Está en la página 1de 0

DISEO ELECTRNICO CON

APLICACIONES LIBRES O GRATUITAS


PARA EL TCNICO EN ELECTRNICA

Miguel Pareja Aparicio

Ttulo: Diseo electrnico con aplicaciones libres o gratuitas para el tcnico en electrnica
Autor: Miguel Pareja Aparicio
mipaap@gmail.com
ISBN: 9788484547396
Depsito legal: A9762008
Edita: Editorial Club Universitario Telf.: 96 567 61 33
C/. Cottolengo, 25 San Vicente (Alicante)
www.ecu.fm
Printed in Spain
Imprime: Imprenta Gamma Telf.: 965 67 19 87
C/. Cottolengo, 25 San Vicente (Alicante)
www.gamma.fm
gamma@gamma.fm

Reservados todos los derechos. Ni la totalidad ni parte de este libro puede reproducirse o transmitirse por
ningn procedimiento electrnico o mecnico, incluyendo fotocopia, grabacin magntica o cualquier
almacenamiento de informacin o sistema de reproduccin, sin permiso previo y por escrito de los titulares
del Copyright.

ndice
PRLOGO...................................................................................................................... 9
CAPTULO1
APLICACINLIBREYGRATUITA ...................................................................................... 11
1.1.INTRODUCCIN........................................................................................................... 11
1.2.DEFINICIN................................................................................................................ 12
1.3.DIFERENCIAS .............................................................................................................. 12
1.4.APLICACIONESSHAREWARE ........................................................................................... 14
1.5.CDIGOCERRADOYCDIGOABIERTO .............................................................................. 14
1.6.LICENCIAGPL............................................................................................................. 15
CAPTULO 2
APLICACIONES PARA EL TCNICO EN ELECTRNICA.................................... 31
2.1.INTRODUCCIN........................................................................................................... 31
2.2.PAQUETESDEAPLICACIONESOSOFTWARE. ....................................................................... 32
2.3.SIMBOLOGANORMALIZADA .......................................................................................... 32
2.4.LIBRERASYCREACINDECOMPONENTES ......................................................................... 33
2.5.EDICINDEESQUEMAS ................................................................................................. 34
2.6.CREACINDEPLACASDECIRCUITOIMPRESO...................................................................... 35
2.7.SIMULACINDECIRCUITOS ............................................................................................ 37
2.8.VENTAJASDELASIMULACIN ........................................................................................ 39
2.8.1.INTRODUCCIN ............................................................................................................... 39
2.8.2.REDUCCINDETIEMPODEDISEO ..................................................................................... 40
2.8.3.REDUCCINDECOSTES ..................................................................................................... 40
2.8.4.PORTABILIDAD ................................................................................................................ 41
2.8.5.OTRASVENTAJAS ............................................................................................................. 41
2.9.APLICACIONESOSOFTWAREDECLCULO .......................................................................... 42
2.10.APLICACIONESASOCIADASADISPOSITIVOSPROGRAMABLES................................................ 42
2.11.OTRASAPLICACIONES ................................................................................................. 44
2.12.LINUX ..................................................................................................................... 45

CAPTULO 3
EDICIN DE ESQUEMAS: TINYCAD ...................................................................... 47
3.1.INTRODUCCIN........................................................................................................... 47
3.1.1.LAAPLICACIN ................................................................................................................ 47
3.1.2.JUSTIFICACINDELUSODEESTAAPLICACIN........................................................................ 48
3.1.3.OBTENERLAAPLICACIN................................................................................................... 48
3.2.EDICINDEESQUEMAS................................................................................................. 49
3.2.1.VENTANADETRABAJO ...................................................................................................... 49
3.2.2.MODODETRABAJO.......................................................................................................... 50
3.3.NUEVOSCOMPONENTES ............................................................................................... 52
3.3.1.CREARNUEVALIBRERA..................................................................................................... 52
3.3.2.CREARUNNUEVOCOMPONENTE ........................................................................................ 52
3.3.3.AADIRIMGENESDEBITMAPALCOMPONENTE ................................................................... 55
3.3.4.PROPIEDADESDELCOMPONENTE ........................................................................................ 56
3.4.EJEMPLOS ................................................................................................................. 56
3.5.CREARNETLISTPARAFREEPCB ...................................................................................... 58
3.7.CREARNETLISTPARASIMULACIN .................................................................................. 59
CAPTULO 4
CREAR PLACAS DE CIRCUITO IMPRESO: KICAD .............................................. 61
4.1.INTRODUCCIN........................................................................................................... 61
4.2.INSTALACIN ............................................................................................................. 62
4.3.RECOMENDACINUSODEKICAD .................................................................................... 65
4.4.ELGESTORDEPROYECTOS ............................................................................................. 65
4.5.EESCHEMA................................................................................................................. 69
4.6.PCBNEW ................................................................................................................... 73
4.7.EJEMPLOPASOAPASO ................................................................................................. 76
4.7.1.NUEVOPROYECTO ........................................................................................................... 76
4.7.2.CREARESQUEMAPRINCIPAL............................................................................................... 76
4.7.3.CREARNETLIST................................................................................................................ 78
4.7.4.CREARPLACADECIRCUITOIMPRESO ................................................................................... 79
4.7.5.RESULTADOEN3D........................................................................................................... 81
4.8.MSOPCIONESKICAD.................................................................................................. 83
4.8.1.AUMENTARELGROSORDELASPISTAS ................................................................................. 83
4.8.2.AUMENTARELGROSORDELALNEADECONTORNO ............................................................... 83
4.8.3.AADIRTEXTO ................................................................................................................ 84
4.9.ARCHIVOSGERBER .................................................................................................... 84
4.10.CREARNUEVOSCOMPONENTES .................................................................................... 86
4.10.1.EESCHEMA.................................................................................................................... 86
4.10.2.PCBNEW ...................................................................................................................... 87

CAPTULO 5
CREAR PLACAS DE CIRCUITO IMPRESO: FREEPCB ......................................... 89
5.1.INTRODUCCIN........................................................................................................... 89
5.2.INSTALACIN.............................................................................................................. 90
5.2.1.DESCARGA...................................................................................................................... 90
5.2.2.ESTRUCTURADEDIRECTORIOS............................................................................................ 90
5.3.DESCRIPCINDELAVENTANADEEDICIN......................................................................... 91
5.4.EJEMPLO ................................................................................................................... 94
5.4.1.ELCIRCUITO .................................................................................................................... 94
5.4.2.CREARUNNUEVOPROYECTO ............................................................................................. 95
5.4.3.IMPORTARNETLIST ........................................................................................................... 96
5.4.4.INCLUIRLOSLMITESDELAPLACA ....................................................................................... 98
5.4.5.INCLUIRTALADROS ........................................................................................................... 99
5.4.6.COLOCACINDECOMPONENTES ...................................................................................... 101
5.4.7.CREARPLANOSDEALIMENTACIN .................................................................................... 102
5.4.8.TRAZARLASPISTAS......................................................................................................... 103
5.5.CREARNUEVASHUELLASOFOOTPRINT ........................................................................... 104
5.5.1.LIBRERAS ..................................................................................................................... 104
5.5.2.EDITORDEFOOTPRINT ............................................................................................. 106
5.6.CREAFICHEROSGERBER............................................................................................ 107
CAPTULO 6
SIMULACIN: SWCAD III....................................................................................... 109
6.1.INTRODUCCIN ......................................................................................................... 109
6.2.MODODETRABAJO ................................................................................................... 110
6.3.EDITORDEESQUEMAS ................................................................................................ 111
6.3.CONFIGURACINDELASIMULACIN.............................................................................. 113
6.4.EJEMPLO ................................................................................................................. 116
6.4.ELCIRCUITO ..................................................................................................................... 116
6.4.1.EDICINDELESQUEMA ................................................................................................... 116
6.4.2ARRANQUEDELASIMULACIN ................................................................................... 119
6.4.3.VISUALIZACINDEDATOS ............................................................................................... 121
6.4.4.INCLUIRNOMBREALOSNODOS ........................................................................................ 123
6.5.VISUALIZACINDELAAPLICACIN................................................................................. 124
6.6.NUEVOSCOMPONENTES ............................................................................................. 125
6.7.AADIRTEXTOSIMULABLE .......................................................................................... 127

CAPTULO 7
SIMULACIN: SPICE OPUS LITE.......................................................................... 129
7.1.INTRODUCCIN......................................................................................................... 129
7.2.INSTALACIN ........................................................................................................... 130
7.3.ENTORNODETRABAJO ............................................................................................... 132
7.3.1.VENTANAPRINCIPAL....................................................................................................... 132
7.3.2.CERRARAPLICACIN ....................................................................................................... 133
7.3.3.ACCESOALAAYUDA ....................................................................................................... 133
7.3.4.NAVEGACINENTREDIRECTORIOS .................................................................................... 133
7.3.5.CREARFICHERO ............................................................................................................. 134
7.3.6.ABRIRFICHERO .............................................................................................................. 135
7.4.EDICINDELARCHIVODELCIRCUITO .............................................................................. 135
7.4.1.ESQUEMADELARCHIVO .................................................................................................. 135
7.4.2.DEFINICINDELCIRCUITO ............................................................................................... 136
7.4.3.DEFINICINDELASIMULACIN ........................................................................................ 138
7.5.EJEMPLO ................................................................................................................. 140
CAPTULO 8
SIMULACIN: MULTIMEDIA LOGIC................................................................... 145
8.1.INTRODUCCIN......................................................................................................... 145
8.2.ENTORNODETRABAJO ............................................................................................... 147
8.2.1.INTRODUCCIN ............................................................................................................. 147
8.2.2.BARRADEHERRAMIENTAS ............................................................................................... 147
8.2.3.PALETADECOMPONENTES .............................................................................................. 147
8.3.CREACINDELCIRCUITO ............................................................................................. 148
8.4.SIMULACINDELCIRCUITO ................................................................................................. 149
8.5.CAMBIOSDELACONFIGURACINDECOMPONENTES............................................................... 150
8.6.EJEMPLO ................................................................................................................. 151
8.6.1.ELCIRCUITO ........................................................................................................... 151
8.6.2.CIRCUITOSUMADOR....................................................................................................... 151
8.6.3.CIRCUITOSUMADORCONACARREO .................................................................................. 152
CAPTULO 9
DISEOS MICROCONTROLADOS: MPLAB E ICPROG...................................... 155
9.1.INTRODUCCIN......................................................................................................... 155
9.2.MODODETRABAJO ................................................................................................... 156
9.3.EJEMPLOPASOAPASO ............................................................................................... 158
9.3.1.JUSTIFICACIN............................................................................................................... 158

9.3.2.ELCIRCUITO ................................................................................................................. 158


9.3.3.SELECCINMICROCONTROLADOR ..................................................................................... 159
9.3.4.NUEVOPROYECTO ......................................................................................................... 159
9.3.5.EDICINDETEXTO ......................................................................................................... 161
9.3.6.ENSAMBLADODELCDIGO .............................................................................................. 162
9.3.7.SIMULACIN ................................................................................................................. 163
9.4.HARDWAREYAPLICACINDECOMUNICACIN ................................................................. 165
9.4.1.PROGRAMADOR ............................................................................................................ 165
9.4.2.APLICACINDECOMUNICACIN....................................................................................... 165
CAPTULO 10
EDUBUNTO Y EL TCNICO ELECTRNICO....................................................... 169
10.1.INTRODUCCIN ....................................................................................................... 169
10.2.EDUBUNTU ............................................................................................................ 170
10.2.1.INTRODUCCIN ........................................................................................................... 170
10.2.2.NOTASSOBRELAVERSINUTILIZADA .............................................................................. 171
10.3.KICAD ................................................................................................................... 171
10.4.PCBDESIGN......................................................................................................... 172
10.5.STATICFREESOFTWAREELECTRICVLSIDESIGNSYSTEM ............................................ 173
10.6.TKGATE ............................................................................................................... 174
10.7.GEDA................................................................................................................... 175
10.8.KTECHLAB ........................................................................................................... 176
10.9.MENEDUBUNTU ................................................................................................... 177
10.10.OTRASAPLICACIONES ............................................................................................. 178
10.11.ACTUALIZACINEDUBUNTU .................................................................................... 178
APNDICE1.BIBLIOGRAFA ......................................................................................... 179

PRLOGO

El tcnico electrnico como principal tarea tiene el diseo de pequeos


circuitos, ya sea de mayor o menor complejidad, segn experiencia y necesidad.
Por lo que su principal tarea en el diseo electrnico es la de realizar un
esquema del diseo o circuito, y crear una placa de circuito impreso. Estas dos tareas
el tcnico ya las tiene asumidas, pero las suele realizar de forma manual.
Entonces, por qu no utilizar aplicaciones informticas que faciliten ambas
tareas?
La respuesta puede ser que se desconozcan estas aplicaciones, o que las
aplicaciones que se conocen sean de pago, y no se deseen realizar el desembolso
econmico.
Ante estas respuestas decid crear esta obra. Por una parte la intencin es
mostrar unas aplicaciones libres o gratuitas que pueden ser de ayuda para el tcnico
electrnico, y por otra parte el mostrar sus caractersticas para que el lector comience
a utilizarlas.
El libro se ha escrito teniendo en cuenta conocimientos bsicos de informtica
y conocimientos bsicos de electrnica, por lo que puede ser que haya partes o
comentarios que resulten demasiado simples, segn nivel de estudios y nivel
profesional. Para que pueda ser destinado a cualquier persona con distintos niveles de
estudios, desde estudiantes de ciclos formativos hasta para estudios universitarios, y
como consulta para cualquier tcnico o ingeniero que necesite realizar un esquema,
una placa de circuito impreso o una simulacin.

La obra se ha estructurado en cuatro bloques:


El primero muestra las caractersticas de aplicaciones libres y gratuitas, as
como sus diferencias. (Captulo 1).
El segundo muestra una descripcin de las caractersticas de las aplicaciones
que pueden ser de utilidad para el tcnico electrnico bajo la plataforma Windows.
(Captulo 2).
El tercero muestra una coleccin de aplicaciones de uso para el tcnico en
electrnica. (Captulo 3 al captulo 9).
El cuarto comenta una coleccin de aplicaciones para ser utilizadas en la
plataforma Linux. (Captulo 10).
La coleccin de aplicaciones descritas es: TinyCAD (Captulo 3), Kicad
(Captulo 4), FreePCB (Captulo 5), SwCAD III (Captulo 6), SpiceOpus Lite
(Captulo 7), Multimedia Logic (Captulo 8), MPLAB e IcProg (Captulo 9).
Si se dispone de conexin a Internet, en cada uno de los captulos se incluye la
direccin desde donde se puede descargar la aplicacin, es decir la direccin de la
pgina web (de su pgina oficial). Para los que no tengan acceso a Internet se
acompaa con un CD-ROM con todas las aplicaciones descritas (excepto las vistas
en el captulo 10), en la misma versin que las utilizadas para la redaccin de esta
obra.
Comentar que la estructura de todos los captulos, se ha descrito para que stos
puedan ser consultados de forma individual. Por esta razn, no se ha seguido una
estructura idntica para todos los captulos, sino que se han estructurado en funcin
de las caractersticas de cada aplicacin; segn su entorno grfico, modo de trabajo
(unas sirven para la creacin de placas de circuito impreso, otras para la simulacin
de circuitos integrados, etc), opciones disponibles, comunicacin con otras
aplicaciones, etc. Pero todos los captulos (del 3 al 9) tienen un denominador comn,
se comentan sus caractersticas aplicadas a un ejemplo guiado para que el propio
lector, siguiendo el texto pueda tener una base para empezar a utilizarlo.

10

CAPTULO 1
APLICACIN LIBRE Y GRATUITA

1.1.- Introduccin
A lo largo de este libro se van a comentar algunas aplicaciones que se utilizan
para el diseo electrnico, unas tienen en la licencia que se trata de aplicaciones
libres y otras que se trata de aplicaciones gratuitas.
As pues, este primer captulo se centra en las diferencias entre ambas licencia,
ya que son dos trminos que se suelen confundir.
Se ha dedicado un apartado a la licencia GPL, describiendo cada uno de sus
apartados para que el lector comprenda las caractersticas de las aplicaciones libres,
puesto que las licencias GPL son las que utilizan las aplicaciones libres.

11

1.2.- Definicin
Se entiende como aplicacin libre una aplicacin que una vez conseguida,
principalmente descargada de Internet, se puede usar, distribuir, modificar y
redistribuir; siempre y cuando la nueva aplicacin creada sea redistribuida con la
misma licencia, es decir, contine siendo libre. Para ser libre tambin debe ir
acompaada de su cdigo fuente.
Mientras que una aplicacin gratuita (o Freeware), se distribuye gratuitamente,
y en ocasiones se ofrece el cdigo fuente, aunque no suele ser usual que lo
acompae. Adems la aplicacin suele mantener el copyright del autor.

1.3.- Diferencias
A continuacin se describen en detalle las tres principales diferencias de que
una aplicacin sea libre o gratuita. Se ha incluido un ejemplo de cada una de ellas,
con el fin de que el lector comprenda mejor dichas diferencias. Se debe comentar que
los ejemplos son inventados y simplificados al mximo con el nico fin de que el
ejemplo sea lo ms representativo posible, en otros casos se muestra un ejemplo real.

La primera diferencia, radica en que el software denominado libre, no


debe ser gratuito necesariamente, puede conservar por un lado su
libertad de distribucin, pero puede ser distribuido comercialmente. (Es
decir, pagando).

El ejemplo ms representativo es cuando se ofrecen distribuciones del sistema


operativo Linux a cierto precio. Aunque este precio sea bastante menor al de otros
sistemas operativos de pago, pero hay que tener en cuenta que se est pagando por la
documentacin que la acompaa (manual de instalacin, manual de aplicaciones,
etc) y por la creacin del medio de distribucin (CD-ROM o DVD). Es decir, se
est distribuyendo comercialmente.
Adems, viendo el punto 1 de la licencia GPL (ver apartado 1.6 para ver el
texto completo, traduccin y comentarios) que acompaa a las aplicaciones libres,
queda patente esta diferencia. A continuacin se muestra una traduccin del punto 1:
Usted puede copiar y distribuir copias literales del cdigo fuente del Programa, segn lo
ha recibido, en cualquier medio, supuesto que de forma adecuada y bien visible publique
en cada copia un anuncio de copyright adecuado y un repudio de garanta, mantenga
intactos todos los anuncios que se refieran a esta Licencia y a la ausencia de garanta, y
proporcione a cualquier otro receptor del programa una copia de esta Licencia junto con
el Programa.
Puede cobrar un precio por el acto fsico de transferir una copia, y puede, segn su libre
albedro, ofrecer garanta a cambio de unos honorarios.

12

CAPTULO 2
APLICACIONES PARA EL TCNICO
EN ELECTRNICA

2.1.- Introduccin
El uso de diversas aplicaciones para cualquier tcnico o ingeniero se ha
convertido en parte importante, ya que haciendo buen uso de varias aplicaciones se
pueden facilitar las tareas de diseo y clculo.
En partcular el tcnico en electrnica lo utiliza principalmente para la edicin
de esquemas, simulacin y creacin de placas de circuito impreso.
31

En este captulo se ver a grandes rasgos las caractersticas que deben tener las
aplicaciones que utiliza un tcnico en electrnica. Para que en los prximos captulos
se muestren algunos ejemplos de varias aplicaciones, teniendo en cuenta que todas
ellas sean aplicaciones libres o gratuitas (Captulo 1).

2.2.- Paquetes de aplicaciones o software


Como paquetes de aplicaciones, tambin denominados paquetes de software, se
entiende por un conjunto de aplicaciones que permiten la comunicacin entre ellas.
Todo ello controlado desde una aplicacin principal (denominada gestor de
proyectos), y a partir de la cual se puede acceder a una u otra aplicacin, realizando
diferentes tareas integradas en un mismo proyecto.
El aumento del uso de equipos informticos en el mbiente domstico, ha
propiciado que los paquetes de aplicaciones de diseo electrnico hayan dejado de
ser utilizados nicamente en el diseo industrial, pasando a ser utilizados en equipos
domsticos, ya que solo es necesario un ordenador personal.
Las principales aplicaciones que han aumentado son para la docencia y el
ejercicio libre de la profesin, sin dejar de lado su uso industrial.
Los paquetes de aplicaciones, incluyen aplicaciones para: la edicin de
esquemas (apartado 2.5), la creacin de circuitos impresos (apartado 2.6) y
simulacin (apartado 2.7).
El uso de paquetes de aplicaciones, reduce el tiempo que se necesita para
ejecutar un diseo o proyecto electrnico.
Por ejemplo, el diseo se edita desde el editor de esquemas, despus se
realiza la simulacin para comprobar su funcionalidad, y finalmente se crea la
aplicacin del circuito impreso tomando como referencia las conexiones realizadas
en el editor de esquemas (apartado 2.8).
Aunque las tres tareas parecen estar realicionadas, se realizan utilizando
aplicaciones diferentes. Pero al estar integrados en un paquete de aplicaciones, la
comunicacin entre una u otra aplicacin es automtica, sin que el usuario se tenga
que preocupar de dicha tarea, solo en la realizacin del diseo.
Las aplicaciones de diseo electrnico asistido por ordenador, tambin se
denominan aplicaciones CAE.

2.3.- Simbologa normalizada


Cada elemento o dispositivo elctrico o electrnico disponible en un circuito o
instalacin de una representacin grfica, utilizada para la realizacin de
documentaciones y su posterior identificacin por otro tcnico o ingeniero, o en una
32

posterior revisin por el autor o otra persona. Dicha representacin grfica se


denomina smbolo.
La principal caracterstica que debe cumplir un smbolo para que su utilizacin
resulte eficaz es que debe ser universal, es decir, que pueda ser identificado por
cualquier profesional y en cualquier pas. El organismo que se encarga de normalizar
los smbolos electrnicos y elctricos, es la Comisin Electrotcnica Internacional
(CEI), y los smbolos normalizados son publicados en sus normas, despus cada pas
adapta sus normas para unificar criterios; en Espaa estas normas a aplicar son las
normas UNE.
La simbologa normalizada es utilizada para que los esquemas de circuitos sean
iguales en cualquier parte del mundo. Por ejemplo que un esquema editado por un
tcnico en Rusia sea entendido por un tcnico de Valencia.
En consecuencia, si los esquemas son realizados con software CAE o con
cualquier otro editor de esquemas, los componentes utilizados deben utilizar los
smbolos normalizados.

2.4.- Libreras y creacin de componentes


Para la realizacin de los esquemas en una aplicacin CAE, se debe disponer de
la representacin grfica de cada uno de los componentes, para ello se utilizan las
libreras que agrupan los diferentes smbolos.
Normalmente se distribuyen por su origen o funcionalidad, como por ejemplo:
librera con los componentes de un fabricante, librera con componentes digitales, o
analgicos, o de potencia, etc.
Las aplicaciones de edicin de esquemas disponen de programas o
herramientas para la edicin de nuevos componentes, y su posterior aadido a una
librera, ya que puede darse el caso de necesitar componentes que no se encuentren
en las libreras de la propia aplicacin.
El procedimiento de creacin de nuevos componentes puede variar de una
aplicacin a otra. El un procedimiento general es el que se muestra a continuacin:
1. Creacin de una librera.
2. Creacin del nuevo componente.
3. Guardar el nuevo componente dentro de la librera creada.
4. Luego hay que indicarle a la aplicacin que hay una nueva librera.
Tambin permiten la modificacin de algn componente ya creado, o que el
nuevo componente ya creado se almacene en una librera diferente.
Sucede de forma similar cuando se requieren libreras para la herramienta de
simulacin (mdelos matemticos para emular su funcionamiento), o para la herramienta
de creacin de placas de circuito impreso (la creacin de huellas o footprint).
33

Tambin despus de crear los nuevos componentes hay que establecer las
referencias entre una y otra aplicacin, ya que se dispone de ficheros diferentes para cada
una de las aplicaciones que forman el paquete.
En las libreras que se encuentran por defecto ya estn establecidas las referencias
entre los componentes de las diferentes aplicaciones, es decir, la relacin que se
establece entre un smbolo que es utilizado en el editor de esquemas, y su modelo
matemtico que es utilizado en el simulador.

2.5.- Edicin de esquemas


Las aplicaciones de edicin de esquemas electrnicos estn basadas en una
herramienta de diseo CAD.
Como en todo programa CAD se pueden aadir imgenes, cuadros de texto,
etc. Adems de nuevos componentes que no pertenecen directamente al diseo
electrnico pero que pueden servir de ayuda para la elaboracin de la documentacin
sobre un circuito o proyecto, aunque no exista como componente electrnico.
Por ejemplo, en el diseo de un regulador de carga de una batera a travs de
un panel solar, se puede simbolizar el panel solar y la batera, que no se trata de un
componente electrnico y por ello no se incluye en las libreras de las aplicaciones.
Un ejemplo de este tipo de aplicaciones se muestra en el captulo 3, con la
aplicacin libre TinyCAD (figura 2.1), que se utiliza para la creacin de esquemas,
adems de presentar una facilidad de manejo y de creacin de nuevos componentes.

Figura 2.1.- TinyCAD

34

Tambin se puede recurrir a aplicaciones, no especficas para el diseo de


circuitos electrnicos, como es el uso del AutoCad mediante la utilizacin de
libreras que incluyen los smbolos normalizados electrnicos. Al igual existe su
versin asociada en libre, como QCad.
Aunque en la prctica y sobre todo en el mbito profesional, es interesante que
est incluido en un paquete de aplicaciones todas las herramientas necesarias para el
diseo de circuitos y proyectos, es decir, que la edicin del esquema sirva para su
posterior simulacin o creacin de placa de circuito impreso (paquete de
aplicaciones).

2.6.- Creacin de placas de circuito impreso


Se trata de aplicaciones que se utilizan para la creacin de placas de circuito
impreso, y que despus se implementa fsicamente mediante el uso de una insoladora
sobre la placa de cobre.
La ventaja respecto al diseo manual es que, una vez ya se ha diseado, se
pueden crear tantas placas de circuito impreso como sea necesario, y adems que
todas sern idnticas. Mientras que si se realiza de forma manual el proceso es ms
costoso (en tiempo) cuando se tienen que realizar varias placas de circuito impreso,
con el mismo diseo.
Con el uso de paquetes, se parte de la aplicacin de edicin de esquema para
despus pasar a la aplicacin de creacin de placas de circuito impreso. El proceso de
creacin de la placa de circuito impreso es el que se muestra a continuacin de forma
ordenada:
1. Editar el esquema.
2. Crear fichero de intercambio, entre el editor de esquema y el editor de
placa de circuito impreso denominado Netlist.
3. Situacin de los lmites de la placa.
4. Colocacin de las huellas o footprint dentro de los lmites.
5. Realizar las conexiones de los componentes, creacin de pistas y capas.
6. Modificacin de las pistas.
7. Creacin de fotolito o archivo GERBER.
8. Finalmente hay que realizar el montaje de la placa de circuito impreso.
Tambin se puede crear la placa de circuito impreso directamente desde el
editor de placa de circuito impreso, como es el caso de FreePcb (Captulo 5, Figura
2.2). Los pasos anteriores quedaran modificados (paso 1 y 2), que se quedaran en
un solo paso:

35

1. Buscar huellas o footprint necesarios, en funcin del circuito.


2. Situacin de los lmites de la placa.
3. (Continuacin pasos anteriores).

Figura 2.2.- FreePcb

Figura 2.3.- Kicad

Usar uno u otro puede ser en funcin de la complejidad del circuito, ya que
partiendo de la representacin del esquema se consigue que las conexiones sean ms

36