente han acumulado |H
3
|-uridina no
liberan al exterior el precursor de ARN al ser tratadas con lcn972. Ademas, la
actividad metabolica de las celulas se mantiene inalterada ya que los cultivos tratados
sintetizan ADN, ARN y proteinas a tasas similares a las del cultivo control, durante
al menos una hora despues del tratamiento (aproximadamente el tiempo de
Introduccion 16
generacion en Lactococcus) (Martinez et al., 1996). Sin embargo, no ocurre lo
mismo al medir la incorporacion de |H
3
|-N-acetil-glucosamina en el peptidoglicano.
En los cultivos tratados, se observa una cinetica lineal en lugar de una exponencial,
como corresponderia a un cultivo en Iase de crecimiento activo, es decir,
dividiendose rapidamente. La observacion al microscopio optico muestra la perdida
de la morIologia cocoide y un alargamiento de las celulas hasta aumentar su volumen
unas cuatro veces. Mediante citometria de Ilujo y el uso de colorantes especiIicos
para determinar la viabilidad de las celulas (ej. DAPI) se comprobo que estas
mantienen la integridad de su membrana plasmatica, señal de viabilidad, hasta que la
relacion superIicie-volumen supera un valor critico y la celula muere. Por ultimo,
con microscopia electronica de cortes ultraIinos de los cultivos tratados se observa
una inhibicion de la Iormacion de los septos de division (Martinez et al., 2000a).
Todos estos datos sugieren que la lactococina 972 inhibe la síntesis del
peptidoglicano en el septo, afectando así a un proceso crucial en el ciclo
biológico celular como es la división celular. Este particular modo de accion
representa un interesante modelo de estudio para el desarrollo de nuevos
antimicrobianos ya que no son muchos los actualmente descritos que actuan a este
nivel (Piddock, 1998).
En el proceso de division celular se han deIinido las siguientes etapas (Bramhill,
1997; Errington et al., 2003):
a) seleccion del sitio de division, generalmente en el punto medio de la celula;
b) ensamblaje del aparato citoplasmatico, que implica la Iormacion del anillo Z
por parte de la proteina FtsZ y, en la mayoria de los organismos, FtsA; union
al anillo Z de las proteinas especializadas, que dirigen la sintesis del material
de la pared celular, cuyo conjunto Iorma el divisoma (Figura 4). Dichas
proteinas se denominan Fts (filament thermosensitive mutants), dado que
los correspondientes mutantes termosensibles en E. coli adoptan un Ienotipo
Iilamentoso a la temperatura restrictiva. Una nomenclatura previa se reIiere a
varias de estas proteinas como PBPs (penicillin binding protein), por la
propiedad que tienen de admitir en su centro activo moleculas de
compuestos -lactamicos.
Introduccion 17
Una de estas proteinas, denominada PBP3 (FtsI) en E. coli, esta implicada de
Iorma especiIica en la Iormacion del peptidoglicano del septo. Asi, se observo que el
antibiotico -lactamico ceIalexina, que inhibe la septacion sin aIectar al proceso de
elongacion celular o la sintesis del peptidoglicano, se une con especial aIinidad a
PBP3 (Spratt, 1977). Posteriores ensayos con mutantes de ftsI en los cuales no se
produce sintesis del peptidoglicano durante la division, conIirmaron esta teoria
(Margolin, 2000).
Postulamos, por tanto, que la lactococina 972 podria interaccionar con la PBP de
Lactococus homologa a PBP3, mediante uno de los mecanismos siguientes: 1)
bloqueando su actividad directamente; 2) actuando sobre carboxipeptidasas que
parecen determinar la disponibilidad del supuesto sustrato de estas PBPs (el lipido II-
tripeptido) o; 3) evitando su localizacion en el septo.


Figura 4. Ciclo de Iormacion del divisoma en E. coli. OM: membrana externa; Mur: mureina; PP:
espacio periplasmico; CM: membrana citoplasmatica. Tomado de OOO"78@"B72"8=PQIRCBBOP
G958H!SCP<453?92@"T3B.

Introduccion 18
K" /;'*1*U%&*VD ,( -% ;)/,W&&*VD
,( $%&'()*/&*D%+
K"!" *234567889:2
El uso de las bacteriocinas como agentes conservantes puede realizarse, bien
utilizando un cultivo iniciador productor de bacteriocina in situ, o bien utilizando la
bacteriocina como aditivo. En cualquiera de los casos seria necesaria la optimizacion
de su produccion para poder disponer de la maxima actividad antimicrobiana. Por
tanto, esto seria uno de los primeros pasos a seguir en el estudio de la aplicacion de
las bacteriocinas.
La produccion de bacteriocinas esta inIluenciada por diversos Iactores, entre los
que se incluyen las Iuentes de carbono y nitrogeno, las condiciones de Iermentacion
(pH, temperatura, agitacion, etc.) y en general, cualquier variable que aIecte al
crecimiento microbiano (Biswas et al., 1991; Callewaert y de Vuyst, 2000; de Vuyst
et al., 1996; Uguen et al., 1999).

K"0" &92J398= 6? >= <4567889:2 6? G=83?495892=@ <54 $%-
La produccion de bacteriocinas parece ser un proceso asociado al crecimiento:
generalmente tiene lugar durante la Iase exponencial y cesa al Iinal de la misma
(Parente et al., 1997; Lejeune et al., 1998). Se ha observado que despues de alcanzar
un maximo, los niveles de bacteriocina decrecen llegando, en ocasiones, a no ser
detectada en el medio de cultivo. Esto podria deberse a la adsorcion de la
bacteriocina a las celulas productoras o bien a la degradacion de la misma por
proteasas. Sin embargo, hasta ahora no ha sido detectada ninguna proteasa en los
cultivos productores capaz de degradar las bacteriocinas, aunque se ha comprobado
la existencia de procesos de adsorcion para muchas de ellas como la nisina
(Meghrous et al., 1992), la enterocina 1146 (Parente y Ricciardi, 1994a), la
amilovorina L471 (de Vuyst et al., 1996; Lejeune et al., 1998) y la lactococina 140
(Parente et al., 1994). Asi pues, parece ser este segundo mecanismo el que realmente
inIluye en la desaparicion del antimicrobiano.
Introduccion 19
Existen diversos modelos matematicos (Leroy y de Vuyst, 2001) que intentan
describir el crecimiento de las bacterias lacticas. Un ejemplo son las ecuaciones
logisticas y las de Gompertz (Lejeune et al., 1998) que pueden ser utiles a la hora de
predecir el eIecto de un unico Iactor ambiental sobre la produccion de bacteriocina y
otros parametros biologicos relevantes (biomasa, evolucion del pH del medio de
cultivo, etc.). La principal desventaja del uso de estas ecuaciones es que han sido
diseñadas para una cepa en concreto, de manera que su extrapolacion a otras cepas,
con un crecimiento muy diIerente, da resultados muy imprecisos.
Por ultimo, cabe señalar que, aunque la produccion de bacteriocina sea un
proceso concomitante con el crecimiento, las condiciones optimas para este ultimo
no implican necesariamente un maximo en la produccion de bacteriocina. Por
ejemplo, se ha encontrado una relacion bastante lineal entre la velocidad de
produccion de bacteriocina y la velocidad de crecimiento celular para algunas
bacteriocinas, tanto en cultivo continuo como discontinuo (Kaiser y Montville, 1993;
Parente, et al., 1994; Parente y Ricciardi, 1994a, 1994b, 1999; de Vuyst et al., 1996;
Bhugaloo-Vial, et al.,1997), pero esta relacion no se ha observado para la nisina en
ninguno de los sistemas de cultivo (Kim et al., 1997), ni para la plantaricina C en
cultivo continuo (Barcena et al., 1998). La explicacion a la Ialta de linealidad en
estos dos casos podria derivar del hecho de que ambas bacteriocinas son
lantibioticos, cuya biosintesis y regulacion es mucho mas compleja que las de las
bacteriocinas de Clase II.

K"C" X=8354?@ Y7? =A?83=2 = >= <4567889:2 6? G=83?495892=@ <54 $%-
K"C"!" Cepa microbiana
Una misma bacteriocina puede ser producida por varias cepas o especies
diIerentes (Bhunia et al., 1994; Jack et al., 1995; Rodriguez et al., 1995; Martinez et
al., 2000b). Este hecho no puede generalizarse, puesto que Yang y Ray (1994)
encontraron que, aunque los niveles de produccion de nisina y de leuconocina Lcm1
variaban entre las diIerentes especies, en la produccion de pediocina AcH no
aparecia dicha diversidad. Estas diIerencias en la produccion pueden atribuirse a
niveles diIerentes de expresion de los genes necesarios para la produccion y/o
Introduccion 20
inmunidad de las bacteriocinas. Asi, por ejemplo, se habia observado en el caso de la
nisina (Kim et al., 1998), y de la amilovorina L471 (de Vuyst et al., 1996) que la
produccion siempre llegaba a un maximo que no se podia superar. Sin embargo, se
obtuvo un mutante espontaneo de L. lactis N8, la cepa LAC48, que producia 10
veces mas nisina que la cepa parental, aunque los niveles de expresion de los genes
nis eran similares en ambas cepas (Quiao et al., 1997). Estudios posteriores
demostraron que la inmunidad a la nisina en el mutante era mucho mayor que en la
cepa parental.

K"C"0" El medio de cultivo
La produccion de bacteriocinas tambien esta muy inIluenciada por el tipo y
concentracion de las Iuentes de carbono, nitrogeno y IosIato, asi como por los
cationes y agentes surIactantes presentes en el medio.
La produccion de nisina Z es optima cuando se utiliza como Iuente de carbono
glucosa, sacarosa o xilosa (Matsusaki et al., 1996; Chinachoti et al., 1997a, b). De
Iorma similar, la produccion de pediocina AcH es maxima cuando el medio se
suplementa con glucosa, sacarosa, xilosa o galactosa (Biswas et al., 1991). Como ya
hemos mencionado anteriormente, una produccion de biomasa maxima no se
corresponde obligatoriamente con una produccion maxima de bacteriocina; tal es el
caso de la enterocina 1146 cuyos niveles de biomasa utilizando como Iuente de
carbono sacarosa, Iructosa o lactosa son similares, pero solo se obtienen
concentraciones altas de bacteriocina con la primera (Parente y Ricciardi, 1994b).
Tan importante como el tipo de Iuente de carbono es la concentracion inicial de
carbohidrato. Esta variable inIluye tanto en la concentracion Iinal de bacteriocina
como en el rendimiento de produccion de bacteriocina por unidad de biomasa (Y
B/X
).
Estudios realizados por de Vuyst y Vandame (1992) con nisina revelaron que cuando
la concentracion de sacarosa aumenta de 10 a 40 g/L, Y
B/X
experimenta un descenso
de 19,1 a 10,9 mg
CDW
/g, a pesar de que se producia mas biomasa. Por el contrario, en
el caso de la amilovorina L471 no se ha encontrado un incremento en la actividad
cuando se aumenta la concentracion de glucosa de 20 a 60 g/L observandose, sin
embargo, un retraso en la degradacion de la bacteriocina (Lejeune et al., 1998).
Introduccion 21
Se ha estudiado tambien el eIecto de diIerentes Iuentes de nitrogeno y su
concentracion sobre la produccion de nisina (de Vuyst y Vandame, 1993), de
enterocina 1146 (Parente y Hill, 1992; Parente y Ricciardi, 1994b) y de lactocina D
(Parente y Hill, 1992). Todos ellos encontraron que los mejores rendimientos en la
produccion de bacteriocina se obtenian con Iuentes de nitrogeno 'completas¨, como
por ejemplo extracto de levadura.
En lo reIerente a los aniones (PO
4
3-
) y cationes (Mg

y Ca

) presentes en el
medio, el eIecto que estos ejercen sobre la produccion de bacteriocinas es especiIico
de la cepa productora. Por ejemplo, la presencia de IosIato inorganico mejora la
produccion de nisina con la cepa L. lactis subsp. lactis NIZO22186 (de Vuyst y
Vandame, 1993); sin embargo, este eIecto estimulador no se observa con la cepa IO-
1 (Matsusaki et al., 1996).
Otros aditivos, como el Tween 80 y el etanol, estimulan la produccion de
algunas bacteriocinas. Por ejemplo, la presencia de este ultimo (1° v/v) en el medio
de cultivo estimula la produccion de lactococina S (Mortvedt-Abildgaard et al.,
1995) y de amilovorina L471 (de Vuyst et al., 1996). Estos autores han intentado
explicar este Ienomeno mediante varias hipotesis: estimulacion de la expresion de los
genes involucrados en la sintesis de la bacteriocina, eIecto preventivo sobre la
agregacion de la misma e incremento en la Y
B/X
debido a las condiciones de estres.
Ademas, se ha estudiado el eIecto que tienen ciertos compuestos osmoprotectores
sobre la optimizacion de la produccion de lacticina 481 (Uguen et al., 1999),
observandose que esta disminuye rapidamente cuando las celulas crecen en un medio
de alta osmolaridad, pero que no se ve aIectada cuando a este medio se le añade
betain-glicina (GB).

K"C"C" Condiciones de la fermentación
El control del pH es esencial a la hora de optimizar la produccion de
bacteriocinas. Asi, el pH optimo para la sintesis de bacteriocinas es por lo general 5,5
- 6,0, valor algo menor que el optimo para el desarrollo de las BAL, aunque este
valor suIre variaciones entre especies e incluso entre cepas.
Introduccion 22
En el caso de la temperatura se observa una relacion entre la temperatura optima
de crecimiento y la de produccion maxima de bacteriocina (Meghrous et al., 1992;
Matsusaki et al., 1996; Chinachoti et al., 1997a; Lejeune et al., 1998), aunque
tambien se ha observado que el crecimiento a temperaturas suboptimas puede
provocar un aumento en Y
B/X
en casos puntuales (Lejeune et al., 1998).
Otros parametros tambien a tener en cuenta son las condiciones de agitacion y la
aireacion del cultivo (ambas relacionadas entre si). Un aumento en cualquiera de
ellas puede provocar la disminucion del crecimiento y de la produccion de
bacteriocina. En el caso de la lactococina S, se ha observado una inhibicion en la
sintesis de bacteriocina en cultivos aerobicos (Mortvedt-Abildgaard et al., 1995); por
el contrario, estas condiciones de estres provocan un incremento en Y
B/X
para la
amilovorina L471 (de Vuyst et al., 1996), a pesar de los niveles bajos de bacteriocina
que se observan al Iinal de la Iermentacion.

Z" '(/)[% ,(- &W-'*\/
(D ,*+&/D'*DW/ ] (D &/D'*DW/
Z"!" &7>39^5 ?2 69@85239275
Z"!"!" Introducción
En el cultivo en discontinuo el crecimiento del organismo se lleva a cabo en un
sistema cerrado, es decir, un biorreactor, en el cual se ha introducido un medio
adecuado, y en el que las condiciones ambientales de temperatura, pH, etc., han sido
preIijadas. En este caso las celulas creceran hasta que algun componente esencial del
medio se convierta en limitante, o hasta que se produzca algun cambio en el
ambiente que inhiba el metabolismo celular (por ejemplo la acumulacion de un
producto toxico, la superacion de la capacidad tamponante del medio, etc.).
A continuacion vamos a deIinir una serie de parametros y ecuaciones que nos
seran utiles a la hora de realizar los calculos y analizar los resultados obtenidos de un
cultivo en discontinuo. No explicaremos su deduccion matematica, que se puede
consultar en libros especializados (Scragg, 1991)
Introduccion 23
Z"!"0" Tasa de crecimiento específica
Se deIine la tasa de crecimiento o velocidad de crecimiento específica (µ, h
-1
)
como la velocidad de aumento de la concentracion celular por unidad de tiempo.
Puede determinarse durante la Iase exponencial de crecimiento mediante la ecuacion
siguiente:

µ = = =
÷
d d
t
t t t
X X 693 , 0 2 ln ln ln
0
(1)

donde:
X
t
es la biomasa del cultivo en el tiempo t de la curva de crecimiento (g
CDW
/L),
X
0
es la biomasa inicial del cultivo (g
CDW
/L),
t
D
es el tiempo de duplicacion (h).
A partir de esta ecuacion podemos calcular µ en un cultivo en discontinuo
representando el logaritmo de la biomasa en Iuncion del tiempo (Figura 5).

Z"!"C" Rendimiento en biomasa
Este parametro es muy importante puesto que representa la eIiciencia de la
conversion del sustrato en biomasa. Se deIine el rendimiento en biomasa (Y
X/S
) como
la cantidad de biomasa Iormada por unidad de masa de sustrato consumido, es decir:
















Figura 5. Calculo de la tasa de crecimiento especiIica (µ). Podemos estimar el tiempo de
duplicacion mediante la relacion µ ÷ 0,693/t
d
.
l
o
g

d
e

l
a

b
i
o
m
a
s
a

pendiente ÷ µ
tiempo
Introduccion 24
S
X
Y
S X
A
A
=
/
(2)

Z"!"H" Productividad en biomasa
La productividad en biomasa se deIine como la biomasa celular producida por
unidad de volumen de medio de cultivo y por unidad de tiempo (g L
-1
h
-1
):

t
X
p
X
= (3)

Generalmente, para algunos cultivos en discontinuo este parametro debe de ser
calculado para todo el proceso, incluyendo el tiempo que se ha tardado en preparar el
biorreactor, esterilizar el sistema, el tiempo que se tarda en realizar el cultivo y el del
vaciado del biorreactor.

Z"0" &7>39^5 ?2 85239275
Z"0"! Instrumentación
En el cultivo en continuo las celulas crecen en un sistema abierto donde se
mantiene la poblacion celular en un estado de crecimiento equilibrado, mediante la
eliminacion constante de una parte del cultivo y el reemplazo de este con medio
Iresco.
Existen dos tipos de sistemas de cultivo en continuo:
1. el QUIMIOSTATO, en el cual se añade un nutriente limitante del crecimiento a
una velocidad constante, de manera que tanto la densidad del cultivo como la
velocidad de crecimiento se ajustan a este hecho,
0" el TURBIDOSTATO, en el cual se mantiene constante la densidad optica del
cultivo añadiendo medio Iresco a medida que se necesita.
En el Apartado 4.1. de Materiales y Metodos (Instrumentacion) se presenta el
esquema del quimiostato utilizado en este estudio y que puede servir como
orientacion sobre los diIerentes elementos que componen estos aparatos.
Introduccion 25
Z"0"0" Relación entre la tasa de dilución y la concentración celular
En el quimiostato la velocidad de crecimiento celular esta determinada por la
velocidad de adicion del nutriente limitante (Iuente de carbono y nitrogeno, IosIoro,
elementos traza, vitaminas, etc.). Si mantenemos esta velocidad de adicion constante,
el cultivo puede mantenerse en un estado estacionario o sostenido de crecimiento
de manera indeIinida. Esta es una de las mayores ventajas del cultivo continuo Irente
al cultivo discontinuo.
Esta propiedad del quimiostato puede expresarse mediante una serie de
ecuaciones que relacionan la concentracion celular y la del nutriente limitante con la
velocidad de adicion del medio. Estas ecuaciones se obtienen desarrollando los
balances materiales del biorreactor, obteniendose como ecuacion Iinal:

X
J
FX
dt
dX
µ + ÷ = (4)

donde:
F es la velocidad de adicion del medio (L/h),
V es el volumen del biorreactor (L),
X es la concentracion de celulas en el biorreactor (g
CDW
/L)
µ es la tasa de crecimiento especiIica (h
-1
).
El termino F/V se denomina tasa de dilución (D), y equivale al numero de
volumenes de cultivo que pasan por el quimiostato por hora. Sustituyendo en la
ecuacion (4), y reagrupandola obtenemos:
) ( D X
dt
dX
÷ = µ (5)

De esta expresion deducimos que variando la velocidad de adicion del medio
podemos variar la tasa de crecimiento.
Durante el estado estacionario la biomasa permanece constante dentro del
quimiostato (dX/dt ÷ 0), de manera que sustituyendo en la ecuacion (5) obtenemos
que en el estado estacionario µ ÷ D.
Introduccion 26
Z"0"C" Relación entre la tasa de dilución y la concentración de sustrato
El desarrollo de la ecuacion que nos permite llegar a esta relacion es muy similar
al de la ecuacion (4), es decir, partimos de un balance de materia:
S X
R
Y
X
J
S F
J
FS
dt
dS µ
÷ ÷ = ÷ (6)

donde:
S es la concentracion del nutriente limitante en el quimiostato (g/L),
S
R
es la concentracion del sustrato limitante en el reservorio del medio (g/L),
Y
X/S
es el rendimiento de biomasa (g de peso seco celular Iormado por gramo de
sustrato consumido, g
CDW
/g),
µ es la tasa de crecimiento especiIica (h
-1
),
F es la velocidad de adicion del medio (L/h),
V es el volumen del biorreactor (L),

En el estado estacionario dS/dt ÷ 0 y ademas µ ÷ D (recordemos que F/V ÷ D),
de manera que la relacion entre la tasa de dilucion y la concentracion de sustrato
puede escribirse como:

) ( S S Y X
R S X
÷ = (7)

(en el estado estacionario X y S se representan como X y S por convenio).

Z"0"H" Tasa de dilución crítica
Como ya hemos apuntado (ecuacion 5), cuando trabajamos con el quimiostato,
variando la tasa de dilucion (D) podemos variar la tasa de crecimiento especiIica (µ).
Cuando D ~ µ
max,
(µ - D) tiene un valor negativo en la ecuacion (5), de manera que a
medida que vamos aumentando el valor de D comienza a tener lugar una
disminucion en la concentracion celular dentro del quimiostato y como resultado se
Introduccion 27
dice que hay un lavado del cultivo. Se deIine la tasa de dilución crítica (D
c
) como
la tasa de dilucion mas baja a la cual ocurre el lavado del cultivo. En la practica el
valor de D
c
es similar al de µ
max
.

Z"0"K" Productividad
En el cultivo continuo la productividad en biomasa, p
x
(g L
-1
h
-1
) es un
parametro indicativo de la eIectividad del sistema, y se expresa como:

X D p
x
· = (8)

Z"0"Z" Producción de bacteriocinas
La produccion optima de bacteriocinas en cultivo en discontinuo generalmente
requiere la utilizacion de medios complejos y de condiciones Iisicas (como
temperatura y pH) muy controladas (Leroy y de Vuyst, 1999; Moortvedt-Abildgaard
et al., 1995; Parente y Ricciardi, 1994; Yang y Ray, 1994). Por estas razones,
raramente el cultivo en discontinuo se elige para la produccion de bacteriocinas.
El proceso de eleccion para la produccion de bacteriocinas es el cultivo en
continuo, debido a varias razones. Podemos obtener altas densidades celulares y,
puesto que la mayoria de las bacteriocinas se producen durante la Iase de crecimiento
activo, podemos obtener una produccion volumetrica de bacteriocina alta. Ademas,
durante estos cultivos, la concentracion de nutrientes puede controlarse para mejorar
y estabilizar la produccion de bacteriocina. Tambien, el cultivo en continuo permite
eliminar aquellos metabolitos inhibidores, como acido lactico o la propia
bacteriocina, maximizandose asi la produccion de la misma, especialmente a tasas de
dilucion que son lo suIicientemente altas para proveer los nutrientes necesarios.
Finalmente, mediante la utilizacion de cultivos en continuo podemos evitar el
descenso en la produccion de bacteriocina, que como ya hemos indicado, se observa
despues de alcanzar un maximo en los niveles de produccion.

Introduccion 28

Tabla 2. Datos comparativos de la produccion de diIerentes bacteriocinas producidas por BAL en
cultivos en discontinuo y en continuo.


Bacteriocina

Cepa

Proceso
B
(10
6
AU o
IU/L)
Y
B/X

(10
6
AU/g)

Referencia
Bavaricina
MN
Lb. bavaricus
MN
discontinuo
continuo; D÷0,058
continuo; D÷0,205
3,2
6,4
6,4
n.d.
n.d.
n.d.
Kaiser y Montville,
1993.
Enterocina
1146
E. faecium
DPC1146
discontinuo
continuo; D÷0,14
continuo; D÷0,56
2,8
3,2
1,8
2,0
1,9
1,9
Parente et al., 1997.
Divercina
Cb. Divergens
V41
discontinuo
continuo; D÷0,03
continuo; D÷0,2
cont.¹Ca-alg; D÷2
cont.¹MF; D÷0,4
100,0
200,0
210,0
5,0
2,0
n.d.
78,1
78,1
n.d.
n.d.
Bhugaloo-Vial et
al., 1997.
Plantaricina
C
Lb. plantarum
LL441
continuo; D÷0,055
continuo; D÷0,12
continuo; D÷0,25
3,2
0,4
0,1
2,1
0,2
0,06
Barcena et al.,
1998.

Nisina
L. lactis
IFO12007
discontinuo
cont.¹MF; D÷0,5
cont.¹MF¹B; D÷0,5
0,12
0,15
0,14
0,035
n.d.
n.d.
Taniguchi et al.,
1994.
Pediocina
PO2
Pc. acidilactici
PO2
cont. Ca-alg; D÷3 0,25 n.d.
Nisina
L. lactis
AFIS2011
cont. Ca-alg; D÷3 0,13 n.d.
Nisina
L. lactis
ATCC11454
continuo; D÷0,1
continuo; D÷0,25
continuo; D÷0,4
0,08
0,18
0,06
0,043
0,097
0,033
Meghrous et al.,
1992.
Nisina L. lactis IO-1
discontinuo
continuo; D÷0,1
cont.¹inm.; D÷0,1
cont.¹inm.; D÷0,3
cont.¹MF; D÷0,1
cont.¹MF, D÷0,3
disc.¹MF¹SepPakC8
3,15
2,81
2,16
1,30
2,75
2,00
2,4 (¹1,4)
2,25
2,14
n.d.
n.d.
n.d.
n.d.
2,5
Matsusaki et al.,
1996.
Chinachoti et al.,
1997c.
B: titulo de bacteriocina; Y
B/X
, rendimiento de la produccion de bacteriocina por unidad de
biomasa; D, tasa de dilucion h
-1
; n.d., no disponible; Ca-alg, celulas inmovilizadas en alignato de
calcio; MF, microIiltracion; imm., celulas inmovilizadas en ENTG.-3800. (Parente y Ricciardi,
1999)
Introduccion 29
En la Tabla 2 se comparan procesos en discontinuo y en continuo para la
produccion de algunas bacteriocinas.
Generalmente se observa en los cultivos en continuo una relacion lineal entre la
D y la produccion especiIica de bacteriocina (Y
B/X
) (ver Apartado 6.2.2. Relacion
entre la tasa de dilucion y la concentracion celular). Este es el caso de la enterocina
1146 (Parente et al., 1997), la bavaricina MN (Kaiser y Montville, 1993) y la
divergicina (Bhugaloo-Vial et al., 1997). Pero tambien se han observado otros
patrones de produccion; por ejemplo, solo se observa produccion de plantaricina C a
tasas de dilucion bajas (Barcena et al., 1998).
A medida que el valor de la D aplicada aumenta, disminuye la biomasa y la
concentracion de bacteriocina, pudiendose llegar al lavado del cultivo (ver Apartado
6.2.4. Tasa de dilucion critica). Es por esto por lo que algunos autores han utilizado
Iermentaciones en continuo con reciclaje de celulas o con celulas inmovilizadas
(Tabla 2). El uso de cultivos inmovilizados requiere la optimizacion de algunos
parametros especiIicos, como el tipo de membrana empleada en la microIiltracion, ya
que se han observado Ienomenos de retencion de la bacteriocina (Bhugaloo-Vial et
al., 1997). Este tipo de Iermentaciones permiten el uso de valores de D muy altos, de
manera que aunque los valores del titulo de bacteriocina sean menores que para los
sistemas celulares libres, la productividad aumenta considerablemente.

M" ;)(+(D'%&*VD ,(- ')%$%_/`
%D'(&(,(D'(+ ] /$_('*\/+
En nuestro laboratorio se ha identiIicado una nueva bacteriocina, la lactococina
972, producida por la cepa Lactococcus lactis subsp. lactis IPLA972. Esta
bacteriocina, debido a sus peculiares propiedades Iisico-quimicas y a su particular
modo de accion, no puede englobarse en ninguna de las clases de bacteriocinas
descritas hasta el momento. Asi pues, la lactococina 972 podria considerarse como el
prototipo de una nueva clase de peptidos antimicrobianos, lo que la hace muy
interesante desde un punto de vista biologico a pesar de tener una aplicacion
tecnologica limitada, debido al estrecho rango de microorganismos sensibles.
Introduccion 30
En este trabajo de proIundizacion del conocimiento de las caracteristicas de la
lactococina 972, los objetivos planteados han sido los siguientes:
1. Caracterizacion del sistema de produccion/inmunidad de la lactococina 972:
1.1. Completar la secuenciacion del operon que codiIica para la
bacteriocina y analisis inIormatico de la secuencia obtenida.
1.2. Analisis Iuncional del operon mediante su expresion controlada en
L. lactis NZ9000.
2. Caracterizacion del modo de accion de la lactococina 972, con especial
enIasis en su posible papel sobre las PBPs de Lactococcus lactis:
2.1. Analisis del perIil de proteinas de union a penicilina (PBPs) de las
cepas L. lactis IPLA972 y L. lactis R2, productoras de la
bacteriocina, y comparacion con el de la cepa sensible L. lactis
MG1614.
2.2. Determinacion de la inIluencia de la lactococina 972 sobre el perIil
de PBPs de las celulas sensibles a la bacteriocina.
3. Optimizacion de la produccion de bacteriocina en biorreactor mediante el
cultivo en discontinuo y en continuo de la cepa productora L. lactis IPLA972.









"#$%&'#(%) *
"+$,-,)

Materiales y metodos 31















II. MATERIALES Y MÉTODOS
1. MICROORCAAISMOS, JEC1ORES
Y COADICIOAES DE CUL1IJO
Las cepas bacterianas y los vectores de clonacion utilizados en este estudio se
encuentran descritos en las Tablas 3 y 4.
La cepa Lactococcus lactis subps. lactis IPLA 972, productora de lactococina
972 (lcn972), Iue aislada de un queso artesanal asturiano. Esta cepa pertenece a la
coleccion del Instituto de Productos Lacteos de Asturias (IPLA-CSIC), y ya Iue
objeto de la tesis doctoral de la Dra. Martinez (Martinez, 1996). Esta registrada en la
Coleccion Española de Cultivos Tipo como CECT5695.
Las cepas de lactococos se propagaron en medio M17 (Oxoid, Basingstoke,
Hampshire, England) suplementado con diIerentes carbohidratos (glucosa, lactosa,
0,5°) a 30 ºC, sin agitacion. Las cepas de Escherichia coli se incubaron en medio
2TY (Sambrook et al., 1989) a 37 ºC, con agitacion.
Los ensayos de metabolismo y produccion de bacteriocina en biorreactor se
realizaron en medio ESTY (Pronadisa) (de composicion identica al M17). Este
medio se suplemento con glucosa o lactosa (5 o 20 g/L) como Iuente de carbono.
Materiales y metodos 32
Los microorganismos se conservaron congelados a 80 ºC en el medio de
crecimiento suplementado con glicerol al 10 °. Los antibioticos utilizados Iueron
suministrados por Sigma-Aldrich. Durante los bioensayos rutinarios de actividad con
la cepa indicadora L. lactis MG1614 el medio de crecimiento se suplemento con
estreptomicina (Str, 500 µg/ml).
Como agentes de seleccion en los experimentos de clonacion se utilizaron
ampicilina (Amp, 100 µg/ml) para las cepas de E. coli y eritromicina (Ery, 2,5 µg/ml)
y cloranIenicol (Cm, 10 µg/ml) para las cepas de L. lactis. Como segundo agente de
seleccion se utilizo (cuando Iue necesario) X-Gal o X-Glu (Sigma-Aldrich).
Tabla 3. Cepas bacterianas utilizadas.

Cepa Propiedades relevantes Fuente/Referencia
L. lactis subsp. lactis
IPLA 972
IL1403
F4-2

Cepa silvestre Bac
¹
Inm
¹
.
Cepa libre de plasmidos, Bac
-
Inm
-
.
Cepa huesped del Iago P335.

Martinez et al., 1996.
Venema et al., 1996.
Moineau, 1999.
L. lactis subsp. cremoris
MG1614
R2

NZ9000

pBL54

N12

R12

PBPX


Cepa libre de plasmidos, Bac
-
Inm
-
, Str
r
. RI
r
.
Cepa derivada de MG1614, que contiene pBL1,
Bac
¹
, Inm
¹
.
Cepa derivada de MG1363; contiene los genes nisK
y nisR, receptora de pNZ8020 y pNZ8048E.
Cepa derivada de NZ9000, Bac
¹
inducible,

Inm
¹

constitutiva.
Cepa derivada de NZ9000 que contiene el P
Lcn972
en
pauta con el gen reportero uidA.
Cepa derivada de R2 que contiene el P
Lcn972
en pauta
con el gen reportero uidA.
Cepa derivada de NZ9000 que contiene el gen pbpX
en pauta con el P
nisA


Gasson, 1983.
Martinez, 1999.

Kuipers et al., 1998.

Este trabajo.

Este trabajo.

Este trabajo.

Este trabajo.
E. coli
JM105

DH10B


KW1

KW2

endA1, thi, rpsL, sbcB15, hsdR4, (lac-proAB)
(F`, traD36, proAB, lacI
q
ZDM15)
F

, mcrA, (mrr-hsdRMS-mcrBC), 80dlacZ
M15, lacX74, deoR, recA1, endA1, araD139,
(ara, leu)7697, galU, galK,

, rpsL, nupG
(add-gus-man) hsdR hsdM
·
metB strA purB
Cepa derivada de KW1, que contiene el P
Lcn972
en
pauta con el gen reportero uidA.

Woodcok et al., 1989.

Gruber, 1992.


Fiedler y Wirth, 1988.

Este trabajo.
Materiales y metodos 33

2. 1ECAICAS DE BIOLOCIA MOLECULAR
2.1. Manipulación y análisis de ácidos nucleicos
2.1.1. Extracción de ADN plasmídico y electroporación
El ADN plasmidico de L. lactis se aislo segun el metodo de O`Sullivan y
Klaenhammer (1993). La electroporacion de las cepas de lactococos se realizo de acuerdo
con el metodo de Leenhouts et al. (1990), utilizando cubetas de 0,2 cm en un Gene Pulser
Apparatus (Bio Rad). Las condiciones del pulso Iueron de 12,5 kV/cm, 200 y 25 µF.
Para aislar los plasmidos de E. coli se utilizo el metodo de Birboim y Doly (1979)
cuando el analisis de los mismos era rutinario. Para la obtencion de ADN plasmidico de
alta pureza se utilizo el sistema 'GenElute
TM
Plasmid Miniprep Kit¨ (Sigma-Aldrich).
La trasIormacion de las distintas cepas de E. coli se realizo utilizando el metodo descrito
por Dower et al. (1988) aplicando las mismas condiciones de pulso que para los
lactococos.
Tabla 4. Vectores utilizados.

Plásmido Propiedades relevantes Fuente/Referencia
L. lactis
pBL1
pNZ8020
pNZ8048E
pIL252
pBL11
pBL12
pBL54

Bac
¹
Inm
¹
.
P
nisA
, Cm
r
.
P
nisA
, Cm
r
, Ery
r
.
Bajo numero de copias, Ery
r
.
Derivado de pNZ8020 que contiene el gen pbpX, Cm
¹
.
Derivado de pIL252 que contiene el P
Lcn972
junto en el
gen reportero uidA.
Derivado de pNZ8020 que contiene los genes lclA,
lclB y lclC, Bac
¹
,

Inm
¹
,

Cm
¹
.

Martinez et al., 1996.
de Ruyter et al., 1996b.
de Ruyter et al., 1996b.
Simon y Chopin, 1988.
Este trabajo.
Este trabajo.

Este trabajo.
E. coli
pUC18
pTUT-mcs2
pBL2
pBL53

Clonaciones intermedias, seleccion por inactivacion
insercional del gen -lacZ, Amp
r
.
CuantiIicacion de la actividad de promotores mediante
el gen reportero de la glucuronidasa de E. coli, uidA.
Derivado de pTUTmcs2 que contiene el P
Lcn972
.
Derivado de pUC18 que contiene los genes lclA, lclB
y lclC, Amp
r
.

Imai y Kitajima, 1997.

Chaillou et al., 1998.

Este trabajo.
Este trabajo.

Materiales y metodos 34
!"#"!" Técnicas electroforéticas y extracción de ADN de los geles de agarosa
Para el analisis de los Iragmentos de ADN este se sometio a electroIoresis en
geles de agarosa al 0,7 °, utilizando tampon TBE, y de acuerdo con las indicaciones
descritas por Maniatis et al. (1982) y Sambrook et al. (1989). Como patron de peso
molecular se utilizo ADN del Iago , digerido con PstI o HindIII.
Para la extraccion de los Iragmentos de ADN de los geles de agarosa se
utilizaron Iundamentalmente dos metodos: la extraccion mediante 'Ireeze and
squeeze¨ (Sambrook et al., 1989) o mediante el sistema 'GenEluteTM Minus EtBr
Spin Columns¨ (Sigma-Aldrich).

!"#"%" Reacción en cadena de la polimerasa (PCR)
En los experimentos de PCR (Saiki et al., 1985; Mullis y Faloona, 1987) se
utilizo Taq ADN polimerasa (Roche), cuando la ampliIicacion se realizo para
comprobar la existencia de un gen determinado, y Pwo ADN polimerasa (Roche)
cuando se necesitaba una alta Iidelidad en la ampliIicacion (por ejemplo cuando el
Iragmento ampliIicado iba a ser posteriormente clonado).
En la Tabla 5 se indican los oligonucleotidos utilizados como cebadores en este
estudio. Las ampliIicaciones constaron de un paso de desnaturalizacion del ADN a
95 ºC durante 5 minutos, seguido de una serie de ciclos de anillamiento (cuyo
Tabla 5. Oligonucleotidos utilizados.
Nombre Secuencia
Enzima de
restricción
T
m

(ºC)
Fragmento amplificado
P1 CGTTTGAATTCACTTTCCG EcoRI 56,8
P2 CTTGGTTTCCATGGAGAATCC NcoI 60,7
Promotor Lcn972
Nis1
ATGTGCTTATTAATCTCAGGAATTCCTGAG
EcoRI 65,1
Nis2 CCCTCTAGATTAAAAAGCTAAAGCTAA XbaI 61,2
Operon Lcn972
Bac3 GTGTATCCTTACCTTGTC -- 48,4
Bac6 CAAAACTTAATGCTCC -- 47,8
Fragmento EcoRV-HindIII
de pBL1
PBP2
AGCAACGCCATGGTAAAATTTTTAA
NcoI 46,0
PBP3
CCAGATCTTACCGCCGCCACTATCCC
BglII 59,0
Gen pbpX de
L. lactis IL1403
PA
ACTATTCCAGAACGAGCG
53,7
PB
CCCAGTGCTACCAAATCC
56,0
Fragmento de 381 pb de la
dUTPasa de Iagos de la
especie P335 de L. lactis
Materiales y metodos 35
numero y condiciones dependieron de los cebadores utilizados, el tamaño del
Iragmento a ampliIicar y el enzima utilizado), un paso de elongacion a 72 ºC,
Iinalizando con un paso de extension a 72 ºC durante 10 minutos.

2.1.4. Secuenciación de ADN
La secuenciacion se realizo segun el metodo de los desoxinucleotidos triIosIato
descrito por Sanger et al. (1977), utilizando 5`-|-
35
S|dATP (Amersham Pharmacia
Biotech) y el kit T7 Sequenase version 2.0 (U.S. Biochemicals, Cleveland, OH), o
mediante la tecnica de 'chromosome walking¨ basada en la reaccion de PCR,
utilizando como cebadores oligonucleotidos marcados Iluorescentemente, Taq
polimerasa (Amersham Pharmacia Biotech) y un secuenciador automatico ALF DNA
(Amersham Pharmacia Biotech). Para realizar la secuenciacion del Iragmento de
pBL1 EcoRV-HindIII, de 0,7 kpb, imposible de clonar en ningun vector, se
secuencio directamente el producto de PCR (ampliIicado con los cebadores Bac3 y
Bac6, Tabla 5). Las secuencias de ADN se ensamblaron utilizando el paquete de
programas GCG (Devereux et al., 1984).

2.1.5. Análisis de las secuencias
Los datos obtenidos tras la secuenciacion de los genes Iueron analizados
utilizando:
1. La base de datos blatsn (basada en el programa BLAST, Basic Local
Alignment Search Tool, Atschul et al., 1997; Zhang y Madden, 1997),
accesible en la pagina web del NCBI (National Center Ior Biotechnology
InIormation) http://www.ncbi.nlm.nih.gov/, se utilizo para el alineamiento
de las secuencias de nucleotidos.
2. El programa DAAman (version 4.0, Lynnon BiosoIt, ©1994-1999) permitio
la busqueda de posibles pautas abiertas de lectura, asi como la busqueda de
posibles sitios de union a ribosoma y promotores. Tambien se utilizo para
la busqueda de repeticiones invertidas que pueden actuar como terminadores
de la transcripcion rho-independiente.
Materiales y metodos 36
El programa MFold (Zuker et al., 1999), disponible en la pagina web
http://bioweb.pasteur.fr/seqanal/interfaces/mfold-simple.html, se utilizo para
predecir la estabilidad de los transcritos generados a partir de las orfs previamente
identiIicadas.
A partir de la secuencia de ADN se dedujo la de aminoacidos utilizando el
programa DAAman (ver 4.0, Lynnon BiosoIt, ©1994-1999). Esta secuencia se
sometio a analisis utilizando:
1. El programa DNAman, que nos permitio el calculo de la composicion de
aminoacidos y la prediccion de las propiedades Iisico-quimicas de la proteina
(como punto isoelectrico y peso molecular teorico). Tambien se utilizo para
realizar los alineamientos entre distintas secuencias de proteinas; para ello se
uso la matriz BLOSUM (blocks substitution matrix; HenikoII y HenikoII,
1992) con los siguientes parametros: gap open penalty ÷ 10, gap extension
penalty ÷ 0,05 y ° delay divergent sequences ÷ 62.
2. El programa SignalP (ver 1.1, Nielsen et al., 1997), disponible en la pagina
web http://www.cbs.dtu.dk/services/ SignalP/, se uso para detectar la
existencia de posibles peptidos señal.
3. La base de datos de dominios de proteinas prosite (Sigrist et al., 2002) y el
programa ScanProsite (Gattiker et al., 2002), todos ellos accesibles en la
pagina web http://us.expasy.org/prosite/, se utilizaron para la busqueda de
motivos comunes con otras proteinas y proteinas con dominios concretos,
respectivamente.
4. Los programas: 1opPred2 (Claros y von Heijne, 1994); 1Mpred (HoImann y
StoIIel, 1993); HMM1OP ver 2.ô (Tusnady y Simon, 2001); SOSUI (Mitaku
Group, Department oI Biotechnology, Tokyo University oI Agriculture and
Technology), todos ellos disponibles en la pagina Expasy Molecular Biology
Server (http://us.expasy.org/), se utilizaron para comprobar la presencia de
regiones transmembrana, asi como la orientacion de estas.
5. La base de datos blastp (basada en el programa BLAST), accesible en la
pagina web del NCBI, nos permitio la busqueda de proteinas homologas a
nuestras secuencias en las bases de datos.
Materiales y metodos 37
6. La base de datos rpsblast (basada en el programa BLAST; Marchler-Bauer et
al., 2003) accesible en la pagina web del NCBI, se utilizo para la busqueda de
dominios conservados (COGs, Clusters oI Orthologous Groups). Dado que
cada COG incluye proteinas de organismos Iilogeneticamente muy diversos,
este sitio es especialmente util para asignar Iuncion a proteinas que no
muestran un grado signiIicativo de similitud con otras proteinas.

2.1.ô. Expresión controlada de genes en Lactococcus
Para conseguir una expresion controlada de genes en Lactococcus, asi como para
identiIicar cuales eran los genes necesarios para la produccion e inmunidad de la
lactococina 972, se utilizo el sistema NICE (NIsin Controlled Expression system,
Figura 6), que nos permite un control sencillo de la expresion de estos genes (de
Ruyter et al., 1996a).
Los ensayos de induccion se realizaron tanto en medio liquido (de Ruyter et al.,
1996b) como utilizando el sistema en multicapa (Eijsink et al., 1996).


NisK
NisR
P
i
nisina
nisK nisR
regulacion de la
expresion genica
transduccion de
señales
gen x
Pnis
proteína X

Figura 6. Diagrama del sistema NICE: nisK y nisR son los genes que codiIican para la histidin
kinasa (NisK) y el regulador (NisR), respectivamente; Pnis es el promotor inducible de la nisina;
gen x es el gen que se clona bajo la accion del Pnis y proteina X es su producto.
Materiales y metodos 38
2.1.7. Ensayo de actividad del promotor de la lactococina 972
Para realizar el estudio cuantitativo de la actividad del promotor del operon de la
lactococina 972 (P
Lcn972
) se llevaron a cabo diIerentes Iusiones con el gen reportero
de la glucuronidasa, uidA, de E. coli. El analisis cuantitativo se realizo tanto en
extractos de E. coli KW1 como de L. lactis MG1614 y R2.
Para la medida de la actividad -glucuronidasa se utilizaron extractos celulares
obtenidos mediante ruptura mecanica; su contenido en proteina se determino
utilizando el sistema BCA (Pierce Biotechnology, Inc.). El ensayo de actividad se
realizo sobre estos extractos en microplacas, utilizando un volumen Iinal de reaccion
de 250 µl: 100 µl de extractos o diluciones ¹ 150 µl de mezcla de reaccion (148 µl
buIIer ¹ 2 µl de reactivo X-GLUC 100 mM). Las placas se analizaron utilizando un
lector de microplacas BENCHMARK PLUS (Bio Rad) y aplicando los siguientes
parametros de lectura: longitud de onda 405 nm, a 37 ºC durante 45 min,
obteniendose 20 puntos de lectura que nos permitieron conIeccionar las rectas para el
analisis.
La actividad -glucuronidasa (UA/min) se deIinio como la variacion de la
absorbancia por minuto (pendiente de la recta obtenida durante la lectura) y se
expreso por µg de proteina del extracto (UA min
-1
µg prot
-1
).

2.2. Proteinas
2.2.1. Obtención de membranas de L. lactis
Los cultivos se incubaron a 30 ºC hasta alcanzar una OD
600
de aproximadamente
0,8. Las celulas se recogieron y se lavaron con tampon IosIato potasico (100 mM, pH
7,0), congelandose el sedimento. Posteriormente, la muestra se proceso siguiendo el
metodo descrito por Margolles et al. (1999). Para ello, las celulas se trataron con una
concentracion de 10 mg/ml de lisozima y se lisaron utilizando una prensa de French
(French®Press) a 20.000×psi, siguiendo el metodo de Bayer et al. (1982). La
suspension se centriIugo a baja velocidad (13.000×g, 10 min., 4 ºC) para eliminar los
restos celulares, y posteriormente el sobrenadante se sometio a ultracentriIugacion
Materiales y metodos 39
(125.000×g, 60 min., 4 ºC). El sedimento se resuspendio en tampon IosIato (100
mM, pH 7,0) y se congelo inmediatamente a -80 ºC hasta su utilizacion.
La concentracion de proteina de las preparaciones de membrana se cuantiIico
utilizando el metodo de BradIord (1976) (Bio-Rad Laboratories).

2.2.2. Electroforesis de proteínas
La electroIoresis de las proteinas se realizo en geles de poliacrilamida al 10 ° en
presencia de SDS al 0,1 ° (SDS-PAGE, Laemmli, 1970). Para la separacion de
peptidos pequeños se utilizo el metodo de SDS-PAGE-Tricina (Schäger y von
Jagow, 1987).
Las proteinas se tiñeron con azul de Coomassie R-250 (Bollag y Edelstein,
1991). Cuando Iue necesaria la utilizacion de un metodo mas sensible, debido a la
baja concentracion de proteinas en el gel, se utilizo el metodo de tincion con plata
(Oakley et al., 1980).
La actividad inhibitoria de los peptidos separados mediante electroIoresis se
ensayo siguiendo el metodo descrito por Bhunia et al. (1987). Para ello, los geles se
lavaron durante 3 h en H
2
O destilada a temperatura ambiente, y posteriormente se
cubrieron con una capa de medio de cultivo (1,2 ° de agar) inoculado con L. lactis
MG1614. Las placas se incubaron durante 16 18 h a 30 ºC.

2.2.3. Marcaje de las PBPs de Lactococcus
En primer lugar se realizo un marcaje general de las PBPs presentes en nuestras
cepas de lactococos, utilizando el reactivo BOCILLIN FL¹ (Molecular Probes) y
segun el metodo descrito por Zhao et al. (1999). Para ello, una preparacion de
membranas conteniendo 300 µg de proteina por muestra se incubo con BOCILLIN
FL a una concentracion Iinal de 50 µM, a 37 ºC durante 30 min. Las proteinas de la
muestra se separaron mediante SDS-PAGE, y las PBPs marcadas se visualizaron
mediante un FluorImager (Molecular Dynamix Storm system, The Molecular
Dinamics, USA) utilizando los parametros de la Iluoresceina (maximo de excitacion
Materiales y metodos 40
495 nm, maximo de emision 520 nm). Los resultados se procesaron utilizando el
programa ImageQuant¹ (The Molecular Dinamics, USA).

2.2.4. Ensayos de competición de lactococina 972 y BOCILLIN FL¹
Las membranas aisladas como se ha descrito anteriormente (300 µg de proteina
por muestra) se incubaron con lactococina 972 puriIicada (concentracion Iinal 400
UA/ml) durante 1 hora a 30 ºC. La suspension se sometio a ultracentriIugacion
(125.000 g, 60 min., 4 ºC) y el sedimento de membranas se resuspendio en el
volumen inicial de muestra utilizando tampon IosIato (50 mM, pH 7,5).
Posteriormente se adiciono BOCILLIN FL (concentracion Iinal 50 µM) y se incubo
durante 30 min a 37 ºC. Las muestras se sometieron a SDS-PAGE, y las PBPs
marcadas se visualizaron de la manera anteriormente descrita.

2.2.5. Obtención y purificación de anticuerpos policlonales
Se obtuvieron anticuerpos policlonales Irente a la lactococina 972 y la PBP3 de
E. coli. En el caso de la lactococina 972 se empleo la bacteriocina puriIicada disuelta
en tampon PBS. La PBP3 se obtuvo despues de sobreexpresar el gen pbpB clonado
bajo el control del promotor P
r
del Iago (Ayala et al., 1988), aislandose la banda
correspondiente a esta proteina (110 kDa) a partir de un gel SDS-PAGE de los
extractos celulares.
Se emplearon conejos machos de la raza Nueva Zelanda de unos 3 meses de
edad y aproximadamente 2,5 kg de peso (Granja Cunicola San Bernardo, S.L.;
Navarra), cuidados y mantenidos durante el ensayo por el Servicio de Animalario de
la Universidad de Oviedo. Los animales Iueron inmunizados cada 15 dias en cada
caso, con aproximadamente 1 mg de proteina mezclado con el mismo volumen de
adyuvante de Freud incompleto (Sigma-Aldrich). Se procedio a su sacriIicio a los 4
meses de inmunizacion mediante anestesia con Nembutal intraperitoneal y posterior
sangrado a muerte por puncion cardiaca. Para comprobar la evolucion de la
inmunizacion se recogio una pequeña Iraccion de sangre, de la vena marginal de la
oreja, a los 2 meses de comenzar el proceso.
Materiales y metodos 41
Los anticuerpos se puriIicaron siguiendo el metodo descrito por Harlow y Lane
(1998, cap. 8) y se almacenaron a -20 ºC hasta su utilizacion.

2.2.ô. Enzyme-linked inmunoabsorbent assay (ELISA)
La cuantiIicacion del suero obtenido en el sangrado intermedio y en el Iinal se
realizo mediante un ensayo ELISA (Harlow y Lane, 1998, cap. 14), utilizando como
antigeno la lactococina 972 puriIicada o extractos totales de E. coli que
sobreexpresan PBP3. Como control negativo de anticuerpos se utilizo suero
preinmune de conejo; como control negativo de antigeno se incluyo seroalbumina
bovina (BSA). Se empleo como sustrato revelador ortoIenildiamina (OPD, Sigma-
Aldrich) y se leyo la absorbancia de las placas a una longitud de onda de 492 nm. El
titulo de cada muestra de suero se expreso como la dilucion maxima cuya
absorbancia es al menos el doble que la misma dilucion de suero control preinmune
de conejo.

2.2.7. Hibridación tipo ~Western¨
Las muestras de proteinas se sometieron a SDS-PAGE como se ha descrito
anteriormente y se transIirieron a membranas Hybond¹ ECL mediante
electroelucion durante 2 horas a 200 mA. Las membranas se bloquearon durante toda
la noche a 4 ºC utilizando leche desnatada en polvo (Sveltesse, Nestle) al 2 ° (p/v).
Las diluciones de los anticuerpos primarios pAblcn972 y pAbPBP3 utilizadas en
los ensayos Iueron de 1:1000. Como anticuerpo secundario se utilizo un anticuerpo
monoclonal anti-IgG de conejo conjugado con peroxidasa (monoclonal anti-rabbit
IgG (-chain speciIic)-Peroxidase, Sigma-Aldrich).
Como sistema de deteccion se utilizo el reactivo ECL¹Plus (Amersham
Pharmacia Biotech), y se siguieron las especiIicaciones del proveedor para la
hibridacion, deteccion y eliminacion de los anticuerpos de la membrana para su
posterior uso con otros anticuerpos primarios.

Materiales y metodos 42
2.2.8. Ensayos con el tripéptido antagonista de la vancomicina:
N-N-diacetil-!-Lys-"-Ala-"-Ala ¡(Ac)2KAA]
Para determinar si el modo de accion a nivel molecular de la lactococina 972 es
similar al del antibiotico vancomicina se utilizo el tripeptido antagonista de la misma
N

-N

-diacetil-!-Lys-"-Ala-"-Ala |(Ac)
2
KAA|. Para ello se siguio el metodo
descrito por Brötz et al. (1995): a cultivos de L. lactis MG1614 creciendo
activamente se les añadieron diIerentes concentraciones de bacteriocina (533 mM 0
mM) que habia sido previamente incubada con un exceso molar de tripeptido (100,
250 y 500). Se midio la OD
600
del cultivo durante las tres horas siguientes.

3. Lactococina 972
3.1. Purificación
Para la puriIicacion de la lactococina 972 se siguio el metodo desarrollado por
Martinez et al. (1996). El sobrenadante de un cultivo de L. lactis IPLA972 en la Iase
exponencial tardia se mezclo con 5 volumenes de acetona a 0 ºC y se incubo durante
un minimo de 30 minutos a -20 ºC. El precipitado obtenido, una vez resuspendido en
tampon IosIato 50 mM, pH 7,0, se paso a traves de una columna de intercambio
cationico (High-S, Bio Rad). Para eluir la bacteriocina se utilizo un gradiente de
NaCl (0,1 2 M) aplicando un Ilujo de 1ml/min, y recogiendose Iracciones de 1 ml.
La concentracion de proteina se determino utilizando el reactivo de BradIord
(1976) (Bio-Rad Laboratories).

3.2. Detección de la actividad inhibitoria
La actividad inhibitoria de los sobrenadantes de cultivo de L. lactis y de las
Iracciones puriIicadas de lactococina 972 se evaluo utilizando el test de diIusion en
agar (Martinez et al., 1996), deIiniendose la unidad arbitraria de bacteriocina
(UA/ml) como el inverso de la dilucion mas alta que origina un halo de inhibicion
perceptible.

Materiales y metodos 43
3.3. Ensayo de inducción de profagos
En este experimento se utilizaron cultivos de L. lactis MG1614 en Iase
exponencial crecidos en medio M17-glucosa, a 30º C. Cuando los cultivos
alcanzaron un valor de OD
600
de 0.2 se dividieron en tres alicuotas, y a dos de las
cuales se les añadio 20 UA/ml y 40 UA/ml (concentracion Iinal) de lactococina 972,
parcialmente puriIicada, continuandose la incubacion en las mismas condiciones
durante tres horas mas. Como control se utilizo la alicuota del cultivo a la que no se
le añadio bacteriocina. Pasado este tiempo se eliminaron las celulas por
centriIugacion. Se hicieron diluciones seriadas de los sobrenadantes y se mezclaron
100 !l de cada una con 3 ml de M17-glucosa (conteniendo 0.7° de agar) Iundido al
que se habian incorporado 100 !l de cultivo exponencial de las cepas L. lactis
IL1403 o L. lactis F4-2. Estas suspensiones se extendieron sobre placas con M17-
glucosa y se incubaron durante 18 horas, pasadas las cuales los cultivos se
inspeccionaron para detectar placas de lisis en los cespedes de las bacterias utilizadas
como hospedadoras. Alternativamente, se tomaron alicuotas de 5 !l de los
sobrenadantes con los que se realizo PCR en las condiciones expuestas en el apartado
2.1.3, utilizando como cebadores dos oligonucleotidos (PA y PB, Tabla 5) cuyas
secuencias limitan un segmento de 381 pb del gen que codiIica para una dUTPasa y
que es el unico comun a todos los aislados de Iagos de la especie P335 de L. lactis
(C. Madera, comunicacion personal). Los amplicones obtenidos se separaron en
geles de agarosa al 2°. Como control positivo de la ampliIicacion se uso ADN del
Iago P335, y como control negativo, la mezcla de reaccion sin adicion de ADN.

4. Producción de la lactococina 972 en biorreactor
4.1. Instrumentación
Los ensayos de Iermentacion, en discontinuo y en continuo, se realizaron en un
biorreactor BIOSTAT B (Braun-Biotech International GmbH) equipado con un vaso
de Iermentacion de 2 litros de capacidad (Figura 7).
El biorreactor dispone de un sistema de agitacion de turbina (modelo Rushton) y
una sonda de temperatura modelo Pt-100. Las sondas de pH (InPro
®
3000/225) y pO
2

Materiales y metodos 44
(InPro
®
600), ambas de la marca Ingold (Metter-Toledo, France), son extraibles. Los
distintos parametros Iueron monitorizados y controlados en una unidad de control.
Esta unidad esta equipada con cuatro bombas peristalticas que regulan
respectivamente la adicion de acido o alcali, de medio de cultivo Iresco desde un
reservorio esteril, y el mantenimiento constante del volumen de trabajo.
En ambos tipos de cultivo se utilizaron los siguientes parametros de reaccion:
temperatura de incubacion 30 ºC y agitacion de 150 rpm. El pH se mantuvo
constante a un valor de 6,8 mediante la adicion de NH
4
OH 2N. Las muestras se
tomaron en condiciones esteriles y se procesaron inmediatamente.

4.2. Cultivo en discontinuo
En este caso no se produce ni adicion de medio ni eliminacion del cultivo del
vaso de Iermentacion del biorreactor. La incubacion se iniciaba inoculando al 2°
(v/v) con un cultivo de una noche de la cepa productora de bacteriocina,
considerando este el tiempo inicial del ensayo. Las muestras se tomaron esterilmente
a los tiempos indicados y se procesaron en el menor tiempo posible.
sistema de agitacion

sonda de pH

sonda de pO
2

reservorio
de acido/base

entrada de O
2
/N
2



jarra de
cultivo reservorio
del medio








reservorio
del eIluente


Figura 7. Representacion esquematica de un quimiostato. Los simbolos son: : Iiltros de
aire;

: bombas peristalticas; : sentido del Ilujo.
Materiales y metodos 45
4.3. Cultivo en continuo
El volumen de trabajo del biorreactor se mantuvo constante mediante el
Iuncionamiento ininterrumpido de una de las bombas peristalticas conectada al tubo
de aspiracion introducido en el vaso de Iermentacion hasta el nivel preIijado del
medio de cultivo (700 ml). El cultivo celular retirado se recogio en un reservorio
esteril reIrigerado (4 ºC), en el que se mantenia para su posterior centriIugacion y
puriIicacion de la bacteriocina producida.
Los ensayos de cultivo continuo se iniciaron en modo discontinuo, inoculando al
2° (v/v) con un cultivo de una noche de la cepa productora de bacteriocina. La
adicion del medio Iresco y retirada del cultivo se inicio cuando se alcanzo la Iase
exponencial de crecimiento. Se tomaron muestras esterilmente a las tasas de dilucion
de 0,09; 0,24; 0,46; 0,67; 0,89 y 1,11 h
-1
, y se procesaron en el menor tiempo posible.
Cada ensayo se realizo por duplicado. Se considero que el cultivo alcanzo el estado
estacionario cuando habian pasado, al menos, tres tiempos de residencia (tres
volumenes de medio de cultivo a traves del vaso de Iermentacion) y ademas se
observaba una OD
600
constante.

4.4. Medida del crecimiento microbiano
Para la determinacion del numero de celulas viables, las muestras de cultivo se
diluyeron en solucion Ringer • (Oxoid) y se sembraron por triplicado y en
proIundidad en medio M17-lactosa (Biokar).
El calculo de la biomasa se realizo determinando el peso seco (X, g
DCW
/L) de
alicuotas de cultivo. Para ello se Iiltraron 4 ml de muestra a traves de un Iiltro de
nitrato de celulosa previamente tarado (0,45 µm de tamaño de poro y 25 mm de
diametro) (Whatman) que se lavo posteriormente con 4 volumenes de agua destilada.
Los Iiltros se secaron a 85 ºC durante 24 h, y se pesaron nuevamente. La diIerencia
entre los dos valores del peso de los Iiltros se tomo como el peso seco de la muestra.
Las muestras se analizaron por triplicado.

Materiales y metodos 46
4.5. Detección de la actividad inhibitoria
La actividad inhibitoria total de los cultivos de L. lactis IPLA 972 se determino
sumando los valores obtenidos en la cuantiIicacion de los sobrenadantes de cultivo
mas los obtenidos al lavar las celulas con tampon IosIato sodico 50 mM, pH 7,
durante un minuto, y utilizando un volumen igual al del cultivo. La actividad
inhibitoria se determino, en ambos casos, mediante el test de diIusion en agar antes
descrito (ver Apartado 3.2.).

4.ô. Cuantificación de ácidos orgánicos y azúcares
La determinacion simultanea de acidos organicos y azucares se realizo mediante
cromatograIia liquida de alta eIicacia (HPLC) utilizando el metodo descrito por
Gonzalez de Llano et al. (1996), con algunas modiIicaciones (Carcoba et al., 2000).
Se utilizo una columna de intercambio ionico HPX-87H Aminex y una precolumna
Microguard H
¹
(Bio-Rad Laboratories). Las condiciones de trabajo Iueron: una
temperatura de 65 ºC y elucion isocratica a un Ilujo de 0,7 ml/min, usando como Iase
movil 3 mM de H
2
SO
4
y un volumen de inyeccion de 50 µl.
Los detectores utilizados Iueron: un detector de Iotodiodos alineados (Waters
996) para la determinacion de acidos organicos y un detector de indice de reIraccion
(Waters 410) para la determinacion de azucares, ambos conectados en serie y
controlados por un sistema de soItware Milenium 2010 (Waters Corporation).
Tanto la cuantiIicacion de azucares como la de acidos organicos se realizo
utilizando el metodo del patron externo.

4.7. Parámetros cinéticos
Los parametros cineticos, asi como sus expresiones y calculo se indican en el
Apartado 6 de la Introduccion (Teoria del cultivo discontinuo y continuo). En este
apartado nos limitaremos a explicar las Iormulas que hemos utilizado para realizar
los calculos.
Materiales y metodos 47
En los ensayos de cultivo discontinuo, la tasa de crecimiento maxima (µ
max
) se
determino de Iorma experimental en la Iase exponencial de crecimiento del cultivo
como:
t
X

max
(9)

donde t es el tiempo y X la concentracion de la biomasa (g/L). El tiempo de
duplicacion (t
D
) se calculo mediante la siguiente expresion:

max
2 ln

D
t (10)

Para calcular el rendimiento en biomasa (Y
X/S
) se aplico la siguiente ecuacion:

S
X
Y
S X

/
(11)

donde S es la concentracion de sustrato (g/L). El calculo de la productividad en
biomasa (p
X
) expresada en g L
-1
h
-1
, se determino utilizando la expresion:

t
X
P
X
(12)

El rendimiento en bacteriocina (Y
B/X
, en AU/g) se deIine como la cantidad de
bacteriocina producida por gramo de biomasa, mientras que la velocidad especiIica
de produccion se expresa como el rendimiento por hora (q
B
, UA g
-1
h
-1
).
Materiales y metodos 48
En los ensayos en cultivo continuo, los parametros cineticos se calcularon en
condiciones de estado estacionario. La productividad en biomasa (p
X
) se calculo
como:
D X P
X
(13)

donde X es el valor de la biomasa cuando se alcanza el estado estacionario y D es la
tasa de dilucion. Las velocidades especiIicas de produccion de bacteriocina (q
B
) se
calculan mediante la Iormula:
X
D AU
q
B

(14)

donde AU son las AU/L del cultivo.

4.8. Análisis estadistico
El analisis estadistico se realizo utilizando el paquete de programas
STATISTICA (ver. 5.5, StatsoIt, Inc., USA).
Los datos relativos a la produccion en biomasa en cultivo continuo se
sometieron a analisis de la varianza de un Iactor (ANOVA).










"#$%&'()*$

Resultados 49
















III. RESULTADOS

"# $%&%$'(&)*%$)+, -(,.')$% /(0
12(&+, /( 0% 0%$'1$1$),% 345
"#"# %6789:9: ;< 8= :<>?<6>9= ;<8 @87:A9;B @C0"
La biosintesis de la lactococina 972 esta codiIicada por un operon que se
encuentra localizado en el plasmido pBL1 (Martinez et al., 1999). Como paso previo
al analisis Iuncional de dicho operon se procedio a la secuenciacion completa del
plasmido (Sanchez et al., 2000). Dicha secuencia ha sido depositada en la base de
datos GeneBank, con el numero de acceso NC¸004955 (Figura 8).
El analisis de la secuencia revelo que el contenido medio en G¹C del plasmido
es del 33 °, siendo este valor similar al encontrado en otros plasmidos de lactococos
(van Kranenburg et al., 2000; Dougherty et al., 1998). Sin embargo, la proporcion de
G¹C no es homogenea en todo el plasmido variando entre el 27 °, que presenta el
gen lclB, y el 40 ° del gen estructural de la lactococina 972 (lclA).
El estudio de la estructura del plasmido revela dos aspectos importantes. En
primer lugar, se observa una asimetria en la distribucion de los sitios de restriccion,
encontrandose la mayoria dentro del operon de la lactococina 972, que comprende
los genes lclA, lclB y lclC, aunque curiosamente no se encuentra dentro de este
ningun sitio de restriccion Sau3AI. En segundo lugar, los genes de este operon junto
con el gen orf4 se encuentran Ilanqueados por dos secuencias de insercion parciales
Resultados 50


(ISS1 y ISS1CH) y una secuencia de insercion completa (ISS1) (Polzin y
Shimizu-Kadota, 1987; Huang et al., 1992), lo que sugiere que este plasmido podria
ser un mosaico generado a partir de la Iusion de dos replicones diIerentes.

"#5# %6789:9: <:DE?>D?E=8 ;<8 B@<EF6 ;< 8= 8=>DB>B>96= 345
Los genes lclA (que codiIica para el prepeptido de lcn972), lclB y parcialmente
lclC ya habian sido identiIicados en estudios anteriores (Martinez et al., 1999). El
analisis posterior de toda la secuencia de nucleotidos de pBL1 nos permitio conocer
la secuencia completa de lclC y comprobar que a continuacion no existia ninguna orf
adicional (Figuras 8 y 9). Delante de las tres orfs se encuentra un unico promotor
Iuncional seguido de dos secuencias invertidas. Ademas, cada orf se encuentra
precedida de un posible sitio de union a ribosoma a la distancia adecuada para
comenzar la traduccion.
pBL1
10897 bps
BglII
NcoI
SacI
EcoRV
HindIII
AvaI
ClaI
PstI
SacI
PstI
HindIII
AvaI
XbaI
XbaI
XbaI
XbaI
ISS1CH
ISS1
orf4
lclA
lclB
lclC
ISS1
ISS1
orfX
repB


Figura 8. Diagrama de pBL1, plasmido de L. lactis IPLA972 que contiene los genes para la
produccion e inmunidad de la lactococina lactococina 972. Numero de acceso a GeneBank
NC¸004955.
Resultados 51
. . . . . .
TCATTTATTCGCCATAAATAACGTTTTTTCGAACTATTTTACTGGACGAAACTAGAGAGTGTCTCAACCA 70

. . . . . .
CGGTCTTTTCGTTTGAATTAACTTTCCGAAAAAGACAAGTTTTCATGAAAATATTAAAAATTCTTTATTC 140

. -35 . -10 . . .
TTCATATATGTGAATATTGACACAAAAAAACAAAAATGATAAAATTATATTTGTAGGCGCTCTCTTGCAT 210

. . . . . rbs .
AGTGAGATGTGCTTATTAATCTCATATTTACTGAGATTAAACTTTTATAATTTATGGAGGATTCTATATG 280
lclA M
. . . . . . .
AAAACCAAGTCTCTCGTATTGGCATTATCTGCGGTTACGTTATTCTCTGCCGGAGGAATTGTAGCTCAAG 350
K T K S L V L A L S A V T L F S A G G I V A Q
. . . . . . .
CTGAAGGAACATGGCAACATGGATATGGTGTTAGTTCGGCATATTCAAATTATCATCATGGTAGCAAAAC 420
A E G T W Q H G Y G V S S A Y S N Y H H G S K T
. . . . . . .
TCATTCAGCCACAGTTGTAAATAATAATACTGGCCGACAAGGTAAGGATACACAACGTGCCGGTGTTTGG 490
H S A T V V N N N T G R Q G K D T Q R A G V W
. . . HindIII . . .
GCAAAAGCTACTGTTGGACGTAACTTAACTGAAAAAGCTTCATTTTATTATAACTTTTGGTAAAATTAAA 560
A K A T V G R N L T E K A S F Y Y N F W *
. . . rbs . . .
AAGCTAAGGCTTAGCTTAGCTTTAGCTTTTTAATAAAGAGGGATTTATATGTATAAAAAACTAGAAAGAG 630
lclB M Y K K L E R
. . . . . . .
TATTAATTACCTTATCTATTGTACTGGTTTCAGCTTTTTCCATGATAATAGTTATTAATAAGCACAAACA 700
V L I T L S I V L V S A F S M I I V I N K H K Q
. . . . . . .
AATGTTTGCTGGTACTAATGGAGGAGTCCTTGTTCTAAAAGCCAAAAGTAACATAAAAGAATCTATAGCT 770
M F A G T N G G V L V L K A K S N I K E S I A
. . . . . . .
GAAATCGCCAAAAAAAATAATGTTCTAATTGCTAAACAAATAATGGTTCCTAGTACGGATGGAAAAACGG 840
E I A K K N N V L I A K Q I M V P S T D G K T
. . . . . AvaI . .
ATAATCAGCCTACATTTCAAAAATTTGGGAACGGAACCCTTCCCAAAGATTTTCCCGAGCAAAAGAATAA 910
D N Q P T F Q K F G N G T L P K D F P E Q K N K
. . . . . . .
AGAATTTATTGAAGATAGTAATGATTCTGTTTACTACTTTATATTTGGAAAAACTTTAAGTTCAATTGAT 980
E F I E D S N D S V Y Y F I F G K T L S S I D
. . . . . . .
TTATCTAAATATTTAAATGAGAAAGGCAATACTTCAATGGTCTCTGATAATGATTGGAGATTTCAAGGAA 1050
L S K Y L N E K G N T S M V S D N D W R F Q G
. . . . . . ClaI .
TTACTGCATTACTTGACACTCGGATGATTGTTGGATTATTGTTATTTCTTATTTCTTACACATCGATATT 1120
I T A L L D T R M I V G L L L F L I S Y T S I L
. . . . . . .
AATGGCTAATATTATAATAAATTTAAAAAAACAAGGTGTTCAACGTTTAGCTGGAATTTCTTGTTTTAGA 1190
M A N I I I N L K K Q G V Q R L A G I S C F R
. . . . . . .
CTATCTTTTTTAGGCCTTAAAAAGCGACTAACTTATATATTTATTACAACAATCATTACTTTATTAACAA 1260
L S F L G L K K R L T Y I F I T T I I T L L T
. . . . . . .
GTAGTTTGATTCTTTACATTATAAATCTCAGAAGAATAATGTATTTTTATGTAATTATTTTTCCAACTAT 1330
S S L I L Y I I N L R R I M Y F Y V I I F P T I
. . . . . . PstI .
ATTTATAGTATTAGTCTTACTTTTGATTGAGTTAATCGTTGGAATTTTAGTTTATTTATTTCTGCAGAGA 1400
F I V L V L L L I E L I V G I L V Y L F L Q R
. . . . SacI . . .
CAAAAAATAAATCTTGTAATAAAAGATATGGCTCCAATAAGAGCTCTAATGAGTTTCGTCTTTTTACTAC 1470
Q K I N L V I K D M A P I R A L M S F V F L L


Resultados 52


. . . . . . .
AATTAATTTCCCTCCTCTGTCTTATTTTTTCTTTTTCAAGCATCAGTTCATCACACAAAGATTTGGTATT 1540
Q L I S L L C L I F S F S S I S S S H K D L V L
. . . . . . .
ATTGAAGAAAGCAACCAATAAATGGAAATCACAAGATTATTATTCTCCTAGTCTATTAAATGGAAATACA 1610
L K K A T N K W K S Q D Y Y S P S L L N G N T
. . . . . . .
GAAAAATCTAAAGAGAATGTATTAAGATTTTTATCTGAAGCGAATCAAAAAGAAGAAGTCTTAATAATTG 1680
E K S K E N V L R F L S E A N Q K E E V L I I
. . . . . . .
CAGATAACTTTAATAAGTATCCATTACAAAACCAATATTTTCCAACCAGCAATGGAAATGAAAATATCCT 1750
A D N F N K Y P L Q N Q Y F P T S N G N E N I L
. . . . . . .
TTATGTAACCCCTAACTATCTAAAGAAAGTTGGAATTAAATTTAATAACACTATGAAAAGTGATATTACT 1820
Y V T P N Y L K K V G I K F N N T M K S D I T
. . . . . . .
ATTTTAGTTCCTGAGACTGAAAAATCGCGTAAAAATAAATTATCAACTTTATGGTCACAAGCATTCAACT 1890
I L V P E T E K S R K N K L S T L W S Q A F N
. . . . . . .
CTTTAAATGAAACATCTTTCAGTTATAATTCTAGCGTTTATAAATCGCCCTCAAAAGACCTATTCACTTT 1960
S L N E T S F S Y N S S V Y K S P S K D L F T F
. PstI . . . . .
CCGCATTTTTGGCTGGTCTGCAGTAGATAATCAGGCATTTGTTCAAGAACCTTTAATTGTCGTTATGTCA 2030
R I F G W S A V D N Q A F V Q E P L I V V M S
. . . . . . .
CCTAAACTCTTTAATATTAACAATAAAAACATTAACAGTGACGTTTTATTTTCTTGGTTTAGTCGTGAAC 2100
P K L F N I N N K N I N S D V L F S W F S R E
. . . . . . .
AAATTTTATTTTCCAATAACAAAACAACAGCAGATTTGATAAAAAAATATAGGTTAGAAAACGTTCTAGG 2170
Q I L F S N N K T T A D L I K K Y R L E N V L G
. . . . . . .
TTCTTTTTCAAATGGAAATTTGTCTGTCAAAAATAGATTTGTAGAAATAAAATCACAACAACTATTTATA 2240
S F S N G N L S V K N R F V E I K S Q Q L F I
. . . . . . .
GTTGTTACCTCAAGTATAGCTTTGATTAGCTCTACATTTTTATTTTATCTTATGAATAAAATCTATCTCT 2310
V V T S S I A L I S S T F L F Y L M N K I Y L
. . . . . . .
ATCAAAATAGAAAAAAATTTGCAGTAGCTCGAATATCTGGCGAGTCTCTGTTTACTACGCATAAAACTTA 2380
Y Q N R K K F A V A R I S G E S L F T T H K T Y
. . . . . . .
CTTAATTCAACTATTCATAATTATTATTTTCGCAATAGGAATGATTTTTATTTGGCACTTAAATCCATTA 2450
L I Q L F I I I I F A I G M I F I W H L N P L
. . . . . . .
ACCCTCATAATTCCTCCAATTTTAGGAGGTTTGCAGCTAATACTTTTAACAAGACAAATAAAAAATAATA 2520
T L I I P P I L G G L Q L I L L T R Q I K N N
. . rbs . . . .
AAACATTTAATATTTCCGTTTTGAAAGGGGAGTAATGTGATTGAATTAAAAAATATTGAAAAATCTTACG 2590
K T F N I S V L K G E *
lclC M I E L K N I E K S Y
. . . . . . .
ATAATCATAATATTTTACATAATTTTAACTACCAATTTAAAGATAATAAAAGTTATGCCTTAGTAGGAAA 2660
D N H N I L H N F N Y Q F K D N K S Y A L V G
. . . . . . .
ATCTGGTTCAGGGAAAACAACACTACTTAATATCATCGGAAGACTAGAACTTCCAGACAAAGGTGATATA 2730
K S G S G K T T L L N I I G R L E L P D K G D I
. . . . . . .
TTGATAGATGATGATAACTTAAAAACAATTCCTGAGAGAAGATACTTCAAAGATTATCTTGGATATTTAT 2800
L I D D D N L K T I P E R R Y F K D Y L G Y L
. . . . . . .
TTCAAAACTATGGTTTAATAGATAACGAGAGTATAAAAGACAATTTAAAATTAGCTTTTATTGGAAAAAA 2870
F Q N Y G L I D N E S I K D N L K L A F I G K
. . . HindIII . . .
GTTAAAAAATCAGGACCAAGAAATTATAATGTCTAAAGCTTTAAGTAAAGTTGGGCTAGAAAATTATAAC 2940
K L K N Q D Q E I I M S K A L S K V G L E N Y N

Resultados 53
. . . . . . .
ATAGATAGAAAAATTTTTTCATTATCCGGAGGAGAAGCGCAACGTGTTGCTATAGCAAAGTTAATTATAA 3010
I D R K I F S L S G G E A Q R V A I A K L I I
. . . . . . .
AAAGTCCACCAATTATTTTGGCTGATGAACCGACAGGTTCATTAGATAGAGAAACTGGAAAAGAAGTGAT 3080
K S P P I I L A D E P T G S L D R E T G K E V
. . . . . . .
GGATATACTTCTAAGTTTAGTTAAGGAAAATACTACTGTTATTATCGCTACGCATGATTCACATGTGTAC 3150
M D I L L S L V K E N T T V I I A T H D S H V Y
. . . . . . .
AATCGTGTAGATTCTATAATTAATCTATAAGAGTTTCACTAAACTTTTTTCGAGGGACGAGAAAAACAAA 3220
N R V D S I I N L *
. . . . . . .
AGAGACGGGTAAACCGTCTTTTTTTGCTTGCTTGGGGTCTGGGGCAAACGCCCCATTTTGCCAACTGAAA 3250

Figura 9. Secuencia del operon de la lactococina 972 y regiones adyacentes. -10 y -35: secuencias
promotoras consenso; : sitio de inicio de la transcripcion; : posicion de secuencias invertidas; rbs:
secuencia consenso de union al ribosoma; : sitio de procesamiento del peptido señal de la
bacteriocina; *: triplete de parada de la traduccion. Se indican las secuencias diana de los enzimas de
restriccion.


Todos estos datos, junto con el hecho de que lclA codiIica para el gen estructural
de la lactococina 972, sugieren que estas tres orfs pueden Iormar el operon que
regularia tanto la sintesis como la inmunidad de la lactococina 972.
Entre el nucleotido de inicio de la transcripcion situado en la posicion -85
(Martinez et al., 1996) respecto al punto de inicio de la traduccion de lclA y el sitio
de union a ribosoma (rbs) de dicha orf aparecen dos secuencias invertidas
parcialmente solapadas que poseen una energia libre (G) de -15 y -20 kcal/mol,
respectivamente (Figura 9). Estas secuencias podrian estar implicadas en procesos de
regulacion de la expresion o bien en la estabilidad del ARNm resultante de la
transcripcion del operon. El estudio de la secuencia de este transcrito, utilizando el
programa MFold, desde su inicio hasta el sitio de union a ribosoma de lclB (nt
numero 598) predice moleculas de ARNm con estructuras secundarias muy estables
(G ~ -100 kcal/mol) (Figura 10). Estas moleculas presentan una serie de
caracteristicas comunes:
1. En el extremo 5` del ARNm, correspondiente a la region que no va a ser
traducida (denominada 5`-UTR, untranslated region), nos encontramos
con una organizacion tipica con varias estructuras en horquilla (dos
como minimo) seguidas de la region de union al ribosoma (Rauhut y
Klug, 1999).
Resultados 54


2. En el extremo 3` del ARNm tambien existe otra region que no participa
en la traduccion (3`-UTR, untranslated region) pero que tambien esta
implicada en la estabilidad del ARNm, aunque en este caso es muy
diIicil distinguir si estas estructuras en horquilla son terminadores de la
transcripcion rho-independientes (Platt, 1986) o estructuras
estabilizadoras del ARNm.
El codon de inicio de la traduccion del gen lclB (AUG) se encuentra precedido
por un posible sitio de union a ribosoma (GAGGGA), y en su extremo 3` (a unos 60
pb desde la señal de parada UGA) encontramos dos secuencias invertidas, de las que
una esta incluida dentro de la otra, que poseen un G de -22 y -16 kcal/mol,
respectivamente.


Figura 10. Dos posibles estructuras secundarias del ARNm de lclA. Con una Ilecha roja se señala el
sitio de inicio de la transcripcion (G). La secuencia consenso de union al ribosoma (rbs) se señala
mediante una Ilecha azul; esta region corresponderia al 5`-UTR (ver texto). La Ilecha verde indica el
lugar del codon de parada y la Ilecha magenta el Iinal del transcrito de ARNm; ambas Ilechas limitan la
region 3`-UTR (ver texto). Los valores de G para ambas estructuras son: A) -104,73 kcal/mol; B) -
105,93 kcal/mol

B)
Resultados 55
El codon de inicio de la traduccion del gen lclC (GUG) esta en pauta con el
codon de parada de lclB. Al igual que en el resto de las orfs esta precedido por un
posible sitio de union al ribosoma (GAAAGGGGAG). Ademas, 40 pb despues de su
codon de parada encontramos dos pares de secuencias invertidas, de las que, sobre
todo la primera, podrian actuar como terminadores rho-independientes, debido a la
cola de uridinas que presenta. Dichas repeticiones invertidas poseen Gs de -4,20 y -
4,10 kcal/mol, respectivamente.
El estudio de la estructura secundaria del ARNm del operon completo de la
lactococina 972 (3086 nt), utilizando el programa MFold, da lugar a mas de 60
estructuras posibles, las cuales presentan valores de G superiores a 600 kcal/mol.

"#G# (:D?;9B ;< 8=: :<>?<6>9=: ;< @EBD<H6=:
"#G#"# LclA
El producto de lclA (lcn972) es un polipeptido de 91 aminoacidos que posee un
sitio de procesamiento en su residuo Ala-25, que ha sido conIirmado mediante la
secuenciacion del peptido maduro (Martinez et al., 1996; Martinez et al., 1999).
En el presente estudio se llevo a cabo el analisis del perIil de hidroIobicidad de
la prebacteriocina, habiendose encontrado dos partes claramente diIerenciadas
(Figura 11A). El extremo amino-terminal, que corresponderia al peptido señal es
predominantemente hidroIobico, mientras que el resto de la molecula es claramente
hidroIilico. Dicho peptido señal contiene todos los elementos necesarios para que la
proteina sea exportada a traves del sistema general de secrecion (SEC) de la celula
(Pugsley, 1993). Asi podem
1. el dominio N, hidroIilico, posee dos aminoacidos cargados
os reconocer en el los tres dominios caracteristicos
(Figura 11B):
positivamente (lisinas),
2. el dominio H, apolar, Iormado predominantemente por residuos
hidroIobicos. Muestra un alto contenido en alanina y leucina, lo que hace
que el peptido señal adopte una estructura de -helice en ambientes
apolares,
Resultados 56


3. el dominio C, menos hidroIobico que el dominio H, y que contiene la
secuencia Ala-X-Ala que es reconocida por la peptidasa del sistema
general de secrecion. Asimismo, al inicio del dominio C aparecen dos
residuos G, los cuales Iorman un giro en la -helice, cuya Iuncion parece
ser la de hacer accesible el sitio de corte del dominio C a la peptidasa
señal.
El peptido maduro posee una longitud de 66 aminoacidos cuyo peso molecular
teorico (7,381 kDa) coincide con el estimado mediante SDS-PAGE-tricina

(Martinez,
1996) y mediante espectrometria de masas (7,383 kDa; Martinez, comunicacion
personal). Como ya hemos señalado antes, el gen lclA presenta el mayor contenido
en G¹C (40 °) de todo el plasmido pBL1, debido a un alto contenido en tripletes que
codiIican para alanina y glicina. La abundancia de estos aminoacidos pequeños es
caracteristico de las bacteriocinas de Clase II y les conIiere un alto grado de libertad


-5
-4
-3
-2
-1
0
1
2
3
4
5
1 91 23 46 69
H
i
d
r
o
I
o
b
i
c
i
d
a
d

Numero de aminoacidos


M K T K L V L A L S A V T L F S A G G I V A Q A

Figura 11. A) PerIil de hidroIobicidad de pre-lcn972. La secuencia se analizo utilizando una ventana
de 6 aminoacidos y el metodo de Kyte y Doolittle (1982). B) Dominios del peptido señal de la
lactococina 972. En amarillo el dominio H, en azul el dominio N y en verde el dominio C. Se muestra
subrayados los aminoacidos que son reconocidos por la peptidasa del SEC.
A)
B)
Resultados 57
conIormacional (Kaiser y Montville, 1996). Ademas, lcn972 es un peptido muy
basico (con un pI teorico de 9,7), otra caracteristica comun a las bacteriocinas de
Clase II, cuyos pIs varian entre 8 y 11,1, aunque a diIerencia de ellas no muestra
regiones claramente hidroIobicas.

"#G#5# LclB
El producto de lclB es una proteina de 648 aminoacidos (74,139 kDa), con un
punto isoelectrico teorico de 9,81. El analisis del perIil hidropatico revela la
presencia de varios segmentos hidroIobicos, lo cual nos indica que posiblemente
LclB sea una proteina de membrana.
Para predecir la topologia de LclB utilizamos cuatro programas diIerentes:
TopPred2, TMpred, HMMTOP ver 2.0. y SOSUI. Tres de estos programas
(TopPred2, TMpred y SOSUI) propusieron siete segmentos transmembrana
(numerados de I VII, Figura 12) mientras que HMMTOP predijo ocho (numerados
de 1 8, Figura 12). Podemos observar que los seis primeros segmentos son casi
identicos, tanto en posicion como en longitud, discrepando los programas en la parte
C-terminal de la molecula. De acuerdo con los programas TopPred2, TMpred y
SOSUI, en esta parte solo existe un segmento transmembrana, aunque en el caso del
programa SOSUI este segmento se encontraria situado en una posicion intermedia
entre los segmentos 7 y 8 predichos por el programa HMMTOP (602 624).
Ademas, los programas TopPred2 y SOSUI predicen que el extremo amino se
encuentra en el exterior de la celula, mientras que los otros dos suponen que se
encuentra en el interior. Esta diversidad de predicciones no es sorprendente puesto
que se ha observado que la topologia de estas proteinas de membrana no es Iacil de
predecir mediante algoritmos, siendo necesaria cierta evidencia experimental
mediante Iusiones con enzimas, como por ejemplo PhoA y LacZ (Franke et al.,
1999).
A la vista de las distintas predicciones, cabria preguntarse ¿cual de todas estas
conIiguraciones es la mas Iactible?. Para obtener una respuesta estudiamos cual de
todas ellas sigue la regla 'positive-inside¨ (von Heijne, 1992), que establece que las
helices transmembrana se distribuyen de tal modo que los lazos de la region
Resultados 58


citoplasmatica tienen mas cargas positivas que los lazos en la zona exterior de la
celula. El resultado de este estudio indica que la conIiguracion mas probable de LclB
es la indicada por el programa TMPred, cuya estructura se representa esquematizada
en la Figura 13.

"#G#G# LclC
La proteina codiIicada por lclC tiene una longitud de 205 aminoacidos (23,160
kDa), con un punto isoelectrico teorico de 6,11. El analisis de la secuencia de
aminoacidos revelo la presencia de los motivos de Walker A (GXXGXGKS/T) y B
(hhhD seguido por DEA/PTSALD o similar), donde X es cualquier aminoacido y h
es un aminoacido hidroIobico (Walker et al., 1982) (Figura 14A). Estos motivos se
I
1 MYKKLERVLI TLSIVLVSAF SMIIVINKHK QMFAGTNGGV LVLKAKSNIK
1
51 ESIAEIAKKN NVLIAKQIMV PSTDGKTDNQ PTFQKFGNGT LPKDFPEQKN

101 KEFIEDSNDS VYYFIFGKTL SSIDLSKYLN EKGNTSMVSD NDWRFQGITA
II
151 LLDTRMIVGL LLFLISYTSI LMANIIINLK KQGVQRLAGI SCFRLSFLGL
III 2 IV
201 KKRLTYIFIT TIITLLTSSL ILYIINLRRI MYFYVIIFPT IFIVLVLLLI
3 V 4
251 ELIVGILVYL FLQRQKINLV IKDMAPIRAL MSFVFLLQLI SLLCLIFSFS
5
301 SISSSHKDLV LLKKATNKWK SQDYYSPSLL NGNTEKSKEN VLRFLSEANQ

351 KEEVLIIADN FNKYPLQNQY FPTSNGNENI LYVTPNYLKK VGIKFNNTMK

401 SDITILVPET EKSRKNKLST LWSQAFNSLN ETSFSYNSSV YKSPSKDLFT

451 FRIFGWSAVD NQAFVQEPLI VVMSPKLFNI NNKNINSDVL FSWFSREQIL
VI
501 FSNNKTTADL IKKYRLENVL GSFSNGNLSV KNRFVEIKSQ QLFIVVTSSI
VII
551 ALISSTFLFY LMNKIYLYQN RKKFAVARIS GESLFTTHKT YLIQLFIIII
6
601 FA AI IG GM MI IF FI IW WH H L LN NP PL LT TL LI II IP PP P I IL LG GG GLQLILL TRQIKNNKTF NISVLKGE
7 8

Figura 12. Localizacion de los segmentos transmembrana de LclB: segmentos predichos por los
programas TopPred2 y TMpred (numerados I-VII); segmentos predichos por el programa HMMTOP
(numerados de 1-8); en negrita se indica la posicion del segmento 7 predicha por SOSUI.
Resultados 59
encuentran altamente conservados en las proteinas que unen ATP-GTP (Fath y
Kolter, 1993).
Ademas de estos motivos, encontramos en LclC una secuencia altamente
conservada (LSGG) denominada ~signature sequence¨ o péptido de unión (Figura
14A), caracteristica de todos los miembros de la superIamilia de transportadores
ABC (Ames et al., 1990; Higgins et al., 1988), cuya Iuncion parece ser la de
transmitir las señales desde el NBD (Nucleotide Binding Domain) al TMD
(TransMembrane Domain) (Borges-Walmsley et al., 2003). Tambien encontramos
en LclC otros dominios o regiones conservadas (Saurin et al., 1999), identiIicadas
mediante comparacion de las posibles estructuras secundarias de algunos modulos
NBD con las estructuras tridimensionales bien conocidas de algunas enzimas que
hidrolizan ATP. Son la región Switch (con un residuo histidina altamente
conservado a una distancia de 25 aminoacidos del motivo Walker B) denominada asi
por analogia con la secuencia en la proteina RecA, y que juega un papel en la
propagacion de los cambios de conIormacion que siguen a la hidrolisis de ATP; y el
dominio helicoidal, con los residuos conservados Q y N, implicados en el transporte
del ATP (Mourez et al., 1997) (Figura 13A y B).


I
II


I
II
I
II

I
I
II
I
II
I
I
I
II
V
VV

V
V
V
V
VV
I
II


V
VV
I
II
I
II
I
II
I
II
I
II

I
II
V
VV

V
VV
I
I
I
I
II
I
II

citoplasma
exterior

Figura 13. Posible representacion de LclB, utilizando las predicciones del programa TMpred.
Resultados 60



"#I# $BA@=E=>9F6 ;< 8=: :<>?<6>9=: ;<;?>9;=:
;< 8=: @EBD<H6=: 0>8 >B6 8=: ;<@B:9D=;=: <6 8=: J=:<: ;< ;=DB:
Con objeto de dilucidar las posibles Iunciones de las proteinas que Iorman parte del
operon de la lactococina 972 procedimos a realizar la busqueda de homologias en las
bases de datos.
LclA muestra muy baja homologia con otras proteinas, sin embargo, LclB y LclC
muestran alta homologia y dominios conservados con otras proteinas, de acuerdo con los
resultados obtenidos por los programas J8=:D@ y E@:J8=:D.
LclA presenta homologia con las proteinas NP¸358194 de St. pneumoniae R6,
NP¸344656 de St. pneumoniae TIGR4, NP¸3741525 y NP¸395555 de S. aureus subsp.
aureus N315 (Figura 15). Todas estas proteinas poseen un tamaño entre 90 y 110
aminoacidos, un posible peptido señal del tipo SEC y, excepto NP¸358194, poseen pIs
A)

MIELKNIEKSYDNHNILHNFNYQFKDNKSYALVGKSGSGKTTLLNIIGRL 50
Walker A
ELPDKGDILIDDDNLKTIPERRYFDYLGYLFGNYGLIDNESIKDNLKLAF 100
IGKKLKNQDQEIIMSKALSKVGLENYNIDRKIFS!"##EAQRVAIAKLII 150
dominio helicoidal ABC-signature
SPPIILADEPTGSLDRETGKEVMDILLSLKENTTVIIATHDSHVYNRVD 200
Walker B región Switch
SIINL 205

B)

Q N H

Figura 14. A) Localizacion de los motivos A y B de Walker (x, cualquier residuo; h residuo
hidroIobico), el peptido de union (LSGG) y los residuos conservados de la region Switch. B)
Dominios y secuencias conservadas en los modulos ABC. El modulo ABC se representa mediante la
linea horizontal, con el extremo amino a la izquierda. Las secuencias consenso se representan
mediante rectangulos: Walker A y Walker B, peptido de union y dominio helicoidal.
Tambien se representan el centro activo (con los residuos de glutamina y asparagina altamente
conservados) en el dominio helicoidal, asi como motivo Switch con el residuo histidina, cerca del
extremo C-terminal.
Resultados 61

A)

66 LclA_-
70 NP_344656_-
74 NP_358194_-
70 NP_371556_-
70 NP_395555_-
.......EGTWQHGYG..VSSAYSNYHHGSKTHSATVVNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW
...VWVEGGQWNYGVGWTGTFGYSDYLHSTRYHTATVR..HGGRTSKDYAKPEAWARASLTKIPPTGMEYFYGFE
.AVQYPDGGVWTYGEGSGGGWAFSNYYHGKKYHYSSIVSRWDGHSDKGEAPAGKTSYAWIWTKWGEQVAFYYDYD
.STEYAEGGTWSHGVG..SKYVWSYYYHGHKGHGATAIGKYRSFSG..YTRAGVKAKASATKHNCWVNRAYYNIY
AATVHVAGGVWSHGIG..KHYVWSYYSHNKRNHGSTAVGKYSSFSG..VARPGVQSKASAPKAWGGNKTFYSLH
G
G
G
G
G
W
W
W
W
W
G
G
G
G
G
G
G
G
G
G
S
S
S
S
S
Y
Y
Y
Y
Y
H
H
H
H
H
H
H
H
H
H
A
A
A
A
A


B)
LclA¸-
NP¸371556¸-
NP¸395555¸-
NP¸358194¸-
NP¸344656¸-
100° 20° 80° 60° 40°


C)

Lcn972 L. lactis IPLA972


NP¸358194 St. pneumoniae R6


NP¸344656 St. pneumoniae TIGR4


NP¸374152/NP¸395555 S. aureus N315





Figura 15. A) Alineamiento multiple de los peptidos relacionados con LclA. NP¸344656: St. pneumoniae
TIGR4; NP¸358194: St. pneumoniae R6: NP¸374152; S. aureus subsp. aureus N315; NP¸39555: S.
aureus subsp. aureus N315. Los aminoacidos comunes a todas las secuencias (100° homologia) se
muestran en negro. Se utilizo el programa DNAman (matriz BLOSUM62).Todos ellos presentan un 49,33
° de identidad. Se muestran sombreados los aminoacidos conservados. B) ° Homologia entre los
diIerentes peptidos. C) Organizacion del entorno de los genes que codiIican para proteinas homologas a
LclA.
Se indica el numero NP de acceso a la base de datos GeneBank de las proteinas homologas a LclA, y la
especie y cepa que contiene los genes. Los genes no estan representados a escala.

LclA; Proteina similar a LclA; LclB; proteñina del COG4562

LclC; proteina del COG1136
LclA
NP¸344656
NP¸358194
NP¸374152
NP¸395555

LclA

NP¸374152

NP¸395555

NP¸358194

NP¸344656
LclA

NP¸374152

NP¸395555

NP¸358194

NP¸344656

66 LclA_-
70 NP_344656_-
74 NP_358194_-
70 NP_371556_-
70 NP_395555_-
.......EGTWQHGYG..VSSAYSNYHHGSKTHSATVVNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW
...VWVEGGQWNYGVGWTGTFGYSDYLHSTRYHTATVR..HGGRTSKDYAKPEAWARASLTKIPPTGMEYFYGFE
.AVQYPDGGVWTYGEGSGGGWAFSNYYHGKKYHYSSIVSRWDGHSDKGEAPAGKTSYAWIWTKWGEQVAFYYDYD
.STEYAEGGTWSHGVG..SKYVWSYYYHGHKGHGATAIGKYRSFSG..YTRAGVKAKASATKHNCWVNRAYYNIY
AATVHVAGGVWSHGIG..KHYVWSYYSHNKRNHGSTAVGKYSSFSG..VARPGVQSKASAPKAWGGNKTFYSLH
E
G
G
G
G
G
G
G
G
G
W
W
W
W
W
H
H
H
G
G
G
G
G
G
G
G
G
G
S
S
S
S
S
Y
Y
Y
Y
Y
H
H
H
H
H
G
S
G
G
K
R
K
K
R
H
H
H
H
H
A
A
A
T
T
T
T
V
V
I
V
G
G
G
S
S
S
S
S
G
S
D
G
G
K
K
K
A
A
A
R
K
R
R
A
P
A
A
P
G
E
G
G
G
V
V
V
A
A
A
K
R
K
K
A
A
A
A
A
S
S
S
R
K
K
K
F
Y
F
F
Y
F
Y
Y
Y
Y
Y
Y
Y
Figura 15. A) Alineamiento multiple de los peptidos relacionados con LclA. NP¸344656: St.
pneumoniae TIGR4; NP¸358194: St. pneumoniae R6; NP¸374152 y NP¸39555: S. aureus subsp.
Aureus N315. Los aminoacidos comunes a todas las secuencias (100° homologia) se muestran en
negro; en rosa los que presentan una homologia del 75°; y en azul 50° de homologia. Se utilizo el
programa DNAman (matriz BLOSUM62). Todos ellos presentan un 49,33° de identidad. B) ° de
homologia entre los diIerentes peptidos. C) Organizacion del entorno de los genes que codiIican para
proteinas homologas a LclA.
Se indica el numero NP de acceso a la base de datos GeneBank de las proteinas homologas a LclA, y la
especie y cepa que contiene los genes. Los genes no estan representados a escala.

LclA; proteina similar a LclA;

LclB; proteina del COG4562;

LclC; proteina del COG1136.
Resultados 62


teoricos muy basicos (mayores de 9), y perIiles de hidroIobicidad muy parecidos a LclA
(datos no mostrados). El alineamiento de sus secuencias (Figura 15A) muestra una
identidad del 49,33 °. Se observan dos secuencias consenso: G-X-W-X
2
-G-G y S-X-Y-
X-H-X
4
-H en el extremo amino de las proteinas maduras. La busqueda de patrones
similares mediante el programa ScanProsite no proporciono ningun resultado
concluyente. En la Figura 15B se muestra el grado de homologia entre las diIerentes
proteinas. LclA se parece mas a las proteinas de S. aureus (35 °) que a las de St.
pneumoniae (32 °), a pesar de que la cepa productora de lactococina 972 esta mas
relacionada Iilogeneticamente con esta ultima especie.
Al analizar el entorno genetico de estas proteinas dentro de los genomas de los
microorganismos (Figura 15C) observamos que preceden a una proteina integral de
membrana (con 7 segmentos transmembrana) seguida de una proteina de union a ATP.
Es decir, tienen la misma organizacion genetica que el operon de la lactococina 972. Un
estudio detallado de estas proteinas de membrana revelo que pertenecian al COG numero
4652 (COG4652), en el cual tambien esta incluida la proteina LclB.
Todas las proteinas pertenecientes al COG4562 tienen una longitud de entre 644 y
713 aminoacidos. El alineamiento multiple de sus secuencias indica que poseen una
identidad del 35,9 ° en su parte carboxi-terminal (136 146 aminoacidos) (Figura 16).
El alineamiento de esta region muestra una secuencia altamente conservada: Y-F-X
3
-(R,
K)
2
-X-(L, I, F)-X-(I, V, L)-(K, R)
2
-(L, I)-X-G, donde el aminoacido glicina esta presente
de Iorma invariable en todas las secuencias. Esta secuencia posee una proporcion de
aminoacidos hidroIilicos del 37,5 ° (de los cuales el 25 ° poseen carga positiva a pH 6,0
y el resto son neutros) y una proporcion del 25 ° de aminoacidos hidroIobicos. Ademas,
esta secuencia consenso se encontraria localizada entre los segmentos transmembrana 6 y
7, en el interior celular. La busqueda de patrones utilizando el programa ScanProsite no
proporciono ningun resultado.
La proteina LclC posee homologia con un elevado numero de proteinas de union
a ATP, y en particular con las pertenecientes a la Iamilia de los transportadores de
tipo ABC. Esta proteina se encuentra incluida en los COG1136 y COG2884.
El COG1136 agrupa a todas las proteinas de union a ATP que Iorman parte de
los transportadores de tipo ABC y que estan implicadas en el transporte de peptidos
Resultados 63
antimicrobianos. En la Figura 17A se representa el alineamiento de estas secuencias
que presenta una identidad del 57,79 °. La proteina representativa de este COG es
SalX que Iorma parte del transportador de la salivaricina A. Estos sistemas de
transporte no poseen componentes periplasmaticos. Ademas, el dominio de union a
ATP se encuentra Iusionado con el dominio transmembrana en la mayoria de los
sistemas.
En el COG2884 se encuentran incluidas las proteinas FtsE (o relacionadas con
ella). FtsE es una proteina hidroIilica que une ATP (ATPasa) que se asocia a la
563 LclB
626 NP_241146
577 NP_266165
574 NP_268176
606 NP_344657
587 NP_345191
169 NP_346383
591 NP_346415
587 NP_358195
569 NP_371557
569 NP_374153
559 NP_395556
NKTTADLIKKYRLENVLGSFSNGNLSVKNRFVEIKSQQLFIVVTSSIALISSTFLFYLMN
YEHYLPLLRDLQLDDNAKHLVTVNEQAQKDISEIQRALTLDTILFVLTATIALFMIVQSS
YQPLIPILKKNSALETHPSMIKIDDISKTDNLSTVGNPYNYAVTNGLVILIFLSMILTTT
KEQTLNRLKELGLYDKVHYLVNAYGQYEAQTNLVKESLSMAIISAIITIIVISFFYILLH
EITELVEKLSDGNYLKFSSIQAIQ...QEKVDSYRDAVRNFNLLFALFGLLSMMISYFLL
YESGLELLKKAGIYEQVSYLKEGRSVYLTRYNEVQTETATLILGAIVGIASSLLLFYSVN
LSDAQELIQRQGIENWVSEMQTGYHNYITLLDNIQRERWVMLAGAVLGIATSILLFNTMN
YGDSITALKEKGLYHKVSYLVKSQLFFAKVLNDKRVEFYSLLIGTILTLSTAILLFDSMN
YESGLELLKKAGIYEQVSYLKEGRSVYLTRYNEVQTETATLILGAIVGIASSLLLFYSVN
YDALVKNIENYHLDGEISGITNYKDSVMEMYHENNLKLTVLNFSQIIIAIILIIIILFDV
YDALVKNIENYHLDGEISGITNYKDSVMEMYHENNLKLTVLNFSQIIIAIILIIIILFDV
LDTLKQLLKDNHLEEEISGITNYKDSVLNELNETKTKMIITIVTIIINVFILLIATVFET
Y
Y
Y
Y
Y
Y
Y
L
L
I
L
L
L
L
I
L
L
L
L
I
L
L
I
I
L
K
R
K
K
K
K
K
K
S
G
G
G
G
G
G
L
L
L
I
I
L
I
L
L
L
G
S
S
S
S
S
S
S
S
E
E
E
N
D
E
E
E
E
V
I
I
V
I
I
I
I
I
619 LclB
684 NP_241146
634 NP_266165
631 NP_268176
666 NP_344657
644 NP_345191
226 NP_346383
648 NP_346415
644 NP_358195
629 NP_371557
629 NP_374153
619 NP_395556
KIYLYQNRKKFAVARISGESLFTTHKTYLIQLFIIIIFAIGMIFIWHLN....PLTLIIP
HLLFAQHKKRFLLRRLFGHSLFRAYRNVLFWTLATWVVILG..IALYRHSGTQYLAIVVL
VFYFETYKKKIAVKRLYG...ISFFVTYKTLFAIVLVQGSLYFAFALSQRDVNITLEGLG
VLYFTHFRRTIVIKFISGMPNLRIHRRFIFVELGLLLILLPTLTIISN...EFLYSLFVV
VTTFLLKRRDIITKKFMGWKLVDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPLLLFAGFT
LLYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGASLFILSSR...DLVIGLLTL
RLYFEEFRRAIFIKRIAGLRFLEIHRTYLFAQLGVFLLG...FVASVFLQVEIGVAFLVL
LLYFEQFRRELMIKRLAGMTIYELHGKYLLAQGGVLLLG...LVLSSILTRDGLISALVV
LLYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGASLFILSSR...DLVIGLLTL
KYYFEQHRKLLVIKKLYGYSTLRANYQYLLINNIVVVFIGILTNVILHSQYIMMIFATIL
KYYFEQHRKLLVIKKLYGYSTLRANYQYLLINNIVVVFIGILTNVILHSQYIMMIFATIL
IQYFSWNKKQLLLRKIHGYSLFSSNVRYLTISILLSIMLAYTTHILFGSKILLFIIMSIA
I
L
F
L
L
L
L
L
Y
Y
Y
Y
Y
Y
Y
Y
Y
Y
L
F
F
F
F
F
F
F
F
F
F
F
E
E
E
E
E
E
E
Q
Q
H
Q
E
Q
Q
Q
Q
R
K
K
R
R
R
R
R
R
R
R
K
K
K
K
R
R
R
R
R
R
K
K
K
F
F
I
I
I
I
I
L
I
L
L
L
V
L
V
I
I
I
I
I
I
I
L
R
K
K
K
K
K
K
K
K
K
R
R
R
R
K
R
R
R
R
K
K
K
I
L
L
I
F
I
I
L
I
L
L
I
G
G
G
G
G
G
G
G
G
G
G
G
H
H
H
H
H
H
N
N
N
Y
Y
F
Y
Y
Y
Y
Y
Y
Y
L
L
I
L
M
L
L
M
L
L
L
I
V
V
L
V
L
L
V
V
V
I
F
I
F
F
L
L
F
F
F
L
L
L
I
V
I
I
I
I
I
L
V
L
L
V
L
L
L
648 LclB
713 NP_241146
663 NP_266165
660 NP_268176
694 NP_344657
673 NP_345191
255 NP_346383
677 NP_346415
673 NP_358195
654 NP_371557
654 NP_374153
644 NP_395556
PILGGLQLILLTRQIKNNKTFNISVLKGE
VLFLTEVVVTSVVLMRLEQKNKVSVLKGE
IYFVLEILIIILILLKLQKGLFLNVLKGE
SALWFISLIILLVQMKNFENGQINSLKGE
CLDILFVLGLASRMEKRS...LVELLKGGIL
LVFLASAVLTLYRQAQKESRVSMTIMKGK
LLFTGLSLLQLHVQMQKENKMSMLVLKGG
ALFTLNALLILVRQDKKEEAGSMAVLKGK
LVFLASAVLTLYRQAQKESRVSMTIMKGK
VVQILLQICSLYYHGRRFNEVIKEF
VVQILLQICSLYYHGRRFNEVIKEF
IIQHLLQIAYIKYLEKYFKDLMREI
L
F
F
L
F
F
F
F
L
F
L
L
L
L
L
L
V
L
L
L
V
L
L
V
I
I
I
L
I
L
L
L
L
L
L
L
I
Q
Q
Q
Q
Q
Q
H
H
K
R
K
K
K
K
R
R
K
L
L
L
L
L
M
L
L
M
K
K
K
K
K
K
K
K
K
G
G
G
G
G
G
G
G
G


Figura 16. Alineamiento multiple del extremo carboxi-terminal de las proteinas pertenecientes al
COG4562. B. halodurans; NP¸268176: L. lactis IL1403; NP¸345191, NP¸ 346283 y NP¸346415:
St. Pneumoniae TIGR4; NP¸374153 y NP¸395556: S. aureus N3115; NP¸371557: S. aureus
Mu50; NP¸358195: St. Pneumoniae R6.
Las secuencias tienen una identidad del 35,9 °. Los aminoacidos conservados (100 ° homologia)
se muestran sombreados en negro; en rosa los que presentan una homologia del 75 °; y en azul
de 50 ° de homologia. Se utilizo el programa DNAman (matriz BLOSUM62).
Resultados 64


A)
75 LclC
75 NP_268175
73 NP_241147
76 NP_266166
73 NP_395558
76 NP_345192
74 NP_346384
75 NP_346414
73 NP_374155
MIELKNIEKSYDN....HNILHNFNYQFKDNKSYALVGKSGSGKTTLLNIIGRLELPDKGDILIDDDNLKTIPERRYFK.
MFELTNIIKEFLH....RKVFDNFKLTFEAGKVYAIIGQSGSGKTTLLNMIAKLESYE.GSILYEGKELSKIKKHSYFLN
MIKLENVFVKKGN....KNILDGCNFNFEKGKSYALVGESGAGKSTLLNIIAGFEDVS...QGSIYIEDKLLKKKVDFYR
MIEIEELTKSYKG....HIIFDKLNLRIPEGKMTAIYGTSGAGKSTLLNIIGLIEDYDDGKYYFNGQFAPPFNSSLALKM
MIKLENVFVKKGN....KNILDGCNFNFEKGKSYALVGESGAGKSTLLNIIAGFEDVS...QGSIYIEDKLLKKKVDFYR
MIELKNISKKFGS....RQLFSDMNLHFEGGKIYALIGTSGCGKTTLLNMIGRLEPYDKGQIIYDGTSLKDIKPSVFFRD
MIELKQVSKSFGE....RELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYD.GTIFYRGKDLANYKSSDFFR.
MIDIQGLEKKFND....RAIFSGLNLKLEKGKVYALIGKSGSGKTTLLNILGKLEKIDGGRVLYQGKDLKTIPTREYFR.
MIELKDLTIQKGN....IHILKKLNLKFQCGKSYALIGKSGCGKSTLLNTIAGLEKTG...KQYVYFNGQLEQFKSNFYR
M
M
M
M
M
M
M
M
M
I
F
I
I
I
I
I
I
I
E
E
E
E
E
D
E
L
L
L
I
L
L
L
I
L
N
N
N
E
N
N
D
K
K
K
K
K
K
D
G
G
G
G
G
I
V
I
I
I
L
L
I
I
L
F
L
F
L
F
F
F
L
N
N
N
N
N
N
N
L
F
L
F
L
M
L
L
F
F
F
I
F
F
F
L
F
E
E
E
E
E
E
Q
G
G
G
G
G
G
G
G
K
K
K
K
K
K
K
K
K
Y
Y
Y
Y
Y
Y
Y
Y
A
A
A
A
A
A
A
A
A
L
I
L
I
L
L
L
L
L
V
I
V
V
I
I
I
I
G
G
G
G
G
G
G
G
G
S
S
S
S
S
S
S
S
S
G
G
G
G
G
G
G
G
G
G
G
G
G
G
G
G
G
G
K
K
K
K
K
K
K
K
K
T
T
T
T
T
T
T
T
T
T
T
T
T
T
L
L
L
L
L
L
L
L
L
L
L
L
L
L
L
M
L
L
N
N
N
N
N
N
N
N
N
I
M
I
I
I
M
M
I
I
I
I
I
I
I
I
L
I
G
A
A
G
A
G
G
G
A
L
L
F
I
F
L
L
L
L
E
E
E
E
E
E
E
E
E
D
E
D
D
D
D
G
G
G
G
G
G
G
Y
F
Y
Y
Y
Y
D
G
G
G
G
G
L
L
L
L
L
K
K
K
K
K
K
K
K
K
K
F
F
F
L
F
F
F
F
F
151 LclC
150 NP_268175
147 NP_241147
153 NP_266166
147 NP_395558
151 NP_345192
150 NP_346384
151 NP_346414
148 NP_374155
..DYLGYLFQNYGLIDNESIKDNLKLAFIGKKLKNQDQ.EIIMSKALSKVGLENYNI.DRKIFSLSGGEAQRVAIAKLII
..D.LSYLFQNFGLIENETIDKNLDLGLINHKLSKKTKQEK.KLETLAQVNVAYLKL.NQKIYELSDGEAQRVALAKAIL
..YTLGYLFQNFALLENQTISQNLDLALKFKKN.KKDN.MNLKKEVLKKVGLDLDIK..RIVSSLSGGEQQRVALARLIL
RRNKISYLFQNFALLEDETIEKNLEIALIYSRISKKEK.RKKMKKLLLQVGINHRLN..TKVYSLSGGEKQRVAIARALL
..YTLGYLFQNFALLENQTISQNLDLALKFKKN.KKDN.MNLKKEVLKKVGLDLDIK..RIVSSLSGGEQQRVALARLIL
..Y.LGYLFQDFGLIESQTVKENLNLGLVGKKLKEKEKISL.MKQALNRVNLSYLDL.KQPIFELSGGEAQRVALAKIIL
..HELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQ.RLRQKQALEQVGLVYLDLDKR.IFELSGGESQRVALAKIIL
..DQMGYLFQNFGLLENQSIKENLDLGFVGQKISKVERLER.QVGALEKVNLGYLDL.EQKIYTLSGGEAQRVALAKTIL
..DKLGYLFQNYGLIDNLTVNENLDIGLAYKKISKKEK.EQLKIRYIEQFGLSNSLK..RKVHTLSGGEQQRVALIRMML
L
L
L
I
L
L
L
M
L
G
S
G
S
G
G
G
G
G
Y
Y
Y
Y
Y
Y
Y
Y
Y
L
L
L
L
L
L
L
L
L
F
F
F
F
F
F
F
F
F
Q
Q
Q
Q
Q
Q
Q
Q
Q
N
N
N
N
N
D
N
N
N
Y
F
F
F
F
F
F
F
Y
G
G
A
A
A
G
G
G
G
L
L
L
L
L
L
L
L
L
I
I
L
L
L
I
I
L
I
D
E
E
E
E
E
E
E
D
N
N
N
D
N
N
N
N
E
E
Q
E
Q
Q
Q
Q
T
T
T
T
T
T
I
I
I
I
I
V
I
I
V
N
N
N
N
N
N
N
N
N
L
L
L
L
L
L
L
L
L
D
D
E
D
N
D
D
L
L
L
I
L
L
L
L
I
A
G
A
A
A
G
G
G
G
F
L
L
L
L
L
L
F
L
K
K
K
K
K
K
K
K
R
K
K
K
K
K
S
S
S
S
S
K
K
K
K
R
K
K
K
K
K
K
K
K
D
D
E
D
E
E
E
E
K
K
K
K
K
L
L
L
L
L
L
L
L
I
V
V
V
V
V
V
V
V
G
G
G
G
G
G
L
V
L
I
L
L
L
L
L
R
R
R
R
R
K
K
K
K
K
I
I
V
V
V
I
I
I
V
L
L
L
L
L
L
L
L
L
S
S
S
S
S
S
S
S
S
G
D
G
G
G
G
G
G
G
G
G
G
G
G
G
G
G
G
E
E
E
E
E
E
E
E
E
Q
Q
Q
Q
Q
Q
Q
Q
Q
R
R
R
R
R
R
R
R
R
V
V
V
V
V
V
V
V
V
A
A
A
A
A
A
A
A
A
I
L
L
I
L
L
L
L
L
A
A
A
A
A
A
A
A
K
K
R
R
R
K
K
K
R
I
I
I
L
I
I
I
I
M
I
L
L
L
L
L
L
L
L
207 LclC
208 NP_268175
208 NP_241147
211 NP_266166
208 NP_395558
213 NP_345192
210 NP_346384
213 NP_346414
213 NP_374155
KSPPIILADEPTGSLDRETG.KEVMDILLSLVKENTTVIIATHDSHVYNRVDSIINL
KDSPVILADEPTAALDSENS.EEVMKLLLSMKNENRIIIIATHNPVIWEMADEVVELSR
KDPKIILADEPTGSLDTKNG.KIVIDLLLKLLDENKTMIVVTHDLELAKRFDVIVNISELRS
KESQLILADEPTGSLDTENR.NEVIALLRQEVDKGKAVVIVTHDSYLKEVSDLVIEIGE
KDPKIILADEPTGSLDTKNG.KIVIDLLLKLLDENKTMIVVTHDLELAKRFDVIVNISELRS
KDPPLILADEPTASLDPKNSEELL.SILESLKNPNRTIIIATHNPLIWEQVDQVIRVTDLSH.R
KNPPFILADEPTASIDPATS.QLIMEILLSLRDDNRLIIIATHNPAIWEMADEVF..T.MDHLK
KNPPLILADEPTAALDPENS.EEVMNLLVDLKDENRIIIIATHNPLVWNKADEIIDMRKLAHV
KDPIVMLADEPTGALDPKTG.QMIIQSLFDLVDENKVLILATHDMAIANQCDEIIDLEQYSKVASM
K
K
K
K
K
K
K
K
K
D
D
E
D
D
N
N
D
P
P
P
P
P
P
P
P
P
P
P
P
I
I
I
I
I
I
I
I
M
L
L
L
L
L
L
L
L
L
A
A
A
A
A
A
A
A
A
D
D
D
D
D
D
D
D
D
E
E
E
E
E
E
E
E
E
P
P
P
P
P
P
P
P
P
T
T
T
T
T
T
T
T
T
G
A
G
G
G
A
A
A
G
S
S
S
S
S
S
L
L
L
L
L
L
I
L
L
D
D
D
D
D
D
D
D
D
N
N
N
N
N
N
V
V
V
V
V
L
I
V
I
I
L
L
L
L
I
I
L
L
L
L
L
L
L
L
L
L
L
L
L
L
L
V
F
L
M
L
L
L
L
L
L
N
D
D
D
N
D
D
D
E
E
E
E
D
E
E
N
N
N
N
N
N
N
N
I
I
I
V
I
I
I
I
I
I
I
V
I
V
I
I
I
L
A
A
A
A
A
A
T
T
T
T
T
T
T
T
T
H
H
H
H
H
H
H
H
H
D
N
D
D
D
N
N
N
D
D
D
D
D
D
D
D
D
D
I
V
I
V
I
V
V
I
I
I
V
V
I
V
I
F
I
I



B)
73 LclC
76 ftsE_Lisinn
76 fstE_NeisMenin
76 ftsE_BacSub
78 ftsE_IL1403
77 ftsE_MycoTub
78 ftsE_StpyM1GAS
78 fysE_StpnTIGR4
..MIELKNIEKSYDN..HNILHNFNYQFKDNKSYALVGKSGSGKTTLLNIIGRLELPDKGDILID.DDNLKTIPER..RY
M..ILMEDVYKKYPN.GITAANGLNINIGEGEFVYVVGPSGAGKSTFIKMIYREERATKGKIIVD.KFDLINMKNREIPY
..MIRFEQVSKTYPG.GFEALKNVSFQINKGEMIFIAGHSGSGKSTILKLISGITKPSRGKILFN.GQDLGTLSDNQIGF
M..IEMKEVYKAYPN.GVKALNGISVTIHPGEFVYVVGPSGAGKSTFIKMIYREEKPTKGQILINHK.DLATIKEKEIPF
MSIIKLSNVSKKYSN.GTTALRNISLEIEPGEFTYIVGPSGAGKSTFIKLLYRELKIDRGSGTVA.QYDLSKLKRRDVPM
..MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDVRVS.KFHVNKLRGRHVPK
MALIEMSGVTKKYRR.STTALRDVNVSVNQGEFVYLVGPSGAGKSTFIKLLYREEQLTTGKLYVG.EFNLTKLKARDVPI
MSIIEMRDVVKKYDN.GTTALRGVSVSVQPGEFAYIVGPSGAGKSTFIRSLYREVKIDKGSLSVA.GFNLVKIKKKDVPL
M
M
M
M
M
I
I
I
I
I
I
I
I
E
E
E
E
L
M
M
L
L
M
M
I
V
V
V
V
V
V
V
K
K
K
K
K
K
K
K
K
K
K
K
Y
Y
Y
Y
Y
Y
Y
Y
N
N
N
N
N
G
G
G
G
A
S
G
T
T
T
T
A
A
A
A
A
A
A
L
L
L
L
L
L
L
N
N
N
N
I
V
L
V
V
V
F
I
I
I
I
I
V
V
G
G
G
G
G
G
G
E
E
E
E
E
E
E
F
F
F
F
F
F
V
I
V
V
V
Y
F
Y
Y
F
Y
Y
V
V
V
V
I
V
V
G
G
G
G
G
G
G
G
P
P
P
P
P
P
S
S
S
S
S
S
S
S
G
G
G
G
G
G
G
G
A
A
A
A
A
G
G
G
G
G
G
G
G
K
K
K
K
K
K
K
K
S
S
S
S
S
S
S
T
T
T
T
T
T
T
T
L
F
I
F
F
F
F
F
L
I
L
I
I
M
I
I
K
K
K
K
R
K
R
I
M
L
M
L
L
L
I
I
I
I
L
L
L
L
Y
Y
Y
Y
Y
R
R
R
R
R
R
E
E
E
E
E
E
E
E
E
E
R
K
K
K
K
P
A
P
P
P
T
T
T
T
K
K
R
K
R
K
G
G
G
G
G
G
G
G
I
I
I
I
V
L
L
I
V
I
V
V
V
V
F
Y
F
F
F
N
D
D
D
D
N
N
L
L
L
L
L
V
L
L
K
K
K
K
I
M
L
I
L
L
L
I
K
K
K
R
K
K
R
R
K
R
R
R
K
I
I
I
V
V
V
V
P
P
P
P
P
P
150 LclC
152 ftsE_Lisinn
152 fstE_NeisMenin
152 ftsE_BacSub
154 ftsE_IL1403
153 ftsE_MycoTub
154 ftsE_StpyM1GAS
154 fysE_StpnTIGR4
FKDYLGYLFQNYGLIDNE..S.IKDNLKLAFIGKKLKNQDQEIIMSKALSKVGLENYNIDRKIFSLSGGEAQRVAIAKLI
LRRNVGVVFQDYKLLQSK.TVYENIAYAMEVV..ETEPTVIKERVMEVLDLVNLKHK.VRMLPDELSGGEQQRISIARSI
MRQHIGIVFQDHKILYDR.NVLQNVILPLRIIG.Y.PPRKAEERARIAIEKVGLKGR.ELDDPVTLSGGEQQRLCIARAV
VRRKIGVVFQDFKLLP.KLTVFENVAFALEVIG.E.QPSVIKKRVLEVLDLVQLKHK.ARQFPDQLSGGEQQRVSIARSI
LRRSVGVVFQDYKLLPKK.TVFENISYAMEVIG.K.SPREIKKRVNEVLDLVGLKHK.IRSFPNELSGGEQQRVAIARSI
LRQVIGCVFQDFRLLQQK.TVYDNVAFALEVIG.K.RTDAINRVVPEVLETVGLSGK.ANRLPDELSGGEQQRVAIARAF
LRRHIGVVFQDYKLLPRK.TVFENVAYAMEVIG.E.KRRHIKKRVPEVLDLVGLKHK.MRSFPSQLSGGEQQRVAIARAI
LRRSVGVVFQDYKLLPKK.TVYENIAYAMEVIG.E.NRRNIKRRVMEVLDLVGLKHK.VRSFPNELSGGEQQRIAIARAI
F
L
M
V
L
L
L
L
K
R
R
R
R
R
R
R
R
R
R
R
R
L
V
I
I
V
I
I
V
G
G
G
G
G
G
G
G
V
I
V
V
V
V
L
V
V
V
V
V
V
V
F
F
F
F
F
F
F
F
Q
Q
Q
Q
Q
Q
Q
Q
N
D
D
D
D
D
D
D
Y
Y
F
Y
F
Y
Y
K
K
K
K
R
K
K
L
L
I
L
L
L
L
L
I
L
L
L
L
L
L
L
P
P
P
P
K
R
K
K
K
K
K
T
T
T
T
T
T
V
V
V
V
V
V
V
E
Q
E
E
D
E
E
N
N
N
N
N
N
N
I
V
V
I
V
V
I
A
A
A
A
A
Y
F
Y
F
Y
Y
A
P
A
A
A
A
A
L
M
L
L
M
L
M
M
E
E
E
E
E
E
V
I
V
V
V
V
V
I
V
I
I
I
I
I
I
G
G
G
G
G
G
G
E
E
E
E
P
P
P
P
R
R
R
R
I
I
I
I
I
I
K
K
K
K
K
R
R
R
R
R
R
M
V
V
V
V
V
V
E
E
E
E
E
E
V
V
V
V
V
V
L
L
I
L
L
L
L
L
D
E
D
D
E
D
D
L
L
L
L
L
V
V
V
V
V
V
V
V
G
G
G
G
G
G
L
L
L
L
L
L
L
L
K
K
K
K
K
K
N
H
H
H
H
H
K
R
K
K
K
K
K
R
R
R
R
R
L
F
F
L
F
F
P
P
P
P
P
P
P
E
Q
E
E
Q
E
L
L
L
L
L
L
L
L
S
S
S
S
S
S
S
S
G
G
G
G
G
G
G
G
G
G
G
G
G
G
G
G
E
E
E
E
E
E
E
E
Q
Q
Q
Q
Q
Q
Q
Q
Q
Q
Q
Q
Q
Q
Q
R
R
R
R
R
R
R
R
V
I
L
V
V
V
V
I
A
A
A
A
A
I
I
I
I
I
I
I
I
A
A
A
A
A
A
A
A
K
R
R
R
R
R
R
R
A
A
A
A
I
I
V
I
I
F
I
I
207 LclC
228 ftsE_Lisinn
216 fstE_NeisMenin
228 ftsE_BacSub
230 ftsE_IL1403
229 ftsE_MycoTub
230 ftsE_StpyM1GAS
230 fysE_StpnTIGR4
IKSPPIILADEPTGSLDRETGKEVMDILLSLVK.ENTTVIIATHDSHVYN....RVDSIINL
ANMPKVLIADEPTGNLDPDTSWEIMNILEEISN.RGTTIVMATHNKEIVNTLKHRVVAIENGRIVRDEQQGEYG.YEI
VHQPGLLIADEPSANLDRAYALDIMELFKTF.HEAGTTVIVAAHDETLMADYGHRILRLSKGRLA
VNNPDVVIADEPTGNLDPDTSWEVMKTLEEINN.RGTTVVMATHNKEIVNTMKKRVIAIEDGIIVRDESRGEYGSYD
ANAPKVLIADEPTGNLDPENSWEIMNLLEKI.NLQGTTILMATHNSQIVNTLKHRVIAIENGRIVRDQEEGVYG.YDD
VNRPLVLLADEPTGNLDPETSRDIMDLLERI.NRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEQRGVYGMDR
VNNPKLLIADEPTGNLDPEISWEIMQLLERI.NVQGTTILMATHNSHIVNTFRHRVVAIEDGRIVRDEEKGDYG.YDD
VNNPKVLIADEPTGNLDPDNSWEIMNLLERI.NLQGTTILMATHNSQIVNTLRHRVIAIENGRVVRDESKGEYG.YDD
I
V
V
V
V
V
N
H
N
N
N
N
N
P
P
P
P
P
P
P
P
K
K
K
K
I
V
L
V
V
V
L
V
I
L
L
V
L
L
L
L
L
I
I
I
I
L
I
I
A
A
A
A
A
A
A
A
D
D
D
D
D
D
D
D
E
E
E
E
E
E
E
E
P
P
P
P
P
P
P
P
T
T
T
T
T
T
T
G
G
A
G
G
G
G
G
N
N
N
N
N
N
N
L
L
L
L
L
L
L
L
D
D
D
D
D
D
D
D
P
P
P
P
P
P
E
D
D
E
E
E
D
T
T
T
T
G
S
S
S
S
S
S
W
L
W
W
R
W
W
E
E
D
E
E
D
E
E
V
I
I
V
I
I
I
I
M
M
M
M
M
M
M
M
I
I
L
L
L
L
L
L
L
F
L
L
L
L
L
E
E
E
E
E
E
L
I
F
I
I
I
I
I
N
H
N
N
N
N
N
G
G
G
G
G
G
G
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
V
I
V
V
I
V
I
I
I
V
I
V
L
L
L
L
I
M
V
M
M
M
M
M
A
A
A
A
A
A
A
A
T
T
T
T
T
T
T
H
H
H
H
H
H
H
H
D
N
D
N
N
D
N
N
S
S
S
S
V
I
L
I
I
I
I
I
V
M
V
V
V
V
V
N
N
N
N
D
N
N
T
T
T
T
T
H
H
H
Q
H
H
R
R
R
R
R
R
R
R
V
V
I
V
V
V
V
V
A
A
A
A
A
I
I
L
I
I
L
I
I
E
E
E
E
E
N
N
D
N
D
N
G
G
G
G
G
G
G
R
R
R
R
R
R
I
L
I
I
L
I
V
V
V
V
V
V
V
R
R
R
R
R
R
D
D
D
D
D
D
E
E
Q
E
E
E
G
G
G
G
G
G
Y
Y
Y
Y
Y
Y
G
G
G
G
G
G
Y
Y
Y
Y
Y
E
D
D
D
D




Figura 17. A) Alineamiento multiple de LclC con las secuencias del COG1163. El grado de
identidad para todas ellas es de 57,79 °. NP¸241147: B. halodurans; NP¸266166 y NP¸268175:
L. lactis IL1403; NP¸345192, NP¸346284 y NP¸346414: St. pneumoniae TIGR4; NP¸374155 y
NP¸395558: S. aureus N315. B) Alineamiento multiple de LclC con las secuencias de las
proteinas FtsE (COG2884). Todas ellas poseen un grado de identidad del 63,55 °. LisInn: Lis.
innocua; NeisMen: N. meningitidis Z2491; BacSub: B. subtilis subsp. subtilis 168; IL1403: L.
lactis subps. lactis IL1403; MycoTub: M. Turberculosis; StpyM1G: St. pvogenes M1GAS;
StpnTIG: St. pneumoniae TIGR4.

Los aminoacidos conservados (100 ° homologia) se muestran sombreados en negro; en rosa, los
que presentan un 75 °; y en azul 50 ° de homologia. Se utilizo el programa DNAman (matriz
BLOSUM62).
Resultados 65
membrana interior (en E. coli) mediante la union con FtsX. Los mutantes de FtsE
con capaces de crecer solo en medios con cantidades elevadas de sal (1 ° de NaCl),
lo cual aporta datos sobre su papel en la division celular o en el transporte. En la
Figura 17B presentamos el alineamiento de LclC con diIerentes proteinas FtsE de
diIerentes microorganismos, con una identidad del 63,55 °.

5# (K'L/)1 /(0 2&1M1'1& /( 0%
0%$'1$1$),% 345 N2
8>6345
O
La actividad del promotor del operon de la lactococina 972 (P
lcn972
) se analizo en
tres entornos geneticos distintos: E. coli KW1, L. lactis NZ9000 y L. lactis R2. Para
ello, el promotor se ampliIico utilizando la tecnica de PCR (oligonucleotidos P1 y
P2, Tabla 5) y se Iusiono con el gen reportero uidA. La actividad -glucuronidasa de
los extractos celulares se determino como se indica en Materiales y Metodos (2.1.7.
Ensayo de actividad del promotor de la lactococina 972).
Para los experimentos en E. coli se procedio a la construccion del plasmido
pBL2 (Figura 18), clonando el promotor P
lcn972
en el plasmido pTUTmcs2. Esta
construccion se electroporo en la cepa de E. coli KW1, denominandose la nueva cepa
E. coli KW2. La determinacion de la actividad -glucuronidasa en E. coli KW2 dio
un valor medio de 71,59 + 0,96 UA min
-1
µg proteina
-1
(Figura 19).
pBL2
5107 bps
1000
2000
3000
4000
5000
EcoRI
NcoI
XhoI
NheI NaeI
ScaI
BglI
P
Lcn972
uidA
amp
pBL2
5107 bps
1000
2000
3000
4000
5000

pBL12
6585 bps
1000
2000
3000
4000
5000
6000
NcoI
AvaII
XhoI
XbaI
ScaI
HindIII
KpnI
HindIII
EcoRI
P
Lcn972
'
uidA
erv
repF
repD
repE
pBL12
6585 bps
1000
2000
3000
4000
5000
6000
'


Figura 18. Diagramas de los plasmidos pBL2 y pBL12, utilizados.
Resultados 66


Para observar como se comportaba este promotor en cepas de L. lactis, se
procedio a construir el plasmido pBL12 (Figura 18), clonando el promotor P
lcn972
en
el plasmido pIL252. Esta construccion se electroporo en L. lactis NZ9000
(denominandose la cepa L. lactis N12) y en la cepa L. lactis R2 (denominandose L.
lactis R12). Los ensayos de la actividad enzimatica -glucuronidasa realizados en
ambas cepas dieron valores de 0,267 + 0,051 UA min
-1
µg proteina
-1
para L. lactis
N12 y de 0,198 + 0,003 UA min
-1
µg proteina
-1
para el caso de L. lactis R12 (Figura
19).

G# %,P0)K)K QL,$)1,%0 /(0 12(&+,
/( 0% 0%$'1$1$),% 345
Para comprobar si los genes lclA, lclB y lclC son necesarios y suIicientes para la
produccion de la lactococina 972 y para la inmunidad de las celulas productoras Irente a
esta, dichos genes se clonaron bajo el control del promotor de la nisina. La clonacion se
llevo a cabo en el plasmido pNZ8020 (Figura 20), realizandose una Iusion transcripcional
con P
nisA
. El plasmido asi obtenido se denomino pBL54 (Figura 20) y se electroporo a la
cepa L. lactis NZ9000, denominandose a la nueva cepa L. lactis pBL54.
La capacidad de produccion de lactococina 972 de la cepa L. lactis pBL54 se estudio
utilizando el sistema de induccion en placa descrito en Materiales y Metodos (2.1.6.
Expresion controlada de genes en Lactococcus). En la Figura 21 podemos observar los
71,59
0,267 ` 0,198 `
0
10
20
30
40
50
60
70
U
A

m
i
n
-
1

u
g

p
r
o
t
e
i
n
a

-
1
E. coli KW2 L. lactis N12 L. lactis R12

Figura 19. Valores de actividad -glucuronidasa en las diIerentes cepas ensayadas. p·0,01(*).
Resultados 67
resultados obtenidos. Cuando se indujo la cepa L. lactis pBL54 con 1 ng de nisina se
observo la presencia de halos de inhibicion de crecimiento de la cepa sensible L. lactis
MG1614 (Figura 21A), mientras que con la cepa L. lactis NZ9000, electroporada con el
plasmido control pNZ8020, no se observaban dichos halos (Figura 21B). Estos
resultados nos indican que la cepa L. lactis pBL54 secreta al medio lactococina 972
activa, y ademas es inmune a la misma, puesto que se observa un crecimiento normal de
las colonias de L. lactis pBL54.
En un segundo ensayo se determino el grado de induccion de la sintesis de
lactococina 972 en la cepa L. lactis pBL54. Para ello se incubaron las celulas en medio
liquido con diIerentes concentraciones de nisina (0 1 ng/ml) y se recogieron los
sobrenadantes del cultivo a diIerentes tiempos (0 3 horas). Estos sobrenadantes Iueron


Figura 21. Ensayo en multicapa (ver Materiales y metodos) de induccion de las cepas A) L. lactis
pBL54 y B) L. lactis pNZ8020, en presencia de 1 ng/ml de nisina Z.
A) B)
NdeI
pNZ8020
3163 bps
500
1000
1500
2000
2500
3000
SalI
NcoI
BglII
Pnis
repC
repA
cm
BamHI
SmaI
EcoRI
BglII
XbaI
XhoI

XhoI
AvaI
XbaI
pBL54
6136 bps
1000
2000
3000
4000
5000
6000
ClaI
Pnis
lclB
pBL54
6136 bps
1000
2000
3000
4000
5000
6000
BamHI
KpnI
SpeI
AvaI
SmaI
PstI
EcoRI
HindIII
AvaI
PstI
SacI
PstI
XmnI
HindIII
NdeI
SalI
XmnI
NcoI
lclA

lclC
repC
repA
cm

Figura 20. Diagrama de los plasmidos pNZ8020 y pBL54.
Resultados 68


sometidos al ensayo de inhibicion por diIusion en placa de agar utilizando como cepa
indicadora L. lactis MG1614 (Figura 22A). Los resultados indicaron que en ausencia de
nisina las celulas no Iueron capaces de secretar lactococina 972 al medio (no aparece halo
de inhibicion). Al añadir nisina a los cultivos se observo que el tamaño del halo era
proporcional al tiempo de incubacion de las celulas en presencia de nisina y a la
concentracion de la misma utilizada para la induccion (Figura 22A). Ademas, hemos
observado, al igual que otros autores (de Ruyter et al., 1996b), que existia una saturacion
del sistema con el tiempo (a partir de 1,5 2 horas de incubacion no se produce mas
bacteriocina) y con la concentracion de nisina en el medio (la produccion de lcn972
aumenta hasta 0,75 ng/ml de inductor, permaneciendo constante a partir de ese punto).
Se comprobo ademas que la inhibicion se debia a la produccion y secrecion de
lactococina 972 al medio de cultivo, sometiendo los sobrenadantes de los cultivos a
electroIoresis en geles SDS-Tricina (Figura 22B). La tincion con plata de estos geles
revelo la presencia de la banda de 7,5 kDa (monomero de lcn972) y la banda de 15 kDa
(dimero y Iorma activa de lcn972). Ademas, se realizo la caracterizacion de la actividad
A)

B)



Figura 22. A) Ensayo de diIusion en agar de sobrenadantes de L. lactis pBL54 a diIerentes
tiempos de induccion y con diIerentes concentraciones de nisina Z. B) Gel SDS-PAGE Tricina de
sobrenadantes de medio de cultivo de L. lactis pBL54 recogidos a diIerentes tiempos despues de
añadir 0,25 ng/ml de nisina Z. 0: control, 1: 30 min, 2: 1 hora, 3: 1,5 horas, 4: 2 horas, 5: 3 horas,
MW: marcadores de pesos moleculares.
30 min

1 hora

1,5 horas


2 horas


3 horas
0 0,1 0,25 0,75 1 ng/ml nisZ
0 1 2 3 4 5 MW
2 kDa

18 kDa
16 kDa

10 kDa
8 kDa
6 kDa
Resultados 69
inhibitoria de estos peptidos (descrita en Materiales y Metodos, 2.2.2. ElectroIoresis de
proteinas) conIirmandose que el peptido de 15 kDa poseia actividad bacteriocinogenica
(datos no mostrados).
Para determinar si alguno de los genes era responsable de la inmunidad de las celulas
Irente a la lactococina 972 se realizaron ensayos de inhibicion del crecimiento de L. lactis
pBL54 en placas, con diIerentes concentraciones de nisina para inducir la expresion del
promotor. Observamos que la cepa es inmune a la accion de la lactococina 972 incluso
hasta concentraciones de 800 UA/ml. Sorprendentemente, la cepa es resistente a la accion
de la bacteriocina incluso sin inducir la expresion del operon con nisina. Es posible que la
transcripcion basal del promotor nis (de Ruyter et al., 1996b) sea suIiciente para inducir
una inmunidad elevada incluso en ausencia de agente inductor de su expresion.
No ha sido posible clonar los genes lclB y lclC, ni de Iorma independiente ni
conjunta, en cepas de L. lactis. Asi pues ha sido imposible comprobar si alguno de ellos o
ambos son responsables de la inmunidad de las cepas Irente a la lactococina 972. Sin
embargo, si Iue posible clonar una Iorma mutante del gen lclB que presentaba un
desplazamiento de pauta a partir del triplete que codiIica para el tercer aminoacido de
LclB. Esto sugiere que el gen lclB intacto se comporta como letal cuando se clona en
multicopia en L. lactis.

I# M1/1 /( %$$)+, /( 0% 0%$'1$1$),% 345
I#"# (R<>DB ;< 8= 8=>DB>B>96= 345 :BJE<
<8 >E<>9A9<6DB ;< 0# 8=>D9: M-"S"I
La inhibicion que ejerce la lactococina 972 sobre la incorporacion del precursor
del peptidoglicano N-acetilglucosamina y la observacion de las secciones de celulas
tratadas con lactococina 972 al microscopio electronico, realizadas en trabajos
preliminares sobre el modo de accion de esta (Martinez et al., 1996; Martinez et al.,
2000a) sugerian que actuaba como un inhibidor de la division celular y en concreto
de la Iormacion del septo.
Estos datos se conIirmaron al observar la Iilamentacion que induce la
bacteriocina a concentraciones subinhibitorias sobre cultivos sensibles de L. lactis
Resultados 70


MG1614 creciendo exponencialmente. La observacion de las celulas al microscopio
optico de contraste de Iases (Figura 23) revelo dos eIectos diIerentes: cuando se
utilizan concentraciones iguales o superiores a la CIM (10 UA/ml, Figura 23D) se
observa el Ienotipo ya descrito anteriormente donde las celulas pierden su morIologia
cocoide (Martinez et al., 2000a). Sin embargo, cuando la concentracion de
bacteriocina era ligeramente inIerior a la CIM (entre 2,5 y 5 UA/ml, Figuras 23B y
23C), las celulas son incapaces de separarse Iormandose Iilamentos largos.
La Iilamentacion es un eIecto que tambien inducen diversos antibioticos
inhibidores de la sintesis de peptidoglicano, especialmente aquéllos que aIectan a la
Iase extracelular del proceso. De entre ellos los mas importantes son los
glucopeptidos y los -lactamicos. Por esa razon, nos planteamos si la lactococina 972
actuaba de modo semejante a alguno de estos antimicrobianos.








Figura 23. FotograIias al microscopio optico de contraste de Iases de cultivos de L. lactis MG1614
tratadas con diIerentes concentraciones de lcn972 despues de dos horas: A) control; B) 2,5 UA/ml;
C) 5 UA/ml; D) 10 UA/ml. La barra de la escala representa 10 µm.
A) B)
C) D)
Resultados 71
I#5# $BA@=E=>9F6 >B6 <8 AB;B ;< =>>9F6 ;< 8= T=6>BA9>96=
La vancomicina se une a la Iraccion D-alanil-D-alanina terminal del disacarido
pentapeptido, impidiendo asi su polimerizacion a traves de la Iormacion de puentes
entre los peptidos de cadenas diIerentes del peptidoglicano. Este proceso es inhibido
por el tripeptido antagonista de la vancomicina, N

-N

-diacetil-L-Lys-D-Ala-D-Ala
|(Ac
2
)KAA|. Para determinar si la lactococina 972 reconocia la misma diana en el
peptidoglicano se trato con dicho tripeptido antes de añadirla a cultivos en Iase
exponencial de la cepa L. lactis MG1614.
Como control se realizaron ensayos en los que se utilizo vancomicina
(concentracion maxima 2,38 µM) y el tripeptido antagonista (exceso 100 molar) con
la misma cepa, observandose una completa inhibicion de la actividad del antibiotico,
es decir que los cultivos crecian normalmente en presencia de concentraciones letales
del quimioterapeutico (datos no mostrados). Una vez comprobado el eIecto
antagonista del tripeptido sobre la vancomicina, L. lactis MG1614 se incubo en
presencia de diIerentes concentraciones de la bacteriocina (0 nM - 533 nM), y en
presencia de bacteriocina tratada con un exceso molar del tripeptido (100, 250 y 500
veces).
Los resultados (Figura 24) indican que existe un eIecto antagonista parcial que
se observa sobre todo a la concentracion de lactococina que se corresponde con la
CIM para la cepa L. lactis MG1614 (133 nM). A esa concentracion el tripeptido
protege claramente a las celulas de la accion de la bacteriocina. Por otro lado, la Ialta
de eIecto protector a concentraciones superiores de lactococina 972, podria indicar
que esta interacciona de algun modo con el proceso de polimerizacion del
peptidoglicano pero que su blanco de accion no es el mismo que el de los
glucopeptidos.

I#G# )A@89>=>9F6 ;< 8=: 2C2: <6 <8 AB;B ;< =>>9F6 ;< 8>6345
El hecho de que la bacteriocina bloquee el crecimiento del septo de division nos
llevo a plantearnos la hipotesis de que su diana podria ser la PBP implicada en dicho
proceso. En el momento de iniciar este estudio no existian reIerencias bibliograIicas
Resultados 72


sobre las proteinas que participan en la division y Iormacion del septo en lactococos,
de manera que utilizamos otros microorganismos como reIerencia. Por ejemplo, se
sabe que en E. coli la proteina denominada PBP3 (producto del gen ftsI) esta
implicada en la Iormacion del septo (Errington et al., 2003), siendo PBP2 su
homologa en B. subtilis (Yanouri et al., 1993) y PBPX en St. pneumoniae (Laible et
al., 1989). Al realizar una comparacion entre las secuencias de estas proteinas y las
PBPs de L. lactis IL1403, observamos que la proteina mas homologa a ellas era
PBP2X, producto del gen pbpX (Tabla 6).
Una vez localizado el gen, nos propusimos sobreexpresar la proteina con la
intencion de determinar si un aumento en la concentracion de la misma podria
inducir la resistencia a la bacteriocina, lo que indicaria que se producia una
interaccion entre ambas. Para ello, el gen pbpX se clono bajo el promotor inducible
de la nisina en el plasmido pNZ8048E (Figura 25) realizandose una Iusion
traduccional. El plasmido asi obtenido se denomino pBL11 (Figura 25) y se
electroporo en la cepa L. lactis NZ9000, denominandose a la nueva cepa L. lactis
PBPX.
0
0,1
0,2
0,3
0,4
0,5
0,6
0,7
0,8
0,9
1
0 33 67 133 267 533
lcn972 (nM)
OD
600
Figura 24. Valores de OD
600
de las celulas L. lactis MG1614 tratadas con diIerentes
concentraciones de lactococina 972 (0 nM 533 nM) o bien con lactococina 972 previamente
tratada con un exceso molar (500) del tripeptido antagonista de la vancomicina |(Ac)2KAA|.
lcn972 y lcn972 ¹ 500 exceso de (Ac)
2
KAA.
Resultados 73
Tabla 6. Comparacion entre los diIerentes genes y las PBPs que codiIican de E. coli y lactis IL1403
(Ayala, comunicacion personal).

gen
(# >B89
Proteína Actividades
gen
0# 8=>D9:
Proteína
ponA PBP1A
TGasa
TPasa
ponA PBP1A
ponB PBP1B
TGasa
TPasa
pbp1B PBP1B
pbpC PBP1C
TGasa
TPasa
pbp2A PBP2A
pbpA PBP2 TPasa pbp2B PBP2B
pbpB PBP3 TPasa pbpX PBP2X
dacB PBP4
EPasa
CPasa
-- --
pbp4b PBP4b
EPasa ?
CPasa ?
BLasa ?
vvdA PBP4
dacA PBP5 CPasa dacA PBP3
dacC PBP6 CPasa dacB PBP5
dacD PBP6B CPasa -- --
ampH AmpH
CPasa ?
BLasa ?
-- --
ampC AmpC
BLasa
CPasa
-- --
pbpG PBP7/8 EPasa -- --
mepA MepA EPasa -- --
mtgA MtgA TGasa -- --

TGasa: transglicosilasa; TPasa: transpeptidasa, EPasa: endopeptidasa; CPasa: carboxipeptidasa;
BLasa: -lactamasa, ?: actividad no conIirmada enzimaticamente.


NdeI

SalI
XbaI
HindIII
AvaI
XhoI
BglII

erv
repC
repA
cm

PnisA



pNZ8048E
4379 bps
1000
2000
3000
4000
SalI

EcoRV
NcoI
AvaI
EcoRI
PstI
SalI
HindIII

pBL21
5612 bps
1000
2000
3000
4000
5000

AvaI

XhoI
ClaI
HindIII
AvaI
XhoI
NdeI
SalI
BglII

XhoII
pbpX

repC
repA
cm
PnisA

pBL11


Figura 25. Diagrama de los plasmidos pNZ8048E y pBL11.
Resultados 74


A continuacion se indujo la sintesis de la proteina PBPX en presencia de nisina
(Figura 26A). Sin embargo, la proteina resultaba toxica para las celulas ya que se detenia
su crecimiento (Figura 26B). Debido a este hecho no pudimos comprobar si estas celulas
eran mas resistentes a la lactococina que los controles con pNZ8048E, ya que la
bacteriocina solo es activa sobre celulas en Iase de crecimiento activo.
Puesto que la division celular es un proceso muy complejo, que depende de la accion
coordinada de numerosas proteinas, pudiera ser que la diana Iuera otra de las PBPs
presentes en L. lactis. Por ello procedimos, en primer lugar, a caracterizar el perIil de
PBPs de nuestros lactococos, utilizando un compuesto -lactamico Iluorescente
(BOCILLIN FL) que se une de Iorma especiIica a estas proteinas. (Materiales y Metodos,
apartado 2.2.3. Marcaje de las PBPs de Lactococcus).
A)
1 2 3 4 5 6 7 8


B)

0,0

0,2

0,4

0,6

0,8

1,0

1,2

0

30

60

90

120

150

OD

600

minutos


Figura 26 A) Gel SDS-PAGE de induccion de PBPX. Calles 1-4 extractos de L. lactis PBPX
recogidos a diIerentes tiempos de induccion (0, 15, 30 y 60 minutos, respectivamente); calles 5-7
extractos de L. lactis NZ9000 con el plasmido control pNZ8048E recogidos a diIerentes tiempos de
induccion (0, 15 y 60 minutos, respectivamente); calle 8 patron de pesos moleculares. La Ilecha
muestra la banda de aproximadamente 88 kDa que corresponde a PBPX. B) Curva de crecimiento
de las cepas L. lactis PBPX y L. lactis NZ9000 con el plasmido control pNZ8048E.
- 91 kDa
- 51,4 kDa
- 34,7 kDa
Resultados 75
El analisis de los geles de membranas de distintas cepas de lactococos, marcadas
con BOCILLIN FL (Figura 27), revelo la presencia de siete proteinas cuyos pesos
moleculares oscilaban entre 85 y 44 kDa, a las que se denomino PBP1, PBP2a,
PBP2b, PBP2c, PBP3, PBP4 y PBP5. Sorprendentemente, la proteina PBP5 de la
cepa productora de lactococina L. lactis IPLA 972 tiene mas aIinidad por este
compuesto que las PBP5 de las otras cepas, dando lugar a una banda de mayor
intensidad.
Para determinar si la actividad de alguna de las PBPs detectadas se veia aIectada
por la lactococina 972, se realizo un ensayo de competicion. Para ello se procedio a
incubar las membranas de las cepas L. lactis IPLA972 y R2, productoras y resistentes
a la bacteriocina, y de MG1614, no productora y sensible, con bacteriocina
puriIicada. Posteriormente, las membranas se marcaron con BOCILLIN FL y se
sometieron a electroIoresis. Los resultados se muestran en la Figura 28. La banda
correspondiente a la PBP4 de L. lactis MG1614, de 55 kDa, tratada con lactococina
972, presenta una menor intensidad que en las muestras control. Estos resultados nos
indican que la posible diana de la lactococina 972 podria ser esta proteina.
Por otro lado, las membranas de L. lactis MG1614 recogidas a diIerentes
tiempos de incubacion (partiendo de un inoculo al 1 °) y sometidas a SDS-PAGE se
marcaron con anticuerpos policlonales generados Irente a PBP3 de E. coli
(pAbPBP3). Se observo que una proteina de peso molecular similar a PBP4



!"#$%&' !"#$%&' (' *+,-,. (' *+,-,. !"#$%&' !"#$%&' (' *+,-,. (' *+,-,.


Figura 27. PerIil de PBPs de L. lactis IPLA972, L. lactis MG1614 y L. lactis R2, marcadas con
Bocillin FL¹.
IPLA972 MG1614 R2
PBP 1 (85 kDa)
2a (81 kDa)
PBP 2b (79 kDa)
2c (78 kDa)
PBP 3 (62 kDa)
PBP 4 (55 kDa)
PBP 5 (44 kDa)
Resultados 76




1 2 3 4




Figura 29. Hibridacion tipo 'Western¨ de extractos de L. lactis MG1614, a diIerentes tiempos de
crecimiento (inoculo 1° (v/v), en GM17, 30•C), con pAbPBP3 de E. coli. 1: 30 min; 2: 1 h; 3: 1,5 h;
4: 2 h. A la izquierda se indican los pesos moleculares del patron de proteinas.
93 kDa -
105 kDa -
49 kDa -
35 kDa -
55 kDa


IPLA972 MG1614 R2

lcn972 - + - + - +

Figura 28. Ensayo de competicion entre el Bocillin FL¹ y la lactococina 972. La Ilecha roja indica
la unica banda cuya intensidad disminuye en la cepa L. lactis MG1614 cuando las membranas son
tratadas con lcn972. IPLA972: L. lactis IPLA972, MG1614: L. lactis MG1614, R2: L. lactis R2. A la
izquierda se indican los pesos moleculares del patron de proteinas.
105 kDa -
90 kDa -
65 kDa -
49 kDa -
Resultados 77
reaccionaba con estos anticuerpos (Figura 29). Al estudiar la presencia de esta
proteina a lo largo de la curva de crecimiento de L. lactis MG1614 observamos que
esta se sintetiza principalmente en la Iase de crecimiento activo, comenzando a
desaparecer al Iinal de la Iase exponencial de crecimiento (Figura 29). Este resultado
concuerda con el hecho de que la lactococina 972 solo es activa Irente a celulas que
se encuentran creciendo de Iorma activa, siendo las celulas en Iase estacionaria mas
reIractarias a su accion.
Posteriormente, los anticuerpos pAbPBP3 de E. coli se utilizaron tambien para
poner de maniIiesto esta proteina en extractos de celulas tratadas con diIerentes
concentraciones de lactococina 972 (Figura 30). Se puede observar que la banda de
55 kDa (PBP4) aumenta de tamaño en presencia de bacteriocina y aparece como una
proteina de aproximadamente 70 kDa. Esta masa molecular se corresponderia con la
de un posible complejo Iormado por PBP4 (55 kDa) y el dimero de la lactococina
972 (15 kDa).







Figura 30. Hibridacion tipo 'Western¨ de extractos de L. lactis MG1614 tratadas con
concentraciones decrecientes de lactococina 972 (max 14 UA/ml min 0 UA/ml) y revelados con
anticuerpos policlonales Irente a la PBP3 de E. coli (pAbPBP3). A la izquierda se indican los pesos
moleculares de los marcadores y las Ilechas indican las bandas de 55 y 70 kDa.
Lcn972
70 kDa -
121 kDa -
50 kDa -
55 kDa
70 kDa
Resultados 78


Por ultimo, utilizando anticuerpos policlonales generados Irente a lactococina
972, que reconocen tanto la Iorma dimerica como el monomero de bacteriocina, se
comprobo que la banda de 70 kDa reaccionaba tambien con dichos anticuerpos
(Figura 31), lo que reIuerza la hipotesis de la Iormacion del complejo PBP4-lcn972
anteriormente mencionado. Ademas, este complejo es muy estable, ya que es capaz
de soportar el tratamiento al cual son sometidos los extractos celulares para realizar
su electroIoresis (temperatura elevada en presencia de SDS).

I#I# (R<>DB ;< 8= 8=>DB>B>96= 345 :BJE< 8= E<:@?<:D= K1K <6 0=>DB>B>>?: 8=>D9:
En un articulo reciente (Miller et al., 2004) se propone que la inhibicion de la
actividad enzimatica de PBP3 induce la respuesta SOS en Escherichia coli. Por otra
parte, los resultados expuestos en este trabajo sugieren que la lactococina 972 se une
a PBP4 de L. lactis, que es el analogo Iuncional de PBP3 de E. coli. Por ello, nos
planteamos determinar si la lactococina 972 inducia la respuesta SOS en L. lactis ya
que, si Iuera asi, tendriamos un dato indicativo adicional de que el blanco molecular
de la bacteriocina seria la PBP4 de este ultimo organismo. Si a esto añadimos que
muchos proIagos responden a la induccion de la respuesta SOS, iniciando un ciclo
litico que conducira a la generacion de una progenie viral, resultaba conveniente
comprobar si la lactococina 972, añadida a un cultivo en Iase exponencial de L. lactis
70,0 kDa







Figura 31. Hibridacion tipo 'Western¨ de extractos de L. lactis MG1614 sin tratar (calle 1) y
tratados con 14 UA/ml de lactococina 972 (calle 2) revelados con A) anticuerpos policlonales
Irente a la PBP3 de E. coli (pAbPBP3); B) con anticuerpos policlonales Irente a la lactococina 972
(pAblcn972). A la derecha se indican los pesos moleculares estimados para las bandas.
70,0 kDa
55,0 kDa A)
B)
1 2
70,0 kDa
Resultados 79
MG1614 a la concentracion inhibitoria minima (20 UA/ml) o al doble de esta (40
UA/ml), inducia proIagos residentes en su genoma. Con este objetivo, se incubaron
los cultivos durante tres horas mas para permitir la generacion de la progenie, y sus
sobrenadantes se procesaron para comprobar si producian placas de lisis sobre L.
lactis IL1403 y L. lactis F4-2.
En ninguno de los dos casos se observaron dichas placas, por lo que se procedio
a realizar un ensayo de PCR utilizando oligonucleotidos especiIicos para Iagos de la
especie P335 como cebadores, con objeto de poner de maniIiesto la posible presencia
de ADN Iagico en los sobrenadantes de los cultivos. El resultado obtenido se
presenta en la Figura 32. Como puede verse, los sobrenadantes de cultivos incubados
en presencia de la lactococina 972 dan lugar a una banda de ADN ampliIicado (calles
4 y 5), cuyo tamaño se corresponde con el que se obtiene al ampliIicar el ADN del
Iago P335 (calle 2). Dicha banda no aparece en la muestra correspondiente al
sobrenadante del cultivo sin tratar con la bacteriocina. De todo ello se deduce que la
lactococina 972 induce la respuesta SOS en L. lactis, al igual que lo hacen ciertos
antibioticos -lactamicos, especiIicos para la PBP3, en Escherichia coli.



Figura 32. Gel de agarosa de la ampliIicacion por PCR del gen de la dUTPasa de Iagos de la
especie P335 de: 2: ADN del fago P335; 3: sobrenadante de L. lactis MG1614 sin tratar; 4:
sobrenadante de un cultivo de L. lactis MG1614 tratado con 20 UA/ml y 5: con 40 UA/ml de
lactococina 972; 6: control. Calle 1: patron de pesos moleculares PstI.
1 2 3 4 5 6
Resultados 80


U# $&($)M)(,'1V M('%C10)KM1 W 2&1/L$$)+,
/( 0%$'1$1$),% 345 (, C)1&&(%$'1&
El estudio de la inIluencia de las Iuentes de carbono, lactosa y glucosa, sobre el
crecimiento, metabolismo y produccion de lactococina 972 de la cepa L. lactis
IPLA972 se realizo en cultivo discontinuo y continuo a valores de pH constantes
(6,8). Las concentraciones de azucar utilizadas Iueron de 5 y 20 g/L.

U#"# )6R8?<6>9= ;< 8= R?<6D< ;< >=EJB6B :BJE< <8 >E<>9A9<6DB
X 8= @EB;?>>9F6 ;< 8>6345 <6 >?8D9TB <6 ;9:>B6D96?B
Las velocidades de crecimiento (µ
max
) en presencia de glucosa y lactosa Iueron
similares, aunque algo mayores en el caso de la glucosa. Tambien se observo un
incremento en la produccion de biomasa al aumentar la concentracion de azucar,
indicandonos que no existia ningun otro componente del medio llegaba a hacerse
limitante aparte de la Iuente de carbono. Sin embargo, el recuento del numero de
celulas viables despues de 24 horas de cultivo era similar en todos los casos (10
9

uIc/ml) (datos no mostrados). El aumento en la biomasa, sin que se produzca
variacion en el numero de celulas viables, puede ser debido a una acumulacion
intracelular de compuestos de reserva o a la produccion de metabolitos secundarios
como los exopolisacaridos. El rendimiento optimo de biomasa (Y
X/S
) se obtiene con
glucosa 5 g/L y la productividad (p
X
) es maxima cuando se utiliza la Iuente de
carbono a una concentracion de 20 g/L (Tabla 7).
La produccion de bacteriocina tuvo lugar de Iorma paralela a la evolucion de la
biomasa durante la Iase exponencial de crecimiento y decrecio durante la Iase
estacionaria (Figura 33). A medida que la concentracion de azucar aumentaba,
tambien lo hizo la actividad de bacteriocina detectada (Figura 33; Tabla 7). De
hecho, la actividad Iue unas 8 veces mayor cuando la concentracion de la Iuente de
carbono era de 20 g/L

(glucosa o lactosa) Irente a 5 g/L. En la Tabla 7 podemos
observar tambien que el mejor rendimiento (Y
B/X
) y velocidad especiIica de
produccion de bacteriocina (q
B
) se obtuvo con lactosa 20 g/L.

Resultados 81

Tabla 7. Parametros cineticos de crecimiento y produccion de bacteriocina en cultivo en
discontinuo de L. lactis IPLA972 en M17, con diIerentes concentraciones de glucosa y lactosa a pH
6,8 y 30 •C.


Azucar
(g/L)

max

(h
-1
)

t
d

(h)

X
max

(g
DCW
/L)

Y
X/S

(g
DCW
/g)

p
X

(g
DCW
L
-1
h
-1
)

Actividad
lcn972
(AU/ml)
Y
B/X

(AU/
g
DCW
)
q
B

(x10
3
AU
g
-1
DCW
h
-1
)
Glucosa
5 0,729 0,951 1,850 0,379 0,185 1440 1129 226
20 0,737 0,940 4,650 0,233 0,465 12800 3145 524
Lactosa
5 0,700 0,990 1,125 0,225 0,188 1280 1574 394
20 0,684 1,013 4,650 0,233 0,465 10560 7634 1521

max
: tasa de crecimiento especiIica durante la Iase exponencial de crecimiento; t
d
: tiempo de
duplicacion; g
DCW
: peso seco; g: gramos de azucar; X
max
: maxima concentracion de biomasa; Y
X/S
:
rendimiento en biomasa; p
X
: productividad de biomasa; Y
B/X
: rendimiento en bacteriocina; q
B
:
velocidad especiIica de produccion de bacteriocina. Los calculos se describen en Materiales y
Metodos.
A) B)
0
200
400
600
800
1000
1200
1400
1600
0 2 4 6 8 10 12 14 16 18 20 22 24
Tiempo (h)
A
U
/
m
l
0
0,2
0,4
0,6
0,8
1
1,2
1,4
1,6
1,8
2
b
i
o
m
a
s
a

(
g
/
L
)
0
2000
4000
6000
8000
10000
12000
14000
0 2 4 6 8 10 12 14 16 18 20 22 24
Tiempo (h)
A
U
/
m
l
0
0,5
1
1,5
2
2,5
3
3,5
4
4,5
5
b
i
o
m
a
s
a

(
g
/
L
)

C) D)
0
200
400
600
800
1000
1200
1400
0 2 4 6 8 10 12 14 16 18 20 22 24
Tiempo (h)
A
U
/
m
l
0
0,5
1
1,5
2
2,5
3
3,5
b
i
o
m
a
s
a

(
g
/
L
)
0
2000
4000
6000
8000
10000
12000
0 2 4 6 8 10 12 14 16 18 20 22 24
Tiempo (h)
A
U
/
m
l
0
0,5
1
1,5
2
2,5
3
3,5
4
4,5
5
b
i
o
m
a
s
a

(
g
/
L
)

Figura 33. Produccion de biomasa () y de lactococina 972 ( ) por L. lactis IPLA972 en cultivo en
discontinuo a pH 6,8 y 30 •C en medio M17 suplementado con: A) glucosa 5 g/L; B) glucosa 20 g/L; C)
lactosa 5 g/L y D) lactosa 20 g/L. Los datos representados son los obtenidos en una de las Iermentaciones.
A
U
/
m
l

A
U
/
m
l

A
U
/
m
l

A
U
/
m
l

Tiempo (h)
Tiempo (h)
Tiempo (h)
Tiempo (h)
b
i
o
m
a
s
a

(
g
/
L
)

b
i
o
m
a
s
a

(
g
/
L
)

b
i
o
m
a
s
a

(
g
/
L
)

b
i
o
m
a
s
a

(
g
/
L
)

Resultados 82


U#5# (R<>DB ;< 8= D=:= ;< ;98?>9F6 X 8= R?<6D< ;< >=EJB6B :BJE<
<8 >E<>9A9<6DB X 8= @EB;?>>9F6 ;< 8>6345 <6 >?8D9TB <6 >B6D96?B
Los cultivos en continuo nos permitieron estudiar la cinetica de crecimiento de
la cepa L. lactis IPLA972 y la produccion de lcn972 en Iuncion de la tasa de dilucion
(D) y la Iuente de carbono. Para ello se utilizaron diIerentes tasas de dilucion en las
que se alcanzaban los estados estacionarios. Los valores de biomasa y bacteriocina
obtenidos se muestran en la Figura 34, y los parametros cineticos correspondientes
en la Tabla 8.
Es especialmente destacable que es posible obtener estados estacionarios
estables para tasas de dilucion superiores a los valores de µ
max
calculados
previamente en cultivos en discontinuo (Tabla 7), sin que se observe el lavado del
cultivo. Este crecimiento hipertroIico (wall-growth) del cultivo se produce como
Tabla 8. Parametros cineticos de crecimiento celular y produccion de bacteriocina en cultivos en
continuo de L. lactis IPLA972 en M17 con diIerentes concentraciones de glucosa y lactosa a varias
tasas de dilucion, pH 6,8 y 30 •C.

Concentracion
de azucar
(g/L)

D
(h
-1
)

Y
X/S
(g
DCW
g-1)

p
X

(g L
-1
h
-1
)

Y
B/X
(x10
3
AU g
-1
)

q
B

(x10
3
AU g
-1
DCW
h
-1
)
Glucosa
5 0,090 0,322 + 0,098 0,097 + 0,030 998 + 302 89 + 27
0,239 0,329 + 0,007 0,393 + 0,009 973 +22 232 + 5
0,457 0,306 + 0,014 0,699 + 0,032 2735 + 870 1251 + 398
0,673 0,254 + 0,006 0,855 + 0,020 113170 + 5592 8858 + 3761
20 0,090 0,125 +0,000 0,226 + 0,000 9216 + 0 829 + 0
0,239 0,157 +0,001 0,750 + 0,003 7334 + 28 1753 + 7
0,673 0,097 + 0,000 1,300 + 0,000 11919 + 0 8022 + 0

Lactosa
5 0,090 0,203 + 0,011 0,091 + 0,005 1424 + 75 129 + 7
0,457 0,218 + 0,005 0,449 + 0,011 1319 + 28 603 + 13
0,673 0,195 + 0,000 0,656 + 0,000 8862 + 3249 5960 + 2185
20 0,090 0,146 + 0,005 0,264 + 0,010 1651 + 371 149 + 47
0,239 0,160 + 0,004 0,766 + 0,020 3295 + 380 906 + 91
0,457 0,143 + 0,009 1,311 + 0,086 7243 + 3002 3311 + 1373
0,673

wall-growth wall-growth wall-growth wall-growth

D: tasa de dilucion; g
DCW
: peso seco; g: gramos de azucar; Y
X/S
: rendimiento en biomasa; p
X
:
productividad de biomasa; Y
B/X
: rendimiento en bacteriocina; q
B
: velocidad especiIica de produccion
de bacteriocina. Los datos se obtuvieron en el estado estacionario y se representan como la media de
duplicados + desviacion estandar. Wall-growth: no se pudieron realizar los calculos debido al crecimiento
hipertroIico del cultivo (ver texto).
Resultados 83
A)

0
0,5
1
1,5
2
2,5
3
3,5
0 0,2 0,4 0,6 0,8 1 1,2
Tasa de dilucion (h-1)
b
i
o
m
a
s
a

(
g
/
L
)


B)

0
5000
10000
15000
20000
25000
0 0,2 0,4 0,6 0,8 1 1,2
Tasa de dilucion (h-1)
A
U
/
m
l


Figura 34. A) Produccion de biomasa y B) produccion de lactococina 972 por L. lactis IPLA972 a
diIerentes tasas de dilucion en cultivos en continuo a pH 6,8 y 30 •C en medio M17 suplementado con: :
glucosa 5 g/L; : lactosa 5 g/L; : glucosa 20 g/L; : lactosa 20 g/L. Los datos representados son los
obtenidos en una de las Iermentaciones.
Tasa de dilucion (h
-1
)
Tasa de dilucion (h
-1
)
Resultados 84


consecuencia de la adhesion de una proporcion signiIicativa de celulas a las paredes
del biorreactor. Este hecho Iue particularmente evidente cuando se aplicaron tasas de
dilucion superiores a 0,457 h
-1
en cultivos crecidos en presencia de 20 g/L de lactosa
(las celulas adheridas constituian el 40° de la biomasa), y superiores a 0,673 h
-1
en
el resto de condiciones de Iuente de carbono. Por lo tanto, los parametros cineticos
calculados para las tasas de dilucion superiores a esos valores no se corresponden
con los reales y no se muestran en la Tabla 8. A tasas de dilucion mayores de 0,894
h
-1
se produjo el lavado de los cultivos crecidos en presencia de 5 g/L de lactosa.
Con respecto a la produccion de biomasa (Figura 34A), esta se vio claramente
aIectada por la Iuente de carbono cuando se aplicaron tasas de dilucion proximas a la
µ
max
(D € 0,673 h
-1
). La glucosa proporciono mayor biomasa que la lactosa en las dos
condiciones ensayadas (5 g/L, p · 0,01; 20 g/L, p · 0,00001); los rendimientos en
biomasa en todos los casos Iueron mejores a valores de D bajos (Tabla 8). Ademas,
al igual que se observo en los cultivos en discontinuo, la concentracion mas alta de
azucar dio lugar a una productividad en biomasa mayor.
La sintesis de lactococina 972 (Figura 34B) siguio un comportamiento similar
para ambos azucares a baja concentracion (5 g/L). Aunque se detecto actividad
lcn972 en todas las tasas de dilucion, se observo un maximo de actividad a D € 0,673
h
-1
(91 96 ° de µ
max
). Esto indicaria que la lactococina 972 es principalmente
sintetizada cuando las celulas estan creciendo de Iorma activa. Este comportamiento
no se observo cuando la concentracion de azucar era de 20 g/L. En este caso, cuando
la Iuente de carbono utilizada era lactosa, el maximo de actividad se observo a D €
0,457 h
-1
(66 ° de µ
max
), mientras que en presencia de glucosa la actividad
bacteriocinogenica alcanzo niveles elevados en un amplio rango de de tasas de
dilucion (0,09 0,673 h
-1
), lo cual signiIicaria que la produccion de lactococina 972
se mantiene alta incluso cuando las celulas estan creciendo lentamente (12 ° de
µ
max
). En general, y al igual que ocurre en los cultivos en discontinuo, el valor
maximo de la biomasa da lugar a valores de actividad de bacteriocina tambien
maximos. Los valores maximos de rendimiento (Y
B/X
) y velocidades especiIicas de
produccion (q
B
) de bacteriocina se obtuvieron con glucosa (Tabla 8).

Resultados 85
U#G M<D=JB89:AB ;< 8= ><@= 0# 8=>D9: IPLA972
<6 >?8D9TB en ;9:>B6D96?B X <6 >B6D96?B
En los cultivos en discontinuo ambas Iuentes de carbono se consumieron
completamente despues de 4 - 5 h (a la concentracion mas baja de azucar) o 6 - 8 h (a
la concentracion mas alta) de incubacion (datos no mostrados). En estos cultivos, L.
lactis IPLA972 presento un metabolismo homolactico con respecto a su perIil de
produccion de metabolitos. La produccion de acido lactico supuso del 80 al 96 ° del
azucar consumido, aunque tambien se acumularon acido acetico y Iormico al Iinal
del cultivo (10 h a 24 h). Tambien se detecto etanol, aunque su concentracion era
muy similar al limite de deteccion y no pudo ser cuantiIicada adecuadamente (datos
no mostrados).



25°
50°
75°
100°

0
200
400
600
800
1000
1200
1400


25°
50°
75°
100°
0,09 0,24 0,46 0,67 0,89 1,11 0,09 0,24 0,46 0,67 0,89 1,11
0
200
400
600
800
1000
1200
1400





Figura 35. Productos metabolicos Iinales y concentracion de azucar residual en cultivos en continuo
de L. lactis IPLA 972 a diIerentes tasas de dilucion (D) de M17 suplementado con glucosa (A, B) o
lactosa (C, D) a 5 g/L (A, C) o 20 g/L (B, D). Las muestras se tomaron en el estado estacionario.
: azucar residual; : acido acetico; : acido Iormico; : acido lactico.
P
r
o
d
u
c
c
i
o
n

d
e

a
c
i
d
o

(
°
)

A
z
u
c
a
r

r
e
s
i
d
u
a
l

(
m
g
/
1
0
0

m
l
)

Tasa de dilucion (h
-1
)
B)
C)
D)
A)
Resultados 86


El analisis de los productos Iinales del metabolismo en los cultivos en continuo
dio lugar a los resultados representados en la Figura 35. Se observo que el balance
entre las Iermentaciones homolactica y acido-mixta es dependiente de la
disponibilidad del azucar. El crecimiento de L. lactis IPLA972, en presencia de un
exceso de azucar (glucosa o lactosa, 20 g/L) y a altas tasas de dilucion, daba lugar a
una Iermentacion homolactica en la que mas del 90 ° del azucar metabolizado se
convirtio en acido lactico. Solo a D 0,457 h-1 se pudieron detectar cantidades
apreciables de otros metabolitos, siendo la Iuente de carbono completamente
consumida. A la concentracion mas baja de azucar ensayada se hizo mas notable
el cambio de Iermentacion homolactica a acido-mixta a medida que descendia D.










"#$%&$#'(

Discusion 87

















!"# %!&'(&!)*

Las bacteriocinas son peptidos producidos por las bacterias, que presentan
propiedades antimicrobianas Irente a otras bacterias, a menudo estrechamente
relacionadas con la cepa productora. Desde el descubrimiento de la primera
bacteriocina ha pasado casi un siglo, pero ha sido en estos ultimos 25 años cuando ha
aumentado el interes por estos compuestos y su utilizacion como agentes
conservantes de los alimentos, y tambien como potenciales agentes que podrian
complementar o incluso reemplazar a los antibioticos. A este respecto cabe citar la
aparicion de numerosos articulos de revision, que se han centrado en el estudio de las
bacteriocinas producidas por bacterias Gram-positivas, relacionados con su sintesis
(Ennahar et al., 2000; Riley, 1998; Nes et al., 1996), estructura y mecanismo de
accion (Cleveland et al., 2001; McAuliIIe et al., 2001; Nes y Holo, 2000; Abee,
1995), actividad biologica (Ennahar et al., 1999; Requena y Pelaez, 1995) y
aplicaciones (Cleveland et al., 2001; de Vuyst y Vandamme, 1996; Hoover, 1993).
La lactococina 972 se ha revelado como una nueva bacteriocina que no puede
ser clasiIicada dentro de ninguno de los grupos descritos hasta el momento: posee
una elevada resistencia a proteasas especiIicas, es termosensible y muy hidroIilica.
Ademas, su modo de accion es totalmente diIerente al de otras bacteriocinas, ya que
la Iorma activa es un homodimero y no induce la Iormacion de poros, sino que inhibe
la Iormacion del septo bacteriano, lo cual provoca la detencion del ciclo celular y
posteriormente la muerte de las bacterias.
Discusion 88
!" $%&'()*'+),( &-(./)+' 0-1
$2-%,( 0- 1' 1'+/$+$+)(' 345
Para comprender mejor la organizacion genetica que subyacia a la biosintesis de
la lactococina 972 decidimos realizar en primer lugar la secuenciacion completa del
plasmido pBL1 en el cual se encontraba codiIicada, ya que por estudios previos se
sabia que la produccion e inmunidad eran transmisibles por electroporacion de este
replicon a celulas sensibles (Martinez et al, 1996).
El analisis de dicha secuencia nos revelo algunos aspectos importantes. En
primer lugar, el gen estructural (lclA) precede a dos genes (lclB y lclC)
estrechamente ligados, lo que sugiere que los tres Iorman parte de un operon, y todos
ellos se encuentran junto con otra orf (orf4) Ilanqueados por dos secuencias de
insercion deIectivas (ISS1 y ISS1CH) y una secuencia de insercion completa
(ISS1). Este hecho, junto con que los sitios de restriccion se encuentren distribuidos
de Iorma asimetrica nos hace pensar que Iue introducido como un bloque genetico
dentro de un antecesor de pBL1, a traves de una transIerencia mediada por ISS1. En
el caso de los plasmidos que codiIican para la colicina Js (pColJs), para la klebicina
B (pKlebB) (Riley y Wertz, 2002) y la lacticina 3147 (Dougherty et al., 1998)
tambien se ha observado este hecho, pudiendose considerar que estos elementos
extracromosomicos estan compuestos por un plasmido criptico que aportaria la
inIormacion para su mantenimiento y replicacion en las celulas hospedadoras y un
bloque de genes que codiIican para una bacteriocina concediendo, probablemente,
una ventaja selectiva apreciable a las celulas que los albergan. Por otro lado, el
solapamiento entre el triplete stop de lclB y el de inicio de lclC sugeria que este
ultimo gen tambien Iormaria parte del acervo genetico necesario para la biosintesis
de la bacteriocina. Ademas, este solapamiento indicaria la existencia de un
acoplamiento traduccional de los genes, asegurando que la produccion de ambas
proteinas se realiza en la proporcion adecuada (van de Guchte et al., 1991). Existen
otros ejemplos de estructuras de genes acoplados de esta manera, como lctF, lctlE y
lctG del operon de la lacticina 481 (Rince et al., 1997), nisF, nisE y nisG del
agrupamiento de la nisina (Siegers y Entian, 1995) y epiF, epiE y epiG del grupo de
genes de la epidermina (Peschel y Götz, 1996). Finalmente, los experimentos de
Discusion 89
expresion del conjunto de los tres genes lcl bajo el promotor de la nisina, en una cepa
previamente sensible, indujo tanto la inmunidad como la capacidad de produccion de
la bacteriocina, pudiendo aIirmarse asi que toda la inIormacion genetica necesaria
para la sintesis e inmunidad de lcn972 se encuentra en un unico operon que consta de
tres genes, lclA, lclB y lclC, en cuyo extremo 5` se encuentra un solo promotor
Iuncional.
Entre dicho promotor, P
Lcn972
, y el punto de inicio de la traduccion aparecen dos
secuencias invertidas. ¿Cual puede ser la posible Iuncion de estas secuencias?. El
extremo 5` del ARNm que no se traduce (5`-UTR) no solo sirve para la union de los
ribosomas al inicio de la sintesis proteica sino tambien como potencial punto de
ataque de las RNasas, de manera que la existencia de estructuras secundarias en esa
zona podria servir para estabilizar el ARNm. Esta Iuncion ha sido descrita en
diIerentes sistemas (RNA1 de ColE1, ARNm del operon rnc, ambos de E. coli, el
mensajero de pufBA de Rhodobacter, etc) (Rauhut y Klug, 1999). Otra importante
caracteristica que aparece en nuestro transcrito, y que tambien aparece en el RNA1,
seria la presencia de una region de cadena sencilla (SS) a continuacion del lazo que
contiene el sitio de union a ribosoma asi como el codon de inicio. Parece ser que esta
region de cadena sencilla estabilizaria el ARNm mediante la saturacion con
ribosomas que se unirian Iuertemente a la secuencia Shine-Dalgarno.
La gran estabilidad de este ARNm parece conIirmarse no solo con los valores
obtenidos de G al estudiar su estructura secundaria del ARNm utilizando el
programa MFold, sino tambien mediante los resultados obtenidos en los estudios de
expresion de los genes lclA y lclB (Martinez et al., 1999). En estos experimentos se
encontro que el transcrito perteneciente al gen lclA es muy abundante a lo largo de
toda la curva de crecimiento, detectandose incluso en cultivos de 24 h. Pudiera ser
que en esta persistencia del ARNm correspondiente a lclA participen tambien dos
secuencias invertidas (con un G de -35 kcal/mol) que aparecen entre los genes lclA
y lclB y que podrian actuar como una 3`-UTR estabilizadora, ademas de como
señales de terminacion de la transcripcion rho-independientes. Esta ultima Iuncion de
las dos secuencias invertidas no debe ser muy eIectiva ya que durante la Iase
exponencial se detecta un segundo transcrito que cubre todo el operon, aunque este
ultimo es mucho menos abundante que el correspondiente a la lectura de lclA
Discusion 90
exclusivamente (Martinez et al., 1999). Esta organizacion en la que aparece una
secuencia terminadora entre el gen estructural y el resto de las orfs implicadas en el
transporte e inmunidad ha sido descrita tambien para otros operones de bacteriocinas
como la lacticina 481 (Rince et al., 1997), la nisina (Rauch y de Vos, 1992) y la
lacticina RM (Yarmus et al., 2000) entre otras.
Los estudios de expresion de P
Lcn972
mostraron sorprendentemente que este
promotor es muy activo en E. coli, mientras que su actividad en lactococos Iue mas
de dos ordenes de magnitud menor a juzgar por los valores de -glucuronidasa
obtenidos. Posiblemente este hecho se deba a la preIerencia de la polimerasa de E.
coli por promotores localizados en regiones ricas en A¹T, que seria el caso de P
Lcn972

(Nishi y Itoh, 1986). Complementariamente, la mayor actividad enzimatica,
observada en E. coli KW2 respecto a L. lactis N12 y L. lactis R12, podria ser el
producto del alto numero de copias que presenta el plasmido PTUTmcs2 Irente a
pIL252. La elevada expresion del promotor en su ubicacion original, el plasmido
PBL1, podria deberse en parte a que dicho plasmido presente unas 50 copias/celula
(B. Mayo, comunicacion personal).
El analisis de la secuencia de aminoacidos de la lactococina 972 deducidos a
partir de la secuencia del gen estructural lclA, revelo una de sus caracteristicas mas
importantes: la presencia de un peptido señal tipico que es reconocido por el sistema
de secrecion general (SEC). Este hecho, aunque no muy Irecuente, tambien ocurre en
algunas bacteriocinas de clase II, como la acidocina B (Leer et al., 1995), la
divergicina A (Worobo et al., 1994), la bacteriocina 31 (Tomita et al., 1996), la
enterocina P (Cintas et al., 1997) y la listeriocina 743A (KalmokoII et al., 2001). En
todos estos casos, al igual que ocurre con la lactococina 972, la produccion de
bacteriocina depende de la expresion de un solo operon que comprende el gen
estructural y el/los (posibles) gen/es de inmunidad, sin la necesidad de proteinas
especializadas para su secrecion y maduracion.
No esta claro porque la mayoria de las bacteriocinas de bacterias lacticas de
Clase II poseen un sistema de exportacion de tipo doble glicina cuando otras utilizan
el sistema SEC de la celula. En cambio, la necesidad de un sistema especiIico puede
entenderse mejor en el caso de las bacteriocinas de Clase I, las cuales serian
Discusion 91
incapaces de atravesar la membrana citoplasmatica utilizando el sistema SEC porque
las estructuras de los anillos de lantionina probablemente mantengan al peptido en
una conIormacion inadecuada para la secrecion. Evidentemente este razonamiento no
puede aplicarse para las de Clase II.
Por otra parte, los resultados obtenidos del analisis de la secuencia de
aminoacidos de las proteinas LclB y LclC indican que ambas Iormarian un complejo
que daria lugar a un transportador ABC. Los transportadores ABC pertenecen a la
superIamilia ABC (ATP-Binding Cassette) y se caracterizan porque estas proteinas
son capaces de utilizar la energia de hidrolisis del ATP para promover la exportacion
de metabolitos muy variados (Holland y Blight, 1999; Nikaido y Hall, 1998, Fath y
Kolter, 1993). Los transportadores ABC presentan dos dominios esenciales, uno de
union e hidrolisis de los nucleotidos triIosIato y otro que atraviesa la membrana
citoplasmatica, y Iorma el canal a traves del cual tiene lugar el proceso de
exportacion. Dichos dominios pueden estar Iormando parte de un unico polipeptido
o, como en nuestro caso, de polipeptidos diIerentes. Asi, en LclC se encontraria el
dominio de union a nucleotidos, mientras que la region transmembrana seria parte de
LclB.
Ahora bien, si la bacteriocina se excreta a traves del sistema general de
secrecion, parece redundante que exista al mismo tiempo un sistema especiIico de
exportacion. Por ello, deIendemos la hipotesis de que ambos genes, lclB y lclC,
codiIicarian para la/s proteina/s de inmunidad de la lactococina 972. Las razones que
avalan esta asuncion son variadas. En primer lugar, se ha observado que los genes de
inmunidad de la mayoria de las bacteriocinas de Clase II se encuentran a
continuacion del gen estructural, Iormando un operon (Nes et al., 1996), como ocurre
con los genes lclB y lclC. Por otro lado, aunque los ensayos destinados a clonar y
posteriormente expresar estos genes individualmente en una cepa de L. lactis
sensible a la bacteriocina no han sido positivos, todos nuestros resultados indican que
sus productos participan en la inmunidad de las celulas Irente a la lactococina 972.
Al clonar todo el operon bajo el control del promotor de la nisina, las celulas se
hacian resistentes a la accion de la bacteriocina, incluso con la expresion basal del
promotor en ausencia de induccion. La imposibilidad de clonar lclB o lclC no es un
caso excepcional. De hecho, tampoco ha sido posible la clonacion de los genes lctF y
Discusion 92
lctE de la lacticina 481 (Rince et al., 1997), concluyendo los autores que
posiblemente el nivel de expresion de estos genes puede ser toxico para la bacteria en
ausencia de un tercer gen denominado lctG.
Por ultimo, aunque la mayoria de las bacteriocinas de Clase II poseen proteinas
de inmunidad de pequeño tamaño, cuya Iuncion a nivel molecular es aun
desconocida, no es raro que un transportador ABC actue como una proteina de
inmunidad. Asi ocurre por ejemplo con los lantibioticos como la nisina, la subtilina y
la epidermina. No se sabe con certeza cual es el mecanismo de accion de estas
proteinas, aunque experimentos realizados con los genes epiF, epiE y epiG de la
epidermina (Otto et al., 1998; Sahl y Bierbaum, 1998) sugieren que proporciona
inmunidad activando la extrusion de las moleculas de bacteriocina, manteniendo asi
la concentracion del lantibiotico en la membrana muy por debajo del nivel critico
necesario para la aparicion de poros.
Otro dato interesante ha sido la homologia encontrada entre el operon de la
lactococina 972 y una serie de operones de Streptococcus y Staphvlococcus de
Iuncion desconocida. En todos los casos un gen que codiIica para una proteina de
pequeño tamaño y pI alto precede a una proteina integral de membrana con siete
segmentos transmembrana y esta a una proteina de union a ATP. En el genero
Staphvlococcus aparece un gen adicional que codiIica una proteina semejante a LclA
entre la proteina de membrana y la de union a ATP. En esta situacion resulta muy
atractivo especular que los peptidos de pequeño tamaño podrian tener Iuncion
antimicrobiana (por homologia con LclA), mientras que las otras dos proteinas
podrian Iormar un transportador de tipo ABC que proporcionaria inmunidad a la
celula protegiendola Irente a su propio producto. En este sentido es notable que todos
los peptidos homologos que pertenecen a estos sistemas, son sintetizados como pre-
peptidos que poseen un peptido señal tipico del sistema SEC bacteriano.
La presencia de estos operones en los cromosomas de las bacterias
pertenecientes a otros generos bacterianos emparentados con Lactococcus y su
homologia con el de la lactococina 972 nos hace plantearnos dos cuestiones. En
primer lugar, ¿podria haber evolucionado el operon de la lactococina 972 a partir de
uno de estos sistemas?. A Iavor de esta hipotesis esta su localizacion plasmidica y el
Discusion 93
hecho de que este Ilanqueado por ISs. Si esto es asi, y debido al peculiar modo de
accion de la lactococina 972, ¿estan implicados estos sistemas de algun modo en la
division celular?. A este respecto es llamativa la homologia de LclC con las proteinas
pertenecientes al COG2884 (que agrupa a las proteinas FtsE), que estan implicadas
en la Iormacion del septo. Tendriamos asi un escenario en que una agrupacion de
genes, cuya expresion estaria muy bien controlada debido a la naturaleza del proceso
de division, habria pasado a un entorno Iisiologico distinto, lo que provocaria la
perdida de dichos controles. Esto, unido a la presencia de los genes en un plasmido
multicopia, daria lugar a una expresion desordenada de los mismos y a la
acumulacion de un peptido que, en proporcion inadecuada respecto a los otros
elementos que median la division celular, podria tener un eIecto letal.

5" 6$0$ 0- '++),(
Estudios preliminares sobre el modo de accion de la lactococina 972 revelaron
que la Iorma activa de esta bacteriocina es un homodimero. Se han descrito
aproximadamente 20 bacteriocinas dimericas (Garneau et al., 2002), de las cuales 14
pertenecen al grupo de no-lantibioticos (Clase II). A diIerencia de la lactococina 972,
todas ellas estan Iormadas por dos peptidos diIerentes, sintetizados como prepeptidos
que poseen una señal de procesamiento de tipo doble glicina (excepto la enterocina
L50 que se sintetiza directamente como bacteriocina madura). Por otra parte, todas
las bacteriocinas dimericas cuyo modo de accion se conoce parecen abrir poros en las
membranas plasmaticas de las celulas sensibles. Por lo tanto, podemos concluir que
la lactococina 972 no se parece a ninguna bacteriocina de las sintetizadas como dos
peptidos, ni estructuralmente ni por su modo de accion.
Como ya se habia apuntado en trabajos anteriores (Martinez et al., 2000a),
cuando las celulas se incuban con concentraciones letales de lactococina 972, se
produce la inhibicion de la Iormacion del septo de division. Ademas, las celulas
comienzan a lisarse (a partir de los 60 minutos de tratamiento), probablemente
debido al debilitamiento de la pared celular, lo que provocaria a su vez la ruptura de
la membrana plasmatica por eIecto de la presion osmotica. Rice y Bayles (2003) han
Discusion 94
sugerido que este hecho podria ser un tipo de muerte celular programada (PCD,
programmed cell death), al igual que ocurre en los organismos eucariotas (apoptosis).
Consistente con el modo de accion descrito, cuando las celulas tratadas se
observan al microscopio presentan un aspecto alargado y un tamaño medio que
coincide, aproximadamente, con el de dos celulas normales. Un estudio mas
exhaustivo al microscopio electronico revelo que las celulas presentaban las
constricciones ecuatoriales asi como el primordio del septo. Este hecho, junto con
que la bacteriocina es solo activa Irente a poblaciones bacterianas que se encuentran
en Iase exponencial de crecimiento, parecia indicar un modo de accion similar al de
los antibioticos que inhiben las ultimas etapas de la biosintesis de la pared celular.
Para determinar si la lactococina 972 actuaba de manera similar a los
glucopeptidos se trataron cultivos de celulas sensibles con el tripeptido antagonista
de la vancomicina, diacetil-!-Lys-"-Ala-"-Ala, el cual Iue incapaz de inhibir
totalmente la actividad de la bacteriocina, en concentraciones superiores a la CIM, lo
que nos indica que el modo de accion, a nivel molecular, de la lactococina es
diIerente al de los antibioticos glucopeptidos. Ahora bien, este ensayo revelo que el
tripeptido antagonizaba parcialmente la accion de la lcn972, sobre las celulas
sensibles, en concentraciones inIeriores o iguales a la CIM lo que sugiere que la
bacteriocina interactua de algun modo con el pentapeptido de la unidad de
peptidoglicano.
Por otra parte, determinados antibioticos -lactamicos ejercen un eIecto sobre S.
aureus que parece ser similar al observado para la lcn972, ya que inhiben la
Iormacion del septo, provocando, en ultimo termino la lisis celular (Rohrer y Berger-
Bächi, 2003). Complementariamente, experimentos recientes (Pinho y Errington,
2003) han demostrado que en S. aureus RN4220 pueden tener lugar dos modos de
sintesis de pared celular: una localizada Iundamentalmente en el septo cuando las
celulas crecen normalmente, y otra dispersa, como ocurre en los bacilos, cuando la
maquinaria de sintesis de la pared celular pierde su localizacion especiIica. En este
ultimo caso las celulas son capaces de seguir creciendo (hasta 8 veces su volumen
normal) debido a la Iormacion de pared celular nueva a lo largo de toda la bacteria,
dando lugar a celulas no viables que no pueden ser 'rescatadas¨ cuando se restaura
Discusion 95
su crecimiento normal. Este podria ser nuestro caso: aunque la sintesis de septo esta
bloqueada, las celulas continuan Iormando peptidoglicano a lo largo de la bacteria, a
traves de la sintesis de pared celular de Iorma dispersa. Tambien se ha observado en
E. coli que cuando se realizan mutaciones en el gen fstI (que codiIica PBP3), se
inhibe la sintesis de peptidoglicano durante la division, pero las celulas son capaces
de seguir creciendo, Iormando largos Iilamentos sin septos (Spratt, 1977). Todo esto
sugiere que la diana de la lactococina 972 podria ser o bien la proteina equivalente en
L. lactis a PBP3 de E. coli, o bien cualquier otra proteina que participe en la
elongacion del septo.
La proteina homologa a PBP3 de L. lactis IL1403 es PBP2X (producto del gen
pbpX). Cuando sobreexpresamos esta proteina observamos que las celulas detenian
su crecimiento, de manera que no pudimos comprobar si su sobreexpresion protegia
o no a las celulas Irente a la lactococina 972. Por ello, como aproximacion alternativa
al problema, realizamos en primer lugar un analisis del perIil de PBPs de nuestras
cepas. En todas ellas se detectaron 7 PBPs: PBP 1 (85 kDa), PBP 2a (81 kDa), PBP
2b (79 kDa), PBP 2c (78 kDa), PBP 3 (62 kDa), PBP 4 (55 kDa) y PBP 5 (44 kDa);
aunque la intensidad observada para esta ultima era mucho mayor en L. lactis
IPLA972 que en MG1614 y su derivado R2, productor de la lactococina 972.
El ensayo de competicion entre BOCILLIN y lactococina 972, realizado para
observar si la bacteriocina diIicultaba la union del -lactamico al centro activo de
alguna PBP de L. lactis MG1614, revelo que se producia una disminucion en la
intensidad de una de las bandas del gel, la cual correspondia a PBP4, lo que se
considero como una primera evidencia de que el blanco molecular de lcn972 podria
ser dicha proteina.
Para conIirmar el eIecto de la bacteriocina sobre PBP4 de L. lactis se razono del
siguiente modo: el analogo molecular de esta proteina en E. coli deberia ser PBP3,
dado que los antibioticos -lactamicos especiIicos para esta PBP bloquean la
Iormacion de septos en E. coli e inducen la Iilamentacion de los cultivos. Es posible,
por lo tanto, que anticuerpos generados Irente a PBP3 de E. coli reaccionen Irente a
PBP4 de L. lactis, pudiendo revelar asi alteraciones en la movilidad electroIoretica
de esta proteina como consecuencia de su interaccion con la bacteriocina. Los
Discusion 96
resultados obtenidos conIirmaron la hipotesis. Asi, los anticuerpos policlonales
generados Irente a PBP3 de E. coli (pAbPBP3) eran capaces de reconocer una
proteina de peso molecular similar a la PBP4 en extractos de L. lactis MG1614
recogidos a diIerentes tiempos de incubacion. Ademas, se observo que esta proteina
es mas abundante durante la Iase exponencial de crecimiento. Estos resultados
concuerdan con el hecho de que la actividad inhibitoria de la lactococina 972 solo se
observe en celulas que se encuentran creciendo activamente.
El ensayo de marcaje con anticuerpos pAbPBP3 de extractos de celulas sensibles
que habian sido previamente incubadas con lactococina 972, revelo la desaparicion
de la banda correspondiente a PBP4 y la aparicion de una nueva banda de unos 70
kDa, que podria corresponderse con la Iormacion de un complejo PBP4-lcn972. Para
comprobar este hecho, se realizo un segundo marcaje, esta vez con anticuerpos
policlonales Irente a la lactococina 972 (pAblcn972), y se observo que la banda
superior de 70 kDa era reconocida por estos anticuerpos, conIirmandose asi que
correspondia al complejo PBP4-lcn972.
Por ultimo, se ha descubierto que determinados antibioticos -lactamicos como
la piperacilina y la ceIalexina, que se unen exclusivamente a la PBP3 de E. coli
(Botta y Park, 1981; Pogliano et al., 1997), inducen la respuesta SOS (Miller et al.,
2004). Este eIecto ocurre porque la inactivacion de PBP3 estimula, a traves de la
induccion del operon dpiBA, la sintesis de la proteina DpiA, la cual se une al origen
de replicacion e impide el acceso al mismo de los Iactores DnaA y DnaB,
bloqueando asi la duplicacion del material genetico celular. Esto induce el sistema
SOS y particularmente la expresion del gen sfiA, cuyo producto inhibe la
polimerizacion de FtsZ y, por tanto, la division celular (Miller et al., 2003). De Iorma
analoga, si la lactococina 972 inhibiera la Iormacion de los septos a traves de su
union al homologo Iuncional de PBP3 en L. lactis, podria esperarse que indujera la
respuesta SOS en este organismo.
Ahora bien, una de las consecuencias de la respuesta SOS es la induccion de los
proIagos residentes en los genomas bacterianos, lo que ocurre porque la proteasa
RecA rompe el represor viral, induciendose asi el ciclo litico de dichos Iagos
(Ptashne, 1992).
Discusion 97
Todos los Iagos atemperados de L. lactis descritos hasta el momento se engloban
en la especie P335, y todos ellos comparten homologia de secuencia a nivel de ADN
en un unico gen que codiIica para una dUTPasa (Labrie y Moineau, 2002).
En este contexto, si L. lactis MG1614 Iuera lisogenico para algun Iago, una
caracteristica muy comun entre las cepas de lactococos (Cuesta et al., 1995), podria
ocurrir que el tratamiento de sus cultivos con lactococina 972 indujera la liberacion
de una progenie viral, lo que indirectamente conIirmaria la accion de la bacteriocina
sobre el homologo Iuncional de PBP3 de E. coli. La produccion de nuevos Iagos
podria detectarse bien por la aparicion de placas de lisis sobre cespedes de otros
lactococos, o bien por ampliIicacion de un segmento de ADN limitado por
oligonucleotidos correspondientes al gen de la dUTPasa. La induccion de proIago no
dio lugar a placas de lisis en las cepas indicadoras utilizadas, pero si Iue posible
ampliIicar ADN Iagico. Por lo tanto, los resultados obtenidos indican que la
lactococina 972 induce un proIago residente en el genoma de L. lactis MG1614,
presumiblemente como consecuencia de la activacion de la respuesta SOS, lo que
apunta a que, como se habia postulado, la bacteriocina inhibe al homologo de PBP3
de E. coli, el cual habia sido identiIicado en experimentos anteriores como PBP4 de
L. lactis.
De todo lo anterior se deduce que PBP4 seria una transpeptidasa de localizacion
preIerente en el septo de division, lo que indirectamente explicaria el eIecto
antagonista parcial del tripeptido diacetil-!-Lys-"-Ala-"-Ala sobre la actividad de la
bacteriocina, ya que este, al ser un analogo del sustrato del enzima (Nguyen-Disteche
et al., 1982), podria diIicultar la union de la lactococina 972 a PBP4.
Asi pues, parece claro que la lactococina 972 tiene un modo de accion
radicalmente diIerente al mostrado por los peptidos cationicos antimicrobianos que,
como ya se indico, inducen la Iormacion de poros en la membrana citoplasmatica.
Sin embargo, es posible que su accion sobre la pared celular, y en concreto en la Iase
de septacion, no sea un caso excepcional. En un trabajo reciente (Friedrich et al.,
2000) sobre la accion de diIerentes peptidos cationicos sintetizados quimicamente
Irente a bacterias Gram-positivas, se observo que algunos de ellos son capaces de
inducir septacion anormal, e incluso uno de ellos (Bac2A-NH
2
, una version
Discusion 98
linealizada de 12 aminoacidos del peptido ciclico bactenecina, producido por los
neutroIilos bovinos) es capaz de provocar la lisis de celulas de S. aureus actuando en
la zona de Iormacion del septo.
Por lo tanto, la lactococina 972 tiene un valor aplicado potencial como prototipo
de una nueva Iamilia de compuestos que, inhibiendo la actividad enzimatica de las
PBPs, no poseen anillo -lactamico. Estos compuestos, en principio, deberian ser
activos sobre bacterias patogenas productoras de -lactamasas y no deberian inducir
eIectos colaterales indeseables, ya que la septacion es un proceso que no tiene lugar
en los organismos eucariotas. Ahora bien, la aplicacion de estos compuestos pudiera
verse limitada por el espectro de accion tan estrecho de la lactococina 972. Por ello,
es necesario seguir proIundizando en el estudio de la interaccion PBP-lactococina,
con el objeto de determinar que componentes del dipeptido estan implicados en el
reconocimiento especiIico de las celulas diana y cuales antagonizan la actividad
transpeptidasa de estos enzimas.

7" 2%$08++),( 0- 1' 1'+/$+$+)(' 345
9 6-/':$1);6$ 0- 1" <=>?@A !+,-./0
La explotacion de la cepa bacteriocinogenica L. lactis IPLA972 como cultivo
iniciador, asi como la obtencion de grandes cantidades de lactococina 972 para poder
estudiarla en proIundidad, nos impulso a realizar un estudio exhaustivo de los
parametros Iisiologicos optimos que permitiesen obtener una produccion maxima
tanto de biomasa como de bacteriocina. Para ello se estudio el eIecto de la Iuente de
carbono en el crecimiento, metabolismo y produccion de lcn972 en cultivo en
discontinuo, mientras que en cultivo en continuo (quimiostato) se evaluaron los
eIectos combinados de la tasa de dilucion y de la Iuente de carbono.
Estos estudios complementarian a otros realizados previamente (Martinez, 1996)
en los cuales se evaluo la inIluencia del pH en la produccion de lactococina 972 en
cultivo en discontinuo. Los resultados obtenidos revelaron que la produccion de
bacteriocina en medio de crecimiento M17 era maxima cuando el pH se mantuvo
constante a un valor de 6,8. Por lo tanto, este Iue el valor que se eligio para realizar
Discusion 99
los cultivos, tanto en discontinuo como en continuo, de la cepa productora L. lactis
IPLA972, y se utilizo un medio de cultivo complejo, ESTY (de composicion identica
al M17), suplementado con glucosa o lactosa.
Los valores de las velocidades de crecimiento obtenidos en los cultivos en
discontinuo son elevados, como era de esperar cuando se utilizan medios de
crecimiento complejos, de acuerdo con lo observado anteriormente para otros
lactococos (Thompson y Gentry-Weeks, 1994). A pH 6,8, los rendimientos en
biomasa (0,23 a 0,37 g
DCW
/g) Iueron similares a los descritos para otros lactococos
silvestres (R. Carcoba, comunicacion personal). Este parametro disminuye a medida
que la concentracion en glucosa se incrementa en el medio de cultivo, lo cual podria
sugerir un mayor consumo en energia destinado al mantenimiento celular,
probablemente debido a la acumulacion de productos metabolicos Iinales en
concentraciones que pueden resultar toxicas para las celulas (Bibal et al., 1998;
Loubiere et al., 1997).
En los cultivos en continuo se observa que, a medida que aumenta la
concentracion de azucar en el medio, se incrementa la biomasa dentro de un amplio
rango de tasas de dilucion (0,090 0,673 h
-1
). Esto nos indica que es muy
improbable que cualquier otro componente del medio de cultivo sea limitante. Sin
embargo, a D ~ 0,673 h
-1
, la biomasa se reduce considerablemente a pesar de que se
detecta un exceso de Iuente de carbono, y se produce un lavado de los cultivos en el
medio que contiene una concentracion de lactosa del 5 g/L a D ~ 0,894 h
-1
. La unica
excepcion se observa en el medio con glucosa 5 g/L, en el cual no se detecta azucar
residual. En este sentido, cabe señalar que algunos autores indican que la arginina es
el nutriente limitante en los cultivos en continuo cuando en el medio existe un exceso
de Iuente de carbono (Goldner et al., 1985).
De acuerdo con el patron de productos metabolicos Iinales, L. lactis IPLA972 se
comporta como una cepa homolactica, capaz de sintetizar acido lactico en grandes
cantidades. Sin embargo, es capaz de producir un cambio hacia un metabolismo
acido-mixto, principalmente en los cultivos en continuo a bajas tasas de dilucion. En
la literatura se ha descrito que este cambio tiene lugar cuando el Ilujo glicolitico esta
limitado por la disponibilidad del azucar (Cocaign-Bousquet et al., 2002). Se ha
Discusion 100
observado que este metabolismo acido-mixto mejora considerablemente las
propiedades organolepticas de los quesos Iermentados con lactococos silvestres
(Carcoba et al., 2000; Rilla et al., 2003).
En lo reIerente a la produccion de bacteriocina, los resultados obtenidos
conIirman la importancia de la eleccion de las condiciones apropiadas para su
biosintesis, Iavoreciendose en medios que proporcionan una alta densidad celular
(Parente y Ricardi, 1999). De acuerdo con esto, cuando incrementamos la
concentracion de la Iuente de carbono observamos en los cultivos en discontinuo que
aumenta considerablemente la produccion de lcn972. En nuestro estudio utilizamos
20 g/L como limite superior de concentracion de Iuente de carbono. Descartamos la
utilizacion de niveles superiores porque existen diversos estudios que indican que
concentraciones muy altas, no solo no aumentan el titulo de bacteriocina sino que
poseen eIectos negativos en la produccion de la misma (Parente et al., 1997; ZamIir
et al., 2000; Guerra et al., 2001; Cheigh et al., 2002). Ademas, la cepa L. lactis
IPLA972 es muy acidiIicante y los niveles de acido lactico y Iormico obtenidos (125
nM y 20 mM, respectivamente) son muy proximos a los descritos como
autoinhibitorios (Cachon y Divies, 1993; Loubiere et al., 1997).
La naturaleza de la Iuente de carbono (glucosa o lactosa) apenas aIecta al total
de la actividad de bacteriocina obtenida en los cultivos en discontinuo. Sin embargo,
el rendimiento de bacteriocina y la velocidad especiIica de produccion Iueron
superiores en los cultivos con lactosa. Esto podria implicar una regulacion mediante
la Iuente de carbono, como en el caso de la nisina, cuyo promotor es inducible por la
lactosa y galactosa (Chandrapati y O`Sullivan, 2002).
Los datos de produccion de bacteriocina en los cultivos en discontinuo deben
interpretarse con precaucion a la hora de obtener las conclusiones sobre la cinetica de
la produccion de bacteriocina, puesto que los niveles detectados en los sobrenadantes
representan el balance entre la acumulacion y la inactivacion durante el proceso de
Iermentacion. Ademas, en este tipo de cultivos existen diIerentes variables que son
susceptibles de cambiar a lo largo del periodo de incubacion, como la velocidad de
crecimiento, la disponibilidad del nutriente limitante y la acumulacion de los
productos metabolicos Iinales, lo cual puede inIluenciar la velocidad de sintesis de la
Discusion 101
bacteriocina. A este respecto, los cultivos en quimiostato nos oIrecen la posibilidad
de manipular la velocidad de crecimiento, mientras el resto de las variables se
mantienen constantes.
Asi, la produccion de bacteriocina en quimiostato conIirma que sigue la cinetica
de un metabolito primario asociada con el crecimiento celular, ya que la sintesis de
lcn972 tiene lugar, principalmente, a tasas de dilucion cercanas a la µ
max
(91° -
96°) en las diIerentes condiciones de Iuente de carbono ensayadas, excepto en
presencia de lactosa 20 g/L. En este caso, el maximo de la produccion tiene lugar al
66° de la µ
max
. Sin embargo, este dato debe tomarse con precaucion debido a la
Iuerte adherencia celular a la pared del vaso (wall-growth), observada a altas D bajo
estas condiciones de crecimiento. Debido a esto, los calculos de los parametros
cineticos no son muy exactos, pues las celulas adheridas pueden sintetizar
bacteriocina pero no son cuantiIicadas como biomasa. Este Ienomeno ha sido
descrito previamente en los lactococos (Rogers et al., 1978) y se ha asociado a
cambios en la superIicie bacteriana debidos, por ejemplo, a la sintesis de
exopolisacaridos, un hecho comun entre las BAL que se encuentran creciendo en
exceso de Iuente de carbono (de Vuyst et al., 2001). Precisamente, es este el
ambiente en el que se encuentran los cultivos de L. lactis IPLA972 cuando estamos
trabajando a valores altos de D.
En los cultivos en quimiostato, se observa tambien una elevada inIluencia de la
tasa de dilucion en la sintesis de lcn972. Esta correlacion con la velocidad de
crecimiento ha sido descrita para otras bacteriocinas. La produccion de nisina y
plantaricina C (Meghrous et al., 1992; Barcena et al., 1998) tiene lugar a valores de
D inIeriores a la µ
max
, mientras que existe una relacion lineal para la bavaricina MN y
la enterocina 1146 (Kaiser y Monteville, 1993; Parente et al., 1997).
Los rendimientos en lcn972 se mejoran unas 10 veces en los cultivos en
continuo. De los diIerentes tipos de cultivo utilizados, se obtiene el mejor
rendimiento en quimiostato a pH 6,8 y glucosa 20 g/L. De esta manera, podemos
asegurar altos niveles de lcn972 en los sobrenadantes en un amplio rango de
condiciones (entre 12° y 91° de la µ
max
), lo que Iacilitaria la obtencion lcn972 en
grandes cantidades, destinadas a la caracterizacion posterior de esta bacteriocina.
Discusion 102
Ademas, estas condiciones de crecimiento son adecuadas tambien para obtener una
gran cantidad de biomasa, necesaria para disponer de concentrados de la cepa
productora que podrian ser utilizados como cultivo iniciador en la Iabricacion de
quesos.














"#$"%&'(#$)'

Conclusiones 103

















"# $%&$'()*%&+)

1ª El plasmido pBL1, de 10,9 kb, alberga todos los determinantes geneticos
necesarios para la biosintesis de la lactococina 972 y para la inmunidad de la
cepa productora Irente a dicho peptido antimicrobiano. En el plasmido se
distinguen dos regiones que estan Ilanqueadas por secuencias de insercion
derivadas de ISS1. Una de ellas alberga los genes de replicacion, mientras en
la otra se encuentran los tres genes responsables de la sintesis/inmunidad de
la bacteriocina.

2ª Los genes de sintesis/inmunidad de la bacteriocina Iorman un unico operon,
cuyos transcritos presentan regiones 5` y 3` que no se traducen y que,
presumiblemente, les conIieren estabilidad.

3ª La lactococina 972, producto de la expresion de lclA, se sintetiza como una
prebacteriocina que contiene un peptido señal, tipico de las proteinas que se
exportan por el sistema SEC de secrecion general. El resto de la molecula
presenta una alta proporcion en aminoacidos de pequeño tamaño, lo que le
conIiere un alto grado de libertad conIormacional.

Conclusiones 104
4ª Las proteinas LclB y LclC, que derivan de los otros dos genes del operon,
presentan caracteristicas que sugieren que actuan coordinadamente. LclB
posee varios segmentos hidroIobicos que indican una localizacion
transmembranal, mientras que LclC presenta los motivos tipicos de las
proteinas que transIieren energia a traves de la hidrolisis de ATP. Se postula
que ambas participan en la inmunidad Irente a la bacteriocina, al impedir que
alcance su blanco molecular de accion.

5ª En los genomas de multiples bacterias Gram-positivas aparecen operones con
una organizacion semejante a la del que codiIica para la lactococina 972. Este
hecho, junto a la presencia del operon de la bacteriocina en un plasmido y que
este Ilanqueado por secuencias de insercion, sugiere que dicho operon se
habria incorporado a un plasmido ancestral criptico, para dar lugar a pBL1.

6ª En Lactococcus lactis se han detectado siete proteinas de union a penicilina
con tamaños que oscilan entre 85 y 44 kDa. De entre ellas, la PBP4, de 55
kDa, es el blanco al que se une la lactococina 972, lo que tiene como
consecuencia el bloqueo de la Iormacion del septo de division celular. Por
tanto, PBP4 de L. lactis se comporta Iisiologicamente como la PBP3 de
Escherichia coli, una transpeptidasa cuya inhibicion provoca la detencion de
la generacion del septo en este ultimo organismo. Esta semejanza no es solo
Iuncional, sino tambien estructural, ya que anticuerpos generados contra
PBP3 de E. coli, reconocen a PBP4 de L. lactis como antigeno.

7ª La lactococina 972 induce la respuesta SOS en Lactococcus lactis ya que
provoca la induccion de un proIago en una cepa lisogenica. De modo
semejante, ciertos antibioticos -lactamicos, especiIicos para la proteina
PBP3 tambien inducen la respuesta SOS en E. coli. Este es un nuevo dato a
Iavor de la identidad Iuncional de PBP4 de L. lactis y PBP3 de E. coli.

Conclusiones 105
8ª La cinetica de biosintesis de la lactococina 972 es la propia de un metabolito
asociado a crecimiento, es decir, su concentracion aumenta de Iorma
directamente proporcional al incremento en biomasa que se produce durante
la Iase exponencial de crecimiento de Lactococcus lactis IPLA972 cuando se
cultiva en cultivo discontinuo. Correspondientemente, el incremento de la
concentracion de Iuente de carbono (glucosa o lactosa) se traduce en un
mayor rendimiento en bacteriocina.

9ª La cinetica de metabolito asociado a crecimiento mostrada por la lactococina
972 Iue corroborada mediante cultivo continuo (quimiostato), dado que la
biosintesis de bacteriocina tuvo lugar principalmente en tasas de dilucion
proximas a la µ
max
en todas las condiciones de Iuente de carbono ensayadas,
excepto en presencia de 20 g/L de lactosa. En este caso, el maximo de
produccion tuvo lugar a una tasa de dilucion equivalente al 66° de la µ
max
.

10ª El cultivo en continuo (quimiostato) en un medio de crecimiento complejo a
pH 6,8 y utilizando como Iuente de carbono glucosa a 20 g/L, permite
obtener el maximo rendimiento en bacteriocina, que se consigue, ademas, en
un amplio rango de tasas de dilucion (entre el 12 ° y el 91 ° de µ
max
).

11ª La cepa productora de lactococina 972 muestra un metabolismo
predominantemente homolactico con las dos Iuentes de carbono ensayadas y
a altas tasas de dilucion. A tasas bajas, la menor disponibilidad de azucar se
traduce en un cambio hacia un metabolismo acido-mixto, de modo que,
ademas de acido lactico, se producen otros acidos organicos (acetico y
Iormico).














"#"$#%&'()*(

BibliograIia 107









VI. BIBLIOGRAFIA
Abee, T. 1995. 'Pore-Iorming bacteriocins oI Gram-positive bacteria and selI-
protection mechanisms oI producer organisms¨. FEMS Microbiol. Lett. 129: 1-
10.
Altena, K., Guder, A., Cramer, C. y Bierbaum, G. 2000. 'Biosynthesis oI the
lantibiotic mersacidin: organization oI a type B lantibiotic gene cluster¨. Appl.
Environ. Microbiol. 66: 2565-2571.
Ames, G.F.L., Mimura, C. y Shyamala, V. 1990. 'Bacterial periplasmic permeases
belong to a Iamily oI transport proteins operating Irom Escherichia coli to
human traIIic ATPases¨. FEMS Microbiol. Rev. 75: 429-446.
Atschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, 1., Zhang, Z., Miller, W. y
Lipman, D.1. 1997. 'Gapped BLAST and PSI-BLAST: a new generation oI
protein database search programs¨. Nucleic Acid Res. 25: 3389-3402.
Axelsson, L.T. 1993. 'Lactic acid bacteria: classiIication and physiology¨. En Lactic
acid bacteria (Salminen, S. y von Wright, A., Eds.). Marcel Dekker, Inc. pp. 1-
63.
Axelsson, L.T. y Holck, A. 1995. 'The genes involved in production oI and immunity
to sakacin A, a bacteriocin Irom Lactobacillus sake Lb706¨. J. Bacteriol. 177:
2125-2137.
!

BibliograIia 108
Ayala, 1.A., Plá, 1., Desviat, L.R. y de Pedro, M. 1988. 'A lacZ-pbpB gene Iusion
coding Ior an inducible hybrid protein that recognizes localized sites in the
inner membrane oI Escherichia coli¨. J. Bacteriol. 170: 3333-3341.
Aymerich, T., Holo, H., Harvarstein, L.S., Hugas, M., Garriga, M. y Nes, I.F.
1996. 'Biochemical and genetic characterisation oI enterocin A Irom
Enterococcus faecium, a new antilisterial bacterium in the pediocin Iamily oI
bacteriocins¨. Appl. Environ. Microbiol. 62: 1676-1682.
Bárcena, B.1.M., Siñeriz, F., González de Llano, D., Rodríguez, A., Suárez, 1.E.
1998. 'Chemostat production oI plantaricin C by Lactobacillus plantarum
LL41¨. Appl. Environ. Microbiol. 64: 3512-3514.
Bayer, E.A., Skutelsky, E. y Wilchek, M. 1982. 'The ultrastructural visualization oI
cell surIace glycoconjugates¨. Methods En:vmol. 83: 195-215.
Bhugaloo-Vial, P., Grajek, W., Dousset, X. y Boyaval, P. 1997. 'Continuous
bacteriocin production with high cell density bioreactors¨. En:vme Microb.
Technol. 21: 450-457.
Bhumia, A.K., 1ohnson, M.C. y Ray B. 1987. 'Direct detection oI an antimicrobial
peptide oI Pediococcus acidilactici in sodium dodecyl sulIate polyacrylamide
gel electrophoresis¨. J. Ind. Microbiol. 2: 319-322.
Bhunia, A.K., Ray, P., 1ohnson, M.C. y Ray, B. 1994. 'Determination oI
bacteriocin-encoding plasmids oI Pediococcus acidilactici strain by Southern
hybridization¨. Lett. Appl. Microbiol. 18: 168-170.
Bibal, B., Goma, G., Vayssier, Y. y Pareilleux, A. 1998. 'InIluence oI pH, lactose
and lactic acid on the growth oI Streptococcus cremoris: a kinetic study¨. Appl.
Microbiol. Biotech. 28: 340-344.
Bierbaum, G. y Sahl, H.G. 1985. 'Induction oI autolysis oI staphylococci by the
basic peptide antibiotics Pep5 and nisin and their inIluence on the activity
autolytic enzymes¨. Arch. Microbiol. 141: 249-254.
#
BibliograIia 109
Birboim, H.C. y Doly, 1. 1979. 'A rapid alkaline extraction procedure Ior screening
recombinant plasmid DNA¨. Nucleic Acids Res. 7: 1513-1523.
Biswas, S.R., Ray, P., 1ohnson, M.C. y Ray, B. 1991. 'InIluence oI growth
conditions on the production oI a bacteriocin pediocin AcH, by Pediococcus
acidilactici¨. Appl. Environ. Microbiol. 57: 1265-1267.
Bollag, D.M. y Edelstein, S.1. 1991. 'Gel electrophoresis under denaturing
conditions¨. En Protein methods. pp. 95-142. Wiley-Liss, New York.
Borges-Walmsley, M.I., McKeegan, K.S. y Walmsley, A.R. 2003. 'Structure and
Iunction oI eIIlux pumps that conIer resistance to drugs¨. Biochem. J. 376:
313-318.
Botta, G.A. y Park, 1.T. 1981. 'Evidence Ior involvement oI penicillin-binding
protein 3 in murein synthesis during septation but not during cell elongation¨.
J. Bacteriol. 145: 333-40.
Bradford, M.M. 1976. 'A rapid and sensitive method Ior the quantitation oI
microgram quantities oI protein utilizing the principle oI protein-dye binding¨.
Anal. Biochem. 72: 248-254.
Bramhill, D. 1997. 'Bacterial cell division¨. Annu. Rev. Cell Dev. Biol. 13: 395-424.
Breukink, E., Wiedemann, I., van Kraaij, C., Kuipers, O.P., Sahl, H.G. y de
Kruijff, B. 1999. 'Use oI the cell wall precursor lipid II by a pore-Iorming
peptide antibiotic¨. Science. 286: 2361-2364.
Brötz, H., Bierbaum, G., Markus, A., Molitor, E. y Sahl, H.G. 1995. 'Mode oI
action oI the lantibiotic mersacidin inhibition oI peptidoglycan synthesis via a
novel mechanism?¨ Antimicrob. Agents Chemother. 39: 714-719.
Brötz, H., Bierbaum, G., Reynolds, P.E. y Sahl, H.G. 1997. 'The lantibiotic
mersacidin inhibits peptidoglycan biosynthesis at the level oI
transglycosylation¨. Eur. J. Biochem. 246: 193-199.


BibliograIia 110
Brötz, H., 1osten, M., Wiedemann, I., Schneider, U., Gotz, F., Bierbaum, G. y
Sahl, H.G. 1998. 'Role oI lipid-bound peptidoglycan precursors in the
Iormation oI pores by nisin, epidermin and other lantibiotics¨. Mol. Microbiol.
30: 317-327.
Cachon, R. y Divies, C. 1993. 'Modelling oI growth and lactate Iermentation by
Lactococcus lactis subps. lactis biovar. diacetvlactis in batch culture¨. Appl.
Microbiol. Biotech. 40: 28-33.
Callewaert, R. y de Vuyst, L. 2000. 'Bacteriocin production with Lactobacillus
amvlovorus DCE 471 is improved and stabilized by Ied batch Iermentation¨.
Appl. Environ. Microbiol. 66: 606-613.
Cárcoba, R., Delgado, T. y Rodríguez, A. 2000. 'Comparative perIormance oI a
mixed strain starter in cow`s milk, ewe`s milk and mixtures oI these milds¨.
Eur. Food Res. Technol. 211: 141-146.
Chaillou, S., Postma P.W. y Pouwels, P.H. 1998. 'Functional expression in
Lactobacillus plantarum 80 oI xvlP encoding the isoprimeverose transporter oI
Lactobacillus pentosus¨. J. Bacteriol. 180: 40114014.
Chandrapati, S. y O`Sullivan, D.1. 2002. 'Characterization oI the promoter regions
involved in galactose- and nisin-mediated induction on the nisA gene in
Lactococcus lactis ATCC 1454¨. Mol. Microbiol. 46: 467-477.
Cheigh, C.I., Choi, H.1., Oark, H., Kim, S.B., Kook, M.C., Kim, T.S., Hwang,
1.K. y Pyun, Y.R. 2002. 'InIluence oI growth conditions on the production oI
a nisin-like bacteriocin by Lactococcus lactis subsp. lactis A164 isolated Irom
kimchi¨. J. Biotechnol. 95: 225-235.
Chinachoti, N., Matsusaki, H., Sonomoto, K. y Ishikazi, A. 1997a. 'Utilization oI
xylose as an alternative carbon source Ior nisin Z production by Lactococcus
lactis IO-1¨. J. Fac. Agric. Kuvshu. Univ. 42: 171-181.

$
BibliograIia 111
Chinachoti, N., Zaima, T., Matsusaki, H., Sonomoto, K. y Ishikazi, A. 1997b.
'Relationship between nisin Z Iermentative production an aeration condition
using Lactococcus lactis IO-1¨. J. Fac. Agric. Kvushu. Univ. 43: 437-448.
Chinachoti N., Endo, N., Sonomoto, K. y Ishikazi, A. 1997c. 'Bioreactor systems
Ior eIIicient production and separation oI nisin Z production by Lactococcus
lactis IO-1¨. Fac. Agric. Kvushu. Univ. 42: 421-436.
Cintas, L. M., Casaus, P., Havarstein, L. S., Hernandez, P. E. y Nes, I. F. 1997.
'Biochemical and genetic characterization oI enterocin P, a novel sec-
dependent bacteriocin Irom Enterococcus faecium P13 with a broad
antimicrobial spectrum¨. Appl. Environ. Microbiol. 63: 4321-4330.
Claros, M.D. y von Heijne, G. 1994. 'TopPred II: an improved soItware Ior
membrane protein structure prediction¨. CABIOS. 10: 685-686.
Cleveland, 1., Montville, T.1., Nes, I.F. y Chikindas, N.L. 2001. 'Bacteriocins: saIe,
natural antimicrobials Ior Iood preservation¨. Int. J Food Microbiol. 71: 1-20.
Cocaign-Bousquet, M., Even, S., Lindley, N.D. y Loubiere, P. 2002. 'Anaerobic
sugar catabolism in Lactococcus lactis genetic regulation and enzyme control
over pathway Ilux¨. Appl. Microbiol. Biotechnol. 60: 24-32.
Cuesta, E.P., Suárez, 1.E. y Rodríguez, A. 1995. 'Incidence oI lysogeny in wild
lactococcal strains¨. J. Dairv Science. 78: 998-1003.
Dalet, K., Cenatiempo, Y., Cossart, P. y Héchard, A. 2001. 'A sigma(54)-
dependent PTS permease oI the mannose Iamily is responsible Ior sensitivity
oI Listeria monocvtogenes to mesentericin Y105¨. Microbiologv. 147: 1575-
1580.
de Ruyter, P.G.G.A., Kuipers, O.P., Beerthuyzen, M.M., van Alen-Boerigter, I. y
de Vos, W.M. 1996a. 'Functional analysis oI promoters in the nisin gene
cluster oI Lactococcus lactis¨. J. Bacteriol. 178: 3434-3439.

%
BibliograIia 112
de Ruyter, P.G.G.A., Kuipers, O.P. y de Vos, W.M. 1996b. 'Controlled gene
expression systems Ior Lactococcus lactis with the Iood-grade inducer nisin¨.
Appl. Environ. Microbiol. 62: 3662-3667.
de Vuyst, L. y Vandame, E. 1. 1992. 'InIluence oI the carbon source on nisin
production in Lactococcus lactis subsp. lactis batch Iermentation¨. J. Gen.
Microbiol. 138: 571-578.
de Vuyst, L. y Vandame, E.1. 1993. 'InIluence oI the phosphorus and nitrogen
source on nisin production in Lactococcus lactis subsp. lactis batch
Iermentations using a complex medium¨. Appl. Microbiol. Biotechnol. 40: 17-
22.
de Vuyst, L. y Vandame, E.1. 1996. 'Lactic acid bacteria and bacteriocins: their
practical importance¨. En Bacteriocins of lactic acid bacteria. L. de Vuyst and
E.J. Vandame (eds.). Blackie academic and proIessional. pp. 1-11.
de Vuyst, L., Callewaert, R y Crabbé, K. 1996. 'Primary metabolite kinetics oI
bacteriocin biosynthesis by Lactobacillus amvlovorus and evidence Ior
stimulation oI bacteriocin production under unIavourable growth conditions¨.
Microbiologv. 142: 817-827.
de Vuyst, L., de Vin, F., Vanilgelgem, F. y Degeest, B. 2001. 'Recent developments
in the biosynthesis and applications oI heteropolysaccharides Irom lactic acid
bacteria¨. Int. Dairv J. 11: 687-707.
Dellagio, F., de Roissart, H., Toniani, S., Curk, M.C. y 1anssens, D. 1994.
'Caracteristiques generales des bacteries lactiques¨ En Bateries Lactiques. H.
de Roissart y F.M. Luquet (eds.). pp. 25-116. Lorica. Uriage, La France.
Desmazeaud, M.1. y de Roissart, H. 1994. 'Metabolisme general des bacteries
lactiques¨. En Bacteries Lactiques. H. de Roissart y F.M. Luquet (eds.). pp.
169-207. Lorica. Uriage, La France.
Devereux, 1., Haeberly, P., y Smithies, O. 1984. 'A comprehensive set oI sequence
analysis programs Ior the vax¨. Nucleic Acids Res. 12: 387395.

BibliograIia 113
Diep, D.B., Harvarstein, L.S., Nissan-Meyer, 1. y Nes, I.F. 1994. 'The gene
encoding plantaricin, a bacteriocin Irom Lactobacillus plantarum C11, is
located on the same transcription unit as an arg-like regulatory system¨. Appl.
Envirom. Microbiol. 60: 160-166.
Diep, D.B., Harvarstein, L.S. y Nes, I.F. 1996. 'Characterization oI the locus
responsible Ior the production in Lactobacillus plantarum C11¨. J. Bacteriol.
178: 4472-4483.
Dougherty, B.A., Hill, C., Weidman, 1.F., Richardson, D.R., Venter, 1.C. y Ross,
R.P. 1998. "Sequence and analysis oI the 60 kb conjugative, bacteriocin-
producing plasmid pMRC01 Irom Lactococcus lactis DPC3147". Mol.
Microbiol. 29: 1029-1038.
Dower, W.1., Miller, 1.F. y Ragsdale, C.W. 1988. 'High eIIiciency transIormation
oI Escherichia coli by high voltage electroporation¨. Nucleic Acids Res. 16:
6127-6145.
Eijsink, V.G.H., Brurberg, M.B., Middelhoven, P.H. y Nes, I.F. 1996. 'Induction
oI bacteriocin production in Lactobacillus sake by a secreted peptide¨. J.
Bacteriol. 178: 2232-2237.
Eijsink, V.G.H., Skeie, M., Middelhoven, P.H., Brurberg, M.B. y Nes, I.F. 1998.
'Comparative studies oI Class IIa bacteriocins oI lactic acid bacteria¨. Appl.
Environ. Microbiol. 64: 3275-3281.
Eijsink, V.G.H., Axelsson, L., Diep, D.B., Harvarstein, L.S., Holo, H. y Nes, I.F.
2002. 'Production oI class II bacteriocins by lactic acid bacteria; an example oI
biological warIare and communication¨. Antonie van Leeuwenhoek. 81: 639-
654.
Engelke, G., Gutowski-Eckel, Z., Hammelmann, M. y Entian, K.D. 1992.
'Biosynthesis oI the lantibiotic nisin: genomic organization and membrane
localization oI the NisB protein¨. Appl. Environ. Microbiol. 58: 3730-3743.
&
BibliograIia 114
Ennahar, S., Sonomoto, K. y Ishizaki, A. 1999. 'Class IIa bacteriocins Irom lactic
acid bacteria: antibacterial activity and Iood preservation¨. J. Biosci. Bioeng.
87: 705-716.
Ennahar, S., Sashihara, T., Sonomoto, K. y Ishizaki, A. 2000. 'Class IIa
bacteriocins: biosynthesis, structure and activity¨. FEMS Microbiol. Rev.
24:85-106.
Errington, 1., Daniel, R.A. y Scheffers, D.1. 2003. 'Cyotokinesis in bacteria¨.
Microbiol. Mol. Biol. Rev. 67: 52-65.
Fath, M. 1. y Kolter, R. 1993. 'ABC transporters: Bacterial exporters`. Microbiol.
Reviews. 57: 995-1017.
Fiedler, S. y Wirth, R. 1988. 'TransIormation oI bacteria with plasmid DNA by
electroporation¨. Anal. Biochem. 170: 38-44.
Fimland, G., Eijsink, V.G.H. y Nissen-Meyer, 1. 2002. 'Comparative studies oI
immunity proteins oI pediocin-like bacteriocins¨. Microbiologv. 148: 3661-
3670.
Franke, C.M., Tiemersma, 1., Venema, G. y Kok, 1. 1999. 'Membrane topology oI
the lactococcal bacteriocin ATP-binding cassette transporter protein LcnC¨. J.
Biol. Chem. 274: 8484-8490.
Fremaux, C., Ahn, C. y Klaenhammer, T.R. 1998. 'Molecular analysis oI the
lactocin F operon¨. Appl. Environ. Microbiol. 59: 3906-3915.
Friedrich, C.L., Moyles, D., Beveridge, T.1. y Hancock, R.E.W. 2000.
'Antibacterial action oI structurally diverse cationic peptides on Gram-positive
bacteria¨. Antimicrob. Agents. Chemother. 44: 2086-2092.


'
BibliograIia 115
Gajic, O., Buist, G., Kojic, M., Topisirovic, L., Kuipers, O.P. y Kok, 1. 2003.
'Novel mechanism oI bacteriocin secretion and immunity carried out by
lactococcal multidrug resistance proteins¨. J. Biol. Chem. 278: 34291-34298.
Garneau, S., Martin, N.I. y Vederas, 1.C. 2002. 'Two-peptide bacteriocins produced
by lactic acid bacteria¨. Biochimie. 84: 577-592.
Gasson, M. 1. 1983. 'Plasmids complements oI Streptococcus lactis NCDO 712 and
other lactic streptococci protoplast-induced curing¨. J. Bacteriol. 154: 1-9.
Gattiker, A., Gasteiger, E y Barroch, A. 2002. 'ScanProsite: a reIerence
implementation on a PROSITE scanning tool¨. Appl. Bioinf. 1: 107-108.
Gaudu, P., Vido, K., Cesselin, B., Kulakauskas, S., Tremblay, 1., Rezaïki, L.,
Lamberet, G., Sourice, S., Duwat, P. y Gruss, A. 2002. 'Respiration capacity
and consequences in Lactococcus lactis¨. Antonie van Leeuwenhoek. 82: 263-
269.
Goldner, S.B., Solberg, M. y Post, L.S. 1985. 'Development oI a minimal medium
Ior Clostridium perfringens by using an anaerobic chemostat¨. Appl. Environ.
Microbiol. 50: 202206.
González de Llano, D., Rodríguez, A. y Cuesta, P. 1996. 'EIIect oI lactic starter
cultures on the organic acid composition oI milk and cheese during ripening-
analysis by HPLC¨. J. Appl. Bacteriol. 80: 570-576.
Gratia, A. 1925. 'Sur un remarquable exemple d´antagonism entre deux souches de
colibacille¨. C. R. Soc. Biol. Fill. 93: 1040-1041.
Gruber, C.E. 1992. 'High-eIIiciency cDNA cloning: a comparison oI electroporation
and in vitro packaging¨. Biotechniques. 12: 804-806.
Guerra, N.P., Rua, M.L. y Pastrana, L. 2001. Nutritional Iactors aIIecting the
production oI two bacteriocins Irom lactic acid bacteria on whey¨. Int. J. Food
Microbiol. 70: 267-281.
(
BibliograIia 116
Harlow, E. y Lane, D. 1998. 'Storing and puriIying antibodies¨. Antibodies. a
laboratorv manual. Cold Spring Harbor Laboratory. 8: 283-318.
Harvarstein, L.S., Holo, H. y Nes, I.F. 1994. 'The leader peptide oI collicin shares
consensus sequences with leader peptides that are common amongst peptide
bacteriocins produced by Gram-positive bacteria¨. Microbiologv. 140: 2383-
2389.
Harvarstein, L.S., Diep, B.D. y Nes, I.F. 1995. 'A Iamily oI bacteriocin ABC
transporters carry out proteolytic processing oI their substrates concomitant
with export¨. Mol. Microbiol. 16: 229-240.
Héchard, Y. y Shal, H.G. 2002. 'Mode oI action oI modiIied and unmodiIied
bacteriocins Irom Gram-positive bacteria¨. Biochimie. 84: 545-557.
Héchard, Y., Pelletier, C., Cenatiempo, Y. y Frere, 1. 2001. 'Analysis oI
sigma(54)-dependent genes in Enterococcus faecalis: a manose PTS permease
(EII(Man)) is involved in sensitivity to a bacteriocin, mesentericin Y105¨.
Microbiologv. 147: 1575-1780.
Henikoff, S. y Henikoff, 1.G. 1992. 'Amino acid substitution matrices Irom protein
blocks¨. Proc. Natl. Acad. Sci. USA. 89: 10915-10919.
Higgins, C.F., Gallagher, M.P., Mimmack, M.L. y Pearce, S.R. 1988. 'A Iamily oI
closely related ATP-binding subunits Irom prokaryotic and eukaryotic cells¨.
BioEssavs. 8: 111-116.
Hofmann, K. y Stoffel, W. 1993. 'TM-base: a database oI membrane spanning
proteins segments¨. Biol. Chem. Hope-Sevler. 374: 166.
Holland, I.B. y Blight, M.A. 1999. 'ABC-ATPases, adaptable energy generators
Iuelling transmembrane movement oI a variety oI molecules in organisms Irom
bacteria to humans¨. J. Mol. Biol. 293: 381-399.
Hoover, D.G. 1993. 'Bacteriocins with potential Ior use in Ioods¨. En Antimicrobials
in foods. P.M. Davidson y A.L. Branen (eds). Marcel Dekker, INC.pp.409-439.
)
BibliograIia 117
Huang, D.C., Novel, M., Huang, X.F. y Novel, G. 1992. 'Nonidentity between
plasmid and chromosomal copies oI ISS1-like sequences in Lactococcus lactis
subsp. lactis CNRZ270 and their possible role in chromosomal integration on
plasmid genes¨. Gene. 118: 39-46.
Imai, K. y Kitajima, M. Patent JP1997037787-1 / 10 Feb 1997.
1ack, R.W., Tagg, 1.R. y Ray, B. 1995. 'Bacteriocins oI Gram-positive bacteria¨.
Microbiol. Rev. 59: 171-200.
1acob, F., Lwof, A., Simonovitch, A. y Wollman, E.L. 1953. 'DeIinition de
quelques termes relatiIs a la lysogenie`. Ann. Inst. Pasteur. 84: 222-224.
1ohnsen, L., Fimland, G., Mantzilas, D. y Nissen-Meyer, 1. 2004. 'Structure-
Iunction analysis oI immunity proteins oI pediocin-like bacteriocins: C-
terminal parts oI immunity proteins are involved in speciIic recognition oI
cognate bacteriocins¨. Appl. Environ. Microbiol. 70: 2647-2652.
Kaiser, A.L. y Montville, T.1. 1993. 'The inIluence oI pH and growth rate on the
production oI the bacteriocin, bavaricin MN, in batch and continuous
Iermentation¨. J. Appl. Bacteriol. 75: 536-540.
Kaiser, A.L. y Montville, T.1. 1996. 'PuriIication oI the bacteriocin bavaricin MN
and characterization oI its mode oI action against Listeria monocvtogenes Scott
A cells and lipid vesicles¨. Appl. Environ. Microbiol. 62: 10881-10890.
Kalmokoff, M. L., Banerjee, S. K., Cyr, T., Hefford, M. A. y Gleeson, T. 2001.
'IdentiIication oI a new plasmid-encoded sec-dependent bacteriocin produced
by Listeria innocua 743¨. Appl. Environ. Microbiol. 67: 4041-4047.
*
+
,
BibliograIia 118
Kim, W.S., Hall, R.1. y Dunn, N.W. 1997. 'The eIIect oI nisin concentration and
nutrient depletion on nisin production oI Lactococcus lactis¨ Appl. Microbiol.
Biotechnol. 48: 449-453.
Kim, W.S., Hall, R.1. y Dunn, N.W. 1998. 'Improving nisin production by
increasing nisin immunity/resistance genes in the producer organism
Lactococcus lactis¨. Appl. Microbiol. Biotechnol. 50: 429-433.
Klaenhammer, T.R. 1993. 'Genetics oI bacteriocins produced by lactic acid
bacteria¨. FEMS Microbiol. Rev. 12: 39-86.
Kleerebezem, M., Beerthuyzen, M. M., Vaughan, E. E., de Vos, W. M. y Kuipers,
O. P. 1997. 'Controlled gene expression systems Ior lactic acid bacteria:
transIerable nisin-inducible expression cassettes Ior Lactococcus, Leuconostoc,
and Lactobacillus spp.¨. Appl. Environ. Microbiol. 63: 4581-4584.
Konisky, 1. 1982. 'Colicins and other bacteriocins with established modes oI action¨.
Annu. Rev. Microbiol. 36: 125-144.
Kuipers, O.P., de Ruyter, P.G.G.A., Kleerebezen, M. y de Vos, W.M. 1998.
'Quorum sensing-controlled gene expression in lactic acid bacteria¨. J.
Biotechnol. 64: 15-21.
Labrie, S. y Moineau, S. 2002. 'Complete genomic sequence oI bacteriophage ul36:
demonstration oI phage heterogeneity within the P335 quasi-species oI
lactococcal phages¨. Jirologv. 296: 308-320.
Laemmli, U.K. 1970. 'Cleavage oI structural proteins during the assembly oI the head
oI bacteriophage T4¨. Nature. 227: 680-685.
Laible, G., Hakenbeck, R., Sicard, M.A., 1oris, B., Ghuysen, 1.M. 1989.
'Nucleotide sequences oI the pbpX genes encoding the penicillin-binding
proteins 2x Irom Streptococcus pneumoniae R6 and a ceIotaxime-resistant
mutant, C506¨. Mol, Microbiol. 3: 1337-48.

-
BibliograIia 119
Leenhouts, K.1., Kok, 1. y Venema G. 1990. 'Stability oI integrated in the
chromosome oI Lactococcus lactis¨. Appl. Environ. Microbiol. 56: 2726-2735.
Leer, R.L., van der Vossen, 1.M.B.M., van Gezen, M., van Noort, 1.M. y Pouwels,
P.H. 1995. Genetic analysis oI acidocin B, a novel bacteriocin produced by
Lactobacillus acidophilus. Microbiologv. 141: 1629-1635.
Lejeune, R., Callewaert, K., Crabbé, K. y de Vuyst, L. 1998. 'Modelling the
growth and bacteriocin production by Lactobacillus amvlovorus DCE 471 in
batch cultivation¨. J. Appl. Microbiol. 84: 159-168.
Leroy, F. y De Vuyst, L. 1999. 'Temperature and pH conditions that prevail during
Iermentation oI sausages are optimal Ior production oI the antilisterial
bacteriocin sakacin K¨. Appl. Environ. Microbiol. 65: 974981.
Leroy, F. y de Vuyst, L. 2001. 'Growth oI the bacteriocin-producing Lactobacillus
sakei strain CTC 494 in MRS broth is strongly reduced due to nutrient
exhaustion: a nutrient depletion model Ior the growth oI lactic acid bacteria¨.
Appl. Environ. Microbiol. 67: 4407-4413.
Loubiere, P., Cocaign-Bousquet, M., Matos, 1., Goma, G. y Lindley, M.D. 1997.
'InIluence oI end-products inhibition and nutrient limitations on the growth oI
Lactococcus lactis subsp. lactis¨. J. Appl. Microbiol. 82: 95-100.
McAuliffe, O., Ryan, M.P., Ross, R.P., Hill, C., Breeuwer, P. y Abee, T. 1998.
'Lacticin 3147, a broad-spectrum bacteriocin which selectively dissipates the
membrane potential¨. Appl. Environ. Microbiol. 64: 439-445.
McAuliffe, O., Ross, R.P. y Hill, C. 2001. 'Lantibiotics: structure, biosynthesis and
mode oI action¨. FEMS Microbiol. Rev. 25: 285-308.
Maniatis, T., Fritsch, E.F. y Sambrook, 1. 1982. 'Molecular cloning: a laboratory
manual¨. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.


.
BibliograIia 120
Marchler-Bauer, A., Anderson, 1.B., DeWeese-Scott, C., Fedorova, N.D., Geer,
L.Y., He, S., Hurwitz, D.I., 1ackson, 1.D., 1acobs, A.R., Lanczycki, C.1.,
Liebert, C.A., Liu, C., Madej, T., Marchler, G.H., Mazumder, R.,
Nikolskaya, A.N., Panchenko, A.R., Rao, B.S., Shoemaker, B.A.,
Simonyan, V., Song, 1.S., Thiessen, P.A., Vasudevan, S., Wang, Y.,
Yamashita, R.A., Yin, 1.1. y Bryant, S.H. 2003 'CDD: a curated Entrez
database oI conserved domain alignments¨. Nucleic Acids Res. 31: 383-387.
Margolin, W. 2000. 'Themes and variations in prokaryotic cell division¨. FEMS
Microbiol. Rev. 24: 531-548.
Margolles, A., Putman, M., van Veen, H.W. y Konings, W.N. 1999. 'The puriIied
and Iunctionally reconstituted multidrug transporter LmrA oI Lactococcus
lactis mediates the transbilayer movement oI speciIic Iluorescent
phospholipids¨. Biochemistrv. 38: 16298-16306.
Martínez, B. 1996. Tesis Doctoral. Universidad de Oviedo.
Martínez, B., Suárez, 1.E. y Rodríguez, A. 1996. 'Lactococcin 972: a homodimeric
lactococcal bacteriocin whose primary target is not the plasma membrane¨.
Microbiologv. 142: 2393-2398.
Martínez, B., Fernández, M., Suárez, 1.E. y Rodríguez, A. 1999. 'Synthesis oI
lactococcin 972, a bacteriocin produced by Lactococcus lactis IPLA 972,
depends on the expression oI a plasmid-encoded bicistronic operon¨.
Microbiologv. 145: 3155-3161.
Martínez, B., Rodríguez, A., Suárez, 1.E. 2000a. 'Lactococcin 972, a bacteriocin
that inhibits septum Iormation in lactococci¨. Microbiologv. 146: 949-955.
Martínez, B., Suárez, 1.E. y Rodríguez, A. 2000b. 'Bacteriocins produced by wild
lactococcal strains isolated Irom Spanish Iarmhouse cheeses¨. Res. Adv. in
Food Science. 1: 21-32.
Matsusaki, H., Endo, N., Somomoto, K. y Ishikazi, A. 1996. 'Lantibiotic nisin Z
Iermentative production by Lactococcus lactis IO-1L: relationship between
production oI the lantibiotic and lactate and cell growth¨. Appl. Microbiol.
Biotechnol. 45: 36-40.
BibliograIia 121
Meghrous, 1., Huot, M., Quittelier, M. y Petitdemange, H. 1992. 'Regulation oI
nisin biosynthesis by continuous cultures and by resting cells oI Lactococcus
lacis subsp. lactis¨. Res. Microbiol. 143: 879-890.
Miller, C., Ingmer, H., Thomsen, L.E., Skarstad, K. y Cohen, S.N. 2003. 'DpiA
binding to the replication origin oI Escherichia Coli plasmids and
chromosomes destabilizes plasmid inheritance and induces the bacterial SOS
response¨. J. Bacteriol. 185: 6025-6031
Miller, C., Thomsen, L.E., Gaggero, C., Mosseri, R., Ingmer, H. y Cohen, S.N.
2004. 'SOS response induction by -lactams and bacterial deIense against
antibiotic lethality¨. Science. 305: 1629-1631.
Moineau, S. 1999. 'Applications oI phage resistance in lactic acid bacteria¨. Antonie
Leeuwenhoek. 76: 377-382.
Moll, G.N., Ubbink-kok, T., Hildeng-Haugen, H., Nissen-Meyer, 1., Nes, I.F.,
Konings, W.N. y Driessen, A.1.M. 1996. 'Lactococcin G is a potassium ion-
conducing, two-component bacteriocin¨. J. Bacteriol. 178: 600-605.
Moll, G.N., Konings, W.N. y Driessen, A.1.M. 1999. 'Bacteriocins: mechanism oI
membrane insertion and pore Iormation¨. Antonnie van Leeuvenhoek. 76: 185-
198.
Monnet, V., Condon, S., Cogan, T.M. y Gripon, 1.C. 1996. 'Metabolism oI starter
cultures¨. En Dairv Starter Cultures (Cogan, T.M. y Accolas, J.P., eds.). VCH
Publishers, Inc. New York, pp. 47-100.
Mortvedt-Abildgaard, C., Nissen-Meyer, 1., 1elle, B., Grenov, B., Skaugen, M. y
Nes, I. 1995. 'Production and pH-dependent bactericidal activity oI
lactococcin S, a lantibiotic Irom Lactobacillus sake¨. Appl. Environ. Microbiol.
61: 175-179.
Mourez, M., Hofnung, M. y Dassa, E. 1997. 'Subunits interaction in ABC
transporters: a conserved sequence in hydrophobic membrane proteins oI
periplasmic permeases deIines an important site oI interaction with the ATPase
subunit¨. EMBO J. 16: 2066-2077.

BibliograIia 122
Mullis, K.B. y Faloona, F.A. 1987. 'SpeciIic synthesis oI DNA in vitro via a
polymerase-catalyzed chain reaction¨. Methods En:vmol. 155: 335-350.
Nes, I.F y Holo, H. 2000. 'Class II antimicrobial peptides Irom lactic acid bacteria¨.
Biopolvmers. 55: 50-61.
Nes, I.F., Diep, D.B., Harvarstein, L.S., Brurberg, M.B., Eijinsk, V.E. y Holo H.
1996. 'Biosynthesis oI bacteriocins in lactic acid bacteria¨. Antonie van
Leeuwenhoek. 70: 113-128.
Nguyen-Disteche, M., Leyh-Bouille, M. y Ghuysen, M. 1982. 'Isolation oI the
membrane-bound 26 000-Mr penicillin-binding protein oI Streptomvces strain
K15 in the Iorm oI a penicillin-sensitive D-alanyl-D-alanine-cleaving
transpeptidase¨ Biochem. J. 207: 109-115.
Nielsen, H., Engelbrecht, 1., Brunak, S. y von Heijne, G. 1997. 'IdentiIication oI
prokaryotic and eukaryotic signal peptides and prediction oI their cleavage
sites¨. Prot. Engin. 10: 1-6.
Nikaido, H. y Hall, 1.A. 1998. 'Overview oI bacterial ABC transporters¨. Methods
En:vmol. 292: 3-20.
Nishi, T. y Itoh, S. 1986. 'Enhancement oI transcriptional activity oI the Escherichia
coli trp promoter by upstream A ¹ T-rich regions¨. Gene. 44: 29-36.
O`Sullivan, D.1. y Klaenhammer, T.R. 1993. 'Rapid mini-prep isolation oI high-
quality plasmid DNA Irom Lactococcus and Lactobacillus spp.¨. Appl.
Environ. Microbiol. 59: 2730-2733.
Oakley, B.R., Kirsch, D.R. y Morris, N.R. 1980 'A simpliIied ultrasensitive silver
stain Ior detecting proteins in polyacrylamide gels¨. Anal. Biochem. 105: 361-
363.
/
0
BibliograIia 123
Otto, M., Peschel, A. y Götz, F. 1998. 'Producer selI-protection against the
lantibiotic epidermin by the ABC transporter EpiFEG oI Staphvlococcus
epidermidis Tü3298¨. FEMS Microbiol. Lett. 166: 203-211.
Parente, E. y Hill, C. 1992. 'A comparison oI Iactors aIIecting the production oI two
bacteriocins Irom lactic acid bacteria¨. J. Appl. Bacteriol. 73: 290-298.
Parente, E. y Ricciardi, A. 1994a. 'InIluence oI pH on the production oI enterocin
1146 during batch Iermentation¨. Lett. Appl. Microbiol. 19: 12-15.
Parente, E. y Ricciardi, A. 1994b. 'EIIect oI nitrogen and carbohydrate sources on
lactic acid and bacteriocin production by Enterococcus faecium DPC1146¨.
Agro-Industrv Hi-Tech. 5: 35-39.
Parente, E. y Ricciardi, A. 1999. 'Production, recovery and puriIication oI
bacteriocins Irom LAB¨. Appl. Microbiol. Biotechnol. 52: 628-638.
Parente, E., Ricciardi, A. y Addario, G. 1994. 'InIluence oI pH on growth and
bacteriocin production by Lactococcus lactis subsp. lactis 140NWC during
batch Iermentation¨. Appl. Microbiol. Biotechnol. 41: 388-394.
Parente, E., Brienza, C., Ricciardi, A. y Addario, G. 1997. 'Growth and bacteriocin
production by Enterococcus faecium DPC1146 in batch and continuous
culture¨. J. Ind. Microbiol. Biotechnol. 18: 62-67.
Peschel, A. y Götz, F. 1996. 'Analysis oI the Staphvlococcus epidermis genes epiF, -
E, and G involved in epidermin immunity¨. J. Bacteriol. 178: 531-536.
Piddock, L.1.V. 1998. 'Antibacterials mechanisms oI action¨. Curr. Op. Microbiol.
1: 502-508.
Pinho, M.G. y Errington, 1. 2003. 'Dispersed mode oI Staphvlococcus aureus cell
wall synthesis in the absence oI the division machinery¨. Mol. Microbiol. 50:
871-881.

1
BibliograIia 124
Platt, T. 1986. 'Transcription terminator and the regulation oI gen expression¨. Annu.
Rev. Biochem. 55: 339-372.
Pogliano, 1., Pogliano, K., Weiss, D.S., Losickm R. y Beckwith, 1. 1997.
'Inactivation oI FtsI inhibits constriction oI the FtsZ cytokinetic ring and
delays the assembly oI FtsZ rings at potential division sites¨. Proc. Natl. Acad.
Sci. USA. 94: 559-64.
Polzin, K.M. y Shimizu-Kadota, M. 1987. 'IdentiIication oI a new insertion element,
similar to gram-negative IS26, on the lactose plasmid oI Streptococcus lactis
M13¨. J. Bacteriol. 169: 5481-5488.
Ptashne, M. 1992. A genetic switch. Cell Press, Blackwell ScientiIic Publications,
Cambridge, MA.
Pugsley, A.P. 1993. 'The complete general secretory pathway in gram-negative
bacteria¨. Microbiol. Reviews. 57: 50-108.
Quiao, M., Omaetxebarria, M.1., Ra, R., Oruetxebarria, I. y Saris, P.E.1. 1997.
¨Isolation oI a Lactococcus lactis strain with high resistance to nisin and
increased nisin production¨. Biotechnol. Lett. 19: 199-202.
Quadri, L. E., Sailer, M., Terebiznik, M. R., Roy, K. L., Vederas, 1. C. y Stiles, M.
E. 1995. 'Characterization oI the protein conIerring immunity to the
antimicrobial peptide carnobacteriocin B2 and expression oI carnobacteriocins
B2 and BM1¨. J. Bacteriol. 177: 1144-1151.
Ra, S.R., Beukes, M., Tamura, K. y Hastings, 1.W. 2000. 'Genes responsible Ior
nisin synthesis, regulation and immunity Iorm a regulon oI two operons and are
induced by nisin in Lactococcus lactis N8¨. Microbiologv. 142: 3098-3101.

2
3
BibliograIia 125
Rammath, M., Beukes, M., Tamura, K. y Hastings, 1.W. 2000. 'Absence oI a
putative mannose-speciIic phosphotransIerase system enzyme IIAB component
in a leucocin A-resistant strain oI Listeria monocvtogenes, as shown by two-
dimensional sodium dodecyl sulIate-polyacrylamide gel electrophoresis¨. Appl.
Environ. Microbiol. 66: 3098-3101.
Rauch, P.1. y de Vos, W.M. 1992. 'Characterization oI the novel nisin-sucrose
conjugative transposon Tn5276 and its insertion in Lactococcus lactis¨. J.
Bacteriol. 174: 1280-7.
Rauhut, R. y Klug, G. 1999. 'mRNA degradation in bacteria¨. FEMS Microbiol. Rev.
23: 353-370.
Requena, T. y Peláez, C. 1995. 'Review: antimicrobial activity oI lactic acid bacteria.
Bacteriocin production¨. Revista Española de Ciencia v Tecnologia de los
Alimentos. 35: 19-44.
Rice, K.C. y Bayles, K.W. 2003. 'Death`s toolbox: examining the molecular
components oI bacterial programmed cell death¨. Mol. Microbiol. 50: 729-738.
Riley, M.A. 1998. 'Molecular mechanism oI bacteriocin evolution¨. Annu. Rev. Gen.
32: 255-278.
Riley, M.A. y Wertz, 1.E. 2002. 'Bacteriocin diversity: ecological and evolutionary
perspectives¨. Biochimie. 84: 357-364.
Rilla, N., Martínez, B., Delgado, T. y Rodríguez, A. 2003. 'Inhibition oI
Clostridium tvrobutvricum in Vidiago cheese by Lactococcus lactis ssp. lactis
IPLA729, a nisin Z producer¨. Int. J. Food Microbiol. 85: 23-33.
Rincé, A., Dufour, A., Uguen, P., le Pennec, 1. y Haras, D. 1997. 'Characterization
oI the lacticin 481 operon: the Lactococcus lactis genes lctF, lctE, and lctG
encode a putative ABC transporter involved in bacteriocin immunity¨. 63:
4252-4260.
Rodríguez, 1.M., Cintas, L.M., Casaus, P., Suárez, A. y Hernández, P. 1995. 'PCR
detection oI the lactococin S structural gene in bacteriocin-producing
lactobacilli Irom meat¨. Appl. Environ. Microbiol. 61: 2802-2805.
BibliograIia 126
Rogers, P.L. Bramall, L. y McDonald, I.1. 1978. 'Kinetic analysis oI batch and
continuous culture oI Streptococcus cremoris HP¨. Canadian J. Microbiol. 24:
372-380.
Rohrer, S. y Berger-Bächi, B. 2003. 'FemABX peptidyl transIerases: a link between
branched-chain cell wall peptide Iormation and -lactam resistance in gram-
positive cocci¨. Antimicrob. Agents Chemother. 47: 837-846.
Sahl, H.G. y Bierbaum, G. 1998. 'Lantibiotics: biosynthesis and biological activities
oI uniquely modiIied peptides Irom gram-positive bacteria¨. Annu. Rev.
Microbiol. 52: 41-79.
Saiki, R.K., Scharf, S.1., Faloona, F., Mullis, K.B., Horn, G.T., Erlich, H.A. y
Arnheim, N. 1985. 'Enzymatic ampliIication oI -globin genomic sequences
and restriction site analysis Ior diagnosis oI sickle cell anaemia¨. Science. 230:
1350-1354.
Sambroock, 1., Fritsch, E.F. y Maniatis, T. 1989. 'Molecular cloning. A laboratory
manual¨. 2ª Ed. Cold Spring Harbor Laboratory Press, New York.
Sánchez, C., Hernández de Rojas, A., Martínez, B., Argüelles, M.E., Suárez, 1.E.,
Rodríguez, A. y Mayo, B. 2000. 'Nucleotide sequence and analysis oI pBL1,
a bacteriocin-producing plasmid Irom Lactococcus lactis IPLA972¨. Plasmid.
44: 239-249.
Sanger, F., Nicklen, S. y Coulson, A.R. 1977. 'DNA sequencing with chain-
terminating inhibitors¨. Proc. Natl. Acad. Sci. U.S.A. 74: 5463-5467.
Saurin, W., Hofnung, M. y Dassa, E. 1999. 'Getting in or out : early segregation
between importers and exporters in the evolution oI ATP-binding cassette
(ABC) transporters¨. J. Mol. Evol. 48: 22-41.
Schäger, H. y von 1agow, G. 1987. 'Tricin-sodium dodecyl sulphate-polyacrylamide
gel electrophoresis Ior the separation oI protein in the range Irom 1 to 100
kDa¨. Anal. Biochem. 166: 368-379.
4
BibliograIia 127
Scragg, A.H. 1991. 'Bioreactors in biotechnology¨. Scragg, A.H., ed. Ellis Horwood
limited, Chichester, England.
Siegers, K. y Entian, K.D. 1995. 'Genes involved in immunity to the lantibiotic nisin
produced by Lactococcus lactis 6F3¨. Appl. Environ. Microbiol. 61: 1082-
1089.
Sigrist, C.1., Cerutti, L., Hulo, N., Gattiker, A., Falquet, L., Pagni, M., Bairoch,
A. y Bucher, P. 2002. 'PROSITE: a documented database using patterns and
proIiles as motiI descriptors¨. Brief Bioinform. 3: 265-274.
Simon, D. y Chopin, A. 1988. 'Construction oI a plasmid Iamily and its use Ior
molecular cloning in Streptococcus lactis¨. Biochimie. 70: 559-566.
Somma, S., Merati, W. y Parenti, F. 1971. 'Garmidycin, a new antibiotic inhibiting
peptidoglican synthesis¨. Antimicrob. Agents Chemother. 11: 396-401.
Spratt, B.G. 1977. 'Temperature-sensitive cell division mutants oI Escherichia coli
with termolabile penicillin-binding proteins¨. J. Bacteriol. 131: 293-305.
Tagg, 1.R., Dajani, A.S. y Wannamaker, L.W. 1976. 'Bacteriocins oI Gram positive
bacteria¨. Bacteriol. Rev. 40: 772-756.
Taniguchi, M., Hoshino, K., Urasaki, H., Fujii, M. 1994. 'Continuous production oI
an antibiotic polypeptide (nisin) by Lactococcus lactis using a bioreactor
coupled to a microIiltration module¨. J. Ferment. Bioeng. 77: 704-708.
Thompson, 1. y Gentry-Weeks, C.R. 1994. 'Metabolisme des sucres par les
bacteires lactiques¨. En Bateries Lactiques. H. de Roissart y F.M. Luquet
(eds.). pp. 230-290. Lorica. Uriage, La France.
Tomita, H., Fujimoto, S., Tanimoto, K. y Ike, Y. 1996. 'Cloning and genetic
organization oI the bacteriocin 31 determinant encoded on the Enterococcus
faecalis pheromone-responsive conjugative plasmid pYI17¨. J. Bacteriol. 178:
3585-3593.
5
BibliograIia 128
Tusnády, G.E. y Simon, L. 2001. 'The HMMTOP transmembrane topology
prediction server¨. Bioinformatics. 17: 849-850.
Uguen, P., Hamelin, 1., le Pennec, 1.P. y Blanco, C. 1999. 'InIluence oI osmolarity
and the presence oI an osmoprotectant on Lactococcus lactis growth and
bacteriocin production¨. Appl. Environ. Microbiol. 65: 291-293.
van de Guchte, M., Kok, 1. y Venema, G. 1991. 'Distance-dependent translational
coupling and interIerence in Lactococcus lactis¨. Mol. Gen. Genet. 227: 65-71.
van Heusden, H.E., de Kruijff, B. y Breukink, E. 2002. 'Lipid II induces a
transmembrane orientation oI the pore Iorming peptide lantibiotic nisin¨
Biochemistrv. 41: 12171-12178.
van Kranenburg, R., Kleerebezem, M. y de Vos, W.M. 2000. 'Nucleotide analysis
oI the lactococcal EPS plasmid pNZ4000¨. Plasmid. 43: 130-136.
Venema, K., Dost, M.H.R., Beun, P.A.H., Haandrikman, A.1., Venema, G. y Kok,
1. 1996. 'The genes Ior secretion and maturation oI lactococcins are located on
the chromosome oI Lactococcus lactis IL1403¨. Appl. Environ. Microbiol. 62:
1689-1692.
von Heijne, G. 1992. 'Membrane protein structure prediction. Hydrophobicity
analysis and the positive-inside rule¨. J. Mol. Biol. 225: 487-494.
Walker, 1.E., Saraste, M., Runswick, M.1. y Gay, N.1. 1982. 'Distantly related
sequences in the - and -subunits oI ATP synthasa, myosin, kinases and other
ATP-requiring enzymes and a common nucleotide binding Iold`. EMBO J. 1:
945-951.
6
7
8
BibliograIia 129
Wiedemann, I., Benz, R. y Sahl, H.G. 1998. 'Pore Iormation by the peptide
antibiotic nisin in the presence oI the bacterial peptidoglycan lipid II: a black
lipid membrane study¨. Third International Workshop on Lantibiotics,
Blaubeuren, p. 72.
Wiedemann, I., Breukink, W., van Kraaij, C., Kuipers, O.P., Bierbaum, G., de
Kruijffs, B. y Sahl, H.G. 2001. 'SpeciIic binding oI nisin to the peptidoglycan
precursors lipid II combines pore Iormation and inhibition oI cell wall
biosynthesis Ior potent antibiotic activity¨. J. Biol. Chem. 276: 1772-1779.
Woodcock, D.M., Crowther, P.1., Doherty, 1., 1efferson, S., DeCruz, E., Noyer-
Weidner, M., Smith, S.S., Michael, M.Z. y Graham, M.W. 1989.
'Quantitative evaluation oI Escherichia coli host strains Ior tolerance to
cytosine methylation in plasmid and phage recombinants¨. Nucleic Acids Res.
17: 3469-3478.
Worobo, R.W., Heukel, T., Sailer, M., Roy, K.L., Vedras, 1.C. y Stile, M.E. 1994.
'Characteristics and genetic determinant oI a hydrophobic peptide bacteriocin,
carnobacteriocin A, produced by Carnobacterium piscicola LV17A¨.
Microbiologv. 140: 517-526.
Yan, L.Z., Gibbs, A.C., Stiles, M.E., Wishart, D.S. y Vederas, L.C. 2000.
'Analogues oI bacteriocins: antimicrobial speciIicity and interactions oI
leucocin A with its enantiomer, carnobacteriocin B2, and truncated
derivatives¨. J. Med. Chem. 43: 4579-4581.
Yang, R. y Ray, B. 1994. 'Factors inIluencing production oI bacteriocins by lactic
acid bacteria¨. Food Microbiol. 11: 281-291.
Yanouri, A., Daniel, R.A., Errington, 1. y Buchanan, C.E. 1993. 'Cloning and
sequencing oI the cell division gene pbpB, which encodes penicillin-binding
protein 2B in Bacillus subtilis¨. J. Bacteriol. 175: 7604-7616.

9
BibliograIia 130
Yarmus, M., Mett, A y Shapira, R. 2000. 'Cloning and expression oI the genes
involved in the production oI and immunity against the bacteriocin lacticin
RM¨. Biochim. Biophvs. Acta. 1490: 279-290.
Zamfir, M., Callewaert, R., Cornea, P.C. y de Vuyst, L. 2000. 'Production kinetics
oI acidophilin 801, a bacteriocin produced by Lactobacillus acidophilus IBB
801¨. FEMS Microbiol. Lett. 190: 305-308.
Zhang, 1. y Madden, T.L. 1997. "PowerBLAST: A new network BLAST application
Ior interactive or automated sequence analysis and annotation". Genome Res.
7: 649-656.
Zhao, G., Meier, T.I., Kahl, S.D., Gee, K.R. y Blaszczak, L.C. 1999. 'BOCILLIN
FL, a sensitive and commercially available reagent Ior detection oI penicillin-
binding proteins¨. Antimicrob. Agents. Chemother.43: 1124-1128.
Zuker, M., Mathews, D.H. y Turner, D.H. 1999. 'Algorithms and thermodynamics
Ior RNA secondary structure prediction: A practical guide in RNA
biochemistry and biotechnology¨. J. Barciszewski y B.F.C. Clark (Eds). NATO
ASI Series, Kluwer Academic Publishers.
: