Está en la página 1de 213

FIZIKOS SSAJOS SU MEDICINA IR KITAIS FIZINIAIS MOKSLAIS _____________________________ 1

VI L NI AUS UNI VE RS I T E T A S
F i z i k o s f a k u l t e t a s
J. Butrimait, A. Dementjev, G. Dikius, R. Gadonas, J. Jaseviit,
V. Karenauskait, V. Sirutkaitis, V. Smilgeviius
F I Z I K A
biomedicinos ir fizini
moksl studentams
I dalis
Mechanika
Molekulin fizika
Vilniaus universiteto leidykla
2003
Vadovlis parengtas vadovaujant
prof. habil. dr. V. Sirutkaiiui
Recenzavo:
doc. dr. L. Bastien, dr. A. Baginskas, prof. habil. dr. L.Praneviius,
doc. dr. M. Baleviius, prof. habil. dr. R. Rotomskis ,
doc. dr. P. Juodvalkis , prof. habil. dr. D. Kalibatien
Vadovl spaudai rekomendavo
Auktj mokykl bendrj vadovli leidybos komisija
(2002 05 24, protokolo Nr. 05A-110)
Ileista Lietuvos Respublikos vietimoir mokslo ministerijos bei Vilniaus universiteto lomis
Vadovliorengim parm Lietuvos valstybinis moksloir studijfondas
bei Europos Sjungos Leonardoda Vinioprograma
(projektoNr. LT/00/B/F/PP-137.024)
J. Butrimait, A. Dementjev, G. Dikius,
R. Gadonas, J. Jaseviit, V. Karenauskait,
V. Sirutkaitis, V. Smilgeviius, 2003
Vilniausuniversitetoleidykla, 2003
UDK 53(075.8)
Fi 386
ISBN 9986195959
TURINYS
PRATARM / 5
1 . FIZIKOS SSAJOS SU BIOMEDICINA IR
KITAIS FIZINIAIS MOKSLAIS / 7
2. MATAVIMAI IRMATAVIMOPAKLAIDOS / 10
A. Dement j ev, V. Karenauskai t
2.1. Dydiai ir vienetai / 10
2.2. Matavim tikslumas ir paklaid vertinimas / 11
2.3. Tiesiogini matavim paklaid skaiiavimas / 12
2.4. Netiesiogini matavim paklaid skaiiavimas / 14
2.5. Paklaidos apvalinimas ir matavimo rezultat uraymas / 15
2.6. Matavimai / 15
2.7. Duomen apdorojimo programos / 18
3. SAUGOS PROBLEMOS LABORATORIJOSE / 19
V. Karenauskai t , J. Jasevi i t
3.1. Saugos taisykls atliekant elektros laboratorinius darbus / 19
3.2. Saugos taisykls atliekant kitus laboratorinius darbus / 20
3.3. Elektros srovs poveikis ir elektrins saugos priemons / 20
* 3.4. Paciento apsauga / 24
4. MECHANIKA / 26
4.1. Kn inertikumas. Mas, svoris ir sunkis / 26
V. Karenauskai t, J. Jasevi it, G. Dikius
Laboratorinis darbas Tikslusis svrimas / 32
4.2. Sukamasis judjimas / 35
V. Si rut kai ti s, A. Dementj ev, J. Jasevi i t, R. Gadonas
Laboratorinis darbas Pagrindinio sukamojo judjimo
dinamikos dsnio patikrinimas / 54
Laboratorinis darbas Inercijos momento nustatymas bifiliarija svyruokle / 56
Laboratorinis darbas Giroskopo precesijos tyrimas / 58
4.3. Garsas. Ultragarsas / 60
V. Karenauskai t, A. Dement jev, V. Si rut kai t i s
Laboratorinis darbas Garso greiio ore nustatymas / 72
* Medicinos fakultet studentams.
4 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
4.4. Klausos fizika / 74
A. Dement j ev, J. But ri mai t
Laboratorinis darbas Klausos jutos ribos matavimas kompiuteriu / 84
5. MOLEKULIN FIZIKA / 87
5.1. Skysi klampumas / 87
V. Karenauskai t, J. Butri mai t
Laboratorinis darbas Skysi klampos tyrimas / 99
5.2. Duj klampumas / 101
J. Jasevi i t , V. Karenauskai t
Laboratorinis darbas Duj klampos tyrimas / 109
5.3. Tirpal paviriaus tempimas / 110
A. Dement j ev, V. Karenauskai t
Laboratorinis darbas Tirpal paviriaus tempimo tyrimas / 120
5.4. Garavimas ir kondensacija. Oro drgm. Virimas / 122
G. Di ki us, V. Karenauskai t , V. Si rut kai t i s, J. Jasevi i t
Laboratorinis darbas Oro drgms nustatymas Asmano psichrometru / 135
Laboratorinis darbas Vandens virimo temperatros priklausomybs
nuo iorinio slgio tyrimas / 137
5.5. ilumos perdavimo bdai / 138
V. Karenauskait, V. Si rutkaiti s, V. Smilgevii us
Laboratorinis darbas Kietojo kno ilumos laidumo koeficiento nustatymas / 149
5.6. Kietj kn tamprumas / 151
V. Karenauskai t, J. Butri mai t, V. Si rutkai ti s
Laboratorinis darbas Tampros modulio nustatymas dinaminiu lipo bdu / 162
Laboratorinis darbas Mediag tamprumo savybi tyrimas / 164
5.7. Mass pernaa / 165
V. Si rutkai ti s, V. Karenauskai t
UDAVINIAI / 178
G. Dikius, V. Karenauskai t, J. Butrimait
1. Kai kurios udavini sprendimo formuls / 178
2. Udavini slygos / 183
3. Kai kuri udavini atsakymai / 189
PRIEDAI / 190
G. Dikius, V. Karenauskai t, J. Butrimait
1. Vektoriai ir veiksmai su jais / 190
2. Fizikiniai dydiai ir j ymjimai / 192
3. Fizikini dydi lentels / 193
Dalykin rodykl / 206
Literatros sraas / 211
FIZIKOS SSAJOS SU MEDICINA IR KITAIS FIZINIAIS MOKSLAIS _____________________________ 5
PRATARM
Vadovlis skiriamas auktj mokykl studentams, studijuojantiems biomedicinos ir fiziniams
mokslams priskiriamus ems mokslus. iems studentams reikalingos specifins fizikos inios,
susijusios su vairifizikini vyksm gyvuosiuose organizmuose ir gamtiniuose objektuose aikini-
mu, fizikini metodtaikymu medicinoje, biologijoje, geografijoje, geologijoje bei hidrometeoro-
logijoje, prietais fizikinipagrindnagrinjimu. Tokios paskirties vadovli, jei neminsime siau-
ros tematikos metodini priemoni, per pastaruosius deimtmeius Lietuvoje nebuvo ileista, to-
dl iuo darbu siekiame upildyti susidariusi sprag.
Vadovlis yra dviej dali. Pirmj dal sudaro Mechanikos ir Molekulins fizikos skyriai, o
antrj Elektros, Magnetizmo, Medicinins elektronikos, Optikos ir Branduolio fizikos skyriai.
Kiekvienoje dalyje yraMatavim ir matavimo paklaid, Bendrdarbo mokomosiose laboratorijo-
se saugos problem bei Fizikos udavini skyriai, taip pat priedai ir literatros sraas.
Atsivelgiant auktj mokykl biomedicinos ir ems moksl studij programose fizikai
skiriam paskait laik, kuris sudaro nuo 16 iki 48 val., vadovlyje i viso pateikta daugiau kaip
dvideimties iems mokslams svarbi fizikos tem teorija. Kiekvienos temos aprae gana plaiai
apraomi fizikiniai reikiniai, j ryys su medicina, biologija, geologija, chemija, geografija ir kt.,
pateikiamos formuls, reikalingos fizikos udaviniams sprsti, dydiams skaiiuoti. Kiekvieno
skyriaus pabaigoje yra su tema susijusilaboratorini darb apraai: uduotys; darbo priemons ir
prietaisai; uduoi atlikimo metodika ir eiga.
Pateikiant teorin mediag stengtasi apsiriboti minimaliu formuli kiekiuir mediag idsty-
ti taip, kadji apimt pagrindinius faktus ir bt suprantama auktj mokykl pirmojo ar antrojo
kurs studentams. Todl knygoje yra daug aikinamj paveiksl, prietais schem, pateikiama
nemaai specifini medicinins ir biologins fizikos ini, nurodomi su kiekviena tema susij
taikymai medicinoje ir fiziniuose moksluose. Vadovlyje yra tem, aktuali vairi specialybi
studentams: pavyzdiui, medicinos regos ir klausos fizika, elektrokardiografija, elektrostimulia-
cija, gyvjorganizmtermoreguliacija; biologijos ir chemijos mikroskopija, spektrofotometrija;
geologijos, geografijos ir meteorologijos giroskopiniai reikiniai, ems magnetinis laukas, oro
drgm, ilumos perdavimo bdai, ir daugelis kit. Fizikos udavini skyriuje pateikti udaviniai
yra naudingi ugdant student gebjim taikyti fizikos inias vairioms situacijoms.
Vadovlyje aprayti keli kompiuterinio modeliavimo arba vadinamieji virtuals darbai, kuri
atlikimo metodika pateikta kompaktinje ploktelje Virtualioji fizikos laboratorija. Taigi stu-
dentai turi galimyb tokius darbus atlikti ne tik laboratorijoje, bet ir jiems patogioje vietoje pasi-
rinktu laiku, naudodamiesi asmeniniais kompiuteriais ir interneto ryiu.
Vadovl rengVilniaus universitetoFizikos fakultetoKvantins elektronikos katedros lekt. J. But-
rimait, prof. habil. dr. A. Dementjev (Fizikos instituto Netiesins optikos ir spektroskopijos
laboratorijos vedjas), prof. dr. R. Gadonas, doc. dr. J. Jaseviit, lekt. V. Karenauskait, prof. ha-
bil. dr. V. Sirutkaitis, prof. habil. dr. V. Smilgeviius ir Bendrosios fizikos ir spektroskopijos katedros
6 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
prof. dr. G. Dikius. Darbui vadovavohabil. dr. prof. V. Sirutkaitis. I vadovlioturiniomatyti autori
indlis temos apra, taiau kiekvienos temos pabaigoje pateikt laboratorini darb metodin
mediag daugiausiarengV. Karenauskaitir J. Butrimait.
Vadovlis ne tik autori keleri met darbo rezultatas. Prie jo rengimo prisidjo daugelis
moni. Tad knygos autoriai nuoirdiai dkoja:
Kvantins elektronikos katedros vedjui akademikui prof. habil. dr. A. Piskarskui u ios
knygos rengimo iniciatyv ir nuolatin dmes;
recenzentams: Kauno medicinos universiteto doc. dr. L. Bastienei, dr. A. Baginskui, Vytau-
to Didiojo universiteto prof. habil. dr. L. Praneviiui, Vilniaus universiteto doc. dr. M. Ba-
leviiui, prof. habil. dr. R. Rotomskiui ir Medicinos fakulteto doc. dr. P. Juodvalkiui ,
prof. habil. dr. D. Kalibatienei, u vertingas pastabas ir patarimus;
doc. J. Slavnui u galimyb pasinaudoti anksiau ileistais elektros darb apraais;
Kvantins elektronikos katedros darbuotojams: dr. S. Bagdonui u papildom mediag sky-
riui Regos fizika. Mikroskopija, dr. L.Gininui u mediag darbui Vaizd perdavimo
viesolaidine pyne tyrimas, doktorantei O. Balachninaitei u pasilyt papildom mediag
skyriui Kintamoji elektros srov. Omo dsnis kintamajai srovei, dr. A. Matijoiui ir J. Si-
rutkaitienei u technin pagalb;
kalbos redaktorei Z. Manstaviienei u kruopt ir dmesing rankraio redagavim;
Vilniaus universiteto leidyklos darbuotojai V. Vaidakaviienei u kantryb ir bendradarbiavi-
m maketuojant bei rengiant vadovl spaudai;
visiems kolegoms, bendradarbiams ir studentams, kurie atidiai skaitydami rankrat aptiko
ir nurod klaid bei netikslum;
visiems finansiniams vadovlio rmjams.
Nepaisant autori ir redaktori pastang, tam tikr netikslum galjo likti, todl u juos i
ankstoatsipraome.
Autoriai
FIZIKOS SSAJOS SU MEDICINA IR KITAIS FIZINIAIS MOKSLAIS _____________________________ 7
1. FIZIKOS SSAJOS SU
BIOMEDICINA IR KITAIS
FIZINIAIS MOKSLAIS
Gamtos painimas yra toks mogikas ir teistas,
jog kiekvienam, pasiaukojusiam iam tikslui, linkiu skms
V. Gt
Fizikos terminas kilo i graik kalbos odio, reikianio gamt, ir istorikai tapo terminu, varto-
jamu apibdinti gamtos reikini studijas. monija visais laikais domjosi gamtos reikiniais ir j
prieastimis. Kuo daugiau buvo suinoma apie gamt, tuo spariau pltojosi ir fizika. I pradi
informacija apie gamt buvo gaunama tik mogaus jutimais, t. y. regos, klausos, alio ir kario.
Tos inios devynioliktajame amiuje buvo apibendrintos ir isirutuliojo tokias klasikins fizikos
akas, kaip mechanika, optika, akustika, termodinamika. Elektromagnetizmas kaip atskira fizi-
kos aka susiformavo tik devynioliktajame imtmetyje, kai buvo sukurti pirmieji prietaisai, rea-
guojantys elektromagnetin lauk, nes mogaus jutimo organai yra maai jautrs iam laukui.
Itobulinus stebjimo ir eksperimentinius metodus, devynioliktojo amiaus pabaigoje prasidjo
koncepcin fizikos revoliucija, sukrusi reliatyvumo ir kvantins mechanikos teorijas ir pakeitusi
gamtos reikini, ypa materijos sandaros, suvokim. ios naujos teorijos pateik isamesn ir
vientisesn gamtos reikini supratim, grst materijos sandaros ir form sveika. is supratimas
buvo pavadintas modernija fizika, nors i tikrj reik tik naujovikesn, atitinkant to laiko
inias fizikin poir. Mokslo istorija rodo, kad reikini supratimas nuolat kinta. Pagal iuolai-
kin samprat, fizika tai mokslas, kurio tikslas yra tirti materijos formas ir j tarpusavio sveikas
bei jomis aikinti visus gamtos reikinius. I io apibrimo plaukia, kad fizika yra fundamenta-
liausias i vis gamtos moksl. Fizikos dsniai, bdami bendri materialiajampasauliui, svarbs
visiems biomedicinos ir fiziniams mokslams, juo labiau kad ribos, skirianios fizik nuo kit apie
gyvj ir negyvj gamt moksl, niekada nebuvo grietos. Chemija susijusi tik su vienu fizikos
aspektu: fizikos dsni taikymu molekuli sandarai, formavimuisi ir j saveikoms tirti bei prakti-
niu tikslu vienas molekules veriant kitomis. Biologija, aikindama sudtingus procesus gyvosiose
sistemose, remiasi fizika ir chemija.
Norint pasiekti fizikos, kaip ir kit fizini moksl, tikslus, naudojami stebjimo ir eksperimen-
t metodai. Stebjimas tai natraliai vykstanio reikinio stebjimas ir dokumentavimas sten-
giantis nustatyti vairiveiksni ir slyg tak. Dauguma natraliai vykstani reikiniyra reti ir
j pasirodymo slygos kinta maai, todl stebjimai yra ltas ir sunkus fizikini reikini tyrimo
metodas. Todl, jei manoma, taikomi eksperimentiniai metodai. Eksperimentavimas tai reiki-
nio stebjimas specialiai parengtomis ir grietai kontroliuojamomis slygomis. iuo atveju tyrjas
8 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
gali keisti slygas pagal nor ir kartulengviau suprasti, kaipjos veikia proces. Be eksperimentavi-
mo ir matavim iuolaikinis mokslas nebt pasieks iandieni auktum. Stebjimas ir eksperi-
mentavimas yra ne vieninteliai fizik taikomi metodai. I inom faktmokslininkai gali generuo-
ti naujas inias teoriniu bdu. iuoatveju fizikas silo tiriamos fizikins sistemos model. Naudojant
anksiaunustatytus sryius tiriama, ar modeliorezultatai atitinka eksperiment, ir pagal tai mode-
lis tobulinamas keiiant matematin jo apraym. Taipgali bti numatomi iki iol neinomi reiki-
niai atliekant teorin modeliavim arba nustatomi keli proces tamtikri sryiai.
Fizika, kaip modeli ir artini mokslas, reikalinga tiek gyvosios, tiek negyvosios gamtos tyr-
jams kaipmetod visuma. Medicinos studentams reikia gyti ini, kaiptaikyti fizikinius metodus
diagnostikai ir gydymui. Hidrologijos ir meteorologijos studentams svarbuimokti fizikos metod,
kad galt sprsti klimatologijos ir hidrologijos problemas. Geografijos specialybs studentams
aktualu suvokti fizikini gamtos vaizdini visum, jos dsningumus. Geologijos, hidrogeologijos,
ininerins geologijos specialybi studentams ypa svarbu ne tik gyti fizikos ini, bet ir imokti
jas taikyti atliekant savarankikus tyrimus.
Kita vertus, daugelis vyksm gyvuosiuose organizmuose (tarp j ir mogaus), j sveika su
aplinka apraomi fizikos dsniais ir yra biofizikini tyrim objektas siekiant geriau suprasti iuos
vyksmus. Tai mogaus klausa ir kalba, pagrstos akustikos ir mechanikos; rega optikos ir kvanti-
ns fizikos; irdies veikla mechanikos ir elektros, kraujotaka hidrodinamikos, gyvj organiz-
m termoreguliacija termodinamikos principais ir t. t. iuolaikinje biologijoje vis didja btiny-
b greta kokybini naudoti kiekybinius tyrimometodus, siekiant geriau suprasti ir tiksliau aprayti
tiriamus procesus. Tai taikoma ne tik eksperimentiniams tyrimo aspektams, bet ir pagrindinei
teorijai tokitem kaipfotosintez ir molekulin genetika. Kiekybinei biologijos raidai pastaruoju
metu daugiausiai takos dar fizikos fundamentiniai principai. Todl, norint suprasti iuolaikini
biologijos moksl koncepcijas, svarbu inoti iuos fizikinius principus.
Bet fizika svarbi ne tik tuo, kad yra koncepcinis ir teorinis kit gamtos moksl pagrindas. I
praktinio takosvarbu, kadji suteikia metodus ir technines priemones, kurios gali bti naudojamos
bet kurioje fundamentini ir taikomj tyrim srityje. Geologai naudoja gravimetrinius, akusti-
nius, branduolinius ir mechaninius metodus. Tas pats pasakytina apie okeanologus, meteorologus,
seismologus ir t. t. iuolaikinse ligoninse veikia laboratorijos, kuriose yra visi moderniausi fizi-
kiniai prietaisai. Medicinoje plaiai naudojamas ultragarsas, rentgeno spinduliai, radioizotopai,
lazeriai. Kiekvienoje iuolaikinje biologijos ar chemijos laboratorijoje rasime vairi mikroskop,
iuolaikini spektrofotometr.
Dvideimt pirmj ami daugelis mokslinink ar politikos veikj vadina biologijos amiumi,
todl iandien fizikos mokslininkai ieko nauj iki bei galimybi taikyti fizikos tyrim rezul-
tatus biomoksluose: lazeri spektroskopij vaizdinimui, atomins jgos mikroskopij tiriant
DNR. ie ir kiti metodai leidia pltoti nanodarini gyvuosiuose organizmuose tyrimus, pavelgti
submolekulin pasaul, o tai XXI amiaus mokslo paangos raktas, utikrinantis nuolatin,
simbiozin fizikos, biomedicinos ir kit fizini moksl sry, bei i srii mokslinink bendra-
darbiavim.
FIZIKOS SSAJOS SU MEDICINA IR KITAIS FIZINIAIS MOKSLAIS _____________________________ 9
Todl btina jau biomedicinos ir fizinimoksl studij lygmeniu siekti optimalios fundamenti-
ni ini ir j profiliavimo derms, mokomojoje mediagoje aprayti ne tik pamatines fizikos
mokslo inias, bet ir j taikym vairiose mokslo srityse, naujausius fizikos mokslo laimjimus. Tad
iame vadovlyje pagrindiniai fizikos reikiniai, dsniai, principai iliustruojami gausiais j taikymo
medicinoje, biologijoje, chemijoje, geologijoje, geografijoje pavyzdiais.
vairs fizikos tyrimo metodai ir prietaisai, sudarantys teorijos ir praktikos vienov, naudojami
ir kituose moksluose. gyti pagrindini tyrimo metod esmini ini studentai gali atlikdami labo-
ratorinius darbus. Tai btina, kad bsimieji specialistai ateityje galt greitai perprasti naujus, vis
tobulesnius metodus ir prietaisus, kadangi bendrieji j veikimo principai danai lieka nepakit.
Todl tiems, kurie pasirinko biomedicinos ar kit fizini moksl studijas, fizikos kursas gali
padti geriau suvokti gyvosios ir negyvosios gamtos fizikinius reikinius, dsnius, fizikos ir i
moksl ryius, j derms perspektyvas, susiformuoti fizikin poir gamtos pasaul.
10 ____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
2. 2. 2. 2. 2. MATAVIMAI IR MATAVIMAI IR MATAVIMAI IR MATAVIMAI IR MATAVIMAI IR
MATAVIMO PAKLAIDOS MATAVIMO PAKLAIDOS MATAVIMO PAKLAIDOS MATAVIMO PAKLAIDOS MATAVIMO PAKLAIDOS
2.1. Dydiai ir vienetai 2.1. Dydiai ir vienetai 2.1. Dydiai ir vienetai 2.1. Dydiai ir vienetai 2.1. Dydiai ir vienetai
Atliekant fizikos laboratorinius darbus, svarbu imanyti fizikini dydi matavimus, eksperiment
rezultat tikslum ir mokti rezultatus tinkamai apdoroti.
Eksperimento metu matuojami tam tikri fizikiniai dydiai. Dydis nusako reikinio, kno arba
mediagos esmin savyb, kuri gali bti kokybikai iskirta ir kiekybikai surasta. Terminas dydis
gali bti susijs su tam tikru bendruoju dydiu (ilgiu, laiku, mase, ) arba su atskiruoju dydiu (tam
tikro strypo ilgiu ir pan.). Kiekybin tam tikro atskirojo dydio iraika, sudaryta i matavimo
vieneto, padauginto i skaiiaus, yra vadinama dydio verte. Matavimas fizikinio dydio verts
radimas matavimo priemone. Matavimai gali bti tiesioginiai arba netiesioginiai.
Tiesioginiu vadinamas toks matavimas, kuriuo dominanio dydio vert nustatoma tiesiogiai i
prietaiso rodmen. Pavyzdiui, ilgio matavimas slankmaiu, laiko sekundmaiu, srovs stiprio
ampermetru.
Netiesioginiu vadinamas toks matavimas, kuriuo fizikinio dydio vert randama kaip kit dydi
funkcija. Pavyzdiui, kno tankis nustatomas inant jo mas ir tr, rezistoriaus vara i srovs
stiprio ir tampos tarp jo gal. Netiesiogiai randam dydi verts apskaiiuojamos pagal tam tikras
formules, imatavus jas einani dydi vertes. Kiekvienas matavimas yra nagrinjamo dydio ir
matavimo vieneto santykio radimas. Fizikini dydi matavimo vienetai yra skirstomi pagrindinius
ir ivestinius.
Tarptautin vienet sistema (SI, pranc. Systeme International dUnites) patvirtinta 11-oje Gene-
ralinje mat ir svarsi konferencijoje 1960 metais. Jos pagrindiniai vienetai: mass kilogramas
(kg), ilgio metras (m), laiko sekund (s), temperatros kelvinas (K), srovs stiprio amperas (A),
mediagos kiekio molis (mol), viesos stiprio kandela (cd).
Metras atstumas, kur vakuume nusklinda viesa per 1/299 792 458 sekunds dal. Tokia
metro apibrtis priimta 1983 metais, o iki tol jis buvo apibriamas vairiais dydiais.
Kilogramas mass vienetas; jis lygus kilogramo tarptautinio etalono, t. y. 39 mm skersmens ir
tokio pat aukio ritinio, pagaminto i 90 % platinos ir 10 % iridio lydinio, saugomo Tarptautiniame
mat ir svori biure Sevre (Sevres) prie Paryiaus, masei.
Sekund lygi spinduliavimo, atitinkanio kvantin uol tarp cezio-133 atomo pagrindins bsenos
dviej hipersmulkiosios sandaros lygmen, 9 192 631 770 period trukmei.
Kelvinas, termodinamins temperatros vienetas, yra vandens trigubo tako termodinamins
temperatros 1/273,16 dalis. Vandens trigubas takas egzistuoja esant 611 Pa slgiui ir 273,16 K
temperatrai.
MATAVIMAI IR MATAVIMO PAKLAIDOS ____________________________________________________ 11
Amperas stipris nuolatins elektros srovs, kuri, tekdama dviem tiesiais, lygiagreiais, be
galo ilgais, nykstamai mao apvalaus skerspjvio laidais, esaniais vakuume 1 m atstumu vienas
nuo kito, sukelia tarp j 2 10
7
niutono jg kiekvienam laid ilgio metrui.
Molis mediagos kiekis sistemos, sudarytos i tiek vienod daleli, kiek atom yra 0,012 kg
anglies 12. Vartojant mol, turi bti vardytos vienodos dalels. Jomis gali bti atomai, molekuls,
jonai, elektronai, kitos dalels arba tiksliai apibrtos toki daleli grups.
Kandela yra viesos stipris tokio altinio, kuris tam tikra kryptimi skleidia vienspalv 540 10
12
herc danio 1/683 vato steradianui stiprio spinduliuot. is vienetas skiriamas vertinti viesos
poveik mogaus akiai. Reikia paymti, kad 540 10
12
Hz danio viesai mogaus akis yra jautriausia
(bangos ilgis 555 nm).
Ivestiniai dydiai skiriasi nuo pagrindini ir yra ireikiami jais arba kitais ivestiniais dydiais.
Ivestiniai dydiai turi ivestinius SI vienetus, kurie apibriami pagrindiniais SI vienetais arba
kitais ivestiniais vienetais. Jie apskaiiuojami i tuos vienetus apibriani lygybi ir kartais
gali turti specialius pavadinimus ir simbolius. Dydio dimensija tai formul, pateikianti dyd
tam tikroje sistemoje kaip sandaug laipsnini daugikli, reikiani pagrindinius dydius.
Fizikini dydi skaitines vertes ne visada patogu apibdinti pagrindiniais vienetais, todl yra
vesti deimtainiai kartotiniai ir daliniai vienetai, keliomis ir net keliolika deimi kart
besiskiriantys nuo pagrindini. T vienet pavadinimai gaunami pridedant prie sistemini vienet
pavadinim atitinkamus priedlius. Pastarieji paprastai pateikiami lentelse (r. pried
4 lentel). Vartojant nurodytus priedlius, matavimo vienetas parenkamas taip, kad fizikinio
dydio vert bt ireikta vieneto eils skaiiumi.
2.2. Matavim tikslumas ir paklaid vertinimas 2.2. Matavim tikslumas ir paklaid vertinimas 2.2. Matavim tikslumas ir paklaid vertinimas 2.2. Matavim tikslumas ir paklaid vertinimas 2.2. Matavim tikslumas ir paklaid vertinimas
Kiekvienas matavimas yra neivengiamai susijs su tam tikru netikslumu. Dydio X matavimo
rezultato x
i
ir tikrosios matuojamojo dydio verts x
t
(daniausiai ji neinoma) skirtumas yra
vadinamas matavimo absoliuija paklaida
t i i
x x x = . i paklaida, o kartu ir matavimo tikslumas,
susij su matavimo prietais netobulumu, bandymo slyg ir paties matuojamojo objekto kitimu,
teorinio modelio ir taikomo matavimo metodo artutinumu ir kt.
Matavimo prietaisai rodo iek tiek padidintas arba sumaintas matuojam dydi vertes. ie
nuokrypiai nuo tikrj veri vadinami sistemingosiomis paklaidomis. Kartojant matavimus,
sistemingoji paklaida nuolat kartojasi. Sistemingosios paklaidos mainamos tikrinant prietaisus,
tobulinant eksperimento metodik bei lyginant to paties dydio matavimus skirtingais metodais.
Sistemingoji paklaida, kurios kilm yra inoma, o jos enklas ir didumas gana tiksliai nustatomi,
vadinama pataisa.
Be sistemingj paklaid, yra dar atsitiktins paklaidos. Atsitiktini paklaid prieastys yra
atsitiktiniai ir eksperimento metu nekontroliuojami trikdiai, kuri takos matavimo rezultatui
tiesiogiai vertinti negalima dl to, kad trikdi yra daug, j prigimtis vairi ir poveikis skirtingas.
Jei atsitiktins paklaidos yra tos paios eils arba gerokai didesns u sistemingsias, tai, matuojant
dyd kelis kartus, gaunamos skirtingos jo verts. Tokiu atveju nuokrypio nuo tikrosios dydio
12 ____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
verts enklas ir absoliutusis didumas nuolat kinta. Taiau daugkartini matavim atsitiktinms
paklaidoms galioja statistikos dsniai, todl atsitiktin paklaid galima enkliai sumainti t pat
dyd matuojant daug kart. Sistemingj paklaid atveju nuokrypio didumas ir enklas yra
pastovs.
Aikios ribos tarp sistemingj ir atsitiktini paklaid nra. Kai kuriais atvejais sistemingj
paklaid galima paversti atsitiktine. Pavyzdiui, sveriant kn svirtinmis svarstyklmis, gaut
mass paklaid eina ir sistemingoji svarelio mass paklaida. Sveriant t pat kn skirting komp-
lekt, nors ir tos paios tikslumo klass svareliais, sistemingosios paklaidos yra skirtingos ir pasi-
reikia kaip atsitiktins.
Matavimo neapibrtis x
p
yra su matavimo rezultatu susijs parametras, apibdinantis sklaid
veri, kurias pagrstai bt galima priskirti matuojamajam dydiui. Neapibrtis rodo matavimo
priemoni, metodikos ir kit procedr tobulum. Bendruoju atveju neapibrt sudaro daug sand.
Kai kurie i j vertintini i kartojam matavim empirinio skirstinio, apibdinamo standartiniu
nuokrypiu. Kiti sandai vertinami remiantis patirtimi ir kitokia informacija. Matavimo rezultatas yra
tiksliausias matuojamojo dydio verts vertinimas, o visi sandai, tarp j ir atsirandantys dl sistemingj
poveiki, turi takos veri sklaidai.
Pasikliautinumas yra matavimo rezultato kokybinis bruoas, kuriuo apibdinama matuojamo
dydio ir tikrosios verts atitikties tikimyb P. Visuotinai pripastama, kad ir tobuliausiai vertinus
visas paklaidas ir pritaikius pataisas, dar lieka tam tikra pasikliautinumo neinomyb. Imatuoto
dydio x galutinis rezultatas uraomas kaip aritmetinio vidurkio x ir neapibrties suma
P
x x x = , nurodant pasikliovimo tikimyb P. Pagal Europos Bendrijos reikalavimus paprastai
P = 95 %.
Kaip minta, yra dviej pagrindini ri matavimai: tiesioginiai ir netiesioginiai, todl i
matavim paklaidos skaiiuojamos skirtingai.
2.3. 2.3. 2.3. 2.3. 2.3.

Tiesiogini matavim paklaid skaiiavimas Tiesiogini matavim paklaid skaiiavimas Tiesiogini matavim paklaid skaiiavimas Tiesiogini matavim paklaid skaiiavimas Tiesiogini matavim paklaid skaiiavimas
Fizikiniam dydio x matavimui keliamas pagrindinis reikalavimas: nustatyti veri interval
P t P
x x x x x + ir nurodyti io intervalo pasikliovimo tikimyb P, kad tikroji matuojamojo
dydio vert yra tame intervale.
2.3.1. Tiesiogini matavim atsitiktins paklaidos skaiiavimo schema
1. Turint dydio x matavim duomenis x
i
, apskaiiuojama:
a) matuojamo dydio vidurkis

=
=
n
i i
x
n
x
1
1
,
b) atskir matavim paklaidos

x x x
i i
= ,
c) atskir matavim paklaid kvadratai ( )
2
i
x ir j suma
( )

=

n
i i
x
1
2
.
MATAVIMAI IR MATAVIMO PAKLAIDOS ____________________________________________________ 13
Matavimo Nr. x
i
x
i
(x
i
)
2
1 x
1

n x
n
x
0
1

=
=
n
i i
x ( )
=

n
i i
x
1
2
2. Randamas atskiro matavimo standartinis nuokrypis S ir standartinis vidurkio nuokrypis s
atitinkamai
( )
1
1
2

=

=
n
x
S
n
i i
,

( )
) n ( n
x
s
n
i i
1
1
2

=

=
.
3. Parenkama tam tikra pasikliovimo tikimyb P, paprastai P = 0,95.
4. I pried 1 lentels randamas Stjudento koeficientas t
n P ,
esant tam tikrai tikimybei P ir tam
tikram matavim skaiiui n.
5. Randamas matuojamojo dydio neapibrties atsitiktins paklaidos sandas s t x
P , n P , n
= .
2.3.2. Tiesiogini matavim sistemingosios paklaidos
Matavimo prietais sistemingosios paklaidos nusakomos tikslumo klase nuo 0,5 iki 4 (procentais).
Tikslumo klas daniausiai nurodoma ant prietaiso skals. Jeigu ant skals ji nepaymta, tai tokio
prietaiso santykin redukuotoji paklaida
r
(arba prietaiso tikslumo klas) yra didesn kaip 4 %.
Matavimo prietais paklaidos daniausiai vertinamos kaip atsitiktins nurodant jos didiausi
vert
rib
x . inant prietaiso tikslumo klas (santykin redukuotj paklaid
r
) ir jo skals matavimo
rib

x
rib
, prietaiso sistemingosios paklaidos didiausia vert

x
rib
apskaiiuojama pagal formul
100
rib r rib
/ x x =
. Tada esant pasirinktai pasikliovimo tikimybei P prietaiso sistemingoji
neapibrtis apskaiiuojama pagal formul
rib
3 x ) / t ( x
P , P , p
=

. ia koeficientas
P
t
,
randamas
i Stjudento koeficient lentels (jei P = 0,95, tai
P
t
,
= 2,0).
2.3.3. Tiesiogini matavim atsitiktins paklaidos
Matavimo prietais rodmenys daniausiai nuskaitomi vienos ar puss padalos tikslumu. Diskrei
skaitmenini prietais rodmenys nuskaitomi maiausio ingsnio (vienos padalos) tikslumu.
Slankmaio ir mikrometro rodmenys nuskaitomi vienos maiausios padalos tikslumu. Atskaitymo
paklaidoms vertinti vedamas apvalinimo intervalas h. Didiausia galima atskaitymo paklaida yra
lygi pusei apvalinimo intervalo x
a
= h / 2. Pasirinktai pasikliovimo tikimybei P atskaitymo
neapibrtis yra skaiiuojama taip: x
a, P
= Ph / 2. Kai P = 0,95, tai x
a, P
h /2.
2.3.4. Tiesiogini matavim sumin neapibrtis
Jeigu neapibrties sandai yra tos paios eils, tai sumin neapibrtis randama pagal formul
2 2 2
) x ( ) x ( ) x ( x
P , p P , a P , n P , s
+ + =
n(n 1)
Gauti rezultatai suraomi lentel:
( ) ( ) ( )
14 ____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
ir galutinis matavimo rezultatas uraomas
P , s
x x x = , nurodant dydio x dimensij ir tikimybs
P vert.
Apskaiiuojama ir santykin paklaida
x
x
P , s
x
100

=

%.
2.4. Netiesiogini matavim paklaid skaiiavimas 2.4. Netiesiogini matavim paklaid skaiiavimas 2.4. Netiesiogini matavim paklaid skaiiavimas 2.4. Netiesiogini matavim paklaid skaiiavimas 2.4. Netiesiogini matavim paklaid skaiiavimas
Danai iekomasis fizikinis dydis z yra tiesiogiai matuojam dydi a, b, funkcija: z = f (a, b, ).
Tada tikimiausia dydio z vert lygi z = ...) , , ( b a f . Dydio z paklaidos absoliuioji vert
| z z | | z | = , kai inomos tiesiogiai matuojam dydi paklaidos a b , , ..., nustatoma dvejopai.
Pati paprasiausia paklaidos vertinimo formul yra tokia:

" +

+ + = | ||
,...) , (
| | ||
,...) , (
| | ,...) , ( ,...) , ( | | | b
b
b a f
a
a
b a f
b a f b b a a f z
;
(2.1)
ia
,... ,
b
f
a
f

funkcijos f dalins ivestins. Lygybs enklas (2.1) formulje pasiekiamas, kai vis
dalini ivestini ir nepriklausomai matuojam dydi paklaidos yra vienodo enklo. Todl pagal
(2.1) formul vertinta paklaida vadinama ribine, nes taip nustatyta paklaida yra pati didiausia.
Kai nepriklausomai matuojam dydi yra maai (du, trys), i formul galima naudoti paklaidai
vertinti. Taiau kai matuojam dydi yra daug, tokia situacija maai tiktina ir pagal (2.1) formul
gaunama nepagrstai didel paklaida. Matematinje statistikoje yra parodoma, kad tuo atveju dydio
z neapibrtis tiksliau nustatoma formule
" +

=
2
,
2
, , P s P s P s
b
b
f
a
a
f
z
. (2.2)
Taigi netiesiogiai matuojamojo dydio z tikroji vert yra intervale ] , [
, , P s P s
z z z z +

su
pasikliovimo tikimybe P. Matavimo rezultatas uraomas taip:
P z b a z c b a z
P s
, ...) , , ( ) , , (
,
=
(2.3)
greta nurodant tikimyb. Kaip ir tiesioginiams matavimams, netiesiogini matavim rezultato
tikslumui apibdinti naudojama santykin paklaida neapibrties santykis su imatuoto dydio
aritmetiniu vidurkiu: z
z
/ = (ia ir toliau dl paprastumo neapibrties indeksai s ir P
neberaomi).
vertinant netiesiogiai imatuoto dydio z paklaid, danai patogiau i pradi apskaiiuoti io
dydio santykin paklaid, o po to absoliuij. Taip daniausiai daroma tada, kai iekomo dydio
z iraik galima urayti laipsnini funkcij sandauga:
; "
p m n
c b a z =
(2.4)
ia n, m, p bet kokie sveikieji, trupmeniniai, teigiamieji arba neigiamieji skaiiai. Btina atkreipti
dmes tai, kad dydiai a, b, c, ... turi bti matuojami nepriklausomai. Remiantis (2.2) formule,
iekomo dydio santykins paklaidos kvadratas
z
MATAVIMAI IR MATAVIMO PAKLAIDOS ____________________________________________________ 15
. ...
2 2 2 2
+


c
c
p
b
b
m
a
a
n
z
z
(2.5)
Santykin paklaid padauginus i iekomo dydio verts, gaunama jo absoliuioji paklaida.
2.5. Paklaidos apvalinimas ir 2.5. Paklaidos apvalinimas ir 2.5. Paklaidos apvalinimas ir 2.5. Paklaidos apvalinimas ir 2.5. Paklaidos apvalinimas ir
matavimo rezultat uraymas matavimo rezultat uraymas matavimo rezultat uraymas matavimo rezultat uraymas matavimo rezultat uraymas
Skaiiuojant paklaidas, matematinius veiksmus reikia atlikti kaip galima tiksliai. Bet vis tiek
kiekvienas skaiiavimo rezultatas yra apytikslis, gautas tam tikru tikslumu. Paklaidos vert uraoma
dviem reikminiais skaitmenimis, jei pirmasis i j yra vienetas; kitais atvejais vienu skaitmeniu.
Skaiiaus reikminiais skaitmenimis vadinami visi jo skaitmenys, taip pat ir nulis, jeigu jis nra
skaiiaus priekyje. Skaiiai apvalinami laikantis ios taisykls: jei pirmasis atmetamas skaitmuo
yra ne maesnis kaip 5, tai paskutinis paliekamas skaitmuo padidinamas vienetu. Matavimo
rezultatas apvalinamas tiek, kad jo ir paklaidos paskutiniai skaitmenys bt tos paios eils. Skaiiuoti
reikia tokiu tikslumu, kad skaiiavimo paklaida bt 10 ar daugiau kart maesn u eksperimentin.
Pavyzdiui, jei gauta vert x = 0,0154, tai atmetus skaitmen 4, uraoma x = 0,015. Jei x = 275,
tai btina suapvalinti iki x = 3 10
2
.
Galutinis matavimo rezultatas uraomas kartu su jo absoliuija paklaida. Dimensija ir
bendrasis daugiklis raomi u skliaust. Pavyzdiui, m = (1,05 0,03) kg.
2.6. Matavimai 2.6. Matavimai 2.6. Matavimai 2.6. Matavimai 2.6. Matavimai
2.6.1. Ilgio matavimas
Fizikiniai dydiai daniausiai matuojami atitinkamos paskirties matavimo prietaisais. Papras-
iausias laboratorinis ilgio matavimo prietaisas yra metalin liniuot, turinti centimetrines ir
milimetrines padalas. Ji yra gana tiksli: milimetr ir centimetr ymjimo paklaidos nevirija
atitinkamai 0,05 ir 0,1 mm. Matuojant tokia liniuote, matavimo tikslum lemia atsitiktin
atskaitymo puss padalos didumo paklaida. Taigi paprasta metalin liniuot tinka tik tada, kai
atstum pakanka imatuoti 0,5 mm tikslumu. Naudojamos ir tikslesns liniuots su smulkesnmis
0,1 mm padalomis. Tokios liniuots padalos stebimos per speciali iilgai slankiojani lup. Ilgis
ja imatuojamas 0,1 mm tikslumu. Plastmasini ar medini liniuoi gradavimo tikslumas
neinomas, todl jas naudoti laboratorijose nerekomenduojama.
Dar tiksliau ilgis matuojamas slankmaiais ir mikrometrais. Tikslesniems ilgio ar kampo
matavimo prietaisams naudojamas nonijus. J sudaro nedidel 10 ar 20 padal turinti liniuot, kuri
stumdoma iilgai pagrindins (mastelins) liniuots. Nonijaus tikslumas priklauso nuo jo padal
skaiiaus n ir lygus 1/n mastelins padalos daliai. Slankmatis yra nonijaus skal turintis prietaisas,
naudojamas ilgiui nuo 10 mm iki 100 mm matuoti (2.1 pav.). Slankmaio nonijaus skal gali turti
10 arba 20 padal.
...
16 ____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Matavimo bdas:
1. Slankmaio iaunos suglaudiamos ir patikrinama, ar nonijaus skals nulis sutampa su
fiksuotos skals nuliu. Jei ne, tai sidmimas rodmuo (nulio pataisa).
2. Matuojant kn, slankmaio iaunos iskeiamos arba suglaudiamos.
3. Tvirtinimo vartu ufiksuojama judamoji slankmaio dalis.
4. Nuskaitomas skals rodmuo.
5. Norint rasti tiksl dyd, prie perskaityto rodmens pridedama arba i jo atimama nulio pataisa.
Mikrometras yra prietaisas ilgiui iki 30 mm tiksliai matuoti (2.2 pav.). Vien kart apsisuks
bgnelis pasislenka per vien cilindrins vors padal (iuo atveju 50 bgnelio padal lygios 0,5 mm,
taigi kiekviena jo padala atitinka 0,01 mm). Mikrometro atskaitymo paklaida nevirija puss vienos

0
4 5 2 7 8 9 10
10
Matuoti i
vidaus
Nonijaus
skal
Tvirtinimo
vartas
Rodmuo atitinka
4,16 cm
Fiksuota
skal
Matuoti i
iors
0 10
5 4
1 0
2.1 pav. Slankmatis [pagal 33]

Cilindrin
vor
Bgnelis
Atrama
Mikrometrinis
sraigtas
Frikcinis mechaniz-
mas (kno prispau-
dimo jgai apriboti)
Padalos (iuo atveju
kievienos padalos vert
0,5 mm)
6,5 mm
Vien kart
apsisuks bgnelis
pasislenka per vien
cilindrins vors
padal (iuo atveju
50 bgnelio padal
lygios 0,5 mm, taigi
kiekviena jo padala
atitinka 0,01 mm)

0 5
40
5
40
2.2 pav. Mikrometras [pagal 33]
kiekvienos padalos vert
yra 0,5 mm)
4,15 cm
Pagrindin
6,91 mm
Vien kart apsisuks
bgnelis pasislenka per
vien cilindrins vors
padal (iuo atveju 50
bgnelio padal lygios
0,5 mm, taigi kiek-
viena jo padala atitinka
0,01 mm)
MATAVIMAI IR MATAVIMO PAKLAIDOS ____________________________________________________ 17
bgnelio padalos verts. Mikrometro gradavimas yra tokios paios eils. Todl maksimali matavimo
mikrometru sistemingoji paklaida atitinka bgnelio padalos vert.
Matavimo bdas:
1. Apskaiiuojamos bgnelio skals padalos verts.
2. Frikciniu mechanizmu visikai suglaudiamos prietaiso iaunos. Bgnelio skals nulis turt
sutapti su horizontalija atskaitos linija. Jei nesutampa, sidmima nulio paklaida.
3. Tarp iaun spraudiamas matuojamas knas ir frikciniu mechanizmu suglaudiamos
iaunos.
4. sidmimos didiausios matomos cilindrins vors skals
yms (iuo atveju 6,5 mm).
5. sidmima bgnelio padala, kuri sutampa su horizontalija
skals atskaitos linija (iuo atveju 0,41 mm).
Norint gauti tiksl rezultat (iuo atveju 6,91 mm), reikia
iuos du rodmenis susumuoti ir prie j pridti arba i j atimti
nulio patais.
Deformacijas patogu matuoti rodykliniu mikrometru
(2.3 pav.). Jo matavimai skaitomi apskritimo skalje, kurios
padala lygi 0,01 mm. Matuojamas knas remiasi judam atra-
m A, kurios poslinkis perduodamas mikrometro dantrai
sistemai, sujungtai su rodykle.
Matavimo slankmaiu ir mikrometru principais paremti ir ma-
tavimai kitais prietaisais, pavyzdiui, poliarimetru, goniometru,
mikroskopo koordinaciniu staleliu (tik ia koordinats atskai-
tomos dviem slankmaiais) ir kt.
2.6.2. Laiko matavimas
Vienas i paprastesni, danai naudojam laiko matavimo
prietais yra mechaninis sekundmatis (2.4 pav.). Juo galima
matuoti laiko intervalus nuo keli sekundi iki 60 min. Tokiais
sekundmaiais laikas imatuojamas ne didesniu kaip 0,2 s
tikslumu. Matavimo tikslum lemia sekundmaio sistemingoji
paklaida. Sekundmatis paleidiamas ir stabdomas paspaudus
galvut A. Paspaudus galvut B, rodykls grta pradin padt.
2.6.3. Tikslusis svrimas
Svrimu vadinamas kno mass radimas lyginant jo gravitacines savybes arba inertikum su
analogikomis etaloninio kno savybmis. Tiksliai kno masei rasti daniausiai naudojamos
svirtins ir elektronins svarstykls. Tikslios svarstykls skirstomos analizines ir mikroanalizines.
Analizini svarstykli tikslumas yra iki 1 mg, o mikroanalizini iki 10
3
mg. Plaiau apie svarstykles
ir naudojimsi jomis skaitykite 4.1 skyriuje.
0
1
2
3
4
5
6
7
8
9
10
0
20
30
40
50
60
70
80
90
90
80
70
60 40
30
20
10
0.01 mm
M ade in
V ilniaus U ni versitetas
F izikos F akultetas
K E K 517

2.3 pav. Rodyklinis mikrometras


10
20
30
40
50
5
10
15
20
25
30
35
40
45
50
55
M ade in
V il nius U ni ver sitetas
F i zikos F akul tetas
K E K 517

2.4 pav. Sekundmatis


A
A
B
18 ____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
2.7. Duomen apdorojimo programos 2.7. Duomen apdorojimo programos 2.7. Duomen apdorojimo programos 2.7. Duomen apdorojimo programos 2.7. Duomen apdorojimo programos
Pradjus naudoti asmeninius kompiuterius, eksperiment duomenims apdoroti taikomi vairs
program paketai, pavyzdiui, Microcal Origin, MathCAD, Matlab, Excel ir kt.
Microcal Origin ir kit program paket vairios versijos leidia apdoroti ir analizuoti didelius
duomen kiekius, pateikti rezultatus lenteli, grafiniu ir analitiniu pavidalais. Taip pat danai
ios programos palaiko dinaminius duomen mainus su duomen altini failais, su kit Windows
program objektais.
SAUGOS PROBLEMOS LABORATORIJOSE _____________________________________________________ 19
3. 3. 3. 3. 3. SAUGOS PROBLEMOS SAUGOS PROBLEMOS SAUGOS PROBLEMOS SAUGOS PROBLEMOS SAUGOS PROBLEMOS
LABORATORIJOSE LABORATORIJOSE LABORATORIJOSE LABORATORIJOSE LABORATORIJOSE
Studentai ir studij metu, ir darbinje veikloje susiduria su darbo saugos btinybe. Jie jau besi-
mokydami turi ne tik laikytis darbo saugos reikalavim, bet ir inoti pagrindinius darbo saugos
principus, kad galt taikyti juos ir ateityje.
3.1. Saugos taisykls atliekant 3.1. Saugos taisykls atliekant 3.1. Saugos taisykls atliekant 3.1. Saugos taisykls atliekant 3.1. Saugos taisykls atliekant
elektros laboratorinius darbus elektros laboratorinius darbus elektros laboratorinius darbus elektros laboratorinius darbus elektros laboratorinius darbus
1. Prie pradedant laboratorin darb, pirmiausia btina susipainti su tam darbui reikalingais
elektros tampos altiniais, suinoti tamp vertes.
2. Patikrinti, ar darbo vietoje yra visi darbui reikalingi prietaisai ir priemons, ar j jungiamieji
laidai bei kitukai tvarkingi.
3. Kiekvien darb atlikti tik jam skirtais prietaisais. Imti prietaisus i kit darbo viet galima
tik dstytojui ar laboratorijos darbuotojams leidus.
4. Prie pradedant jungti elektros grandin, visus prietaisus idstyti taip, kad jungiant nepersipint
laidai.
5. Jungiamj laid ilg parinkti apytiksliai tok, koks yra atstumas tarp jungimo tak.
6. I pradi jungti pagrindines grandines, po to matavimo prietaisus ir pagaliau tampos altinius.
7. Prie pradedant matavimus, visiems matavimo prietaisams parinkti tinkam matavimo skal
ir prietais rodykles nustatyti nulin padt.
8. Prietaisus jungti prie tampos altini tik dstytojui ar laborantui patikrinus elektros grandini
sujungim.
9. Pastebjus prietais gedimus, kitus sutrikimus ar dingus tampai grandinje, nedelsiant i-
jungti grandin ir praneti apie tai dstytojui.
10. Pasitraukiant i darbo vietos, btina atjungti tampos altinius.
11. Baigus darb, pirmiausia reikia atjungti tampos altinius ir prietaisus, tik po to iardyti
grandin. Laidus tvarkingai sudti jiems skirtas vietas.
20 ____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
3.2. Saugos taisykls atliekant kitus laboratorinius darbus 3.2. Saugos taisykls atliekant kitus laboratorinius darbus 3.2. Saugos taisykls atliekant kitus laboratorinius darbus 3.2. Saugos taisykls atliekant kitus laboratorinius darbus 3.2. Saugos taisykls atliekant kitus laboratorinius darbus
1. Atsargiai elgtis su lengvai dtaniais daiktais, vairiais stikliniais indais, termometrais,
manometrais ir kt., ypa tada, kai kurie nors i j yra kaitinami.
2. Labai atidiems reikia bti su koherentins viesos spinduoliais, kadangi jie danai maitinami
aukta tampa.
3. Dirbant su optiniais prietaisais, negalima liesti pirtais vairi element optini paviri, per
kuriuos sklinda viesa.
4. Dirbant su vairiais prietaisais, maitinamais 220 V tampa, laikytis 3.1 skyriaus 2, 3, 7, 9 ir 10
taisykli.
3.3. Elektros srovs poveikis ir elektrins saugos priemons 3.3. Elektros srovs poveikis ir elektrins saugos priemons 3.3. Elektros srovs poveikis ir elektrins saugos priemons 3.3. Elektros srovs poveikis ir elektrins saugos priemons 3.3. Elektros srovs poveikis ir elektrins saugos priemons
Labai svarbu inoti apie aling elektros poveik mogaus organizmui ir imanyti saugos metodus.
Ypa tai svarbu vis kategorij medicinos darbuotojams, kurie pastaruoju metu medicinos diag-
nostikai ir gydymui naudoja daug iuolaikins elektronins aparatros.
3.3.1. Statini elektros krvi poveikis ir sauga nuo j
Veikiant viesai, slgiui ir triniai, mogaus kno pavirius sielektrina statiniais elektros krviais.
Tai labai silpni vyksmai, bet jie veikia nervinius receptorius, sukeldami nepageidaujam papildom
dirginim, ypa nemgstam vyresnio amiaus moni.
sielektrinimas atsiranda ne tiek ardant chemines jungtis, kiek nubraukiant nuo drabui
elektrintas dulki daleles, i oro prilipusius jonus. Jeigu mogus vilki sintetiniais drabuiais, tai
trintis tarp jo kno ir drabui elektrina juos prieingo enklo krviais, ir tada drabuiai gali
prilipti arba juos velkantis sukelti kibirktis. Statiniai krviai susidaro sausame ore, kai potencial
skirtumas yra keli imt ar tkstani volt didumo.
Statiniai elektros krviai yra ne tik alingas dirgiklis mogaus odai, bet ir tam tikr galim
pavoj altinis. ia vardyti du didiausi galimi pavojai:
1. Statiniai elektros krviai dl kibirki gali sukelti sprogim, jeigu moksliniam eksperimentui
ar medicinoje, pavyzdiui, anestezijai, vartojamos sprogstamosios dujos (eteris arba
ciklopropanas).
2. Gali kilti antrini pavoj, jei mogus staigi isielektrinimo kibirkt sureaguos nevalingais
judesiais. Tokiu atveju gali bti imestas i rank ir sudauytas koks nors stiklinis indas su
skysiu, apipilama aparatra arba trukteljus, pavyzdiui, prie paciento, prijungtus laidus,
jie atjungiami.
Norint ivengti toki pavoj, reikia nevilkti sintetini drabui, patalpose grindys turi bti
laidios, kad ant j nesirinkt statiniai elektros krviai. Visi staliukai ir veimliai turi bti su
guminiais ratukais. Be to, reikia vengti vartoti sprogstamsias dujas.
SAUGOS PROBLEMOS LABORATORIJOSE _____________________________________________________ 21
3.3.2. Elektros srovs poveikis
I esms pavojingas yra elektros srovs tekjimas mogaus knu. Elektros keliam al nusako
tekanios srovs stipris, kuris priklauso nuo prijungtos tampos ir visos grandins varos. tampos
didum lemia naudojamo prietaiso maitinimo tampa, o grandins var mogaus kno ir dviej
jungiamj laid, jeigu jie yra, vara.
Elektros srovs sukeltas organizmo paeidimas priklauso nuo srovs stiprio, jos kitimo laikui
bgant (esant kintamajai srovei nuo danio), nuo poveikio trukms ir nuo srovs tekjimo kelio:
pavojingiausi atvejai, kai srov teka per ird ir plauius, t. y. nuo rankos link rankos ar nuo
rankos link kojos. Didiausias paeidimas (iluminis ar paralyiuojantis) pasireikia ten, kur yra
maas prijungiamo elektrodo plotas. Nuo elektrodo tolyn srov organizme akojasi ir renkasi ke-
lius, kuri vara maesn. Organizme gali susidaryti keletas lygiagrei skirting srovs stipri
grandini.
Poveikio pobdis priklausomai nuo srovs stiprio pateikiamas 3.1 lentelje. Ji sudaryta remiantis
duomenimis, gautais vairi stipri 50 Hz kintamj srov jungiant prie uns krtins vienai sekundei.
Pavojingesn yra kintamoji srov, ypa nepalanki irdiai yra 50 Hz danio kintamoji srov.
Kintamosios ir nuolatins elektros srovs poveikio padariniams palyginti pateikiama 3.2 lentel.
ios lentels duomenys atitinka tuos atvejus, kai elektros srov eina kno paviri ir i jo
ieina. Jeigu srov eina ir i jo ieina tiesiai irdies paviri (pavyzdiui, per kateter), tai net
keleto deimi mikroamper srov (kai tampa ne didesn kaip 5 V) sukelia irdies skilveli
virpjim. Tokiems atvejams saugos riba yra laikomas 10 A stipris.
Kaip jau minta, lemiam tak srovs stipriui daro mogaus kno vara. Maiausia savitja
vara (r. 6.1 skyri) isiskiria tie mogaus kno audiniai, kuriuose yra daugiau elektrolit ir
maiau pertvar. Tarplstelinis skystis geriau praleidia nuolatin elektros srov, nes netrukdo
membranos. vairi audini savitosios varos pateiktos 3.3 lentelje.
Srovs stipris (mA) Poveikis
1 Jautros slenkstis
16 Susitraukia raumenys, negalima atsiplti nuo kontakto
50 Skausmas, galimas smons netekimas, mechaniniai paeidimai, irdis ir
kvpavimo sistema tebefunkcionuoja
1003000 irdies ir kvpavimo paralyius

3.1 lentel. Kintamosios srovs poveikis gyvam organizmui
3.2 lentel. Kintamosios ir nuolatins srovs poveikis mogui
Srovs stipris (mA) Poveikis mogui
Kintamoji 50 Hz srov Nuolatin srov
11,5 56 Jutos slenkstis
15 7080 Skausmingi raumen traukuliai
25 90100 Kvpavimo spazmai, didelis skausmas
80 300 Skilveli virpjimas, mirties pavojus
100 500 irdies paralyius, klinikin mirtis

22 ____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Kaip matyti i 3.3 lentels, elektros srov gali pasirinkti maesns varos kelius, bet negali
apeiti odos, todl btent odos vara lemia knu tekanios elektros srovs stipr. Vis audini vara
gali keistis priklausomai nuo j funkcins bkls, t. y. nuo j prisipildymo vandeniu (pabrinkimo)
arba krauju. Be to, vara gali keistis po pirmojo elektros poveikio audiniai atsimena, kad jais
tekjo srov.
Odos vara priklauso nuo jos amiaus,
storio, drgnumo ir maja didjant kontakto
slgiui. Pavyzdiui, gydomj procedr
metu, kai oda sudrkinama, jos vara kon-
takto su elektrodu vietoje gali bti 15 k.
Labai svarbu tai, kad vara priklauso nuo
tampos. i priklausomyb vaizduojama 3.1 pa-
veiksle, kur uregistruota mogaus odos vara,
keiiant tamp tarp rank, kai oda nepaeista.
I io grafiko matyti, kad esant 100 V tampai
vara priklausomai nuo odos storio ir drg-
numo gali skirtis deimia kart. Kai tampa
didesn, is skirtumas maja, maja ir varos
vert.
Odos varos ir pavojingos tampos verts kai kuriais atvejais nurodytos 3.4 lentelje.
Vara smarkiai sumaja, jeigu pramuamas odos raginis sluoksnis. Vidaus organ var prasta
laikyti pastovia ir lygia 1000 . Kadangi oda gali bti paeista, tai skaiiuojant bendr mogaus
kno var btina prilyginti vidaus organ varai, t. y. 1000 . Remiantis srovs poveikio organizmui
tyrimais ir atsivelgiant kno varos didum, elektros maitinimo tinkl tampa (220 V) laikoma
pavojinga. Nepavojinga laikoma tampa, ne didesn kaip 24 V.
3.3 lentel. mogaus kno audini savitoji vara
Audiniai
Savitoji vara, m
Nugaros smegenys 0,55
Kraujas 1,66
Raumenys 2,0
Nervinis audinys 14
Riebalinis audinys 33
Sausa oda 10
5

Kaulas 10
7



stora, sausa
oda
plona, drgna
oda
650
10
4

10
2

10
3

R,
10
2
10
3
10
4
U,V 10
3.1 pav. Odos varos priklausomyb nuo tampos
Plona, drgna
Stora, sausa
3.4 lentel. Odos varos ir pavojing tamp verts

.
m
SAUGOS PROBLEMOS LABORATORIJOSE _____________________________________________________ 23
3.3.3. Saugos nuo elektros srovs priemons
Pirmiausia reikia atkreipti dmes tai, kokia reikm turi elektros grandin jungti saugikliai.
Jie apsaugo pai grandin nuo trumpo jungimo, nuo didelio ilumos kiekio, kuris galt isiskirti
tekant stiprioms srovms, bet neapsaugo mogaus, kad elektros srov netekt per j. Saugikliai
nutraukia elektros srov, kai jos stipris tampa didesnis u tam tikr pasirinkto saugiklio
slygojam vert. Kad saugiklis nutraukt srov, per j turi pratekti stipri srov. Todl jis suveikia
slygikai ltai, t. y. pakankamai greitai, kad apsaugot elektros grandin, bet nepakankamai
greitai, kad apsaugot mog nuo per daug stiprios srovs. Todl btina pasirpinti grietesnmis
srovs stipr ribojaniomis priemonmis.
Kintamoji srov teka dviem laidais: faziniu, kuriuo perduodama srovs energija, ir nuliniu,
kuris paprastai jungiamas su dideliu elektrodu, kastu em. Nulinio laido potencialas yra
tiksliai lygus ems toje vietoje potencialui arba nulinio laido potencialas yra tiksliai lygus nuliui
ems atvilgiu. Kintamosios srovs kitukiniai lizdai sienose yra jungiami su elektriniais arba
transformatoriniais kabeliais, kurie pagaminti i labai laidi elektrai mediag (pavyzdiui, vario),
taiau turi vis dlto baigtin var. Dl to tarp kabelio gal susidaro tam tikras potencial skir-
tumas, o nulinio laido potencialas, palyginti su ems potencialu toje vietoje, gali skirtis net 10 V
(3.2 pav.). is potencial skirtumas gali bti pavojingas, jei nulinis laidas susisiekt su eme per
vanden ar drgnas grindis.
Jeigu naudojamo prietaiso korpusas metalinis, tai dvilaidis kabelis ir dviej skylui kitukinis
lizdas yra labai pavojingi. Kai kuriose alyse dviej skylui kitukiniai lizdai yra udrausti net
buityje ir juo labiau medicinos staigose. Teisingas sprendimas yra sujungti metalin prietaiso korpus
su eme toje pat vietoje. Toks jungimas galimas rengus prietais, bet dar paprasiau, jei yra rengtas
trij skylui kitukinis lizdas ir triakis kitukas bei naudojamas trilaidis kabelis. Pastaruoju metu
pagal ES standartus naudojamos trilaids sistemos trilaidiai dviej skylui kitukiniai lizdai ir
dviakiai kitukai, kuri centre yra nulinio laido jungtis (3.3 pav.).
Reikia atkreipti dmes tai, kad, turint trij skylui kitukin lizd ir triak kituk arba pagal
naujausius standartus rengtas trilaides sistemas, ikyla naujas pavojus. Aptarnaujantis prietais
mogus dabar pasitiki, kad korpusas gerai emintas, ir gali nukentti nutrkus kabelyje nuliniam
laidui. Todl kabelius btina reguliariai tikrinti. Jokiu bdu negalima ijungti kituko i lizdo.
Tempiant u kabelio nulinis laidas gali nutrkti ir tai bus nepastebima, nes jungtas prietaisas
normaliai veiks.
3.2 pav. Srovs perdavimo nuo elektrins iki vartotoj pagrindini laid jungimo diagrama

Fazinis laidas
Nulinis laidas
(0 V)
eminimas
Elektrin
arba
transfor-
matorin
Srovs vartotoj
apkrovos
Vietin sienin
rozet
Nulinis laidas
( 0 V dl vietini
apkrov eminimo)
Nulinis laidas
Vietinis sieninis
kitukinis lizdas
24 ____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Apibendrinant saugos reikalavimus galima suformuluoti taip:
1. Mokymo, mokslo ir medicinos staigose gali bt naudojami tik eminti kitukiniai lizdai.
2. Visi metaliniai, esantys aplink dirbantj su prietaisais daiktai turi bti eminti kartu per t
pat atskir kitukin lizd.
3. Niekada netraukti u laido, norint atjungti prietais.
4. Nuolat tikrinti kabeli nulin laid ir rengini technin bkl.
5. Atsisakyti sintetini drabui, kad nesusidaryt statiniai elektros krviai.
6. Jeigu situacija atrodo pavojinga, btina kreiptis technikai kvalifikuotus specialistus.
* ** **
3.4. Paciento apsauga 3.4. Paciento apsauga 3.4. Paciento apsauga 3.4. Paciento apsauga 3.4. Paciento apsauga
iuolaikikose medicinos staigose yra naudojama daug vairi elektronini arba maitinam i
elektros tinklo prietais, kurie reikalingi tiek diagnostikai, tiek gydymui. Su jais kontaktuoja
pacientai, medicinos bei techninis personalas. Norint ivengti pavoj (elektros oko, nudegim,
padidintos radiacijos, sprogim, ugnies ir kt.), vairs prietaisai turi bti ypa atidiai priirimi ir
naudojami.
Pacient btina apsaugoti nuo pavoj, kylani dl galim elektroninio aparato ar sistemos
gedim ir diagnostinio tyrimo ar gydomosios procedros taisykli paeidim. J metu paciento
knu teks per didel, vadinamoji nuotkio, srov.
Geriausias metodas ivengti nuotkio per pacient srovs naudoti instrumentus, kuriuose
3.3 pav. Prietaiso jungimo trilaidiu kabeliu trilaid sistem schema
220
Nulin
jungtis Trilaidis kabelis
Prietaiso
korpusas
Dviakis kitukas su
nuline jungtimi
* Medicinos fakultet studentams.
3.5 lentel. Prijungt prie paciento rengini nuotkio srovs verts
Nuotkio srovs stipris, A
Individualaus paciento 1020
Srov tarp paciento galni 50
Keleto kartu sujungt pacient 100
eminimo 100

SAUGOS PROBLEMOS LABORATORIJOSE _____________________________________________________ 25
nemanomas didesns negu 12 A srovs tekjimas per kiekvien prie paciento prijungt laid.
Tai ypa svarbu, kai laidai sujunti su paciento irdimi elektrostimuliatoriaus elektrodais ar elektrolit
pripildytais kateteriais.
Jeigu vienu metu paciento bklei tirti arba jam gydyti yra jungiamas ne vienas elektrinis
prietaisas, tai gali susidaryti pavojing situacij dl skirting eminimo kontr arba skirting
maitinimo fazini laid potencial skirtumo. Todl labai svarbu, kad kartu jungiam aparat
eminimo kontras bt bendras ir maitinimo fazinis laidas bt tas pats. Ir dar viena aplinkyb:
paciento eminim reikia vertinti kaip blog, o ne kaip apsaugos priemon, ir jo vengti. Sistemos,
kuriose pacientas bna funkcikai emintas, pavyzdiui, raant elektrokardiogram, naudojamos
pakankamai danai, todl tokiu atveju btinas atskiras laidas.
Labai svarbu apsaugoti pacient nuo maitinimo tinklo tampos. Tam yra vienintel patikima
priemon darbin grandin nuo paciento atskirti transformatoriumi.
Medicinos staigose yra pavoj dl taisykli paeidim. Vienas i svarbesni dalyk yra
naudojamo aparato maksimalios galios (srovs stiprio, tampos) ir galios, vartojamos atliekant
tam tikr procedr, santykis. Jis turi bti minimalus. Pavyzdiui, bt paeidimas, jeigu burnos
gleivins galvanizacija, vykdoma keli miliamper stiprio srove, bt atliekama prietaisu, kurio
maksimalus srovs stipris lygus 100 mA. Atsitiktinai pasukus reguliavimo rankenl, srov gali
pasidaryti pavojingo stiprio. Atlikti procedr, tiksliai laikantis nustatyt srovs arba tampos
parametr, padeda signalizacijos elementai. Btina sistemos jungimo tinkl viesos
signalizacija.
Todl, norint utikrinti vairi situacij saugum, vairi kategorij medicinos personalas privalo
laikytis taisykli, surayt 3.3.3 skyrelyje. Be to:
1. Kiekvienam ligonins pacientui turi bti atskiras elektros tampos altinis ir visi jo prieirai
ar gydymui reikalingi prietaisai turi bti jungiami kartu bei turti vien eminimo tak.
2. Pacientas turi bti sujungtas su eminimu vieninteliu atskiru laidu.
3. Dirbant su medicinine aparatra, naudojami tik izoliuoti stiprintuvai.
4. Procedros atliekamos tik prietaisais, kuri maksimalus srovs stipris nevirija tai procedrai
reikalingos ribins srovs verts.
5. Turi bti naudojama viesos signalizacija.
26 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
4. MECHANIKA
4.1. Kn inertikumas. Mas, svoris ir sunkis
Kn inertikumas. Kno mas. Mediagos tankis.
Visuotinis traukos dsnis. Kno svoris ir sunkis.
Archimedo dsnis.
Svarstykli sandara. Lygiapei svarstykli jautris.
Svarstykli tipai.
Tikslaus svrimo taisykls.
4.1.1. Kninertikumas. Kno mas, svoris ir sunkis
Pirmasis Niutono dsnis teigia: kiekvienas knas ilaiko rimties arba tolygaus tiesiaeigio judjimo
bsentol, kol kitknpoveikis jonepriveriatbsenpakeisti. Vadinasi, ijudintoknojudjimui
palaikyti iorin jga nereikalinga. i kn savyb vadinama inertikumu, o pirmasis Niutono
dsnis dar vadinamas inercijos dsniu.
Inertikumas pasireikiaknui prieinantis iorinei jgai, kuri veriapakeisti jojudjimobsen.
Knogreiiopokyt nusakantis dydis, kno pagreitis, lygus a, pagal antrj Niutono dsn yra tiesiog
proporcingas kn veikianiai jgai F ir atvirkiai proporcingas to kno masei m:
m
F
a = . (4.1.1)
Bandymai rodo, kad, kuo didesn jga veikia kn, tuo didesn pagreit jis gyja. Kita vertus, jei
vienodos jgos veikia skirtingus knus, j gytieji pagreiiai yra skirtingi, nes skirtingas kn
inertikumas. Kninertikumkiekybikai nusakant fizikin dyd apibr I. Niutonas (I. Newton)
ir pavadino j mase. Taigi masyra kninertikumo slenkamajame judjime matas. Ji apibriama
kaip kn sudaranios mediagos kiekis. Kn inertikum nusakani mas vadiname inercine
mase. Taiau su mase susijusi dar kita pagrindin materialiojo kno savyb gravitacija.
Pagal Niutono gravitacijos (visuotins traukos) dsn bet kokie du
knai traukia vienas kit jga, tiesiog proporcinga jmasms m
1
, m
2
ir
atvirkiai proporcinga atstumo r tarp j kvadratui (4.1.1 pav.) . ios
jgos modulis uraomas taip:
2
2 1
21 12
r
m m
F F F

= = =
; (4.1.2)
ia gravitacijos konstanta.
F
12
m
2
F
21
m
1
4.1.1 pav. Dviej kn
gravitacin sveika
MECHANIKA ____________________________________________________________________________ 27
i formulgalioja tada, kai knmatmenys yra mai, palyginti su atstumu tarpj(tuomet knai
laikomi materialiaisiais takais). Todl traukos jgos tarp kn laboratorinmis slygomis mes
nepastebime, nes ji yra labai maa, palyginti su kn sunkiu.
Kaip matyti, kno mas yra ir gravitacijos matas. i mas vadinama gravitacine, arba svarija,
mase. Kaip parod bandymai, kno inercin mas lygi jo gravitacinei masei, todl, inant kno
inertikum, galima numatyti jo svarum, ir atvirkiai.
Suknosvarumususijusi netikmas, bet ir josvoris. Knosvoris tai jga, kuriaknas dl ems
traukos veikiapakabar atram. Knosvor galimamatuoti dinamometruarbanustatyti svarstyklmis,
lyginant j susvareliosvoriu. Taiauknosvoris priklausone vientik nuoems traukos tamknui,
bet ir nuopakabos ar atramos judjimopagreiio. Jei pakabos ar atramos pagreitis nukreiptas emyn,
kno svoris maja, o jei auktyn didja. Taip paaikinama nesvarumo bsena, kai pakabos ar
atramos pagreitis nukreiptas emynir lygus laisvojo kritimopagreiiui.
Sunkio jga (sunkis) tai jga, kuria em veikia nagrinjamj kn. Kadangi dl ems
traukos knas gyja laisvojo kritimo pagreit g, tai sunkio jga F
g
skaitine verte lygi kno mass ir
laisvojo kritimo pagreiio g tamtikroje vietoje sandaugai:
F
g
= mg. (4.1.3)
Knus, esanius ems paviriuje, veikia traukos (gravitacijos) jga, nukreiptaems centrolink
ir atvirkiai proporcingaatstumonuoknoiki ems centrokvadratui. Kadangi emsukasi, knus
taippat veikiaicentrin jga, statmenaems sukimosi aiai ir nukreiptanuosukimosi aies. i jga
priklausonuoems paviriaus vietos, kuriojeyraknas, geografins platumos ir lygi nuliui aigaliuo-
se, o didiausia (sudaro 0,3 % sunkio jgos) pusiaujyje. Gravitacijos jga taip pat priklauso nuo
platumos, nes em nra tikslios rutulio formos (ji suplota aigaliuose). Dl to pusiaujyje traukos
jga 0,2 %maesnkaipaigaliuose. Taigi ems aigaliuosesunkiojgair laisvojokritimopagreitis
yra 0,5 %didesnis negupusiaujyje. Sunkiojgair laisvojokritimopagreitis dar priklausonuoaukio
vir ems paviriaus, nes, tolstant nuo jos sukimosi aies, icentrin jga didja. Kylant auktyn,
sunkio jga ir laisvojokritimo pagreitis maja.
Lyginant svorio ir sunkio jgas, pirmiausia pasakytina, kad ios jgos veikia skirtingus knus:
svorio jga pakab arba atram, o sunkio nagrinjamj kn. Be to, sunkio jga tamtikroje
vietojeyrapastovus dydis, oknosvoris, kaipjauminta, priklausonuopakabos ar atramos judjimo
pagreiio. Skaitine verte kno svorio ir sunkio jgos lygios tada, kai to kno pakabos ar atramos
takas juda tiesiai pastoviu greiiu arba yra rimties bsenos.
Norint labai tiksliai nustatyti kurionors knosunkiojg, reikia j matuoti beorje erdvje, nes
ore kiekvienas knas palengvja. Pagal Archimedo dsn kiekvien kn, panardint skyst ar
dujas, vertikaliai auktyn veikia keliamoji jga, lygi istumto skysio ar duj sunkiui. Istumto
skysio arba duj tr paymjus V, jo tank , Archimedo jgos modul galima urayti taip:
F
A
= Vg. (4.1.4)
Tankis yra fizikinis dydis, apibdinantis kno mass pasiskirstym. Trinis tankis savo skaitine
verte lygus mediagos trio vieneto masei:
=m/V. (4.1.5)
28 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Jis matuojamas kilogramais kubiniam metrui (kg/m
3
). I pateikto 4.1.2 paveiksle pavyzdio
matyti, kaip keiiasi ems tankis (a) ir laisvojo kritimo pagreitis (b) tolstant nuo ems centro.
4.1.2. Svarstykls ir j tipai
Kno svrimas tai kno mass nustatymas svarstyklmis. Plaija prasme svarstykls gali bti
vairi tip, kadangi ir knai, kuri mas norima inoti, yra nuo maiausi elementarij daleli
iki planet ar vaigdi. Visos svarstykls, kad ir kokios konstrukcijos ar tipo bt, tiesiogiai
daniausiai nustato ne kno mas, o to kno sunkio jg, arba sukamj moment. I i dydi
apskaiiuojama kno mas, arba svarstykls i anksto yra sugraduojamos mass vienetais.
iuolaikik svarstykli veikimas paremtas ne sveriamo kno svorio palyginimu su svareli
svoriu, bet su kitomis veikianiomis jgomis, pavyzdiui, daniausiai elastini kn deformacijos
jgomis. iuo principu veikia spyruoklins svarstykls. Jos yra i anksto sugraduojamos.
Spyruoklini svarstykli veikimo principas paremtas Huko dsniu (r. 5.6 skyri). iuo atveju
svarstyklijautrusis elementasyraspyruokl, kuri deformuojasi veikiamasveriamokno, oknosunkio
jgatsveriaitemptos(arbasuspaustosarsusuktos)spyruoklstamprumojga: F=kx; ia xspyruokls
deformacija, k spyruokls standumas. Paprasiausios spyruoklins svarstykls dinamometras.
Duomenys nuskaitomi skalje, kurioje juda rodykl, sujungta suspyruokle. Numus sveriam kn
nuo svarstykli, rodykl grta nulin padt, t. y. paveikus riboto didumo jga spyruoklje
neatsiranda liekamosios deformacijos. Spyruoklinmis svarstyklmis matuojama ne kno mas,
bet svoris. Taiaudaugeliuatvejspyruoklinisvarstykliskalgraduojamamass vienetais. Kadangi
laisvojo kritimo pagreitis priklauso nuo geografins platumos ir aukio vir jros lygio, tai
spyruoklini svarstykli rodmenys priklauso nuo j buvimo vietos. Be to, spyruokls tamprumo
savybs priklausonuo temperatros ir keiiasi laikui bgant. Visa tai maina svarstykli tikslum.
Mikrosvarstyklse, kurios yra daug jautresns u spyruoklines, vienas kvarcinio silo galas
tvirtinamas, o prie kito kabinamas sveriamas knas. Kno sunkis nustatomas i silo ilinkimo,
matuojamo mikroskopu.
Svarbiausia vis tip svarstykli charakteristika didiausia leistina ribin apkrova, t. y. tokia
apkrova, kuri gali atlaikyti svarstykls, nesikeiiant j metrologinms charakteristikoms.
Pagal ribins apkrovos dyd svarstykls skirstomos stacionarisias (iki imtton), kilnojamsias
(nuo 50 kg iki 6 t) ir stalines (iki 50 kg). Moksliniais tikslais daniausiai naudojamos laboratorins
svarstykls iki 50 kg ribins apkrovos, o maoms masms nustatyti vadinamosios analizins
4.1.2 pav. ems tankio (a) ir laisvojo kritimo pagreiio (b) priklausomybs nuo ems spindulio
a) b)
P
a
g
r
e
i
t
i
s
,
m
s
-
2
MECHANIKA ____________________________________________________________________________ 29
svarstykls (1500 g ribins apkrovos) ir mikroanalizins (<0,1 mg). Stacionariosios ir kilnojamosios
svarstykls yra nelygiapets veikia svertoprincipu. Pagal svirties peiilgisantyk jos vadinamos
deimtainmis (svarelio mas sulyginama su deimt kart didesne mase) ir imtainmis.
Laboratorins svarstykls (iki 10 kg ribins apkrovos) beveik visada daromos lygiapets.
Svarstyklms apibdinti vartojamos ir kitos charakteristikos: leistinapaklaida, leistina rodmen
variacija, jautris, padalos vert, rodmen nuskaitymo tikslumas, veikos (nusistovjimo) trukm.
Svarstykls turi bti:
1) tikslios antrkart sveriam krovin turi atsverti ta pati svareli mas, lygiai taip pat ir
perklus krovin i vienos lktels kit;
2) jautrios jautris (apie j skaitykite 4.1.3 skyrelyje) turi bti kiekgalimadidesnis ir pastovesnis,
t. y. neturi labai priklausyti nuo krovinio mass;
3) pastovios svarstyklipusiausvyraturi bti pastovi ir svyravimoapiejperiodas nelabai ilgas.
Svarstykls yra tikslios, kai j svirties pei ilgiai yra lygs ir lkteli prizmi briaunos lygia-
greios susvirties prizms briauna. Prieinguatvejutikrieji svarstyklisvirties peiilgiai priklausyt
nuo krovinio lktelje vietos.
Ribin svarstykliapkrova paprastai bna paymta ant pai svarstykli ir sveriant reikia jos
neviryti.
4.1.3. Svarstykli jautris
Viena i svarbiausi svarstykli charakteristik yra j jautris. Svarstykli jautriu vadinamas svars-
tykli svirties pasvirimo kampo tangento santykis su pridto krovinio mase. Jei | yra kampas,
kuriuo pasvyra svarstykli svirties peiai, kai vien i pusiausvir lkteli padedamas papildo-
mas mass mkrovinlis (perkrova), tai svarstykli jautris k
(4.1.6)
Svarstykli svirties pasvirimo kampas priklauso nuo perkrovos mass m, svirties peties ilgio l,
svirties mass centro nuotolio d iki atramos tako O, svirties svorio Qg (Q svirties mas). Takas
Nyra svirties mass centras.
Sveriant svirtinmis svarstyklmis, kno prie peties b (mas M) sunkio Mg jgos momentas turi
atsverti svareli (mas P), prikabint prie kito peties c, sunkio jgos Pg moment (4.1.3 pav., a).
Kai svirtis horizontali, pusiausvyros slyg galima urayti taip:
Mgb = Pgc, arba M = Pc/b,
t. y. kno mas yra didesn u svareli mas c/b karto.
is teiginys teisingas sveriant nelygiapetmis svarstyklmis. Sveriant lygiapetmis svarstyklmis,
b = c ir kno mas lygi svareli masei: M = P.
Svirtis pusiausvyros padtyje nebtinai yra horizontali, ji gali bti ir pasvirusi (4.1.3 pav., b),
pavyzdiui, sveriant analizinmis svarstyklmis.
m
k
| tg
=
30 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Pusiausvyroje veikianijgmomentai turi bti lygs.
Taigi ir horizontaliojoje, ir pasvirusiojepadtyse(4.1.3 pav.)
gaunamos tokios sunkio jg moment lygybs:
Mgb = Pgc, (4.1.7)
(M+ m)gbcos| =Pgccos| +Qgdsin| . (4.1.8)
Padalijus (4.1.7) lygt i g, o (4.1.8) i gcos|, gaunama:
Mb = Pc, (4.1.7a)
(M+m)b =Pc +Qdtg|, (4.1.8a)
i ia
| tg
b
d
Q
b
c
P m M + = + .
Lygiapei svarstykli b = c = l, todl i lygyb gali bti
perrayta taip:
| tg
l
d
Q P m M + = + . (4.1.9)
ios lygybs deiniosios puss antrasis narys parodo, kokios mass svareliai neatsvr.
I (4.1.8a) lygybs atmus (4.1.7a), gaunama
ml =Qdtg| .
Taigi svarstykli jautr apibria santykis
k =
Qd
l
m
=
| tg
.
(4.1.10)
Sveriant jautriomis svarstyklmis, svirties pasvirimokampas paprastai yra maas, todl tg | ~|
ir tada galima urayti:
Qd
l
m

=
.
(4.1.11)
Svarstyklijautris yra tiesiog proporcingas svirties peties ilgiui l, atvirkiai proporcingas svirties
mass Q ir jos mass centro nuotolio d nuo atramos tako sandaugai. Kai svarstykli svirties ir
lkteli prizmibriaunos yra vienoje tiesje, jautris neturt priklausyti nuoapkrovos. Praktikai
i slyga ne visada tiksliai tenkinama, nes svirtis iek tieklinksta j apkrovus, todl ir jautris, kintant
apkrovai, iek tiek kinta. Padidinus vienos lktels apkrov m mg, pusiausvyros padtis skalje
pakinta An padal. Santykis An/ m vadinamas svarstykli jautriu turimai apkrovai.
MECHANIKA ____________________________________________________________________________ 31
Jautriui padidinti svarbusvirt padaryti lengvesn. Dl toji ipjaustoma ir daromai kiek galima
lengvesns mediagos. Tinkamamjautriui nustatyti kartais naudojamas tamtikras sraigtas, prisuktas
prie svirties i viraus arba prie jos rodykls; sukinjant sraigt, pamale kyla arba leidiasi
svirties svorio centras kinta nuotolis d nuo atramos tako O.
4.1.4. Mass nustatymas atsivelgiant Archimedo jg
Mus supa atmosferos oras, todl ir svrimas vyksta ore. Ore kno svoris sumaja tiek, kiek sveria
to kno istumtas oras. Kadangi oro tankis yra madaug 1/700 vandens tankio, tai vienetinio tankio
knas ore netenka apie 0,14 %savo svorio. Dl to reikia skirti stebimj kno svor nuo jo tikrojo
svorio vakuume; taigi tenka daryti pataisas.
inant sausoorotank
0
, kai orotemperatra yra 0
o
Cir atmosferos slgis lygus 10
5
Pa, galima
rasti kambario oro tank
( )
( ) t
h / H
+

=
273 760
8 3 273
0

; (4.1.12)
ia
0
=1,293 kg/m
3
, H atmosferos slgis, h ore esanivandens garslgis, t oro temperatra
patalpoje (
o
C).
i formul retai naudojama. Kai nereikia didelio tikslumo, imama =
0
.
Teguknovakuume mas(iekomoji tikroji mas) yra M, svarelitikroji maslygi knomasei
m, kno tankis
k
, svarelio tankis
1
. Tuomet kno tris yra V=M/
k
; tokio pat trio oro mas
lygi
k
/ M . Todl kno stebimoji mas ( ) ( )
k k
1 / M / M M = . Tokiu pat bdu ran-
dama svarelio stebimoji mas ore, kuri lygi ( )
1
1 / m . Jei sveriant kn svarstykls yra
pusiausvyroje, tai
( ) (
k
1 m / M = ( )
1
1 / m , arba ( )(
1
1 = / m M )( )
1
k
1

/
.
(4.1.13)
4.1.3. Elektronins svarstykls
iuolaikinse svarstyklse danai naudojamas elektroninis renginys, kuris apdoroja j patenkani
deformacijos jutikli siuniam informacij. Visa informacija gali bti apdorojama kompiuteriu,
rayta jo atmint ir pan.
Deformacijos jutikli (4.1.4 a pav.) veikimas pagrstas laidinink elektrins varos didjimu
didjant jo mechaninei deformacijai. vairios mediagos yra skirtingai jautrios deformacijai, kuri
paprastai dar priklauso nuo laidininko trio ir jo formos. Tempimo deformacija jutiklyje didina
var, ogniudymo maina. Paprastai keli tokie jutikliai jungiami Vitstono tiltel (4.1.4 pav., b)
ir matuojamas elektros srovs, atsirandanios dl deformacijos, stipris. Atsakymas pateikiamas
32 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
jgos ar mass vienetais.
L A B O R AT O R I N I S D A R B A S
Tikslusis svrimas
Darbo uduotys
Itirkite svarstykli jautrio priklausomyb nuo apkrovos.
Nustatykite:
kno tank;
kno mas, atsivelgdami Archimedo jg.
Darbo priemons ir prietaisai
Svarstykls, svareli rinkinys, sveriamasis knas, plonas silas, stiklin, distiliuotas vanduo.
Darbo metodika
io darbo uduotys atliekamos analizinmis svarstyklmis.
1. Svarstykli jautrio tyrimas
Analizines lygiapetes svarstykles sudaro gulsia lygiapet svirtis, paremta prizme ant stataus stovo;
jo statumas patikrinamas gulsiuku. Jei jonra, tai, vien ar kit pus sukinjant kojeles, ant trij
koj stovinti papd nustatoma gulsiai (viena jos koja nejudama), o svarstyklistovas staiai.
Svirties atstumai nuo prizms iki krat yra lygs, tad svirtis lygiapet. Prie svirties pritvirtinta
rodykl rodojos pasvirimokamp skalje. Sukant stabd akuts pakelia svirt auktynnuoprizms,
kadjos briaunabe reikalonedilt, opakeltos auktynatsparos pakelialkteles, kadbtapsaugotos
briaunos. Norint ivengti oro srovi ir kit paalini trikdi takos, svarstykls laikomos stiklinje
spintelje su pakeliamomis priekinmis ir atidaromomis oninmis durelmis.
Riamoji mediaga
Dengiamoji plvel
Atramair kintamosvarosplvel
Riamoji mediaga
Deformuojamasknas
R - AR
R +AR
R +AR
R - AR
+U
-U
+ U -
(AU)
(U)
4.1.4 pav. Deformacijos jutiklio sandara (a) ir Vitstono tiltelio schema (b)
a) b)
R +AR
R AR R +AR
R AR
+U
(U)
U
(AU)
U +
MECHANIKA ____________________________________________________________________________ 33
Kol svarstykls nrasustabdytos (aretuotos), lkteles nieko nededama! Nuleidus svirt, skalje
randama tui svarstykli rodykls vieta. Skal padalyta 20 dali; nulis yra skals viduryje (arba
kairiajamekrate). Stebimi tuisvarstyklisvyravimai. Paprastai nelaukiama, kol svarstyklisvyra-
vimai pasibaigs, bet jie stebimi ir i rodykls atsilenkim randamas svareli ir sveriamojo krovinio
masiskirtumas. Atskaitomos skals padalos, iki kuriprieinarodykls galas, atsilenkdamas dein
ir kair. Svirtis turi svyruoti maais kampais, olktels turi judti tikauktynemyn, bet nesvyruoti
alis. Lktelms svyruojant, susidaryt papildoma icentrin jga. vertinamos tik deimtosios
padaldalys ir jos uraomos. Stebimi tikkeli svyravimai. t pus, nuokurios svyravimai pradedami
stebti, uraoma vienu svyravimu daugiau negu kit pus. Pavyzdiui, pradjus irti i deins
puss, stebimi keturi (arbadu) svyravimai kairnir penki (arbatrys) deinn, nessvyravimoamplitud
vis laik maja. Imami kiekvienos grups atskirai aritmetiniai vidurkiai (vienas kairn, kitas
deinn). Rezultataritmetinisvidurkis rodotikrjneapkrautsvarstyklipusiausvyros vietn
0
.
Pavyzdiui:
.
Rodykl pasviro
kairn() deinn(+)
10,6
9,9 10,5
9,8 10,4
Suma 19,7 31,5
Vidurkis (9,85) (10,5)
Tada kairij lktel dedamas sveriamas knas, dein svareliai: sveriamj mas jie turi
atsverti tiek, kadsvyruojanios svirties rodyklneieitu skals rib. Reikiarasti tokisvarelimas,
kuri priverstsvirties rodyklsustoti netoli n
0
padalos. Paprastai tamtikrasvarelimasveriarodykl
apsistoti vienojen
0
pusje, opridjus (arbaatmus, jeigusvarelimasyradidesnusveriamjmas)
i vismaiausisvarel, tvietnukelia kitnuon
0
pus. Tuoatvejui paprastos proporcijos randama
tokiai vismaiausiosvareliodalis, kuripridjus (arbaatmus), pusiausvyros vietaatsidurtties n
0
.
Svarstykli pusiausvyros vietos pasikeitimas yra proporcingas vienos lktels perkrovai p, kai
i perkrova maa. Todl, radus, kiek nukrypsta rodykl, ir padidinus krovin mau svareliu, pa-
vyzdiui, 2 mg, pagal proporcij galima rasti miligram ir j dali skaii, kuriuos tekt pridti
prie sveriamojo daikto, kad svarstykli rodykl apsistot pusiausvyros vietoje n
0
.
Svarstyklms apkrauti miligramais bei j dalimis naudojamas pakabinamas ties atitinkama
svirties padala svarelis, vadinamas irgeliu. Paprastai is svarelis sveria 10 mg (0,01 g); jis kilno-
jamas tamtikra svirtele. Bet kuris svarstykli svirties petys turi deimt padal, oios padalos dar
po penkias smulkesnes padalas. Padtas ant to svirties peties, kurio lktel dedami svareliai,
pavyzdiui, 5 padaloje, irgelis veikia svirties pet, kurio ilgis yra tik 0,5. Todl jo poveikis tolygus
padto svarstykli lktelje svarelio0,5 0,01 = 0,005 g poveikiui. Gaut gramdal tenka pridti
prie lktelje esanisvareli mass. Padjus irgel ant tosvirties peties, kuriolktel dedamas
sveriamasis knas, gaut gram dal tenka atimti i lktelje esani svareli mass.
vairiai apkraut svarstykli jautris randamas taip: ant abiej svarstykli lkteli padedami
vienodos mass kroviniai ir i svyravim randama svirties pusiausvyros vieta
0
n'
. Vliau viena
lktel perkraunama nedideliumass msvareliu, pavyzdiui, 2 mg, ir randamapakitusi svarstykli
( )
325 0
2
85 9 5 10
0
,
, ,
n =
+
=
34 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
svirties pusiausvyros vietan
1
. Potoperkrova nuimamair patikrinamapirmyktsvirties pusiausvyros
vieta; ji kartais gali iek tiek pasikeisti; tegu dabar ji yra
0
n' ' .
Tada pusiausvyros vietos pokytis, svarstykles perkrovus mmiligram, yra An =n
1
n
0
, jei
0
"
0
'
0
2
n
n n
=
+
,
(4.1.14)
o svarstykli jautris apkrovai
m
k = =
|
m
n A
(pad/mg). (4.1.15)
Darbo eiga
1. Ant abiejsvarstykli lkteli dedami vienodos mass kroviniai (pavyzdiui, 1 g, tada apkrova
yra 1 g) arba nieko (tada lkteli apkrova yra nulin).
2. Atleidus stabd, stebimi keli svirties svyravimai: lyginiai arba nelyginiai kair ir dein.
Apskaiiuojama svirties pusiausvyros vieta
0
n'
.
3. Viena lktel perkraunama nedideliu mass msvareliu, pavyzdiui, 2 arba 10 mg.
4. 2-ajame ingsnyje apraytubdurandama pakitusi svarstyklisvirties pusiausvyros vieta n
1
.
5. Perkrova nuimama ir dar kart nustatoma svirties pusiausvyros vieta
0
n' ' ; ji gali iek tiek skirtis
nuopradins.
6. Randama svirties pusiausvyros vietos vidutin vert.
7. Apskaiiavus pusiausvyros vietos pokyt, pagal (4.1.15) formulskaiiuojamas svarstyklijautris.
8. Svarstykli jautris nustatomas jas apkrovus vairi (0, 1, 10, 20, 40, 70, 100 g) masi kroviniais.
9. Matavim ir skaiiavim duomenys suraomi lentel:
10. Svarstykli jautrio kitimas keiiant apkrov pavaizduojamas grafikai: braiomas priklauso-
mybs k = f(M) grafikas.
Svarstykls Svarstykli svirtiespusiausvyrosvieta Pusiausvyros J autris
apkrautos,
M, g
pradin
0
n'
udjusm
svarel
n
1
numusm
svarel
0
n ' '
vidutin
n
0
vietospokytis
(n
1
n
0
)
(n
1
n
0
)/m
pad/mg
2. Kno tankio nustatymas
1. Knas pasveriamas, t. y. nustatomas ore josvoris P
0
.
2. Randamas kno tris; jeigu knas yra taisyklingos geometrins formos, tris apskaiiuojamas
imatavus jo kratines slankmaiu ar kitais prietaisais.
3. Pagal (4.1.5) formul apskaiiuojamas kno mediagos tankis.
4. Jeigu knas yrasudtingos formos, jo tris nustatomas taip: knas plonusilupakabinamas ant
kabliuko madaug 58 cm auktyje vir svarstykli lktels. Jeigu sveriamo kno mas labai
maa, btina vertinti ir silo mas. stiklin pripilama distiliuoto vandens, madaug 4/5 jos
talpos; stiklinkiamatarpsvarstyklilktels ir pakabos taip, kadvisas tiriamasis knas panirt
vanden; svrimo metu stiklin laikoma taip, kad knas neprisiliest prie stiklins sieneli ir
MECHANIKA ____________________________________________________________________________ 35
4.2. Sukamasis judjimas
Materialiojo tako judjimas apskritimu. Kietojo kno svoka.
Sukimo momentas. Inercijos momentas, jo fizikin prasm.
Pagrindinis sukamojo judjimo dinamikos dsnis.
Besisukanio knokinetin energija.
Oberbeko svyruokl.
Bifiliarioji svyruokl.
Giroskopas. Giroskopiniai reikiniai.
4.2.1. Materialiojo tako judjimas apskritimu. Kampinis greitis ir pagreitis
Materialiojo tako judjimas apskritimu tai paprasiausias kreivaeigio judjimo atvejis. is ju-
djimas gali bti tolygusis ir kintamasis. Sukamasis judjimas daniausiai apraomas kampiniu
greiiu ir kampiniu pagreiiu.
Tegu takas, tolygiai juddamas apskritimu, per laik t pasislenka i padties M
1
padt M
2
(4.2.1 pav.). Takospindulys r pasisukakampu, kuris vadinamas
poskio kampu. Poskio kampo ir laiko santykis, arba, kitaip
tariant, kampas, kuriuo spindulys pasisuka per laiko vienet,
vadinamas kampiniu greiiu; kampinis greitis paprastai ymimas
graikika raide e:
e= / t. (4.2.1)
Kai = 1 radir t = 1 s, e = 1 rad/s. Kampiniogreiio vienetu
laikomas toks greitis, kai spindulys per 1 s pasisuka 1 radkampu.
Kampinis greitis yra vektorinis dydis: e vektorius sutampa
su sukimosi aimi, o jo kryptis tokia, kad, irint i jo galo, mate-
rialusis takas sukasi prie laikrodio rodykl. Apie vektorius ir
veiksmus su jais plaiau skaitykite pried 1-oje dalyje.
4.2.1 pav. Kampinio greiio
vektoriaus apibrtis
M
1
M
2 r

e
neinirt i vandens, ostiklin ir ranka neprisiliestprie svarstyklilktels ar jos pakab.
5. Nustatomas kno vandenyje svoris P
v
ir apskaiiuojama Archimedo jga
F
A
= P
0
P
v
=
v
Vg; (4.1.16)
ia
v
vandens tankis, V kno istumto vandens tris.
6. Apskaiiuojamas kno tris
V = (P
0
P
v
)/g
v
. (4.1.17)
r
Tolygusis judjimas apskritimu yra periodinis, nes po tamtikro laiko, vadinamo periodu, jud-
jimas kartojasi. Per vien period Tspindulys nubria 2t rad kamp, taigi kampin greit galima
ireikti itaip:
e= 2t / T. (4.2.2)
Tolygiojo sukimosi kampin greit lengva rasti inant sukimosi dan v, t. y. apsisukim skaii
per laiko vienet. Takui apskriejant apskritim vien kart, spindulys nubria kamp 2t rad.
Vadinasi, jei takas per laik t apskrieja apskritim n kart, tai jo kampinis greitis
e= 2tv =2tn/ t. (4.2.3)
Judjim apskritimu galima apibdinti ir linijiniugreiiu. Pasislinkdamas i padties M
1
padt
M
2
(4.2.1 pav.), takas nueinakeli, lyg lankoM
1
M
2
ilgiui
2 1
M M
l . ilg galimaireikti centrinio
kampo ir spindulio r sandauga: r l
M M
=
2 1
. Padalij abi puses i laiko t, matome, kad t / l
M M
2 1
yra linijinis greitis v, o t / kampinis greitis e. Taigi gaunamas linijinio ir kampinio greii
vektori ryys, ireikiamas vektorine eir r sandauga (r. 1 pried):
v = e r. (4.2.4)
Kaipmatyti, tako linijinis greitis, skirtingai nuo kampinio, priklauso nuo atstumo iki sukimosi
centro. Be to, linijinis greitis yra statmenas vektoriams r ir e (4.2.2 pav.).
Takas gali judti apskritimu ir netolygiai. iuoatveju ir kampinis, ir linijinis greiiai kiekvienu
laiko momentu esti skirtingi. Taiau, imant labai trump laiko tarp At, kampin greit galima
laikyti pastoviu. Jei per t laiko tarp knas pasisuka kampu A, tai vidutinis greitis per laiko
tarp e = A / At .
io santykio riba, kai At artja prie nulio, yra lygi momentiniamkampiniamgreiiui:
t t t d
d
lim
0

e =
A
A
=
A
.
(4.2.5)
Momentinis kampinis greitis skaitine verte yra lygus poskio kampo ivestinei laiko atvilgiu.
Kampinio greiio kitimo spart apibdina kampinis pagreitis c, kuris, kai judjimas tolygiai
kintamasis, skaitine verte lygus kampinio greiiopokyiui per laiko vienet. Judjimas yra tolygiai
kintamasis, jei kampinis greitis per vienodus laiko tarpus pakinta vienodu dydiu. Kai judjimas
nra tolygiai kintamasis, momentinis kampinis pagreitis skaitine verte yra lygus kampinio greiio
ivestinei laiko atvilgiu:
(4.2.6)
Kampinio pagreiio vienetu laikomas toks pagreitis, kai per 1 s kampinis greitis pakinta
1 rad/s, t. y. 1 rad/s
2
.
36 __________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
.
d
d
t
e
c =
Kampinis pagreitis yravektorinis
dydis. Jo kryptis, kampiniam
greiiui didjant, sutampa su
kampinio greiio vektoriaus kryp-
timi, ir prieingai kampiniam
greiiui majant, kampinis pagreitis
yra nukreiptas prieinga kampiniam
greiiui kryptimi (4.2.2 pav.).
4.2.2. Slenkamasis ir sukamasis kietojo kno judjimai
Absoliuiai kietuoju knu mechanikoje laikomas toks knas (materialij tak sistema), kurio
vis tak tarpusavio padtis laikui bgant nekinta. Kitais odiais tariant, kietasis knas negali
bti deformuojamas.
Slenkamasis kietojo kno judjimas yra toks, kai jo vis tak trajektorijos yra lygiagreios
kreivs. Tuomet viso kno judjimui nusakyti pakanka apibrti vieno tako (pvz., mass, arba
inercijos centro) judjim.
Mass centru vadinamas takas, kuriospindulys vektorius r
c
ireikiamas sistem sudaraniomis
masmis m
i
ir j spinduliais vektoriais:

=
=
N
i
i i
m
m
1
c
r
r . (4.2.7)
Teorema apie mass centro judjim teigia, kad kiekvienamknui judant slenkamuoju judjimu
jo mass centras juda taip, lyg jame bt sukoncentruota visa to kno mas mir lyg j veikt vis kn
veikiani jg atstojamoji.
Kno sukimasis gali bti sudtingas, taiau visuomet j galima iskaidyti tris nepriklausomus
sukimusis apie statmenas viena kitai koordinatines ais. Todl labai svarbu inagrinti atskir su-
kimosi atvej sukimsi apie nejudam a. Tai toks kietojoknojudjimas, kai jotaktrajektorijos
yra koncentriniai apskritimai, o j vis centrai sudaro vien ties, vadinam sukimosi aimi.
4.2.3. Kietojo kno sukimasis apie nejudam a. Sukimo momentas
Tegu yra kietasis knas, kuris gali suktis apie nejudam a OO
1
(4.2.3 pav.). Paveikus kietj kn
vienodomis jgomis F skirtinguose takuose Air B, poveikio rezultatas bus nevienodas. Veikiant
4.2.2 pav. Kampinio pagreiio ir greiio kryptys, kai
kampinis greitis didja (a) ir kai maja (b)
38 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
jgai take B, kno gytas kampinis pagreitis c bus
didesnis, negu veikiant take A.
Vadinasi, sukamojojudjimoatvejuknpoveikis
vienokitamnegali bti vienareikmiai nusakytas jga,
kaiptai buvo slenkamojo judjimo atveju. Kai knas
gali suktis, kitknpoveikis jamnusakomas nejga,
o kitu fizikiniu dydiu sukimo arba jg momentu,
kuris lygus
M=r F. (4.2.8)
Jo skaitin vert
M=r F sino=Fl.
Petimi l vadinamas maiausias atstumas tarpsuki-
mosi aies ir jgos Fveikimotiess, t. y. ilgis statmens,
nuleisto i sukimosi aies ties, kurioje guli jgos F vektorius.
Sukimo momentas yra vektorinis dydis, nukreiptas sukimosi aimi taip, kad, irint i jo galo, jga
suka kietj kn prie laikrodio rodykl (4.2.3 pav.). SI sistemoje sukimo momento vienetas yra
niutonmetras (N m).
4.2.4. Inercijos momentas. Hiugenso ir teinerio teorema apie ai perklim
Kaip ankiau minta, sukamojo judjimo atveju poveik knui nusako ne jga, o kitas fizikinis
dydis sukimo momentas. Pasirodo, kno inertikum sukamojo judjimo atveju taippat nusako
ne tas pats kaip slenkamojo judjimo fizikinis dydis, t. y. ne mas, o inercijos momentas. Inercijos
momentas priklauso ne tik nuo kno mass, bet ir nuo jos isidstymo kne bei nuo to, kurios
sukimosi aies atvilgiu jis skaiiuojamas. Vis kn padalijus n ma element, kurimass yra
m
i
(i = 1, 2, , n) ir nuotoliai nuo sukimosi aies lygs r
i
, kno inercijos momentas tos sukimosi
aies atvilgiu

=
=
n
i
i i
r m I
1
2
.
(4.2.9)
Inercijos momentas yra skaliarinis dydis, jo SI vienetas yra kgm
2
.
Taisyklingos geometrins formos vienalyi kn inercijos momentai aies, einanios per j
geometrin (kartu ir mass) centr, atvilgiu yra inomi: rutulio 2/ 5 mr
2
, ritinio 1/ 2 mr
2
, ilgo
plono strypo 1/ 12 ml
2
; ia m mas, r rutulio ir ritinio spindulys, l strypo ilgis.
Jeigu sukimosi ais neina per mass centr (4.2.4 pav.), tai tokios aies atvilgiu inercijos mo-
mentas I skaiiuojamas remiantis Hiugenso ir teinerio ai perklimo teorema:
4.2.3 pav. Kietojo kno sukimasis apie
nejudam a (M
A
= r
A
F; M
B
= r
B
F)
M
B
M
A
r
A
F
F
r
B B A
O
1
O
O
M
B
M
A
r
A
F
A
F
B
r
B
A B
O
1
l
o
MECHANIKA ____________________________________________________________________________ 39
I = I
0
+ md
2
; (4.2.10)
ia I
0
inercijos momentas aies, einanios per mass
centrir lygiagreios sunagrintja, atvilgiu, mkno
mas, datstumas tarpai. Pasinaudojus ia teorema,
plono strypo inercijos momentas atvilgiu jam stat-
menos aies, einanios per jo gal, lygus
I = I
0
+ md
2
= 1/ 12 ml
2
+ 1/ 4ml
2
= 1/ 3 ml
2
.
d
O
O
1
C
4.2.4 pav. Brinys inercijos momento
skaiiavimui, kai sukimosi ais OO
1
neina per mass centr C
4.2.5. Pagrindinis sukamojo judjimo dinamikos dsnis
Slenkamojo judjimodinamikos pagrindas yra trys Niutono dsniai. I jsvarbiausias yra antrasis
Niutono dsnis:
a = F/ m, (4.2.11)
t. y. pagreitis, kur gyja jgos F veikiamas knas, yra tiesiog proporcingas tai jgai ir atvirkiai
proporcingas kno masei m. is dsnis yra svarbiausias todl, kad jis kartu yra ir slenkamojo
judjimo lygtis, i kurios galima rasti kno koordinai ir jo greiio priklausomybi nuo laiko
dsningumus.
Pagrindinis sukamojo judjimo dinamikos dsnis yra
c
I
M
=
, (4.2.12)
t. y. kampinis pagreitis

c, kur gyja sukimo momento Mveikiamas knas, yra tiesiog proporcingas
tamsukimo momentui ir atvirkiai proporcingas inercijos momentui sukimosi aies atvilgiu.
4.2.6. Judesiokiekio momentas
Dalels, turinios mas m ir judanios greiiu v (ir todl turinios judesio kiek p = mv) bei
esanios atstumu r nuo tako O, judesio kiekio momentas tako O atvilgiu yra apibriamas
vektori r ir p vektorine sandauga
L = r p. (4.2.13)
O
O
1
C
40 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
L
r
v
m
u
0
4.2.5 pav. Dalels judesio kiekio
momentas tako O atvilgiu
O
L
r
m
u
v
Judesiokiekiomomentas Lyravektorius, statmenas
ploktumai, kuri sudaro r ir v (4.2.5 pav.). Jo modulis
priklausonuotakoOpadties, t. y. atstumor, ir bendru
atveju yra ireikiamas
L=mr vsinu ; (4.2.14)
ia u yra kampas tarpr ir v. Kai dalel juda apskritimu
(4.2.6 pav.), o judesio kiekio momentas yra skaiiuo-
jamas apskritimo centro atvilgiu, vektoriai r ir v yra
statmeni vienas kitam, t. y. u = 90, todl naudojantis
(4.2.4) sryiu judesiokiekio momento modul galima
ireikti taip:
L=mr v =mer
2
. (4.2.15)
L kryptis iuo atveju sutampa su e kryptimi.
Judesio kiekio moment L ir jgos moment M,
veikianius t pai dalel ir apskaiiuotus to paties
tako atvilgiu, sieja labai svarbus tarpusavio ryys:
dalels judesio kiekio momento kitimas (ivestin)
laiko atvilgiu yra lygus veikianiam t dalel jgos
momentui:
M
L
=
t d
d
.
(4.2.16)
i lygtis yra labai panai slenkamojojudjimo lygt
dp/dt =F, tiksukamojojudjimo atveju judesiokiekis
p pakeistas judesio kiekio momentu L, o jga F jg
momentu M.
Atsivelgus (4.2.9) formul, judesio kiekio
momentas yra inercijos momento ir kampinio greiio
sandauga: L = Ie. Jei iorini jg moment suma
sukimosi aies atvilgiu lygi nuliui, tai judesio kiekio
momentas ilieka pastovus. Judjimas esant pastoviam
judesio kiekio momentui ne visada yra judjimas su
pastoviukampiniu greiiu, nes kno inercijos momen-
tas I judjimo metu gali lengvai pasikeisti. Judesio
kiekio momento tverms dsniui demonstruoti danai
naudojamas bandymas, parodytas 4.2.7 paveiksle.
Suolelis sukamas kampiniu greiiu
1
e , kai mogus
laiko hantelius itiestomis rankomis. Po to sulenks
rankas mogus sumaina inercijos moment nuo
1
I
4.2.6 pav. Kampinio greiio ir judesio
kiekio momento vektorinis ryys
judjimo apskritimu atveju
e
m
90
o
v
L
r
4.2.7 pav. Eksperimentas
su sukamuoju suoleliu
e
1
e
2
L
r
v
m
90
o
e
MECHANIKA ____________________________________________________________________________ 41
iki
1 2
I I < , tada dl judesio kiekio momento tverms dsnio
2 2 1 1
e e I I = kampinis sukimosi
greitis sulenkus rankas padidja (
1 2
e e > ).
4.2.7. Sukamasis judjimas centrini jg lauke
Jei dalel veikiani jg momentas lygus nuliui, tai pagal (4.2.16) lygt gaunama const = L . Taigi
iuoatvejudalels judesio kiekiomomentas (dl dalels judjimoorbita jis dar vadinamas orbitiniu
judesio kiekio momentu arba trumpiau orbitiniu momentu) tako atvilgiu yra pastovaus didumo
ir pastovios krypties, jei jg momentas to paties tako atvilgiu yra nulinis. i slyga pirmiausiai
gali bti tenkinama, kai dalel yra laisva (t. y. veikianti jga F = 0) ir juda pastoviu greiiu. Taiau
jgmomentas M=Fr sino gali bti lygus nuliui, kai jga Fnelygi nuliui, bet yra lygiagreti sur, t. y.
kampas u = 0. iuo atveju jgos F kryptis kerta tak O. Jga, kurios kryptis visada kerta fiksuot
tak, t. y. jgos centr, vadinama centrine jga.
Taigi, kai knas juda veikiamas centrins jgos, judesio kiekio momentas jgos atvilgiu yra
pastovus. i ivada yra labai svarbi, nes jgos, atsirandanios daugelyje gamtini sistem, yra
centrins. Pavyzdiui, ems sukimasis apie Saul dl centrins jgos, vis laik nukreiptos
Sauls centr (4.2.8 pav., a). Dl to ems orbitinis judesio kiekio momentas Sauls atvilgiu yra
pastovus. Panaiai ir elektronas vandenilio atome juda veikiamas centrins jgos, atsirandanios
dl elektrins sveikos su teigiamai elektrintu
branduoliu(4.2.8 pav., b). Tadir elektronoorbitinis
judesiokiekiomomentas branduolioatvilgiuyra
pastovus. Atomuose, turiniuose daug elektron,
veikianti kiekvienelektronatstojamoji jganra
tiksliai centrin. Be centrins elektrono ir
branduolio sveikos, ia yra elektron sveika.
Taiaudaugeliuatvejir daugiaelektroniuoseato-
muose atstojamjsveik pakankamu tikslumu
galima laikyti centrine.
4.2.8. Vandenilio atomo elektrono orbitinis judesio kiekio momentas
ia bus nagrinjamas judesiokiekio momentovertinimas vandenilio atome klasikins ir kvantins
mechanikos poiriu. Klasikins mechanikos poiriu elektronas apie branduol juda apskritimine
orbita ir jo parametrai yra tokie: mas m = 9,1110
31
kg, vidutinis atstumas iki branduolio
r = 5,2910
11
m ir kampinis greitis
1 16
s 10 13 4

= , e . I (4.2.15) gaunama
1 2 34 1 16 2 11 31 2
s m kg 10 05 , 1 ) s 10 13 , 4 ( m) 10 29 , 5 kg)( 10 11 , 9 (

= = e = r m L .
i skaitin vertatitinka vien i svarbiausifizikinikonstant t = 2 h q , t. y. Plankokonstant.
Atominidaleliorbitinis judesiokiekiomomentas yrapaprastai reikiamas hvienetais. iuo, kaipir
4.2.8 pav. Orbitinis judesio kiekio momentas:
ems judjimo aplink Saul (a);
elektrono judjimo vandenilio atome (b)
F
v
Elektronas
Protonas
Saul
L
em
F
v
L
Elektronas
a) b)
a) b)
L
ems
L
elektrono
F
v
F
v
em
42 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
ems sukimosi apieSaul, atvejuveikianios jgos yracentrins ir orbitinis judesiokiekiomomentas
yra pastovus. Vlesni tyrimai parod, kadklasikinis orbitinio judesio kiekiomomentoskaiiavimas
nra tinkamas kvantinms dalelms, t. y. ir atomoelektronui. Viena i pagrindiniivadyrata, kad
atom elektronorbitinis judesio kiekiomomentas gali gyti tik reikmes, tenkinanias lygyb
); 1 (
2 2
+ = l l L q
ia l yra teigiamas sveikas skaiius (0, 1, 2, 3, ...) ir vadinamas orbitiniu kvantiniu skaiiumi. i
savyb vadinama orbitinio judesiokiekio momento kvantavimu. Be ios slygos elektrono orbitinis
judesio kiekiomomentas gali gauti tik tamtikras orientacijas erdvje. is apribojimas vadinamas
erdviniu kvantavimu.
4.2.9. Savasis ir orbitinis judesio kiekio momentai
Daleli orbitinis judesiokiekiomomentas priklausonuotako, kurioatvilgiujis yra skaiiuojamas.
ia daleli sistemos savuoju judesio kiekio momentu laikomas momentas, apskaiiuotas daleli
sistemos mass centro atvilgiu.
Knas, kuriomass centras yra take C, pavaizduotas 4.2.9 paveiksle. iuoatvejusavasis judesio
kiekio momentas skaiiuojamas atvilgiu koordinai sistemos, kurios pradia sutampa su taku
C. Savasis judesio kiekio momentas yra daleli sistemos savyb. Kietojo kno arba elementarios
dalels savasis judesio kiekio momentas vadinamas sukiniu.
Sistemos orbitinis judesio kiekio momentas L
orb
skaiiuojamas O tako ir su juo susietos
koordini sistemos atvilgiu. Lyra apibriamas kaip judesio kiekio momentas dalels, kurios
mas lygi visos sistemos masei m
=
i
i
m ir kuri yra take, sutampaniame su sistemos mass
centru. Judjimo apskritimu
L
orb
=r
mc
mv
mc
;
ia
mc
r atstumas nuo tako Oiki sistemos mass centro, o
v
mc
kno mass centro judjimogreitis. Kadangi sistemos
judjimas gali bti ireiktas kaipjudjimoapiemass centr
ir mass centro judjimo suma, tai daleli sistemos pilnas
judesio kiekio momentas gali bti ireiktas kaip sistemos
savojo ir orbitinio judesio kieki moment suma:
L = L
sav
+ L
orb
.
Pirmasis narys deinje aprao vidin judesio kiekio
moment koordinai sistemos C atvilgiu, oantrasis narys
orbitin judesio kiekio moment koordinai sistemos L
atvilgiu, lyg visa sistemos mas btsukoncentruota mass
centre.
4.2.9 pav. Vidinis ir orbitinis
judesio kiekio momentai
0
XL
YL
ZL
Lorb.
rcm.
Xc
Yc
Zc
Lvid.
C
Z
C
Y
C
X
C
r
mc
O
Z
L
Z
C
L
orb.
Y
C
X
C
r
mc
Y
L
X
L
L
orb.
C
MECHANIKA ____________________________________________________________________________ 43
Pavyzdiui, galima panagrinti ems ju-
djim apie Saul ir elektrono judjim apie
branduol. em juda apie Saul ir kartusukasi
apie savo a (4.2.10 pav., a; atstum ir dydi
proporcijos neilaikytos). Taigi emturi orbitin
judesio kiekio moment Sauls atvilgiu L
orb
ir
savj moment L
sav
, arba sukin, savo centro
atvilgiu. Panai situacijayrair atome: elektronas
sukasi apie savo a ir branduol (4.2.10 pav., b).
4.2.10. Kietojoknojudesio
kiekiomomentas
Imkime ploki kietj kn, besisukant apie
jamstatmena (4.2.11 pav.). Kietojokno, t. y.
kno, kuriame, veikiant jgai arba jgos mo-
mentui, atstumas tarp j sudarani tak
nekinta, judesio kiekio moment galima rasti
sumuojant atskir j sudarani tak judesio
kiekio momentus:

= + + + =
i
i
L L L L L
3 2 1
.
Pasinaudojus (4.2.15) iraika kiekvienam
L
i
, gaunama

|
|
.
|

\
|
= =
i i
i i i i
r m r m L e e
2 2
.
Kaipbuvoparodytaaukiau, skliaustuoseraytas dydis yraknoinercijos momentas josukimosi
aies atvilgiu. Taigi patvirtinama, kad
. e I L =
(4.2.17)
I ios iraikos matyti, kadplokio kietojokno, besisukaniojo apie statmen jama, atveju
judesio kiekio momentas turi t pai krypt kaip kampinis greitis. Jei vietoje plokts yra bet
kokios formos kietasis knas, tai (4.2.17) formul negalioja ir judesio kiekio momentas Lgali turti
krypt, kuri skiriasi nuo ekrypties.
4.2.11 pav. Besisukanio plokiojo
kno kampinis greitis ir judesio
kiekio momentas
44 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
4.2.11. Laisvosios sukimosi ays. Icentrins jgos. Koriolio efektas
Bet kuris knas nepriklausomai nuo jo formos turi tris tarpusavyje statmenas kryptis. Kiekviena
kryptimi judesio kiekio momentas lygiagretus su sukimosi aimi. Jos vadinamos pagrindinmis
inercijos aimis, o atitinkami inercijos momentai pagrindiniais inercijos momentais. Pagrindins
kai kurikn inercijos ays pateiktos 4.2.12 paveiksle. I jo matyti, kadbet kuri einanti per rutulio
centr ais yra pagrindin. Jei knas turi simetrijos ais, tai jos sutampa su pagrindinmis aimis.
Todl (4.2.17) formul galima taikyti tuo atveju, kai I yra pagrindinis inercijos momentas.
4.2.12 pav. Pagrindins kai kuri simetrini kn inercijos ays
Y
0
X
0
Z
0
Y
0
Y
0
X
0
Z
0
Z
0
Y
0
X
0
X
0
Z
0
Z
0
X
0
Y
0
Z
0
X
0
Y
0
Z
0
X
0
Y
0
Z
0
X
0
Y
0
Nagrinjant sukamj judjim, labai svarbu inoti apie laisvsias sukimosi ais. Tai ays, ilai-
kanios savo krypt erdvje, pavyzdiui: ems sukimosi ais, aislinio sukuio ais ir kt. Kn
sukimasis visada yra stabiliausias apie a, kurios atvilgiu inercijos momentas didiausias. Apie
likusias ais jis yra maiau stabilus. Labai danai knas, besisukantis apie a, kurios atvilgiu
inercijos momentas maas, pats keiia i sukimosi a stabilesn (sudidesniuinercijos momentu).
Reikia paymti, kad kno mass centro padtis priklauso nuo kno padties erdvje, todl
skirtingose padtyse knas turi skirtingas laisvsias sukimosi ais.
Sukimasis apie a, atitinkani tarpin inercijos momento vert, yra nestabilus ma trikdi
atvilgiu. Gyvnir mogaus sukimasis laisvoskrydioir vairiuolimetuvykstaapielaisvsias ais
sudidiausiuarbamaiausiuinercijos momentu. Kadangi masicentropadtis ir pagrindiniinercijos
momentverts priklausonuoknopadties, tai esant skirtingoms padtims bus skirtingos ir laisvosios
sukimosi ays. ems sukimosi ais yra laisvoji, nes em sukasi apie a su didiausiu inercijos
momentu.
Kaipmintaanksiau, besisukanioje atskaitos sistemojekiekvienas takas turi centrin pagreit ir
tokiasistemanra inercin. Tokiojesistemojeknveikiainercijos jga, nukreiptasukimosi spindulio
kryptimi, ir ji stengiasi knus atitolinti nuosukimosi aies, todl vadinama icentrine.
Dl ems sukimosi apie savoa, einani per iaurs irPietpolius, visi jos paviriaus takai
juda tuo paiukampiniugreiiue. Taiauems paviriaus takai, esantys skirtingose geografinse
platumose, dl skirtingo atstumo iki sukimosi aies juds nevienodu linijiniu greiiu, kuris kis nuo
didiausios verts pusiaujyje iki nulins verts poliuose (4.2.13 pav.). Takas A, esantis geografinje
platumoje, kurios koordinat , juds linijiniu greiiu
e e cos R r = = v ;
ia r ilgisstatmens, nuleisto nuo tako iki ems sukimosi aies, R ems spindulys. Ten, kur
ems kampinio greiio ir spindulio vertsyraatitinkamai
5
10 292 , 7

= e s
1
ir r
6
10 35 , 6 = m,
MECHANIKA ____________________________________________________________________________ 45
pusiaujo takams gaunamas v =459ms
1
greitis, o takams, esantiems Vilniuje, kur
0
55 = , v =266ms
1
. Tai didelis linijinis
greitis, taiau mes jo nejauiame, nes judame
tokiugreiiu kartusuvisais daiktais, esaniais
aplink mus, o ems sukimosi sukeltos
papildomos jgos yra labai maos, palyginti
suems traukos jga.
Atskaitos sistemos, judanios supagreiiu
inercini atskaitos sistem atvilgiu, vadi-
namos neinercinmis atskaitos sistemomis. J
mechanikos udaviniai irgi gali bti aprayti
antruoju Niutono dsniu, bet tam turi bti
traukiamos papildomos inercins jgos, kuri
inercinse atskaitos sistemose nra. Inercins jgos pasireikia ir tada, kai sistema sukasi pastovaus
dydio greiiu, todl em yra geras neinercins sistemos pavyzdys. Jei knas ant ems paviriaus
nejuda, tai neinercinje atskaitos sistemoje, susijusioje su ems paviriumi, jos sukimasis sukelia
papildomicentrin inercijos jg. Icentrins inercijos jgos poveik galimapajusti sukantis karusele,
kai pasiekiamas linijinis greitis yra tik keli metrai per sekund, bet, neveikiant kitoms jgoms, jos
sukeliam stmim tolyn nuo sukimosi centro lengvai jauiame. Jei knas dar papildomai juda
(skrenda lktuvas ar sviedinys, juda oro mass atmosferoje ar vandens mass vandenynuose),
besisukanineinercinatskaitos sistemturi bti trauktainercinKoriolio(Coriolis) jga, apraanti
Koriolio efekt.
Matematikai rodoma, kadsuemesusijusiojeneinercinjeatskaitossistemoje, kuri sukasi kampiniu
greiiue,pagreitis:
a = g
0
e (e R) 2ev;
iag
0
laisvojokritimopagreitis, Rknoatstumas nuoems centro(spindulys), vdaiktojudjimo
greitis ems atvilgiu. Taigi pagreitis priklauso nuo kno padties ems paviriuje. Deins lygy-
bs puss antrasis narys nusako icentrin pagreit, o treiasis Koriolio pagreit. Icentrinis narys
yra 3,310
2
ms
2
eils, o Koriolio narys 3,310
5
v ms
2
eils. Todl greiiams, maesniems u
400 ms
1
, Koriolio pagreitis gali bti neskaitytas lyginant su icentriniu. Taiau jis turi svarbi
kryptini ypatum ir nuo jo takos daugeliu atvej priklauso ems klimato(uragan, oro sraut,
vandenyn srovi) formavimasis.
Toliau paaikinsime, kaip stovinio ar ltai judanio kno atveju galima atmesti Koriolio
pagreiio nar. ems tako A, esanio geografinje platumoje , icentrinis pagreitis yra lygus
r
2
e arba e cos
2
R ir veikia dienovidinio ploktumoje kryptimi AE. Laikant, kad em yra
sfera, galima teigti, jog laisvojo kritimo pagreitis g
0
iame take yra nukreiptas spindulio kryptimi
AC link ems centro. Icentrinio pagreiio vektori galima iskaidyti dedamsias: AB yra
antilygiagreti g
0
, o AF nukreipta linkpusiaujo. Takui G, esaniampusiaujyje, icentrin jga bus
didiausia R
2
e ir antilygiagreti g
0
. Bendruatvejumatuojamas pagreitis bus lygus efektyviamlaisvojo
kritimo pagreiiui g, kurio skaitin vert tokia:
C
G
F

A
D
N
r
g
0
B
V
E
e
e
2
rcos
2

R
e (e r)
H
Pusiaujoploktuma
4.2.13 pav. Icentrinis pagreitis
dl ems sukimosi
N
D
C
G H
F
E A
B
e
2
Rcos
2

e (eR)
46 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
e
2 2
0
cos R g g = ;
ia geografins platumos kampas, atskaitomasnuopusiaujo(4.2.13 pav.). Dl antrojo nario
laisvojo kritimo pagreiio vektorius truput nukrypsta nuo savo krypties ems centr. Nors is
narys yra labai maas (0,3 %) lyginant su g
0
, jisnusakog
0
kitim kintant geografinei platumai. ia
pateiktos eksperimentins laisvojo kritimo pagreiio g verts keletui ems paviriaus tak.
Vieta Platuma, laipsniais g, ms
-2
iaurs aigalis 90 9,8321
Vilnius 55 9,8148
Grinvias 51,5 9,8119
Pusiaujas 0 9,7799
Didiausias efektyvus laisvojo kritimo pagreitis g
0
yra aigaliuose, kur icentrinio pagreiio
normalin dedamoji, veikianti prieinga ems traukos jgai kryptimi, yra lygi nuliui, ir maiausias
pusiaujyje, kur icentriniopagreiio normalins dedamosios, veikianios prie ems traukos jg,
vert yra didiausia.
Icentrins inercijos jgos normalin dedamoji, nukreipta prie svorio jg, maina kno svor.
Jos tangentin dedamoji veria kn slinkti pusiaujolink. Kno svorio ir icentrins inercijos jgos
atstojamoji nra statmena ems paviriui, jei em yra rutulys, bet yra statmena, jei em yra
geoido formos. Tokia em ir yra. Ji susiformavo geoido formos dl traukos ir icentrini jg
poveikio dar bdama skystos bsenos. O jos vandenyn pavirius taip pat yra geoido formos.
Skirtumas nuo rutulio formos labai maas (pusiaujo ir dienovidinio ilgi santykis lygus 1,0017),
nes icentrin inercijos jga tesudaro apie 0,3 %svorio jgos.
Koriolio efektas, t. y. inercijos jga, kuri btina, kad besisukanioje koordinai sistemoje bt
galima aprayti judjim prastais Niutono dsniais, veikia dein nuo kno judjimo krypties,
atskaitos sistemai sukantis prie laikrodio rodykl, arba kair, atskaitos sistemai sukantis pagal
laikrodio rodykl. Koriolio jgos efektas yra susijs su kno, judaniobesisukanioje koordinai
sistemoje, kelio nuokrypiu. I tikrj knas nenukrypsta nuo savo judjimo krypties, taiau taip
atrododl koordinaisistemos judjimo. Paprastai fizikos knygoseKoriolioefektas nagrinjamas
naudojant vektorins algebros ir judesiokiekiomomentomechanikos elementus. Tokionagrinjimo
ivados bus pateiktos ir ia, nes jos leidia gauti skaitines vertes, taiau pat Koriolio efekt bus
stengiamasi aikinti daug paprastesniu bdu, suprantamu studentams, neturintiems toki ini.
Korioliopagreitis 2[ev]yra statmenas greiiui V, todl jis sukelia knojudjimokelionuokryp.
Koriolio jga priklauso nuo kno santykinio greiio, kuris iskaidomas dvi dedamsias. Dl
greiiovertikaliosios dedamosios atsirandaKorioliojgos dedamoji,veikianti horizontaliojeploktumoje
statmenai dienovidinioploktumai. Jeiguknas juda vir, tai i jga veikia vakarus, ojeiguemyn
rytus. Todl i gana didelio aukiolaisvai krintantisknas nukrypsta rytus nuo vertikals,
einanios ems centr. Dl greiio horizontaliosios dedamosios atsiranda dvi Koriolio jgos
dedamosios. Dedamoji, lygi 2m [e
h
, v
h
], priklauso nuo ems sukimosi kampinio greiio ho-
rizontaliosios dedamosios ir yra vertikalios krypties. Ji arba spaudia kn prie ems, arba,
prieingai, stengiasi tolinti nuo ems paviriaus priklausomai nuo vektori (kampinio greiio e
h
MECHANIKA ____________________________________________________________________________ 47
4.2.14 pav. Koriolio efektas iovus raket link aigali: iaurs (a), Piet (b)
ir linijinio greiio v
h
) krypi. i jg btina atsivelgti skaiiuojant tolimj kn judjim,
pavyzdiui, balistini raket skrydius.
Antra Korioliojgos dedamoji, susijusi suhorizontalija greiiodedamja v
h
,lygi (2m[e
h
,v
v
]).
Tai horizontali jga, statmenagreiiui. iaurs pusrutulyjeji visada veikia deinnuogreiiokrypties.
Dl to, pavyzdiui, iaurs pusrutulioupideinieji krantai yrapaplauti daugiaunegukairieji. Koriolio
inercijos jga, veikianti judanias vandens molekules, suteikia joms pagreit, nukreiptlinkdeiniojo
kranto. Todl vanduogyjatamtikrios krypties greit ir utekaant kranto. Dl tos paios prieasties
nevienodai dvisi dviej juost geleinkelio bgiai, jeigu traukiniai jais vaiuoja tik viena kryptimi.
Pasirodo, kad Koriolio efekto kai kurias ivadas galima paaikinti daug paprasiau. Tarkime,
knas juda nuopusiaujolinkiaurs arbaPietaigalio. sivaizduokime, kadpusiaujyje yra raketos
paleidimo sistema, galinti iauti raket dideliu atstumu (pvz., 3000 km). Pradedant nagrinjim
reikia prisiminti tokius svarbius faktus: em sukasi rytus; ems sukimosi linijinis greitis
didiausias pusiaujyje ir maiausias aigaliuose; knas, paleistas tamtikroje ems vietoje, turi tos
vietos sukimosi linijin greit; greiiovektorius nekinta, jei j statmena kryptimi veikia jga. Pritaikius
ias ivadas nagrinjamamatvejui, galima konstatuoti, kadi pusiaujopaleista raketaturi dvi greiio
dedamsias kryptimi, kuria buvoiauta, ir rytkryptimi, kuri gavodl paleidimovietos judjimo
linijiniu greiiu. Pusiaujyje paleistos raketos linijinis greitis rytus yra didesnis u ems tako,
kur taikoma ir kuris yra ariau iaurs aigalio, linijin greit. Todl skrisdama taikin raketa nuo
nustatytos tiesiosios krypties nukryps dein. Jeigu raketa bt paleista link Piet aigalio, tai
situacija bt ta pati tik iuo atveju raketa nukrypt kair irint i pusiaujo. Jei nuokryp
vertinsime irdami em i kosmoso, tai abiem atvejais nuokrypis bus rytus (4.2.14 pav.).
Prieinguatveju, t. y. jei aunamanuoiaurs aigaliolinkpusiaujo, tai dl maesnio rytus nukreipto
linijinio greiio aigalyje lyginant su pusiauju gaunama, kad raketa nukryps vakarus nuo taikyto
tako. Jei knas slenka iaurs pusrutuliui piet (nuopusiaujo), tai jovakar-ryt krypties greiio
dedamoji yra didesn u tos vietos ems paviriaus toki dedamj dydiu v
1
v
2
=eR (cos
1

cos
2
). Reikia pabrti, kadKoriolio efektas pastebimas tik knui judant gana dideliais atstumais.
a) b)
48 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
4.2.15 pav. Besisukanio vjo formavimasis dl Koriolio jg ir emo slgio centro:
prie laikrodio rodykl iaurs pusrutulyje (a) ir pagal laikrodio rodykl Piet pusrutulyje (b)
Gana paprastai galima paaikinti ir kn, krintani i didelio aukio, nuokryp nuo statmens.
Tarkime, daiktas yra imestas i 100 metr aukio pastato. Didesniame auktyje esantis daiktas
turs ir didesn linijin greit, nukreipt rytus, todl nukris ant ems paviriaus ne padtyje, kur
bt statmuo ems paviri, bet nukryps rytus. Tiesa, tas nuokrypis bt tik apie 1 cm. Jei
kno greitis yra nukreiptas vakarus ar rytus, tai pasikeiia kampinis greitis ir sumaja ar padidja
inercijos icentrin jga.
Pasirodo, Koriolioefektas yra svarbus ems klimatui, kadangi nuo jopriklauso uragan, vj,
vandenyn srovi formavimasis. Viskas, kas juda laisvai (pavyzdiui, oras), iaurs pusrutulyje
nukrypsta dein, oPietpusrutulyje kair. Tai iplaukia i Korioliojgos matematins iraikos.
Kaip pavyzd galima nagrinti iaurs pusrutulio emo slgio srit atmosferoje. Jei atmosferoje
susidaro mao slgio sritis, tai oras i aplinkini srii pradeda plsti linkios srities, stengdamasis
ilyginti slgiskirtum. Orosrautai, artjantys nuopusiaujo, turs didesn linijin greit rytkryptimi,
oartjantieji nuoaigalio maesn linijin greit nei oras emoslgiosrityjeir nukryps vakarus. Dl
to emo slgio srityje susiformuos skurys, besisukantis prie laikrodio rodykl (4.2.15 pav., a). Ir
atvirkiai, jei iaurs pusrutulyje yra aukto slgio oro sritis, i kurios oras isisklaido, formuojasi
skuriai, besisukantys pagal laikrodiorodykl (4.2.15 pav., b); tokiasituacijabus ir Pietpusrutulyje
susidarius emo slgio sriiai. Koriolio jgos tropik srityje sukelia vjus pasatus. altas oras i
aigalio, turdamas maesn linijin greit ir juddamas linkpusiaujo, iaurs pusrutulyje nukrypsta
vakarus, o Piet pusrutulyje rytus.
4.2.12. Centrifuga
Kitas su icentrine inercijos jga susijs pavyzdys centrifuga, kuri naudojama ir buityje (dio-
vinimui), ir vairiose mokslinse biomedicinos laboratorijose. Centrifugavimas tai toks procesas,
kuriometunevienalytsesistemose vyksta daleliatskyrimas (separacija). Pavyzdiui, medicininse
centrifugose raudonieji kraujo kneliai nusodinimo bdu atskiriami nuo kraujo plazmos.
a) b )
R
MECHANIKA ____________________________________________________________________________ 49
Centrifugos schema pavaizduota
4.2.16 paveiksle. I jos matyti, kad cen-
trifuguojamas skystis pilamas specia-
lius plastikinius mgintuvlius, kuriede-
dami rotori, galint suktis 500
1000 s
1
daniu.
Centrifugai sukantis, joje esant
skyst veikia netiksunkio ir Archimedo
jgos, bet ir icentrin jga F, nukreipta
nuo sukimosi aies. Be to, kiekvien
kiet dalel, esaniskystyje ir judani
apskritimu, taip pat veikia icentrin
jga F
1
. Jei F > F
1
, tai daleljuds linksukimosi aies, ojei F < F
1
, tai daleldl inercijos juds link
centrifugos krato. Vadinasi, atskyrimo efektas tuo geresnis, kuo didesnis i jg skirtumas, t. y.
dalels ir skysio tanki skirtumas:
F
icentrin
= F
1
F = (
1
) Ve
2
r;
ia r dalels nuotolis nuo sukimosi aies, skysio tankis,
1
dalels tankis, V dalels tris.
Elektros varikliu sukus centrifug, laikikliai su mgintuvliais, veikiami icentrins inercijos
jgos, atlenkiami beveik horizontali padt, o skystyje esanios kietos dalels, juddamos
icentrine kryptimi, nusda ant mgintuvli dugno. Pirmiausia nusda didesns mass dalels,
o vliau maesns.
iuolaikik ultracentrifug icentrin inercijos jga apie 10
5
kart didesn u daleles veikian-
i sunkio jg ir jose galima atskirti maesnes negu 100 nmdydio daleles.
4.2.13. Besisukaniokno kinetin energija
Tegu kietasis knas sukasi apie nejudam a OO
1
(4.2.17 pav.). Reikia rasti jo kinetin energij.
Tarkime, kno mas sudaryta i atskir ma mass element m
1
, m
2
, m
3
, , m
n
, kurie nutol nuo
sukimosi aies atstumais r
1
, r
2
, r
3
, , r
n
. Kiekvienas mass elementas juds skirtingulinijiniu greiiu
v
1
, v
2
, v
3
, , v
n
, nes linijinis tako greitis priklauso nuo atstumo iki sukimosi aies.
Viso besisukanio kno kinetin energija yra lygi atskir mass element kinetini energij
sumai:
.
2 2 2 2 2 2
1
2 2 2 2
3 3
2
2 2
2
1 1
k
=
= + + + + + + =
n
i
i i n n i i
m m m m m m
W
v v v v v v
A A
.
Pasinaudojus (4.2.4) formule, kiekvieno mass elemento linijin greit galima ireikti kno
kampiniu sukimosi greiiu: v
1
= er
1
, v
2
= er
2
, v
3
= er
3
ir t. t. Tuomet
Sandarusrotoriaus
dangtis
Vakuumosluoksnis
Mgintuvliodangtis
Plastikinismgintuvlis
Sedimentai (nuosdos)
Lizdassukimosi velenui
Fiksavimovartas
4.2.16 pav. Centrifugos schema
Vakuumas
50 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
( ) .
2 2
2 2 2 2 2
1
2
2
2 2 2
2 2
2
1 1
2
2 2 2 2 2
3
2
3
2
2
2
2
2
1
2
1
k

=
= + + + + + =
= + + + + + + =
n
i
i i n n i i
n n i i
m r m r m r m r m
m m m m m
W
r
r r r r r
e e
e e e e e
A A
A A
(4.2.18)
Takinio elemento mass ir nuotolio iki sukimosi aies kvadrato sandauga (mr
2
) vadinama jo
inercijos momentu nagrinjamos sukimosi aies atvilgiu. Taigi (4.2.18) lygybje skliausteliuose
esanti dydi suma reikia viso kno inercijos moment (4.2.9):
.
1
2 2 2 2
2 2
2
1 1

=
= + + + + + =
n
i
i i n n i i
m r m r m r m r m I r A A
Kno inercijos momentas nepriklauso nuo sukimosi
greiio ir apibdina kno sukamojo judjimo inercines
savybes: kuo didesnis inercijos momentas, tuo daugiau
reikia energijos jo kampiniamgreiiui pakeisti.
raius inercijos momento ymen I (4.2.18) lygyb,
gaunama besisukanio kno kinetins energijos formul:
W
k
= Ie
2
/2. (4.2.19)
Palyginus j suslenkamojojudjimokinetins energijos
formule, matyti, kadsukamajame judjime mass vaidmuo
tenka inercijos momentui, o vietoje linijinio greiio yra
kampinis greitis.
4.2.14. Inercijos momentas ir jo taka sparnuoi sparn formai
Sukamuoju judjimu laikomas ir pauki bei vabzdisparn judjimas. Jis iuoatveju apima tik
apskritimo dal. Galima vertinti vabzdio sparno kinetin energij, norint pamatyti, kaip sparno
geometrija yra susijusi su jo inercijos momentu (4.2.18 pav.).
O
O1
mi
ri
v
i
4.2.17 pav. Brinys besisukanio
kno kinetins energijos
skaiiavimui
O
r
i
m
i
i
O
1
r
4.2.18 pav. Sparno sukimosi schema: oninis vaizdas (a) ir vaizdas i viraus (b)
r
e
Sukimosi ais
r
Sukimosi ais
a b
Sukimosi ais
Sukimosi ais
e
e
r
MECHANIKA ____________________________________________________________________________ 51
4.2.15. Giroskopas. Giroskopiniai reikiniai
Danai pasitaikanti mechanikos udaviniuose situacija, kai vienas i kno tak nejuda, yra kokiu
nors bdu tvirtintas. Tokiu atveju knas turi tris sukamojo judjimo laisvs laipsnius, ir aprayti jo
judjim yra viena i sunkiausi mechanikos problem. Prie toki udavini priskiriamas ir
giroskopo judjimo apraymas.
odis giroskopas (gr. gyros ratas, gyr sukuosi ir skop iriu, stebiu) reikia prietais
sukimuisi aptikti. Dabar giroskopu vadinamas greitai
besisukantis simetrikas kietasis knas, kurio sukimosi
(simetrijos) ais gali keisti savo krypt erdvje.
I lygties dL / dt =M gaunama, kad, nesant iorinioj-
gos momentoM, judesiokiekiomomentas Lliekapastovus.
Sukdamasis apie pagrindin inercijos a taip, kad L = I e,
knas ilaiko savo sukimsi apie a pastoviu kampiniu
greiiu. Tai gali bti iliustruota giroskopubesisukaniorato
pavidalu su tokiu tvirtinimu, kad jo ays gali laisvai keisti
krypt erdvje(4.2.19pav.). Ratas G(giroskopas) greitai su-
kasi apiepagrindina ABir yratvirtintas taip, kadbendras
jgos momentas takoOatvilgiulygus nuliui. Todl sistemos
judesio kiekio momentas yra pastovus ir lygiagretus su AB
arbaYaimi. Naudojamas tvirtinimas leidiasukimosi aiai
ABlaisvai judti tiekapiehorizontalijX, tiekir vertikalij
Z a. Pavyzdiui, giroskop neant kreiva trajektorija, AB
visuomet rodotpai krypt.
Jei giroskopo ais nustatyta taip, kadAByra horizontali
ir rodorytvakarkrypt (4.2.20 pav., 1padtis), tai bgant
laikui dl ems sukimosi galima pastebti, kad AB
pastoviai lenkiasi emyn ar auktyn. Po ei valand ji
tampa vertikali (4.2.20 pav., 4 padtis). is aies AB
sukimasis yra dl ems sukimosi.
Jei veikiantisgiroskopjgos momentas nralygus nuliui,
tai i sryio dL / dt =M iplaukia, kad judesio kiekio mo-
4.2.19 pav. Giroskopas
A
G
Z
O
B
X
L =Ie
Y
O
Z
G
A
B
X
Y
L = Ie
N
1 G
2
3
4
B
e
e
e
e
A
A
B
4.2.20 pav. Rato G pagrindins aies
padties kitimas dl ems sukimosi
G
A
A
B
B
Skaiiavimams iskiriama maa sparno juostel atstumu r nuo sukimosi aies. Jei juostels
mas yra dm, tai jos kinetin energija yra 1/ 2 dm
i
r
i
2
e
2
. Viso sparno kinetin energija randama
sudjus vis juosteli, sudarani sparn, energijas:
2
1
d
2
1 2 2 2
r m W
i i k
e e = =
I .
Jeigukampinis greitis yra pastovus, W
k
maesn, kai I maesnis. Vadinasi, skridimui sunaudota
energija maiausia, kai vabzdio sparno konstrukcija tokia, kai jo inercijos momentas maiausias.
Pagrindin sparno mas (raumenys) turi bti kuo ariau sukimosi aies.
N
52 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
mentas kintalaike. Giroskopojudesio kiekiomomentas kinta
jgos momento veikimo kryptimi. Atskiru atveju, kai M yra
statmenas judesio kiekio momentui L, pokytis dLtaip pat yra
statmenas L, todl kintajudesiokiekiomomentokryptis, bet ne
modulis. Todl kinta sukimosi aies kryptis, bet judesiokiekio
momentas liekapastovaus didumo. i situacijapanai judjim
apskritimu, kai veikia centrin jga, statmena greiiui, kurio
kryptis kinta, bet modulis ne. Sukimosi aies judjimas apie
fiksuot a dl iorinio jgos momento poveikio vadinamas
precesija.
Precesija stebima sukus ir paleidus vaikik aisl vilkel
(sukut), kuris yra irgi giroskopas (4.2.21 pav.). Vilkelis sukasi
apie pagrindin a Z
0
. Paveiksle ais X
0
yra pasirinkta XY
ploktumoje, oY
0
yraploktumoje, sudarytojei aiZir Y. Tiek
judesio kiekio momentas L, tiek jg momentas M turi bti
apskaiiuoti fiksuoto tako, kuriuo vilkelis remiasi pagrind,
atvilgiu. Kai vilkelis sukasi apie simetrijos a OZ
0
kampiniu
greiiue, jojudesiokiekiomomentas Ltaippat yra lygiagretus
su OZ
0
. Iorinis jgos momentas M atsiranda dl veikianio
mass centr C sunkio mg ir yra lygus sandaugai bmg; ia
b = OC sin bei statmenas aims Z
0
ir Z. Todl jgmomentas
Myranukreiptas iilgai X
0
ir statmenas vektoriui L. Veikiant jg
momentui M, ais Z
0
precesuojaapiea Zkampiniugreiiu
e
O
I
b g m
= . (4.2.20)
i iraika galioja, kai kampinis greitis e yra labai didelis
lyginant su precesijos kampiniu greiiu O . Nagrinjant
isamiau, bendru atveju kampas nelieka pastovus, bet
osciliuoja tarpdviej fiksuot veri. Vektoriaus Lgalas tuo
paiu metu, kai precesuoja apie Z, dar svyruoja tarp dviej
apskritim Cir C' (4.2.22 pav.), brdamas nurodyt keli.
is Z
0
aies svyravimas vadinamas nutacija.
em taippat yra milinikas giroskopas, kurio sukimosi
ais einaper iaurs ir pietpolius. Veikiant Sauls ir Mnulio
traukos jgai iremei nesant i tikrovienalytei sferai, atsiranda
nedidelis planet masteliais jgos momentas, kuris sukelia
4.2.21 pav. Sukuio precesija
t
X
Y
Z0
Z
0
90
o
- |
L
Y0
X0
L= Ie
|
O
O
C
b
G
Mg
e
Y
mg
L = Ie
O
e
b
Y
0
X
0
M
O
O
4.2.23 pav. ems sukimosi
aies precesija
e
4.2.22 pav. Giroskopo aies
precesija ir nutacija
Nutacija
X
0
Z
0
Z
Precesija
C
C
Z
o
trajektorija

L
Y
L
C
C'
Z
0
Z
0
O
Z
Y
X
C'
C
ems precesij ir nutacijas. ems pusiaujo ploktuma su
ems sukimosi apie Saul orbitos ploktuma sudaro kamp, lyg 23
o
27'. i ploktuma vadinama
ekliptika. Pusiaujoir ekliptikos ploktumsusikirtimas vadinamas ekvinokcijos linija. ems sukimosi
ais precesuoja vakarryt kryptimi apie statmen, ivest i ekliptikos ploktumos (4.2.23 pav.).
Precesijos periodas yra 27 725 metai; jis buvoatrastas dar 135 m. pr. Kr. ems ais taippat patiria
nutacijas, kuri amplitud yra 9,2'' ir periodas lygus 19 met.
Trajektorija
MECHANIKA ____________________________________________________________________________ 53
4.2.25 pav. Artilerijos sviedinio precesija (a),
nesisukanio sviedinio trajektorija (b)
ir besisukanio sviedinio trajektorija (c)
e
v
C
O
a)
b )
c )
4.2.16. Giroskopo taikymai
Svarbi laisvojo, t. y. turiniojotris pakabas, giroskoposavybyra ta,
kad, veikiant giroskopo iorin pakab, tiek sunkio, tiek kit jg
sukeltiems momentamsgiroskopovidinis ratas nraveikiamas jokio
jgosmomento. Atitinkamai judesiokiekiomomentasnekintairlieka
pastovus modulio ir krypties erdvje atvilgiu. Nesvarbu koks
judjimas suteiktas iorins pakabos rmui, giroskopo aies kryptis
erdvjenekinta. Tokieuniversaliai pakabinti giroskopai yranaudingi
suteikiant atraminkrypt kne, kuris pats gali keisti judjimokrypt.
Pavyzdiui, torpedvaldantisgiroskopasnustatopradinjosjudjimo
krypt ir seka, kadtorpedanuojos nenutolt. Tikrai laisvas, inomas
kaipkrypties giroskopas, yranaudojamas automatiniampilotavimui
lktuvuoseilaikyti pastoviskridimokrypt. Laisvasgiroskopas suhorizontaliaaimi nustatopakilusios
aukiausitakbalistins raketos poskiokrypt, neirint jos sukimosi apiesavoa.
sukus giroskopodisklabai greitai, lengvapastebti, kadgiroskopoais ilaikosavokrypt esant bet
kokiemspakabosjudjimamsirnetganastipriems
smgiams giroskopo rmelius. Todl tok
giroskopgalimanaudoti kaipkompas. Aiku,
tam reikia mass centr tiksliai sutapatinti su
geometriniu pakabos centru. Taigi vidutini
matmen giroskopui, kurio mas yra apie 1 kg,
besisukaniam30 000 aps/minkampiniugreiiu,
masscentroposlinkisper1 m sukeliaprecesij,
kurios greitis artimas 1/val. em sukasi daug
didesniu greiiu 15/val. Vadinasi, tokiu
giroskopulengvapastebti ems judjim.
Daug kur taikymams naudojamas dviej
pakabgiroskopas. iuoatvejujgmomentasgali
veikti besisukant giroskoporatapietamtikras
kryptis, bet ne visas. Turbt plaiausiai tokie gi-
roskopai taikomi laiv girokompasams. Giro-
kompase giroskopo ais yra horizontali, kaip
pavaizduota 4.2.24 paveiksle. Jg momento,
veikianiojoiogiroskopobesisukant rat, analiz
rodo, kadkai antroji pakaba yrapritvirtintaprie
rmo, besisukaniokartusueme, tai judesiokie-
kiomomentovektorius pasisukair rodo iaur.
Remiantis giroskopo principu galima
paaikinti, kodl besisukantys ratai nevirsta; kaip
galima ilaikyti pusiausvyr vaiuojant mo-
tocikluir dviraiu; kaipkulkos sukimasis leidia
4.2.24 pav. Girokompasas
Fiksuotaprie
ems
tvirtinta
prie ems
54 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
ilaikyti jos judjimo krypt veikiant oro pasiprieinimui ir kodl ems sukimosi aies kryptis
erdvje yrapraktikai pastovi.
Giroskopai yra pagrindiniai elementai vairiausi giroskopini rengini ir prietais, plaiai
naudojam lktuv, laiv, torped, raket ir kt. judjimui automatikai valdyti. vairiuose
techniniuose renginiuose danai pasitaiko greitai besisukani kn. Veikiant j sukimosi a,
atsiranda vadinamosios giroskopins jgos, besiprieinanios tokiems poveikiams. Pagal treij
Niutono dsn kietasis knas, suktas iki didelio greiio, j veikiant iorini jg moment ir dl
to kylani precesij reaguoja prieingu giroskopiniu momentu, kuris veikia jau iorinius knus,
sukelianius mint precesij(pavyzdiui, besisukaniknguolius, kardaninius arnyrus ir pan.).
Toks atsirandantis momentinis giroskopo atoveiksmis jo atramoms prieinasi neaniojo kno
judjimokursokitimui ir kartupadedavairuoti transportopriemon (pvz., laiv) reikiama kryptimi.
Besisukanio kno stabilumas jau seniai naudojamas artilerijoje. Sviediniui judant, be sunkio
jgos P , j veikia oro pasiprieinimo jga R, nukreipta madaug kryptimi, prieinga sviedinio
masi centro greiiui v
c
(4.2.25 pav., a). Taiau tos jgos veikimo takas nesutampa su masi
centru. Veikiant tos jgos momentui, nesisukantis sviedinys netvarkingai vartaliojasi (4.2.25 pav., b).
Tada dar labiau padidja pasiprieinimas judjimui, sumaja skrydio nuotolis ir tikslumas.
Besisukantis sviedinys turi giroskopo savybi. Oro pasiprieinimo jga sukelia jo precesij aplink
ties, kuria nukreiptas sviedinio greitis (4.2.25 pav., a), t. y. aplink sviedinio masi centro
trajektorijos liestin. Tai daro skryd taisykling, tolimesn ir taiklesn, be to, garantuoja sviedinio
pataikym taikin priekine dalimi (4.2.25 pav., c).
LABORATORINIS DARBAS
Pagrindinio sukamojo judjimo
dinamikos dsnio patikrinimas
Darbo uduot i s
Patikrinkite pagrindin sukamojo judjimo dinamikos
dsn.
Darbo priemons ir prietaisai
Oberbekosvyruokl, slankmatis, liniuot, automatinis arba
rankinis sekundmatis.
Dar bo me t odi k a
Naudojamos iame darbe Oberbeko svyruokls schema
pavaizduota4.2.26paveiksle.Jisusidedaiketuristrypirdviej
skirting spinduli r
1
ir r
2
skriemuli, pritvirtint ant vienos
horizontalios aies O(statmenos brinioploktumai). Stryp
galuosepritvirtinti tamtikrojepadtyjeketuri vienodos mass
krovinliai m' (povienantkiekvienostrypo). Svyruoklijudina
skirtingosmass msvareliai, pritvirtinti priesilo, uvyniotoant
4.2.26 pav. Oberbeko svyruokl
h
m
m'
m'
m'
m'
l
r
1
r
2
O
m' m'
r
1
r
2
l
m' m'
m
h
O
MECHANIKA ____________________________________________________________________________ 55
m, kg r, m H, m t, s I, kgm
2
AI, kgm
2
kgm
2
kgm
2
m
n
, kg r, m h, m h
1
, m t, s I, kgm
2
AI, kgm
2
kgm
2
kgm
2
vienoar kitoskriemulio. Svarelionusileidimotrukmmatuojama elektroniniuprietaisu, susidedaniui
sekundmaioirfotoelektrins jopaleidimoirsustabdymosistemos (1 atvejis)arbarankiniusekundmaiu
(2atvejis).
Darbo eiga
1. Darbas atliekamas Oberbeko svyruokle su automatiniu sekundmaiu
1. Imatuojami skriemuli skersmenys.
2. Tamtikros mass msvarelis tvirtinamas prie silo, kuris uvyniojamas ant vieno i skriemuli.
3. Imatuojama jo judjimo trukm t
1
, nusileidimo auktis h.
4. Apskaiiuojamas sistemos inercijos momentas
|
|
.
|

\
|
= 1
2
2
2
h
gt
mr I ; (4.2.21)
ia m svarelio mas, r skriemulio spindulys, g laisvojo kritimo pagreitis, t svarelio
judjimo trukm, h auktis, i kurio svarelis nusileido.
5. Darbo eigos 2, 3, 4 punktai kartojami su kitokios mass svareliais ir su kiekvienu svareliu
matavimai kartojami 35 kartus.
6. Matavimo ir skaiiavimo duomenys suraomi lentel:
2. Darbas atliekamas Oberbeko svyruokle su rankiniu sekundmaiu
1. Imatuojami skriemuli skersmenys.
2. Pasveriami mass svareliai.
3. Svarelis pritvirtinamas prie silo, kuris uvyniojamas ant vieno i skriemuli.
4. Imatuojama jo judjimo trukm t
1
, nusileidimo auktis h ir pakilimo auktis h
1
.
5. Apskaiiuojamas sistemos inercijos momentas
(
(

|
|
.
|

\
|
+

= 1 1
2
1
1
2
2
h h
h h
h
t
g mr I ; (4.2.22)
ia m svarelio mas, r skriemulio spindulys, g laisvojo kritimo pagreitis, t svarelio
judjimo trukm, h auktis, i kurio jis nusileido, h
1
auktis, kur jis pakilo.
6. Darbo eigos 3, 4, 5 punktai kartojami su kitokios mass svareliais.
7. Matavimo ir skaiiavimo duomenys suraomi lentel:
56 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
LABORATORI NIS DARBAS
Inercijos momento nustatymas
bifiliarija svyruokle
Bifiliarija svyruokle vadinamas renginys (4.2.27 pav.),
susidedantis i dviej vienodo ilgio sil ABir CD, ant kuri
pakabintas koks nors knas BD. Pasukus kn aplinkvertikali
a OO', jis pradeda sukamuosius svyravimus aplink t a.
Koordinat, nusakanti jo momentin padt, yra kno BD
poskio aplink a OO' kampas , atskaitomas nuo pusiau-
svyros padties.
Tegu l ymi atkarpos OO' ilg pusiausvyros padtyje, 2c
atstum tarp pakabos tak Air C, 2b atstum BD. Sistema
laikoma simetrika, kai takai O ir O' yra atkarp AC ir BD
centrai.
Kno BDpakilimoauktis h skaiiuojamas nuo jo apatins
pusiausvyros tako:
) cos 1 )( / 2 ( 1
2
= l bc l l h . (4.2.23)
Paprastai 2 / d c b = = .
Potencin pakabos energija mgh E =
p
, o kinetin energija
k
E susideda i sukamojo judjimo
energijos =
'
k
E Ie
2
/ 2 ir slenkamojo judjimo iilgai aies z energijos
' '
E
k
= mv
2
/ 2 (ia I kno
BD inercijos momentas aies OO' atvilgiu, m kno BD mas). Nesunku sitikinti, kad, esant
maiems poskio kampams , slenkamojojudjimo energija daug maesn u sukamojo judjimo
energij (
' ' '
k k
E E << ), o pakilimo auktis
2
2
2

l
b
h ~ .
(4.2.24)
Tokia sistema svyruoja cikliniu daniu
Il
mgb
2
= e
(4.2.25)
ir periodu
2
2 / 2
mgb
Il
T = = e . (4.2.26)
I ia randamas bifiliariosios svyruokls inercijos momentas
l
T mgb
I
2
2 2
4
=
. (4.2.27)
4.2.27 pav. Bifiliarioji svyruokl
m0
m
a a
b
b
O
O'
l
d
D
B
C A c
c
m
0
m
0
a a
O'
b b D B
d
c c
O
C A
MECHANIKA ____________________________________________________________________________ 57
m, kg d, m l, m t, s n T, s e r,
I , kgm
2
AI
r,e
, kgm
2
I ios formuls apskaiiuojamas I, jei inomi prietaiso duomenys ir eksperimentikai nustatytas
svyravim periodas. Formul teisinga nesant energijos nuostoli. Tokius nuostolius vertinti
sudtinga. Taiaupataisos maos, jei energijos nuostoliai per period mai, lyginant suvisa sistemos
svyravimo energija. Taigi (4.2.27) formul taikytina, jeigu sistemos svyravim periodas T daug
maesnis negu svyravim slopimo trukm.
Darbo uduotys
Nustatykite bifiliariosios svyruokls dviej ritini inercijos moment.
Patikrinkite Hiuigenso ir teinerio teorem.
Darbo priemons ir prietaisai
Bifiliarioji svyruokl, sekundmatis, liniuot, slankmatis.
Darbo metodika
Darbas atliekamas bifiliarija svyruokle, kurios schema pateikta 4.2.27 paveiksle.
Darbo eiga
1. Svyruokl paleidiama svyruoti.
2. Sekundmaiu imatuojama 1020 svyravim trukm t ir randamas j periodas T =
0
t / n (n
svyravim skaiius).
3. inant strypo mas m ir imatavus atstum tarpsil d bei sil ilg l, pagal (4.2.27) formul
apskaiiuojamas neapkrauto strypo inercijos momentas I
0
:
.
16
2
0
2
2
0
T
l
mgd
I
t
=
(4.2.28)
4. Prie strypo simetrikai atstumu a nuo aies pritvirtinami du vienodos m
0
mass ir r
0
spindulio
ritiniai. Imatavus svyravim period T
1
, pagal (4.2.28) formul apskaiiuojamas strypo su
ritiniais inercijos momentas I
1
. iuo atveju svyruokls mas yra lygi strypo ir pritvirtint ritini
masi sumai:
0 1
2m m m + =
0
.
5. Apskaiiuojamas ritini inercijos momentas ir jo paklaida:
I I I =
1 e r, 0
.
(4.2.29)
6. Atliekami matavimai ir skaiiavimai apkrautamir neapkrautamstrypui ir duomenys suraomi
lentel (
e r, e r, e r,
I I I A = ):
7. Teorikai apskaiiuoti pritvirtint ritini inercijos moment galima inant Hiuigenso ir teine-
rio teorem (4.2.10 formul). Kadangi vieno ritinio inercijos momentas jo geometrins aies
58 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
atvilgiu
2
0 0 0
) 2 / 1 ( r m I
r
=
tai dviejritini teorikai apskaiiuotas inercijos momentas sukimosi
aies OO' atvilgiu (4.2.27 pav.) lygus
) 2 ( ) ( 2
2 2
0 0
2
0 0 r t r,
a r m a m I I + = + =
;
(4.2.30)
ia a yra pus atstumo tarp ritini masi centr.
Jeigu rezultatai, apskaiiuoti pagal (4.2.29) ir (4.2.30) formules paklaid ribose sutampa, tai
rodo, kadHiuigenso ir teinerio teorema yra teisinga.
8. Matavim ir skaiiavim duomenys suraomi lentel:
L A B O R AT O R I N I S D A R B A S
Giroskopo precesijos tyrimas
Darbo uduotys
Imatuokite giroskopo precesijos kampin greit.
Nustatykite variklio rotoriaus ir smagraio judesio kiekio ir
inercijos momentus.
Darbo priemons ir prietaisai
Giroskopas, liniuot.
Darbo metodika
Prietais (4.2.28 pav.) sudaro elektros variklis (1), smagratis (2)
ir atsvaras (3), galintis slankioti iilgai strypo (4) su padalomis.
Pat giroskop sudaro varikliuko rotorius (1) su masyviu disku
(2). Visa sistema tvirtinta atramoje (5) taip, kad gali sukiotis
aplinkgulsij ir staij ais. Giroskopopasisukimokampas gulsiojoje ploktumoje matuojamas
paymtomis plokiame skritulyje (6) padalomis. Tachometras (7) matuoja smagraio sukimosi
kampin greit e
z
, o sekundmatis (8) giroskopo sukimosi aplink staij a trukm.
I pradiatsvaras (3) pritvirtinamas ant apkabos strypotaip, kadvisas prietaisas btneutralioje
pusiausvyroje, giroskopo ais nustatoma horizontaliai. Varikliukas jungiamas ir palaukiama
23 minutes, kol rotorius pradeda suktis nominaliu daniu.
Atsvar (3) pastmus nuo pusiasvyros tako, giroskop veikia atstojamasis iorini jg
momentas M = Fh; ia h atsvaro postmis. io momento sukurtas precesijos kampinis greitis,
susijs su jg momentu M, teorikai apskaiiuojamas
z z
I
M
t e

O = =
d
d
.
m
0
, kg r
0
, m a, m I
r, t
, kgm
2
AI
r, t
, kgm
2
I
r, e
, kgm
2
AI
r, e
, kgm
2
4.2.28 pav. Giroskopo
struktrin schema
2
5
1
3
4
6
7
8
MECHANIKA ____________________________________________________________________________ 59
n, s
1
h, m , rad t, s O, s
1
F, N M, Nm L, Nms e
z
, s
1
I
z
, kgm
2
Giroskopo precesijos kampinis greitis Oapskaiiuojamas i lygybs t / O = ; ia girosko-
po aies pasisukimo kampas per laik t.
Jei giroskopo smagratis (2) sukasi pastoviu kampiniu greiiu (e
z
= const), tai
= =
z z
I
M
e
O
const.
(4.2.31)
Toliau matuojamos precesijos kampinio greiio verts esant skirtingoms momento M
i
vertms
(skirtingiems peiams h
i
). Btina atlikti 34 matavimus kiekvienai rotoriaus sukimosi greiio
vertei. Esant stabiliamvarikliuko darbui ) const ( =
z
e , paklaid ribose turi bti tenkinama slyga
.
2
2
1
1
n
n
M M M
O O O
~ ~ ~ (4.2.32)
Pasinaudojus tuo, kiekvienai rotoriaus sukimosi greiio vertei nustatomas giroskopo judesio
kiekio momento vidurkis

=
=
n
i
i
i
M
n
L
1
.
1
O
(4.2.33)
Skaiiuojamas giroskopo inercijos momentas
z
z
L
I
e
=
.
(4.2.34)
Paklaid ribose giroskopo inercijos momento verts I
z
visiems e
z
turi sutapti.
Darbo ei ga
1. Stumdykite atsvar (3) tol, kol giroskopo strypas (4) bus statmenas vertikaliajai aiai.
2. junkite varikl ir nustatykite, kad smagraio apsisukim danis n bt 1000 aps min
1
.
3. Pastumkite atsvar 1,5 cm kair arba dein ir paspauskite mygtuk NULIS.
4. Kai giroskopas pasisuks ne maiau kaip 30
o
, spauskite mygtuk STOP.
5. Apskaiiuokite giroskopo precesijos kampin greit O .
6. Bandymus pakartokite, pakeit atsvaro poslink, pavyzdiui, h
i
=2,0; 2,5; 3,0 cm.
7. Pakartokite darbo eigos 26 punktus, keisdami apsisukim dan n (2000 aps min
1
ir kt.).
8. Apskaiiuokite giroskopo judesio kiekio moment L.
9. Apskaiiuokite giroskopo inercijos moment I
z
, turdami omenyje, kad e
z
= 2tn.
10. Duomenys suraomi lentel:
60 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
4.3. Garsas. Ultragarsas
Garso bangos, j kilm ir savybs.
Garso bang atspindys ir limas.
Garso bangpanaudojimas medicinoje.
Ultragarsas, jogeneracija ir savybs.
Ultragarso sveika su biologiniais audiniais. Taikymai medicinoje.
Akustinis Doplerio efektas. Jo taikymas medicinoje.
4.3.1. Garso bangos, j kilm
Akustika (gr. akustikos klausos, girdjimo) viena i seniausi mokslo srii, tirianti garso
suklim, sklidim ir sveik su mediaga. iuolaikinis akustikos mokslas apima daugyb vairi
tem, taiaudaniausiai akustika suprantama kaipmokslas apie mogaus klausos organu ausimi
girdim svyravim (nuo 16 Hz iki 20 kHz) ir bang sklidim dujose, skysiuose ir kietuosiuose
knuose.
Savo prigimtimi garso bangos yra mechanins, todl joms sklisti reikia tam tikros tamprios
terps ir jos negali sklisti vakuumu. Tai demonstruoja toks bandymas: skambant kn, pavyzdiui,
elektrin skambut, padjus poorosiurbliogaubtu, siurbiant or i pogaubto, garsas vis silpnja, kol
pasidaro visai negirdimas. Todl galima daryti ivad, kad atmosferos oras perduoda i vairi
altini garsus mogaus ausiai. Garsas atsiranda dinamikai sutrikdius vien i mint terpi.
Toks trikdys paprastai keiia makroskopinius terps parametrus slg, tank, temperatr ir kt.
Norint aprayti gars, reikia nustatyti iparametr sryius (jie uraomi lygi pavidalu).
Kiekvien terpsudaranias daleles ria tamprumojgos. Todl, ijudinus vien terps dalel i
pusiausvyros padties, visada atsiranda tamprumo jga, kuri stengiasi grinti j pusiausvyros
padt. Kai terp suspaudiama, dalels artja viena prie kitos, toje vietoje susidaro didesnioslgio
sritis (sutankjimas). Tuo momentu atsiranda stmos jgos, kurios veria terps daleles tolti vien
nuo kitos. Kai jos nutolsta didesniais negu normaliomis slygomis atstumais, toje vietoje susidaro
maesnio slgio sritis (iretjimas). Taiaualia yra didesnio slgiosritis, kurioje atsiradusios stmos
jgos stengiasi dalel grinti pusiausvyros padt. Taiptarpusavyje sveikaudamos dalels sukelia
terpje svyravimus (slgio kitimus), kurie bangos pavidalu sklinda visomis kryptimis.
Garso bang atsiradimo modelis pavaizduotas 4.3.1 paveiksle. sivaizduokite terps daleles
kaip maos mass rutuliukus, sujungtus spyruoklmis. Paveiksle pavaizduota toki sujungt
spyruoklmis daleliseka. Jei Adalel kokios nors iorins jgos pastumiama dein, tai spyruokl
tarp Air Bdaleli suspaudiama. Spyruokls didjanti jga veria ir Bdalel judti dein, tokiu
bdu didindama spyruokls jg tarp Bir Cdaleli, ir t. t. Daleli pozicijos tolesniais laiko tarpais
parodytos 4.3.1 paveiksle, a. ia matyti, kad prasidjs kairje sutankjimas juda iilgai linijos
deinn. Taiaurealiojeterpje i vispusidaleles Air Esupa daugiaudaleli, todl j sveika bus
sudtingesn, negu aprayta modelyje, vadinasi, tai reikia atsivelgti sprendiant konkreius
udavinius.
MECHANIKA ____________________________________________________________________________ 61
Adalel patraukus kair (4.3.1 pav., b) nuo pradins jos padties, spyruokl tarpAir Bdaleli
itempiama, ji pailgja. Spyruokls tempis veria judti kair B dalel, po to ir C dalel, ir t. t.
Kaipatsiradiretjimai juda iilgai linijos deinnnuodalels prie dalels, parodyta4.3.1 paveiksle,
b. Matyti, kaddaleli virpesiai vyksta iilgai bangos sklidimo krypties. Bendruatveju garso bangoje
daleli virpesiai dujose ar skystyje nukreipti iilgai sklidimo krypties. Tokios bangos vadinamos
iilginmis. Skersinmis bangomis vadinamos tokios, kuriose dalels virpa statmenai bangos
sklidimo krypiai. Kietuosiuose knuose galimos tiek iilgins, tiek skersins tampriosios bangos.
J greiius atitinkamai aprao formuls:

E
c
L
= ir

G
c
T
=
. (4.3.1)
Kadangi Jungo modulis E didesnis nei lyties modulis G (plaiau apie iuos modulius
r. 5.6 skyri), tai iilgini garso bang greitis
L
c toje paioje mediagoje didesnis nei skersini
bang greitis
T
c .
Garsus sukelia svyravimai. Taigi galima teigti, kad paprasiausi ir maloniausi klausai garsai,
btent muzikins natos, atitinka harmoninius virpesius (gr. harmonia darna), t. y. periodin fizi-
kinio dydio kitim, vykstant pagal sinusoarbakosinusodsn. Dydis, kuriokitimas sudaro virpes,
gali bti terps daleli poslinkis tamtikra kryptimi, slgis tamtikrame take ir kt. Labai svarbios
yra harmonins bangos, kuriose visi dydiai yra harmonins laikofunkcijos (4.3.2 pav.). iuo atveju
banga, sklindanti iilgai pasirinktos krypties, pavyzdiui, x aies, apraoma lygtimi, kuri apibria
virpanios dalels poslinkio s priklausomyb nuo koordinats x bet kuriuo laiko momentu t:
( ) | | x/c t A s = e cos ;
(4.3.2)
ia A virpesi amplitud, c bangos sklidimo greitis, e kampinis danis.
Garso bang apibdina jos ilgis, danis ir greitis. Bangos ilgis tai atstumas tarp dviej
gretim periodins bangos sklidimo kryptimi tak, kuri faz tam tikru laiku yra ta pati. Vieno
4.3.1 pav. Garso bang atsiradimo modelis: sutankjimo (a)
arba iretjimo (b) sklidimas iilgai terps daleli
E
D E B C A
D E B C A
D E B C A
D E B C A
D B C A
D E B C A
E
D E B C A
D E B C A
D E B C A
D E B C A
D E B C A
D E B C A
a) b)
62 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
svyravim ciklo trukm vadinama periodu, o
dydis, atvirkias periodui garsobangos daniu
v. Garso bangos greiiu vadinamas svyravim
sklidimo terpje greitis. Jis priklauso nuo
terps, kuria sklinda garso banga, tamprumo
savybi, temperatros bei atmosferos slgio.
Pavyzdiui, garsogreitis oreyralygus 332 m/s,
esant 0
o
C temperatrai ir normaliam slgiui.
Pried6 lenteljepateikti garsobangvairiose
terpse greiiai.
Garso greit, bangos ilg ir dan sieja lygyb
c = v. (4.3.3)
Didjant daniui, trumpja bangos ilgis, bet greitis toje paioje terpje ilieka nepakits. Garso
greitis didja pereinant i oro skyst ir toliau kietj kn, nes
ore
<
sk
<
kk
.
Garso stipr lemia garso bangos svyravim amplitud, o aukt danis.
Garsai skirstomi tonus ir triukmus. Tonu vadinamas periodinis harmoninis garsas, kurio
amplitud ir danis kinta tolygiai. Tonai skirstomi paprastus (harmoninius) ir sudtingus. Pap-
rastuosius tonus galima igauti kamertonu ar garso generatoriumi, o sudtinguosius skleidia mu-
zikos instrumentai, mogaus kalbos aparatas (balss). Garsotonas apibdinamas svyravimdaniu,
amplitude ir forma arba harmoniniu spektru.
Triukmu vadinami patys vairiausi garsai, kuri stipris, danis, amplitud laikui bgant kinta
netvarkingai. Triukmams priskiriami plojimai, girgdjimas, main vibracijos, kalbos priebalss
ir pan.
Garso, kaip mechanins bangos, charakteristika yra jos stipris I ir garso (akustinis) slgis p.
Garso banga pernea energij (virpani aplinkos daleli kinetins ir potencins energij suma),
bet nepernea mediagos (terps dalels tik virpa apie savo pusiausvyros padtis). Perneamas
garso banga energijos srautas u yra lygus:
u = Pt; (4.3.4)
ia t laiko tarpas, P garso galia.
Srauto tankis (arba garso bangos stipris) I yra garso, pereinanioper paviri, statmen sklidimo
krypiai, galia, tenkanti to paviriaus ploto vienetui:
I = P/S,
o takinio altinio atveju
I = P/ 4tr
2
; (4.3.5)
ia S paviriaus plotas, kur krinta garso banga.
4.3.2 pav. Harmonin banga
tam tikru laiko momentu

y
c
A
y
x
MECHANIKA ____________________________________________________________________________ 63
Kita vertus, bganiosios plokiosios garsobangos energijos srautotankis, arbastipris, priklauso
nuo bangos amplituds Akvadrato ir terps tankio :
.
2
2 2
cA
I

=
(4.3.6)
Garso stipris SI vienet sistemoje matuojamas vatais kvadratiniammetrui (W/m
2
).
Praktikai daniau naudojamas ne garso stipris, bet garso slgis p, atsirandantis garso bangai
sklindant terpe. Plokiosios harmonins bangos garsoslgis su garsostipriususietas tokiu sryiu:
p I = p
2
/ (2c);
(4.3.7)
ia terps tankis, c garso greitis. Sandauga c = Z
c
vadinama bangine (akustine) vara (r.
pried 7 lentel). i vara yra svarbi terps (biologini audini) charakteristika, slygojanti garso
bangos atspind ir l dviej terpi riboje.
4.3.2. Garso bangatspindys ir lis
Garso bangos atspindys gali vykti, kai banga sklinda per dviej skirting terpi rib, pavyzdiui, i
oro vanden, i oro mogaus organizmo audinius ir pan. Paprastai dalis garso bangos atsispindi,
t. y. grta pirmj terp, o dalis yra sugeriama ir / ar perduodama kitai terpei. Vykstant garso
bangos liui, keiiasi bangos sklidimo naujoje terpje kryptis, nes joje kitoks bangos sklidimo
greitis. Garso bangos atspindio ir lio dsniai yra analogiki viesos atspindioir lio dsniams
(r. 7.1 skyri).
Kiekvienu atveju dviej terpi riboje galima rasti garso bangos atspindio r ir praleidimo t
faktorius. iefaktoriai priklausonuoterps bangins varos. Atspindiofaktorius lygus atspindtosios
ir krintaniosios garso bang gali santykiui:
1
1
P
P
r
'
= , arba ireikus per t terpi bangines varas
2
2 1
2 1
Z Z
Z Z
r
+

= . (4.3.8)
Praleidimo faktorius lygus praleistosios ir krintaniosios garso bang gali santykiui:
1
2
P
P
= t , arba ireikus per t terpi bangines varas
2
2 1
2 1
4
Z Z
Z Z
+
= t
. (4.3.9)
iose formulse Z
1
=
1
c
1
pirmosios terps bangin vara, o Z
2
=
2
c
2
antrosios terps ban-
gin vara.
Be atspindio ir lio, dar gali vykti garso bangos sklaidos reikinys, kur apibdina sklaidos
faktorius o. Jis lygus isklaidytosios ir krintaniosios garso gali santykiui.
Pastaba. Kai kuriuose literatros altiniuose vietoje faktoriaus termino, kuris yra apibrtas
LSTISO31standarte, vartojamas atitikmuokoeficientas. Pavyzdiui, vietojepraleidimofaktoriaus
pralaidumo koeficientas.
64 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Akivaizdu, kad iems reikiniams turi galioti sryis o + r + t = 1, iplaukiantis i energijos
tverms dsnio. Reikia paymti, kad atspindio ir praleidimo faktoriai nepriklauso nuo to, i
kurios puss banga krinta, ir (4.3.8) formuls nesikeiia. Kai visa krintaniosios bangos energija
atsispindi, r = 1, o t = 0; kai nra atsispindjusios bangos, r = 0, visa bangos energija patenka
antrj terp t = 1 (sakoma, kadnra ir sklaidos).
Garso energija tiek i oro vanden, tiek atvirkiai perduodama labai blogai. Tuo gali-
ma sitikinti apskaiiavus garso perjimo i oro vanden ir atgal praleidimo faktori. Oro
25 1
1
, = kg/m
3
, 340
1
~ c m/s, ~
1 1
c 420 kg/m
2
s; vandens 1000
2
= kg/m
3
, 1500
2
~ c m/s,
~
2 2
c 1,510
6
kg/m
2
s. Garsui sklindant i oro vanden t = 0,00114.
4.3.3. Garsosklidimas apribotose terpse
Kaip jau paymta anksiau, plokioji banga yra idealizacija, ji turt upildyti vis erdv. Aki-
vaizdu, kadtokios bangos realiai gamtojeneegzistuoja. Bet kokios, ispinduliuotos neapribotterp
garso bangos amplitud, bangai sklindant visas puses, maja dl difrakcijos, analogikos viesos
bang difrakcijai (r. 7.4 skyri 2-oje vadovlio dalyje). Tuo tarpu terpje, apribotoje vamzdiu,
banganeisisklaido. Garsas neisisklaidydamas sklindavandentiekiovamzdiais, ventiliacijos kanalais,
metrotuneliais. Metrotaiptriukminga yra todl, kadjudaniotraukiniogarsas neisisklaido alis,
o sklinda iilgai tunelio.
Siaurais vamzdiais (kai skersiniai matmenys maesni nei bangos ilgis) gali sklisti tikplokiosios
garsobangos, bganios iilgai vamzdio. Plaiais vamzdiais gali sklisti daugsudtingesns skersins
sandaros bangos. Jei apvalus a spindulio vamzdis yra labai siauras ) ( << a , tai bangos sklidimas
jame nepriklauso nuo to, ar jis tiesus, ar ilenktas, jis gali bti net su liais. Visais atvejais daleli
slgis ir greitis, praktikai visada likdamas pastovus vamzdio pjvyje, priklauso tik nuo atstumo,
skaiiuojamo iilgai vamzdio aies. Be to, garso greitis visada lygus garso greiiui neapribotoje
terpje. Todl siauri vamzdiai yra naudojami norint juose gauti plokij bang, pavyzdiui,
plokiosios bangos greiiams matuoti. Lenkti siauri vamzdiai plaiai naudojami varinipuiamj
instrument gamybai. Vamzdiai sulenkiami, kad sumat instrumento matmenys. Garsas,
igaunamas lenktu vamzdiu, turi tok pat aukt, kaip ir igautas tiesiu to paties ilgio vamzdiu.
Siaurame begaliniame vamzdyje gali egzistuoti laisvi bet kokio danio harmoniniai garso
virpesiai. Vamzdiuose suudengtais galais yra kitaip. ia galimos tik stoviniosios garso bangos ir
tik tamtikrdani, kurie vadinami savaisiais vamzdio garso virpesiais. Norint rasti savj virpesi
dan, reikia turti omenyje tai k. Ant absoliuiai kiet sieneli terps daleligreitis lygus nuliui
(4.3.3 pav., a). Todl ant dangteli turi bti slgio ppsniai (4.3.3 pav., b). Jei vamzdis udengtas i
abiej gal, tai jo ilgyje Ltelpa n (sveikasis skaiius) pusbangi. Taigi pagrindiniotono bangos ilgis
yra
1
=2L, o oberton bang ilgiai n kart maesni u pagrindinio tono bangos ilg. Taigi savj
udaro i abiej gal vamzdio garso virpesi bangos ilgiai yra
n / L
n
2 = , . ... , , , n 3 2 1 = (4.3.10)
Prie atvirojo vamzdiogalo garso (o ne atmosferinis) slgis turi bti lygus nuliui, t. y. prie jo turi
susidaryti slgio mazgas ir greiio ppsnis. Todl vamzdiui, atidengtam i abiej gal, savj
virpesi bangos ilgiai sutampa su (4.3.10) formule.
MECHANIKA ____________________________________________________________________________ 65
Vamzdio, udengto kietu dangteliu tik i vieno
galo, savj svyravim bangos ilgiai, kaip nesunku
sitikinti pavelgus 4.3.4 paveiksl, nustatomi i
sryio
); 1 2 /( 4 = n L
n
(4.3.11)
ia L vamzdio ilgis, n = 1, 2, 3, ... .
Savieji svyravimai tolydio gsta. Tai lemia ne tik
orostulpe vykstantys reikiniai (vidin trintis, ilumos
mainai), bet ir garsobangspinduliavimas i vamzdio
angos j supant or. Savj svyravim dinamikos
vamzdyjeudavinys, skaitant garsospinduliavim, yra
labai sudtingas. Reikia paymti, kad garso slgis
atvirojo vamzdio gale ne visai tiksliai yra lygus nuliui
ir tai lemia garso spinduliavimas i to atvirojo
vamzdio galo. Tam tikru artiniu spinduliavimo
poveik garso bangos ilgiui galima apibendrinti taip.
Spinduliavimo egzistavimas tartum pailgina R
spindulio vamzd ir pakeiia savosios bangos ilg:
, 8 , 0 ) 1 2 (
4
R L n
n
+ ~

. ... n 3, 2, 1, =
(4.3.12)
ie samprotavimai teisingi ir rezonansinei dei,
naudojamai kamertono skleidiamam garsui sus-
tiprinti. Ds ilgis parenkamas toks, kadjoje esanio
oro savasis pagrindinio svyravimo danis sutapt su
kamertono svyravim daniu. iuo atveju ds ilgis
iek tiek maesnis nei ketvirtis bangos ilgio
1
ore.
Atsivelgus spinduliavim i abiejatvirapskritovamzdiogal, gaunamas toks savjdani
santykis:
R , / n L
n
6 1 2 = , ,... , , n 3 2 1 = .
(4.3.13)
Taigi baigtini matmen vamzdyje gali vykti tik tam tikro danio svyravimai. Taiau vamzd
veikiant paalinmis jgomis, galima sukurti bet kokio danio priverstinius svyravimus. Kaip ir
sutelktos sistemos, pavyzdiui, vytuokls, atveju, priverstinio poveikio daniui sutampant su ko-
kiu nors savuoju vamzdio daniu, atsiranda rezonansiniai reikiniai ir svyravimamplitud smar-
kiai padidja. J skaiiuojant, jau reikia skaityti nuostolius, susijusius su garso sugertimi ir spin-
duliavimu.
4.3.3 pav. Pagrindinio tono virpesi
greiio (a) ir slgio (b) amplitudi
pasiskirstymas iilgai udaro vamzdio
a)
b)
a)
b)
4.3.4 pav. Trij pirmj savj svyravim
greiio amplitudi pasiskirstymas iilgai
vamzdio, kietu dangteliu udengto tik i
vieno galo
c)
66 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
4.3.4. Garsotaikymas medicinoje
Daugelis proces, vykstani mogaus organizme, pavyzdiui, kvpavimas, irdies ir kit organ
darbas, sukelia vairius garsus. Toki gars registravimas ir analiz yra vieni i svarbiausi kli-
nikini tyrim. Plaiausiai naudojamas ir paprasiausias tokio tipo instrumentas yra visiems gerai
inomas fonendoskopas (4.3.5 pav.). is prietaisas susideda i jautrios membranos ir dviej lanksi
siaur vamzdeli, nukreipiani garso svyravimus aus bgnelius. Oro stulpo rezonansas,
atsirandantis rezonatoriuje su tempta membrana, sustiprina gars ir palengvina jo analiz. Maas
vamzdeli skersmuo, kaipjau buvo minta, utikrina ger garso sklidim tais lenktais vamzdeliais
be pakitim.
Pavyzdiui, spindulins arterijos keliam pulso bangfiksavimu(klausantis per fonendoskop)
paremtas arteriniokraujoslgiomatavimometodas. Oroslgis pripuiamojojemanetje(4.3.6 pav.)
pakeliamas vir sistolinio slgio, o po to ltai mainamas atsukant special iaup. Oro slgiui
susilyginus su sistoliniu, pradedami girdti charakteringi garsai. i gars atsiradimas susijs su
sudtingu pulso bangos sklidimo i dalies uspaustoje arterijoje pobdiu. Kai slgis manetje
pasidaro maesnis nei diastolinis, kraujas arterija ima tekti netrukdomai, ir mintieji garsai
inyksta.
Kaip minjome, triukmu vadinami patys vairiausi garsai, susidedantys i daugelio neko-
reliuot ton, kuri danis, intensyvumas ir trukm
netvarkingai kinta. Triukmas danai pasitaiko gamtoje,
jis lydi vairius atmosferos reikinius, turbulentinius
vandens srautus ir kt. Atskirai reiktiskirti pramonin
triukm, kur kelia vairios mainos ir mechanizmai.
Veikdamas nerv sistem, triukmas didina nuovarg,
maina darbingum ir sukelia vairius nervinius nega-
lavimus. Todl ypa svarbu imtis priemoni triukmui
mainti. Triukmo garsumui matuoti yra naudojami
vairs prietaisai, vadinami triukmamaiais.
Rykiausias garso panaudojimo gyvojoje gamtoje
pavyzdys yra mogaus kalba ir vairi gyvn echolo-
kacija: nuo iknosparnio iki delfino. Reikia paymti,
kad iknosparniai geba pasinaudoti Doplerio efektu.
Registruodami atspindto ultragarso signalo danio
pokyt, jie gali nustatyti juos supani objekt padt ir
judjim nuosavo judjimo vektoriaus krypties at-
vilgiu. Tokiu bdu jie gali nejudanius objektus atskirti
nuo judanij, pavyzdiui, vabzdi, kuriais jie minta.
Mint garso bang dani sritis nra baigtin, toki
priima tik mogaus klausos organas ausis. Realiai eg-
zistuoja ir didesnio, ir maesnio danio garso bangos,
4.3.5 pav. Fonendoskopas
4.3.6 pav. Kraujo arterinio slgio
matavimo prietaisas
MECHANIKA ____________________________________________________________________________ 67
~
UB
UB
V
2
2
1
3
4.3.7 pav. Atvirktinio (a)
ir tiesioginio (b) pjezoelektrinio
efekto schemos
a)
b)
taiaumogus jnegirdi. Bangos, kuri danis maesnis nei 20 Hz, vadinami infragarsu, jei didesnis
nei 20 kHz ultragarsu.
Infragarsas yra dedamoji vairi triukm dalis. Ore infragarsas greitai ugsta, taiau gerai
sklinda tampriomis terpmis, taip pat ir vandeniu. Medicininiai tyrimai parod, kad infragarsiniai
svyravimai yra labai pavojingi. Negirdimos bangos sukelia mogui prislgtumo jausm ir
nepaaikinambaim. Bet kuriamegyvajameorganizmeegzistuojasavieji svyruojamieji emodanio
judesiai. Jei infragarsoperiodas yraartimas iems svyravimams, vykstarezonansas. Silpni infragarsai
veikia vidin aus ir sukelia jros lig, stiprs priveria organus vibruoti, o irdis gali net sustoti.
mogaus knas visikai neskaidrus regimojoje srityje. Poreikis matyti neskaidriose terpse
iuolaikiniame moksle, medicinoje, technikoje atsiranda praktikai kiekviename ingsnyje. Toki
matymo galimyb suteikia akustika, ypa plaiai klinikinje praktikoje taikoma ultragarsin
diagnostika.
Todl toliau apraomos ultragarso bangos, j savybs ir panaudojimas medicinoje.
4.3.5. Ultragarsas, jo generacija ir savybs
Ultragarsu vadinamos 0,02200 MHz danio mechanins bangos. Jos skirstomos emo danio
6080 kHz (skleidia delfinai, iknosparniai ir vairs dirbtiniai triukmai) ir aukto danio nuo
80 kHz iki 100 MHz bangas (jas daniausiai sukuria dirbtiniai pjezoelektriniai altiniai, turintys
elektrini virpesigeneratori). Medicinoje diagnostikai
daniausiai naudojamas 130 MHz danio ultragarsas.
Elektromechanini ultragarso altini ir imtuv veiki-
mas pagrstas pjezoelektriniu efektu (4.3.7 pav.).
Atvirktinis pjezoelektrinis efektas naudojamas ultragarso
altiniuose. Jo esm ta, kad, veikiant elektriniu lauku,
pjezoelektrinio kristalo darbini matmen kitimas,
sustiprintas rezonansu, sukuria kietajame kne ar skys-
tyje ultragarso bang (UB). Toks UB generatorius
(4.3.7 pav., a) paprastai sudarytas i:
1) mediagos, isiskirianios geromis pjezoelek-
trinmis savybmis, ploktels;
2) laidaus sluoksnio pavidalo elektrod;
3) elektros srovs generatoriaus.
Prieelektrodprijunguskintamelektros tamp, plok-
telpradedavirpti ultragarsiniudaniu(generuojamaUB).
UB imtuvas veikia tiesioginio pjezoelektrinio efekto
principu: mechanin ultragarso banga sukelia kristalo
deformacij, dl togeneruojamas kintamas elektrinis laukas
(galimaufiksuoti prijungtuvoltmetru; 4.3.7 pav., b).
68 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
UBgeneracija pavaizduota 4.3.8 paveiksle: (a) stacionarus objektas (kairje) kontaktuoja su
skysiu; (b) objektas juda link skysio, sukeldamas lokali auktesnio slgio srit; (c) objektas
juda prieinga kryptimi, tuo tarpu ultragarso slgio banga sklinda toliaudeinn; (d)(u) objektas
toliau svyruoja apie (a) eilutje nurodyt padt, generuodamas bangas, kurios sklinda skystyje.
Ultragarsobanga, kaipir garsobanga (GB), apibdinama bangos ilgiu, daniu, greiiu. Garsoir
ultragarso bang greiiai yra apytiksliai lygs (c
GB
~c
UB
), taiauUBilgis daug maesnis negu GB
(
UB
<<
GB
), todl UBnuo plokio altinio sklinda pakankamai siauru pluoteliu, kur lengva
fokusuoti.
UB, susidrusi su kietu objektu, veikia j tamtikra spinduliuots jga, kuri tiesiogiai priklauso
nuo UBgalios. Taipimatuojama bangos perneama energija. Paprastai diagnostikai taikom UB
altini spinduliuots jga yra labai maa, todl diagnostikai reikia ypa didelio jautrio jutikli.
UB stipris skaiiuojamas kaip ir garso bangos (4.3.5 ir 4.3.7 formuls), taiau UB stipris daug
didesnis negu GB (10, 100, 1000 W/cm
2
). Pavyzdiui, ultragarso altinio, kurio skersmuo 4 cm
2
ir
kuris skleidia 1 W galios bang, garso stipris yra 0,25 W/cm
2
(2500 W/m
2
). Dl ios prieasties
ultragarso bangos medicinoje taikomos daug plaiaunegu garso bangos.
4.3.8 pav. Ultragarso bangos generacija, kai judantis objektas kontaktuoja su skysiu
MECHANIKA ____________________________________________________________________________ 69
4.3.6. Ultragarso sklidimas skysiais ir biologiniais audiniais, sveika su mediaga.
Taikymai medicinoje
Sklisdama mediaga, ultragarso banga sukelia labai vairius vyksmus:
1. Mechaninius (mediagmikrostruktros deformacijas, gali net suardyti mediag; kavitacij,
jonizacij, disociacij; smulkina vairias terpes ir kt.).
2. Fizikinius-cheminius (mikrovibracijas lsteliniame ir tarplsteliniame lygmenyse; ardo
biomakromolekules; paeidia paias biologines membranas bei j laidum; turi ilumin
poveik; ardo lsteles ir mikroorganizmus).
Dl toultragarsas plaiai taikomas medicininei diagnostikai ir terapijai (ultragarsinei fizioterapijai).
Visi ultragarsiniai metodai pagrsti UBsveika suvairiais skysiais ir biologiniais audiniais: dl to
juose keiiasi ultragarsospinduliuots savybs ir parametrai, todl svarbuapie tai inoti.
Pavyzdiui, panardinus vanden ultragarso altin, jo skleidiamas ultragarso pluotas, esant
3 MHz daniui, 1500 m/s greiiui ir
0,5 mm bangos ilgiui parodytas 4.3.9 pa-
veiksle, a. Kaipmatyti i paveikslo, pluoto
forma ir plotis priklauso nuo altinio
skersmens: kelicentimetrgylyjepluotas
yra tokio pat ploio, kaip ir altinio skers-
muo, taiautolstant jis platja. Norint gauti
ultragarsu ger vaizd, btina turti kuo
siauresn ultragarso pluot. Deja, tik ma-
inant altinioskersmen, pakankamai siau-
ro pluoto gauti nepavyksta. Tai matyti i
4.3.9 paveikslo, b: perpus sumainus
altinio skersmen, pluotas yra siauras tik
kelis centimetrus, o toliau jis iplinta.
Norint gauti siaur viesos pluot,
naudojami liai ar gaubti veidrodiai. Pa-
naiai fokusuojamas ultragarso pluotas
plastikiniais liais arbagaubto(oneplok-
io) paviriaus altiniais. Abiem atvejais
rezultatas geresnis parodytu 4.3.9 paveiks-
le, c (tolstant nuo altinio pluotas tolygiai
platja) atveju. Norint detaliauitirti koki
nors mogaus organizmo srit, pavyzdiui,
ird, paprastai naudojami ultragarsozondai
(13 MHz), kuri pagrindinis elementas
yraultragarsinis jutiklis (4.3.10 pav.). Jutik-
lis paprastai atlieka dvi funkcijas: sukuria
4.3.9 pav. Apytiksl ultragarso pluoto vandenyje
skstis: nefokusuoto 10 mm skersmens (a); 5 mm
(b) ir sufokusuoto 10 mm skersmens (c) altini
(a)
(b)
(c)
a)
b)
c)
4.3.10 pav. Tipin ultragarsinio zondo schema
Srov
Koaksialinis
kabelis
Dialektrikas
Jutiklis
Zondo
apvalkalas
Apsauginis
sluoksnis
em
Dielektrikas
70 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
ultragarso impuls ir priima atsispindjus impuls, be to, prijungus elektronin (ar skaitmenin)
osciloskop(r. 6.6skyri2-ojevadovliodalyje) tuos impulsus galimastebti. inant laikotarptarp
impulsgalimanustatyti, kokiamegylyjeyra objektas, okeiiant jutikliopadt gauti duomenapie
objektoformir padt. Paprastai jutikliumatuojamas UBstipris prieobjektir ujo, potosudaromas
elinis objekto vaizdas. Taip stebima vairi organ veikla, pavyzdiui, smegen veikla
echoencefalografu, kuriojutiklis dedamas prie kaukols ir registruojamaatsispindjusionuogalvos
audiniultragarsosignaloamplituds priklausomyb nuolaiko. I tikrjultragarsobangos sklinda
gana ltai, todl, esant charakteringiems organ dydiams, kne nra sunku imatuoti sklidimo
trukmes. Todl akustini vaizd formavimui taikomi vairs ultragarsiniai-impulsiniai metodai.
Akivaizdu, kadorganizmo skysiais lapimu, kraujo plazma ultragarsas sklinda panaiai kaip
ir vandeniu. Juose ultragarso silpimo koeficientas, kuris apibriamas kaip bangos galios lygio
(ireikto decibelais, r. 4.4 skyri) sumajimas per ilgio vienet, yra labai maas, o sklidimo
greitis yra apie 1500 m/s. Silpimo koeficientas biologiniame audinyje yra daug didesnis negu
vandenyje. Didjant ultragarsodaniui, jis tiesikai didja. Audinyje 1 MHz daniobangos silpimo
koeficientas lygus 1 dB/cm, o 10 MHz 10 dB/cm. Kiekvienamaudiniui tinkamiausias ultragarso
danis parenkamas atskirai, nes jis priklauso nuo audinio tipo ir gylio, kur turi siskverbti banga.
Kai tiriama sritis yra maa, pavyzdiui, skenuojant ak, tada naudojama pakankamai aukto
(10 MHz) danio ir mao bangos ilgio (0,15 mm) banga, kuri utikrina ger skiriamj geb (ji
lemia sistemos gebjim iskirti smulkias detales vidaus organ akustiniame vaizde). Skenuojant
pilvo ertms organus, pasirenkamas 3 MHz ar emesnis danis, kuris leidia geriausiskverbti i
organaudinius.
Kraujyje ir minktuosiuose organizmo audiniuose (raumenyse, kepenyse, inkstuose) bangos
sklidimo greitis skiriasi nuogreiiovandenyje tik keliais procentais. Vadinasi, iorgan matmenys
gali bti nustatomi pakankamai tiksliai. Kai ultragarso banga susiduria sukauliniu audiniu, kurio
bangin vara labai didel, beveik visa garso energija atsispindi.
Skirtinga vairi organizmo audini ultragarso sugertimi ir atspindiu dl audini skirting
akustini savybi (tankio ir bangins varos (, Z)) remiasi ultragarsins diagnostikos metodas
vidaus organ vaizdinimas ultragarsu. Pavyzdiui, ultragarsui pereinant i kepen inkstus, atsis-
pinds tik labai maa dalis bangos, nes i organ tankiai ir bangos greiiai juose yra panas.
Taiau riebaluose bangos greitis ir tankis yra maesni negu kepenyse, todl didesn dalis bangos
energijos atsispinds nuo i audini ribos.
Beveikvisa ultragarsobangos energija atsispindi oroir biologinio audinio riboje, nes orotankis
yra daug maesnis negu audinio, be to, bangos greitis ore yra tik 330 m/s. Todl norint ivengti
atspindionuoioriniaudini, o esant auktiems daniams ir didels orosugerties, tarpultragarso
bang altinioir tiriamojo objekto tepamas tamtikras tirtas tepalas (gelis), suderinantis bangines
altinio ir imtuvo varas su ioriniais organizmo audiniais.
Atspindi ratai formuoja vidaus organ vaizd monitoriaus ekrane. Atspindt signal
apdorojant kompiuteriais, galima gauti tikslios informacijos apie organ didum ir diagnozuoti
vairius susirgimus ankstyvoje stadijoje. Reikia paymti, kad ultragarsiniai metodai yra maiau
pavojingi negu tyrimai jonizuojania spinduliuote. Kita vertus, ultragarso bang greitis yra
pakankamai didelis, kad bt galima sukaupti informacij ir atkurti vis kadr per 80 ms. Kitaip
MECHANIKA ____________________________________________________________________________ 71
sakant, atsiranda galimyb stebti judani element dinamik (r. 4.3.7 skyrel). i galimyb su
labai maa alingo poveikio tyrimo metu tikimybe, ekonomikumu ir pakankamu aparatros
paprastumu lemia tai, kad ultragarsiniai metodai taip plaiai taikomi medicininei diagnostikai.
4.3.7. Akustinis Doplerio efektas
Garsobang, sklindaniterpje, danis priklausonuogarsoaltinioir imtuvojudjimo. Kai altinis
ir imtuvas nejuda vienas kito atvilgiu, garso danis, priimamas imtuvu, yra toks pat, kaipir altinio
skleidiamogarsodanis. altiniui tolstant (ar artjant) nuoimtuvo, registruojamas danis sumaja
(arba atvirkiai padidja), kartu pasikeiia ir bangos ilgis vyksta akustinis Doplerio efektas. Tai
artjimo atvejupavaizduota 4.3.11 paveiksle. ia garso bang altinis, kurio greitis v
s
, juda terpje
(pavyzdiui, ore ar vandenyje) dein pus. Garso bangos greitis ioje terpje yra c. Po tamtikro
laiko, kai bangaltinis prajo 1,2, 5 padtis, pastebsime, kadatitinkamuose takuose suadint
bangfrontai yranekoncentrikos sferos. Paveikslematyti, kadbangos yrasutankjusios tojepusje,
kur link juda altinis, ir atvirkiai, prieingoje pusje yra iretjusios. Vadinasi, deinje pusje
esantis nejudantis klausytojas registruos sumajusio bangos ilgio
' = cT v
s
T (4.3.14)
ir padidjusio danio
s
v
= '
c
c
v v (4.3.15)
bang.
Dopleriometodugalimaimatuoti bangas spinduliuojanialtiniarbajas sklaidaniobjekt
judjimo greit. is metodas turi plaias praktinio taikymo galimybes. Su daugeliu fiziologini
mogaus organizmo proces susijusio judjimo sukeltas Doplerio dani poslinkis, atsirandantis
dl Doplerio efekto, yra garso bang diapazone. Todl paprastais greiio indikatoriais (i kuri
garsas perduodamas ausines arba garsiakalb) galima nustatyti kokio nors objekto judjim, o
tam tikrais atvejais ir sprsti apie judjimo
pobd. Pavyzdiui, tokie prietaisai buvo
panaudoti moters iose vaisiaus irdies
plakimui ir kraujagysli sieneli virpjimui
nustatyti matuojant arterin kraujo slg.
Taiau didiausi susidomjim kelia
Doplerioefektonaudojimas kraujotakos pa-
rametrams registruoti ir matuoti, kai kraujo
kneliai sklaidoultragars. Matuojant ultra-
garsiniu jutikliusiuniamo ir atsispindjusio
nuo judani raudonj kraujo kneli
signal bang dani skirtum, nustatomas
kraujotkms greitis. Jei yra kraujokreulys
ar trombas, kraujo srov kraujagyslje
1 2 3 4 5
4
3
2
1
cT
vsT
x
4.3.11 pav. Schema Doplerio efektui aikinti
72 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
apribojama, raudonieji kraujokneliai juda
liau ir tai registruoja ultragarsinis
prietaisas. Panagrinsime atvej detaliau.
Ultragarsinioaparatogalvutje esantis
altinis siunia dideliodaniov
0
ultragarso
bangas, kurios atsispindi nuo kraujagysle
judani kraujo kneli (4.3.12 pav.).
Atsispindjusias bangas su Doplerio
danio poslinkiu v
D
registruoja esantis
galvutje imtuvas. Dan v
D
galima rasti
atsivelgus tai, kad i pradi kraujo
knelius galima nagrinti kaip judant
imtuv. Tadaimtuvoregistruojamas danis
nustatomaskampuu Au/2. Poto io danio bangos isklaidomos (ispinduliuojamos) judaniais
kraujokneliais ir registruojamos ultragarsinioaparatogalvutje esaniameimtuve kampuu + Au/
2. Atsivelgus tai, kad mogaus audiniuose ultragarso bang greitis (c ~ 1500 m/s) daug kart
didesnis negu kraujotkms greitis (v ~ 1 m/s) ir kampas Au paprastai yra maas, gaunama tokia
Doplerio dani poslinkio formul:
cos 2
D
v
u
v
c
V
=
0
. (4.3.16)
I formuls matyti, kad Doplerio dani poslinkis yra proporcingas kraujo tkms linijiniam
greiiui, altinio daniui, atvirkiai proporcingas ultragarso greiiui audiniuose ir priklauso nuo
kraujo tkms greiio krypties. Jeigu ultragarso danis yra apie 10 MHz, tai ultragarsins bangos
Doplerio poslinkio daniai yra mogaus girdimumo diapazone. Ultragarsinis Doplerio metodas
plaiai taikomas klinikinje praktikoje, pavyzdiui, nustatant arterijos patologines susiaurjimo
vietas, kuriose padidja kraujo tkms greitis.
LABORATORI NIS DARBAS
Garso greiio ore nustatymas
Darbo uduotis
Nustatykite garso greit ore stovinij bang metodu.
Darbo priemons ir prietaisai
Prietaisas garso greiiui ore nustatyti; garso generatorius, stiklin kolba su vandeniu, jungiamieji
laidai.
4.3.12 pav. Ultragarsinio Doplerio metodo kraujo
tkms greiiui matuoti schema
Kraujagysl
Audiniai
Oda
Gelis
Primiklis
Siuntiklis
Ulrtagarsinioaparato
galvut
v

v
0 v
A
Imtuvas
Ultragarsinioaparato
altinis
MECHANIKA ____________________________________________________________________________ 73
v, Hz h
0
, m h
1
, m h
i
, m , m c, m/s Ac, m/s
Darbo metodika
Prietaiso garso greiiui nustatyti schema pavaizduota
4.3.13 paveiksle. J sudaro akustinio danio virpesi
generatorius (G), garsiakalbis (T), piltuvlis (B) ir stiklinis
vamzdis (A), kur pilamas vanduo. Garsiakalbis (T) yra
akustini bang altinis. Sklindanti vamzdiu (A) banga
atsispindi nuo vandens paviriaus ir grta atgal. ios dvi
prieingomis kryptimis sklindanios bangos interferuoja,
ir vamzdyje (A) susidaro stovinioji banga, kai paten-
kinama vamzdio ilgiui l akustinio rezonanso slyga
l = (n + 1/2)
st
; ia n =0, 1, ... ,
st
= / 2 stoviniosios
bangos ilgis. Kaip matyti i brinio, stulpo viruje yra
stoviniosios bangos terps daleli greiio svyravim
pupsnis, o apaioje mazgas, nes viruje yra laisvasis oro
stulpo galas, o apaioje atspindys nuo tankesns terps.
Jeigu oro stulpe susidaro stovinioji banga, tai girdimas
pagarsjimas. Tokipagarsjimgalima igirsti kelet. U-
raius atitinkamus h
i
, randamas rezonansins garsobangos
ilgis:
( ) ( ) ( )
i
h h h h h h
i i 1 1 2 0 1
2

+ + +
=
A
,
arba
( )
i
h h
i 0
2
=
,
i = 1, 2,, n.
(4.3.17)
Darbo eiga
1. jungiamas generatorius ir nustatomas pasirinktas danis (pavyzdiui, 800 Hz).
2. Piltuvliu stiklin ind (A) pilamas vanduo ir, keiiant vandens stulpelio aukt, klausomasi
garsumo kitimo.
3. Igirdus pagarsjimus, nustatomos mazg padtys h
0
, h
1
,, h
n
.
4. raius matavimo rezultatus (4.3.17) formul, apskaiiuojamas bangos ilgis.
5. Randamas garso bang ore greitis c =v.
6. Matavimai (15 punktai) kartojami kelis kartus, pakeitus generatoriaus dan.
7. Matavim ir skaiiavim duomenys suraomi lentel. vertinamas matavim tikslumas.
4.3.13 pav. Prietaiso garso
greiiui nustatyti schema
h
4
h
2
h
0
A
B
G
T
h
0
h
1
h
2
h
3
h
4
74 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
4.4. Klausos fizika
Garso spinduliavimas.
mogaus klausos organai.
Garso suvokimas ir matavimas.
Ausies girdimumo ribos spektrin priklausomyb.
Garso signal transformacija: mikrofonai, telefonai.
4.4.1. Garso spinduliavimas
Svyruojantis knas kuriaapiesaveterps sutankjimus ir praretjimus ir taipgeneruojagarsobangas.
ibangneamos energijos altinis yra judanioknokinetin energija. iospinduliavimoaltinio
suformuotas garso laukas priklauso tik nuo to altinio formos ir svyravim pobdio. Kuriam
lauk charakteristikoms inagrinti naudojami supaprastinti modeliai, leidiantys gana paprastai
apskaiiuoti spinduliavimo altini parametrus. Spinduliavimo altiniams, kuri matmenys
pakankamai dideli, palyginti su bangos ilgiu, taikomas begalins ploktumos, sinfazikai
svyruojanios savo normals kryptimi kaip viena visuma, modelis (4.4.1 pav.). Tokia ploktuma
kuria plokij bganij bang, kurioje slgis ir daleli svyravimo greitis kinta sinfazikai.
Plokij bang kuria ir svyruojantis siaurame vamzdyje stmoklis. Plaiai taikomas maos
pulsuojanios sferos pavidalo altinio modelis. Plokiojo ir sferinio bangos front formavimasis
pavaizduotas 4.4.1 ir 4.4.2 paveiksluose.
Suadinti oro stulposvyravimus, pavyzdiui, vargon vamzdyje, yra labai sudtinga (4.4.3 pav.).
Bendrais bruoais j galima aprayti taip. Tolygiai puiant or per pstuk, oroitekjimas i plyio
sukelia autosvyravimus. I t suadint vairaus danio svyravim ilieka tie, kuri danis yra
artimas vienami savjvamzdiodani. iuoprincipuparemtas garsogavimas vairiais vilpukais
ir galingais gariniais garso generatoriais. Pastarieji neturi judani dali, todl yra patikimi ir
patogs vairiems pramoniniams tikslams. iuo principu remiasi ir dainuojanio mogaus garso
spinduliavimas (4.4.4 pav.).
4.4.1 pav. Plokiosios bangos
spinduliavimo modelis
4.4.2 pav. Sferins bangos
spinduliavimo modelis
MECHANIKA ____________________________________________________________________________ 75
4.4.5 pav. Garso sirenos schema:
1 aukto slgio kamera, 2 elektros
variklis, 3 rotorius, 4 statorius
Kartais yra svarbu gauti krypting garso bang. Tada
reikia padidinti altinio matmenis. Tai padaryti galima
ruporu vamzdio gabalu, kurio vienas galas tolydiai
platjantis. Ruporai danai naudojami garsiakalbiams,
tada smarkiai padidja garso ispinduliavimas. Tai lemia
net ir mao danio bang slgio ir svyravim greiio
sinfazikum rupore. Pagal laik suvidurkintas energijos
srauto tankis intensyvumas iuoatvejuyra maksimalus.
Ruporai, naudojami sustiprinti ir padidinti kalbos
kryptingum, vadinami megafonais. Ruporai taip pat
naudojami gautam garsui sustiprinti. iuo atveju prie
siaurojo ruporogalo pridedama ausis ar koks kitas garso
imtuvas. Danai garso kryptingumui padidinti yra
specials akustiniai veidrodiai ir liai arbavietoje vieno
altinio su dideliu ruporu naudojama toki altini sinfazin sistema.
Sirenos yra stiprs garso altiniai (4.4.5 pav.). J veikimas pagrstas papildomos oro mass
purkimu nesutrikdyt terp. Ainse sirenose elektrovariklis disk su skylmis (rotori) suka
kito nejudaniodisko, taippat su skylmis (statoriaus), atvilgiu. Tarpas tarprotoriaus ir statoriaus
paprastai yratik~0,05 mm. Siurbliususpaustas oras i specialios kameros per rotoriaus ir statoriaus
skyles patenka rupor. Slgio, net ir garso, pulsacij lemia skyli rotoriuje ir statoriuje skaiius,
taip pat rotoriaus apsisukim skaiius. Paleidiant siren apsuk skaiius didja, todl garsinio
signaloauktis kintanuoemoiki tamtikrostacionaraus aukio. Orosirenos daniausiai naudojamos
spjamajai signalizacijai koki nors pavoj atveju: aviacijos antskrydi karo metu, gaisro ir kt.
4.4.4 pav. Dainuojanio mogaus
spinduliuojamas garsas
4.4.3 pav. Garso
spinduliavimas vargonu
76 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Visa informacija, perduodama transliacijos, telefoninio ryio, garso stiprinimo, garso raymo
ir atkrimo sistemomis, yra skirta mogui. Todl, norint teisingai tokias sistemas projektuoti ir
eksploatuoti, reikia inoti mogaus klausos savybes, nes mogaus klausos organas yra savotikas
garso imtuvas, kuris labai skiriasi nuo mogaus kuriam garso imtuv.
4.4.2. mogaus klausos organai
Klausos organais mogus gauna daug ir vairios informacijos apie j supant pasaul. mogaus garso
analizatori sudaro specializuota garso svyravim primimo, garso poji formavimo ir garso
form atpainimo sistema. mogaus ausis (4.4.6 pav.) susideda i trij dali: iorins, vidurins ir
vidins ausies. Iorin aus sudaro kauelis, iorin klausomoji landa ir bgnelio plv. Iorins
ausies elementai reikalingi garsui nukreipti mint bgnelio plv membran, visikai
udengiani iorin land paiame jos gale. Vidurin ausis, susidedanti i tarpusavyje sujungt
klausos kauleli (plaktuko, priekalo ir kilpos kaulelio prie vidins ausies), perduoda svyravimus
vidinei ausiai, kuri sudaro sraig, prieangir pusapvaliai kanalai periferinvestibulinioaparato
dalis. Sraigje garso virpesiai transformuojasi nervinius impulsus, klausos nervu keliaujanius
smegenis.
Ausies kauelis iek tiek koncentruoja garso energij, patenkani iorin land. Pastaroji
sudaro savotik rezonatori ~ 2,7 cmilgio vamzdel, i vieno galo dengiam bgnelio plvs. Jei
ketvirtis garsobangos ilgioyra lygus landos ilgiui, vyksta rezonansas (kaipparodyta4.3.4paveiksle).
Btent tai paaikina mogaus klausos jautrumo maksimum esant ~ 3 kHz daniui.
4.4.6 pav. Ausies sandara:
1 ausies kauelis, 2 iorin klausomoji landa (vamzdelis), 3 bgnelis, 4 plaktukas, 5 priekalas, 6
kilpa kaulelis prie vidins ausies, 7 vidins ausies sraig, 8 vestibulinis aparatas, 9 anga, einant
nosiarykl
1
2
3
4 5
7
8
9
6
MECHANIKA ____________________________________________________________________________ 77
Bgnel sudaro plona (apie 0,1 mm) pertvara, kuri yra daug plonesn nei bangos ilgis. Todl jos
judjimo greitis sutampa su oro daleli virpjimo daniu. Minimalij girdimumo rib atitinka
plvs poslinkis, kuris yra tik ~ 10
11
m, t. y. maesnis nei atomo spindulys. Maksimalij rib, kai
jau jauiamas skausmas, atitinkantis plvs poslinkis yra ~ 1 m.
Vidurin ausis garsinius oro svyravimus transformuoja skystos vidins ausies terps svyra-
vimus. Jei garso bangos tiesiogiai krist ovalij vidins ausies ang, tai dl skirting oro ir
vandens banginivar vidin aus patekt tik 0,1 %j energijos. Vidurins ausies kaulelidarbo
principas yra panaus sverto ir leidia padidinti poveikio jg. Ausies bgnelio plvs plotas
(0,7 cm
2
) yra kur kas didesnis nei ovaliosios vidins ausies angos (0,03 cm
2
). Todl vidurin ausis
atlieka slgio transformatoriaus funkcij, padidindama slg madaug 20 kart. Kita vertus, mo-
gaus ausis blogai girdi po vandeniu, nes dl skirting vandens ir oro bangini varpraktikai visas
garsas atsispindi nuo bgnelio plvs. Todl ms protviai padar neteising ivad, kad
povandeninis pasaulis tylos pasaulis. Net atsirado posakis tyli kaip uvis. I tikrj uvys yra
be galo plepios. Tai paaikjo tik madaug XX amiaus 5-j deimtmet, kai povandeniniam
laivynui prireik hidroakustini registracijos sistem. Vidurin ausis atlieka dar vien svarbi
funkcij apsaugo vidin aus nuo pernelyg dideli mechanini apkrov priimant labai stiprius
garsus. To pasiekiama padidus kilpos judjimosudtingum, kai garso intensyvumas yra didelis.
mogaus ausis isiskiriadanioanalizatoriaus savybmis, diskretiniusuvokimudanioir dinaminio
diapazonoatvilgiu(analoginis garsosignalas paveriamas dvejetaineelektriniimpulsseka). Visos
iosoperacijosvykstavidinjeausyje, vadinamojojesraigje. Sraigjeyrapagrindin(baziliarin)membrana,
susidedanti i daugeliotarpusavyjesilpnai sujungtpluot. Iilgai pagrindinsmembranos isidsiusios
nervins aknels, kurikiekviena(ojdaugiaukaip20 000) susiadinanuopagrindins membranos
pluotprisilietimoirsiunia smegenklausoscentrelektrinius impulsus. Tenatliekamasudtingai
impulsanaliz, kurios dkamogus nustatoperduodampraneim.
Kiekvienas pagrindins membranos pluotas rezonuoja tamtikrupastoviutampluotui daniu.
Sudtingas garsas, susidedantis i daugeliodaninidedamj, sukeliapluot, atitinkanidanines
dedamsias, svyravimus. Klausos analizatoriaus skiriamoji geba nedidel, o klausos analizatoriaus
rezonatoriaus pralaidumo juosta monoauralins (vienauss) klausos atveju esant 300 Hz daniui
yra apie 50 Hz, 1000 Hz daniui 60 Hz, 3000 Hz 150 Hz. ios pralaidumo juostos vadinamos
kritinmis klausos juostelmis.
Girdimumo dani juost i apaios riboja 1620 Hz danis, o i viraus 20 000 Hz. ioje
srityje mogus simena tik kelis imtus danio lygi (gradacij), o i gradacij skaiius majant
garso intensyvumui staigiai maja ir vidutinikai sudaro ne daugiau kaip100150. Gretim lygi
daniai vidutinikai skiriasi ne maiaukaip4 %(patys geriausi muzikantai nejunta film, nufilmuot
kinui 24 kadr per sekund greiiu ir rodom per televizij 25 kadr per sekund greiiu, ir
atvirkiai, garsinimo skambjimo skirtumo). mogus netiesiogiai gali pajusti iki 0,3 %vidutinio
danio pokyt, pavyzdiui, lygindamas du vienas po kito einanius tonus. Pagal dviej ton dani
m galima pajusti dani skirtumus iki deimtj herco dali.
Medicinos aka, tirianti klaus, jos paeidimoprieastis, sutrikimoformas, gydymo, profilaktikos
ir reabilitacijos bdus yra vadinama audiologija (lot. audio girdiu; gr. logos mokslas).
78 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
4.4.3. Garso suvokimas ir matavimas
Pagrindins membranos pluotas virpdamas suvirpinanervins lstels plaukines ataugas ir didjant
j svyravim amplitudei, vyksta sudirginimas, t. y. dl lstels membranos deformacijos vyksta
veikimo potencialo generacija. Nervin lstel siunia elektrinius impulsus smegen klausos
centr, garsas igirstamas. Toks uolinis perjimas i girdimos bsenos negirdimir atgal vadinamas
girdimumo slenksiu. Optimali vidins ausies konstrukcija ir didelis vidins ausies jautrumas leidia
mogui girdti 13 kHz dani srityje gars, kurio stipris yra tik
12
0
10

= I W/m
2
. Maksimalus
garso stipris, kur gali registruoti nepaeista mogaus ausis, yra artimas 1 W/m
2
. Taigi dinamin
garso signal primimo sritis (10
13
) yra labai didel, ji virija regos srit (10
7
).
Atskirindividgirdimumoslenkstis turi ganadidel sklaid, pirmiausiai dl pakitim, susijusi
suamiumi, taippat dl darboslyg. Tarpskausmoslenksioir girdimumoslenksioyrapakankamai
didelis intervalas.
XIX amiaus vokiei fiziolog darbai leido suprasti jutimo organ (akies, ausies ir kt.)
funkcionavimo mechanizmus ir i esms suformuluoti psichofizikos pagrindus. Psichofizika
mokslas apie fizini dirgikli parametr ir dl j atsirandani poji pobdio kiekybinius
tarpusavio ryius. E. Vberis (E. Weber) padar ivad, kad skirtumas AI dviej stimul, vos ski-
riam bandomojo, priklauso nuo stimulo I ir jsantykis yra pastovus dydis: const / = A I I . Vliau
G. Fechneris (G. Fechner), remdamasis Vberio dsniu, ived logaritmin stimulo I ir pojio S
ry. I tikrj, esant pakankamai maiems dydio pokyiams, . / d
0
I I K S d = Tai Vberio ir
Fechnerio dsnio diferencialin forma. I ia iplaukia, kad :
e lg , lg ln ) ( ) (
0
0 0
0 0
K K
I
I
K
I
I
K I S I S = = = .
(4.4.1)
StimulovertI
0
parenkamatokia, kaddydioS verts btneneigiamos, t. y. 0 ) (
0
= I S . mogaus
ausiai parenkama minimali girdimo garso stiprio vert
12
0
10

= I W/m
2
. Stimul santykis
I / I
0
tapo pagrindu garso galios lygiams vesti (kai koeficientas K =1, gali santykis ireikiamas
belais (B), kai K = 10, decibelais (dB)):
] B [ ) / ( lg
0
I I L
I
= , ] dB [ ) / ( lg 10
0
I I L
I
= .
(4.4.2)
Belas garso, kurio danis v = 1 kHz , galios lygio pokytis, kai garso stipris pakinta 10 kart.
Taiau yra patogiau matuoti garso slg, nes mogaus ausis tiesiogiai priima slgio svyravimus.
Garso slgis ir techniniuose renginiuose yra lengviau registruojamas nei kiti akustiniai dydiai:
garso stipris, svyravimo greitis, poslinkis ir kt. Vidutinis kvadratinis slgis, atitinkantis girdimumo
rib ore, yra
5
0
10 2

~ p N/m
2
. Tada garso slgio lygiai ireikiami decibelais formule
) / lg( 20
0
p p L
p
= [dB]. (4.4.3)
Garsis subjektyvi garso suvokimo savyb, kuria remiantis garsai skirstomi nuotyli iki garsi.
Jis priklausonetiknuogarsostiprio, bet ir nuodanio, arbabendresniuatvejunuogarsospektrins
MECHANIKA ____________________________________________________________________________ 79
4.4.7 pav. Vienodo garsio kreivs klausant abiem ausimis
sudties, trukms ir kit garso charakteristik. Tyloje girdti uodo zyzimas, muss zvimbimas,
laikrodio tiksjimas ir kiti garsai. Esant triukmui ir trukdiams, galima neigirsti ir garsaus
pokalbio, kitaip sakant, silpn gars girdimumo slenkstis iauga. Toks girdimumo slenksio pa-
didjimas vadinamas maskuote.
Laisvai pasirinkto garso garsio lygio matavimas remiasi mogaus gebjimu palyginti dviej
gars stipr ar j santyk. iuolaikiniai tyrinjimai parod Vberio ir Fechnerio dsnio (4.4.1)
netikslumus. Kur kas tikslesns yra laipsnins garso garsio G ir garso slgio priklausomybs,
pasilytos S. Styvensono (S. Stevens). Grynj ton
n
S
p p G ) ( = k ; ia
S
p tamtikro danio
bangos girdimumoslenkstis, k koeficientas, priklausantis nuogarsodanio, trukms ir individuali
klausytojo savybi. Rodiklio n vert priklauso nuo vidutins kvadratins garso slgio verts. Kai
dB 30 < <
p p
L L
S
, n > 2; kai dB 60 dB 30 < <
p
L , n 1 ~ ; kai dB 60 >
p
L , n 5 , 0 ~ . Praktiniuose
udaviniuose garsogars priimta charakterizuoti garsiolygiu, matuojamu fonais. Tonui, kuriodanis
kHz 1 = v , garsiolygis fonais skaitikai lygus garso slgio lygiui decibelais. Laisvai pasirinkto garso
garsiolygis nustatomas parenkant topaties garsiobang, kurios danis kHz 1 = v . Toniniimpuls,
kuri trukm ilgesn kaip 200 ms, girdimumo slenkstis nustatomas taip pat, kaip ir nuolatinio
tono. Esant impuls trukmms 200 < t ms, girdimumo slenkstis priklauso nuo impulso trukms
santykio su 200 ms ir apibriamas iraika 200 /
imp gs
t I I = . Du trumpi impulsai suvokiami
kaip vienodo garsio, jeigu ta sandauga vienoda abiem impulsams. Kad bt galima vertinti
harmoniniotonogarsiolygius, naudojamasi suvidurkintomis pagal daugel tiriamjvienodogarsio
kreivmis (4.4.7 pav.), patvirtintomis tarptautinio standarto. Jei tamtikro garso garsis yra lygus n
fon, tai reikia, kadgarsas turi tok pat gars, kaipir garsas, kurio danis kHz 1 = v , ogarso stipris
n decibel didesnis nei girdimumo slenkstis. emo (maesnio nei 1000 Hz) danio garsai esant
Skausmo pojtis
Garso jutimo riba
1000 Hz
v, Hz
140
120
100
80
60
40
20
0
L, dB
20 100 1000 10
000
120
100
80
60
40
20
0
80 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
iamgarsiui yra stipresni nei auktesnio (10003000 Hz) danio garsai. Pavyzdiui, 60 Hz ir 40 dB
garsostiprigarsas dar negirdimas. nabdesiogarsiolygis yra apie 1020fon, laikroditiksjimo
2030 fon, kalbos 4050 fon, garsios kalbos 7080 fon, o lktuvo variklio apie 100110
fon. Girdimumorib dideli garso stiprisrityje lemia skausmo slenksiegzistavimas. Skausmo
slenksiai maai priklauso nuo garso danio ir yra 120130 dB. mogaus vidutin diferencin
garso garsio geba apytikriai yra 1 fonas. Esant klausos patologijai, ji gali keistis. Tai panaudojama
diagnozuojant klausos paeidimus.
Girdjimo dviemausimis efektas vadinamas binauraliniu. Jis pasireikia kaip stereoakustinis
(stereofoninis) efektas. Binauralin klaus lemia dvi pagrindins slygos. Pagrindinis em dani
faktorius yra laiko moment, kuriais garsas patenka kairij ir deinij ausis, skirtumas, o
auktdani garsostipriskirtumas. Stereoakustinis klausos efektas pasireikiatuo, kadmogus
jauia skersinius garso altinio matmenis, taip pat jo gyl, t. y. garso altinio matmenis iilgai
linijos, kurios kryptimi ateina garso bangos. Klausytojas pagal gars lengvai atskiria vieno ar kito
instrumento buvimo orkestre viet (koordinates), t. y. klausa dviem ausimis sukuria akustin
perspektyv. io gebjimofizikinis pagrindas yra tas, kadpaprastai viena ausis yra toliaunuo garso
altinio negu kita (4.4.8 pav.). Sklisdamas greiiu , c tolimesn aus garsas pasiekia laiko tarpu
c s t / A = A vliau ir yra maesnio garso stiprio. emesni nei 300 Hz gars lokalizacija neryki ir
praktikai galima tik dl oberton. 300800 Hz dani garsams pagal ulaikymo trukm ausis
pajgi atskirti fazi skirtum kairiojoje ir deiniojoje ausyse. Akivaizdu, kad kuo didesn io
ulaikymo vert, tuo didesn kamp sudaro garso altinio kryptis su vidutine galvos linija. takos
turi ir ekranuojantis galvos poveikis, nes galvos matmenys yra artimi idanibangos ilgiui. Esant
didesniems daniams, dl garso elio aplink
mogaus galv garso galios skirtumai gali sudaryti
30 dB. Klausos sistema gali pajusti 1 dB slgio
skirtumus ir aptikti vos 30 svlavim. Tai atitinka
apie 3
o
garso altinio nuokryp nuo vidurins linijos.
Apskritai mogaus klausos organas leidia nustatyti
garso altinio krypt 14 tikslumu. Taigi suvokti
fizikin erdvin tr galima dl unikali klausos
sistemos laiko analizavimo galimybi.
Garso bangos krypties nustatymo galvos ver-
tikalioje ploktumoje tikslumas nevirija 20
o
. Toks
pat nustatymotikslumas pasiekiamas klausantis viena
ausimi. Gebjimas lokalizuoti garsoaltin kinta esant
vairiai klausos patologijai. Tai panaudojama klini-
kinje audiometrijoje prikurtimo form diferencinei
diagnostikai.
mogus negirdi gars, emesni nei 16 Hz ir
auktesni nei 20 kHz dani. Apatin ir virutin
ribos nra tiksliai apibrtos. mogui senstant,
4.4.8 pav. Garso lokalizacija
MECHANIKA ____________________________________________________________________________ 81
virutin girdim gars riba maja. Nedaugelis penkiasdeimtmei girdi 1416 kHz danio
garsus. Klausos tyrinjimai (atrumo nustatymas) vadinami audiometrija. Girdimumo kreivs
slenkstiniai takai paprastai nustatomi esant skirtingiems daniams. Klausos praradimas
apibriamas kaipgaut rezultat ir normos skirtumas. Grafikas, parodantis skirtum decibelais
priklausomai nuo garso danio, vadinamas audiograma. Tai pagrindinis dokumentas, parodantis
mogaus girdos (klausos) profil. Audiogramos formoje, rekomenduotoje Tarptautins standart
organizacijos, abscisje nurodomas testuojamj ton danis hercais (nuo 125 iki 8000 Hz), o
ordinatje klausos lygis (angl. Hearing Level HL) decibelais (nuo 10 iki 120 dB
HL
). Sveik
moni klausos jautrumo rib vidurkis lygus nuliui (0 dB
HL
).
Klausos lygis (klausos jutimo riba, girdos riba) audiogramoje ymimas sutartiniais simboliais:
a) orinis laidumas (nemaskuojant): deinioji ausis o, kairioji ausis ; b) orinis laidumas (maskuojant):
deinioji ausis A, kairioji ausis . Kaulinis laidumas atitinkamai ymimas simboliais: a) <, >ir b)
[, ]. Grafike orinis laidumas ymimas (simboliai jungiami) itisine, o kaulinis brknine linijomis.
mogus sugeba skirti labai maus garsodanio pokyius. Optimaliojoje klausos zonoje (1000
4000 Hz) garsodanio skiriamoji (diferencin) geba lygi 0,3 %. Vadinasi, pradiniam1000 Hz tono
daniui pakitus 3 Hz, turintis normali klaus mogus jau girdi kitokio aukio ton. Vis ton
diferencin geba nra vienoda; 50100 Hz diapazone ji lygi 1 %. Esant klausos patologijai, i geba
gali kisti. Tai taikoma klinikinje audiometrijoje diferencinei diagnostikai.
4.4.4. Garso signaltransformacija: mikrofonai, telefonai
Mikrofonai (gr. mikro maas ir phone garsas) keiia garso signalus elektrinius. Paprasiausias
ir labiausiai paplits mikrofonas anglinis, naudojamas prastame telefono ragelyje. Jautriojo
elemento vaidmen ia atlieka kapsul su anglies milteliais ir diafragma, prijungta prie pastovios
tampos. Garso slegiama diafragma suspaudia anglies miltelius. Milteli lietimosi paviriaus
pokyiai keiia elektrin milteli var. Pagal diafragmos virpjimo takt kinta ir mikrofono
grandins srovs stipris. Ieinantis kintamosios srovs signalas gali bti iskirtas transformatoriumi,
kurio pirmin apvija jungta mikrofono grandin. Anglies mikrofono daleli kuriam dani
diapazonas nra platus nuo imt Hz iki keli kHz, taiau jo pakanka kalbai suvokti.
Praktikai visuosemikrofonuoseyrajudantis elementas (diafragma, membrana), galintis svyruoti
veikiant garso slgiui. Tada jame vyksta mechanin-elektrin transformacija. mikrofono sudt
eina ir kiti jo praktiniamnaudojimui btini elementai: transformatoriai, stiprintuvai ir pan. Pagal
mechanins-elektrins transformacijos princip mikrofonai skirstomi induktyviuosius, talpinius,
pjezoelektrinius ir pan. Ko gero, plaiausiai taikomi induktyvieji mikrofonai, kuriuose virpant
membranai magnetinis laukas kinta specialioje ritje, esanioje alia tos membranos. Dl
elektromagnetins indukcijos rits ivadose indukuojama EVJ, kurios dydis priklauso nuo garso
slgio kitimo pobdio.
Tarpmatavimui skirt mikrofon ypa auktomis akustinmis-elektrinmis charakteristikomis
isiskiria kondensatoriniai mikrofonai, kuriuose judanti membranaMyrakondensatoriaus ploktel
82 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
(4.4.9 pav.). Antrj ploktel atitinka nejudantis
elektrodas C su skylmis ir dubimais, reikalingais
transformacijos tiesikumui utikrinti. Veikiant garso
slgiui ir vykstant atitinkamiems membranos svy-
ravimams, kondensatoriaus talpa kinta. Veikiant pas-
tovios tampos U
0
altiniui, per apkrovos var Rteka
sikrovimo-isikrovimo srov i, sukurianti varoje R
tamp U, pagal formatkartojani garsosignal. Dl
maos membranos mass ir mao jos storio 310 m
kondensatorinio mikrofono dani diapazonas gali
bti nuo vienet Hz iki 150 kHz ir daugiau, esant
tolygiai daninei charakteristikai. J jautris garso
diapazone apytikriai yra 10 mV/Pa, o dinaminis
diapazonas siekia130 dB. Kondensatorinimikrofon
kapsul gali bti maesn nei 10 mm. Todl minia-
tiriniai kondensatoriniai mikrofonai yra pagrindiniai
garso imtuvai matavimams ore.
Klausantis muzikos dabar labai populiars ausiniai
telefonai. I j plaiausiai paplit yra nebrangs
elektrodinaminiai telefonai (4.4.10 pav.).
Klausos jutimo ribos matavimas grindiamas
lyginimo principu. Nustatoma riba lyginama su dy-
diu (0 dB
HL
), kuris laikomas vidutine norma ir yra
standartizuotas. Praktikai audiometro nulinis lygis
standartizuojamas akustikai kalibruojant orin
telefon. Tam naudojamas specialus prietaisas
dirbtin ausis. Orini telefon generuojam garso
signal stipris kalibruojamas matuojant garso slgio
lyg decibelais (dB
SPL
) (angl. Sound Pressure Level
SPL). Gauti rezultatai i dB
SPL
perskaiiuojami
dB
HL
, atimant etaloninionuliniolygiodyd, kuris skir-
tingiems telefonams nevienodas. Kiekvien etalonin
nulin (minimalus girdimumas) garsoslgiolyg galima apibrti kaip0 dB
HL
kiekvienamfiksuotam
daniui. Leistinas ir subjektyvus audiometr kalibravimas atliekamas nustatant konkreiu
audiometrudeimties ar daugiau otologiniu atvilgiusveik asmenklausos jautrumoribvidurk.
is kalibravimo metodas tinkamas tik konkreiam audiometrui ir taikomas atliekant rutinin
audiometrins rangos kontrol.
Klausos jautrumas turi bti tiriamas specialioje patalpoje su garso izoliacija, kad aplinkos
triukmas nemaskuot testuojamjton. Neturint audiometrini kabin, klaus galima testuoti
4.4.9 pav. Kondensatorinis mikrofonas
R U C
U
0
i
M
4.4.10 pav. Elektrodinaminis telefonas:
1 maas elektrodinaminis garsiakalbis, 2
korpusas, 3 perforuotas tinklelis, 4 mink-
ta mediaga, prisispaudianti prie ausies, 5
gars sugerianti mediaga, 6 elektrinis
kontaktas
1
2
3
4
6
5
MECHANIKA ____________________________________________________________________________ 83
kiekgalimalabiauizoliuotojenuoaplinkos triukmopatalpoje. Taiauiuoatvejuturi bti imatuotas
aplinkos triukmo lygis ir j atsivelgiama interpretuojant tyrim rezultatus.
Prie pradedant matuoti klausos jutimo rib, btina sitikinti, kad audiometras ir telefonai yra
kalibruoti. Neleistina, kad pacientas laikyt ausines rankomis. Didinant ar mainant lankelio ilg,
prie kurio pritvirtinti oriniai telefonai su ausinmis, pasiekiama, kad ausins priglust prie ausies
kaueline per daug spausdamos. Paprastai pirmaturi bti testuojamageriaugirdinti ausis. Klausos
jutimo riba pradedama matuoti nuo 1000 Hz tono, paskui 28 kHz diapazone ir paskiausiai
125, 250 ir 500 Hz tonams. Testuojamj signal trukm turi bti nuo 1 iki 2 s, o intervalai tarp j
ne trumpesni nei signal pateikimo trukm. Testuojamas signalas pagal klasikin psichofizin
rib metod gali bti pateikiamas stiprjimo ar silpnjimo tvarka, kol tiriamasis j igirsta arba
nustoja j girdti. Klausos jutimo riba yra laikomas testuojamojo signalo, kur pajgia igirsti
tiriamasis, maiausios garso galios lygis.
Orinio telefonogeneruojamos garso bangos suvirpina ir kaukol. i virpesistipris, aiku, kur
kas maesnis nei pirminio akustinio signalo. Taiau ie virpesiai pereina galv skersai ir paveikia
prieingos ausies klausos analizatori. Dl io kryminio girdimumo testuojant blogiau girdini
aus neretai tenka geriau girdini (netestuojam) aus maskuoti tamtikro lygio akustiniu signalu.
Maskavimo laipsnis priklauso ne tik nuo gars stiprio, bet ir nuo j danio. Kai klausos riba
matuojama maskuojant prieing aus, testuojamojo ir maskuojamojo stimul danins
charakteristikos turi bti gantinai artimos. Labai svarbu nustatyti optimalmaskuojamojo signalo
galios lyg. Kartais taikomas pastovus 70 dBmaskuojamasis esys.
Klausos jautrumas nra pastovus, jis keiiasi. Klausos analizatorius optimaliai prisitaiko
prie esamo garsumo. i klausos savyb vadinama klausos adaptacija. Tyloje klausos jautrumas
didja, ausis prisitaiko igirsti pat tyliausi gars. Adaptacija apsaugo aus nuo stipri ir ilgalai-
ki gars poveikio. Jeigu aus stiprus garsas dirgina ilgesn laik, pasireikia klausos nuovargis.
Pavyzdiui, mogui ibuvus apie 1,5 val. 100 dB triukme, klausos jautrumas visikai gr
pradin lyg tik madaug po 1,5 paros. Tokiam triukmui veikiant nuolatos, klausos jautrumas
gali nebeatsinaujinti.
Audiometriniams matavimams vis plaiau naudojami kompiuteriai. Jais patogu kontroliuoti
testuojamj akustin stimul ir analizuoti paciento atsakymus. Klausos jautrumo ribos, nustatytos
prastu ir kompiuteriniu audiometrais, gerai koreliuoja.
84 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
LABORATORINIS DARBAS
Klausos jutos ribos matavimas kompiuteriu
Darbo uduot is
Nustatykite ausies girdimumoribos spektrin priklausomyb.
Darbo priemons ir prietaisai
Kompiuteris, garsiakalbiai ir ausins.
Darbo met odika
is darbas atliekamas kompiuteriunaudojantis MATLABprogrampaketuir VUMIFmagistranto
Donato iukio sukurta originalia programa (vadovas doc. A. Bastys). Panaiai (tik, aiku,
nuodugniau ir plaiau, tiksliau kalibruotais prietaisais) klausos tyrimai atliekami ir medicinos
diagnostikos staigose, kur naudojami iuolaikiki kompiuteriniai audiometrai.
Darbo eiga
1. jungus kompiuter, pels ymeklis nukelimas ties mygtuku <Start>ir spragtelima kairiuoju
pels klaviu. Atsiradusiame meniu ymekliu nukeliaujama iki odio <Programs> ir vl
spragtelima kairiuoju pels klaviu. Atsiranda dar vienas sraas (submeniu), kuriame suran-
dama eilut <Matlab> ir, nustaius pels ymekl ties ta programa, spragtelima kairiuoju
pels klaviu. Atsiradus dar vienamsraui, pels ymeklis nuvedamas iki <MATLAB 5.3>
ir dukart spragtelima kairiuoju pels klaviu. Ekrane pasirodo langas <MATLABCommand
Window>.
2. I klaviatros surenkamas odis klausa ir paspaudiamas klaviatros mygtukas <Enter>.
3. Kompiuterioekrane atsirandaKlausos tyrimosistemos langas, pavaizduotas 4.4.11 paveiksle.
4. Pels ymekliunukeliaujama iki mygtuko Klausos juta ir spragtelima pels kairiuoju klaviu.
Lango baltojoje pusje atsiranda dvi etalonins kreivs: alia (nuoroda geresn klaus) ir
raudona(nuoroda blogesnklaus). Langoapaiojepasirodouraas Klausos jutos tikrinimas.
5. Usidedamos ausins, prijungtos priekompiuterioar garsokolonls, sujungtos sukompiuteriu.
6. Pels ymeklis nuvedamas iki urao Tikrinti klausos jut ir spragtelima pels kairiuoju
klaviu. Ekrane atsiranda langas, kuriame yra trys mygtukai su uraais: Jau nebegirdiu,
Pagarsink, Baigti eksperiment.
7. Jei per ausines garsas negirdimas, tai spaudiamas mygtukas Pagarsink. Sklindantis i ausini
garsas po truput slopsta ir, kai jau skleidiamas tam tikro danio signalas nebegirdimas,
spaudiamas mygtukas Jau nebegirdiu. Tada baltajame lange atsiranda tamtikros spalvos
(pvz., mlynos) takas. Po to pasigirsta kito danio signalas.
8. Kartojami 7-o punkto veiksmai visoms skalje Danis, Hz pateiktoms vertms.
9. Po vieno ciklo darbas kartojamas dar kart, tik negirdimumo ribos takai automatikai ymimi
kita spalva. Matavimai atliekami maiausiai tris kartus.
MECHANIKA ____________________________________________________________________________ 85
10. Baigus darb, pels ymeklis nuvedamas iki urao Baigti eksperiment ir spragtelima
kairiuoju pels klaviu.
11. Gautus takus galima sujungti linija. Tai atliekama vienu i bd:
a) ties meniu urau <Tools>spragtelima kairiuoju pels klaviu;
b) klaviatros ymeklio judjimo klaviais |, + pasirenkama Show Toolbar ir pas-
paudiamas <Enter>klavias.
Taip ikvieiama braiymo ranki juosta. Fiksuojant tamtikr laiko tarp pels ymekl ties
atitinkamumygtuku, atsirandatomygtukopavadinimas. Paspaudus mygtukAddline, pels
ymeklis pasikeiia +. Norimoje lapo vietoje pele nubriama linija, jungianti du vienodos
spalvos takus. Taip sujungiami visi suaktyvintame lange matomi takai.
12. Galima urayti grafiko pavadinim. Tam i ranki juostos pasirenkamas mygtukas Add
text. Pels ymeklis pasikeiia |. Nuklus pels ymekl norimviet, spragtelima kairiuoju
klaviu ir uraomas grafiko pavadinimas.
13. Duomenys isaugomi dviem bdais. Pirmuoju isaugomas vaizdas, o antruoju isaugoma
duomenbaz.
4.4.11 pav. Klausos tyrimo sistemos lango vaizdas
86 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
14. Norint isaugoti tik vaizd, lange <Klausos tyrimo sistema> pels ymeklis nuvedamas iki
<File>, spragtelima kairiuoju pels klaviu, i komand srao pasirenkama <Save As>ir
vl spragtelimakairiuoju pels klaviu. Atsiradusiame lange ties eilute Filename uraomas
norimo dokumento pavadinimas. Dokumentui isaugoti spragtelima kairiuoju pels klaviu
ties odiu Save.
15. Norint isaugoti paius duomenis, suaktyvinamas langas <MATLABCommand Window>.
Pels ymeklis nuvedamas iki <File>, spragtelima kairiuoju pels klaviu, i srao
pasirenkama komanda <Save Workspace As> ir vl spragtelima kairiuoju klaviu.
Atsiradusiame lange ties eilute File name uraomas norimo dokumento pavadinimas.
Dokumentui isaugoti spragtelima kairiuoju pels klaviu ties odiu Save.
16. Baigus darb, pels ymeklis lange <Klausos jutos ribos matavimas> nukeliamas prie
deiniajame kampe esanio kryelio Close ir spragtelima kairiuoju pels klaviu. Taip pat
udaromas ir <MATLABCommand Window>langas.
MOLEKULIN FIZIKA ____________________________________________________________________ 87
5. MOLEKULIN FIZIKA
5.1. Skysi klampumas
Skysiai. J fizins savybs.
Skysi tekjimas siaurais vamzdiais.
Bernulio lygtis.
Puazeilio ir Hageno dsnis.
Dinamin ir kinematin klampos. J matavimo vienetai.
Klampomaiai (viskozimetrai).
5.1.1. vadas
Kiekviena gyvojo organizmo lstel yra nepaprastai sudtinga sistema, galinti normaliai veikti
tiktai pastoviomis slygomis. Lsteli aplink sudaro vadinamasis tarplstelinis, audini, skystis.
Palaikyti ioskysiofizini savybiir chemins sudties pastovum yrasvarbiausia slyga, leidianti
atskiroms lstelms ir visamorganizmui normaliai funkcionuoti. Tai nepaprastai sudtinga, kadangi
gyvieji organizmai nuolat taikosi prie kintanios aplinkos. K. Bernaras (C. Bernard) organizmo
skysius (tarplstelin skyst, smegen skyst, limf, krauj) pavadino vidine terpe.
Organizmovidins terps pagrind sudaro vanduo. Daug jo ir visame organizme. Be to, vairios
mediagos patenka organizm kaip vandeniniai tirpalai, ir organizmas nusikrato nuoding
apykaitos produkttaippat tirpal pavidalu. Apie 70 kg sverianio suaugusio mogaus organizme
apytikriai yra 42 kg (60 ) vandens. Jis pasiskirsts taip: lsteli vanduo 40 kno svorio ir
nelstelinis 20 ; pastarj sudaro kraujo plazmos vanduo (5 kno svorio) ir tarplstelinis
vanduo (15 kno svorio). Judriausia vidins terps dalis kraujas, transportuodamas maisto
mediagas, O
2
, CO
2
ir kitus mediag apykaitos produktus, atlieka daug funkcij: maitina, valo,
reguliuoja temperatr.
Organizmo skysiai ineioja po vis organizm hormonus, fermentus ir kitas veiklisias me-
diagas, kurios padeda nerv sistemai sujungti daugyb element vien, bendrai funkcionuojant
vienet organizm.
Taigi medikams ir biologams reikia iniapie skysi fizines savybes, prietaisus, kuriais galima
tas savybes tirti, skysi tekjimo dsnius. iamtikslui ir skirtas is knygos skyrius.
88 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
5.1.2. Skysiai ir j savybs
Knai, su kuriais susiduriame kasdieniame gyvenime, visada mums atrodo vientisi, t. y. visikai
upildyti juos sudarania mediaga. Taiau msjutimo organai, suvokiantys knus kaiptolydius,
sudaro klaiding spd apie j tikrsias savybes. Dabar gerai inoma, kad mediaga susideda i
atom ir molekuli. Diskreios, molekulins mediagos sandaros samprata atsirado jau gilioje
senovje. Mediagos savybi aikinimas remiantis jos molekulins sandaros samprata sudaro
molekulins kinetins mediagos teorijos esm. Nagrinjant atomir molekulisveik, pastebta,
kadesant palyginti dideliems atstumams juos veikia traukos, omaiems stmos jgos (5.1.1 pav.).
iame paveiksle pavaizduotos tipikos tarpmolekulini jg F(r) ir potencins molekuli sveikos
energijos E
p
(r) priklausomybs nuoatstumotarpmolekuli. Kai r = r
0
, potencins energijos kreiv
turi minimum E
pmin
, atitinkant pusiausvirosios padties energij. Atomai ir molekuls nuolat
juda ir todl turi kinetins energijos. Traukos jgos siekia suriti atomus ir molekules vien vi-
sum, o kinetin energija iai tendencijai prieinasi. Jeigu sumin atom ir molekuli kinetin
energija (jos modulis) daug didesn negujtraukos sumin potencin energija(reikia priminti, kad
potencin traukos energija neigiama), tai mediaga yra dujins bsenos; jeigu daug maesn,
kietosios. Skystoji bsena susidaro, kai ios energijos apylygs.
Dujos yra sankaupa molekuli, netvarkingai judani visomis kryptimis nepriklausomai viena
nuo kitos. Todl dujins bsenos mediaga neilaiko nei formos, nei trio. Jos tr ir form
lemia indas, kuriame ji yra. Nesant indo, dujos stengiasi upildyti vis erdv.
Kietajame kne molekuls ilgai ilaiko pastovi tarpusavio padt, ir tik nedideli svyravimai
vyksta apie apibrtas pusiausvirsias padtis. Kietojo kno molekuls arba atomai isidsto
apibrtose padtyse, sudarydami kristalin gardel. Kietosios bsenos mediaga ilaiko ir form,
ir tr. J deformuojant (keiiant form arba tr), atsiranda jgos, kurios stengiasi sugrinti
buvusi form ir tr (r. 5.6 skyrel).
Daug sudtingesn yra skysi sandara. Skystyje, kaip ir kietajame kne, molekuls stipriai
sveikauja ilaikydamos tarpusavio ryius. Taiau skysio molekuls juda kur kas laisviau negu
kietojo kno molekuls, nors ir ne taip laisvai kaip
dujmolekuls. Toks judjimas primenakietojokno
molekuls svyravimus apie pusiausvirj padt.
Taiauprotarpiais skysiomolekul itrksta i savo
aplinkos, nes tarpmolekulins sveikos jgos ilaiko
skysio molekul arti jos laikinosios pusiausvyros
apytiksliai 10
12
10
10
s, po to ji peroka nauj
laikinj pusiausvyr (madaug savo spindulio
atstumu), kur vl tam tikr laik tsia judjim,
pana svyravim. Atitinkamai skysiosandara yra
tarpin tarpkietojo kno ir duj sandaros. Skystoji
bsenaisiskiria tuo, kadmediagastengiasi ilaikyti
tr, bet neilaiko formos.
5.1.1 pav. Tarpmolekulini jg ir
potencins energijos priklausomyb
nuo atstumo tarp molekuli
r0
r
F(r)
E
p
(r)
F, E
p
E
pmin.
E
p
(r)
F, E
p
E
pmin
MOLEKULIN FIZIKA ____________________________________________________________________ 89
5.1.3 pav. Areometras
5.1.2 pav. Indas su skysiu
Skal gali bti sugra-
duota tankio arba
savitojo svorio vienetais
Tuias
vamzdelis
Svarmuo,
laikantis
areometr
vertikaliai
Kiekviena skysio molekul i vis pusi yra apsupta kaimyni,
nutolusi nuo jos vidutiniu nuotoliu, artimu r
0
. iluminis molekuli
judjimas daugiausia vyksta potencialo duobs viduje (5.1.1 pav.).
Skysio molekul per 1 s gali pakeisti savo padt apie 10
8
kart,
atlikdama tarp dviej uoli 10
3
10
5
virpesi. Laiko tarpas tarp
dviej molekuls uoli vadinamas gyvavimo trukme. i trukm
priklauso nuo skysio ries ir temperatros.
Mechaniniu poiriu skysiai skiriasi nuo kietj kn
pirmiausia tuo, kad jie neturi rimties trinties net maiausia jga
sukelia skysi daleli judjim. Toks teiginys tinka idealiesiems
skysiams. Realiuosiuose skysiuose (tokie ir yra gyvuosiuose
organizmuose) pastebimavidin trintis (klampumas), t. y. tamtikras
pasiprieinimas (r. 5.1.5 skyrel). Skysio forma priklauso nuo indo
formos. Realieji skysiai pasiymi spdumu, t. y. skysius slegiant,
j tris truput maja. Visi reikiniai, susij su klampumu ir
spdumu, apsunkina skysi judjimo nagrinjim. Teorikai
patogiau nagrinti neklampi ir nespdi skysi judjim. Tokie
skysiai vadinami idealiaisiais. Jiems galioja tokie dsniai:
1. Paskalio dsnis: nejudaniame skystyje iorinis slgis perduo-
damas visas puses vienodai. Slgis, veikiantis nejudaniame skys-
tyje, vadinamas hidrostatiniu slgiu. Visi realieji skysiai turi svor, todl hidrostatin slg skystyje
sudaro ne tik iorinis slgis, bet ir slgis, kur sukelia paties skysio svoris. Pavyzdiui, inde, kurio
pagrindoplotas yra S, piltaskysio(5.1.2 pav.). Indodugn slegiaskysio, kurioauktis hir tankis ,
svoris P = mg = Vg; ia g laisvojo kritimo pagreitis. Kadangi tris V = Sh, tai P = Shg, o skysio
stulpelio sudaromas hidrostatinis slgis
p = P/S = gh. (5.1.1)
Kuo daugiau daleli yra vir kurio nors tako, tuo didesnis j svoris, taigi ir skysio slgis.
2. Susisiekianij ind dsnis: slgis tame paiame gylyje nepriklauso nuo indo formos, todl
susisiekianiuose induose skysio pavirius yra viename lygyje.
3. Archimedo dsnis: panardint skyst kn veikia auktynnukreipta istumianioji jga, kuri
yra lygi kno istumto skysio svoriui. Jei kno tankis maesnis u skysio tank, tai knas, mestas
skyst, nepasineria, o nugrimzta tik tiek, kad istumtojo skysio svoris susilygint su to kno
svoriu. Esant iai pusiausvyrai, knas plduriuoja. metus t pat kn maesniotankio skyst, jis
nugrimzta, nes savo svoriui atsverti turt istumti didesn skysio tr. iuo principu veikia
areometras tankiamatis (5.1.3 pav.). Tai prietaisas skysio, kuriame jis plduriuoja, tankiui pagal
panirimo gyl matuoti. Jei skystis labai tankus, areometras plduriuoja arti paviriaus, nes reikia
istumti nedidel tr skysio, kurio svoris prilygsta areometro svoriui.
90 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
5.1.3. Srovs tolydumo lygtis
Ankstesniame skyrelyje buvo apraomi nejudantiems skysiams galiojantys dsniai. Toliau yra
raoma apie skysio judjim, kuris vadinamas tekjimu. Sakoma, kad skystis teka stacionariai, jei
laikui bgant skysiodaleli judjimo greitis ir kryptis bet kurioje srovs dalyje nekinta. ia skysio
dalele vadinamas labai maas jo trio elementas, kuriame vis dlto yra nemaai molekuli.
Skysio tekjimas vaizduojamas srovs linijomis. Srovs linija
tai tokia linija, kurios kryptis bet kurioje vietoje atitinka skysio
daleli judjimo krypt. I srovs linij galima sprsti ne tik apie
daleli judjimo krypt, bet ir apie greiio didum kur srovs
linijos tankesns, ten ir greitis didesnis. Stacionaraus tekjimo
srovs linij forma nekinta kuri nors skysio dalel vis laik
juda ta paia srovs linija. Tamtikra skysio dalis, apribota i vis
pusi srovs linijomis, vadinama srovs vamzdiu(5.1.4 pav.). Kai
tekjimas stacionarus, n viena skysio dalel neieina i srovs ir
j neeina. Pavyzdiui, tamtikrose srovs dalyse skerspjvio plotai
yra S
1
ir S
2
, o idealaus skysio tekjimo greiiai per iuos
skerspjvius v
1
ir v
2
. Per 1 s pro pjv S
1
prateks skysio, kurio
tris yra V
1
, o pro S
2
V
2
. ie triai turi bti lygs: V
1
= V
2
(v
1
S
1
= v
2
S
2
). Vadinasi, idealiojo
skysiotekjimogreiioir srovs vamzdioskerspjvioplotosandauga tampaiamsrovs vamzdiui
yra pastovus dydis:
vS = const. (5.1.2)
Tai yra stacionaraus skysio tekjimo srovs tolydumo lygtis. I jos matyti, kad ten, kur srovs
vamzdio skerspjvis maesnis, srovs greitis didesnis, ir atvirkiai. Taiau pro skerspjv per
laiko vienet visada prateka toks pat idealaus skysio tris.
5.1.4. Bernulio lygtis
Pasvirajame srovs vamzdyje (5.1.5 pav.) skysiotris dalyje
ABDC ribojamas tekjimo greiiui statmenais plotais S
1
ir
S
2
. Per trumplaikotarp At is skysiotris srovs vamzdyje
truput pasislinks ir uims padt A
1
B
1
D
1
C
1
. Kadangi skystis
nespdus ir tolydus, tai triai V
1
ir V
2
yra lygs V
1
= V
2
= V.
Skysio mas uimamuose triuose turi kinetins
energijos E
k
= mv
2
/ 2, potencins energijos E
p
= mgh ir
vidins potencins energijos E = pV. ia m skysio mas,
uimanti tr V, v skysio greitis, h skysio stulpelio
auktis, p skysio slgis. Esant tamtikramiors slgiui p
A
,
skystis visada turi vidins potencins energijos. Vidins
potencins energijos didumas matuojamas darbu, kur turi
5.1.4 pav. Srovs vamzdis
S
1
S2
v
1
v
2
5.1.5 pav. Skysi tekjimas
pasviruoju vamzdiu
S
1
S
2
v
1
v
2
1
MOLEKULIN FIZIKA ____________________________________________________________________ 91
atlikti skystis, istumdamas skysio tr beor erdv, ar atvirkiai darbu, kur reikia atlikti,
norint stumti skysio tr Vi beors erdvs tamtikro slgio p
A
skysio aplink.
Visa energija, kuri turi skerspjvyje S
1
iskirta skysio mas m, yra mv V p mgh
1 1
2
1
2 / + + .
Pasislinkus iai skysio masei skerspjv S
2
, visa energija yra mv V p mgh
2 2
2
2
2 / + + . Tekant
idealiajamskysiui i skerspjvioS
1
S
2
, energijos nuostolinra, todl, remiantis energijos tverms
dsniu, iskirtosios mass energija abiejuose skerspjviuose turi bti ta pati:
V p mgh
m
1 1
2
1
2
+ +
v
= V p mgh
m
2 2
2
2
2
+ +
v
.
(5.1.3)
Vadinasi, pilnutin idealiojoskysio mass energija bet kuriame srovs vamzdio skerspjvyje,
kai tekjimas stacionarus, yra pastovus dydis. Padalijus visus narius i trio V ir inant, kad
= V m/ , gaunama
p gh + +

2
2
v
=const;
(5.1.4)
ia dydis p vadinamas statiniu slgiu, dydis gh hidrostatiniu slgiu, o v
2
/ 2 dinaminiu slgiu.
idealiojo skysio tekjimo greiio ir slgio ry teorikai 1738 metais nustat D. Bernulis
(D. Bernoulli), todl (5.1.4) lygtis vadinama Bernulio lygtimi. odiais j galima nusakyti taip:
dinaminio, hidrostatinio ir statinio slgi srovs vamzdyje suma yra pastovus dydis. Jei srovs
vamzdis yra horizontalus (h
1
= h
2
), tai
V p
m
1
2
1
2
+
v
= V p
m
2
2
2
2
+
v
ir Bernulio lygtis uraoma
p +
2
2
v
=const.
(5.1.5)
Dinaminio ir statinio slgi suma vadinama pilnutiniu slgiu. Statinis slgis yra slgis kno,
apie kur teka skystis, paviri. Pavyzdiui, tekant skysiui vamzdiu, statinis slgis yra skysio
slgis sienel. Vamzdio susiaurjimuose padidja skysio greitis, kartu dinaminis ir pilnutinis
slgiai, o statinis sumaja. Vis nari (5.1.4) ir (5.1.5) lygtyse matavimo vienetas yra slgio
vienetas paskalis (1 Pa = 1 N/m
2
).
Bernulio lygtis yra pagrindin hidrodinamikos lygtis. Ji galioja ne tik idealiesiems, bet ir ne-
didels klampos skysiams.
92 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
5.1.5. Skysi klampumas
Dl molekuli sveikos visi realieji skysiai pasiymi vidine
trintimi, arba klampumu. Galima daryti prielaid, kadskystis
sudarytas i atskir skysio sluoksni. Vidins trinties jgos,
veikianios sluoksni paviri liestins kryptimi, atsiranda
tarpskysiosluoksni, judaninevienodais greiiais: greiiau
judantis sluoksnis veikia liau judant greitinanija jga, o
liau judantis veikia greitesnj stabdanija jga. Taip
judanius sluoksnius galimastebti tekant skysiui drkinamu
vamzdiu (5.1.6 pav.). Panaiai vairiais kraujo indais teka
kraujas kraujagyslmis gyvuosiuose organizmuose. Didiau-
si greit gyja dalels, judanios vamzdio aimi, o artjant
joms prie vamzdio sieneli greitis maja, nes atsiranda
skysio iorini sluoksni ir vamzdio sieneli trinties jga. Ariausiai vamzdio krato esantis
sluoksnis nejuda. I. Niutonas (I. Newton) nustat, kad vidins trinties jga tarp dviej skysio
sluoksni yra tiesiog proporcinga t sluoksni vidutini greii skirtumui Av = v
2
v
1
, sluoksni
lietimosi plotui S ir atvirkiai proporcinga atstumui Al tarp tak, kuriuose matuojami vidutiniai
sluoksni greiiai:
;

S
l
F
v
q =
(5.1.6)
ia q dinamin klampa, kuri priklauso nuo skysio prigimties, l A A / v greiio gradientas,
apibdinantis greiio kitimo spart, pereinant i vieno sluoksnio kit statmena sluoksniams
kryptimi. Dinamin klampa skaitine verte lygi vidins trinties jgai, veikianiai tarp skysio
sluoksni, kuri lietimosi plotas lygus 1 m
2
, kai greiiogradientas lygus 1 s
1
. Dinamins klampos
matavimo vienetas SI sistemoje yra Pas (paskalsekund).
Vidins skysi trinties reikinio esm ta, kad skysio molekuls, veikiamos iorins jgos,
atlieka uolius (r. 5.1.2 skyrel) tos jgos kryptimi. Kuo daniau skysio molekul peroka i
vienos laikinosios pusiausvyros vietos kit, tuomaesn skysioklampair didesnis skysiotakumas,
dydis, atvirkias klampai (1/q). Vidins trinties kilm molekulin kinetin teorija aikina taip:
molekuls, pereidamos i greitesniojo sluoksnio ltesnj, pernea didesn judesio kiek negu
atvirkiakryptimi, ojudesiokiekiokitimas sukelia jg, ltinani greitesnj ir greitinani ltesnj
skysio ar duj sluoksn, taigi vidin trint.
Danai greta dinamins klampos inynuose nurodoma ir kinematin klampa, kuri lygi dinamins
klampos ir skysio tankio santykiui:
;

q
v =
(5.1.7)
ia mediagos tamtikroje temperatroje tankis. Kinematin klampa matuojama m
2
s
1
.
5.1.6 pav. Skysio tekjimas
drkinamu vamzdiu
l
l
0
v
MOLEKULIN FIZIKA ____________________________________________________________________ 93
Kinematin klampa daugiau nei dinamin atsivelgia vidin trint, skysiojudjimoypatumus.
Pavyzdiui, vandens klampa~ 100kartdidesnnei oro(kai t = 0
o
C), bet vandens kinematinklampa
10 kartmaesnnei oroir todl klampa turi didesns takos orojudjimui nei vandens. Plaiauapie
duj klamp ir jos aikinim molekulins teorijos atvilgiuparayta 5.2 skyriuje.
vairi skysi klampa. Daugelyje veiklos srii labai svarbu inoti vairi skysi klamp.
Pried 12 lentelje pateiktos kai kuri skysi dinamins klampos. Pavyzdiui, medicinoje i
kraujo klampos kitimo greiio krejimo metu sprendiama apie galimus organizmo susirgimus,
nes, sergant vairiomis ligomis, kraujo klampa bna skirtinga. Dl patologini pakitim kraujo
dinamin klampa gali keistis nuo 1,7 10
3
Pas iki 22,9 10
3
Pas. Veninio kraujo klampa yra
truput didesn nei arterinio. Kai kurie infekciniai susirgimai didina kraujo klamp, o kiti,
pavyzdiui, tuberkulioz maina. Sunkus fizinis darbas taip pat didina kraujo klamp, nes
dirbant i kraujo su prakaitu daugiau pasialina vandens, negu jo pereina i tarplstelinio skysio.
Organizmo kraujo klampapriklauso nuokraujagysli bkls bei kraujotakos greiio. Pasirodo,
kad, majant kapiliar spindiui, didja tik homogenini skysi klampa. Kraujas yra
heterogeninis skystis, todl, kapiliar skersmeniui pasidarius maesniam nei 150 m ir toliau
tebemajant, jo klampa sumaja.
Skysi klampos priklausomyb nuo temperatros. Didjant temperatrai, skysiklampa maja.
i priklausomyb nusako Frenkelio formul
e
kT
A
c
q =
;
ia A konstanta, k Bolcmano konstanta, T skysio absoliuioji temperatra, c skysio
molekuli aktyvacijos energija, t. y. minimali energija, reikalinga molekulei nugalti potencialo
barjer (5.1.1 pav.) ir perokti nauj pusiausvirj padt.
J. I. Frenkelis (. . ) labai vaizdiai nusak ilumos judjim skysiuose. Jis aikino,
kadskysiomolekuls savo ilgus pastovaus gyvenimoperiodus nuolat keiia trumpalaikiais uoliais
tarp i padi. ie periodai labai skirtingi ir nuolat netvarkingai keiiasi, bet vidutin virpesi
trukm apie pusiausvirj padt kiekvienam skysiui yra apibrtas dydis ir jis stipriai maja
temperatrai didjant. Todl padidja molekuli judrumas ir sumaja skysio klampa.
5.1.6. Laminarusis ir turbulentinis klampij skysi tekjimas vamzdiais.
Puazeilio ir Hageno lygtis
Organizm paviriuje per plon oro sluoksn, kontaktuojant su paviriumi ir vadinam pasienio
sluoksniu, dl molekulins difuzijos vyksta ilumos ir mass perneimas. Pasieniosluoksnio savybs
priklauso nuo oro klampumo savybi ir nuo judesio kiekio, susijusio su klampumo jgomis, per-
neimo.
Pasienio sluoksnis atsiranda ant lygaus plokiopaviriaus, panardinto judant sraut (dujas ar
skyst). Kada srauto linijos yra lygiagreios su paviriumi, tekjimas vadinamas laminariuoju ir
94 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
jame vyksta atskir molekuli judesio kieki keitimasis. Laminariosios srovs atskiri sluoksniai
tartumslenka vienas kito atvilgiu. Didjant srovs greiiui, atskiros skysio dalels ne tik slenka,
bet ir pradeda suktis skystyje susidaro skuriai. Toks tekjimas vadinamas turbulentiniu. Skysi
tekjimas vamzdiais gali bti ir laminarusis (sluoksninis), ir turbulentinis. Turbulentiniam
tekjimui yra bdingas slgio atskirose skysiodalyse kitimas, paprastai lydimas garsini reikini
(triukmo, iurlenimo, nyptimo ir kt.), todl turbulentin tekjim lengva aptikti.
uolis nuo laminariojo prie turbulentinio tekjimovyksta priklausomai nuo klampumoir iner-
cini jg santykio, kuris apibdinamas Reinoldso skaiiumi. Angl fizikas O. Reinoldsas
(O. Reynolds) 1883 metais eksperimentikai nustat, kad skysi tekjimo vamzdiais pobdis
priklauso nuo skysio savybi (tankio, klampos), jo tekjimo greiio ir vamzdio skersmens, t. y.
tam tikro bemaio dydio skaitins verts. is dydis pavadintas Reinoldso skaiiumi (Re):
;
kr kr
v q
D D
Re
v v
= = (5.1.8)
ia skysio tankis, v kinematin klampa, v
kr
krizinis laminariojo tekjimo perjimo
turbulentin greitis, D vamzdio skersmuo, q dinamin klampa. Krizin Re vert tiesiame lygi
sieneli vamzdyje vis skysi yra tokia pati ~ 2300. Kai Re < 2300, tekjimas yra laminarusis, kai
Re > 2300, tekjimas vadinamas turbulentiniu.
Tiek laminariojo, tiek turbulentinio tekjimo atveju pasienio sluoksnyje tekjimo greitis kinta
nuo 0 paviriuje iki laisvo srauto greiio Vpasienio sluoksnio viruje. Apskritai pasienio sluoksnio
storis yrasantykinis. Danai naudojamas storis, kuriamegreitis lygus 0,99 V, bet, nagrinjant judesio
kiekio perna, patogiau naudotis vidutiniu pasienio sluoksnio storiu.
Tekant realiesiems skysiams horizontaliu vamzdiu, skysio daleli potencin energija
eikvojama vidins trinties jgoms nugalti ir todl iilgai vamzdio aies krinta statinis slgis.
. Puazeilis (J. Poisseuille) 1840 metais eksperimentais nustat, kad laminarusis skysio tekjimo
neplaiu horizontaliu apvaliu vamzdiu vidutinis greitis v
vid
tiesiog proporcingas slgi jime p
1
ir
ijime p
2
skirtumui, vamzdio spindulio Rkvadratui ir atvirkiai proporcingas skysio klampai q
ir vamzdio ilgiui l:
v
vid
l
p p R
2 1
2
8

=
q
.
(5.1.9)
Tai Puazeilio dsnis. inant v
vid.
, galima rasti skysio, pratekanio skerspjvio S vamzdiu per
laiko vienet, tr
Q= v
vid
S.
Kadangi S = tR
2
, tai
q 8
4
2 1
R
l
p p
Q
t
= .
(5.1.10)
i formul vadinama Hageno ir Puazeilio lygtimi.
MOLEKULIN FIZIKA ____________________________________________________________________ 95
5.1.7 pav. Slgi pasiskirstymas
didiajame kraujo apytakos rate:
1 didiosiose arterijose, 2 maosiose arterijose, 3
arteriolse, 4 kapiliaruose, 5 venulse, 6 venose
[pagal 38]
1 2 3 4 5
6
0
4
8
16
12
kPa
16
12
8
4
0
1 2 3 4 5 6
Skysi tekjimas vamzdiais yra
svarbus medicinoje, nes kraujotakos
sistema sudaryta i vairaus skersmens
apvali ind. Kraujo tekjimas sveika-
me organizme yra laminarusis, nedi-
delis turbulentinis tekjimas atsiranda
ariau irdies votuv, taip pat kiek-
vienoje didesniospindiokraujagyslje
ar bronche, t. y. ten, kur susidaro
neplatus susiaurjimoiedas. Taiau
esant kai kuriems susirgimams, kai
kraujo klampa bna maesn nei nor-
mali, Reinoldso skaiius gali viryti
krizin reikm ir judjimas gali tapti
turbulentiniu. Tuomet kaklo srities ar-
terijose girdimi esiai.
Kraujo tekjimo aorta, kurios vidinis skersmuo lygus apie 2 cm, greitis yra ne didesnis kaip 30
40 cm/s. Didels arterijos isiakoja maesnio skersmens arterijas, ios dar maesnes arterioles
ir galiausiai kapiliarus. Galima tai sivaizduoti kaip lygiagreiai sujungt vamzdi sistem, ku-
rios bendras skerspjvio plotas didja atsirandant kraujo ind isiakojimui. Suminis kapiliar
skerspjvioplotas yra600800kartdidesnis u didijarterijskerspjvioplot, todl kapiliaruose
kraujo tekjimo greitis yra tik apie 0,050,08 cm/s. Kapiliarai jungiasi venules, o ios venas, dl
io jungimosi skerspjvio plotas maja, o tekjimo greitis didja. Pavyzdiui, didiojoje venoje,
kuri jungiasi priedeiniojoprieirdio, kraujas teka614 cm/s greiiu. Susitraukimometukairiajame
skilvelyje slgis padidja ir bna apie 1316 kPa didesnis u atmosferos slg. Papildomo slgio
vir atmosferos pasiskirstymas didiajame kraujo apytakos rate pateiktas 5.1.7 paveiksle. Matyti,
kadarteriolse ir kapiliaruose slgis labiau maja didjant triniai. I pirmovilgsnio gali atrodyti
keista, kad trinties pasiprieinimas yra didelis arteriolse ir kapiliaruose, kuri visas skerspjvio
plotas yra didelis. iamfaktui paaikinti pasinaudojama modeliu i n lygiagreiai sujungt vienodo
spindio r vamzdeli. I (5.1.10) formuls iplaukia, kad vieno vamzdelio pasiprieinimas yra
atvirkiai proporcingas r
4
, o i lygiagretaus vamzdeli jungimo dsnio iplaukia, kad bendras n
vamzdeli pasiprieinimas yra atvirkiai proporcingas nr
4
. Suminis j skerspjvio plotas S yra
proporcingas nr
2
, todl suminis sistemos pasiprieinimas yra atvirkiai proporcingas Sr
2
. Be to,
dinamin klampa kapiliaruose yra maesn. Taigi gana akivaizdu, kad netgi esant dideliam S
sandauga Sr
2
yra maa, jei r pakankamai maas, ir bendras pasiprieinimas yra didelis. Taip yra
arterioli ir kapiliar atveju.
kPa
16
12
8
4
0
96 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
5.1.7. Knjudjimas skystyje
Klampumas pasireikia ne tik skysiams judant vairiais indais, bet ir knui judant skystyje. Kai
knas juda klampiame skystyje, esant dideliems kn greiiams, atsiranda didels pasiprieinimo
jgos. Apie kn esanios klampios terps laminariajame sraute susidaro skuriai bei skurins
srovs. iuo atveju slgis judanio kno priekin paviri pasidaro didesnis negu upakalin ir
atsiranda papildoma jga, kuri prieinasi kno judjimui. Pasiprieinimo jgos didumas ir kilm
priklausonuoknoformos ir judjimogreiio. Klampiojeterpjejudanioknopavirius apsitraukia
plonyiutos mediagos sluoksniu, kuris juda kartusuiuoknu. Kitus aplinkinius skysiosluoksnius
galima laikyti nejudaniais. Taigi tarp prilipusio sluoksnio ir arti kno esani kit sluoksni
susidaro greiiogradientas, kartu ir didels vidins trinties, arba klampumo, jgos (5.1.6. formul).
Maiems knjudjimogreiiams D. Stoksas (J. Stokes) nustat, kadklampumojgayra tiesiog
proporcinga skysio dinaminei klampai, kno judjimo greiiui ir jo matmenims. Rutulikiesiems
knams i jga
F = 6tqrv; (5.1.11)
ia q dinamin klampa, v rutuliuko greitis, r rutuliuko spindulys.
Krintant klampioje terpje rutuliuk veikia trys jgos (5.1.8 pav.):
a) sunkio jga F
s
= mg = 4/3tr
3
g; ia rutuliuko mediagos tankis;
b) Archimedo jga F
A
= m
s
g = 4/3t
s
r
3
g; ia m
s
istumto skysio mas,
s
skysio tankis;
c) pasiprieinimo (klampumo) jga, apskaiiuojama pagal (5.1.11) formul.
metus kn skyst, jogreitis maja tol, kol judjimogreitis tampa
pastovus (tolygusis judjimas). Tada
mg + F
A
+ F
kl
= 0,
arba, raius i jg (moduli) iraikas, atsivelgus jg kryptis:
4/3tr
3
g 4/3 tr
3

s
g 6tqrv
0
= 0; (5.1.12)
ia v
0
tolygiai krintanio rutuliuko greitis. I ios formuls galima
ireikti
) (
9
2
s
2
0

q
=
g r
v .
(5.1.13)
I ia matyti, kadmaesnis tos paios mediagos rutuliukas grimzta
liau negu didesnysis. Dl ios prieasties mayiai vandens laeliai ir
kietosios dalels tiesiog plduriuoja ore ir krinta labai pamau.
5.1.8 pav. Jgos,
veikianios krintant
klampiame skystyje rutull
F
A
F
KL
F
s
r
R
MOLEKULIN FIZIKA ____________________________________________________________________ 97
5.1.8. Viskozimetrija
Metod visuma skysi klampai nustatyti vadinama viskozimetrija. Prietaisai, kuriais nustatoma
klampa, vadinami viskozimetrais, arba klampomaiais. J yra kelios grups.
Rotaciniuose viskozimetruose skystis teka tarp dviej kn, pavyzdiui, cilindr. Vienas i
cilindr sukasi (rotorius), o kitas yra pritvirtintas. Klampa randama matuojant rotoriaus kampin
greit, jei inomas sukimo momentas, arba matuojant jgos moment, veikiant nejudant cilindr,
kai yra inomas rotoriaus sukimosi greitis. Taiau jg moment priklausomyb nuo klampos
ireikiama sudtingais matematiniais sryiais, todl daniausiai tokie viskozimetrai graduojami
pagal inomos klampos skyst ir taipmatuojama santykin klampa. Rotaciniuviskozimetru galima
matuoti skysi dinamin klamp 110
5
Pas intervale.
Toki klamp turi tepalai, ilydyti silikatai, metalai, lakai,
klijai ir kt.
Kitai viskozimetr grupei priklauso tie, kurie skirti
matuoti absoliuij skysio klamp. Jiems priklauso
Stokso viskozimetras (5.1.9 pav.) ir vairs rotametrai.
Stokso viskozimetruose rutuliukas (spindulio r) krinta
vertikaliai emyn cilindru (kurio spindulys yra R).
Nusistovjus kritimo greiiui v, j galima apskaiiuoti
inant laik, per kur rutuliukas nukrenta atstum Htarp
dviej cilindro ymi. Tada klampa qyra r, Rir vfunkcija.
io tipo viskozimetrai leidia matuoti klamp nuo 0,1 iki
10
5
Pas. Rotametruose klampiame skystyje esant
rutuliuk veikia oro srautas, kuris veria j judti ver-
tikaliai auktyn. Tada klampa matuojama analogikai kaip
Stokso viskozimetruose.
Maai (nuo 10
2
iki 10
3
Pas) duj ir skysi klampai
matuoti naudojami kapiliariniai viskozimetrai (5.1.10 pav.).
Vir kapiliaro Kvirutins dalies yra rezervuaras A, kurio
tris V yra inomas. Sunkio jgos veikiamas, skystis teka
kapiliaru. Imatavus laik, per kur skystis iteka i rezer-
vuaro, pagal (5.1.10) Hageno ir Puazeilio formul galima
nustatyti skysio tr, pratekant vamzdio skerspjviu S
per laiko vienet.
ia formule galima naudotis, kai yra tenkinamos
tokios slygos: pirma, skysio tankis viskozimetre turi
bti vienodas; antra, skysio tekjimas kapiliaru turi bti
laminarusis, t. y. Reinoldso skaiius Re neturi viryti
2300.
5.1.9 pav. Stokso viskozimetro
schema
5.1.10 pav. Kapiliarinio
viskozimetro schema
2r
2R
L
H
2R
L
2r
H
A
K
d
h
98 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Remiantis (5.1.9) formule, laminariojo skysio tekjimo kapiliaru greitis

vid
x
p
= v
q 8
2
R
;
ia Ap / Ax slgio gradientas, parodantis slgi skirtum dviejuose kapiliaro skerspjviuose, kai
atstumas tarp j lygus vienetui. Itekjusio i kapiliaro per tamtikr laik skysio tris
V = Sv
vid
t = tR
2
v
vid
t; (5.1.14)
ia S = tR
2
kapiliaro skerspjvio plotas. i lygyb staius v
vid
iraik, gaunama
x
p
V
8
=
A
A

t
q
t R
4
, arba .
8
4
x
pt
V
R
A
A t
= q
(5.1.15)
Skysio tekjim vertikaliu kapiliaru slygoja tik paties skysio, kurio auktis h, slgis. Taigi
Ap = hg. (5.1.16)
staius i iraik (5.1.15) formul,
gt. h
x V
R
= q
A
t
8
4
(5.1.17)
Tada kinematin klampa
gt. h
x V
R
= =
A
t
8
4

q
v
(5.1.18)
Itekant kapiliaru per laiko vienet vienodamskirting skysi triui,
x V
R
A
t
8
4
c hg = ;
ia c pastovus dydis viskozimetro konstanta, priklausanti tik nuo kapiliaro matmen ir laisvojo
kritimo pagreiio g. Taigi
v = ct. (5.1.19)
inant c, tamtikramtriui, nurodytamviskozimetroinstrukcijoje, ir imatavus skysio tekjimo
trukm, galima apskaiiuoti to skysio kinematin klamp v.
Prie tokio tipo viskozimetr priskiriamas ir medicinos staigose naudojamas Heso viskozi-
metras, kuriuo nustatoma kraujo klampa. J sudaro du vienodi tarpusavyje vamzdeliu sujungti
kapiliarai. Vieno kapiliaro galas panardinamas vanden, kito krauj. Kadangi skysi klampa
yra nevienoda, tai kapiliaruose upildomi triai yra skirtingi. Pasinaudojus Hageno ir Puazeilio
formule, galima urayti santykin vandens ir kraujo tri bei klamp priklausomyb:
Q
v
: Q
k
= q
k
: q
v
; ia Q
v
, Q
k
atitinkamai vandens ir kraujo kapiliaruose triai, q
v
, q
k
vandens ir
MOLEKULIN FIZIKA ____________________________________________________________________ 99
kraujoklampos. Tokiubdugalimanustatyti santykinkraujoklamp vandens atvilgiu. Pavyzdiui,
kraujo santykin klampa (vandens atvilgiu) lygi 56, o kraujo plazmos 1,52.
LABORATORINIS DARBAS
Skysi klampos tyrimas
Darbo uduotis
Nustatykite:
skysio kinematins klampos priklausomyb nuo temperatros;
skysio dinamin klamp Stokso bdu.
Dar bo pr i emons i r pr i e t ai s ai
renginys kinematinei klampai nustatyti ir jos priklausomybei nuotemperatros tirti, sekundmatis,
stiklin kolba, gumin arnel, spaustukas, cilindras, slankmatis, mikrometras, vairs rutuliukai.
Darbo met odi ka
1. Skysio kinematins klampos priklausomybs
nuo temperatros tyrimas
Skysio kinematins klampos priklausomyb nuo temperat-
ros tiriama 5.1.11 paveiksle pavaizduotu renginiu. J sudaro
U formos vamzdelis, kairiojoje akoje kapiliaras (1), o dei-
niojojeakojerezervuaras (5) tiriamamskysiui, ildytuvas (),
maiykl (M), termometras (T) (visos ios dalys yra stiklinia-
me inde, upildytame vandeniu), gumin kriau (K). Meta-
liniu spaustuku uspaudus atakls (2) gal, gumins kriau-
s (K) paspaudimais tiriamasis skystis kairiojoje akoje pa-
keliamas iki puss viskozimetro praplatjimo (3). Numus
metalin spaustuk nuoatakls (2), kapiliarupradeda tekti
tiriamasis skystis. inant skysio tekjimo tarp ym M
1
ir
M
2
vamzdelio susiaurjimuose trukm t, pagal (5.1.19)
formul galima apskaiiuoti skysio kinematin klamp.
Viskozimetro konstanta c yra urayta jo techniniame
pase.
Darbo eiga
1. Stiklinis indas iki yms Aupildomas vandeniu.
2. Pasiymima tiriamojo skysio (alyvos) temperatra. iuo atveju ji sutampa su stikliniame inde
esaniovandens temperatra.
5.1.11 pav. Prietaisas kinematins
klampos priklausomybei nuo
temperatros tirti

100 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams


3. Metaliniu spaustuku uspaudiama gumin arnel (B) ir gumins kriaus paspaudimais
tiriamasis skystis pakeliamas i rezervuaro (5) iki puss kapiliaro praplatjimo (3).
4. Atleidus spaustuk, sekundmaiu imatuojama skysio tekjimo tarpym M
1
ir M
2
trukm t.
5. jungiamas ildytuvas ir palaukiama, kol temperatra pakils 5
o
C. Poto kartojami 3 ir 4 punktai.
6. Toliau 35 punktai kartojami, keiiant temperatr 1560
o
Cintervale.
7. raius matavimo rezultatus (5.1.19) formul, visoms temperatroms apskaiiuojama tiria-
mojo skysio kinematin klampa v.
8. Duomenys suraomi lentel:
T,
o
C t, s v, m
2
/s
9. Nubraiomas priklausomybs v = v (T) grafikas.
2. Skysio dinamins klampos nustatymas Stokso bdu
Skysio klampa iame darbe nustatoma Stokso bdu, kuris apraytas 5.1.7 skyrelyje. Dinamin
klampa ireikiama i (5.1.13) formuls:
.
9
2
0
2
v
s
gr

q

= (5.1.20)
Taiau ji tinka tik tada, kai rutullis krinta neribotoje aplinkoje. Jei rutullis krinta iilgai aies
udaro vamzdio ar cilindro (5.1.8 pav.), kurio spindulys yra R, tai rutullio tolygaus kritimo
greitis
( )
,
/ 4 , 2 1 9
2
2
0
R r
gr
s
+

=
q

v (5.1.21)
o dinamin klampa
( )
.
/ 4 , 2 1 9
2
0
2
R r
gr
s
+

=
v

q (5.1.22)
Darbo eiga
1. Svarstyklmis nustatoma 10 ml talpos matavimo cilindro mas m
0
. Po to j pilamas tiriamasis
skystis ir nustatoma cilindrosuskysiumas m
1
. Tada randamaskysiomas m
s
(m
s
= m
1
m
0
)
ir skysio tankis
s
.
2. Mikrometru imatuojamas rutullio skersmuo d (r =d/ 2) ir svarstyklmis nustatoma jo ma-
s m
r
. Apskaiiuojamas rutullio tris, opo to tankis (= m/V). Matavimai atliekami bent su
trimis rutulliais.
MOLEKULIN FIZIKA ____________________________________________________________________ 101
5.2. Duj klampumas
Molekulins kinetins teorijos svokos.
Dujdsniai.
Tobulj dujbsenos lygtis.
Klampos reikiniai skysiuose ir dujose (r. 5.1 skyri).
Klampos priklausomyb nuo temperatros (r. 5.1 skyri).
Molekuli vidutinis laisvasis lkis ir jo priklausomyb nuo slgio ir temperatros.
5.2.1. Molekulins kinetins teorijos svokos
Molekulin fizikatiria tokias mediagos savybes, kurias slygoja jmolekulin sudtis. Daniausiai
pasitaikaniomis slygomis, t. y. kai slgis nra labai didelis, o temperatra nra labai maa, btent
molekuls yra tos sandaros dalels, kurios lemia mediagos bsen. Taigi molekulin fizika tiria
savybes kn, kurie sudaryti i labai didelio skaiiaus labai smulki daleli. Toki sistem galima
nagrinti dviem bdais: mikroskopiniu ir makroskopiniu.
Mikroskopinis bdas yra modelinis. Nagrinjamos pavieni molekuli savybs, j judjimo ir
sveikos dsniai, kuriamas mediagos sandaros modelis. Molekuli savybs suinomos i vairi
fizikos ir chemijos eksperiment, o jjudjimo dsniai apibriami remiantis tamtikromis prielai-
domis. Po to statistiniais metodais nustatomos makroskopini objekt savybs, kurias galima pa-
lyginti sustebimomis bandymuose. Esant galimybei palyginti sutikrove, galimaprielaidas koreguoti.
Makroskopinis nagrinjimo bdas yra fenomenologinis (gr. phainomenon reikinys). Ti-
riamas iorinis makroskopini objekt savybi pasireikimas, nustatomi svarbiausi parametr
kitimo dsningumai ir j savitarpio priklausomybs. Parametr kitimo savitumus lyginant su
bandymais kuriama bendra teorija.
Modelinis ir fenomenologinis mediagos savybi tyrimo bdai vienas kit papildo. Jeigu
mikroskopins teorijos ivados sutampa su makroskopiniais eksperiment duomenimis, galima
tikti, kadmikroskopins teorijos prielaidos yrateisingos. Kitavertus, mikroskopinteorijaiaikina
fenomenologini dsni prasm, parodo j taikymo ribas ir kai kada nustato makroskopini
parametr vertes konkreioms slygoms.
3. Rutullis leidiamas skyst, ir sekundmaiu imatuojamas laiko tarpas t
i
(i = 1, 2, 3, ), per
kur rutullis grimzta aukt h. Matuojama ne nuo skysio paviriaus, o 23 cmgiliau, tuomet
rutullis grimzta pastoviu greiiu.
4. Slankmaiuimatuojamas udarovamzdio, kuriuokrintarutulliai, vidinis skersmuoD(R=D/2).
5. raius (5.1.22) formul vis dydi vertes, apskaiiuojamos dinamins klampos verts q
i
ir
matavim bei skaiiavim rezultatai suraomi lentel:
i m
s
, kg
0
, kg/m
3
d
i
, m r
i
, m m
r,i
, kg
i
, kg/m
3
t
i
, s q
i
, Pas
6. vertinamas matavim tikslumas.
102 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
5.2.2. Duj dsniai
Duj savybs svarbios daugumai main, vykstanitarpgyvorganizm ir aplinkos. Duj dsniais
pirmiausia galima aprayti oro pokyius, svarbius aplinkos fizikai. Be to, jais galima remtis
nagrinjant vandens gar savybes. Vandens garai tai dujos, kurios ypatingos reikms turi
meteorologijai, hidrologijai ir ekologijai (plaiau r. 5.4 skyri), nors j koncentracija atmosferoje
palyginti maa.
Aprayti 5.1skyriuje pagrindiniai hidrodinamikos dsniai tamtikromis slygomis tinkair dujoms.
Taiau dujos neilaiko pastovaus trio, isiskiria dideliu spdumu, turi ma dinamin klamp
tuo jos skiriasi nuo skysi. Tokias duj savybes lemia silpna j molekuli sveika.
Dujos skirstomos realisias ir tobulsias. Pastarosiomis laikomos tokios dujos, tarp kuri mo-
lekuli nra sveikos jg, o molekuls yra labai mai tamprs rutuliukai. Molekulms susidrus
kintatikjgreiiokryptis, ogreiiodidumas liekanepakits. Daugumarealijduj, pavyzdiui, oras
ir jo komponentai, normaliomis slygomis (0
o
C, 760 mmHg) nedaug skiriasi nuo tobulj duj.
Tamtikros mass kiekvien duj bsen apibdina slgis, tris ir temperatra. Kintant vienam
i i parametr, kinta ir bent vienas i likusij. Tarp i kitim visada yra tam tikras ryys.
Vyksmai, kai i trijparametrkintatikdu, ovienas liekapastovus, vadinami izovyksmais. Bandymais
buvo nustatyti trys izovyksm dsniai. Jie sudarofenomenologins tobulj dujteorijos pagrind.
1. Izoterminis vyksmas tai slgio kitimas kintant triui,
kai temperatra ilieka pastovi (T = const). Izotermin
vyksm nusako Boilio ir Marioto dsnis: pastovios tem-
peratros duj slgis atvirkiai proporcingas j uimamam
triui. Matematikai is dsnis uraomas
pV = const, (5.2.1)
o konstantos didumas priklauso nuo dujprigimties, mass
ir temperatros. Grafikai p ir V koordinatse slgio prik-
lausomyb nuo trio, kai temperatra pastovi, vaizduojama
lygiaaehiperbole(5.2.1pav.). Ji vadinamaizoterme. Tpai
duj didesns temperatros izoterms yra toliau nuo
koordinai pradios.
2. Izobarinis vyksmas tai trio kitimas kintant tem-
peratrai, kai slgis ilieka pastovus (p = const). is vyksmas
nusakomas Gei-Liusakodsniu: kai slgis pastovus, dujtris
tiesiog proporcingas j absoliuiajai temperatrai:
const =
T
V
.
(5.2.2)
i konstanta priklauso nuo duj prigimties, mass ir slgio.
Grafikai V ir T koordinatse trio priklausomyb nuo
T
1
T2
>T1
V
p
p1
p2>p1
T
V
0
5.2.1 pav. Izoterms
5.2.2 pav. Izobars
p
1
p
2
>p
1
MOLEKULIN FIZIKA ____________________________________________________________________ 103
temperatros vaizduojama tiese (5.2.2 pav.), kurios tsinys
em temperatrpus eina per koordinaipradi. i ties
vadinama izobare. T pai duj didesnio slgio izobars yra
ariautemperatraies.
Izobars susikerta koordinai pradioje tik teorikai, nes
absoliuiosios temperatros nulis yra nepasiekiamas. Nepa-
siekiama tokia bsena, kai molekuliiluminis judjimas visai
sustoja ir duj slgis tampa lygus nuliui.
3. Izochorinis vyksmas tai duj slgio udarame inde
(V = const) kitimas keiiant jtemperatr. Izochorin vyksm
nusako arlio dsnis: udarame inde duj slgis tiesiog
proporcingas j absoliuiajai temperatrai:
const =
T
p
.
(5.2.3)
Konstanta priklauso nuoduj prigimties, j mass ir trio. Grafikai p ir Tkoordinatse slgio
priklausomyb nuo temperatros vaizduojama tiese (5.2.3 pav.), kurios, kaip ir izobari, tsinys
eina koordinai pradi. Ties vadinama izochore. T pai duj didesnio trio izochors yra
ariau temperatr aies. Izochori susikirtimas koordinai pradioje toks pats teorinis, kaip ir
izobari.
5.2.3. Tobuljduj bsenos lygtis
Atsivelgiant dujdsnius, bet kokios dvi tpaidujbsenos, nusakomos atitinkamai parametrais
p
1
, V
1
, T
1
ir p
2
, V
2
, T
2
, yra susijusios lygybe
.
2
2 2
1
1 1
T
V p
T
V p
=
(5.2.4)
Kadangi bsenos parinktos atsitiktinai, galima tvirtinti, kad, bet kaipkvazitolydiai kintant tobulj
duj parametrams, jie visada susij sryiu
const. =
T
pV
(5.2.5)
is sryis vadinamas Klaiperono lygtimi. Konstantos vert nustatoma inant tamtikro duj kiekio
bent vienos bsenos vertes p, Vir T.
Remiantis Avogadrodsniu, vienodomis slygomis, t. y. esant tampaiamslgiui ir temperatrai,
vienoduose triuose yra vienodi skaiiai duj molekuli nepriklausomai nuo duj prigimties.
5.2.3 pav. Izochors
V1
T
p
0
V1 > V2
V
2
>V
1
V
1
104 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Eksperimentais patvirtinta, kadvienas molis tobuljdujnormaliomis slygomis (p
n
= 1,013 10
5
Pa
ir T
n
= 0
o
C = 273,15 K) uima V
n
= 22,41 dm
3
= 2,241 10
2
m
3
tr.
Tuomet vieno molio duj (5.2.5) lygties konstanta
R
T
V p
(mol.K)
J
n
n n
8,314 = =
(5.2.6)
Ji vadinama universalija duj konstanta. Skaitine verte ji lygi darbui, kur atlieka izobarikai
besiplsdamas 1 mol duj, kai temperatra padidinama 1 K.
Bet kokiamduj kiekiui (5.2.5) lygtis uraoma taip:
RT
M
m
pV =
;
(5.2.7)
ia m duj mas, M j molio mas, o santykis m/M = v parodo moli skaii. Tai yra tobulj
duj bsenos lygtis. Kartais ji vadinama Klauzijaus ir Klaiperono lygtimi. I ios lygties, laikant
paeiliui kiekvien i trijparametrpastoviu, galimaurayti visus tris izovyksnidsnius ir suinoti
t dsnikonstant vertes.
Perraius (5.2.7) lygt taip, kadeitmoliskaiius v, ir dar padauginus ir padalijus i Avogadro
skaiiaus N
A
= 6,02 10
23
mol
1
, (5.2.7) virsta tokia:
T
N
R
V
N
p
A
=
A
v
;
ia v N
A
yra bendras molekuli skaiius N, o N/V = n molekuli tankis,
k
N
R
A
= = ,
23
10 38 1

J K
1
yra Bolcmano konstanta. Taiptiesiogiai i duj bsenos lygties gaunama lygtis
p = nkT, (5.2.8)
kuri parodo, kad tobulj duj slgis yra ne tik tiesiog proporcingas absoliuiajai temperatrai T,
bet ir duj molekuli tankiui n. i lygtis, urayta makroskopiniu fenomenologiniu bdu, yra
susijusi su pagrindine duj kinetins teorijos lygtimi
2
0
3
1
v nm p =
; (5.2.9)
ia m
0
molekuls mas,
2
v vidutinis kvadratinis molekuls greitis. i priklausomyb buvo
nustatyta mikroskopiniu modeliniu metodu. ia vertt prisiminti statistinje fizikoje rodom
vidutins kinetins energijos tolygaus pasiskirstymo laisvs laipsniais dsn: bet kokios sistemos,
esanios iluminje pusiausvyroje temperatroje T, chaotikojudjimo vidutin kinetin energija,
tenkanti vienam laisvs laipsniui, lygi
1
/
2
kT. Tobulj duj molekuls turi tik tris slenkamojo
(molK)
.
A
MOLEKULIN FIZIKA ____________________________________________________________________ 105
judjimo laisvs laipsnius, todl
kT
m
2
3
2
0
=
2
v
(5.2.10)
ir (5.2.9) virsta (5.2.8) lygtimi. Matyti, kad mikroskopiniu metodu urayta (5.2.9) lygtis patvirtina
fenomenologikai (bandymais) atrast tobulj duj bsenos (5.2.7) lygt.
5.2.4. Duj vidin trintis (klampumas)
Dujoms judant, jose, kaip ir skysiuose (r. 5.1 skyri), atsiranda vidins trinties jga. J galima
apskaiiuoti pagal (5.1.6) formul. Galima ireikti ir duj dinamin klamp. Tegu dujose yra du
sluoksniai A ir B (5.2.4 pav.), nutol vienas nuo kito per 2; ia vidutinis molekuli laisvojo
kelio ilgis (molekuli vidutinis laisvasis lkis). Virutinis sluoksnis slenka aies x kryptimi greiiu
v
1
, o apatinis v
2
, ir v
1
> v
2
; molekuli tankis abiejuose sluoksniuose vienodas ir lygus n. Pro
plot AS per laiko tarp At abiemkryptimis pralks toks pat molekuli skaiius:
t S n n n n
6
1

B A
= = = v
;
(5.2.11)
ia v vidutinis iluminio judjimo greitis.
Kadangi pereinani i sluoksnio Amolekuli kryptingo judjimo greitis v
1
yra didesnis negu
sluoksnioBgreitis v
2
, tai pirmjakryptimi perneamas didesnis judesiokiekis neguantrja. Pernet
judesio kieki A(mv) kryptimi z (statmena sluoksni slinkimo kryptims) skirtumas
t S
z
mn m
3
1
) (
A
A
= A
v
v v .
I ia trinties jga (judesio kiekio pokytis per laiko vienet)
S
z
mn
t
m
F

3
1

( v
v
v)
= =
,
arba
S
z t
(m
F

3
1

v
v
v)
= = , (5.2.12)
nes nm =.
Palyginus i lygt su (5.1.6) lygtimi, matyti,
kad duj dinamin klampa
5.2.4 pav. Brinys duj
dinamins klampos formulei ivesti
2
B
A
v
1
v
2
x ais
AS
z
a

i
s
z
x
106 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
q v
3
1
=
. (5.2.13)
Kadangi nepriklauso nuo duj slgio, duj tankis yra tiesiog proporcingas slgiui ( ~ p),
o molekuli vidutinis laisvasis lkis atvirkiai jamproporcingas ( ~ 1/p), tai qturi nepriklausyti
nuo duj slgio. Tyrimai i ivad patvirtino. Ji teisinga tik tol, kol molekuli vidutinis laisvasis
lkis yra maesnis u indo, kuriuo teka dujos, tiesinius matmenis.
Vadinasi, duj dinamin klampa, kaip ir molekuli chaotikojo judjimo vidutinis greitis,
tiesiogiai proporcinga kvadratinei akniai i absoliuios temperatros.
Knui judant netekani duj atvilgiu, taip pat pasireikia duj klampa. Kno pavirius
pasidengia labai plonu duj sluoksniu, kuris juda kartu su knu ir kurio molekuls turi su kno
judjimo greiiu susijus judesio kiek. Molekulms chaotikai judant, tarpiosluoksnio ir gretim
dujsluoksnivykstamolekulikaitair judesiokiekis perneamas lygiai taippat kaiptarpskirtingais
greiiais tekani duj sluoksni. Dl judesio kiekio perneimo didiausiu greiiu judantis duj
sluoksnis, kartu ir knas, prie kurio jis prilips, yra stabdomas.
Toliau apvelgiami vairs su duj klampa susij reikiniai.
Daleli pernaa. Maos dalels atmosferoje yra perneamos dl to paties vyksmo kaip ir duj
mass pernaa tai turbulentin difuzija. Dalels yra inertikos, todl jos negali greitai reaguoti
greiiausius skurijudjimus, kaipkaddujmolekuls, bet esamamatmosferos turbulentikumui
tai nesvarbu. Taiau esant dalelei arti paviriaus, inertikumas gali tapti svarbus, nes dl oro srovs
krypties greitokitimojos gali nukristi ant kitobjekt. Kitas skirtumas nuomolekuliyragravitacini
jgsvarba dalelms.
Veikianti dalel gravitacijos jga yra
dalels sunkio ir jos istumto oro sunkio
skirtumas. Veikiama gravitacijos jgos, dalel
juda pastoviu nusdimo greiiu v
s
, kai
gravitacin jga susilygina su pasiprieinimo
jga. Dalelms, kurioms tinka Stokso dsnis
(r. 5.1 skyri), t. y. toms, kuri Re s 0,1,
nusdimo greitis
) 9 /( 2
a
2
s
gr = v
;
ia oro kinematin klampa, r dalels
spindulys, dalels tankis,
a
aplinkos
tankis. Dalelms, kuri Re > 0,1 reikia
skaityti pasiprieinimo koeficiento priklau-
somyb nuo Re. Esant 1 / g = cm
3
daleli
nusdimo greiio priklausomyb nuo j
spindulio r pateikta 5.2.5 paveiksle. Stokso
dsnis galioja dalelms, kuri 1 / g = cm
3
ir
r s 30 m. Tai tinka iedadulkms, sporoms ir
5.2.5 pav. Daleli nusdimo greiio
priklausomyb nuo j spindulio
0 0,5 1 1,5 2 2,5 3 3,5 4
0,0001
0,001
0,01
0,1
1
0,01
0,1
1
10
100
1
0,5
0
-0,5
-1
-1,5
-2
-2,5
-3
-3,5
10
1000 100 10
Re
p
=1000
Spindulys(m)
-4
N
u
s

d
i
m
o
g
r
e
i
t
i
s
,
m
s
l
o
g
{
v
s
(
m
s
-
1
)
}
log{r(m)} r,m
l
g
(
v
,
m
s

1
)
lg(r, m)
Spindulys, m
Re
p
1
0,5
0
0,5
1
1,5
2
2,5
3
3,5
4
N
u
s

d
i
m
o
g
r
e
i
t
i
s
,
m
s

1
MOLEKULIN FIZIKA ____________________________________________________________________ 107
kitiems gamtiniams aerozoliams. Lietaus laeli(trki linija 5.2.5 pav.), kai r > 2 mm, v
s
artja prie
pastovios verts, nes jie krisdami deformuojasi ir pasiprieinimas vis didja.
Be io aprayto pastovaus judjimo egzistuoja dar ir nepastovus judjimas. Jis vyksta tada, kai
dalel yra papildomai veikiama horizontalios krypties oro srauto. iuo atveju dalel ne tik krinta
emyn, bet ir juda greiiu v
0
horizontalia kryptimi. Dl tokio poveikio dalel, palyginti su pradine
horizontalia padtimi, bus nupsta atstumu l, vadinamu stabdymo keliu. Jis randamas i lygties
t
0
v = l ; ia r m t t = 6 / ir vadinama relaksacijos trukme. Nusdimo greitis
.
s
g t = v
Daleli nusodinimas. Daleli nusodinimas ant objekt vyksta dl difuzijos (Brauno judjimo) ir
j susidrimo. Jei dalels mas ir inertikumas yra mai, tai sutikusi klities ribin sluoksn, dalel
sustos arba aplenks klit. Taip elgiasi muilo burbulai, paleisti pavjui. Dalels nusodinimo ti-
kimyb priklauso nuo dalels stabdymo atstumo l ir pasienio sluoksnio storio, kuris proporcingas
kvadratinei akniai i matmens ir atvirkiai proporcingas kvadratinei akniai i greiio. Todl
nusodinimo tikimyb didesn ant ma klii ir esant dideliamorosrautogreiiui. Didels mass
dalellengvai pereinapasieniosluoksn ir nusdaant klities. Santykis l/r vadinamas Stoksokriterijumi
ir ymimas Stk. Jis leidia palyginti daleli nusodinim vairiomis slygomis. Kitas svarbus dydis
susidrimo efektyvumas, nusakomas santykiususiduriani dalelisu visupereinaniper klities
plot daleliskaiiumi, jei klities nebt. Susidrimoefektyvumas priklausonuoStoksokriterijaus.
Geras susidrimoefektyvumas stebimas vandens laeliams, kurispindulys r~10 m atsitrenkiant
puies spyglius, kuri storis ~1 mm, kai emi debesys slenka per mik. iuo atveju Stk > 10,
kanos pagavimas ant voro tinklo vyksta dar efektyviau, nes laeliai (r = 10 m) yra daug
didesni u tinklosilus, kuriR = 0,1 m. Todl bet kuris laelis, pereidamas net atstumu, maesniu
arba lygiu r, yra sugaunamas. is procesas vadinamas sugavimu. Sugavimas yra svarbus procesas
dalelms, kuri matmenys lygs klities matmenims ar didesni u juos, nusodinti.
Dalelinusodinimui gali kliudyti atokimas nuoklities, todl gamtoje objektai, kuripavirius
yra minktas, sugauna daleles geriau. Minktas pavirius sugeria dalels judesiomoment. Nusodi-
nimo efektyvumo priklausomybs nuo daleli kinetins energijos tyrimai rodo, kad dalel gerai
sugaunama ant stiklo stryp, kai jos energija maesn kaip 10
12
J. Padidjus energijai iki 10
11
J,
sugavimoefektyvumas sumaja beveikdviemeilmis. Jei objektas yra lipnus, tai sugavimotikimyb
ir esant didesnms energijoms yraartimavienetui. Dl gamtiniobjektpaviriaus sandaros ypatum
pagavimo tikimyb didinant dalels kinetin energij maja daug liau. ie tyrimai atlikti su
dalelmis, kuri r > 10 m. Maesnms dalelms sugavimo efektyvumas maiau priklauso nuo
paviriaus lygumo.
Esant r < 5 m nusdimo greitis maja dl to, kad maja sugavimo efektyvumas. Daleli,
kuri r < 0,1 m, nusdimas vyksta dl Brauno judjimo. Apibendrinta nusdimo greiio
priklausomyb nuo dalels spindulio pateikta 5.2.5 paveiksle. Sugavimo procesai yra silpniausi
0,10,2 mspindulio dalelms, todl mogaus sukurti aerozoliai su tokio skersmens dalelmis yra
plaiai paplit ems atmosferoje. Pavyzdiui, SO
2
dalels gali pasklisti dideliame plote, nes silpnai
sugaunamos, ir tikpadidjusios dl drgms poveikioiki 1 myranusodinamos. mogui kvpuojant,
spindulior > 10 mdalels efektyviai sugaunamos nosies gleivinje, or = 110 mdalels patenka
bronchus ir gali nussti ant sieneli, r < 1 mspindulio dalels patenka plauius ir ten nusda.
108 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Paviriaus trintis ir formos pasiprieinimas. Jga, kuria oras veikia paviri jotekjimo kryptimi,
vadinamapaviriaus trintimi. Orotekjimas vir natralijpaviripaprastai yra daug sudtingesnis
neguteoriniuatveju. Taiaukai kuriais atvejais greiiokitimas esant vjui vir augallap, orientuot
lygiagreiai su srautu, atitinka teorin model. Pavyzdys gali bti greiiokitimo ir turbulentikumo
atsiradimo iilgai lapo paviriaus nagrinjamas. Dl lapo kreivumo ir priekinio krato ulinkimo
yra stebimas greiio kitimas (ikraipymas) bei turbulentikumo atsiradimas. Krizin Re reikm
iuo atveju yra 9 10
3
, nors plokio lygaus paviriaus ji yra apie 2 10
4
. Didinant greit v arba
turbulentikumo lyg oro sraute, greitis atitinkamuose paviriaus sluoksnio takuose, palyginti su
v, didja, o Re maja iki 1,9 10
3
. ios jgos atsakingos u augal spor ibarstym.
Be pavirins trinties sukeltos jgos ir judesiomomentopernaos, dt dujsraut kn veikia
jga srauto kryptimi. i jga yra inoma kaip aerodinaminis pasiprieinimas, nes ji priklauso nuo
kno formos ir jo orientacijos. Maksimal aerodinamin pasiprieinim patiria knai, orientuoti
statmenai srauto krypiai. Galima sakyti, kad toks knas oro srauto greit sumaina nuo v iki 0.
Tada maksimalus greitis, kuriuojudesiomomentas gali bti perduodamas vienetiniamkno plotui,
yra 0,5v
2
, taiau turint omeny, kadsrautas stengiasi aptekti klit, jis yramaesnis ir ireikiamas
0,5C
f
v
2
; ia C
f
yra kno formos faktorius.
Daniausiai ios abi jgos yrasumuojamos vienjgt, veikianivienetin plotsrautotekjimo
kryptimi, t. y. lygi2rl (r spindulioir l auktins cilindro) ir tr
2
sferos. Santykis ) 5 , 0 /(
2
v t apibdina
bendr pasiprieinimo koeficient C
d
(cilindro ir sferos, orientuot staiu kampu srov, jis yra
tarp 0,4 ir 1,2, kai Re skaiiai yra nuo 10
2
iki 10
5
). Tinkamai parinkus kbul form, greit
automobili pasiprieinimo koeficientas sumainamas iki ~ 0,3.
Vykstant atmosferos judjimui, visi gamtiniai paviriai pavieniai lapai, augalai, mediai, javai,
dirvoemis, vanduo veikiami tamtikrjg. Atitinkamai kiekvienas objektas arba pavirius tokio
pat didumo, bet prieingos krypties jga veikia atmosfer. i jg didumas priklauso nuo judesio
momento perdavimo tarp oro ir paviriaus. Momento perdavimas visada susijs su vjo lytimi:
vjo greitis objekto paviriuje yra lygus nuliui ir didja didjant atstumui nuo paviriaus. Izoliuoti
objektai, pavyzdiui, pavieniai augalai ar mediai, link turti labai neprastus ribinius sluoksnius
ir ikraipyti atmosferos judjim. Lygus ems pavirius ir vienodos vegetacijos augalai orui judant
generuojaskurius.
Jei turbulentikumas yra stiprus, lapai virpa (plasnoja). Matavimai rodo, kad charakteringas
skersmuo skuri, sukuriam d skersmens cilindr, yra apie 5d, kai 200 > Re . Skuriai, sukurti
lapar stieb, suskyla, formuodami vis maesnius ir maesnius skurius, ltai neamus pasroviui ir
siskverbianius kit lap ir stieb pavirinius sluoksnius.
Lap paviriaus pasiprieinimas gali padidti dl lap paviriaus nelygum ir dl ten esani
plaukeli. Taip pridjus tikr kvieio lap prie jo aliuminins kopijos, pasiprieinimas padidja
20 %, kai vjo greitis yra 1,5 m/s, ir 50 %, kai vjo greitis lygus 0,5 m/s, nes tai slygoja didjim
paviriaus trinties, kuri svarbi esant maoms v vertms. Realiai gyvenime labai retai egzistuoja
aerodinamin izoliacija, ir lapijos pasiprieinimo koeficientas priklauso nuo jos tankio bei vjo
greiio.
MOLEKULIN FIZIKA ____________________________________________________________________ 109
1
2
3
4
6
7
5
5.2.6 pav. Prietaiso oro klampai
matuoti struktrin schema
LABORATORINIS DARBAS
Dujklampos tyrimas
Darbo uduotis
Nustatykite oro dinamin klamp ir molekuli vidutin laisvj lk.
Darbo priemons ir prietaisai
Sekundmatis, manometras, matavimo cilindras ir prietaisas oro klampos koeficientui matuoti.
Darbo metodika
Prietaisas oroklampai matuoti (5.2.6 pav.) sudarytas i ind (1) ir (2), sujungt kapiliaru(3), kurio
ilgis yra l , o spindulys lygus r. Indas (1) sujungtas suvandens pripildytuindu(4). Indas (2) sujungtas
su indu (5), upildytu drgm sugeriania mediaga. Slgi skirtum kapiliaro galuose matuoja
manometras (6).
Klampa pasireikia, kai oras slenka i indo (2),
kuriame slgis lygus atmosferiniam, per kapiliar
(3) kit ind (1), kuriame slgis maesnis dl
itekanio i indo(4) vandens. Itekjusio vandens
tris matuojamas matavimo cilindru (7).
Duj arba skysi sluoksniai, slinkdami vienas
kito atvilgiu, veikia vienas kit klampos arba
vidins trinties jga ((5.1.6) ir (5.2.12) formuls).
Puazeilis apskaiiavo, kad kapiliarinio vamz-
delio, kurio spindulys yra Rir ilgis l, galuose slgi
skirtumui esant Ap, per laik t itekjusio skys-
io, kurio dinamin klampa lygi q, tris
(r. (5.1.15) formul) yra
.
8
4
p
l
t R
V A
t
=
q
(5.2.14)
Vandens manometruimatavus vamzdio galuose slgiskirtum, gaunama
; h g p =
(5.2.15)
ia Ah manometro skysio stulpelio auki skirtumas, manometro skysio tankis, g lais-
vojo kritimo pagreitis.
I (5.2.15) ir (5.2.14) lygybi plaukia
Vl
h g t R
8

4

q
t
=
. (5.2.16)
110 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Molekulinje kinetinje duj teorijoje dinamin klampa q yra susijusi su duj tankiu, kuris i
Klauzijaus ir Klapeirono lygties
RT
Mp
=
, (5.2.17)
molekuli vidutiniu iluminio judjimo greiiu
M
RT 3
= v
(5.2.18)
ir molekuli vidutiniu laisvuoju lkiu ((5.2.13) formul).
Nustaius dinamin klamp q, atmosferos slg p, temperatr T ir inant oro molio mas
M = 1,2910
3
kg/mol, vertinamas vidutinis oro molekuli laisvasis lkis
M
RT
p
3
=
q
. (5.2.19)
Darbo eiga
1. Matavim renginys paruoiamas tyrimams: ind (4) pilamas vanduo. Atsukus iaup
palaukiama, kol nusistovs manometro rodmenys. Tuometu vanduo teka atsargin ind.
2. Nusistovjus slgi skirtumui vamzdelio galuose, po itekanio vandens iaupu pastatomas
matavimo cilindras skysio triui V matuoti. Prie usukant iaup usiraomos manometro
stulpeli auki skirtumo Ah verts, o po 35 minui iaupas usukamas ir uraomos pri-
tekjusio vandens trio V, laiko t verts.
3. Pagal (5.2.16) formulapskaiiuojama dinaminklampa q. (Kapiliaroduomenys l ir r pateikiami
prietaisoaprae.)
4. 23 uduotys kartojamos ne maiau kaiptris kartus. Apskaiiuojama dinamins klampos vidu-
tin vert.
5. Termometru ir barometru imatuojama aplinkos temperatra Tir slgis p.
6. Pagal (5.2.19) formul apskaiiuojamas molekuli vidutinis laisvasis lkis .
5.3. Tirpal paviriaus tempimas
Skysio agregatin bsena (r. 5.1 skyri ).
Skysi molekulinis slgis ir paviriaus tempimas.
Paviriaus tempimo koeficiento fizikin prasm, jo matavimo vienetai.
Pusiausvyros slygos terpi skiriamojoje riboje.
Skysio laisvojo paviriaus kreivumo taka slgiui. Laplaso formul.
Tirpal paviriaus tempimas.
Kapiliariniai reikiniai.
Paviriaus tempimo koeficiento matavimo bdai.
MOLEKULIN FIZIKA ____________________________________________________________________ 111
5.3.1. Skysipaviriaus tempimas
Skystis visada gaun toki form, kuri atitinka j veikianias jgas (r. 5.1.2 skyrel). Todl skysiui
esant udarame inde, normaliomis ems traukos slygomis atsiranda aiki riba, skirianti dvi
mediagos bsenas dujas (garus) ir skyst. Tokios pat temperatros duj tankis paprastai daug
maesnis negu skysio tankis. Taiau esant pakankamai auktai temperatrai, didesnei negu
vadinamoji krizin temperatra, bdinga kiekvienamskysiui (vandens ji yra 374 K), skysio savybs
nesiskiria nuo stipriai suspaust duj ir aiki bsen skiriamoji riba inyksta. Atradus krizin
temperatr, tapo aiku, kodl ilg laik nepavykdavo paversti skysiu kai kuri duj, pavyzdiui,
deguonies ir vandenilio. Jkrizintemperatralabai ema C 118 (
2
O
= T , C) 240
2
H
= T . Norint
ias dujas paversti skysiu, reikia jas ataldyti iki temperatros, emesns u krizin.
Pagrindins skysi ypatybs normaliomis slygomis yra gebjimas ilaikyti tr ir laisvojo
paviriaus egzistavimas. Prie trini skysio savybi priskiriami, pavyzdiui, iluminis pltimasis
ir spdumas. iame darbe inagrinjami kai kurie paviriniai reikiniai, t. y. tokie, kuriuos lemia
skysio laisvasis pavirius.
Skysio, besilieianiopriekitos terps, pavyzdiui, jopaties gar, kitoskysioarba kietojokno
(tarp j ir indo, kuriame jis yra, sieneli), pavirius yra ypatingose, palyginti su kita skysio mase,
slygose. Galimapalyginti skysiomolekuliBir C, esaniarti skysioir dujribos, bsensubsena
molekuls A, esanios toli nuoios ribos, skysioviduje(5.3.1 pav., a). Molekul skysiovidujei vis
pusiapsuptakitmolekuli. Traukos jgos, kurios veikiai aliaesanimolekulipuss, tarpusavyje
kompensuojasi. Tuotarpu molekul, besiribojani sudujomis, skysiomolekuls supa tiki vienos
puss, oidujpuss molekulidaugmaiau. Tokiuatvejuvisjgsumasudaroatstojamj, nukreipt
skysiovid. Surad ijg, veikianivisas paviriaus molekules, atstojamj ir padaliji ploto,
kuriame isidsiusios pavirins molekuls, gautume vadinamj molekulin slg, kuriuopaviriaus
sluoksnis veikia visskysiomas. Skysimolekulinis slgis yradidelis, pavyzdiui, vandens jis siekia
iki 1110
8
Pa ir pan. Dl ios prieasties skysiai yra sunkiai suslegiami norint pastebimai sumainti
jtr, reikiaveikti ioriniu slgiu, kuriodidumas prilygt molekuliniamslgiui.
Be jg, nukreipt skysio vid, paviriaus sluoksnio molekules veikia ir gretimos molekuls
paviriaus liestins kryptimi. sivaizduokimeskysiopaviri, kur sudaroapskritas vienos molekuls
storio plotelis (5.3.1 pav., b). Kiekvien molekul, esani plotelio viduje ne ties jo kontru,
veikiani jg atstojamoji yra lygi nuliui (molekul A). Taiau molekules, kurios isidsiusios
iilgai plotel ribojanio kontro (B, C), veikia atstojamoji jga, nukreipta plotelio vid. Taigi
5.3.1 pav. Jgos, veikianios molekules skysio viduje (a) ir horizontalia kryptimi paviriuje (b)
A
B C
B
C
B
A
C
a)
b)
112 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
molekulins jgos, veikianios plotelio vid, stengiasi plotel sumainti. Tos jgos vadinamos
paviriaus tempimo jgomis. Paviriaus tempimo jga F yra proporcinga plotelio kontro ilgyje
esani molekuli skaiiui, kuris savo ruotu proporcingas paviriaus kontro ilgiui l; vadinasi,
F =ol. (5.3.1)
Proporcingumo koeficientas o priklauso nuo skysio prigimties ir vadinamas paviriaus
tempimo koeficientu. Jei l =l m, i (5.3.1) formuls gauname, kad o = F, t. y. paviriaus tempimo
koeficientas ireikia jg, kuri veikia paviriaus liestins kryptimi l milgio paviriaus kontr.
Norint pervesti molekul i vidini sluoksni paviri, reikia veikti molekulin slg. Kitaip
sakant, kiekviena molekul, esanti arti skysio paviriaus, palyginti su molekulmis, esaniomis
skysio viduje, turi tam tikr potencins energijos pertekli. Kuo didesnis skysio pavirius, tuo
didesnis skaiius molekuli turi i perteklin potencin energij. Taigi tamtikros skysio mass
paviriaus pokytis dS, esant tamtikrai temperatrai, sukuria pavirins energijos pokyt
; d d S U
S
o =
(5.3.2)
ia koeficientas o yra tas pats paviriaus tempimo koeficientas. Vadinasi, paviriaus tempimo
koeficientas o gali bti matuojamas darbu, kur reikia atlikti norint padidinti skysio paviriaus
plot vienu ploto vienetu, esant pastoviai temperatrai. Jo SI matavimo vienetas yra N/m arba
J/m
2
. Jeigu skysio pavirius keiiamas adiabatikai, tai jo temperatra pakinta. Pavyzdiui,
padidinus skysio paviri, skystis atla.
Kadangi molekuls siekia pereiti i skysio paviriaus jo gilum, skysio pavirius stengiasi
susitraukti, todl iilgai paviriaus veikia paviriaus tempimojgos. Dl toskystis gaunatokiform,
kadjolaisvasis pavirius bt kiekgalima maesnis. Vis pirma tai matyti i apvalios formos, kuri
gauna mai skysiolaeliai: gyvsidabriolaai ant horizontalios stiklins ploktels, vandens laai ant
kaitusios krosnies, ant dulktokelioir pan. Visais iais atvejais skysiomolekulisveika sukietuoju
knu, ant kurio yra laai, yra maa, palyginti su jgomis, veikianiomis tarp skysio dali. Todl
skysio polinkis sumainti savo paviriaikiai matomas: sferin laeli forma atitinka jmaiausi
paviri. Kai laelimatmenys mai, sunkiojgos takalaeliformai nedidel. Nesvarumoslygomis
sferinis laas gali turti matmenis, daug didesnius neguprasti skysio laai.
Tuo atveju, kai skystis egzistuoja plonplveli pavidalu, galima nepaisyti potencins energijos
trins dalies. Tokios bsenos reikiniai, susij su paviriaus tempimu, yra paties paprasiausio ir
aikiausio pavidalo, kadangi jiems nedaro takos efektai, sukeliami kn trinisavybi. Paviriaus
tempimo egzistavim galima vaizdiai pa-
demonstruoti naudojant muilo plveles.
Pavyzdiui, ant vielinio karkaso padedame
kilp i silo(5.3.2 pav.). Kol muilo plvel
kilpos vidujeyra vientisa, kilpa gali bti bet
kokios formos (5.3.2 pav., a). Bet plvel
kilpos viduje pradrus taip, kad skysta
plvel likttik tarpsilo i iorins vielos,
paviriaus tempimojgos veikiamas silas
gauna apskritimoform (5.3.2 pav., b). 5.3.2 pav. Silo kilpa muilo plvelje
a) b)
MOLEKULIN FIZIKA ____________________________________________________________________ 113
Plvels siekis susitraukti iki maiausi galim matmen
paaikina muilo burbul rutulin form. Tuo paiu skysio
paviriaus sumajimu nusistovint pusiausvyrai galima
paaikinti taip pat ir lapi smilteli bei lapi plauk
sulipim. Kai plauk epetys panardintas vanden, epeio
plaukai yra isisklaid. Itraukus epet i vandens, plaukai
sulimpa. Kai plaukai sulip, juoseesantis vanduoturi maesn
paviri, negu kai plaukai isisklaid.
Pamus staiakamp vielos rmel, kurio viena ilgio l
kratin galt judti likdama lygiagreti su savo pradine
padtimi (5.3.3 pav.), ir panardinus j muilo tirpal, rmelis
apsitraukia muiloplvele, i abiej pusiapribota pavirinio
sluoksnio. Bandymas rodo, kad plvel stengiasi susitraukti,
ir judri kratin AB ima judti. Norint sustabdyti kratins
judjim, jreikiaveikti jgaF, kuri atsvertjg F', veikiani
kratin i muilo plvels puss. Padidinus jg Fnykstamai maudydiu, kratin ltai perkeliama
jgos Fkryptimi atstumu dx. Taigi jga F atlieka darb A = Fdx. Dl to paviriaus sluoksnio plotas
padidja dydiu dS = 2ldx (pavirinis sluoksnis padidja i abiej plvls pusi), kartu pavirin
energija padidja dUs = 2lo dx. Prilyginus dA = dU
s
, gaunama lygyb
l F 2 / = o ,
(5.3.2a)
i kurios galima vertinti odidum.
Paviriaus tempimo koeficiento apibrt dar reikia papildyti nurodant terp, su kuria skystis
ribojasi. Taip daroma dl to, kad pavirinio sluoksnio molekules veikia tarpmolekulins jgos ir i
nagrinjamo skysio molekuli puss, ir i aplinkins terps molekuli puss. Darbas, kur reikia
atlikti norint itraukti molekul i vidini skysio sluoksni jo paviri, kartu ir paviriaus
tempimas, priklauso ne tik nuo paties skysio, bet ir nuo terps, su kuria jis ribojasi. Lentelse
paprastai pateikiamos skysio, besiribojanio su oru arba jo paties soiaisiais garais, paviriaus
tempimo koeficiento verts. Pavyzdiui, besiribojanio su oru, esant 0Ctemperatrai, vandens
paviriaus tempimo koeficientas yra 75,7 mN/m, o su soiaisiais garais 73,2 mN/m. Taip pat
galima apibrti dviej nesimaiani skysi arba skysio ir kietojo kno skiriamosios ribos
paviriaus tempimo koeficient.
5.3.2. Pusiausvyros slygos terpiskiriamojoje riboje
Trij terpi tarpusavio ribos pavyzdys gali bti skysio laas ant kito tankesnio skysio paviriaus
(5.3.4 pav.). Paymjus ilgio element, nukreipt iilgai trij terpi (1, 2, 3) lietimosi linijos, dl,
element veikianios paviriaus tempimo jgos uraomos kaip l l l d , d , d
13 23 12
o o o . Elementas
dl nukreiptas statmenai brinio ploktumai. Jei
23 12 13
o o o + < , tai pusiausvyra nusistovi taip,
kaip parodyta 5.3.4 paveiksle. Pusiausvyros slyga yra tokia, kad atstojamosios jgos, veikianios
element dl, projekcijos ais, nukreiptas iilgai ir skersai terpi (1, 3) skiriamosios ploktumos,
turi bti lygios nuliui:
2 23 1 12 13
cos cos u o u o o + = ,
2 23 1 12
sin sin u o u o = .
(5.3.3)
5.3.3 pav. Rmelis su judania
kratine ir muilo plvele
F
l
dx
AA
A' A'
BB
B' B'
A
A'
B
B'
F'
F
114 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
I sistemos (5.3.3) galima nustatyti kampus
1
u ir
2
u , vadinamus slyio kampais. Tuo tarpu, jeigu
23 12 13
o o o + > , parodyto pavidalo pusiausvyra yra nemanoma, ir laas (2) pasklinda visu
skysio (1) paviriumi plonu molekuliniu sluoksniu. Kaip pavyzd galima nurodyti benzino arba
ibalo plvel ant vandens paviriaus. Paprastai tokios plvels spindi vaivorykts spalvomis dl
viesos interferencijos. Tokiuatvejusakoma, kadskystis (2) visikai drkinaskyst (1) arbaatvirkiai.
Norint ityrinti pusiausvyros slygas skysio ir kietojo kno riboje, reikia (5.3.3) lygtyse kamp
1
u laikyti lygiu nuliui ), 0 (
1
= u nes kietasis knas pastebimai nesideformuoja. Paviriaus tempimo
jg atstojamj atsveria statmenosios slgio, arba tempimo, jgos skysio ir kietojo kno riboje.
Kamp
2
u galima ymti u. Todl iuo atveju reikia slygos, kad bt lygi nuliui bendros jgos
dedamoji liestins kryptimi
. cos
23 12 13
u o o o + =
(5.3.4)
I ia lengvai randama slyio kampo iraika:
] / ) [( arccos
23 12 13
o o o u = .
(5.3.5)
Kampas paprastai parenkamas taip, kad apimt srit, kuri uima skystis (2). Kai
, 1 / ) (
23 12 13
> o o o (5.3.4) slyga negali bti tenkinama. Tada laas (2) yra ne pusiausvyros
bsenos, o iplinta kietojo kno paviriumi, padengdamas j plona plvele. Tuoatveju sakoma, kad
skystis visikai drkina kietojo kno paviri. Kitu ribiniu atveju, kai , 1 / ) (
23 12 13
< o o o taip
pat joks kampas netenkina (5.3.4) slygos.
Skystis susitraukia sferin la, iek tiek
susiplojus dl sunkiojgos. Pavyzdys gali bti
gyvsidabrio laas ant varaus stiklo paviriaus
arbavandens laas ant parafinopaviriaus. Tuo
atveju sakoma, kadskystis visikai nedrkina
kietojo kno paviriaus. Daniausiai tik i
dalies drkinama ), 2 / 0 ( t < <u arba i dalies
nedrkinama t). < < (t u 2 / Dalinio drki-
nimo reikinys pastebimas prie ind sieneli,
kai induose pripilta skysio (5.3.5 pav.).
Slyio kampo u didumas nustatomas pagal
(5.3.5) formul.
5.3.5 pav. Slyio kampai, kai skystis drkina
(a) arba nedrkina (b) indo sieneles
1 1 2 2
3 3
a) b)
5.3.4 pav. Lao pusiausvyros slygos dviej skysi riboje
23
dl
12
dl
1
3
2
13
dl
MOLEKULIN FIZIKA ____________________________________________________________________ 115
Akivaizdu, kad drkinimas ir nedrkinimas yra santykins svokos: skystis, drkinantis vien
kietj kn, gali nedrkinti kito kietojo kno. Pavyzdiui, vanduo drkina stikl, bet nedrkina
parafino. Gyvsidabris nedrkina stiklo, bet drkina var ir pan.
Drkinimo ir nedrkinimo reikiniai turi didel reikm gamtoje ir technikoje. Pavyzdiui,
vanduo nedrkina augallapir stiebdl juos dengianio plono vakpanaiapnasluoksnio.
Kaip tik todl per liet nesulampa medi lapai, ieno kaugs, iaud stiebai ir pan. Vandens
telkiniuose vandens paviriaus plvele laisvai bgioja ir okinja vabzdiai iuoikai. Galima
atsargiai padti ant vandens lengv aliuminin kelicent monet, ir ji, iektiek lenkusi pavirin
plvel, liks ant jos gulti. Alavuojant, lituojant ir virinant metalus, taip pat klijuojant vairius
kietuosius knus, pirmiausia reikia gerai pavirius drkinti. Geras drkinimas daikliais utikrina
skming audini ir keramini dirbini daym. Muilo naudojimas skalbiant taip pat pagrstas
drkinimo reikiniu. Aprasojus akinistiklams, pro juos nesimato. Taiau matyti trukdone tai, kad
stiklas padengtas vandeniu, o tai, kad j dengiantis vanduo yra vies isklaidani laeli pavidalo.
Norint ivengti laeli susidarymo ant stiklo, reikia kruopiai nuvalyti riebalus, padengti specialiu
laku ir kt., kad vanduo galt drkinti stikl.
domu paymti, kad nesvarumo slygomis dl drkinimo reikinio vanduo udarame stikli-
niame inde pasiskirstoprie jo vis sieneli, o oras susikaupia indo vidurinje dalyje. Apraytas rei-
kinys pirm kart eksperimentikai buvo nustatytas dar 1962 metais kosminilaiv skrydi metu.
5.3.3. Skysio laisvojo paviriaus kreivumo taka slgiui. Laplaso formul
Kokireikmturi skysiopaviriaus kreivumas?Lengvapastebti, kadjgos, susijusios supaviriaus
tempimu ir nukreiptos skysio paviriaus liestins kryptimi, igaubto paviriaus atveju sukelia
papildom slg toje paviriaus pusje, kuri jis nukreiptas savo gaubtumu. Bandymas atliktas su
prietaisu, parodytu5.3.6 paveiksle. Siauras vamzdelio (K) galas leistas skyst nedideliame gylyje.
Spaudiant gumin kriau (GK), vamzdelio su kriaue viduje sukuriamas auktesnis slgis,
matuojamas manometru (M). Didjant slgiui vamzdelyje, ipuiamo burbuliuko spindulys vis
maja (5.3.6 pav., a, b, c). Toliau spaudiant kriau, pasiekiama tokia padtis, kad burbuliuko
spindulys pradeda didti (5.3.6 pav., d), o manometras rodo slgio sumajim.
Toliau galima panagrinti du muilo burbulus, ipstus triakiu vamzdiu su votuvais K
i
,
i = 1, 2, 3 (5.3.7 pav.). I pradi kiekvienas burbulas ipuiamas atskirai. Po to votuvas (K
1
)
usukamas, o votuvai (K
2
) ir (K
3
) atsukami. Tada oras i maesnio burbulo teka didesnj, kuris
didja tol, kol maasis inyksta. Vadinasi, muilo plvel sukuria duj slg, ir tuo didesn, kuo
maesnis jos kreivumo spindulys.
Galima ivesti formul papildomamslgiui, sukuriamamskysiosferinio paviriaus, skaiiuoti.
Tuo tikslu reikia nagrinti sferin muilo burbul. Papildom duj slg p' atmosferos atvilgiu
sferos viduje atsveria burbulo sieneli slgis, atsirads dl paviriaus tempimo. Padidinus slg
burbulo viduje, jo spindulys padidja dydiudr ir tuometuatliekamas darbas r A 4 d
2
t = r p d ' , kuris
virsta burbulopaviriaus laisvja energijaodS. ia dSyravidinioir ioriniomuiloburbulpaviriaus
padidjim suma, t. y. r r r S d 8 2 ) 4 ( d 2 d
2
t = t = . Atsivelgiant tai, kad slg burbulo viduje
sukuria du igaubti paviriai, vienas pavirius sukuria du kartus maesn slg
. / 2 2 / r p p o = ' =
(5.3.6)
116 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Bet kokio(nesferos) paviriaus kreivumas apibdinamas dviempagrindiniais kreivumospinduliais
r
1
ir r
2
. Pagrindiniai spinduliai yra kreivumo spinduliai kreivi, kuriomis kerta paviri dvi jamir
viena kitai statmenos ploktumos. Papildomas slgis nusakomas lygybe.
), / 1 / 1 (
2 1
r r p + = o
(5.3.7)
kuri vadinama Laplaso formule. I formuls matyti, kad esant maiems kreivumo spinduliams
Laplasoslgis gali bti didelis. Pavyzdiui, kai spindulys yra 1 m, papildomas slgis oroburbuliuke,
esaniame vandenyje, lygus 1,4210
5
Pa ~ 1,4 at.
5.3.4. Tirpal paviriaus tempimas
Kuo paremta galimyb lengvai psti muilo burbulus ir kodl niekada nepavyksta to padaryti su
grynu vandeniu? Muilo tirpalo paviriaus tempimas labai maas (klampumas didelis). Muilas
priklauso vadinamj pavirinio aktyvumomediag, kurios adsorbuojamos ant terpi skiriamosios
ribos, klasei. J net nedidels koncentracijos priemaia labai sumaina paviriaus tempim. Toki
mediag molekuls vis pirma patenka pavirin sluoksn ir tik tada, kai jis tampa jomis
pakankamai tankiai upildytas, prasiskverbia pagrindin skysio tr. Vandens atvilgiu prie
pavirinio aktyvumo mediag priskiriama nafta, spiritas, eteris, muilas ir kitos. Pavyzdiui, van-
denyje itirpintas muilas sumaina jo paviriaus tempim nuo 0,073 iki 0,045 N/m. Pavirin
energija stengiasi gyti minimali reikm. Todl muilino vandens pavirius susideda daugiausia i
muilo molekuli. Suplonjus muilo plvelei kurioje nors vietoje, paviripatenka vandens mole-
kuls, ir pavirin energija padidja. Todl atsiranda jgos, besistengianios vl aptraukti t skysio
viet didesne muilo koncentracija. Gryno vandens pavirin energija padidja, kai plvel tiesiog
sutrksta. Yra ir toki mediag (druska, cukrus), kuri priemaia vandenyje padidina tirpalo
5.3.7 pav. Muilo burbulai,
ipsti triakiu vamzdiu
GK
K K K K
a b c d
M
K
K
1
K
3
5.3.6 pav. Burbul ptimo prietaisas ir burbul
spindulio priklausomyb nuo slgio (a, b, c, d)
K
1
K
2
K
3
MOLEKULIN FIZIKA ____________________________________________________________________ 117
paviriaus tempim. Tokios mediagos, atvirkiai, kaupiasi ne skysio paviriuje, o istumia pa-
virinio aktyvumo mediagas paviri ir yra vadinamos vidinio aktyvumo mediagomis. Tai nau-
dojama verdant muil iskirti j i tirpalo isdymo bdu.
Gamtojeir technikojedanai pasitaikoneatskirplveli, ojsankaupput. Danai upeliuose,
kur nedidels vandens srovels varva stovint vanden, gausiai susidaro put. Vandens gebjimas
putoti iuo atveju susijs su vandenyje esaniomis organinmis mediagomis (saponinu), isiski-
rianiomis i augal akn.
Biologini skysi paviriaus tempimo koeficiento pokyiai kai kuriais atvejais gali bti nau-
dojami diagnostikai. Pavyzdiui, sergant gelta lapimo paviriaus tempimas labai sumaja dl to,
kad j patenka tulies rgtys. Sergant diabetu ir kitomis ligomis, padidja lipazs kiekis kraujyje.
Lipazs kiekis nustatomas matuojant tributileno tirpalo, pridjus j krauj, paviriaus tempim.
Pavirinio aktyvumo mediag veikimu pagrstas vienas i kovos su maliariniais uodais bd,
kai apkrsti vandens telkiniai laistomi nafta. Uodolervagyvena vandenyje, bet kvpuoja atmosferos
oru, ikidama pavirisavokvpavimoorgan. Nedideliais kiekiais vanden pilamanafta smarkiai
sumaina paviriaus tempim. Plvel jau neilaiko lervos svorio, ji panyra giliau ir, negaudama
atmosferos oro, sta.
Ibendrsamprotavimlengvasuprasti, kaddidjant temperatrai paviriaus tempimokoeficientas
turi mati. Didjant temperatrai, padidjavidutiniai nuotoliai tarpmolekuli, odl tosumaja j
sveikos jgos, lemianios paviriaus tempim. Beto, esant krizinei temperatrai paviriaus tempimo
koeficientas turi bti lygus nuliui, nes inyksta skirtumas tarp skysio ir gar, inyksta ir pavirius,
skiriantis abi bsenas. Tuo, kad paviriaus tempimas priklauso nuo temperatros, lengva sitikinti
padarius tok bandym. Vandens pavirius pabarstomas kokiais nors milteliais, plaukiojaniais ant jo,
pavyzdiui, talku. Prikius prievandens kaitintdaikt, kuris kaitintvandens paviriprietodaikto,
galima pamatyti, kaip talkas isisklaido nuo kaitintos vietos. Tai vaizdiai rodo, kad, didjant
temperatrai, vandens paviriaus tempimas maja. Taiautikslus paviriaus tempimokoeficiento
priklausomybs nuotemperatros pavidalas nustatomas tikeksperimentikai.
5.3.5. Kapiliariniai reikiniai
Jeiguindo, kuriame yra skystis, matmenys (arbabendresniuatveju atstumas tarpskyst ribojani
paviri) sulyginami su skysio paviriaus kreivumospinduliu, tai tokie indai vadinami kapiliariniais
(lot. capillaris plaukinis). Buityje mes danai susiduriame su mediagomis, kurios sudarytos i
daugybs ma kanalli (popierius, audinys, oda, mediena, dirvoemis ir pan.). Susilietusios su
vandeniuar kitais skysiais, tokios mediagos labai danai juos sugeria save. Tuopagrstas, pavyzdiui,
rankluosionaudojimas luostantis rankas, sugeriamojopopieriaus naudojimas raalui sugerti.
Galima ivesti formul skysio kapiliariniampakilimui h siauru cilindriniu kapiliaru skaiiuoti
(5.3.8 pav.). Vamzdelis laikomas tokiusiauru, kadjospindulys r
0
sulyginamas sumenisko kreivumo
spinduliu r. Veikiamas paviriaus tempimo, skystis pakyla vamzdeliu iki tokio lygio h, kur skysio
stulpelio hidrostatinis slgis gh atsveria Laplaso slg . / 2 r o I ia iplaukia pusiausvyros slyga
/ 2 gh r o = gh ;
(5.3.8)
ia skysio tankis, g laisvojo kritimopagreitis (r. 5.3.8 pav.). Kadangi skysio slyio kampas
lygus u, tai i brinio tiesiogiai matyti, kadkreivumo spindulys, susietas su kapiliaro spinduliu, yra
118 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
. cos /
0
u r r = I ia gaunama skysio pakilimo
aukio formul:
.
cos 2
0
gr
h

u o
=
(5.3.9)
Esant visikam drkinimui, 0 = u , tada
h= 2o/ gr
0
.
Kapiliarinis pakilimas stebimas ne tik cilin-
driniuose kapiliaruose. Skystis pakyla ir tarp
dviej plokteli, kur yra siauras tarpelis. Jeigu
ploktels lygiagreios, tai menisko forma cilin-
drin. iuo atveju skysio pakilimo auktis
kapiliaru nustatomas pagal (5.3.9) formul, tik
vietoje cilindrinio kapiliaro spindulio yra
atstumas tarp plokteli d.
Sudjus kartudvi nulifuotas sudrkintas plokteles, jos prisispaudia viena prie kitos. Bet koks
skysio laisvojo paviriaus elementas dl drkinimo turi gaubto cilindro form. Esant visikam
drkinimui, menisko spindulys , 2 /
1
d r = o slgis skysio viduje emesnis u atmosferos slg
dydiu, lygiu Laplaso slgiui . / 2 /
1
d r p o o = = Esant plokteli plotui S, j traukos jga
pS f = = 2oS/ d. Toki ganadideljg, nukreipt statmenai ploktelms, reikia panaudoti, norint
jas atitraukti viennuokitos. Tuopaiumetupanaudojus netgi nedideljg, nukreipt lygiagreiai
ploktelms, jos lengvai atsiskiria.
Kapiliarinmis savybmis isiskiria bet koks akytas knas, pavyzdiui, filtravimo popierius,
sausa kreida, ipurenta dirva ir kt. Akyti knai lengvai sugeria drkinanius skysius ir juos ilaiko.
Atvirkiai, ie knai yra nelaids nedrkinantiems skysiams. Kapiliariniai reikiniai turi didel
reikm augal vegetacijai, nes dl j vanduo ir maistiniai tirpalai i dirvos kyla iilgai augalo
stiebo.
Be to, biologijoje ir medicinoje labai svarbu, kad drkinant skyst, tekant siauru vamzdiu
(kapiliaru), nepatekt oro burbuliuk. Taip atsitikus, po skirtingo spindulio skysio paviriaus
meniskais atsiranda papildomi slgiai, kuri skirtumas prieinasi skysio tekjimui. Jeigu toki
burbuliuk atsiranda daug, tai kapiliaras gali visikai usikimti. Kraujui tekant smulkiomis
kraujagyslmis ir kapiliarais gyvuosiuose organizmuose, stebimi panas reikiniai. Tada, usikimus
kraujo indams, organizmui ikyla rimtas pavojus. Tokie reikiniai medicinoje vadinami dujembo-
lija. Todl injekcij, kraujo perpylimo ir kit panai procedr metu svarbu, kad kraujo indus
nepatekt oro burbuliuk.
5.3.8 pav. Skysio pakilimas kapiliare
(b stambiu masteliu)
h
r
r
0
O
r
O
a) b)
MOLEKULIN FIZIKA ____________________________________________________________________ 119
5.3.6. Paviriaus tempimo koeficiento matavimo bdai
Medicininje praktikoje paviriaus tempimo koeficientui matuoti danai naudojamas la ati-
trkimo bdas. Skysiui ltai tekant i vertikalaus vamzdelio, susidarolaai ir gauna form, artim
rutuliui, nes sunkio jgos taka lao formai maa. Prie lao atitrkim susidaro ssmauka, kurios
spindulys r iek tiek maesnis u vamzdelio spindul. Iilgai ios ssmaukos apskritimo veikia
paviriaus tempimo jga , 2 o r F t = kuri atitrkimomomentuturi bti lygi sunkiojgai ; gV P =
ia V lao tris. I ia gaunamas paviriaus tempimo koeficientas
r gV t = 2 / o .
(5.3.10)
Lao svoris imatuojamas analizinmis svarstyklmis. Matavimo tikslumui padidinti suskai-
iuojamas tamtikras skaiius la ir matuojamas j visas svoris. Ssmaukos spinduliui imatuoti
atitrkstantis laas projektuojamas j didinant ant ekrano, kur imatuojamas jo skersmuo. Danai
naudojamas supaprastintas la atitrkimometodas palyginimo bdas. Jeigu inomas kokionors
skysio, pavyzdiui, vandens, paviriaus tempimo koeficientas
0
o ir tankis ,
0
tai pamus
vienodus vandens ir tiriamojo skysio trius ir suskaiiavus la tuose triuose skaii atitinkamai
n
0
ir n, naudojantis (5.3.10) formule galima gauti
). / (
0 0 0
n n o o =
(5.3.11)
inant skysio pakilimo kapiliariniais vamzdeliais aukius, paviriaus tempimo koeficient
galima nustatyti naudojantis (5.3.9) pavidalo formulmis. Tam tikslui, naudojant atskaitin mik-
roskop, tiksliai imatuojami vidiniai vamzdeli skersmenys. Prie matavim kapiliariniai vamz-
deliai turi bti variai iplauti: i pradi dichromo rgties kalio druskos tirpalu, sieros rgtimi,
o po to distiliuotu vandeniu ir spiritu. Vamzdeliai idiovinami puiant per juos kaitint or.
Tikslesnis o nustatymo bdas yra kapiliarini bang bdas. Kapiliarins bangos tai kitas
visiems inomo skysio paviriaus raibuliavimo reikinio pavadinimas. Kapiliarini bang
susidarymomechanizmas yratoks. Jeiguveikiant ioriniams veiksniams, pavyzdiui, vjui, pavirius
kurioje nors vietoje tapo gaubtas, tai po tuo gaubtu paviriumi slgis tampa maesnis (dydiu,
lygiu Laplaso slgiui (5.3.7)), negu gretimose srityse su plokiu paviriumi. Tokiu bdu atsirads
slgi skirtumas veria skyst i gretim sluoksni tekti po gaubtu paviriumi, keldamas j
buvus lyg. Bet i inercijos dl sukauptos kinetins energijos pavirius tampa igaubtas ir slgis
nukreipiamas emyn. Matuojant svyravim dan ir bang sklidimo greit, galima rasti paviriaus
tempimo koeficient.
120 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
LABORATORINIS DARBAS
Tirpalpaviriaus tempimo tyrimas
Darbo uduotis
Itirkite tirpalo paviriaus tempimo koeficiento priklausomyb nuo koncentracijos.
Darbo priemons ir prietaisai
renginys tirpalo paviriaus tempimo koeficientui matuoti, kiuvets su tirpalais ir vandeniu,
stiklins.
Darbo metodika
Tirpalo paviriaus tempimokoeficientas matuojamas maksimalaus slgio burbuliuke bdu. Tam
skirtas renginys (5.3.9 pav.) susideda i vandens pripildyto aspiratoriaus (A), guminiais vamzdeliais
ir keturakiu (D) sujungto su manometru (M), ir sandariai udaryto indo (B) virutine oro ertme,
kur pripilama iektiektiriamojoskysio. Indas (B) udarytas stikliniuvamzdeliu(C), kurioapatinis
plonasis galas negiliai panardintas tiriamskyst, ovirutinis sujungtas suatmosfera. Per akotuvo
votuv visa sistema jungiasi su atmosfera.
Jeigu udarius akotuvo votuv iek tiekatsukamas aspiratoriaus votuvas, tai vanduopradeda
ltai tekti i jo specialind. Tada aspiratoriaus virutinjedalyje, kartu ir sujuo sujungtose indo
(B) virutinje dalyje ir manometro (M) deiniojoje alknje, susidaro oro iretjimas. Pamau
itekant vandeniui i aspiratoriaus, slgis inde (B) sumaja. Dl slgi skirtumo Ap tarpindo (B)
vidaus ir iors apatiniame plonajame vamzdelio(C) gale susidaro oroburbuliukas, panaiai, kaip
puiant gumine kriaue(5.3.6 pav.). Didinant Ap
tas oro burbuliukas tolydio didja, nors i
pradi jo spindulys sumaja, ir didjant slgi
skirtum Ap atsveria paviriaus tempimas,
randamas pagal (5.3.6) formul. Burbulo
spindulys r greitai nustoja mati, nes jis negali
bti maesnis u vamzdelio angos spindul R.
Burbuliukas atitrksta tuo momentu, kai slgi
skirtumas, matuojamas manometru, virija
didiausi galim slgio reikm, priklausani
nuo paviriaus tempimo
. / 2
max
R p o =
(5.3.12)
Taigi o imatuoti galima naudojantis (5.3.6)
ir (5.3.12) formulmis. Taiau burbuliuko spin-
dulio negalima nustatyti tiesiog matuojant kapi-
5.3.9 pav. Tirpalo paviriaus
tempimo koeficiento matavimo renginys
H
A
B
C
D
M
MOLEKULIN FIZIKA ____________________________________________________________________ 121
liarospindul, nes burbuliukospindulys nesutampanei sukapiliaroioriniu, nei suvidiniuspinduliu.
Be to, vamzdelis paprastai nebna visikai apvalus. Todl paprasiausia burbuliukospindul laikyti
i bandymonustatomu parametru.
Taigi burbuliukas atitrksta tada, kai atmosferos oro slgio ir oro slgio inde (B) skirtumas,
matuojamas skysiomanometroalknse aukiskirtumuH, atsveriaslg, sukuriambandomojo
skysio paviriaus tempimo o. I ia iplaukia, kad burbuliukui atitrkstant tarp j galioja sryis
; AH = o
(5.3.13)
ia Aproporcingumokoeficientas, priklausantis nuodetalimatmen, t. y. pastovus iamrenginiui
dydis. Jamnustatyti btina atlikti bandym sukokiu nors skysiu, kuriopaviriaus tempimas gerai
inomas, pavyzdiui, vandeniu. staius atitinkamas H
0
ir o
0
vertes (5.3.13) formul, nustatoma
prietaisokonstanta
.
0
0
H
A
o
= (5.3.14)
Tuomet tiriamojo skysio paviriaus tempimo koeficientas randamas pagal formul
.
0
0
H
H
o o = (5.3.15)
Darbo eiga
1. aspiratori pripilama vandens, o ind (B) distiliuoto vandens tiek, kad vamzdelio (C) galas
tik iektiekliestvandens paviri(panirt vanden ne giliaukaip2 mm). Atsukus jungiamojo
vamzdelio (D) votuv, prietaiso viduje sudaromas atmosferos slgis. Skysi lygiai mano-
metro alknse turi susilyginti.
2. Po to, usukus akotuvo (D) votuv, aspiratoriaus votuvas atsukamas tiek, kad slgis kist
pakankamai ltai ir bt galima lengvai nustatyti lygi aukius manometre burbuliuko ati-
trkimo momentu. Kai burbuliuk susidarymo danis nusistovi, nustatoma manometro H
rodmen vert. Matavimai atliekami ne maiau kaip deimiai burbuliuk ir i j ivedamas
vidurkis. Sumainus arba padidinus burbuliuk susidarymo greit, vl imatuojamas H. Jeigu
gauta reikm sutampasuprie tai buvusia, tai bandymoslygos parinktos gerai. Jeigurezultatai
priklauso nuo burbuliuk susidarymo greiio, tai reikia sureguliuoti vandens itekjimo i
aspiratoriaus greit taip, kad tokios priklausomybs nebt.
3. staius (5.3.14) formul gaut reikm H
0
ir paimt i lenteli arba grafiko o
0
esamai
temperatrai, randama prietaisokonstanta A.
4. Ipylus vanden i indo (B) speciali stiklin, indas pripildomas tam tikros koncentracijos
metilo spiritu. Prie matavim btina kruopiai praskalauti indo (C) galiuk tuo paiu tirpalu.
5. Poto, kaipir vandens atveju, nustatomas auktis Hir pagal (5.3.15) formulrandama atitinkama
o reikm.
122 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
6. Pakartojus panaius matavimus su tam tikros koncentracijos tirpalais, matavim rezultatai
suraomi lentel:
c, H, mm o, N/m
7. Nubraiomas paviriaus tempimo koeficiento o priklausomybs ( ) (c f = o ) nuo spirito
koncentracijos c grafikas. vertinamas matavim tikslumas.
5.4. Garavimas ir kondensacija. Oro drgm. Virimas
ems atmosfera.
Skysi garavimas ir kondensacija.
Sotieji ir nesotieji vandens garai.
Santykin ir absoliuioji oro drgm.
Oro drgms matavimo bdai ir prietaisai.
mogaus organizmotermoreguliacija.
Darbo vietos mikroklimatas.
Skysi virimas.
Virimo temperatros priklausomyb nuo iors slgio.
5.4.1. ems atmosfera
ems rutul madaug 1000 km storio sluoksniu dengia atmosfera. Ji, tarytum oro okeanas, ir
elgiasi panaiai: juda, maiosi, slegia apatinius sluoksnius gana dideliu slgiu. Jros lygyje is slgis
lygus 10
5
Pa. Taigi mogaus kno paviri veikia sumin madaug 10
5
Njga. Oro tankis maja
kylant vir beveik 99 %oro mass yra 50 kmstorio apatiniame sluoksnyje.
Atmosferos or sudarodviej tipdujos ir garai. Pirmajamtipui priklausodujos, kuri koncen-
tracija ore nekinta arba kinta labai neymiai: azotas 78,084 %, deguonis 20,964 %, argonas
0,934 %, kitos tauriosios dujos apie 0,01 %. Antrajamtipui priklauso dujos ir garai, kuri kon-
centracija atmosferoje nuolat kinta ir kurie geografikai pasiskirst labai netolygiai: vandens garai,
anglies dioksidas, ozonas ir kitos. iamtipui priklauso ir vienos i taurij duj radonas, kurio
kiekis kinta dl radioaktyvij virsm, taippat ozonas, susidarantis i oro deguonies virutiniuose
atmosferos sluoksniuose veikiant jonizuojanioms dalelms. Ozonas, kurio koncentracija yra di-
diausia atmosferos sluoksnyje nuo 40 iki 80 kmauktyje, apsaugo gyvnus, taip pat ir mog nuo
kenksmingos ultravioletins Sauls spinduliuots.
Vandens garvaidmuoformuojant atskir vietoviorus ir klimat apskritai yra labai svarbus. I
visoems atmosferojeyra1,24 10
16
kg vandens gar. Nors vandens garkilmemjeiki iol nra
MOLEKULIN FIZIKA ____________________________________________________________________ 123
visikai aiki, vidutinikai atmosferoje yra tiek vandens gar, kad visiems susikondensavus ems
pavirius pasidengtmadaug 2,4 cmstorioitisiniuvandens sluoksniu. Kylant auktyn, vandens gar
koncentracija maja. Beveik visi vandens garai yra sutelkti apatiniame madaug 10 km storio
atmosferos sluoksnyje. Vir tropopauzs atmosferos oras yra labai sausas. Tikstratosferoje kartais
susidaroperlamutriniai debesys, taigi tentaippat gali susidaryti sotieji vandensgarai. vairigeografini
platumatmosferojevandens gar koncentracijairgi labai nevienodaekvatoriaus srityseties ems
paviriumi vandens gar koncentracija yra 2,6 %, oties aigaliais tik 0,2 %.
Vanduoi vandens telkininuolat garuoja, orosrautai nuneavandens garus kartais u tkstani
kilometr, susidarius reikiamoms slygoms garai kondensuojasi ir lietaus ar sniegopavidaluikrenta
ant ems paviriaus. Drgm dirvoje yra btina augalams augti, o vandens garai ore btini ir
gyvnams. mogus jauiasi gerai, kai oro drgm yra nuo 50 iki 70 %.
Vandens garavimas ems paviriujebei vandens gar susidarymas atmosferojeyralabai svarbus
fizikinis ir biologinis procesas, nes paslptoji garavimo iluma yra didel, palyginus su savitja oro
iluma. Garavimas yra tas procesas, kuris padeda igyventi mogui ir induoliams tropikuose.
iluma, isiskyrusi kondensuojantis 1 g vandens gar, yra pakankama 1 kg orotemperatrai pakelti
2,5 K. Vandens garai dl j svarbaus vaidmens perneant ilum vadinami atmosferos ilumos
variklio darbine mediaga. Vandens gar koncentracija ore priklauso nuo vairi veiksni: at-
mosferos slgio, temperatros, vjo stiprumo ir krypties, aukio.
Klimato slygos darbo vietoje daniausiai nusakomos iais pagrindiniais parametrais: oro
temperatra, slgiu, drgmeir orosrauto(vjo) greiiu. Yraitirtaklimatoslygtakadarbingumui,
savijautai, nustatytos higienins palankiausios mogui klimato parametr normos. Aiku, geras
darbo slygas nusako ne tik atskiri minti parametrai, bet j derinys. Daniausiai net udarose
patalpose vis klimato parametr optimizuoti nepavyksta. Iki iol daugumos patalp oras neak-
limatizuotas. Suprantama, oroslgis beveik visuomet (iskyrus lktuv salonus) nereguliuojamas.
5.4.2. Barometrin formul. Bolcmano pasiskirstymas
Atmosferos slgis tamtikrame auktyje h vir ems paviriaus priklauso nuo to, koks yra vir jo
esanioorostulpo sunkis. Oro slgiopriklausomyb nuoaukio vir ems paviriaus ireikiama
taip:
p =p
0
e
mgh/kT
;
(5.4.1)
ia e ~ 2,72 natraliojo logaritmo pagrindas, g laisvojokritimo pagreitis, m vienos molekuls
mas, h auktis vir ems paviriaus, k Bolcmano konstanta, T absoliuioji temperatra. Kai
h = 0, tai slgis p = p
0
. Lygyb (5.4.1) vadinama barometrine formule. Ja naudojantis galima rasti
aukt vir ems paviriaus, kai inomas atmosferos slgis auktyje h ir jros lygyje. Barometrai,
kuri skals sugraduotos metrais ir yra skirti aukiui matuoti, vadinami altimetrais. Graduojant
vedamos temperatrins ir laisvojo kritimo pagreiio pataisos, nes (5.4.1) formulje laikoma
T = const ir g = const, o tai teisinga tik nedideliame auktyje (keli deimi km), kitais atvejais
reikia atsivelgti T ir g priklausomyb nuo aukio.
124 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Kita vertus, slgis p proporcingas molekuli tankiui
n: p = nkT. Vadinasi, (5.4.1) formul ireikia molekuli
tankio, kylant vir ems paviriaus, majim:
n =n
0
e
mgh/kT
; (5.4.2)
ia n ir n
0
molekuli skaiius trio vienete takuose,
kuri auki skirtumas yra h.
Barometrin formulgalioja tada, kai dalel yra gra-
vitacijos lauke. Sandauga mgh yra molekuls potencin
energija auktyje h. Vadinasi, molekuli pasiskirstymo
pagal aukt formul kartu ireikia ir molekuli
pasiskirstym pagal j potencines energijas:
n =n
0
e
E
p
/kT
; (5.4.3)
ia n
0
molekuli skaiius trio vienete erdvs dalyje, kurioje j potencin energija laikoma lygia
nuliui, n molekuli skaiius trio vienete toje erdvs dalyje, kurioje j potencin energija yra E
p
.
I (5.4.3) formuls matome, kadmolekuls pasiskirstotaip, kadjpotencinenergijabtmaiausia,
ir atvirkiai molekuli tankis maesnis ten, kur j potencin energija didesn. L. Bolcmanas
(L. Boltzmann) rod, kad is pasiskirstymas galioja ne tik ems gravitacijos lauke, bet ir
kiekviename potencialiniame lauke, kuriame vyksta chaotikasis iluminis dalelijudjimas. Todl
daleli (5.4.3) pasiskirstymas vadinamas Bolcmano pasiskirstymu (5.4.1 pav.).
5.4.1 pav. Daleli pasiskirstymas
pagal potencin energij (Bolcmano)
D
a
l
e
l
i

s
k
a
i

i
u
s
Energija
T1
T2>T1
T
1
T
2
>T
1
5.4.3. Atmosferos sandara
5.4.2 paveiksle pateikta atmosferos temperatros priklausomyb nuo aukio vir ems pavir-
iaus. Kaip matyti, temperatros kitimo kreiv yra sudtinga, t. y. temperatra i pradi maja,
vliau tamtikrame auki ruoe ji yra pastovi, vliau vl pradeda didti, po to vl yra pastovi dar
didesni auki ruoe, po to vl maja, yra pastovi ir vl didja. Pagal temperatros pokyius
atmosferoje ji yra skirstoma keturis sluoksnius. Atskir sluoksniribos yra pastovios temperatros
ruouose, taiau kadangi tokie ruoai tsiasi ~10 km, tai ribos nustatymas yra slyginis ir jis iek
tiek skirtingas vairi autori darbuose. Troposfera (gr. tropos poskis, gr. sphaira rutulys) yra
artimiausias emei sluoksnis, kuriame yra 75 %vis atmosferos duj, dulki ir vandens gar. Ji
tsiasi nuo ems paviriaus iki 1016 km aukio vir ems. Troposferos storis vir ems
paviriaus kinta priklausomai nuo Sauls energijos srauto, pasiekianio em, jis didiausias
pusiaujyje, o maiausias aigaliuose. Troposferoje temperatra vidutinikai sumaja 7
o
Cpakilus
1 km. Jei ems paviriaus temperatra yra 15
o
C, tai minimali troposferos temperatra 11 km
auktyje yra apie minus 60
o
C. Meteorologiniu poiriu troposfera yra svarbiausias atmosferos
sluoksnis, nes 99 %ms or formuojasi ia. Arti io sluoksnio viraus egzistuoja riba, vadinama
tropopauze (gr. tropos poskis, gr. pausis sustojimas), kuri yra tarytum lubos or zonai.
Energija, E
p
D
a
l
e
l
i

s
k
a
i

i
u
s
,
n
/
n
0
MOLEKULIN FIZIKA ____________________________________________________________________ 125
Tropopauzje vyrauja stiprs vjai, j
greitis gali siekti 120450 km/h. J kryptis
ir greitis nuolat kinta.
Kad atmosferos temperatra maja
didjant aukiui, buvo sitikinta dar
XIX amiuje, kai atsirado karto oro ba-
lionai. Tam tikru laikotarpiu egzistavo
nuomon, kad atmosferos temperatra
maja vis laik tolstant nuo ems
paviriaus. Taiau jau 1899 m. buvo
sitikinta, kad atmosferos temperatros
majimas sustoja madaug 1016 km
auktyje, kur baigiasi troposfera ir pra-
sideda naujas sluoksnis, vadinamas stra-
tosfera (lot. stratum poskis, gr. sphaira
rutulys), besidriekiantis auktyn ma-
daug iki 50 km. Stratosferojetemperatra
vl pakyla iki ~0
o
C. Ozono sluoksnis,
sugeriantis daugum aling UV spin-
duli, yra stratosferoje madaug 24 km
auktyje. Vir stratosferos 5085 km
auktyje yra mezosfera (gr. mesos
vidutinis, vidurinis, gr. sphaira rutulys), vir jos 851000 kmauktyje yra termosfera (gr. thermos
iltas, kartas, gr. sphaira rutulys). Mezosferoje temperatra maja vl net iki minus 90
o
C, o
termosferoje gali pakilti net iki 1480
o
C. Termosfera yra dalijama dvi dalis. Jonosfera (gr. ion
einantis, gr. sphaira rutulys) yra sluoksnis elektrint daleli, kuris prasideda tarp80 ir 85 kmvir
ems paviriaus. Sauls spinduliuojama Rentgeno ir UV spinduliuot, patekusi termosfer,
jonizuoja sluoksnio molekules, sukurdama teigiamus jonus ir laisvus elektronus. ie jonai ir
elektronai atspindi ilgsias radijo bangas, ispinduliuotas nuo ems paviriaus atgal em.
Jonosferos sluoksnis yra jautrus elektrint daleli, atlekianii Sauls, poveikiui ir tai daro tak
radijo bang atspindiui. Kitas termosferos sluoksnis vadinamas egzosfera (gr. exo iorje,
gr. sphaira rutulys). Jis prasideda 500700 km auktyje vir ems paviriaus ir isipleia
tarplanetin erdv. Egzosferoje yra tiknedideliotankiovairi duj, otemperatra iagali kisti nuo
300 iki 1650
o
C. Dl silpnos ems traukos ios dujos lengvai ilekia tarpplanetin erdv.
Termosfera mus papildomai apsaugo nuo meteorit, nustojusi veikti palydov ir kit nuolau,
nes jos sudegaauktojetemperatroje.
5.4.4. Oro masi judjimas atmosferoje
Vertindami oromasi(tamtikrdiskreioroporcij) perna vertikaliaarba horizontalia kryptimi
veikiant vjui arbaturbulentikumui meteorologai taikotermodinamikos principus. Laikant proces
adiabatiniu, t. y. kaddiskreti oro porcija nei gauna ilumos, nei atiduoda aplinkai, galima nustatyti
-100 -90 -80 -70 -60 -50 -40 -30 -20 -10 0 10 20
0
10
20
30
40
50
60
70
80
90
100
500
600
1000
Stiprsvjai
Temperatra,
o
C
A
u
k

t
i
s
v
i
r

r
o
s
l
y
g
i
o
,
k
m
Didiausiaozono
koncentracija
Everestovirukaln
Tropopauz
J onosfera
Egzosfera
Termosfera
Stratosfera
Troposfera
Mezosfera
5.4.2 pav. Atmosferos dalijimas keturis
sluoksnius temperatros pokyi pagrindu
,
126 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
temperatros, slgio ir aukio sryius. Tegu diskreti oro porcija, turinti vienetin mas, truput
pakyla ir isipleia, nes iorinis slgis, kylant auktyn, sumaja dydiudp. Jei nra ilumos tekjimo,
tokiampltimuisi naudojama vidin energija ir dl todiskreios oroporcijos temperatra sumaja
dydiu dT.
vyksm patogu iskaidyti dvi pakopas:
1) esant pastoviam slgiui ir triui, diskreti oro porcija pakyla ir atla, atiduodama ilumos
kiek T C
v
d ,
2) nugaldama iorin slg p, diskreti oro porcija pleiasi, sunaudodama energij V pd .
Adiabatiniam vyksmui i ilumos kieki suma turi bti lygi 0. Papildomai pasinaudojant
tobuljdujbsenos lygtimi bei sryiutarpizochorins (esant pastoviamtriui) molins ilumins
talpos
v
C ir izobarins (esant pastoviam slgiui) molins ilumins talpos
p
C
bei suintegravus
galima gauti temperatros ir slgio sry adiabatiniamkilimui
p v p
C C C
p T
) (
=
.
Orui santykis
29 , 0 ) ( =
p v p
C C C
. inant slgiopriklausomyb nuoaukio(r. 5.4.2 skyrel)
i paskutiniosios lygties galima gauti temperatros priklausomyb nuo aukio. Dydis
p
C g h T / d / d =
vadinamas sausa adiabatine majimosparta; ia h auktis vir ems paviriaus, T temperatra,
g laisvojo kritimo pagreitis. Jis lygus ~0,098 K/mir reikia, kad temperatra sumaja apytikriai
9,8 Kdiskreiai oroporcijai pakilus 1 km. iuoatvejusausas reikia, kaddiskretinje oroporcijoje
nra kondensacijos ar garavimo. Diskreti oro porcija kils auktyn tol, kol jos temperatra bus
didesn u supanio oro temperatr. Taiau procesas gali bti nuostovus ir nenuostovus, ir tai
priklauso nuo konkreios atmosferos temperatros auktesniuose sluoksniuose. Slygos yra
nuostovios, kai diskreti oro porcija greitai pasiekia aplinkos oro temperatr. Tai manoma esant
maesniamtroposferos temperatros gradientui, tai bdinga vakarui ir nakiai. Esant didesniam
troposferos temperatros gradientui kilimoprocesas yrailgesnis ir tai slygojaprocesonenuostovum
ir turbulentikum. Tokios slygos paprastai susidarodienos metu, kai vieiaSaul. inant kylanios
oroporcijos temperatrprie ems paviriaus galimaapskaiiuoti aukt, iki kuriojis gals pakilti.
Pavyzdiui, imant diskreios oro porcijos pradin 16,7
o
C temperatr, kuri pakilo dl Sauls
ildyto ems paviriaus, galima teigti, kadtomis slygomis, kai vidutin oro temperatra ems
paviriuje yra 15,6
o
C, o temperatra 1 km auktyje yra 5,4
o
C, nagrinjama oro porcija kils iki
~1,1 km. Oromass kur kas greiiauir aukiaukyla prieapviestir labiauildytstaipaviri,
nes kilimui ir pltimuisi eikvojama vidin energija gali bti papildyta iluminio laidumo bdu j
paimant i ildyt paviri.
Jei kylaniame ore yra pakankamai daug vandens gar, tai jiems pakilus iki aukio, kuriame
temperatra yra lygi ar emesn u rasos tak, prasideda vandens garkondensacija ir formuojasi
debesys. iuoatvejupasireikia lapias adiabatinis temperatros majimas, nes iadl kondensacijos
ilaisvinama paslptoji garavimoiluma. Ji ildoor ir didina atmosferos nenuostovum, slygojant
MOLEKULIN FIZIKA ____________________________________________________________________ 127
tolesn oroporcijos kilim. Todl tokiooroporcij kilimo metu temperatra krinta liau. Vandens
gar paslptoji garavimo iluma yra labai svarbi formuojantis audroms.
Turbulentikumas atmosferoje yra visur, iskyrus sluoksn gana arti ems paviriaus labai
ramiomis naktimis, o turbulentinis vandens gar ir CO
2
perneimas yra labai svarbus visoms
auktesnms gyvybs formoms. Fotosintezei reikaling CO
2
augalai ima i aplinkos. Turbu-
lentikumo matas gali bti CO
2
kiekis, sugeriamas sveik ali pasli per vien dien. Jis yra
ekvivalentus visamCO
2
kiekiui tarp pakloto ir 30 maukio. Praktikai nors CO
2
koncentracija,
kaipfotosintezje naudojamo elemento, tarpauros ir saullydio sumaja, is sumajimas retai
pranoksta15%vidutins koncentracijos ems paviriuje. ieskaiiai rodo, kaddl turbulentikumo
augmenija gali paimti CO
2
bent i emiausi200 matmosferos, o galbt ir i daug didesniauki.
Maas dieninis CO
2
pokytis stebtas net 500 mauktyje.
5.4.5. Garavimas ir kondensacija. Sotieji ir nesotieji garai
Kadangi skysio molekuls isidsiusios gana arti viena kitos, tai, gijusios pakankamai kinetins
energijos, jos gali nugalti savokaimynitrauk ir palikti jpoveikiosfer. Taiau tokios molekuls
tuoj patenka kit kaimyni poveikio sfer ir atsiduria naujoje laikinosios pusiausvyros padtyje
(plaiau r. 5.1 skyri). Tiktai laisvajame skysio paviriuje esanios molekuls gali ieiti u skysio
rib (tuo paaikinamas skysi garavimas nuo paviriaus).
Skysiuose, esant bet kokiai temperatrai, visada yra tamtikras skaiius molekuli, kurios turi
pakankamai energijos kit molekuli traukai nugalti ir skysio paviriui palikti. Tokiu bdu jos
pereina dujinbsen. Skysioperjimas dujin bsen vadinamas garavimu. Vykstant garavimui,
skyst palieka paios greiiausios molekuls, todl vidutin likusi molekuli energija maja ir
skystis vsta. O garams kondensuojantis (jiems virstant skysiu), garavimui sunaudota iluma
atiduodama atgal: kondensacijos metu skystis suyla. Jei skysio pavirius yra altesnis (maesns
temperatros) nei oras vir jo, tai galimas greitesnis molekuli pagavimas nei j netekimas
Kai oras ir vanduo yra udarame inde, vandens molekuls nuolatos ilekia i skysio or,
sudarydamos vandens garus, bet kartu vyksta ir atvirkias procesas, kondensacija, vandens gar
molekuls pereina skyst. Kai vandens gardalinis slgis p didja, garavimosparta majair tampa
lygi nuliui, kai ilekiani per tamtikr laiko tarp molekuli skaiius yra tiksliai lygus grtani
per tok pat laiko tarp skyst skaiiui. Tada oras laikomas prisotintu vandens garais ir dalinis
slgis yra soij gar slgis, ymimas p
s
. Jis stipriai priklauso nuo temperatros.
Prisiminus tobuljduj slgiosry sutemperatra (5.2.8), galima paymti, kadsoij gar
atveju slgis ne tikpriklauso nuo temperatros tiesiogiai, bet ir per molekuli tank n, kuris didja,
didjant temperatrai. Tiksli priklausomyb gaunama i Klauzijaus ir Klapeirono lygties
( )
2 1
V V T
L
T
p

=
d
d
, (5.4.4)
kuri sieja dvifazs sistemos (skysioir josoij gar) pusiausvyros slg p ir temperatr T. ia L
savitoji garavimo iluma, V
1
ir V
2
atitinkamai dujins ir skystos fazs triai.
128 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Praktikoje naudojama soij gar slgio priklausomybs nuo temperatros formul:
p
s
(T) =p
s
(T
n
)e
A(TT
n
) / T
;
ia RT LM A /
v
=
n
, T
n
273 = K(0
o
C), L savitoji garavimo iluma (r. pried 10 lentel), M
v

vandens molio mas. Mikrometeorologijoje svarbus parametras ) (T p
s
kitimo sparta kintant
temperatrai. Nuo 0 iki 30
o
Cintervale, ) (
s
T p didja apie 6,5 %/K, tuo tarputobulj duj slgis
didja tik 0,4 %/K.
Oro su vandens garais rasos taku (T
r
) vadinama temperatra, iki kurios jis turi bti ataldytas,
kadvandens garai tapt soiaisiais, apibriama i sryio ). (
r s
T p p = ; ia p vandens gar dalinis
slgis. Kai vandens gar slgis inomas, rasos takas randamas i lenteli arba i formuls
( )
.
/ ) ( ln 1
n
n
r
A T p / p
T
T
s
=
Rasos takas labai svarbus rasos susidarymui, kai paviriaus temperatrayraemesnu aplinkos
oro rasos tak.
Oro soij gar slgio deficitas, vadinamasis sotinimo deficitas, yra skirtumas tarp soij
gar dalinio slgio p
s
(T) ir esanioore vandens gar dalinio slgio p, t. y. p
s
(T) p. Ekologijoje tai
danai vadinama oro sausinanios galios matu, nes jis i dalies nustato augal augimo ir vandens
igaravimo spart. Mikrometeorologijoje sotinimo deficito gradientas yra pusiausvyros nebuvimas
tarp lapio paviriaus ir alia jo praeinanio oro.
5.4.6. Santykin ir absoliuioji drgm
Oro temperatr, drgm ir srautus galima dirbtinai reguliuoti. Oro drgm charakterizuojama
dviemdydiais: absoliuija ir santykine oro drgme.
Viename kubiniame metre oro esani vandens gar mas vadinama absoliuija oro drgme.
Esant 0C temperatrai ir 760 mm Hg slgiui, 1 m
3
sauso oro mas lygi 1,293 kg. Drgnas oras,
palyginti su sausuoru, yra santykinai lengvesnis, todl laikosi paviriuje. Tai paaikinama tuo, kad
drgno oro tankis yra sauso oro ir vandens gar tanki suma. Kadangi vandens molio mas
M
v
=18 gmol
1
, o sauso oro molio mas M
o
=29 gmol
1
, tai drgno oro tankis tuo maesnis kuo
didesnis yravandens gartankis. Todl ems paviriuje susidars drgnas oras bdamas lengvesnis
kyla auktyn. Nagrinjant ilumos perna, svarbu inoti, kokiai temperatrai esant drgno oro
tankis bus toks pat kaip sauso oro.
Absoliuioji drgm nenusako oro sotinimo vandens garais laipsnio. Tam vedamas dydis, va-
dinamas santykinedrgme. Orosantykine drgme yravadinamas absoliuiosios orodrgms mass g
ir 1m
3
esanios tokios garmass G, kuris sotinttos paios temperatros or, santykis:
r =g/G. (5.4.5)
is dydis danai naudojamas klimato statistikoje ir kartu nusako orodiovinant poveik, taiau
jis svarbiausias nusakant termodinamin pusiausvyr tarpvandens ir vandens gar. Grynovandens
MOLEKULIN FIZIKA ____________________________________________________________________ 129
paviriuje termodinamin pusiausvyra nusistovi, kai r = 1. Taiau kai vandenyje yra itirpusios
druskos (pvz., augallstelse) arbakai vanduokapiliarumojgyralaikomas portosemediagose
(kaip dirvoemyje), pusiausviroji santykin drgm yra maesn u vienet.
Pavyzdiui, pyrago gabalai ir sausainiai ilaiko savyje vanden, kuris yra pusiausvyroje su
konkreia santykine drgme. Bdami ore, kur r didesn, ie daiktai sugeria vanden, bet j praranda
atiduodami orui, jei oro drgm r yra maesn. Kadangi sausaini poros daug maesns negu
pyrago, tai j pusiausviroji santykin drgm yra emesn. Santykin oro drgm virtuvse yra
tokia, kadpalikti ant stalosausainiai paprastai sugeria vanden ir tampa minkti, opyragas praranda
vanden ir tampa trapus.
Danai absoliuioji drgmireikiama vandens gar dalinio slgiovienetais. Tuomet santykin
oro drgm skaiiuojama kaipsantykis absoliuiosios drgms ir soij gardalinio slgio verts,
esant tai paiai temperatrai.
Bet kuriojepastovioje temperatroje vandens garslgis yra proporcingas vandens garmasei.
Tai iplaukia i Klauzijaus ir Klapeirono lygties
; RT
M
m
pV =
(5.4.6)
ia p duj (vandens gar) dalinis slgis, V j tris, m mas, M duj vieno molio mas, R
universalioji dujkonstanta, T temperatra(Kelvinolaipsniais). Abi (5.4.6) lygties puses padalijus
i Vir inant, kad m/V = yra duj (gar) tankis, gaunama
RT,
M
p

= arba p ~ .
Vandens gar dalin slg paymjus p, osoij gar slg paymjus p
s
, galima urayti
r =p(T)/p
s
(T). (5.4.7)
Santykin oro drgm ireikiama procentais, todl (5.4.7) formul galima urayti taip:
r = p(T)/p
s
(T) 100 %. (5.4.8)
5.4.7. lapi paviri ilumos balansas
lapiais laikomi tokie paviriai, kurie yra padengti grynu vandeniu arba drusk tirpalu. Laisvoje
atmosferoje temperatra ir gar slgis atitinkamai yra Tir p, o vandens paviriuje yra T
0
ir p
s
(T
0
).
iluma perduodama i atmosferos paviridl konvekcijos, oatiduodama i paviriaus atmosfer
dl garavimo. Jei pavirius gauna papildomos ilumos i Sauls spinduliuots, tai reikia atsivelgti,
nes nuo ioproceso spartos taip pat priklauso paviriaus temperatra.
Taigi lapias pavirius yra iltesnis arba altesnis negu vir jo judantis oras priklausomai nuo to,
ar gauta i Sauls iluma yra didesn, ar maesn u paviriaus atiduodam ilum atmosferai.
Pavyzdiui, norint apskaiiuoti, kiek vandens igaruoja i atviro vandens baseino per kelias
savaites ar mnesius, btina vertinti vandens baseino ilumin talp. Kuo gilesnis eeras, tuo
130 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
ilgesnis turi bti laikotarpis vidurkiui rasti. Kartais jis gali siekti metus. Todl realiai maksimalus
garavimo laikotarpis dl tokio vidurkinimo gali enkliai pasikeisti.
Garavimonuovandens pavirisparta tiesikai didja didjant spinduliuots sugerties spartai ir
sotinimo deficitui p
s
(T) p. Jis didja kartu su vjo greiiu.
Lap ar augmenijos ilumos balansas daugiausia priklauso nuo aplinkos ir biologini audini.
J temperatra negali bti kontroliuojama itisomis valandomis ir labiausiai priklauso nuo Sauls
spinduliuots srauto. Apraytasis lapi paviri pavyzdys tinka ir augal lapams. Vandens nuo
lapo ir lapio paviriaus garinimo pagrindiniai skirtumai yra tokie:
1. Garavimo spartos priklausomyb nuo spinduliuots sugerties spartos ir sotinimo deficito.
Vandens paviriaus garavimo sparta yra baigtin, net kai spinduliuots sugertis ir sotinimo deficitas
yralygs nuliui. Ji tiesikai didjadidjant iems dydiams, kai kiti yrapastovs. Natraliojeaplinkoje
lap ilumin vara labai priklauso nuo Sauls spinduliuots sugerties spartos. Nesant viesos, j
iotels yraudarytos taip, kadgaravimas yranulinis. (Garavimas vykstatikper vakuotus pavirius.)
Be to, pastebta, kad lapai ioteles udaro, kai sotinimo deficitas spariai didja, taip taupomas
vanduo. Taigi lape vyksta nevisikai dar suprasti savisaugos procesai, i dalies keiiantys garavimo,
palyginti su vandens paviriais, pobd.
2. Garavimospartos ir temperatros priklausomyb nuovjogreiio. Didjant vjogreiiui, garavimo
nuolapipavirisparta didja, opaviriaus temperatramaja. Teorikai lapilumos nuostoliai
dl garavimoturtnepriklausyti nuovjogreiio, taiaukai ilumos nuostoliai pranoksta tamtikr
krizin vert, dl didjaniovjo greiiogaravimoilumos nuostoliai didja.
Atsirads ant lap lietaus vanduo yra igarinamas greiiau, nes jamnereikia pereiti pasienio
laposluoksnio(r. 5.1 skyri), kaipesaniamlape vandeniui. Tokiu bdu yra igarinama gana daug
vandens, ypa tose zonose, kur dani liets.
3. Lapo ir oro temperatros ryys . Sauls atokaitoje esani lap temperatra kur kas didesn
u oro temperatr alto klimato kratuose ir maai skiriasi nuo oro temperatros arba net yra
maesn nei oro karto klimato zonoje. Tai svarbu arktiniams augalams iaurje ilikti. Antras
aspektas yra tas, kadsotinimo deficitas iltuose kratuose yra daug didesnis. Tropikuose medis gali
ilaikyti lap temperatr, artim oro temperatrai (3040C), kai jo aknys gali pakankamai
paimti bei igarinti vandens ir jis atveria lap ioteles.
4. Didjant lap iluminei varai, maja igarinamo vandens mas, bet dl konvekcijos didja
lapoilumos nuostoliai. Tada lapo temperatraSauls atokaitoje paprastai yra tik 12Cauktesn
nei aplinkos oro.
Nakties metu, kai nra Sauls spinduliuots poveikio, lap temperatra yra visuomet maesn
u oro temperatr, tada prasideda kondensacija ant lapo. Rasos formavimosi sparta yra apie
0,060,07 mm/h, kai oras yra prisotintas vandens gar, bet gali bti daug maesnis neprisotintame
ore. Todl per nakt ant augal lap gali susidaryti apie 0,20,4 mmstorio rasos sluoksnis.
MOLEKULIN FIZIKA ____________________________________________________________________ 131
5.4.8. Gyv organizmtermoreguliacija. Darbo vietos mikroklimatas
Skirtingai nuo augmenijos, iltakrauj gyvn vidin temperatra gali bti palaikoma gana
siaurame intervale derinant spart, kuria iluma yra gaminama dl metabolizmoarba prarandama
dl garavimo. iltakraujai gyvnai dar vadinami homojoterminiais. altakraujai, arba
poikiloterminiai, gyvnai sudaro tarpin tarp iltakrauj gyvn ir augmenijos klas. J meta-
bolizmo sparta yra gana maa, jie dideli kari ir ali stengiasi ivengti pasislpdami elyje
arba rasdami pastog. Pavyzdiui, drieai, sausumos vliai, bits stengiasi pasirinkti aplink,
kurioje Sauls spinduliuot pakelia jknotemperatr iki 3035
o
C, t. y. iki prastos altakraujams
gyvnams temperatros.
Bet kurio gyvno ilumos balans galima apibrti lygtimi
M+R=C+E+G,
kurios kiekvienas narys nurodo ilumos tk arba nuostolius per vienetin kno paviriaus plot.
M yra ilumos gaminimo sparta dl metabolizmo; G laidumas per pagrind, ant kurio gyvnas
stovi ar guli; garavim apibdinantis narys E susideda i dviej dali ilumos nuostoli per
kvpavimo sistem ir prakaitavimo per od ; dydis Rapibdina ilum, gaunam ar prarandam
dl spinduliavimo, o C dl konvekcijos.
ia plaiau apvelgiami ilumos nuostoliai dl garavimo.
Neprakaituojant ir ramiai kvpuojant, gyvno ilumos nuostoliai dl kvpavimo sudaro
tik ma dal metabolizmo gaminamos ilumos. Pavyzdiui, mogui kvpiant saus or
E
r
/ M ~ 10 %. skaitant garavim per od, bendri garavimo nuostoliai yra apie 2530 % me-
tabolizmo ilumos. Taiau kai mogus prakaituoja, jis gali prarasti iki 1,5 kg skysi per valand,
o tai atitinka 600 W/m
2
.
Santykio E/Mkitimas rodogyvn adaptacij sausame ore. Pavyzdiui, dykum ropli E/M
daniausiai yra maas; jie net ikvpiam i plaui vanden stengiasi sulaikyti nosies tarpuose, kur
temperatra yra emesn (+25
o
C) ir vandens garai kondensuojasi. Igarinama vandens mas
priklauso nuo gyvno kno trio, o igarinimo sparta nuo paviriaus ploto. Vabzdiai turi didel
ploto ir triosantyk, todl aldymas garinant vanden yra prabanga. mogus ir kiti didesni gyvnai
gali tik tam tikr laiko tarp naudoti vanden, kad sumaint kno temperatr. Kuo didesnis
gyvnas, tuo ilgiau jis gali ilikti be iorinio vandens altinio.
iltakrauj gyvn kno temperatra ilieka pastovi , kai
AQ
p
= AQ
n
; (5.4.9)
ia AQ
p
organizmo sukurtas, o AQ
n
aplinkai perduotas ilumos kiekis per vienod laiko
tarp. AQ
n
slygojamas trij pagrindini vyksm: spinduliavimo, konvekcijos (r. 5.5 skyri) ir
garavimo. Normaliomis slygomis daugiausia ilumos knas praranda dl spinduliavimo. Vandens
garinimas, skaitant prakaitavim ir kvpavim (ikvepiamame ore yra vandens gar), sudaro iki
15 organizmo ilumos nuostoli. Prakaituojant prarandamas ilumos kiekis priklauso nuo
aplinkos temperatros ir oro drgms, taip pat nuo kno pavirinio sluoksnio bsenos. Mat,
132 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
esant emai aplinkos temperatrai, poodinio sluoksnio venos sublikta, ir kraujas ird teka
gilesniuose sluoksniuose alia arterij esaniomis venomis. Tuomet grtaniamvenomis kraujui
perduodamas ilumos kiekis i arterinio kraujo. Dl i prieasi galns altyje atvsta greiiau,
taiau vidin kno temperatra nepakinta. Ir atvirkiai, iltoje aplinkoje pavirins venos
isipleia, jomis teka daugiau kraujo, pakyla odos temperatra, todl efektyviau atiduodama
iluma aplinkai.
ilumos netekimo prakaituojant sparta ireikiama taip:
(
pr
kS
t
Q
=
A
A
(p
o
p
a
);
(5.4.10)
ia k koeficientas, S kno paviriaus plotas (priklauso nuo rb), p
o
odos paviriuje esantis
gar slgis, p
a
aplinkos oro vandens garslgis. Kambario temperatroje ir nesant vjo, prakai-
tuodamas mogus netenka apie 7 organizmo sukurto ilumos kiekio.
Suprantama, ilumos apykaitos kitimas labai priklausonuorbizoliacinisavybi. Pavyzdiui,
lengvas vasarinis kostiumas, laikant j izoliaciniu vienetu, praleidia ilum 4 kartus lengviau negu
iltas iemos aprdas, o laps kailis yra
net 6 kartus geresnis ilumos izoliatorius.
Kitas parametras, turintis didels
takos ilumos main spartai, yra vjo
greitis. Jei vjo greitis maesnis nei 2 m/s,
tai oro sluoksnis, esantis alia kno
paviriaus, sudaro tamtikr 12 cmstorio
izoliacin sluoksn. Stipresnis vjas suma-
ina sluoksn, todl ilumos mainai labai
paspartja. Tada, esant tai paiai aplinkos
temperatrai, jauiamas atalimas. Pavyz-
diui, 20
o
C aplinkos temperatra, esant
5 m/s vjo greiiui, juntama kaip 17
o
C, o
20 m/s vjyje tik 13
o
C.
Gerai savijautai svarbs visi aplinkos
oroparametrai: temperatra, orodrgm,
slgis ir vjo greitis. Norint atsivelgti
visus mintus aplinkos oro parametrus,
apibriama efektyviosios temperatros
svoka(5.4.3 pav.), i kurios galimasprsti
apie optimalius aplinkos oro parametrus
mikroklimatui.
I paveikslo matyti, kad efektyviosios
temperatros vertbus skirtingakeiiantis
oro judjimo greiiui ar oro drgmei.
5.4.3 pav. Efektyviosios
temperatros kreivs [pagal 9]
40
40
40
35
30
30 30
25
20
20
15
10 10
0
5
0 0,15
0,25
0,5
1,0
2,0
3,0
50 50
Drgnojotermometro
temperatra,
o
C
Sausojotermometro
temperatra,
o
C
o
C o
C
E
f
e
k
t
y
v
i
t
e
m
p
e
r
a
t

r
a
O
r
o
j
u
d

j
i
m
o
g
r
e
i
t
i
s
,
m
/
s
MOLEKULIN FIZIKA ____________________________________________________________________ 133
5.4.9. Oro drgms matavimo prietaisai
Oro drgmei nustatyti naudojami vairi konstrukcij drgmmaiai. Nustatant oro drgm
higrometrais (gr. hygros drgnas), pasinaudojama kai kuri mediagpailgjimu brinkstant arba
pagal uregistruot rasos tak. Paprasiausiame higrometre panaudota mogaus varaus plauko
savyb ilgti didjant oro drgmei. Rasos taku T
r
(r. 5.4.5 skyrel) vadinama temperatra, kai ore
esantys vandens garai tampa soiaisiais. I higrometrins lentels (r. pried 14 lentel) randamas
oreesanigarslgis p(jis lygus T
r
temperatros soijgarslgiui) ir aplinkos orotemperatros
soijgarslgis p
s
. Pagal (5.4.8) formulrandamasantykin drgm. Kita grupprietais, kuriais
nustatoma drgm ir kurie daniausiai naudojami, vadinami psichrometrais (gr. psychros altis).
Paprastai juos sudaro du vienodi termometrai. Vieno i j galas bna apvyniotas higroskopine
mediaga ir leistas ind su vandeniu (plaiau r. darbo Oro drgms nustatymas Asmano
psichrometru metodik).
5.4.10. Virimas
Skysiui suteikus didesn ilumos kiek, negu suvartojama garavimui pastovioje temperatroje,
skysio temperatra didja ir garavimas spartja. Suteikiant vis didesn ilumos kiek, galima skyst
uvirinti. Virimas tai garavimas ne tik i paviriaus, bet ir i viso skysio trio. Verdantis skystis
garuoja taip spariai, kad skysio temperatra nebedidja, nes, kad ir kiek ilumos bt suteikiama
skysiui, ji visada suvartojama garavimui. Virimui esmins reikms turi duj burbulliai, kuri
visada yra skystyje; ypa daug jbna prilipusi prie indosieneli ir skystyje esanismulki kiet
daleli.
Kad prasidt virimas, skystyje turi bti oro ar kit duj burbuliuk, t. y. sistema turi bti
dvifaz, nes prieingu atveju virimas negali prasidti. Jeigu skystis bt homogeninis, tai jamvirti
(garuoti i visotrio) reikt, kadvisametryje susidaryt gausyb soijgarburbuliuk. Kitais
odiais tariant, didiausi energij turinios skysio molekuls turt kakaip susirinkti kartu ir
sudaryti mayt soijgarburbuliuk. Viendl jomaoskersmens jis btsugniudytas miliniko
papildomo slgio po kreivu skysio paviriumi, kuris pagal Laplaso dsn lygus
;
2
r
p
o
=
(5.4.11)
ia o skysio paviriaus tempimo koeficientas, r burbuliuko spindulys.
Jeigu skystyje yra nedideli oro burbuliukai, prilip prie indo sieneli ar kit skystyje esani
daikt, tai jie gali tapti garavimo centrais. tuos burbuliukus garuoja skystis, juose susidaro sotieji
skysio garai, o burbuliukai, kaitinant skyst, tolydio didja. Prilipusius burbuliukus prie sieneli
veikia dvi prieing krypi jgos: vertikaliai auktyn nukreipta Archimedo jga ir emyn
burbuliuko sunkiojga. J atstojamoji
( )
3
0 sk A
3
4
gr F t =
;
(5.4.12)
134 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
ia
sk
ir
0
atitinkamai skysio ir oro tankiai, g laisvojo kritimo pagreitis. Burbuliukus laiko
prilipusius prie sieneli tam tikra molekulins prigimties prilipimo jga F
p
, tiesiog proporcinga
burbuliuk paviriaus plotui:
F
p
= k r
2
; (5.4.13)
ia k proporcingumo koeficientas, priklausantis nuomolekulini jg didumo ir prilipusios prie
sienels burbuliuko ploto dalies. Didjant burbuliuk matmenims, is koeficientas nekinta.
Stebint virim stikliniame inde, matyti, kad burbuliukai tam tikr laik yra prilip prie indo
dugno ir sieneli. Vadinasi, iuo metu F
p
> F
A
.
Didjant burbuliukspinduliui r, jgaF
A
didjagreiiauneguF
p
, kol jos susilygina. Tuomomentu
burbuliukai atitrksta nuo sieneli ir ikyla skysio paviri. Kadsotieji garai i ikilusi paviri
burbuliuk galt ieiti aplink, jie turi paviriuje sprogti ir atsiverti. Tai gali vykti tik tada, kai
slgis burbuliuk viduje tampa lygus ioriniamj veikianiamslgiui. Bet kuriame skysio gylyje h
ir bet kokiamburbuliuko spinduliui r turi galioti burbuliuk pusiausvyros slyga
p
s ;
2
3
4
sk
3
o
0
r
gh p
r
rT
M
m o

t
+ + = +
(5.4.14)
ia p
s
= f(T) soij gar slgis, netiesikai priklausantis nuo temperatros, lygybs kairiosios
puss antrasis dmuo oro slgis burbuliuko viduje, M
o
oromolio mas, p iorinis (daniausiai
atmosferos) slgis skysio paviri, 2o/r Laplasoslgis pagal (5.4.11) dsn. Lygties kairioji pus
yra slgis burbuliuk viduje, o deinioji j iorje. Kai jie susilygina (majant h, didjant r ir p
s
),
burbuliukai sprogsta ir skystis uverda. Atmetus (5.5.14) lygybje nykstamai maus dydius, virimo
pradios slyg galima suformuluoti taip: kai soij gar slgis pasidaro lygus ioriniam slgiui,
pakil skysio paviri burbulliai sprogsta ir garai ieina aplink skystis pradeda virti. Vadinasi,
ildomas skystis, esant normaliamslgiui, pradeda virti tokioje temperatroje, kurioje jo soij
gar slgis lygus 760 mm Hg stulpelio. Pavyzdiui, vandens virimo temperatra yra 100
o
C. I ia
aiku, kodl virimo temperatra priklauso nuoiorinioslgio: slgiui didjant, virimo temperatra
didja, ir atvirkiai. Vandens virimotemperatrasumaja 1 laipsniu, slgiui sumajus 27 mm Hg
(pavyzdiui, pakilus vertikaliai auktyn vir horizonto 297 m).
Skyst, kuriame nradujburbulli, galima perkaitinti, t. y. galimaildyti iki virimotemperatros,
taiau jis nevirs. Perkaitinto skysio bsena yra nestabili, ir virimas gali prasidti labai staigiai.
Skyst galima perkaitinti ir staigiai sumainus iorin slg, kad jis likt maesnis u soij gar
slg toje temperatroje. Perkaitintas skystis naudojamas didels energijos dalelms registruoti
burbulinje kameroje.
tr
3
MOLEKULIN FIZIKA ____________________________________________________________________ 135
LABORATORINIS DARBAS
Oro drgms nustatymas Asmano psichrometru
Darbo uduotys
Nustatykite:
absoliuij ir santykin oro drgmes;
vertinkite efektyvij patalpos temperatr.
Darbo priemons ir prietaisai
Asmano psichrometras, pipet, stovas.
Darbo metodika
iame darbe reikia nustatyti oro drgm ir, atsivelgiant gaut jos vert, rasti efektyvij patalpos
temperatr, vertinti, ar patalpoje sudaromos optimalios mogaus savijautai slygos.
Orodrgm nustatoma Asmanopsichrometru (5.4.4 pav.). J sudarodutermometrai (T
1
ir T
2
).
Termometro (T
2
) rutuliukas apvyniojamas drobiniu arba kitokios higroskopins mediagos
gaballiu. Jis sudrkinamas vandeniu, kuris garuodamas reikiam ilumos kiek paima i paties
termometro bei jo artimiausios aplinkos oro, todl termometro (T
2
) temperatra maja. Norint
ivengti gar alia lapio termometro koncentracijos padidjimo, jungiamas ventiliatorius (V),
kuris nupuia gar pertekli. Todl greta abiej termometr vis matavimolaik ilieka aplinkoje
esani vandens gar koncentracija.
Sudrkintotermometrotemperatramajatol, kol nusistovi
ilumos nuostoli dl vandens garavimo ir ilumos kiekio, gau-
namo dl laidumo ir konvekcijos, pusiausvyra.
Kai drgnojotermometrotemperatranustojakristi, sausasis
(T
1
) ir lapiasis (T
2
) termometrai rodoskirtingas temperatras
t
1
ir t
2
. Garavimas vyksta tuospariau, taigi ir abiejtermometr
temperatr skirtumas tuo didesnis, kuo ore esani vandens
gar slgis p maesnis u slg p
s
gar, sotinani aplinkos or.
Temperatr skirtumas t
1
t
2
yra atvirkiai proporcingas
psichrometriniam koeficientui k, kuris priklauso nuo ven-
tiliatoriaus galios, ir P atmosferos slgiui:
.
) ( 1
2
2 1
P
p t p
k
t t
s

=
(5.4.15)
Tuomet
p = p
s
(t
2
) k P (t
1
t
2
). (5.4.16)
5.4.4 pav. Psichrometro
struktrin schema
V
T
2
T1
D
tyrimas
136 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Apskaiiavus vandens gardalin slg, jo vert raoma (5.4.8) formul ir randama santykin oro
drgm.
inant patalpos orotemperatr, santykin orodrgm ir naudojantis efektyvijtemperatr
nomograma (5.4.3 pav.), randama efektyvioji temperatra. Pagal j galima sprsti, ar aplinkos oro
parametrai yra geri mogaus savijautai. Vasar, lengvai apsirengus ir dirbant lengv darb, moni
savijauta geriausia, kai efektyvioji temperatra yra nuo 17,7
o
Ciki 21,2
o
C, o iem, kai mons yra
iliau apsireng, nuo 15,5
o
Ciki 23,2
o
C.
Darbo eiga
1. Psichrometras pakabinamas ant stovo taip, kad nesiliest su paaliniais daiktais ir oras laisvai
cirkuliuot. Keletas vandens la ulainama ant higroskopins mediagos, kuria apvyniotas
vieno termometro galiukas. Po to jungiamas psichrometro ventiliatorius.
2. Stebimi psichrometro abiej termometr parodymai tol, kol nusistovi ilumin pusiausvyra ir
temperatros nebekinta. Tada uraomi termometr rodmenys t
1
ir t
2
.
3. Pagal patalpoje esant barometr nustatomas atmosferos slgis P.
4. I higrometrins lentels (r. pried 14 lentel) randami soij vandens gar slgiai p
s
(t
2
) ir
p
s
(t
1
).
5. raius p
s
(t
2
) ir P vertes (5.4.16) formul, apskaiiuojamas vandens gar dalinis slgis p.
6. Pasinaudojus Klauzijaus ir Klapeironolygtimi, apskaiiuojamaabsoliuioji orodrgm (g/m
3
).
Meteorologijoje absoliuioji drgm kartais prilyginama daliniamslgiui ir matuojama slgio
vienetais gyvsidabrio stulpelio milimetrais (mmHg), kuriais ireikus, dalinio slgio vert
beveik sutampa su absoliuiosios drgms verte, ireikta g/m
3
.
7. I gaut p
s
(t
1
) ir p veri apskaiiuojama santykin oro drgm ((5.4.8) formul).
8. I efektyvij temperatr nomogramos nustatoma efektyvioji temperatra ir vertinamos
patalpos klimato slygos.
9. Matavimai kartojami 23 kartus. Matavim ir skaiiavim rezultatai suraomi lentel:
t
1
,
o
C
t
2
,
o
C
P,
mmHg
k,
K
1
p
s
(t
2
),
mmHg
p,
mmHg
p
s
(t
1
),
mmHg
, g/m
3
r, T
ef,
o
C
MOLEKULIN FIZIKA ____________________________________________________________________ 137
LABORATORINIS DARBAS
Vandens virimo temperatros priklausomybs
nuo iorinio slgio tyrimas
Darbo uduotis
Nustatykite vandens virimo priklausomyb nuo iorinio slgio.
Darbo priemons ir prietaisai
Dvi kariui atsparios kolbos, auintuvas, gyvsidabrio manometras, oro siurblys, termometras.
Darbo metodika
Vandens virimo temperatros priklausomyb nuo iorinio slgio tiriama renginiu, pavaizduotu
5.4.5 paveiksle. Kolba (A), kurioje yra kaitinamas vanduo, sujungta su auintuvu (C), o jo antrasis
galas su kolba (B), kuri savo ruotu sujungta su gyvsidabrio manometru (M). Jungiamajame
vamzdyje taisyta sklend(V), blokuojanti sistemnuoatmosferos. kolb (A) yrastatytas spiritinis
termometras (T). Jo apatinis galas yra aukiau skysio paviriaus.
Darbo eiga
1. Atsukama aldymo sistemos sklend.
2. Usukama sklend (V), ir oro siurbliu i kolb isiurbiama dalis oro(iki manometro virutinio
stulpelio aukio p
v
= 300 mm Hg, bet ne daugiau).
3. Pasiymjus ir apatiniomanometro stulpelio rodmen p
a
, apskaiiuojamas atmosferos slgio ir
slgio sistemoje skirtumas (t. y. ufiksuojamas manometrorodmuo p
m
= p
a
+ p
v
).
4. Uraomas barometro rodmuo, t. y. atmosferos slgis p
atm
.
5. Po kolba (A) atsargiai pastatoma elektrin plytel (plytels kaitinimo spiral neturi liestis su
kolbos dugnu) ir jungiama.
5.4.5 pav. renginys vandens virimo temperatros priklausomybei nuo iorinio slgio tirti
V
T
M
0
pa
0
pv
C
B
A
M
0
p
a
p
V
0
B
V
C
A
T
138 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
6. Uvirus kolboje (A) vandeniui, uraoma virimotemperatros vert.
7. Atsukus sklend (V) ir tokiu bdu padidinus slg kolboje (A) (t. y. sumainus manometro
virutinio stulpelio aukt 50 mm Hg), vanduo nustos virti.
8. Kartojami darboeigos 3, 4, 6 ir 7 punktai (iuos punktus reikia atlikti gana greitai ir jokiu bdu
nesitraukiant nuo renginio), didinant slg kolboje (A) tol, kol jis bus lygus atmosferos slgiui.
9. Duomenys suraomi lentel:
p
m
, mm Hg p
i
= p
atm
p
m
, mm Hg t,
o
C
10. Nubraiomas vandens virimo temperatros priklausomybs nuo iorinio slgio grafikas.
5.5. ilumos perdavimo bdai
Kn vidins energijos ir ilumos svokos.
ilumos perdavimo bdai: laidumas, konvekcija, spinduliavimas.
ilumos srauto ir kiekio svokos.
Savitoji ilumin talpa.
ilumos laidumo lygtis (Furj dsnis).
ilumos laidumo koeficientas. Jo fizikin prasm ir matavimo vienetai.
5.5.1. Knvidins energijos ir ilumos svokos
Kiekvien kn ar knsistem sudaro daugybdaleli (atom, molekuli ir kt.), kurios dalyvauja
netvarkiame iluminiame judjime ir nuolat sveikauja viena su kita. Vis i daleli pilnutin
energija, slygota j netvarkingo judjimo bei tarpusavio sveikos, vadinama kno vidine energija.
Jsudaroatomir molekulislenkamojoir sukamojojudjimokinetinenergija, jvirpesienergija,
atombei molekulitarpusaviosveikos potencinenergija, potencinir kinetinelektronenergija
ir branduolin energija.
Tarpusavyje sveikaudami, knai gali keistis tiek mechanine, tiek vidine energija. iluma
vadinama sklindanti vidin energija, t. y. vidins energijos dalis, kuri pereina i vieno kno kit
arba i vienos kno vietos kit. Todl fizikiniu poiriu negalima sakyti, kad kaits knas turi
daug ilumos. Jis turi daug vidins energijos.
5.5.2. ilumos perdavimo bdai
Patirtis rodo: jeiguizoliuotame kne esantis temperatrskirtumas kokiunors bdunepalaikomas,
tai jis per kur laik inyksta ir viskno dalitemperatra pasidarota pati. Tokia bsena vadinama
ilumine pusiausvyra. Tai vyksta todl, kad knuose iluma sklinda i auktesns temperatros
MOLEKULIN FIZIKA ____________________________________________________________________ 139
viet emesns temperatros vietas. Tikknui esant iluminje pusiausvyroje, yra prasm kalbti
apie jo temperatr. Norint imatuoti kno temperatr termometru, btina, kad nusistovt
termometro ir matuojamojo kno ilumin pusiausvyra. tai kodl io dydiomatavimas utrunka
ilgesn laik.
ilumos perdavimas yra labai sudtingas fizikinis procesas, nes susideda i hidrodinamini ir
ilumini proces. Taiaujau pirmieji stebjimai parod, kadilumos kiekis, kur gauna ir atiduoda
per laiko vienet pavirius, apiplaunamas fluido (ia svoka apibendrinamas tekantis skystis ar
dujos, dalyvaujantys ilumos mainuose), proporcingas paviriaus ir fluido temperatr skirtumui.
dsningum Niutonas apibendrino tokia lygtimi:
T kS Q A = ;
(5.5.1)
ia S paviriaus plotas; AT fluido ir paviriaus temperatr skirtumas. Jei fluidas iltesnis u
paviri, tai AT = T T
p
; ia T ir T
p
fluido ir paviriaus vidutins temperatros.
Lygtyje esantis proporcingumo koeficientas k vadinamas ilumos perdavimo koeficientu. Jis
apibdina ilumos kiek, atiduodam paviriaus ploto vienetui arba gaunam nuojo ploto vieneto
per laiko vienet, kai paviriaus ir fluido temperatr skirtumas lygus vienam laipsniui. Jis
matuojamas W/(m
2
K).
ilumos perdavimokoeficientas yrasudtingadaugeliokintamjfunkcija. koeficientgalima
nustatyti teorikai ir eksperimentikai. Pirmuoju atveju jis apskaiiuojamas sprendiant
diferencialines lygtis, apraanias hidrodinaminius ir iluminius procesus, kurie vyksta aptekant
fluidui paviri. Taiau ios lygtys sudtingos, jas sprendiant paprastai daroma daug prielaid,
todl daniausiai jis nustatomas atliekant eksperimentinius ilumos perdavimo tyrimus.
iluma gali bti perduodama vairiais bdais. Svarbiausi augal ir gyv organizm aplinkoje
yra trys ilumos perdavimo bdai: spinduliavimas, konvekcija ir ilumos laidumas.
5.5.3. Spinduliavimas
Nutol vienas nuo kito knai ilum vienas kitamperduoda spinduliavimo bdu. Prieingai negu
kiti ilumos perdavimo bdai, spinduliavimas gali vykti ir vakuume. Bet koks knas (tarp j ir
mogus), kuriotemperatra auktesn kaip0 K, skleidia spinduliuot. Ji yra tos paios prigimties,
kaip ir regimoji viesa, tik ilgesnio bangos ilgio, t. y. jos sritis yra u raudonj spinduli, todl ji
vadinama infraraudonja spinduliuote (lot. infra po). Pavyzdiui, mogaus kno pavirius
spinduliuoja (bangos ilgis yra 550 m; maksimalus intensyvumas tenka bangos ilgiui 9,5 m).
Priklausomai nuo kno temperatros, keiiasi spinduliuots intensyvumas ir spektrin sudtis,
todl danai ms akys jos nepriima kaip regimosios spinduliuots.
vairs paviriai geba nevienodai spinduliuoti ir sugerti ilumin energij. Knas, visikai
sugeriantis visdanispinduliuot, vadinamas absoliuiai juoduknu. Realiai tokikngamtoje
nra, i svoka yra tik modelis. Knai, kurie turi maesn u vienet sugerties faktori ir jis
nepriklausonuo viesos bangos ilgio, vadinami pilkaisiais. Gamtojepilkkntaippat nra, taiau
140 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
kai kurie knai tam tikrame bangos ilgi intervale spinduliuoja ir sugeria kaip pilkieji knai.
Pavyzdiui, kartais mogaus knas laikomas pilkuoju.
Absoliuiai juodo kno energin vies (kuriame nors paviriaus take paviriaus elemento
skleidiam spinduliuots (energijos) sraut, padalyt i to elemento ploto) aprao Stefano ir
Bolcmano dsnis:
R
e
=oT
4
(juodojo kno), R
e
=ooT
4
(pilkojo kno), (5.5.2)
i kuriomatyti, kadenerginis viesis proporcingas termodinaminei temperatrai ketvirtuojulaipsniu.
Vadinasi, daugiaukaits knas intensyviau spinduliuoja. ia o Stefano ir Bolcmano konstanta,
o sugerties faktorius. Kitas iuos procesus apraantis yra Vyno dsnis:

max
=b/T; (5.5.3)
ia
max
bangos ilgis, kuriam tenka maksimalus spektrinis energins apvietos tankis, b Vyno
konstanta. Tai iliustruojatoks pavyzdys: kambariotemperatrojeknilumos spinduliavimas vyksta
infraraudonojoje srityje ir mogaus akis jo nefiksuoja. Pakilus temperatrai, knai pradeda viesti
tamsiai raudonai, oesant dar auktesnei temperatrai baltai su melsvu atspalviu. Pagal Stefanoir
Bolcmanobei Vynodsnius galima matuojant knspinduliavimnustatyti jtemperatr.
Geriausiai spinduliuot sugeria matinis juodas pavirius, o blogiausiai poliruotas metalinis
pavirius. Kai spinduliuotsugeriama udarojeerdvje, pavyzdiui, iltnamyje, tuomet knai sugeria
Sauls spinduliuot ir ispinduliuoja jau maesns energijos spinduliuot, kuri negali prasiskverbti
pro stikl. Pana barjer atmosferoje suformuoja anglies dioksidas. Pastaruoju metuis barjeras
didja, todl oras pamau iltja.
Vienas i galingiausi iluminio spinduliavimo altini yra Saul. Sauls spinduliuots srautas,
tenkantis vienam kvadratiniam metrui ems atmosferos ribos plotui, yra 1350 W. is dydis va-
dinamas Sauls pastovija. Taiaurealiai is dydis bna maesnis, nes priklauso nuoSauls aukio
vir horizonto ir spinduliuots silpnjimo dl atmosferos, be to, kartu keiiasi ir spektrin
spinduliuots sudtis.
Galia, kurios netenka mogus, sveikaudamas su j supania aplinka (jei jos temperatra yra
emesn u mogaus), gali bti apskaiiuota taip:
= =
0 1
S P P P o ( ); T T
1
4
0
4

ia T
0
ir T
1
atitinkamai aplinkos ir mogaus kno paviriaus temperatra, o =ao (r. (5.5.2))
spinduliavimo koeficientas, S kno paviriaus plotas. Apsirengusio mogaus T
1
suprantama kaip
rb paviriaus temperatra. Pavyzdiui, nusirengs mogus, esant 18
o
Caplinkos temperatrai ir
33
o
Codos temperatrai, kiekvien sekund nuo 1,5 m
2
paviriaus(toks vidutinikai mogaus kno
paviriaus plotas) spinduliuodamas netenka 122 J energijos, kai apsirengs medvilniniais drabuiais
(paviriaus temperatra 24
o
C) tik 37 J.
MOLEKULIN FIZIKA ____________________________________________________________________ 141
5.5.4. Konvekcija
Skysiuose bei dujose iluma daugiausia perduodama konvekcijos bdu. Skysius ir dujas ildant,
kinta j tankis. iltesnis skystis (arba dujos) yra lengvesnis (maesnio tankio) ir kyla auktyn, o
altesnis, bdamas sunkesnis, slenka emyn. Skysiuose ir dujose susidaro konvekcins srovs,
kurios, nedamos iltesnio (maesnio tankio) skysio arba duj mases, pernea ir j turim vidin
energij. Dl ios prieasties vanduo eerodugne yra altesnis negupaviriuje. Milinikus ilumos
kiekius konvekcijos bdu gamtoje pernea vjai ir jr srovs, todl is procesas lemia ir orus
emje: il prie ems paviriaus oro sluoksniai kyla vir, maiosi sualtesnmis oro masmis
taip formuojasi ciklonai ir anticiklonai. Su iuo ilumos perdavimu susiduriama buityje. Dl
konvekcijos greiiau isilygina temperatra patalpose, greiiau suyla vanduo virdulyje ir pan.
Yra dviej tip konvekcija: laisvoji ir priverstin.
Esant laisvajai konvekcijai, ilumos pernaa priklausonuoorocirkuliacijos aplinkir vir kaitinto
ar ataldyto objekto. J lemia oro tankio skirtum, atsirandani dl temperatros gradiento, dl
vandens garkoncentracijos gradiento arba dl abiej efekt, kombinacijos.
Priverstin konvekcija vyksta tada, kai pernaa per ribin sluoksn (r. 5.1 skyri) vyksta puiant
oro srovei ir nuo srovs greiio priklauso ilumos pernaos greitis.
Kai T
s
temperatros pavirius yra kitos temperatros T dujose(arbaskystyje), ilumos nuostoliai
per vienetinio ploto laminarj pasienio sluoksn, kurio storis o, yra
o / ) ( T T k C
s
= ;
(5.5.4)
ia k duj(skysio) ilumos laidumo koeficientas. i lygtis gali bti naudojama tiek laisvajai, tiek
priverstinei konvekcijai. Patogesn iraika, kurioje papildomai traukiamas charakteringas kno
matmuo d (sferai ar cilindrui d yra skersmuo, o staiakampei ploktelei matmuo vjo kryptimi).
iuo atveju lygtis yra tokia:
d T T k Nu d T T k
d
C
s s
/ ) ( / ) ( ) ( = =
o
;
(5.5.5)
ia Nu = d / o Niuselto kriterijus. Panaiai kaip Reinoldso skaiius, jis tinka vertinti jgas,
slygotas panaikn, panardint judant orar skyst. Niuseltokriterijus leidiasulyginti panai,
taiau skirting matmen kn konvekcinius ilumos nuostolius esant vairiems vjo greiiams.
Naudojant difuzijos proces nulemtos ilumins varos r
H
iraik
Nu k
d C
r
p
H

=
, (5.5.6)
(5.5.5) lygtis ireikiama taip:
H s p
r T T C C / ) ( = .
(5.5.7)
Elektros kurse nagrinjant elektrines grandines, plaiai vartojama elektrins varos svoka.
(r. 6.1 skyri). Ji apibdina mediagos pasiprieinim srovs tekjimui ir pagal Omo dsn
ireikiama tampos ir srovs santykiu. Elektrins grandins sroves galima lengvai suskaiiuoti
pakeiiant jos atakas atitinkamomis varomis ir skaitant j nuoseklj arba lygiagretj jungim.
142 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Tokiumetodugalimanesunkiai vertinti vairiatak, kurios i esms gali aprayti vairius laidumo
mechanizmus, indl bendrj grandins srov. Pasirodo, apibendrinta varos svoka yra patogi
apraant ne tikelektros srovs tekjim, bet ir vertinant ilumos, judesio kiekioir mass pernaos
greiius ir srautus. Vartojant reikin apraanios varos svok, reikin galima aprayti keli
lygiagreiai sujungt varsuma, jei atitinkami procesai vyksta lygiagreiai vienu metui tos paios
tiriamo objekto dalies; arba nuosekliai sujungt varsuma, jei jie vyksta nuosekliai i vienos dalies
link kitos, o i ios tolimesn. Sudtingi procesai apraomi lygiagreiai ir nuosekliai sujungtomis
varomis, tikjauapibdinaniomis atitinkamai ilumos, judesiokiekioar mass pernaos reikinius.
Apibendrintos varos svoka jau daug met yra vartojama biolog ir meteriolog. Ji reikia
faktori, kontroliuojant pernaos reikinio greit. Bendru atveju vara yra ireikiama panaiai
kaip Omo dsniu:
parametro pernaos greitis =
potencial skirtumas
.
vara
i iraikapernaos reikiniams gaunama integruojant iilgai pernaos kelio, todl bendruatveju
priklauso nuo paviriaus, kuriuo vyksta ilumos, judesio kiekio ar mass pernaa, geometrijos.
Pernaos reikinio varos matavimo vienetas yra sm
1
. Kuo didesn atitinkamo pernaos reikinio
vara, tuosilpnesnis pernaos procesas.
Priverstin konvekcija. Priverstins konvekcijos slygomis Nu kriterijus priklauso nuo ilu-
mos pernaos greiioper pasienio sluoksn tarpiltesnio ar altesnio paviriaus ir oro, einanio vir
jo, t. y. proceso, analogikojudesiomomentopernaai dl paviriaus trinties. Todl Niuseltokriterijus
yra Reinoldso kriterijaus funkcija. Nagrinjant ilumos perna ore, naudojamas toks Nu ir Re
kriterij sryis:
Nu = ARe
n
; (5.5.8)
ia Air n yra konstantos, taiau j verts priklauso nuo kno geometrijos. Oro srauto greit Viuo
atveju skaito Reinoldso skaiius Re ir btent per j yra skaitoma priverstin konvekcija. Taigi
priverstins konvekcijos bdu per vienetin plot perduodamas ilumos kiekis Cyra proporcingas
Niuseltokriterijui, iuoatvejuproporcingamReinoldsokriterijui ir kartuproporcingamaptekanio
oro srauto greiiui. Taiau i prieklausa yra sudtingesn negu tiesin ir, be to, priklauso nuo to,
srautas yra laminarusis ar turbulentinis.
Laisvoji konvekcija. Laisvosios konvekcijos slygomis ilumos pernaa priklauso nuo oro
cirkuliacijos apie kartesn ar altesn, lyginant su oro temperatra, objekt dl temperatros
gradiento, kuris sukuria tankio gradientus. iuo atveju Niuselto kriterijus gali bti ireikiamas
Grashofo Gr kriterijumi:
Nu=BGr
m
; (5.5.9)
ia Air n yra konstantos, kuri verts taippat priklauso nuo knogeometrijos. Grashofo kriterijus
priklauso nuo paviriaus ir j gaubianio oro temperatr skirtumo (T
s
T), charakteringo objekto
matmens d, oro iluminio pltimosi koeficiento a, oro kinematins klampos v ir laisvojo kritimo
pagreiio. FizikineprasmeGrashofokriterijus yralygus keliamosios jgos ir inercins jgos sandaugos
santykiui su kinematins klampos kvadratu. Jo skaitin iraika tokia:
MOLEKULIN FIZIKA ____________________________________________________________________ 143
3
/ ) ( v T T agd Gr
s
=
2
.
(5.5.10)
Dideliu Gr kriterijumi pasiyminiose sistemose laisvoji konvekcija yra stipri, nes iuo atveju
keliamosios ir inercins jgos, kurios sukelia oro cirkuliacij, yra daug didesns u klampumo
jgas, kurios prieinasi cirkuliacijos radimuisi. Imant air v vertes 20
o
Ctemperatros orui, Grashofo
kriterijus
), ( 158
3
T T d Gr
s
=
(5.5.11)
kai d ireikiamas centimetrais. Laminariosios laisvosios konvekcijos slygomis (5.5.9) iraikoje
m=1 / 4
.
nepriklausomai nuo ilum prarandanio objekto geometrins formos. iuo atveju
4 / 1 4 / 1
) ( ~ T T BGr Nu
s
= ,
ir visas ilumos praradimo greitis Cdl laisvosios konvekcijos yra proporcingas
4 / 5 4 / 1
) ( ~ ) ( ) ( ~ ) ( ~ T T T T T T T T Nu C
s s s s
.
(5.5.12)
Tai vadinamasis penki ketvirtj auimo dsnis.
Mirioji konvekcija. Dl nuolat kintaniovjogreiio, jokrypties ir kartais dl ilumprarandanio
paviriaus judjimo daugumoje gamtinisistem konvekcija yra labai sudtinga. Puiant stipriems
oro gsiams, lapas ar gyvnas netenka ilumos daugiausia dl priverstins konvekcijos, bet vjui
laikinai aprimus pagrindin yra laisvoji konvekcija. Todl konvekcijos veika gali bti apibdinama
kaip miri ta prasme, kad abu konvekcijos bdai dalyvauja ilumos pernaoje, taiau j santykinis
indlis laikui bgant kinta. i situacij yra labai sudtinga nagrinti tiek teorikai, tiek
eksperimentikai, todl ilumos pernaa aplinkoje apskaiiuojama i vidutinio vjo greiio, kai
priverstinkonvekcijalaikoma vyraujania, arbai temperatros skirtumo, jei vjas yralabai silpnas.
Paprastai iuos du konvekcijos bdus galima atskirti naudojantis keliamosios jgos ir inercins
jgos santykiu, kuris proporcingas kriterij Gr ir Re
2
santykiui Gr / Re
2
. Kai Gr >> Re
2
, keliamoji
jga yra daug didesn u inercines jgas, ilumos pernaa vyksta dl laisvosios konvekcijos. Kai
Gr <<Re
2
, keliamoji jga yra labai maa, tuomet svarbi priverstin konvekcija. Pavyzdiui, jei 5 cm
skersmens lapas yra 5
o
Ciltesnis u aplinkos or (Gr = 10
5
), priverstin konvekcija yra svarbi, kai
V > 1 m/s (Re
2
= 10
7
), taiaukai 0,1 < V < 0,5 m/s (toks vjogreitis gana danas javlauke ir tada
Re
2
= 10
5
2,510
6
), ilumos pernaa vyksta tiek dl laisvosios, tiekdl priverstins konvekcijos.
ilumos pernaa augaluose. Nagrinjant ilumos perna technikoje, paprastai kno
temperatra laikomavienodavisameknopaviriuje. Taiaurealiai tokia situacijagalima tikdidelio
ilumos laidumo metaliniams paviriams. Gamtoje objektai yra maai laids ilumai, todl iuo
atvejutariama, kadbet kuris vienetinis knopavirius atiduodavienod ilumos kiek. Toks pavyzdys
yra augalolapas Sauls apviestoje vietoje. Esant vienodiems ilumos nuostoliams i bet kurio lapo
ploto vieneto, jo temperatra lapo paviriuje jau tampa nevienoda.
Daug eksperimentini darb atlikta lap ilumos nuostoliams dl konvekcijos vertinti. Tam
buvo naudojamos tiek lap replikos, tiek reals lapai. ie eksperimentai parod, kad ia yra tam
144 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
tikras skirtumas, bet tiek temperatros kitimas iilgai lapo, tiek temperatros kitimo ribos yra
beveik vienodos. ie matavimai taip pat patvirtino teorines ivadas, kad einant tolyn nuo lapo
krato, kur puia vjas, temperatradidja. Realaus lapo sudtingesnis temperatros kitimas yra
susijs su tuo, kad iuo atveju dl lapo paviriaus reljefo kinta ribinio sluoksnio storis.
Atlikti eksperimentai su vairios formos varinmis skirtingos orientacijos ploktelmis, jas
ildant ir stebint ilumos praradim esant vjo greiiui nuo 0 iki 0,3 m/s, leido nustatyti svarbius
dsningumus. Ploktels buvo vienodo ploto, bet skirtingos formos: apskritimo, eiakamps
vaigds ir net uolo lapo sucharakteringais kirpimais. Buvo matuojama elektros energija, kuri
btina ilaikyti lapo temperatr 15
o
C didesn negu aplinkos oro. i energija yra atvirkiai
proporcinga iluminei varai (r. 5.5.5.1 skyrel). Gautos tokios ivados:
- Padidinus vjo greit nuo 0 iki 0,3 m/s, ilumin vara sumajo nuo 30 iki 95 %;
- vairi formplokteli vara maesn, palyginti su apskritos formos ploktele, ir ji maiau
priklauso nuo savo orientacijos;
- su giliais kirpimais modelis, atitinkantis saulje esant uolo lap, visuomet turi maesn
ilumin var negu lapai, esantys pavsyje su maesniais kirpimais;
- lap modeli ilumin vara maiausia, kai pavirius pakryps (nestatus) vjo krypties
atvilgiu.
ie matavimai patvirtinakai kuriekologhipotez, kadlapformagali rodyti augaladaptacij
prie ilumins aplinkos.
ilumos pernaa induoli organizmuose. Norint nustatyti induoli ilumos perna,
daromi vairs j modeliai naudojant atitinkam matmen cilindrus ar sferas. Tokio modeliavimo
pavyzdys gali bti avies ilumos pernaa, tamnaudojant 0,33 m skersmens elektrikai kaitinam
horizontal cilindr. Kituose eksperimentuose cilindras buvo udengtas avies vilna. Toks
modeliavimas gana gerai atskleidia ilumos mainus ant tikr induoli kailio. Esant nestipriam
vjui, pasienio sluoksnio storis yra didesnis, kai pavirius padengtas plaukais, bet kai Re > 10
5
(Reinoldso skaiius; r. 5.1.6 skyrel), tokio paviriaus pasienio sluoksnio storis buvo maesnis.
Antruoju atveju, matyt, vjas kedena plaukus ir sukelia turbulentikum.
5.5.1 pav. Grashofo kriterijaus
priklausomyb nuo aukio (mogui) [pagal 48]
10
10
10
9
10
8
10
7
10
6
10
5
0
40
80
120
160
Turbulentin srov
Tarpin srov
Laminarin srov
Grashofokriterijus

g
i
s
(
c
m
)
5.5.2 pav. Laisvoji konvekcija
apie mogaus galv [pagal 48]
Laminarioji srov
MOLEKULIN FIZIKA ____________________________________________________________________ 145
Laisvoji konvekcijaypa svarbi tada, kai yradidelis paviriaus ir aplinkos temperatrskirtumas.
Pavyzdiui, esant avies kailio temperatrai T
s
= 85
o
C, o oro T = 40
o
C (tai realu Australijoje),
Grashofo kriterijus Gr ~ 2 10
8
(vienas i ilumos main kriterij) ir laisvoji konvekcija susilygina
su priverstine, kai vjo greitis yra 0,7 m/s.
mogaus atveju laisvoji konvekcija yra gana sudtinga, nes Grashofo kriterijus priklauso nuo
aukio treiuoju laipsniu (d
3
), t. y. kinta kartu su aukiu, kaip parodyta 5.5.1 paveiksle. Eks-
perimentikai toks oro judjimas dl laisvosios konvekcijos buvo patvirtintas lireno (Schlieren)
fotografijos metodu tiriant oro judjim apie galvas (5.5.2 pav.). Oro kilimas apie galv ir
atsilenkiamas prie nosies nervi yra svarbus organizmui apsaugoti nuo bakterij. Panaios
fotografijos gautos tiriant laisvj konvekcij nuo kvieio varpos ir triuio.
Atliekant eksperimentus supaukiir vabzdimetalinmis kopijomis, sudarytomis i cilindr
ir sfer, gauti rezultatai gana artimi teoriniams. Pavyzdiui, tiriant negyv vabzdi temperatr,
apvietus juos lempa ir puiant oro sraut greiiu v, gautas temperatr skirtumas T
s
T yra
proporcingas krintaniai spinduliuots energijai ir atvirkiai proporcingas v . Taipturtbti su
cilindrais tamtikroje Re veri srityje.
5.5.5. ilumos laidumas
iluma i vienokno kit arba i vienos kno dalies kit gali sklisti tiesiogiai jiems lieiantis. Toks
ilumos perdavimo bdas vadinamas ilumos laidumu. vairi kietj kn ilumos laidumas yra
nevienodas. Vieni i j, pavyzdiui, metalai ir vairs kristalai, yra geri ilumos laidininkai, o kiti,
pavyzdiui, oras, medis, stiklas, vairios plastmass, yrablogi ilumos laidininkai (jievadinami ilumos
izoliatoriais). Vadinasi, ilumos laidumas priklausonuomediagos sandaros. Kristalgardelseatomai
yraglaudiai susieti tarpusavyje ir vidinenergijaiapasireikiakaipgardels mazgvirpjimas apie
pusiausvirj padt: kuo didesn kristalo temperatra, tuo didesn gardels mazg virpesi
amplitud, t. y. jkinetin energija. Kiekvieno kristalogardels sandara yra savita, t. y. bdinga tik
iamkristalui (atomtarpusavioisidstymas, atstumai tarpgardels mazg, jtarpusavioorientacija,
gardels mazgryioenergija). Ir aiku, kadbet koks vienogardels mazgovirpjimas pusiausvirosios
padties atvilgiu priveria virpti ir kitus kristalins gardels mazgus, t. y. vienoi atom virpjimo
kinetin energija (kaipiluma) perduodama kitiems kristalins gardels mazgams. Metalilumos
laidumo prieastis yra kita. Kaip inoma, metaluose yra daug laisvj krvinink elektron ir
kuo didesn kno temperatra, tuo didesn laisvj elektron kinetin energija. Pastarieji savo
kinetin energij susidurdami perduoda metalo jonams ir kitiems elektronams.
vairi mediag ilumos laidumas yra skirtingas. Dujos yra blogi ilumos laidininkai, todl
visos mediagos, turinios didesn oro kiek (vilna, iaudai, sniegas), yra vadinamos
termoizoliacinmis mediagomis. Blogai praleidia ilum purus sniegas; sniego danga sumaina
dirvos iluminius nuostolius, o tai teigiamai veikia augalus. Dirvos temperatrai mike didel tak
daro miko kraikas, susidars i negyv augalorganini liekan, tarpkuri yra oro. Jis reguliuoja
ilumin dirvos reim mike. Pati dirva yra blogas ilumos laidininkas, taiaujos ilumos laidumas
priklausomai nuodrgms gali skirtis. Dirvos ilumos laidumosavybs dideltak darogaravimui,
akn susidarymui ir pan.
146 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
ilumos laidumas mikrometerologijoje svarbus nagrinjant ilumos perna dirvoemyje ir per
gyvn od arba kail. Laisvoje atmosferoje laidumas nra svarbus, nes jo indlis daug maesnis
negu konvekcijos.
Nejudantis oras yra geras izoliatorius ir, jei apie objekt galima sukurti nejudant sluoksn, tai jo
ilumos nuostoliai yralabai mai. Taipyradaugelioinduolikailinje dangoje, kuri padeda ilaikyti
stor nejudanio orosluoksn. T pat naudoja mogus, konstruodamas iltus drabuius i kaili ar
kit mediag, galini ilaikyti nejudant or. Didinant ilumin var, ilumos nuostoliai maja.
Taigi turintys ilgesnio plauko kailius vrys yra labiau atspars aliams.
ilumos laidumo lygtis. Tegu vienalyio metalinio strypo, kurio skerspjvio plotas yra S,
ilgis yra x (5.5.3 pav.), gal temperatros yra skirtingos ir atitinkamai lygios T
1
ir T
2
. Tada ilumos,
perneamos per tamtikr laiko tarp dt, kiekis ireikiamas Furj formule
t S
x
T T
Q d d
2 1

= .
(5.5.13)
ioje lygtyje proporcingumo koeficientas yra ilumos laidumo koeficientas, o santykis
(T
1
T
2
)/x parodo ilgio vieneto temperatros pokyt ilumos perdavimo kryptimi ir vadinamas
temperatros gradientu. ilumos laidumo koeficientas parodo, koks ilumos kiekis pereina per
1 m
2
skerspjv per laikovienet, kai temperatros gradientas yra1K/m. inant tamtikros mediagos
ilumos laidumokoeficient, galimapasakyti, ar i mediaga yra geras, ar blogas ilumos laidininkas.
vairi mediag ilumos laidumo koeficientai labai skirtingi (r. pried 11 lentel). ilumos
laidumo koeficientas priklauso ir nuo mediagos temperatros, ir nuo savitosios ilumins talpos.
Esant skirtingoms kno temperatroms, is koeficientas yra skirtingas. Dydis R

= x/Svadinamas
ilumine vara.
Kitas dydis, nusakantis mediagos gebjim kaupti, ilaikyti ir perduoti ilum, yra savitoji
ilumin talpa. Kiekvienos mediagos ji yra skirtinga (r. pried 9 lentel) ir nusako, koks ilumos
kiekis reikalingas mass vieneto kno temperatr pakeisti vienu Kelvino laipsniu.
ilumos perneimo intensyvumas apibdinamas ilumos srauto tankiu. Jeigu laidininku, kurio
skerspjvio plotas yra S, per laik dt perneamas ilumos kiekis dQ, tai ilumos srauto tankis
t S
Q
q
d
d
= .
(5.5.14)
Jis parodo, koks ilumos kiekis perneamas per laidi-
ninko skerspjvioploto vienet per laiko vienet. ilu-
mos srautotankis proporcingas temperatros gradientui
ir nukreiptas jos majimokryptimi. Temperatros gra-
dientas parodo jos kitimo spart ir nukreiptas spar-
iausiodidjimo kryptimi. Didesnis temperatros gra-
dientas reikiadidesn temperatrskirtum, esant tam
5.5.3 pav. Brinys
Furj formulei aikinti
T
e
m
p
e
r
a
t
r
o
s
g
r
a
d
ie
n
ta
s
T
2
T
1
S
T
e
m
p
e
r
a
t

r
o
s
g
r
a
d
ie
n
t
a
s
MOLEKULIN FIZIKA ____________________________________________________________________ 147
paiamatstumui, taigi ir spartesn ilumos laidum. Jeigu ilgio intervale Ax temperatros pokytis
yra AT =T
1
T
2
, tai ilumos srauto tankis
x
T
q
A
A
=
. (5.5.15)
Paprastai iluma daniausiai perduodama visais trimis spinduliavimo, konvekcijos ir ilumos
laidumo bdais, ir grietai atskirti vien nuo kito beveik nemanoma. Taiau kai kuriais atvejais
vienu i i bd iluma visai nesklinda arba sklinda tiek maai, kad jos galima ir nepaisyti.
Pavyzdiui, kietuosiuose knuose nra konvekcijos.
Gyvn kailyje paprastai pasireikia ir laidumas, ir spinduliavimas, ir laisvoji bei priverstin
konvekcijos. Kaili ilumins varos matavimai rodo, kad ji yra artima stovinio oro iluminei
varai. Didjant kailio storiui, paprastai sunku ivengti konvekcijos atsiradimo, nes kailio ribose
gali bti didelis temperatr gradientas. Tai iek tiek turi takos oro judjimui, ir jis nutolsta nuo
nejudanio oro artinio. Storo kailio ilumin vara yra maesn u nejudanio oro madaug 1,6
karto ir tai susij su spinduliavimo nuostoliais ir laisvja konvekcija. Priverstin konvekcija taippat
svarbi kaili laidumui.
Visi ivardyti ilumos pernaos bdai panaudojami nam ildymo sistemoms. Ventiliatorinis
ildytuvas paskirsto ilt or priverstins konvekcijos bdu; iluma i vandeniuildom radiatori
perneama dl laisvosios konvekcijos; esant ivediotiems po grindimis ildytuvams, iluma
perduodama laidumo bdu; kaitinami strypo tipo ildytuvai praranda ilum tiek dl laisvosios
konvekcijos, tiek dl spinduliavimo.
mogaus organizmo audini ilumos laidumas. Skystj organizmo dali (tarplstelinio
skysio, kraujoplazmos ir kt.) ilumos laidumas artimas vandens ilumos laidumui. Tankijaudini,
ypa riebalinio audinio ir odos raginio sluoksnio, ilumos laidumas yra daug maesnis. Pati oda ir
poodinis riebalinis audinys atlieka organizmo ilumos izoliacijos funkcij, nes riebalinio sluoksnio
ilumos laidumo koeficientas yra tik 12 kart didesnis u nejudanio oro. Gilumini mogaus
organizmo audini temperatra yra auktesn negu kno paviriaus temperatra. Be to, audinio
izoliacija labai priklauso nuo kraujagysli tinklo tankumo ir kraujo tekjimogreiio. Reguliuojant
kraujo apytak, galima keisti organizmo ilumos nuostolius, t. y. galima teigti: jei nebt skystos ir
judrios vidins terps, vieni organai perkaist, o kiti per daug atvst. Judri, labai vandeninga,
negreit suylanti ir negreit atlanti vidin terp kakuo panai tobul centrinio ildymo sistem.
Apskritai mogaus knas yra blogas ilumos laidininkas. Vidutinis mogaus knoilumos laidumo
koeficientas (0,20,3 W/(mK)) yra apie deimt kart didesnis u stovinio oro ir didja spartjant
kraujo apytakai.
5.5.6. Temperatros matavimas, termostatai, termoterapija
Biologins sistemos gali ilgiau ar trumpiau bti aplinkose, kur temperatros intervalas nedidelis
(~nuo 0 iki 90
o
C). Medicininei diagnostikai labai svarbus temperatros matavimas.
Termometrijanagrinjair kuriatemperatrmatavimometodus. Temperatros matavimui reikia
pasirinkti temperatros skal, t. y. parinkti tamtikr termometrin mediag ir tamtikro reikinio
148 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
fizines savybes, priklausanias nuotemperatros. Daniausiai parenkamos dvi temperatros, kurias
atitinka fazini virsm temperatros, pavyzdiui, ledo tirpimo (0
o
C) ir vandens virimo (100
o
C),
esant tam tikroms apibrtoms iorinms slygoms. Intervalas tarp i dviej temperatr da-
lijamas 100 dali, taigi 1
o
C(temperatros vienetas) sudaro 0,01 intervalo dal.
Nepriklausanti nuo termometrini savybi ir mediagos II termodinamikos dsnio pagrindu
sukurta skal vadinama termodinamine. ia pagrindiniu taku laikoma trigubovandens H
2
Otako
temperatra: 273,16 K. ios skals vienetas yra kelvinas (K) 1/273,16-oji termodinamins
temperatros (trigubo H
2
Otako). Dviej mint skali ryys T = t
o
C + 273 K.
Kno temperatra yra jo kaitimo matas ir apibdina energij, kuri gyja kn sudaranios
dalels. Ji matuojama termometrais (skysio, dujiniais), termoporomis (r. 6.5 skyri), pirometrais.
Skysio termometr veikimas pagrstas trio, keiiantis temperatrai, kitimu, pirometr spin-
duliuots intensyvumo matavimu (jie taikomi auktoms temperatroms matuoti). Labai emoms
temperatroms matuoti naudojami paramagnetikai. Buityje naudojami gyvsidabriniai, spiritiniai,
skyst kristal termometrai.
Daugumavykstanibiologiniuoseobjektuoseprocespriklausonuotemperatros, todl svarbu
mokti gauti tamtikras temperatras ir reikiamlaikjas ilaikyti pastovias. iamreikalui naudojami
termostatai prietaisai, kuriuose palaikoma pastovi temperatra. Jie gali turti elektrin ildytuv
ir termoreguliatori, kurie utikrina norim pastovi temperatr ir yra plaiai taikomi klinikinse
medicinos staiglaboratorijose. ia daniausiai palaikoma mogaus knotemperatra (~37
o
C).
Termostatai be iorinio ildytuvo vadinami termosu (arba Diuaro indu) ir yra plaiai naudojami
buityje. Tai dvigub blizgani sieneli indas, tam tikr laik ilaikantis pastovi jo turinio
temperatr. Sienels yraperskirtos vakuumotarpu(vakuumas stabdoenergijos perdavim ilumos
laidumo ir konvekcijos bdais, o blizgantis pavirius spinduliavimo bdu).
Kn ilumos laidumas, fazini virsm ilumos kiekiai, chemini reakcij ir radioaktyvi
skilim metu atsiradus spinduliavim lydintys ilumos kiekiai matuojami kalorimetriniais
metodais. ie matavimai atliekami kalorimetrais, kurie gali bti dviej tip:
1) pagal jnusistovjusi temperatr nustatomas pernetas ilumos kiekis Q;
2) T=const, oilumos kiekis Qnustatomas pagal mediagos kiek, perjus kit fazin bsen
(pvz., ledas H
2
OH
2
Ogarai).
Tokiu bdu galima nustatyti mediag ir jos kiek, o toliau galima rasti, kiek yra mediagoje
molekuli ir pan. Tai yra svarbu molekulinje biologijoje, medicininiams tyrimams ir kitur.
Medicininje terapijoje ir chirurgijoje naudojami kartis (termoterapija) ir altis (krioterapija).
Daniausiai naudojami karti ir alti knai arba mediagos tam tikroms kno vietoms suildyti
arba ataldyti.
Termoterapijos metodai skirstomi tris grupes:
1) ilta mediaga tiesiogiai kontaktuoja su reikiama kno vieta;
2) iluma perduodama iluminio spinduliavimo bdu;
3) panaudojamailuma, atsirandanti audiniuoseper juos tekant auktodaniokintamai elektros
srovei (pavyzdiui, prideginimai);
4) panaudojama mikrobangenergija.
MOLEKULIN FIZIKA ____________________________________________________________________ 149
1
2
3
T
1
T
2
T
3
M
x
M
aldytuvas
ildytuvas
5.5.4 pav. Prietaiso ilumos laidumo
koeficientui nustatyti struktrin schema
Taikant pirmj metod turi bti naudojamos tokios mediagos, kurios ilg laik savyje gali
ilaikyti ilum, t. y. turi didel ilumin talp ir ma ilumos laidumo koeficient. Daniausiai
procedroms naudojamas vanduo, purvas, parafinas, smlis. ios mediagos tiesiogiai lieiasi su
oda, todl, kad nesukelt skausming poji, pasirenkama atitinkama j temperatra: H
2
O~
45
o
C, purvo iki 50
o
C, parafino 6065
o
C.
Medicinoje danai naudojamos emos temperatros:
1) atskiriems organams ar audiniams konservuoti (prie atliekant transplantacij);
2) altis turi ir anestezuojani savybi, todl mogaus smegenyse gali suardyti lsteli
branduolius, kurie sukelia nervinius susirgimus (pavyzdiui, Parkinsono lig);
3) ualdant ir po to staigiai atildant suardomi nepageidaujami audiniai ar dariniai;
4) mikrochirurgijoje audiniams paimti ir perneti naudojamas drgn audini prialdymas
prie alto metalinio instrumento;
5) kosmetikoje.
aldoma daniausiai ledu, skystu azotu arba labai lakiais skysiais (eteriu, chloretilu ir pan.).
LABORATORINIS DARBAS
Kietojo kno ilumos laidumo koeficiento nustatymas
Darbo uduot i s
Nustatykite nurodyto kietojokno ilumos laidumo koeficient.
Darbo pri emons i r pri et ai s ai
ilumos laidumokoeficientui nustatyti skirtas prietaisas, elektrin plytel, stovas ir stiklins kolbos.
Darbo metodika
Mediag ilumos laidumo koeficientai nusta-
tomi vairiais bdais. Vienas i j palyginimo
bdas: neinomos mediagos ilumos laidumo
koeficientas
x
nustatomas j lyginant su
inomos mediagos ilumos laidumo koefi-
cientu. Prietaisas (5.5.4pav.) ilumos laidumo
koeficientui nustatyti sudarytas i trij 1 cm
storio varini plokteli. Tarp pirmosios ir
antrosios plokteli dedama tiriamoji me-
diaga (M
x
), o tarp antrosios ir treiosios
inoma mediaga (M). Pirmoji ploktel yra
aldoma leidiant joje padarytais kanalais alt
150 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
vanden, o treioji ildoma leidiant per j verdanio vandens garus. Taip tarp plokteli su-
daromas temperatros gradientas, kuris, nusistovjus iluminei pusiausvyrai (termometrrodmenys
nebekinta), yrapastovus. Ploktelitemperatros matuojamos termometrais T
i
(i = 1, 2, 3), statytais
ploktelse padarytas angas.
Per tiriamj mediag per laik t perneamas ilumos kiekis
t
x
x x
l
T T
S Q
1 2

=
; (5.5.16)
ia
x
tiriamosios mediagos ilumos laidumo koeficientas, S jos paviriaus plotas, l jos storis,
T
2
ir T
1
varini plokteli, tarp kuri yra tiriamoji mediaga, temperatros.
Oper inomj mediag pernetas ilumos kiekis per t pat laik t yra
t
l
T T
S Q
2 3

= ;
(5.5.17)
ia l inomos mediagos storis, T
3
ir T
2
varini plokteli, tarp kuri yra inomoji mediaga,
temperatros.
Nusistovjus iluminei pusiausvyrai Q
x
= Q,
t t
l
T T
S
l
T T
S
x
x
2 3 1 2

=

.
(5.5.18)
I ia gaunama
1 2
2 3
T T
T T
l
l
x
x

=
.
(5.5.19)
Darbo eiga
1. Atsukama aldymo sistemos, kuri sujungta sumatavimo prietaisu, sklend.
2. Kolba, kurioje verdamas vanduo ir kuri sujungta su treija varine ploktele, taisoma vir
elektrins plytels taip, kad kolbos dugnas bt bent 3 cmvir kaitinimo spirals.
3. Elektrin plytel jungiama maitinimo tinkl.
4. Potamtikrolaikovanduokolbojepradedavirti. Nuoiomomentopradedami stebti termometr
rodmenys.
5. Pastebjus, kad termometr rodmenys nekinta (vadinasi, sistemoje nusistovjo ilumin
pusiausvyra), jie pasiymimi ir sitikinus, kad temperatros nekinta, stebjimai nutraukiami.
6. Tiriamosios ir inomos mediag storiai (l
x
ir l) arba imatuojami prie eksperiment, arba
randami kiekvienos laboratorijos metodiniuose prieduose. inomos mediagos ilumos laidumo
koeficientas randamas i lenteli.
7. Visus turimus duomenis raius (5.5.19) formul, apskaiiuojamas tiriamosios mediagos
ilumos laidumokoeficientas
x
ir inyne randama mediaga, turinti toki
x
vert. vertinamas
matavim tikslumas.
8. Visi matavim ir skaiiavim duomenys suraomi lentel:
l, m l
x
, m , W/(mK) T
1
, K T
2
, K T
3
, K
x
, W/(mK) A
x
, W/(mK)
MOLEKULIN FIZIKA ____________________________________________________________________ 151
5.6.1 pav. Kietojo
kno ilgin deformacija
Al
l
0
5.6. Kietj kn tamprumas
Kietj kn tamprumo savybs. Vidinis tempis.
Deformacij rys.
Huko dsnis.
Tampros (Jungo) modulis.
Tamprumo atomin ir molekulin prigimtis.
Garso sklidimas tampriojoje terpje.
Mechanins kietjmediag savybs
5.6.1. Kietj kn tamprumas
Kietaisiais knais vadinamos mediagos, kurios turi apibrt tr bei form ir prieinasi jgai, ban-
daniai juos pakeisti. Kntr bei formslygojaveikianios knosudedamsias daleles (molekules
bei atomus) elektromagnetins prigimties sveikos jgos (r. 5.1 skyri). Stacionarios bsenos
mediagoje tos jgos yra pusiausvyroje. Veikiant kn bet kokia iorine jga, i pusiausvyra suyra,
pakinta nuotolis tarp kn sudarani daleli. iam nuotolio kitimui prieinasi daleli sveikos
jgos, todl kne atsiranda vidins tamprumo jgos, atsverianios kn veikianias iorines jgas.
Taigi kne atsiranda vidinis statmenasis tempis o (toliau vadinamas tiesiog tempiu). Jis skaitine
verte yra lygus tamprumo jgai F (arba iorinei, nes esant pusiausvyrai iorini ir tamprumo jg
absoliuiosios verts yra lygios), veikianiai deformuojamoknoskerspjvio plotoSvienet:
S
F
tampr
= o
. (5.6.1)
Esant pastoviai iorinei jgai, nusistovi nauja veikiani jg pusiausvyra, todl kno tris bei
forma pasikeiia.
5.6.2. Kietj kn deformacija
Kiekvienas kietasis knas, veikiamas iorini jg (mechanini, elektrini ar magnetini), keiia
savo form, t. y. deformuojasi (lot. deformatio pakitimas, pakeitimas). Knui deformuojantis,
pakinta nuotoliai tarp j sudarani daleli. Santykin ilgin deformacija apibriama kaip kno
ilgio pokytis, tenkantis pradinio ilgio vienetui (5.6.1 pav.):
0
l
l A
= c ;
(5.6.2)
ia c santykin ilgin deformacija, Al ilgio pokytis, l
0

pradinis ilgis. Mediagos gebjimas atgauti pradinform, kai
nustoja veikti deformacijos jgos, vadinamas tamprumu, o
grtamoji deformacija tamprija, arba elastikja, defor-
macija, prieingu atveju netamprija, arba plastine.
152 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Mediagtempiopriklausomyb nuosan-
tykins deformacijos pavaizduota 5.6.2 pa-
veiksle. Kreivs atkarpoje OA mediag
deformacija yra tiesiogiai proporcinga tem-
piui. i sritis vadinama proporcingumosritimi,
o riba proporcingumo, arba tiesikumo, riba
(PR, takas). Esant maoms deformacijoms,
paalinus deformuojani jg, kn vidinis
tempis tuojau pat arba po kurio laiko atstato
pirmin kno form. Deformacijos sritis OB
vadinama tamprumo sritimi, o jos riba tamp-
rumo riba (TR, takas). iuo atveju defor-
muotas knas tik po kurio laiko gyja pradin
savo form. Proporcingumo (PR) ir tamprumo (TR) ribos nesutampa, bet yra arti viena kitos.
U tamprumo ribos knas nustoja bti tamprus (paalinus iorin jg, jis neatgauna pradins
formos bei dydio). Jis gyja nauj form bei dyd ir esant iems naujiems matmenims jis jau vl
tamprus. Jo tempis yra pastovus, nustojus veikti iorinms jgoms, atsistato nauja kno forma. i
srit vaizduoja kreivs dalis BC. Esantis u tamprumoribos takas Cvadinamas takumotaku (TT).
Toliau veikiant deformacijos jgai sukeliami esminiai mediagos pokyiai: nutrksta molekuli
ryiai ir mediagos sluoksniai teka vienas vir kito. Toks kitimas vadinama plastine deformacija
(mediaga tampa plastika). i srit vaizduoja kreivs dalis CD. Dar didjant iorinei jgai,
deformacija didja ir galiausiai mediaga suyra (takas Dvadinamas ardymo riba AR).
Plastikieji knai yramaai tamprs, j tamprumoriba yra daug kartmaesn u takumo rib.
Trapij mediag (stiklo, kvarco ir kt.) takumo takas yra maesnis u tamprumo rib, todl ios
mediagos lieka elastingos iki j suardymo. Kai kuri elastingj mediag deformacijos kitimas
didinant temp skiriasi nuo jo kitimo mainant temp. Taigi, esant vienodiems tempiams, tam
tikros deformacijos yra nevienodos.
Kn deformacijos bna vairios. Pagrindinmis laikomos tempimo (5.6.3 pav., a) bei
gniudymo (5.6.3 pav., b), lenkimo (5.6.4 pav., a, b, c), lyties (5.6.3 pav., c) ir sukimo (5.6.3 pav.,
d) deformacijos.
5.6.2 pav. Tempimo diagrama
o, N/m
2
A
B
C
D
PR
TR
TT
AR
O c
5.6.3 pav. Deformacij rys: tempimo (a), gniudymo (b), lyties (c) ir sukimo (d)
F F
S
F
2
F
1
= F
2
F
o
a) b) c) d)
MOLEKULIN FIZIKA ____________________________________________________________________ 153
5.6.3. Huko dsnis. Tampros, arba Jungo, modulis
Kno vidinio tempio ir santykins deformacijos ry 1660 metais bandymais nustat angl fizikas
R. Hukas (R. Hooke). i priklausomyb teigia, kad deformacijos jgos veikiamo kno santykin
ilgin deformacija yra tiesiog proporcinga tempiui:
o=c E; (5.6.3)
ia E proporcingumo koeficientas, vadinamas mediagos tampros, arba Jungo, moduliu. raius
c ir o reikmes, gaunama
S
F
E l
l 1
0
= ,
arba
l
l
S
F
E

0
=
.
(5.6.4)
i formulparodotampros moduliofizikinprasm. Jei 1
0
=
A
l
l
(mediaga pailgjadvigubai), tai
E= F/S = o, (5.6.5)
t. y. skaitine verte tampros modulis lygus tokiam vidiniamtempiui, atsirandaniamkne, kai jo
ilgis padidja du kartus. Didels tampros mediagos realiai tiek nepailgja, todl tampros modulis
apibrtas tik formaliai. Be to, Huko dsnis galioja tik maoms deformacijoms.
vairi mediag tampros moduliai yra skirtingi (r. pried 8 lentel). J didumas priklauso
nuo mediagos tamprumo savybi. Izotropini kn tampros modulis visomis kryptimis yra
vienodas. Anizotropini kn, ypa kristal, tampros modulio vert priklauso nuo tempimo arba
slgimo krypties.
5.6.4. Lenkimo deformacija
Kno deformacij galima sukelti j lenkiant. Keturkampio strypo vien gal tvirtinus, o antrj
lenkiant tamtikra jga F(5.6.4 pav., a), strypas isilenkia. Iorin ilenkta strypo dalis tempiama, o
l

F
l

F
5.6.4 pav. Lenkimo deformacija: veikiant vien gal (a),
abu galus laisvai padjus ant atram (b) ir tvirtinus (c)
a) b) c)
l

F
F
Ad
Ad
Ad
154 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
lenkta vidun slegiama (gniudoma). Dvi strypo dalis skiria deformacijos nepaliestas neutralusis
sluoksnis. Ilenkto strypo vidins tamprumo jgos stengiasi grinti stryp pradin padt, t. y. jos
prieinasi deformuojanios jgos poveikiui. Labiausiai prieinasi deformuot sluoksni vidins
tamprumo jgos. Neutralusis sluoksnis yra visai nedeformuotas, todl jis visai nesiprieina defor-
muojani jgpoveikiui, t. y. neturi takos mediagos atsparumui. Dl ios prieasties technikoje
vairios konstrukcijos, kurias veikia lenkimodeformacijos, danai daromos tuiavidurs, vamzdi
pavidalo. Taipsutaupomadaug metalo, detals esti lengvesns, nors atsparumas lenkimui pasikeiia
neymiai.
Strypolinkis Ad (jolaisvojogaloarba vidutiniotakoposlinkis) yra tiesiog proporcingas lenkimo
deformacijos jgai F, strypo ilgiui l, atvirkiai proporcingas jo ploiui b ir storiui a:
3
3
Eba
Fl
k = ;
(5.6.6)
ia k skaitinis koeficientas, kurio vert priklauso nuo strypo tvirtinimo bdo. iuo atveju k = 4.
Kai abustrypgalai laisvai padti ant atramir pats strypas lenkiamas per vidur, k= 1/4 (5.6.4 pav.,
b), o kai abu strypo galai tvirtinti, k = 1/ 16 (5.6.4 pav., c). Imatavus strypo link, galima rasti tos
mediagos tampros modul.
domu tai, kadir gamtoje daugelio augalstiebai, pauki sparn bei gyvn kaulai, kuriems
tenkaatlaikyti lenkimodeformacijas, taippat tuiaviduriai. Jei jienebttuiaviduriai, atsparumas
lenkimui bt maesnis, nes pilnavidur stieb ar kaul, be iorins jgos, veikt dar ir jo paties
sunkis, kuris visada didesnis u tuiavidurio stiebo sunk.
5.6.5. lytis. lyties modulis
Gretasienio ABCD pavirius, kurio pagrindas AD
tvirtintas (5.6.5 pav.), veikiamas jgos Fdeformuojasi
ir gauna pavidal AB
1
C
1
D. Jgos veikiami kno
sluoksniai pasislenkanevienodai: daugiausiai pasislen-
ka virutinis sluoksnis (atstumu Ax), o apatinis pasi-
lieka vietoje. Toks poslinkis vadinamas lyties defor-
macija. Tada deformuoto kno vidinis tempis lygus
tamprumojgos ir knovirutinio paviriaus (BB'CC')
ploto S santykiui ir vadinamas lyties tempiu t :
t =F/S. (5.6.7)
Pasinaudojus Hukodsniu, galima urayti
y
x
G

= t
;
(5.6.8)
ia G lyties modulis, priklausantis nuo mediagos atsparumo lyties deformacijai, y =CD.
5.6.5 pav. lyties deformacija
F
o
B B
1 C C
1
Ax
D A
B'
C'
y
Ad
MOLEKULIN FIZIKA ____________________________________________________________________ 155
a) b)
5.6.6 pav. Atstumai tarp atom nedeformuotame
(a) ir deformuotame (b) metale
a b
5.6.7 pav. Ilgj molekuli isidstymas
nedeformuotuose (a) ir deformuotuose (b) polimeruose
a) b)
Huko dsnis galioja tik maoms deformacijoms, todl lyties deformacijos atveju jis galioja tik
tada, kai kampas o, kuriuo virutinis sluoksnis pasislenka pagrindo atvilgiu, yra nedidelis:
Ax/y = tgo ~ o.
staius t ir Ax/x reikmes Huko dsnio iraik,
t =Go. (5.6.9)
Jeigu o = 1 rad, G = t . Taigi lyties modulis savo skaitine verte lygus vidiniamlyties tempiui, kai
lyties kampas lygus 1 rad. Kaip ir tampros modulis ((5.6.5) formul), lyties modulis apibrtas
formaliai, nes tokiems dideliems lytiems kampams negaliot Huko dsnis.
5.6.6. Tamprumo atomin ir molekulin prigimtis
Lyginant plieno ir gumos deformacijas, matyti didelis j skirtumas. Pirmiausia j Jungo moduliai
skiriasi beveik 100 000 kart (r. pried 8 lentel), o santykin deformacija c iki atsparumo ribos
plieno yra tik keli procent eils, tuo tarpu gumos gali siekti ~200300%. is skirtumas yra dl
molekulins tamprumo prigimties. Metalas polikristalin mediaga, kurios nedidelse dalyse
(kristaluose) yra grieta tvarka. Esant tamtikrai temperatrai, atstumas tarpatom(jon) yra toks,
kadtraukos jgos btkompensuotos stmos jg(5.6.6 pav., a). Deformavus kn, pakintaatstumai
tarpatom (5.6.6 pav., b) ir tai sukelia elastini atstatomj jg atsiradim.
Guma sudaryta i nereguliariai isidsiusi ilg molekuli, kurios per j ilg yra krymikai
sujungtos vairiuose takuose. Ne-
itemptoje bsenoje molekuls yra ne-
tvarkingai sulankstytos (5.6.7 pav., a) ir
dl Brauno (iluminio) judjimo nuo-
lat kinta. Itempiant gum, molekuls
isirikiuoja tvarkingiau(5.6.7 pav., b) ir
tik krymins jungtys ilaiko molekules
nuo islydimo viena i po kitos. Kai j-
gos nebeveikia, chaotikas molekuli
judjimas stengiasi iardyti tvark ir su-
trumpinti gum. Gumos elastingumas
yra bdingas ir daugumai biologini au-
dini, kurie sudaryti i krymikai su-
jungt ilg polimer molekuli, pavyz-
diui, kraujagyslisienels ir kiti organai
sudaryti i elastino, abdiktino ir kt.
Krymini jungi skaiius gumos
tipo mediagoje veikia deformacijos
156 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
didum ir tampros modul. Kai atstumas tarp krymini jungi maas, tokia polimero molekul
pailgja maiau negu esant dideliam atstumui tarp jungi. Tarp lyties modulio G ir vidutins
molio mass M
l
tarp krymini jungi yra sryis
G RT M
l
= / ;
ia mediagos tankis, R universalioji dujkonstanta, T temperatra (K).
5.6.7. Energija, sukaupta tampriose mediagose
Mediagai itempti btinaatlikti darb. Kai jga, dl kurios poveikiomediagabuvoitempta, suma-
inama arba panaikinama, mediaga stengiasi sugrti pirmin bsen. Aiku, tai vyksta, jei pa-
naudotane per didel jga, kadmediagatrkt. Deformacijai atlikti btinas darbas randamas dau-
ginant tamprumoatstatomjjg(kuri deformacijos metukinta) i atstumo, kuriuodeformuojamas
knas pasislenka. Paprastai tai gali bti ireikta jgos priklausomybs nuo isipltimo diagrama
(5.6.8 pav.). Darbas dAdl deformuojamoknopailgjimodl lygus Fdl. Visas atliktas darbas yra
A F l
l
l
=
}
d
1
2
.
Biologiniams objektams Huko dsnis negalioja, todl darbas didinant tempim ir j mainant
yra skirtingas. Ciklins deformacijos kreivs sudaro kilpas. is reikinys vadinamas elastingja
histereze (gr. hysteresis trkumas, stoka, atsilikimas). Mainant tempim, darbas atliekamas
maesnis. Energijos nuostoliai isitempimo-susitraukimo ciklo metu virsta mediagoje iluma.
Deformuota mediaga turi potencins energijos, kuri lygi darbui, reikalingamiai deformacijai
atlikti, i jos atmus darb, btin pasiprieinimo jgoms nugalti. Taiau ne visa energija gali
5.6.8 pav. Tamprumo jgos priklausomybs nuo isipltimo diagrama:
tempimas (a), atstatymas (b), elastingoji histerez (c)
deformacijoscikle
T
a
m
p
r
u
m
o
j
e
g
a
F
Pailgjimas
dl
a) b) c)
Darbas, btinas
tempimui
Atstatomosios
deformacijos darbas
Energijos nuostoliai
deformacijos cikle
MOLEKULIN FIZIKA ____________________________________________________________________ 157
bti atiduota, kai mediaga susitraukia. Atiduotos energijos susitraukiant ir darbo, panaudoto
deformacijai, santykis
pan
at
A
A
= q
priklauso nuo ciklo trukms ir geriausiu atveju yra 97 % baltymui resilinui, 91 % abducinui.
Susitraukiant sukuriamas darbas (atiduodamaenergija) gali bti panaudotas naudingai. Deformuoto
resilino energija naudojama vabzdi skrydiui ir leidia taip toli nuokti blusai. Skrys uoliams
irgi panaudoja deformuotoraumens elastin energij.
5.6.8. Garsosklidimas tampriojoje terpje
Mediaga, kurios daleles ria tamprumo jgos, vadinama
tamprija. Jei tampriosios terps vienojevietojeyrasukeliami
daleli virpesiai, tai dl daleli sveikos ie virpesiai sklinda
terpe tam tikru greiiu v. Virpesi sklidimas terpje vadi-
namas banga. Sklindant bangai, kiekvienaatskiradalel, kuri
pasiek banga, pradeda virpti aplinksavo pusiausvyros pa-
dt. Atsivelgiant dalels virpesi krypt bangos sklidimo
atvilgiu, bangos skirstomos iilgines ir skersines (5.6.9 pav.).
Iilgins (5.6.9 pav., a) tai tokios bangos, kai dalels
virpa iilgai bangos sklidimo krypties, pavyzdiui, garso
banga dujose ir skysiuose (daugiau r. 4.3 skyri). Visos jos
yra mechanins prigimties, t. y. jose virpa dalels.
Skersins bangos (5.6.9 pav., b) yra tokios, kai dalels virpa statmenai bangos sklidimo krypiai,
pavyzdiui, bangos vandens paviriuje. Mechanins skersins bangos gali sklisti tik mediagose,
kuriose galima lyties deformacija. Skysiuose ir dujose sklinda tik iilgins bangos. Kietuosiuose
knuose galimos tempimo bei gniudymo ir lyties deformacijos, todl juose gali sklisti abiej
ri bangos.
Kiekvien bang galima charakterizuoti periodu, arba daniu, bangos ilgiu, bangos sklidimo
greiiu.
Periodas T tai vieno virpesio trukm. Danis v virpesi skaiius per laiko vienet. Bangos
pavirius tai pavirius, jungiantis tos paios fazs sklindanios bangos takus. Bangos frontas tai
bangos pavirius, skiriantis erdv, kurioje virpesiai vyksta, nuo erdvs, kurioje jie dar neprasidjo.
Bangos frontas visada statmenas bangos sklidimo krypiai ir gali bti vairios formos. Bangos ilgis
maiausias atstumas tarp dviej vienoda faze virpani bangos tak. Bangos ilgiu galima
vadinti ir nuotol, kuriuo nusklinda banga per vien virpesi period. Ryys tarp bangos ilgio,
svyravimo periodo T ir jos sklidimo greiio v ireikiamas lygybe
=vT. (5.6.10)
5.6.9 pav. Daleli virpesiai iilginje
(a) ir skersinje (b) bangoje
Bangos sklidimo kryptis
Dalels
virpesi
kryptys
a) b)
158 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Virpesi danis v = 1/T, todl
v= v. (5.6.11)
Sklindant vairiose terpse vienodoperiodobangoms, jilgis ir sklidimo greitis yra skirtingi. Bang
sklidimo greitis vpriklausotik nuo terps savybi: tankio ir mediagos tamprumo. Iilgini bang
sklidimo greiio v kvadratas yra atvirkiai proporcingas terps tampros moduliui ir jos tankiui:
= v
E

; (5.6.12)
ia E mediagos tampros modulis, jos tankis.
Skersini bang sklidimo greitis priklauso nuo lyties modulio G:
= v
G

.
Kietjkntampros modulis yra didesnis u lyties modul, todl iilgins bangos juose sklinda
greiiau nei skersins. Plaiau apie garso sklidim vairiose terpse galima rasti 4.4 skyriuje.
5.6.9. Pulso bangos sklidimas kraujagyslse
Mediagtamprumosavybs slygoja pulsobangos atsiradim kraujagyslse ir jos sklidimo dsnin-
gumus. Arterij sieneli deformacijos metu isiskirianti energija panaudojama kraujo tekjimui.
Kraujo tris, kur irdis istumia aort sistols metu, sukelia pulso bang, iplintani arterinje
sistemoje nuoaortos iki arterioli. Sistolinis kraujotris itempia elastingas aortos sieneles, kadangi
i irdies arterin sistem sistols metu istumiamo kraujo tris yra didesnis u tr, kuris tuo pat
metu nuteka audinius. Aortos itempimo metu kinetin energija virsta deformacijos potencine
energija ir apie 50 aort istumtokraujosusikaupia itemptuose elastingarterijsegmentuose.
irdies diastols metu, sumajus spaudimui skilvelyje, itemptos elastingos aortos sienels sugrt
pradin padt, pastumdamos krauj periferij, t. y. potencin energija virsta kinetine. Kraujui
sugrti atgal ird neleidia usidar pusmnuliniai votuvai. is efektas, kur nulemia aortos ir
stambiarterijelastins savybs, slygojanetolygios sistolins kraujotkms aortojevirtimtolygiu
tekjimu periferinse arterijose. Tai iliustruoja ir eksperimentinis modelis, kuriame, tuo paiu
metu ritmikai spaudiant skyst stiklin vamzd ir tokio pat skersmens gumin arn, pastebima,
kad tampria gumine arna skystis teka daug tolygiau negu standiu stikliniu vamzdiu.
Kraujagysli elastinms savybms vertinti medicinoje naudojamas standumo rodiklis E', kuris
priklauso nuo slgio ir trio kraujagyslje pokyi:
V
p
E
A
A
= ' ;
ia AV kraujagysls triopokytis, APslgiokraujagyslje pokytis. Dydis, atvirkias kraujagysls
standumui, vadinamas jos tsumu. Pavyzdiui, arterij standumas E' daug kart virija rodikl
MOLEKULIN FIZIKA ____________________________________________________________________ 159
venose, kuriose kraujo trio padidjimas sukelia labai neymius slgio pokyius. Venos isiskiria
dideliu tsumu ir gali sutalpinti didel kraujo tr, todl pagal atliekam funkcij jos vadinamos
talpuminmis kraujagyslmis.
Pulso bangos plitimas panaus bangos plitim gumine arna. Jos greitis priklauso nuo krau-
jagysls sienels tamprumoE ': kuotamprumas didesnis, tuogreiiauplintabanga(5.6.12 formul).
Pavyzdiui, jaunmoniaortoje pulsobangos greitis lygus 56 m/s, oraumeniniotipo arterijose
812m/s, nes periferini kraujagysli standumas didesnis. Vyresnio amiaus moni kraujagysli
standumas didja ir tai slygoja pulso bangos greiio padidjim. Padidjus arteriniam kraujo
spaudimui, pulso bangos greitis papildomai padidja, kadangi maja kraujagysli tsumas. Pulso
bangos greitis yra daug didesnis u kraujo srovs tekjimo greit, kuris stambiose arterijose
vidutinikai bna lygus 2050 cm/s.
5.6.10. Kietj mediag savybs
Beveik visi mus supantys daiktai kiekvien diennuolat ar trumpai yra veikiami tamtikr apkrov.
Pavyzdiui, kd ant kurios mes sdime, pastato pamatas, knyg lentyna ir kt.
iuolaikinje technikoje pagrindins konstrukcins mediagos yra metalai, j lydiniai ir plast-
mass. Daugiau kaip 99 gaminam metal naudojami technikoje tik todl, kad turi tam tikr
fizini savybi derin ir puikias atsparumo apkrovoms savybes. Likusieji 1 naudojami vairiose
technikos srityse dl kit j fizini savybi (elektrini, magnetini ir kt.). Veikiamos apkrovos,
mediagos deformuojasi, t. y. keiia savo matmenis ir form. Technikoje daniausiai i anksto yra
inoma apkrova, kuri veiks i tamtikros mediagos pagamint detal, ir tempis, kuris tai detalei
gali bti pavojingas. Todl konstruktoriaus udavinys parinkti tokius detals matmenis ir form,
kad tempis neviryt leidiam rib. Kuo didesnis mediagos tempis, prie kurio pasireikia plas-
tikumas (5.6.2 pav., takas C), tuopatikimesn mediaga j eksploatuojant, tuomaesn nelaukt
mediagos trki tikimyb, kurie gali baigtis katastrofa.
Mechanins mediagsavybs gali keistis labai plaioseribose. Netgi topaties lydinioatsparumas
ir plastikumas gali labai smarkiai skirtis priklausomai nuo lydinio apdirbimo, jo temperatros ir
kt. vairi konstrukcini mediag metalini ir nemetalini visuma apima labai plat me-
chanini charakteristik diapazon.
5.6.11. Judjimo organ sistema
Viena i bding gyvajamorganizmui savybiyra judjimas. Judjimo organais galima persikelti i
vienos erdvs vietos kit, pakeisti atskir kno dali padt, maitintis, kvpuoti ir pan. Judjimo
organsistemsudaropasyvieji ir aktyvieji judjimoorganai. Prie pasyvijjudjimoorganpriski-
riami kaulai, kremzls, raiiai, o prie aktyvij raumenys ir j pagalbins dalys.
Kaulai (lot. ossa kaulas) yra kieti ir stands organai, sudarantys organizmo griauius. Jie
palaiko pastovi kno form ir proporcijas, gaubia paeidiamus organus (pavyzdiui, smegenis,
plauius, ird, akis, ausis). Evoliucijos procese gamta sumaino mogaus ir gyvuli kaul mas,
160 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
isaugodama griaui tvirtum. Akivaizdus pavyzdys paukiai, kurie daugiau nei kiti gyviai
suinteresuoti sumainti savosvor. tai 1679 metais pirmasis atkreipdmes italfizikas D. Borelis
(D. Borell), paymdamas, kad,,paukioknas neproporcingai lengvesnis nei mogaus ar kitokurio
keturkojo Pavyzdiui, paukio fregato, kuriosparnilgis yra 2 m, griauiai sveria tik 110 g.
5.6.12. Mechanins kaulinio audinio savybs
Kaulai sudaryti i kaulins mediagos: paviriuje tankios, kompak-
tikos, viduje akytos, susidedanios i kaulini sijeli (5.6.10 pav.).
Kaulin mediaga susideda i kaulinio audinio, kraujagysli ir nerv.
Kaulinis audinys yra viena i audinio ri. Jis isiskiria tvirtumu bei
kietumuir sudarytas i dviejskirtingsand: kolagenoir mineralini
mediag. Kolagenas tai pagrindin organinio jungiamojo audinio
sudedamoji dalis. Kaulo mineralini mediag pagrindinis sandas yra
kalcio druskos. Kaulosudtyje yra ~ 99 organizme esanio kalcio ir
~ 75 fosfat. Tokiasudtis suteikia kaului geras mechanines savybes:
jungiamasis audinys garantuoja tamprum, mineralins mediagos
kietum, o abu kartu tvirtum. Paalinus vien i dviej dali, kaulo
formos praktikai nepasikeiia. Ilgai laikant kaul 5 acto rgties
tirpale, visi neorganiniai komponentai (tarp j ir kalcio druskos)
itirpsta. Tada kaulas, kuriame praktikai liks tik kolagenas, tampa
elastingas kaipguma ir j galima susukti ied. Kaul sudeginus, visas kolagenas sudega, olieka tik
neorganiniai komponentai.
Kaulinis audinys yravienas i labai diferencijuotjungiamjaudini, isiskiriani atsistatymo
potencialu: ir osteocitai, ir tarplstelin mediaga gali visikai atsistatyti. Pakartotinas kaulinio
audinio atsistatymas artimai atkartoja kaulo vystymosi ir augimo procesus. i kaulinio audinio
savyb svarbi klinikinei praktikai (traumatologijai, ortopedijai, stomatologijai), ypa esant dideliems
defektams (nuo 10 cm), kai subrends kaulinis audinys nepajgia upildyti kaulo defekto. Norint
patobulinti kaulinio audinio regeneracij, per pastaruosius 20 met tyrinjamos implantacins
mediagos, kurios, sudarydamos kaulo defekto ertmje karkas, padeda ir skatina kaulini lsteli
mitotin dauginimsi ir paplitim visame defekte. Taip utikrinamas kaulo struktros ir funkcijos
atsistatymas.
Kaul sandara evoliucijos eigoje prisitaik prie vairi krvi, tenkani tam tikram kaului.
Pavyzdiui, ilgieji, arba vamzdiniai, kaulai be iimties yra galnse. Jie lengviaupasiduoda lenkimui
(bet nelta), nes yra vamzdio formos. Tai leidia ekonomikai taikyti kaulo audin, kadangi
lenkiant audinio sluoksniai, esantys prie iilgins kno aies, beveik nedalyvauja pasiprieinimo
apkrovai procese.
Ypa didel ir vairi mogaus kaul ir raii mechanin apkrova susidaro ne tik dl kno
svorio, bet taip pat ir dl raumen jgos, atsirandanios pradjus koki nors fizin veikl. ia gali
bti vairi ri jg, veikiani atramos aparat, sveikos. Daniausiai tai spaudimo (stuburo
5.6.10 pav. Kaulo
sandara [pagal 52]
MOLEKULIN FIZIKA ____________________________________________________________________ 161
5.6.12 pav. Kaul liai [pagal 52]
kamienui, apatinms galnms), tempimo
(virutinms galnms, raiiams, raumenims)
ir lenkimo (stuburui, dubens kaulams, galni
kaulams ir kt.) jgos. Jei apkrovavirija leistin
tam tikr element tamprumo rib, tai tie
elementai suyra. Tai gali bti kaul limai ir
sausgysli patempimai. Taip pat galimi kaul
inirimai, raumen trkiai, odos paviriaus
paeidimai ir kt. Tamtikraudinideformacijos
priklausomyb nuo tempio pateikta 5.6.11
paveiksle.
Minktieji audiniai (raumenys), jungiamieji
audiniai (raiiai ir kiti) daugiausia sudaryti i
baltym, pagal savoprigimt priskiriampriepolimer. Raumenys yra aktyvios vestibulinioaparato
dalys veikiant nerviniams impulsams jie keiia savo ilg ir ivysto tamtikr jg. Susitraukiantis
raumen elementas yra mioskaidulos (miofibrilos). Mioskaidulos sudarytos i didelio skaiiaus
protofibril, itempt molekuli(sil) aktino ir miozinobaltym, isidsiusi besikeiianiomis
sritimis ir sujungt tarpusavyje taip, kadvien sil galai eina tarpus kit sil, panaiai kaipgali
bti sunerti rank pirtai.
5.6.13. Kaul lis. Kaul tvirtumas
Kaulo lis tai kaulo vientisumo paeidimas. Daniausiai kaulai lta darbingo amiaus (20
50 m.) monms; vyrams lta daniau nei moterims. Kaulas gali skilti arba lti ir visikai
nulti (5.6.12 pav.). Vaiko kaulai lta kaipalia vytel: ievinis kaulo sluoksnis lta, o antkaulis
ilieka sveikas. Kaulas gali lti skersai, iilgai (labai retai), striai, spiralikai, skeveldrikai (suyra
vairaus dydioskeveldras). Lus kaului vienoje vietoje, bna 2 lgaliai, lus keliose daugiau
lgali. Danai limas bna dl traumos, kai kaul veikia staigi iorin jga, didesn u jo
atsparum. Kaulas gali lti ir sergant kai kuriomis ligomis (pavyzdiui, kaul ir snari
tuberkuliozmis, osteomelitu), dl kaulo naviko, senatvje (dl kalcio stokos senomogaus kaulai
pasidarotraps).
ios knygos pried 7, 8 lentelse pateikti
kritinio tempioduomenys, kuriems esant me-
diagos suyra, Jungo moduliai ir kiti duo-
menys, i kuri matyti, kad kaulas savo tvir-
tumu nusileidia tik plienui, bet yra daug tvir-
tesnis nei granitas ar betonas.
mogaus peties vidurins dalies kaulo
skerspjvio plotas yra apie 3,3 cm
2
. Pasinau-
dojus lenteli duomenimis, galima apskai-
Aktyvsraumenys
Proporcingumo
riba
Viela
Kaulai
Tempimo
riba
Besiilsintys
raumenys
V
i
d
i
n
i
s

t
e
m
p
i
s
,
o
Santykin deformacija, c
Atsipalaidav
raumenys
5.6.11 pav. Vielos ir kai kuri audini vidinio
tempio priklausomyb nuo deformacijos
162 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
iuoti maksimal krvio svor, kok gali ilaikyti is gniudomas kaulas, bdamas vertikalioje
padtyje. is svoris lygus 600 kN. Taippat galima apskaiiuoti ir maksimali jg, kuri gali ilaikyti
tie patys kaulai, jei i jga pridta prie jo laisvojo galo: iilgai statmenosios aies ji lygi 5500 N,
inant, kad kaulo iorinis skersmuo yra 28 mm, vidinis 17 mm ir ilgis lygus 200 mm.
LABORATORINIS DARBAS
Tampros modulio nustatymas dinaminiu lipo bdu
Darbo uduotys
Nustatykite tiriamosios vielos tampros modul.
Raskite garsosklidimo greit mediagoje, i kurios pagaminta viela.
Darbo prietaisai ir priemons
Prietaisas, sudarytas i stovo (G), keturkampio strypo (AB) ir
tiriamosios vielels, liniuot, mikrometras, sekundmatis.
Darbo metodika
FizikoK. lipopalikimas nors ir nedidelis, bet vertingas, skirtas
jo pamgtiems laboratoriniams eksperimentams, taippat kai ku-
rioms technikos problemoms. K. lipas Lietuvos universiteto
Fizikos katedrojepradjodirbti docentu1922 metais. iajis skait
termodinamikos, taip pat kelis kitus fizikos kursus, vadovavo
fizikos laboratoriniams darbams. Be to, 19261931 metais
vadovavo Fizikos katedrai, 1929 metais irinktas jos ekstraor-
dinariniu profesoriumi.
K. lipas tvark mechanikos laboratorinius darbus, papild
juos naujais eksperimentais, konstravo aparatr, ruo apraus,
iekojo bd darbams tobulinti, nauj laboratorini darb
metodik. Jis 1927 metais paskelb nauj dinamin bd Jungo
moduliui nustatyti. is bdas remiasi sistemos virpesi periodo
matavimu ir iki iol naudojamas.
lipo prietaiso schema pavaizduota 5.6.13 paveiksle. Ketur-
kampis strypas (AB) svyruoja ant stovo (G) atram. Tiriamoji
viela (C) yra perverta per viruje (take E) pritvirtint siaur
paslank tvirtinim. Ijudintas strypas (AB) pradeda svyruoti, o
viela isilenkia deformuojasi (5.6.14 pav.). Viena jos pus yra
gniudoma, kitatempiama. Atsiradusios tamprumojgos sukelia
joms proporcing kreipimo moment D, kuris veria stryp
svyruoti. Virpesi periodas
5.6.13 pav. lipo
prietaiso schema
A B
G
E
C
D
5.6.14 pav. Vielos
ilinkimas
E
C
D
E
C
A B
D
E
C
D
MOLEKULIN FIZIKA ____________________________________________________________________ 163
a, m b, m l, m d, m R, m t, s T, s I, kgm
2
E, N/m
2
v, m/s
D I T t = 2
; (5.6.13)
ia I keturkampio strypo inercijos momentas sukimosi aies, einanios per tvirtinimo tak D,
atvilgiu. Jis apskaiiuojamas taip:
(
12
m
I =
(a
2
+b
2
); (5.6.14)
ia a ir b dviej sukimosi aiai statmen strypo briaun ilgiai, m strypo mas.
Kreipimo momentas Drandamas pagal formul
l
E R
D
4
3
4
= ;
(5.6.15)
ia l vielos ilgis (atstumas tarp Eir Dtak), R vielos spindulys. ios formuls iraik raius
(5.6.13), randamas tampros modulis
4 2
3
16
R T
lI
E =
. (5.6.16)
Darbo eiga
1. Atlenkus stryp nuopusiausvyros padties, jis paleidiamas svyruoti. Sekudmaiu imatuojama
1020 virpesi trukm t ir randamas virpesi periodas T = t/n; ia n virpesi skaiius.
2. Liniuote imatuojamas vielos ilgis, strypo kratini ilgiai.
3. Mikrometru imatuojamas vielos skersmuo d ir randamas vielos spindulys R(R= d/2).
4. Pagal (5.6.14) formul apskaiiuojamas strypo inercijos momentas.
5. Pagal (5.6.16) formul apskaiiuojamas vielos tampros modulis.
6. Pagal (5.6.12) formul apskaiiuojamas iilgini virpesi sklidimo greitis mediagoje, i kurios
pagaminta viela.
7. Matavimai kartojami keiiant vielos ilg.
8. Matavim ir skaiiavim duomenys suraomi lentel. vertinamas matavim tikslumas.
164 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
LABORATORINIS DARBAS
Mediagtamprumo savybi tyrimas
Dar bo u duot i s
I lenkimo deformacijos nustatykite tampros modul:
vairi metal ir medio plokteli;
vairi kaul bandini.
Dar bo pr i e mon s i r pr i e t ai s ai
Prietaisas tampros moduliui nustatyti, liniuot, slankmatis, mikrometras, tiriamieji pavyzdiai.
Da r b o me t o d i k a
iame darbe tampros modulis nustatomas i lenkimo defor-
macijos. Prietais tampros moduliui nustatyti (5.6.16 pav.)
sudaro pagrindas (1) sudviemvertikaliomis atramomis (2),
ant kuri dedamas tiriamasis pavyzdys (3) metalin
ploktel arba kaulo audinio pavyzdys. Ant nejudamos atra-
mos yra pritvirtinta atramin prizm, o ant judamosios
besisukantis guolis, kuris sumaina trint. Tarp atram yra
strypas, prie kurio pritvirtintas rodyklinis mikrometras (4).
Prie kiekvieno tiriamojo pavyzdio yra pritvirtintas
kabliukas svoriams prikabinti.
Dar bo e i ga
1. Liniuote imatuojamas tiriamojo pavyzdio ilgis l, o slankmaiu ir mikrometru jo plotis b ir
storis a. Pavyzdioilgis suprantamas kaipjoatstumas tarpatram. Kiekvienodydio matavimai
atliekami bent tris kartus vairiose pavyzdio vietose ir apskaiiuojamos j vidutins verts.
2. Pavyzdys padedamas ant atram, prie jo vidurio priartinamas rodyklinis mikrometras ir pasis-
tengiama nustatyti jo rodykl ties nuline padala.
3. Po to prie pavyzdio centre esanio kabliuko kabinami vairios mass mkroviniai ir kiekvienu
atveju ufiksuojami mikrometro rodmenys; nustatomas linkis Ad.
4. Randama kiekvieno krovinio deformacijos jga F = mg (ia g laisvojo kritimo pagreitis) ir
apskaiiuojamas santykis F/Ad. Randama iosantykio vidutin vert.
5. Apskaiiuojamas tiriamojo pavyzdio tampros modulis E(i 5.6.6 formuls ireikiamas Eir
vietoje koeficiento raoma 1/ 4, kadangi abu pavyzdio galai laisvai padti ant atram):
3
3
4 ba
Fl
E

=
.
5.6.15 pav. Prietaiso tampros
moduliui nustatyti struktrin schema
0 1 23 4 5 6 78 9
10 0
20
30
40
50
60
70
80
90 90
80
70
60 40
30
20
10
0.01 mm M adein Vi lni aus Univer sit et as F izi kosF akult et as K E K 517

1
2
3
4
4Adba
MOLEKULIN FIZIKA ____________________________________________________________________ 165
5.7. Mass pernaa
- Pernaos reikiniai. Difuzija.
- Fikodsnis. Difuzijoslygtis.
- Difuzijos koeficientas ir jo ryys su dinamine klampa.
- Difuzijospasireikimopavyzdiai. Difuzijaaplinkosfizikoje. Masspernaaperporas. Duj ir
vandenspernaagyvn kailyjeir per mogausod.
- Osmosas.Dializ.Hemodializ.
5.7.1. Pernaos reikiniai
Daugelis fizikini proces, vykstani atmosferoje, gyvosiose ir negyvosiose sistemose, susij su
mass, judesio kiekio ir energijos pernaa. i dydi pernaa vyksta pagal panaius dsnius, todl
ganadanai iedsniai fizikos kursenagrinjami greta. Taiauiamevadovlyje, grupuojant mediag
pagal temas, judesiokiekiopernaa buvonagrinta aptariant skysiir dujklampum(5.1 skyrius),
oenergijos pernaa nagrinjant ilumos laidum (5.5 skyrius). iameparagrafenagrinjamamass
pernaa dl difuzijos reikinio. Visi ia minimi pernaos reikiniai yra panas tuo, kad vyksta dl
mediagos molekuli ar daleli judjimo ir pasireikia sistemose, turiniose tam tikro dydio
gradient.
5.7.2. Difuzija
Difuzijasavaiminis vienos mediagos molekulisiskverbimas kitmediagneveikiant iorinms
jgoms. Gana paprasta reikin stebti ant spalvoto tam tikros mediagos tirpalo (pavyzdiui,
vario sulfato ar jodo) atsargiai upylus gryno vandens taip, kad susidaryt ryki skiriamoji tirpal
PavyzdioNr. ir
pavadinimas
a
i
, m a
vid
, m
.
b
i
, m b
vid
, m l
i
, m l
vid
, m
PavyzdioNr. ir
pavadinimas
m, kg F, N , m F/, N/m (F/)
vid.
, N/m E, Pa
6. Visi matavimai ir skaiiavimai kartojami imant kitus pavyzdius.
7. Matavim ir skaiiavim rezultatai suraomi 1 ir 2 lenteles.
1 lentel
2 lentel
8. Kiekvienampavyzdiui nubraiomas priklausomybs Ad = Ad(F) grafikas.
Ad F/Ad, (F/Ad)
166 __________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Maa
konc.
Didel
konc.
Galutinis
profilis
Tarpinis
profilis
Pradinis
profilis
riba. Po tamtikro laiko galima pastebti, kaip vanduo pradeda nusidayti emiau esanio tirpalo
spalva, net jei indas su tirpalais nra judinamas ir kratomas. Kartu skiriamoji riba tarp skirting
tirpal pradeda nykti. itoks savaiminis maiymasis, nulemtas atsitiktiniomolekuli judjimo, yra
vadinamas difuzija. iuo atveju net ir sunkesns molekuls pakyla vir skirting tirpal ribos ir
siskverbia lengvesn mediag, nors tamprieinasi gravitacijos jgos. Kadangi difuzija vyksta dl
mediagos molekuli ar daleli judjimo, todl ji daugiausia reikiasi dujose ir skysiuose, kur
galimas molekuli ir daleli judjimas, taiau i dalies gali reiktis ir kietj kn paviriuje.
Difuzija nusako ne tik skirting molekuli maiymsi dujose, garuose ir skysiuose, bet ir
vienos ries molekuli koncentracijos susilyginim dujose, garuose ir tirpaluose, kuri pradinis
koncentracijos pasiskirstymas nevienalytis. is reikinys pavaizduotas 5.7.1 paveiksle. Kaipmatyti
i koncentracijos profiliokitimo, visikamkoncentracijos isilyginimui reikalingas tamtikras laikas.
Pats difuzijos reikinys yra pagrstas tuo, kad kiekviena tirpalo ar duj dalel, esant tirpalo tem-
peratrai T(K), turi vidutin kinetin energij (vidutin ilumin energij):
kT
m
E
2
3
2
2
0
kin
= = v ;
(5.7.1)
ia k Bolcmano konstanta. I (5.7.1) iplaukia, kad m
0
mass dalel juda vidutiniu greiiu
M RT m kT 3 3
0
2
= = = v v ;
(5.7.2)
ia M = N
0
m
0
daleli molio mas. Jei M = 50 g/mol,
o T=290 K, tai = v 390 m/s. Taigi molekuli judjimas tiek
ore, tiek skystyje yra labai greitas, taiau tai nereikia, jog
molekuls nulekia didel atstum. Dl smgi su arti esan-
iomis kitomis molekulmis tirpalo dalels juda chaotikai.
Chaotiko judjimo trasa pavaizduota 5.7.2 paveiksle. Ne-
veikiant jokiai kryptingai jgai is chaotikas judjimas neturi
iskirtins krypties. Paviens dalels i judjimotrasa potam
tikro laiko gali sutapti su pradine padtimi, taiau statistinis
didelio daleli ansamblio tyrimas rodo, kad po laiko tarpo t
5.7.1 pav. Koncentracijos profilio kitimas tirpale
O
r
P
5.7.2 pav. Chaotikas dalels
judjimas tirpale
h
C C
C
MOLEKULIN FIZIKA ____________________________________________________________________ 167
nuostebjimopradios dalels padtis Pskiriasi nuo pradins padties Oatstumu
r
, kuris propor-
cingas kvadratinei akniai i laiko t:
Dt r
t
4
= ;
(5.7.3)
ia Dyra difuzijos koeficientas, kurio matavimo vienetas yra m
2
s
1
. is koeficientas priklauso nuo
tirpiklioir temperatros. Jis nusakokonkreios dalels difuzijtamtikrametirpale. Masimetrik
molekuli difuzijos koeficientas nepriklauso nuo molekuli koncentracijos, taiau ilgagrandi
molekuli jis gali priklausyti ir nuo difunduojanios mediagos koncentracijos.
5.7.3. Fiko dsnis. Difuzijos lygtis
Labai dideliokitosmediagos daleliskaiiaus pasiskirstymas tirpalemakroskopikai yraapibdinamas
tirpalo koncentracija, t. y. daleli skaiiumi vienetiniame tryje. Jei is skaiius yra labai didelis, tai
koncentracijos isilyginimas tirpale, kurio koncentracijos gradientas pradinis, yragerai apraomas Fiko
dsniu, nusakaniuperneamos mediagos mass kiek. Imant paprasiausiatvej, kai koncentracija
kintatikvienakryptimi (5.7.3 pav.), Fikodsnis teigia: koncentracijos gradientokryptimi perneamos
massAmkiekis yra proporcingas koncentracijos gradientui AC/Ax, paviriausskerspivioplotui S ir
trukmei At:
. t S
x
C
D m A
A
A
= A
(5.7.4)
Tirpalo molekuls difunduoja i didesns koncentracijos srities maesns koncentracijos srit.
Kadangi molekuli judjimas yra chaotikas, todl nra iskirtins judjimo krypties. Gali kilti
klausimas, kokiu bdu molekuls i didesns koncentracijos srities difunduoja maesns
koncentracijos srit. Tai galimapaaikinti nagrinjant molekulijudjimtarpdviejgretimvienodo
trio skysio dali, kuriose konkreios ries molekuli koncentracija skiriasi. Nepaisant judjimo
chaotikumo galima pasakyti, kadtamtikra molekulidalis i vienos skysio dalies pereis gretim
per j skiriamj rib. Kadangi i kiekvienos srities kit pereis ta pati molekuli dalis, tai i srities,
kurioje jkoncentracija didesn, gretimpereis daugiau molekulineguprieinga kryptimi. Todl
skirtumas tarp ilkusi ir lkusi molekuli skaiiaus yra teigiamas ir tai reikia, kad molekuli
difuzija vyksta i didesns koncentracijos srities maesns koncentracijos srit. Laikant difuzijos
koeficient teigiamu, o koncentracijos gradient neigiamu, t. y. koncentracija maja didjant
koordinatei x, ir norint gauti teigiam perneamos mass
kiek koncentracijos majimo kryptimi, deinje (5.7.4)
formuls pusje tenka rayti minuso enkl. I pirmojo
Fiko dsnio gaunamas antrasis, nusakantis koncentracijos
kitim laikoatvilgiu bet kuriame take. Jis dar vadinama
difuzijos lygtimi ir uraomas:
2
2
x
c
D
t
c
c
c
=
c
c
.
(5.7.5)
Ax
S
C
1 C
2
5.7.3 pav. Difuzija skysiuose
koncentracijos majimo kryptimi
t
C C
168 __________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Tai diferencialin lygtis su antromis
ivestinmis, nusakanti, kad koncen-
tracijos kitimo greitis yra proporcingas
antrai koncentracijos ivestinei pagal
koordinat. Jei koncentracijakintastaigiai
nuo vieno tako prie kito, tada ji greitai
keiiasi laiko atvilgiu. Jei koncentracija
maja tiesikai kintant atstumui, tai ji
kiekviename take yra pastovi, nes pas-
tovus ir lekiani bei ilekiani mole-
kuli skaiius. Tai atitinka pastovi me-
diagos mass perna mediagos kon-
centracijos majimokryptimi. Jei antroji
ivestin yra nulis, tai koncentracija nekinta. ia pateiksime tik ios lygties analitin sprendin
paprasiausiamvienos krypties difuzijos atvejui, kai pradiniu laiko momentu t = 0 visa mediaga
yra sukoncentruota ploktumoje, kurios koordinat x = 0. is sprendinys nusako mediagos
koncentracij Ctake x laiko momentu t ir yra lygus:
C )
4
exp(
) ( 2
2
2 1
Dt
x
Dt
m
=
t
.
io sprendinio grafikai pateikiami 5.7.4 paveiksle.
5.7.4. Difuzijos koeficientas ir jo ryys su dinamine klampa
Duj kinetin teorija rodo, kad difuzijos koeficientas yra proporcingas molekuli vidutiniam
laisvajamkeliui l ir vidutiniammolekuli iluminio judjimo greiiui v :
3 / v l D = . (5.7.6)
Taigi difuzija spartja didjant temperatrai, nes didja molekuli greitis v . Be to, skysiuose
difuzija vyksta daug liau, nes juose yra maesnis negu dujose molekulividutinis laisvasis kelias.
Sferinms molekulms, difunduojanioms skysiuose, galioja toks ryys tarp difuzijos koeficiento
ir skysio dinamins klampos q :
r
kT
D
q t 6
=
; (5.7.7)
ia r molekuls spindulys. Taigi maesns molekuls maiau klampiuose skysiuose difunduoja
greiiau. Difuzijos koeficientai kai kurioms molekulms vandenyje pateikiami 5.7.1 lentelje, o
daleli perna ore charakterizuojantys dydiai 5.7.2 lentelje.
C
C
o
t=0
t
1
t
2
0
x x
0
t
2
t
1
t=0
x
c
d
d
5.7.4 pav. Koncentracijos ir koncentracijos gradiento
kitimas priklausomai nuo koordinats (x) ir laiko (t)
difunduojanioje sistemoje su aikia riba tarp tirpalo ir
tirpiklio pradiniu laiko momentu t = 0
t
C
=0
t
1
t
2
t
1
t
2
MOLEKULIN FIZIKA ____________________________________________________________________ 169
5.7.1 lentel. Difuzijos koeficientai molekulms, difunduojanioms 20
0
C temperatros vandenyje
Difunduojanti molekul Forma Molin mas, kg D, m
2
s
-1
10
11
Glicinas(Glycine) Maasfera 0,075 95
CitochromasC
(CytochromeC)
Sfera 13 10,1
Kolagenas
(Collagen)
Ilgagrandin 345 0,69
Tabakomozaikinisvirusas
(Tobaccomosaicvirus)
Strypas 50000 0,3
5.7.2 lentel. Perna ore charakterizuojantys dydiai (1 g/cm
3
tankio dalelms, esant 23
0
C tempe-
ratrai)
Dalelsspindulys,
m
D,
m
2
s
-1
10
11
Vidutinisposlinkisper
1shorizontaliakryptimi,
m
Atstumas, kur dalel nukrintaper
1sveikiamagravitacijosjgos,
m
10
-3
128000 1280 0,0131
10
-2
1350 131 0,137
0,10 22,1 16,8 2,24
1 1,3 4,02 128
Difuzijos koeficientai, sudarius skirtingos koncentracijos skysio sluoksnius, yra matuojami i
koncentracijos kitimo skirtinguose skysio takuose arba tiesioginiais koncentracijos matavimo
metodais, arba i lio rodiklio proporcingo koncentracijai kitimo. Pastaruoju metu difuzijos
koeficientai matuojami i tok tirpal perjusio lazerio pluoto sklaidos fliuktuacij, sukelt
atsitiktinai judani molekuli.
Kadangi difuzijos koeficientas priklausonuotokimolekuls parametrkaipmolekuls spindulys
ir forma, tai imatavus difuzijos koeficientus skysiuose galima gauti naudingos informacijos apie
iuos svarbius difunduojani realiose sistemose molekuli parametrus.
5.7.5. Difuzijos pasireikimo pavyzdiai
Tiek duj, tiek skysi difuzija yra labai svarbi procesams, vykstantiems biologijoje, medicinoje,
aplinkos fizikoje, geologijoje, meteorologijoje ir kitur. Augal aknys difuzijos bdu pasisavina
dirvos vandenyje itirpusias maistingsias mediagas. Augalui reikalingas mediagas aknys greitai
perduoda organizmui, todl j koncentracija arti akn yra maesn. Taigi vyksta nuolatin i
mediag molekuli difuzija per dirvos vanden i aplinkini srii link akn. Panaiu bdu
mogaus ir gyvulivirkinimosistemoje pasisavinamos i maistoorganizmui naudingos mediagos:
skrandis ir arnynas paveria maist skysta mase ir organizmui reikalingos mediagos patenka
kraujagysles, esanias virkinamojo trakto sienelse.
Pvant organinms mediagoms dirvoje isiskiria anglies dioksidas. Jis difunduoja atmosferos
or, kuriame jo koncentracija maesn, ir tenveikiamas molekulins arba turbulentins (slygotos
atmosferos oro judjimo) difuzijos pasklinda dideliuose plotuose ir pasisavinamas augal vykstant
fotosintezs procesui.
170 __________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Difuzija yra galima ir biologinse lstelse, kur vairi ri molekuli randama daugiau ar
maiau skystoje citoplazmoje. Svarbu inoti, kaip greitai molekuls gali difunduoti citoplazm,
kur vykstamolekuli jungimasis, veikiantis lstels igyvenim ir dauginimsi. Naudojant ant odos
tepamus gelius, organizm difuzijos bdu patenka antiknai ir antigenai, kurie vliau susitik
sudaro nuosdas. Nuosd padtis suteikia informacijos apie antiknus ir antigenus, bet
kiekybiniams vertinimams btina inoti difuzijos greit.
5.7.6. Difuzija aplinkos fizikoje
Iki iol nagrinjome difuzij idealiomis slygomis, kai jokie papildomi veiksniai netrikdo na-
grinjamos sistemos. Realiosegamtinsesistemosenagrinjant mass perna, skiriamajaunagrinta
molekulin difuzija ir turbulentin difuzija, t. y. difuzija, vykstanti kartu sukonvekcija. Kaipjaubuvo
minta (5.5 skyriuje), dl priverstins konvekcijos mediaga perneama vjo ar srovs tekjimo
kryptimi pastoviu greiiu v. Kai tiek difuzija, tiek konvekcija yra svarbios mediagos pernaai,
bendras koncentracijos pokytis yra suma abiejreikiniir apraoma apibendrintadifuzijos lygtimi:
.
2
2
x
C
x
C
D
t
C
c
c

c
c
=
c
c
v (5.7.8)
Abi difuzijos rys yraatsakingos u mediagos mass pasikeitimtarporganizmir juos supanio
oro:
molekulin difuzijaveikia organizmviduje (gyvnplauiuose arba lapertmse) ir plonoje
oro plvelje, sudaranioje pasienio sluoksn, kuris apgaubia vis organizm;
turbulentin difuzija vyraujalaisvojoje atmosferoje, nors molekulin difuzija tebeveikia ir yra
atsakinga u galutin turbulentins energijos virtim iluma.
Turbulentin vandens garir CO
2
pernaayra labai svarbi visoms auktesnms gyvybs formoms.
Turbulentikumo matas gali bti CO
2
kiekis, sugeriamas sveik ali pasli per vien dien
fotosintezs metu. Jis yra ekvivalentus visamCO
2
kiekiui, esaniamatmosferos oro sluoksnyje tarp
paklotoir 30maukio. Nors CO
2
koncentracija, kaipfotosintezs rezultatas, sumaja nuo auros
iki saullydio, i tikrjis sumajimas retai virija15 %vidutins koncentracijos ems paviriuje.
ie skaiiai rodo, kad turbulentikumas leidia augmenijai paimti fotosintezei naudojam CO
2
bent i emiausio 200 m atmosferos oro stulpo, o galbt i dar didesnio aukio. Maas dieninis
CO
2
pokytis pastebtas net 500 mauktyje.
Turbulentins difuzijos atvejumass pernaa objektoaptekamoorosrautuyraanalogikailumos
pernaai konvekcijos bduir yrapatogiai susietasunedimensiniuparametru(panaiai kaipNiuselto
kriterijus ilumos perdavimoteorijoje; r. 5.5 skyri), vadinamuervudo(Sherwood) kriterijumi Sh.
Duj mass srautas Fper vienetin paviriaus plot ireikiamas tokia lygtimi:
ShD F ( = (C
p
C
a
) / d; (5.7.9)
ia C
p
ir C
a
vidutin duj koncentracija paviriuje ir atmosferos ore, o d pasienio sluoksnio
storis. Taip kaipNiuselto kriterijus priverstinei konvekcijai yra Reinoldso Re ir Pradtlio kriterij
MOLEKULIN FIZIKA ____________________________________________________________________ 171
r
v
Kutikul
r
v
iotels
Virutin
lapalakio
pus Lapas
Pasieniosluoksnis
Pasieniosluoksnis
Kutikul
Apatin
lapalakio
pus
iotels
5.7.5 pav. Ekvivalentin elektrin grandin vandens gar difuzijai per
lapo ioteles ir lapo virutin bei apatin epidermius apskaiiuoti
sandauga, taip ir ervudo kriterijus yra Re ir santykio g/D, kuris vadinamas midto kriterijumi Sc,
funkcija. Mass pernaai plokios ploktels paviriuje
33 , 0 5 , 0
Re 66 , 0 Sc Sh = .
Tai, kad tiek ilumos, tiek mass perna apraantys kriterijai turi savyje Re kriterij, rodo abiej
proces panaum, o skirtingi Pr ir Sc kriterijai skaito efektyv pasienio sluoksnio stor mass ir
ilumos pernaai, esant priverstinei konvekcijai.
Laisvos konvekcijos slygomis oro cirkuliacij apie kart ar alt objekt lemia oro tankio
skirtumai, atsirandantys dl temperatros gradiento, vandens gar koncentracijos gradiento arba
abiej efekt kombinacijos. Laisvai konvekcijai
m n
Sc BGr Sh = ;
ia Gr jau mintas Grashofo kriterijus. m = 1/4 laminariajam srautui ir 1/3 turbulentiniam.
Siekiant vertinti Gr vert patogiau naudoti ne paviriaus ir oro temperatrskirtum, bet virtuali
temperatr skirtum, kuris skaito ir oro tankio majim dl ore esani vandens gar.
Eksperimentai, atlikti tiriant vandens gar perna, kai vjo greitis didesnis nei 1 m/s, gerai
atitinka (5.7.9) lygt. Panas rezultatai gauti ir garams, kuri difuzijos koeficientai kitokie.
5.7.7. Mass pernaa per poras
Augal lap vandens igarinimas vyksta pakopomis. I pradi vanduo per lstels sieneles
difunduoja poiotelin kamer, po to per ioteli poras ir galiausiai per lapo pasienio sluoksn
atvir atmosfer. Vykstant fotosintezei CO
2
molekuls juda tuo paiu keliu, bet prieinga kryp-
timi. Mass pernaa per poras
labai sudtingas reikinys. J
galima supaprastinti laikant, kad
por vara duj pernaai pri-
klausonuojgeometrijos, dydio
ir isidstymo, o tai pasienio
sluoksnio varos dydis priklauso
nuo lapo matmen ir vjo grei-
io. Lapporilgis paprastai yra
1030 m, o plotas, kur uima
pilna pora su apsauginmis
lstelmis, yra nuo2517 miki
7242 m. Poros uima apie
1 % lapo paviriaus, kai poros
plotis yra 6 m. Por forma gali
bti gana vairi.
5.7.5 pav. pateikiama ekvi-
valentin elektrin grandin,
r
v
r
v
172 __________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
skaitanti vandens garnuostolius i lapoper ioteles ir od. Odos vara vandens igarinimui yra nuo
20 iki 60 s cm
1
, o iotels vara nuo 1 ir 2 s cm
1
. Pasienio sluoksnio vara yra apie ~1 s cm
1
, kai
vjas silpnas. Taigi pagrindinis garavimas i lapovyksta per poras.
Pauki kiauiniuose poros atlieka panai funkcij kaiplap iotels. Jomis vyksta deguonies,
reikalingo besivystaniamembrionui, difuzija vid ir CO
2
bei vandens gar difuzija ior. Tos
paios geometrijos ir tankio, bet skirtingo dydio kiauini paviriaus plotas Ayra proporcingas
m
0,66
(m kiauinio mas), todl porikumas g, apibdinantis vandens nuostolius per kiauinio
paviriaus plot, tik silpnai priklauso nuo m
0,12
. Kiauinio lukt vara vandens garavimui taippat
kaip lap yra 5001000 s cm
1
.
5.7.8. Varos analogija difuzijos skaiiavimuose
Elektrin analogija leidia vaizdiai stebti, kaip vyksta difuzija i lapo tarplstelini ertmi per
ioteliporas iorin pasieniosluoksn. Tai gali bti nagrinjamakaipdvimatis analogas (5.7.6 pav.)
duj difuzijos per apvali d skersmens skylploktelje, kurios storis yra daug maesnis u d. Pagal
trimat duj difuzijos teorij, kiekvieno apvalios skyls ono vara yra r =t d / 8 D; ia D duj
difuzijos koeficientas. Kad tiksliai nustatytume var, btina inoti poros skersmen ir plot
skirtingais atstumais nuo poros galo. Daugumos lap bendrai varai r
t
vandens igarinimui
apskaiiuoti gerai tinka i formul:
D d l r
t
/ ) 8 / ( t + =
;
ia l poros ilgis, d skersmuo. Paprastai atstumas
tarpporyramadaug eiledidesnis uporskersmen,
todl ia yra tik maas atskir por ekvipotencialini
paviri persidengimas (5.7.7 pav.). Por rinkinio
vara r
s
gali bti randama i atskir por varos r
t
. Ji
ireikiama taip:
D nd
d l
r
s
2
) 8 / ( 4
t
t +
= ;
ia n por skaiius vienetiniame lap plote. r
s
maja, kai poros platja. Dujar vandens garmass
pernaa inant var r, gali bti apskaiiuojama pagal
formul
F ( = (C
p
C
a
) / r
s
.
Kai lapo abu paviriai vienodi, bendra vara van-
dens ir CO
2
difuzijai yra r
s
/2.
5.7.6 pav. Difuzijos tarp dviej
ploktum, tarp kuri yra pavien
kiaurym, dvimatis elektrinis analogas
MOLEKULIN FIZIKA ____________________________________________________________________ 173
5.7.9. Duj ir vandens pernaa gyvn kailyje ir per mogaus od
Matavimai, atlikti su i skaidul padarytu kailiu ir tikru avies kailiu, parod, kad kailio vara
vandens garpernaai yra artima nejudanioorovarai, taiaunatraliame kailyjejo vara maja,
nes prisideda vandens pernaa dl kapiliarumo. Kitais matavimais gauta, kad vandens gar
koncentracija maja tiesikai didinant atstum nuo gyvno odos. is kitimas buvo apie 0,6 g/m
3
per 1 cm kailio 5 C oro temperatroje ir apie 1 g/m
3
per 1 cm kailio 28 C oro temperatroje.
Laisvoji konvekcija taip pat didina vandens gar perna kailyje ir drabuiuose. Esant vjui, t. y.
priverstinei konvekcijai, vandens gar pernaa dar padidja.
Tiek mogaus, tiek pauki odos vara vandens gar difuzijai yra 100200 s cm
1
eils ir daug
didesn u drabuiir plunksnvar. Taiaunuogkdikiodos vara gali bti daug maesn, net
~30 s cm
1
, ir iuo atvejugaravimui eikvojama iluma virija kdikiometabolins ilumos gamyb,
jei cirkuliuojantis oras inkubatoriuje nra pakankamai drgnas.
5.7.10. Osmosas
Sumass pernaasusijs dar vienas reikinys. Daugeliolstelimembranos yrapralaidios vandeniui,
bet nepralaidios kitoms vandenyje itirpusioms molekulms. Vadinasi, vanduogali patekti lstel,
bet tamtikri lstels komponentai negali i jos ieiti. is procesas (tirpikliodifuzija per membran
maesns koncentracijos kryptimi) vadinamas osmosu. 5.7.8 pav., a, pavaizduotas stiklinis indas,
kurio viduje yra pusiau pralaidi membrana, skirianti ind dvi dalis. Indo A dalyje yra cukraus
tirpalas, o Bdalyje vanduo. Kiekvienoje indo dalyje esanios molekuls turi kinetins energijos,
todl juda chaotikai tos dalies viduje. Membrana apsaugo nuo visiko dviej tirpal susimaiymo
ir itirpusios mediagos molekuli judjimo i A dalies B dal. Taiau ji yra pralaidi vandeniui,
todl po tamtikro laiko Adalyje padids tirpalo tris (5.7.8 pav., b).
5.7.7 pav. Lapo epidermio su trimis poromis elektrinis analogas
174 __________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Tirpiklio (vandens) koncentracija yra didesn indo B
dalyje (5.7.8 pav., a), nes ioje dalyje joki kit molekuli
nra. Tokiamepaiameskysiotryje Adalyjeyra tirpiklio
(vandens) ir itirpusios mediagos (gliukozs) molekuli,
todl ioje dalyje tirpiklio (vandens) koncentracija yra
maesn, nes vandens molekuls i Bdalies, kur vandens
molekuli koncentracija didesn, difunduos Adal, kur
jkoncentracijamaesn. Otai cukraus molekuls negali
difunduoti per membrani Adalies Bdal. is procesas
vyks, kol abiejose membranos pusse tirpiklio koncentra-
cijos susilygins. Taigi osmosas vyksta i Bdalies Adal.
Panaiu bdu natrio ir chloro jonai apsaugomi nuo
judjimo i vienos lstels membranos puss kit
(5.7.9 pav.).
Osmosas, kaipir visi kiti procesai,vykstantys gyvuose
audiniuose, yra dinaminis procesas. Kadangi visos
dalels turi kinetins energijos, atrodyt, tirpiklio
molekuls tuo paiu metu turt difunduoti abiem
kryptimis vienodai, bet galutinis rezultatas tirpiklio
molekuls juda maesns koncentracijos kryptimi. Kai
kalbama apie tirpiklio judjim, mintyse turima paties
tirpiklio, o ne itirpusios mediagos koncentracija.
Praktikoje osmoso reikin komplikuoja slgio
faktorius. Kaip matyti i 5.7.8 pav., b, indo dalyje
pasikeiia tirpalo auktis. Vykstant osmosui, tirpalo
auktis A dalyje tampa didesnis negu vandens lygis B
dalyje. is skirtumas tarp dviej skysio lygi generuoja
slgi skirtum per membran, nes slgis yra didesnis A
dalyje. ioje dalyje dl osmoso didjant vandens
molekuli skaiiui padidja skysio tris, kartuir slgis.
is didesnis slgis links prieintis kit vandens
molekuli difuzijai Adal. Ilgainiui dl io slgio pasiekiama pusiausvyra. Reikia paymti, kad
difuzija nesibaigia, ji vyksta tolygiai kiekviena kryptimi, kadangi membrana ilieka pralaidi
vandeniui. Hidrostatinis slgis, kur sukelia papildomas skysio stulpelis, vadinamas osmosiniu
slgiu.
Bet kokie du tirpalai, kurie turi tok pat osmosin slg, vadinami izoosmosiniais. Jei du tirpalai
yra atskiriami membrana, tirpiklio molekuls tarpusavyje keisis vietomis, bet nevyks tirpiklio
molekulijudjimas. Reikia paymti, jog tai nepriklausonuoitirpusi daleliprigimties, kadangi
osmosinis slgis yra tik itirpusi daleli kiekio konkreiame tryje, t. y. koncentracijos, funkcija.
Vadinasi, osmosinis slgis priklauso nuo tirpiklio koncentracij dviejuose tirpaluose skirtumo.
Cukrausmolekuls
A B A B
5.7.8 pav. Osmoso reikinys
a b
Osmosas
NaCl
tirpalas
5.7.9 pav. Osmosas, vykstantis per lstels
membran, kai natrio chlorido jonai yra
vienoje membranos pusje, o vanduo
kitoje
MOLEKULIN FIZIKA ____________________________________________________________________ 175
ie reikiniai turi ypating tiesiogin ry sumogaus organizmu, nes vairidalelikoncentracija
skirtingose vidinse knoterpse lemia skysio judjim organlsteles ir i j(pavyzdiui, inkst
ir kt.). Osmosiniai sryiai egzistuoja tarpkraujodaleli ir kit organizmo tirpal. Reikia pasakyti,
kad osmosinis kraujo slgis vandens atvilgiu yra apie 700 kPa, o tai atitinka 67 mvandens stulpo
aukio slg. Taiau kne kraujo molekuls neturi sveikos su grynu vandeniu, todl osmosinis
slgis yra daug maesnis.
Pavyzdiui, normaliai kraujyje natrio chlorido koncentracija yra 0,9 % (0,9 g natrio chlorido/
100 ml vandens). Tai reikia, kad normali natrio chlorido koncentracija eritrocite apytiksliai bus
lygi 0,9 %, ir sakoma, jog lstelyra izotonin kraujo atvilgiu, t. y. lstels turi tok pat tonus (turi
toki pai kaip ir kraujo itirpusi mediag koncentracij). Tirpalas, kuriame natrio chlorido
koncentracija yra didesn u 0,9 %, vadinamas hipertoniniu, nes iuo atveju tirpalas turi didesn
itirpusios mediagos koncentracij negulstel, ovandens koncentracija tirpale yramaesn negu
lstelje. Todl vandens molekuls dl osmoso juds i lstels tirpal, vyks lstels dehidracija,
kartu ji susitrauks ir netgi us. Ir atvirkiai, tirpalas, kuriame natrio chlorido koncentracija yra
maesn u 0,9 %, vadinamas hipotoniniu, nes tuomet itirpusios mediagos koncentracija tirpale
yra maesn, o vandens koncentracija tirpale yra didesn negu lstelje. Vandens molekuls dl
osmoso juds i tirpalo lstel, lstel ibrinks ir net gali sprogti. Taiau organizme egzistuoja
vairs apsauginiai veiksniai, todl ia aprayti kratutiniai atvejai yra reti, nes itirpusi mediag
ir tirpiklio molekuli judjimas yra palyginti maas.
Osmoso reikinys utikrina skysi pusiausvyr mogaus organizme: dl jo vandens molekuls
gali laisvai judti per membranas ir pakeisti vandens koncentracijtieklstelividuje, tiekskysiuose,
esaniuose lstels iorje. Osmosas svarbus ir kraujotakos sistemai, nes kraujagyslitinklui netekus
skysi, padidja itirpusi mediag lygis jose, o tirpiklio lygis dids labai ltai, jei pavyzdiui,
gydymui reikalingas tirpalas pateks organizm staigiai. Taigi padids kraujo tris, kuris savo
ruotu pakels grtanio veninio kraujo lyg ir padidins irdies krv (kraujo tris yra svarbus
veiksnys, lemiantis irdies darb).
5.7.11. Dializ. Hemodializ
Aikinant osmoso reikin 5.7.10 skyrelyje buvo kalbama tik apie vienos mediagos tirpiklio
perna per membran. Taiau mogaus organizmo membranos yra laidios vairioms skirting
mediag molekulms, pavyzdiui, vandens, druskos, gliukozs, lapalo ir kt. Didels molekuls
(hemoglobino, albumino, protein ir pan.) negali difunduoti per membran, taiauskysiai, maos
molekuls ir jonai tai daryti gali. Toks procesas, kai tirpale esanios maos molekuls dl skirtingo
difuzijos greiio per pusiau laidi membran atskiriamos nuo dideli, vadinamas dialize. Dializ
taikoma medicinoje inkst funkcijai pakeisti, kai ji yra nepakankama ar visikai sutrikusi. Dializs
tipai yra du: dializ per pilvaplv ir hemodializ.
Dializ per pilvaplv vyksta dl difuzijos ir osmoso reikini, tam naudojamos pilvaplvs
membranos. Dializs tirpalas leidiamas paciento pilvo ertm. Tai yra santykinai paprasta
procedra, nereikalaujanti brangi prietais ir taikoma pacientams, kuriems yra rykus inkst
176 __________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Membrana
Pacientas
Dializatorius
Dializstirpalo
siurblys
Vanduo
Dializs
tirpalas
Kraujo
siurblys
H2O
Elektrolit
pusiausvyra
Toksins
mediagios
1
2
3
4
5
7.5.9 pav. Hemodializs principo schema
funkcijos nepakankamumas. Ji kartojama tamtikrais laiko tarpais, kiekvien kart vartojant var
skyst.
Hemodialize vadinamas kraujo valymas dializs bdu nuo nepageidaujam mediag (vairi
atliek, toksini mediag, vaist ir pan.) ar j pertekliaus (7.5.9 pav.), kai inkstai ios funkcijos
neatlieka arba j veikla sutrikusi. Tai procesas, kurio metu i vienos pusiau laidios, dirbtins
membranos puss teka kraujas, o i kitos prieinga kryptimi tamtikras skystis. Membranos poros
leidia kraujo plazmos komponentams (iskyrus koloidinius plazmos proteinus) laisvai difunduoti
abiem kryptimis. Kraujas i paciento arterijos teka per dirbtin membran (1), kuri atskiria
dializatori (2) nuo dializs tirpalo tkms (5). Elektrolitai ir maos molekuls laisvai difunduoja
per membranos poras. Didels molekuls ir kraujo lstels negali pereiti membranos. Panaiai
bakterijos, esanios dializs tirpale, negali patekti krauj.
Dializs tirpalas turi kelias paskirtis. Jame esanimediagskirtingos koncentracijos palengvina
vandens difuzij i kraujagysli, kai jose yra vandens koncentracija per didel dl koncentracijos
gradientosusidarymodializs tirpalo kryptimi. Vanduodifunduos dializs tirpal ir bus paalintas
i kraujagysli (i kraujo). Difuzija prieinga kryptimi ( krauj) vyks tada, kai vandens molekuli
koncentracija kraujyje bus ema, pasikeitus dializs tirpalo koncentracijai, taigi egzistuos koncen-
tracijos gradientas kraujo kryptimi. Jei vandens molekulikoncentracija bus tokia kaipir turi bti
normaliai, t. y. vienoda, vandens molekuli difuzija nevyks n viena kryptimi. Itirpusi dializs
tirpale mediag koncentracija atkurs normali t mediag koncentracij plazmoje. Kadangi nei
lapalo, nei kreatino iame tirpale nra, tai beveik visos atliekos (alinami produktai) difunduos i
kraujo ir vamzdeliu (4) bus surenkami atliek voni. Elektrolit koncentracija tuo metu atitiks
normalplazmos lyg, taigi tikj perteklius difunduos iorn, oivalytas kraujas vamzdeliu (3) teka
paciento ven.
ia aprayta sistema vadinama dirbtiniu inkstu, oprocesas hemodialize. Toks dirbtinis inkstas
gali ivalyti 150 litr skysio per 24 valandas, tuo metupagaminama 1,5 litro lapimo. Labai svarbu
io proceso metu palaikyti dializs tirpalo temperatr intervale nuo 36 iki 42
o
C, nes kitaip
pacientas jaus diskomfort(grs ivalytas kraujas bus atvss). iuometupasaulyje sukurtavairi
mediagos
MOLEKULIN FIZIKA ____________________________________________________________________ 177
dirbtinioinkstomodifikacij, kurios skiriasi dirbtinimembranmediagomis (naudojama natrali
celiulioz ir jos pakaitalai, vairios sintetins mediagos ir kt.) ir technologija. Jos naudojamos
atitinkamai atsivelgiant paciento bkl ir bendr medicinin situacij. Dirbtinis inkstas ne tik
ivalo krauj, bet ir palaikotinkam elektrolitpusiausvyr bei pH, kontroliuoja organizmoskysi
balans.
190 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
PRIEDAI
1. Vektoriai ir veiksmai su jais
Vektoriai apibdinami netikskaitineverte, bet ir kryptimi erdvje. Geometrinis vektoriaus vaizdas
tai kryptin atkarpa, t. y. atkarpa, kuriai nurodyti pradia ir galas. ioje knygoje vektoriai ymimi
parykintomis raidmis. Vektoriaus modulis, kryptins atkarpos ilgis, ymimas ta paia, tik
neparykinta raide.
Vektoriai yra tarp savs lygs, jeigu jie nubrti lygiagreiai t pai pus ir j moduliai lygs.
Veiksmai suvektoriais yra tokie: sudtis, atimtis, vektoriaus daugyba i skaiiaus, dviejvektori
skaliarin ir vektorin sandaugos.
Fizikoje vektoriai gali bti laisvieji, liauiamieji ir suritieji. Laisvieji vektoriai yra tokie, kuri
pradios vieta erdvje nra svarbi fizikos reikiniui nusakyti. Pavyzdiui, kai kietasis knas juda
slenkamuoju judjimu, jovis tak greiiai yra vienodi ir skaitinmis vertmis, ir kryptimis. Todl
kno slenkamojo judjimo greiiu galima laikyti jo bet kurio tako greit, t. y. greiio vektoriaus
pradia laikyti bet kur kno tak.
lauiamj vektorinusakomas fizikinis reikinys nepriklausonuo j pradios tiesje, kuria jie
nukreipti. Toks vektorius tai sukimo momentas, veikiantis kn, besisukant apie a. Sukimo
momento modulis yra lygus jgos vektoriaus modulio ir peties maiausio atstumo nuo aies iki
tiess, kuria jga veikia, sandauga.
Suritojovektoriaus pradiasusietasuerdvs taku, nes btent j apibdina. Pavyzdiui, elektrinio
arba magnetinio lauk stipri vektoriai.
Su laisvaisiais vektoriais gali bti atliekami visi penki ivardyti veiksmai. Veiksmai su
liauiamaisiais ir suritaisiais vektoriais atliekami tik tada, kai
j pradios yra viename take.
Dviej vektori suma (1Ppav.) lygi striainei lygiagretainio,
kurio kratins yra sudedamieji vektoriai.
Dviej vektori skirtumas (2P pav.) yra vektorius, kurio
pradia sutampa su atminio galu, o galas su turinio galu.
Vektoriaus a ir skaiiaus sandauga b = a yra vektorius,
lygiagretus su vektoriumi a, o jo modulis lygus sandaugai abiej
moduli: a = b .
Vektorius b nukreiptas ta paia kryptimi kaipir a, jeigu >0,
ir prieinga vektoriui a kryptimi, jei < 0. gali bti dimensinis
dydis, todl vektori b ir a dimensijos gali nesutapti. Tuoatveju ir
b, ir a masteliai bus nepriklausomi vienas nuo kito.
Skaliarin dviej vektori a ir b sandauga (3P pav.) yra
skaliaras (skaiius), lygus abiej vektori moduli sandaugai,
padaugintai i kosinuso kampo o tarp j. Skaliarin sandauga
ymima (a, b) arba ab.
b a c + =
aa
b
1P pav. Vektori sudtis
a
b
= a - b
2P pav. Vektori atimtis
PRIEDAI _________________________________________________________________________________ 191
Fizikinis skaliarins sandaugos pavyzdys yra darbas,
kur atlieka jga F, kai kno, veikiamo ios jgos,
poslinkis lygus Al:
A = F Al = F Al coso;
ia o kampas tarp jgos F ir poslinkio Al krypi.
Vektorin dviej vektori a ir b sandauga (4P pav.)
yra vektorius c, statmenas abiemvektoriams a ir b, o jo
modulis lygus abiej vektori moduli sandaugai,
padaugintai i sinuso kampo o tarp j: c = absino
Bdamas statmenas abiemvektoriams a ir b, j vekto-
rins sandaugos vektorius c yra statmenas ploktumai S,
kuriojeguli vektoriai air b, ir nukreiptas taip, kad, irint
i jogalo, poskis nuopirmojovektoriaus (a) linkantrojo
(b) maiausiu kampu vykt prie laikrodio rodykl. I
apibrties aiku, kadvektorinsandaugapriklausonuo
dauginamj tvarkos. Pakeitus dauginamj vektori air b tvark, jvektorins sandaugos kryptis
pasikeiia prieing.
Vektorin sandauga ymima c =[ab] arba c = a b. Vektorins sandaugos priklausomyb nuo
dauginamj tvarkos a b =b a.
Fizikinis vektorins sandaugos pavyzdys sukimo (arba jg) momentas M, sukeliantis kno
sukimsi. Jis lygus spindulio vektoriaus r ir kn veikianios jgos Fvektorinei sandaugai:
M= r F
Sukimomomentoskaitin vertM=r Fsino, iao kampas tarpvektoriaus r ir knveikianios
jgos F krypi (r. 4.2.3 pav.).
o
a
b
3P pav. Skaliarin sandauga
c = ab = o cos ab
S
a
a
c
b
4P pav. Vektorin sandauga c = a b
o
)
192 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
2. Fizikiniai dydiai ir j ymjimai
Auktis h
Bangos ilgis
Danisv
Difuzijos koeficientas D
Garso bangos stipris I
Garso galia P
Garso galios lygis L
Garso garsis G
Greitis
linijinis v
kampinis e
Inercijos momentas I
tampa U
Jga F
sunkio F
g
svorio P
Judesio kiekio momentas L
Kinetin energija E
k
besisukanio kno W
k
Klampa
dinaminq
kinematin v
Mas m
Molekuli laisvasis lkis
Molekuli tankis n
Molio mas M
Oro drgm:
absoliuioji g
santykin r
Pagreitis a
kampinis c
laisvojo kritimo g
Paviriaus tempimokoeficientas o
Paviriaus plotas S
Periodas T
Poskio kampas
Potencin energija E
p
Santykin ilgin deformacija c
Slgis p
Spindulys-vektorius r
c
Srovs stipris I
Sukimo momentas M
ilumos kiekis
Q
ilumos laidumo koeficientas
ilumos perdavimo koeficientas k
ilumos srauto tankis q
lyties modulis G
Tampros (Jungo) modulis E
Tankis
Termodinamin temperatra T
Tris V
Vara
bangin (akustin) Z
c
elektrin R
ilumin R

Vidinis statmenasis tempis o


PRIEDAI _________________________________________________________________________________ 193
1 l ent el . Stjudento koeficient t
n,P
verts
P
n
0,1 0,2 0,3 0,4 0,5 0,6 0,7 0,8 0,9 0,95 0,98 0,99 0,999
2 0,16 0,33 0,51 0,73 1,00 1,38 2,0 3,1 6,3 12,7 31,8 63,7 636,6
3 0,14 0,29 0,45 0,62 0,82 1,06 1,3 1,9 2,9 4,3 7,0 9,9 31,6
4 0,14 0,28 0,42 0,58 0,77 0,98 1,3 1,6 2,4 3,2 4,5 5,8 12,9
5 0,13 0,27 0,41 0,57 0,74 0,94 1,2 1,5 2,1 2,8 3,7 4,6 8,6
6 0,13 0,27 0,41 0,56 0,73 0,92 1,2 1,5 2,0 2,6 3,4 4,0 6,9
7 0,13 0,27 0,40 0,55 0,72 0,90 1,1 1,4 1,9 2,4 3,1 3,7 6,0
8 0,13 0,26 0,40 0,55 0,71 0,90 1,1 1,4 1,9 2,4 3,0 3,5 5,4
9 0,13 0,26 0,40 0,54 0,71 0,90 1,1 1,4 1,9 2,3 2,9 3,4 5,0
10 0,13 0,26 0,40 0,54 0,70 0,88 1,1 1,4 1,8 2,3 2,8 3,3 4,8
11 0,13 0,26 0,40 0,54 0,70 0,88 1,1 1,4 1,8 2,3 2,8 3,2 4,6
12 0,13 0,26 0,40 0,54 0,70 0,87 1,1 1,4 1,8 2,2 2,7 3,2 4,5
13 0,13 0,26 0,40 0,54 0,70 0,87 1,1 1,4 1,8 2,2 2,7 3,1 4,3
14 0,13 0,26 0,39 0,54 0,69 0,87 1,1 1,4 1,8 2,2 2,7 3,1 4,2
15 0,13 0,26 0,39 0,54 0,69 0,87 1,1 1,3 1,8 2,1 2,6 3,0 4,1
16 0,13 0,26 0,39 0,54 0,69 0,87 1,1 1,3 1,8 2,1 2,6 2,9 4,0
17 0,13 0,26 0,39 0,54 0,69 0,86 1,1 1,3 1,7 2,1 2,6 2,9 4,0
18 0,13 0,26 0,39 0,53 0,69 0,86 1,1 1,3 1,7 2,1 2,6 2,9 4,0
19 0,13 0,26 0,39 0,53 0,69 0,86 1,1 1,3 1,7 2,1 2,6 2,9 3,9
20 0,13 0,26 0,39 0,53 0,69 0,86 1,1 1,3 1,7 2,1 2,5 2,9 3,9
21 0,13 0,26 0,39 0,53 0,69 0,86 1,1 1,3 1,7 2,1 2,5 2,8 3,8
22 0,13 0,26 0,39 0,53 0,69 0,86 1,1 1,3 1,7 2,1 2,5 2,8 3,8
23 0,13 0,26 0,39 0,53 0,69 0,86 1,1 1,3 1,7 2,1 2,5 2,8 3,8
24 0,13 0,26 0,39 0,53 0,69 0,86 1,1 1,3 1,7 2,1 2,5 2,8 3,8
25 0,13 0,26 0,39 0,53 0,69 0,86 1,1 1,3 1,7 2,1 2,5 2,8 3,7
26 0,13 0,26 0,39 0,53 0,68 0,86 1,1 1,3 1,7 2,1 2,5 2,8 3,7
27 0,13 0,26 0,39 0,53 0,68 0,86 1,1 1,3 1,7 2,1 2,5 2,8 3,7
28 0,13 0,26 0,39 0,53 0,68 0,86 1,1 1,3 1,7 2,0 2,5 2,8 3,7
29 0,13 0,26 0,39 0,53 0,68 0,86 1,1 1,3 1,7 2,0 2,5 2,8 3,7
30 0,13 0,26 0,39 0,53 0,68 0,85 1,1 1,3 1,7 2,0 2,5 2,8 3,7
40 0,13 0,26 0,39 0,53 0,68 0,85 1,1 1,3 1,7 2,0 2,4 2,7 3,6
60 0,13 0,25 0,39 0,53 0,68 0,85 1,0 1,3 1,7 2,0 2,4 2,7 3,5
120 0,13 0,25 0,39 0,53 0,68 0,85 1,0 1,3 1,7 2,0 2,4 2,6 3,4
3. Fizikini dydi lentels
194 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
2. 1 lentel. Universaliosios konstantos
Pavadinimas
Simbolis ir apibrtis Vert
Elektrin konstanta (vakuumo
dielektrin skvarba)
c
0
=1/(
0
c)
2
8,8541878210
12
F/m
Gravitacijoskonstanta G 6,67210
11
Nm
2
/kg
2
Magnetin konstanta (vakuumo
magnetin skvarba)

0
4t10
7
H/m
Plankokonstanta h 6,62617610
34
J s
Maoji Plankokonstanta
q
= h/2t 1,05458910
34
J s
viesosgreitisvakuume c 2,9979245810
8
m/s
2. 2 l entel. Elektromagnetins konstantos
Pavadinimas Simbolis ir apibrtis Vert
Boromagnetonas

B
= e
q
/2m
e
9,274015410
24
J /T
Elementarusiskrvis e 1,602177310
19
C
2. 3 l ent el . Atomins konstantos
Pavadinimas Simbolis ir apibrtis Vert
Smulkiosiosstruktroskonstanta o =
0
ce
2
/2h 7,2973530810
3
Borospindulys a
0
= o/(4tR

) 0,52917724910
10
m
Rydbergokonstanta R

= 2tmc
4
/(ch
3
) 1,097373153410
7
m
1
2. 4 l entel . Elektronas
Pavadinimas Simbolis ir apibrtis Vert
Elektronokrviosantykissuelektrono
mase(savitasiselektronokrvis)
e/m
e
1,7588196210
11
C/kg
Elektronorimtiesmas m
e
9,1093897(54)10
31
kg
5,4857990310
4
u
2. 5 l entel . Protonas
Pavadinimas Simbolis ir apibrtis Vert
Protonorimtiesmas m
p
1,672623110
27
kg
1,007276470u
Protonoelektronomasi santykis m
p
/m
e
1,836152701(37)
Pavadinimas Simbolis ir apibrtis Vert
Neutronorimtiesmas m
n
1,6749286(10)10
27
kg
1,008664904u
Neutrono ir protonomasi santykis m
n
/m
p
1,001378404(9)
2. 6 l entel . Neutronas
PRIEDAI _________________________________________________________________________________ 195
3 lentel. Fizikins-chemins konstantos
Pavadinimas Simbolisir apibrtis Vert
Atominismassvienetas m
u
= m(
12
C)/12 1,6605402(10)10
27
kg
Avogadroskaiius N
A
6,0221367(36)10
23
mol
1
Bolcmanokonstanta k = R/N
A
1,380658(12)10
23
J /k
Idealij duj vienomoliotris
normaliomisslygomis
(T
0
= 273,15K; p
0
= 101325Pa)
V
m
= RT
0
/p
0
22,41410(19) l/mol
Standartin atmosfera 1atm 101,325Pa
Stefano ir Bolcmanokonstanta o = t
2
k
4
/(60
q
3
c
2
) 5,67051(19)10
8
W/(m
2
K
4
)
4 lentel. Kartotiniai vienetai
Dau-
giklis
Prie-
dlis
Sim-
bolis
Dau-
giklis
Prie-
dlis
Sim-
bolis
Dau-
giklis
Prie-
dlis
Sim-
bolis
10
18
exa E 10
3
kilo k 10
3
mili m
10
15
peta P 10
2
hekto h 10
6
mikro
10
12
tera T 10
1
deka da 10
9
nano n
10
9
giga G 10
1
deci d 10
12
piko p
10
6
mega M 10
2
centi c 10
15
femto f
5 l entel . vairi mediag tankis normaliomis slygomis (p
0
= 1,01310
5
Pa, T
0
= 293 K)
Mediaga , 10
3
kg/m
3
Mediaga , 10
3
kg/m
3
Acetonas 0,8 Ledas(0
o
C) 0,9
Akmensanglis 1,4 Magnis 1,74
Aliuminis 2,7 Medus 8,93
Amoniakas 0,77 Metanas 0,72
Nafta 0,80,9
Augalinisalyv aliejus 0,92
Natris 0,975
Auksas 19,3 Sausasoras 1,2910
3
Azotas 1,2510
3
Ozonas 2,1410
3
uolas 0,8 Parafinas 0,9
Benzinas 0,7 Pienas 1,03
Benzolas 0,9 Plastilinas 1,5
Betonas 2,2 Plienas 7,8
Bromas 3,12 Plyta 1,8
Chloras 3,2210
3
Porcelianas 2,3
Cinkas 7,1 Sausamogausoda 0,86
Deguonis 1,4310
3
Sausasmedis: uolas 0,71
Deimantas 3,5 beras 0,60,8
Druskosrgtis(38%) 1,19 puis 0,5
Etilospiritas 0,79 Sidabras 10,5
Geleis 7,8 Silicis 2,33
Germanis 2,1 Stiklas 2,5
Gintaras 1,1 vinas 11,4
Gyvsidabris(0
o
C) 13,6 Terpentinas 0,87
Glicerinas 1,26 Valgomoji druska 2,1
Grafitas 5,32 Vandenilis 0,0910
3
Granitas 2,8 Vandensgarai (100
o
C) 0,5810
3
Guma 1,7 Vanduo 1,0
Helis 0,18 Variosulfatas 2,2
Kaulas 1,82,3 Varis 8,9
Ketus 7,4 alvaris 8,38,7
Kraujas 1,05 rutis 2,8
Kvarcas 2,65 ibalas 0,8
196 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
6 l ent el . Garso sklidimo vairiose mediagose greitis
Mediaga t,
o
C v, m/s Mediaga t,
o
C v, m/s
Akmensdruska 20 4400 Plienas 20 50006100
Alavas 20 3320 Plytos 20 3600
Aliuminis 20 6260 Puis 20 5030
Alkoholis 20 1180 Sidabras 20 3600
Auksas 20 3200 Stiklas(optinis)
uolas 20 4115 flintstiklas 20 4450
Benzinas 17 1170 kronstiklas 20 5220
Betonas 20 42505250 Stiklasorganinis 20 2550
Cinkas 20 4170 iferis 20 4510
Deguonis 182,9 912 vinas 20 2160
Deimantas 20 18350 vinas(lydytas) 330 1790
Duraliuminis 20 6400
Geleis 20 5850
Valgomosiosdruskos
tirpalas(20)
15 1650
Gyvsidabris 20 1450 Vanduo 0 1403
Glicerinas 20 1923 Vanduo 20 1483
Grafitas 20 1470 Vanduo 30 1510
Kamtis 20 430530 Vanduo 74 1555
Ketus 20 ~3850 Vanduo 100 1543
Ledas 4 3980 Varis 20 4700
Ore 0 331,5 alvaris 20 42804700
Ore 18 342,4 ibalas 20 2330
7 lentel . mogaus audini ir oro akustins savybs
Mediaga
Tankis
, kgm
3
Iilginisgarsobangos
greitis(vid.) v, m/s
Akustinisimpedansas
kgm
2
/s
Kaulas 1,910
3
1,7510
3
7,6810
6
Kraujas 1,0510
3
1,5710
3
1,5910
6
Minktieji audiniai 1,0610
3
1,5410
3
1,6710
6
Oras 1,29 331 425
Raumenys 1,0410
3
1,5910
3
1,6410
6
Riebalai 0,9210
3
1,4210
3
1,3310
6
Smegenys 1,0210
3
1,5410
3
1,5610
6
Vanduo 1,010
3
1,510
3
1,510
6
8 lentel. Kai kuri mediag tampros modulis
Mediaga E, 10
10
Pa Mediaga E, 10
10
Pa
Aliuminis 7 Plyta 2,8
Betonas 2 Polistirolas 0,32
Geleis 20 Porcelianas 5,8
Guma ~10
4
Sidabras 7,9
Kauloaudinys 1 Stiklas 7
Ketus 9 vinas 1,7
Kolagenas 0,1 Varis 12,3
Oda 0,1310
5
Voratinklis 0,3
Plienas 2122 alvaris 11
PRIEDAI _________________________________________________________________________________ 197
9 l ent el . vairi mediag savitoji ilumin talpa
Mediaga c, kJ /(kgK) Mediaga c, kJ /(kgK)
Acetonas 2,16 Medis 2,39
Aliuminis 0,896 Metilospiritas 2,47
Angliesdioksidas 0,846 Natris 1,3
Angliesmonoksidas 1,047 Nikelis 0,448
Auksas 0,130 Oras 1,009
Azotas 1,038 Parafinas 3,2
Benzinas 2,09 Platina 0,134
Betonas 0,92 Plienas 0,46
Cementas 0,80 Plyta 0,92
Cinkas 0,389 Porcelianas 0,80
Deguonis 0,917 Sidabras 0,234
Etiloeteris 2,33 Siera 0,712
Etilospiritas 2,39 Smlis 0,97
Geleis 0,465 Stiklas, laboratorinis 0,84
Germanis 0,31 paprastas 0,67
Gyvsidabris 0,138 vinas 0,138
Glicerinas 2,39 Vandenilis 14,27
Helis 5,238 Vandensgarai 2,0
Kalis 0,763 Vanduo 4,19
Kamtis 2,89 Varis 0,385
Ketus 0,55 Volframas 0,134
Kvarcinisstiklas 0,729 alvaris 0,385
Ledas(0
o
C) 2,09 ibalas 2,14
Mainin alyva 1,67 mogauskno 3,5
1 0 l e n t e l . Kai kuri mediag virimo temperatra t
vir
ir savitoji garavimo iluma L
(p = 101,3 kPa)
Mediaga t
vir
,
o
C r, kJ /kg Mediaga t
vir
,
o
C r, kJ /kg
Acetonas 56,25 525 Glicerinas 290,5
Aliuminis 2450 10900 Metanas 161,5 510
Amoniakas 33,4 1370 Metilospiritas 64,6 1100
Anglis 4350 510
4
Oras 192 210
Auksas 2700 1650 Siera 444,6 290
Azotas 195,82 198 Sierosdioksidas 10,02 390
Cinkas 907 1755 vinas 1750 8600
Deguonis 182,97 213 Terpentinas 160 2940
Etilospiritas 78,33 840 Toluolas 110,62 364
Fosforas 280 400 Vandenilis 252,77 454
Geleis 2735 6340 Vanduo 100 2256
Gyvsidabris 356,58 285 Varis 2590 4790
198 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
11 l ent el . ilumos laidumo koeficientas
Mediaga , W/Km Mediaga , W/Km
Aliuminis 237 Ledas 0,592
Asbestas 0,1 Oras(27
o
C) 0,026
Auksas 318 Plienas 46
uolas 0,15 Plyta 0,40,9
Betonas 0,91,3 Plyta 11,3
Bronza 200 Porcelianas 1,05
Geleis 80,4 Puis 0,11
Gipsas 0,30,7 Sidabras 429
Gipsas 0,181,05 Stiklas 0,71,1309
Guma 0,146 Vanduo(27
o
C) 0,609
Klevas 0,16 Varis 401
Kvarcas 2,65 Vilna 0,039
12 l ent el . vairi skysi ir duj dinamin klampa (T
0
= 0C)
Mediaga q, 10
3
Pas Mediaga q, 10
3
Pas
Acetonas 0,337 Gyvsidabris 1,59
Actorgtis 1,27 Glicerinas 1393
Amoniakas 0,93 Helis 1,89
Angliargtinsdujos 1,40 Kraujas(sveikomogaus) 45
Angliesdioksidas 1,67 Kraujoplazma 1,5
Anilinas 4,6 Metanas 1,04
Azotas 1,67 Oras 1,72
Azoto(I) oksidas 1,38 Pienas(20
o
C) 1,8
Azoto(II) oksidas 1,72 Ricinosaliejus 1200
Bromas 1,02 Tepimoalyva 305000
Chloras 1,29 Vandenilis 0,84
Deguonis 1,92 Vanduo(0
o
C) 1,8
Etiloeteris 0,238 Vanduo(100
o
C) 0,3
Etilospiritas 1,22 Vanduo(10
o
C) 1,3
13 lentel. vairi mediag paviriaus tempimo koeficientas (20
o
C)
Mediaga o, mN/m Mediaga o, mN/m
Acetonas 24 Muilotirpalas 40
Actorgtis 28 Nafta 26
Alyv aliejus 33 Ricinosaliejus 36
Benzinas 29 Pienas 4250
Etiloeteris 17 lapalas 66
Etilospiritas 22 Vanduo 72
Gyvsidabris 470 Variosulfatas 74
Glicerinas 59
Vitoskiauiniobaltymas 53
Kraujas 58 ibalas 24
, 37C) 2,72
PRIEDAI _________________________________________________________________________________ 199
14 l ent el . Higrometrin lentel. Soij vandens gar slgio ir absoliuiosios drgms
priklausomyb nuo temperatros
t,
o
C p, kPa G, 10
3
kg/m
3
t,
o
C p, kPa G, 10
3
kg/m
3
10 0,287 2,14 15 1,704 12,84
9 2,33 16 1,817 13,65
8 2,54 17 1,937 14,50
7 2,76 18 2,062 15,39
6 2,99 19 2,196 16,32
5 0,421 3,25 20 2,337 17,32
4 0,437 3,53 21 2,486 18,35
3 0,463 3,83 22 2,642 19,44
2 0,517 4,14 23 2,809 20,60
1 0,563 4,44 24 2,984 21,81
0 0,611 4,85 25 3,168 23,07
1 0,656 5,20 26 3,361 24,40
2 0,705 5,57 27 3,565 25,79
3 0,757 5,95 28 3,780 27,26
4 0,813 6,37 29 3,99 28,7
5 0,872 6,80 30 4,24 30,3
6 0,935 7,27 40 7,37 51,2
7 1,005 7,79 50 12,33 83,0
8 1,072 8,28 60 19,91 130
9 1,148 8,83 80 47,33 293
10 1,227 9,41 100 101,3 598
11 1,312 10,02 120 198 1123
12 1,401 10,67 160 618 3259
13 1,497 11,36 200 1554 7763
14 1,597 12,08
15 l ent el . Psichrometrin lentel
Sausojoir drgnojotermometr rodmen skirtumas,
o
C Sausojoter-
mometroro-
domatempe-
ratrat,
o
C
0 1 2 3 4 5 6 7 8 9 10 11
0 100 82 63 45 28 11
1 100 83 65 48 32 16
2 100 84 68 51 35 20
3 100 84 69 54 39 24 10
4 100 85 70 56 42 28 14
5 100 86 72 58 45 32 19 6
6 100 86 73 60 47 35 23 10
7 100 87 74 61 49 37 26 14
8 100 87 75 63 51 40 28 18 7
9 100 88 76 64 53 42 31 21 11
10 100 88 76 65 54 44 34 24 14 4
11 100 88 77 66 56 46 36 26 17 8
12 100 89 78 68 57 48 38 29 20 11
13 100 89 79 69 59 49 40 31 23 14 6
14 100 90 79 70 60 51 42 33 25 17 9
15 100 90 80 71 61 52 44 36 27 20 12 5
16 100 90 81 71 62 54 45 37 30 22 15 8
17 100 90 81 72 64 55 47 39 32 24 17 10
200 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Sausojoir drgnojotermometr rodmen skirtumas,
o
C Sausojoter-
mometroro-
domatempe-
ratrat,
o
C
0 1 2 3 4 5 6 7 8 9 10 11
18 100 91 82 73 64 56 48 41 34 26 20 13
19 100 91 82 74 65 58 50 43 35 29 22 15
20 100 91 83 74 66 59 51 44 37 30 24 18
21 100 91 83 75 67 60 52 46 39 32 26 20
22 100 92 83 76 68 61 54 47 40 34 28 22
23 100 92 84 76 69 61 55 48 42 36 30 24
24 100 92 84 77 69 62 56 49 43 37 31 26
25 100 92 84 77 70 63 57 50 44 38 33 27
15 lentels tsinys
16 l entel . vairi mediag santykin dielektrin skvarba
Mediaga c Mediaga c
Acetonas 21,4 Porcelianas 47
Anilinas 84 Rutilas 130
Benzinas 2,3 Siera 3,64,3
Ebonitas 2,7 Stiklas 510
Etilospiritas 25,1 Transformatorin alyva 2,22,5
Gintaras 2,8 Vakuumas 1
Glicerinas 39 Vandenilis 1,0003
Guma 23 Vanduo(0
o
C) 88
Ledas(18
o
C) 3,2 Vanduo(20
o
C) 81
Marmuras 89 Vakas 5,8
Metilospiritas 33,5 rutis 69
Oras(1,0110
5
Pa) 1,0006 ibalas 2,0
Oras(10110
5
Pa) 1,055 mogauskaulas(beantkaulio) 610
Parafinas 2,2 mogauskraujas 85,5
Polietilenas 2,3 mogaussausaoda 4050
Mediaga
Tempera-
tra
o
C
, Om Mediaga
Tempera-
tra
o
C
, Om
Alyva(transformatorin) 20 10
10
10
13
Vanduo(distiliuotas) 20 10
3
10
4
Alkoholis 20 0,1510
6
Vanduo(distiliuotas) 20 10
3
10
4
Druskosrgtis(10) 18 1610
3
Vanduo(jros) 20 0,3
Glicerinas 20 0,1610
6
Vanduo(ups) 20 10100
Guma 20 10
11
10
12
Vakas(bii) 20 10
13
Kvarcas 230 10
9
rutis 20 10
11
10
15
Mediena(sausa) 20 10
9
10
10
ibalas 20 10
10
Natrioarmas(10) 18 3210
3
Oras 0 10
15
10
18
mogauskaulas
(beantkaulio)
36,6 210
6
Oras(skystas) 196 10
16
mogauskraujas 36,6 1,8
Parafinas 20 10
14
mogausraumenys 36,6 1,5
Sierosrgtis(10) 18 2510
3
Stiklas 20 10
9
10
13
Valgomoji druska(10) 18 8310
3
mogausvirutinisodos
sluoksnis(sausas)
36,6 3,310
3
17 lentel. vairi mediag savitoji vara
PRIEDAI _________________________________________________________________________________ 201
18 l ent el . Temperatrinis varos koeficientas
Mediaga o, 10
3
K
1
Mediaga o, 10
3
K
1
Alavas 4,2 Nikelis 5,0
Aliuminis 4,9 Sidabras 3,6
Cinkas 3,5 vinas 4,1
Geleis 6,2 Tantalas 3,1
Gyvsidabris 0,9 Varis 3,9
Molibdenas 3,3 Volframas 4,5
19 l ent el . Visiko atspindio kampas riboje mediaga-oras
Mediaga o
rib.
,
o
Mediaga o
rib.
,
o
Benzinas 45 Stiklas(lengvasiskronas) 40
Deimantas 24 Stiklas(flintas) 34
Glicerinas 43 Vanduo 49
20 l ent el . vairi mediag absoliutusis lio rodiklis (t = 20
o
C, p = 101,3 k Pa, = 589,3 nm)
Mediaga n Mediaga n
Acetonas 1,36 Kedr aliejus 1,46
Akmensdruska 1,54 Kvarcas 1,54
Amoniakas 1,32 Kvarcinisstiklas 1,46
Angliesdisulfidas 1,63 Ledas 1,31
Anilinas 1,59 Metilospiritas 1,33
Benzolas 1,50 Oras 1,0003
Cukrus 1,56 Sierosvandenilis 1,63
Deimantas 2,42 Stiklas(kronas) FK3 1,464
Etilospiritas 1,36 Stiklas(flintas) F3 1,6128
Glicerinas 1,47 Polistirolas 1,59
Islandijospatas(nepapr. spind) 1,49 Terpentinas 1,51
Islandijospatas(papr. spind) 1,66 Vanduo 1,33299
Kanadosbalzamas 1,54
21 lentel. mogaus akies dali lio rodikliai
Akiesdalys n
Liukoapvalkalas 1,38
Liukocentras 1,41
Ragena 1,37
Stiklaknis 1,33
Vyzdys 1,33
202 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
2 2 l e n t e l . Glaudiamojo lio didinimas ir atvaizd pobdis, esant skirtingiems atstumams
tarp lio, daikto ir jo atvaizdo
Atstumastarpdaiktoir
liooptiniocentrop
Atstumastarpatvaizdoir
liooptiniocentrop'
Skersinisdidinimas
N
L
Atvaizdoris
f 0 Takas
p >2f 2f >p' >f 1<N
L
<0 Tikras, apverstasir sumaintas
2f 2f 1
Tikras, apverstasir natralaus
dydio
2f >p >f p' >2f N
L
<1 Tikras, apverstasir padidintas
f >p >0 p' <0 N
L
>1
Menamas, neapverstasir
padidintas
23 l ent el . Regimosios viesos bang ilgiai
Spalva , nm Spalva , nm
Violetin 380450 Geltonai alia 550575
Mlyna 450480 Geltona 575585
ydra 480510 Oranin 585620
alia 510550 Raudona 620760
24 l ent el . Puslaidininki svybs (t
lyd
lydymosi temperatra, E
0
draustins energijos juostos
plotis,
n
ir
p
elektron ir skyli judrumas)
Mediaga t
lyd.
,
o
C E
0
, eV
n
, 10
2
m
2
/(Vs)
p
, 10
2
m
2
/(Vs)
Baras(B) 2030 1,16 0,01 0,5
Cinkooksidas 1975 3,4 2
Deimantas(C) 4030 5,4 18 14
Fosforas(juodasis, P) 44 0,33 2,2 3,5
Germanis(Ge) 958 0,75 39 19
Jodas(I) 114 1,3 0,25
Kadmiosulfidas(CdS) 1750 2,5 3,5 1550
Sidabrobromidas(AgBr) 430 2,0 2,4 1000(1,7)
Silicis(Si) 1414 1,15 19 5
vinoselenidas(PbSe) 1065 0,15 14 14
vinosulfidas(PbS) 1114 1,2 6,5 8
Telras(Te) 450 0,32 17 12
PRIEDAI _________________________________________________________________________________ 203
25 l entel . Elektron isilaisvinimo darbas A ir fotoefekto raudonoji riba
Mediaga Pagrindas A, eV , nm
Bariooksidas Volframooksidas 1,01,1 12401130
Baris Volframas 1,1 1130
Cezis Volframas 1,36 909
Cezis Platina 1,031 895
Natriochloridas 4,2 295
Natris Volframas 2,10 590
Sidabrobromidas 3,75,14 335240
Toris Volframas 2,62 473
rutis 4,8 255
26 l ent el . Audini lygiaverts dozs svertinis rodiklis
Audinysar organas e Audinysar organas e
Galns 0,20 Plauiai 0,12
Kaulai 0,01 Sklids, kiauids 0,12
Kaul iulpai 0,12 Skydliauk 0,05
Kepenys 0,05 Skrandis 0,12
Krtys 0,05 lapimopsl 0,05
Oda 0,01 Kiti 0,10
27 lentel. Jonizuojanios spinduliuots kokybs koeficientas
Amius 30met
gis 172cm
Mas 70kg
Svoris 690N
Vidutinismogausknotankis 1036kg/m
3
Kraujotankis 10501064kg/m
3
Vidutiniskraujagyslmistekaniokraujogreitis
arterijomis 0,20,5m/s
venomis 0,100,20m/s
kapiliarais 0,00050,002m/s
Veikimopotencialosklidimogreitisjudjimoir jutimonervais 40100m/s
Normaluspapildomasslgissuaugusiomogausarterijoje
diastolinis(t.y. pradinjeirdiessusitraukimofazje) ~9,3(70) kPa(mmHg)
sistolinis(t.y. galinjeirdiessusitraukimofazje) 16,0(120) kPa(mmHg)
dirbaniosirdiesjgapradinjesusitraukimofazje ~90N
28 l ent el . Standartinio mogaus fizikiniai dydiai
Spinduliuot Q
Rentgenoir spinduliuot 1
e

, e
+
, miuonai 1
Neutronai E
n
<10MeV 5
10MeV <E
n
<100MeV 10
100MeV <E
n
<2MeV 20
Protonai, E
p
>1MeV 2
o, kitossunkiosiosdalelsir skilimofragmentai 20
204 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Amius 30met
Knopaviriausplotas 1,85m
2
Normali knotemperatra 36,7
0
C
Atskir knosrii temperatra
kaktos 33,4
0
C
deln 32,8
0
C
pad 30,2
0
C
Odosvidutin temperatra 34,0
0
C
Savitoji kraujoiluma 3,9kJ /(kgK)
Knoilumostalpa 3.610
3
J/kgK
ilumosmain greitis 44,2J /m
2
s
Komfortin santykin drgm 4060%
Kraujopaviriaustempimas 60mN/m
Vandensmas, igaruojanti per par i odospaviriausir plaui 0,82,0kg
O
2
sunaudojimas 260ml/min
CO
2
gamyba 208ml/min
Kraujokiekis 5,2l
irdiesdebitas 5l/min
Arteriniskraujoslgis
16/11kPa
Pulsas
70min
1
Visaplaui talpa 6l
Veikioji talpa 4,8l
kvpiamoorokiekis 0,5l
Liekamasisorotrisplauiuose 0,15l
Kvpavimodebitas 15l/min
Raumen mas 30000g 43%knomass
Riebal mas 10000g14%knomass
Kaul mas 7000g 10%knomass
Kraujomas 5400g 7,7%knomass
Kepen mas 1700g 2,4%knomass
Smegen mas 1500g 2,1%knomass
Plaui mas 1000g 1,4%knomass
irdiesmas 300g 0,43%knomass
Inkst mas 300g 0,43%knomass
Aki mas 30g 0,043%knomass
Savitoji knoaudini vara:
raumenys 1,5Om
kraujas 1,8Om
virutinisodossluoksnis(sausas) 3,310
3
Om
kaulas(beantkaulio) 210
6
Om
Dielektrin skvarba(santykin):
kraujas 85,5
sausaoda 4050
kaulas(beantkaulio) 610
28 lentels tsinys
PRIEDAI _________________________________________________________________________________ 205
kaulas(beantkaulio) 610
mogausknovara, matuojant nuovienosiki kitosrankospirt
gal (kai odayrasausair nepaeista)
~15kO
Regjimopojiotrukm 0,14s
Suaugusiomogausakiesobuolioskersmuo 2425mm
Tinklainsstoris 0,10,4mm
Liukoskersmuo 810mm
Didiausiasliukostoris 3,74,0mm
Liukoliorodiklis ~ 1,4
Stiklaknioliorodiklis 1,34
Akiesvidinisslgis ~104kPa
Stiebeli kiekistinklainje ~ 130mln
28 lentels tsinys
206 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
A
Aerodinaminis pasiprieinimas 108
Akustika 60
Altimetras 123
Amperas 11
Apvalinimo intervalas 13
Areometras 89
Asmano psichrometras 135
Ais
inercijos 44
sukimosi 37
Audiograma 81
Audiologija 77
Audiometrija 81
Avogadro skaiius 104
B
Banga 60
iilgin 61
skersin 61
Bangos ilgis 61
Belas 78
Bolcmano pasiskirstymas 124
Bsena
dujin 88
kietoji 88
skystoji 88
C
Centrifugavimas 48
D
Danis
garso bangos 62
sukimosi 36
Deformacija 151
gniudymo 152
lenkimo 153
DALYKIN RODYKL
sukimo 152
lyties 154
tempimo 152
Dsnis
antrasis Niutono 26
Archimedo 27, 89
Avogadro 103
Boilio ir Marioto 102
Gei-Liusako 102
Fiko 167
judesio kiekio momento tverms 41
pagrindinis sukamojo judjimo
dinamikos 39
Paskalio 89
pirmasis Niutono 26
Puazeilio 94
Stefano ir Bolcmano 140
susisiekianij ind 89
arlio 103
Vyno 140
Vberio ir Fechnerio 79
visuotins traukos 26
Dializ 175
Dydis 10
Dydio dimensija 11
Difuzija 165
molekulin 170
turbulentin 170
Drkinimas 115
Duj embolija 118
Dujos
realiosios 102
tobulosios 102
E
Efektas
akustinis Doplerio 71
Koriolio 45, 46
pjezoelektrinis 67
PRIEDAI _________________________________________________________________________________ 207
Egzosfera 125
Ekliptika 52
Eksperimentavimas 7
Ekvinokcijos linija 52
Elastingoji histerez 156
Elektros srov 21
kintamoji 21
nuolatin 21
nuotkio 24
Elektros srovs poveikis 20, 21
F
Faktorius
atspindio 63
praleidimo 63
sklaidos 63
Fizika 7
klasikin 7
modernioji 7
Fonendoskopas 66
Formul
barometrin 123
Frenkelio 93
Furj 146
Laplaso 116
Stokso 96
G
Garai
nesotieji 127
sotieji 127
vandens 102
Garsis 78
Garso banga 60
Garsobangos
atspindys 63
lis 63
stipris 62
Garso galia 62
Garso galios lygis 78
Geografin platuma 46
Girdimumo slenkstis 78
Girokompasas 53
Giroskopas 51
Greitis
garso bangos 62
kampinis 35, 36
linijinis 36
H
Hemodializ 176
Higrometras 133
I
Infragarsas 67
Izobar 103
Izochor 103
Izoterm 102
J
Jga 45
inercin 45
centrin 41
paviriaus tempimo 112
sunkio (sunkis) 27
svorio (svoris) 27
Jonosfera 125
K
Kandela 11
Kapiliarin banga 119
Kapiliarinis reikinys 117
Kelvinas 10
Kietasis knas 37
Kilogramas 10
Klampa
dinamin 92
kinematin 92
Klausa 74
binauralin 80
Klausos adaptacija 83
Koeficientas
difuzijos 167
paviriaus tempimo 112
ultragarso silpimo 70
ilumos laidumo 146
Kondensacija 127
DALYKIN RODYKL
208 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
Konstanta
Bolcmano 104
Planko 41
universalioji duj 104
Konvekcija 139
laisvoji 141
priverstin 141
Kriterijus
Grashofo 142
Niuselto 141
Stokso 107
ervudo 170
midto 171
L
Laisvoji sukimosi ais 44
Liniuot 15
Lygtis
Bernulio 91
difuzijos 167
duj kinetins teorijos 104
Hageno ir Puazeilio 94
srovs tolydumo 90
tobulj duj bsenos 104
M
Mas 26
gravitacin 27
inercin 26
Mass centras 37
Mass pernaa 171
Matavimas 10
netiesioginis 10
tiesioginis 10
Matavimo neapibrtis 12
Mediagos
pavirinio aktyvumo 116
vidinio aktyvumo 117
Mediagos savybi tyrimo bdai
fenomenologinis 101
modelinis 101
Megafonas 75
Metalas 155
Metras 10
Mezosfera 125
Mikrofonas 81
Mikrometras 16
Molis 11
Momentas
inercijos 38
judesio kiekio 39
orbitinis judesio kiekio 41
sukimo 38
savojo judesio kiekio 42
N
Nedrkinimas 115
Neinercins atskaitos sistemos 45
Nonijus 15
Nuokrypis
standartinis 12, 13
standartinis vidurkio 13
Nutacija 52
O
Orbitinis kvantinis skaiius 42
Oro drgm 123
absoliuioji 128
santykin 128
Osmosas 173
P
Pagreitis 26, 35
efektyvusis laisvojo kritimo 45
icentrinis 45
laisvojo kritimo 27
kampinis 36
Koriolio 45
Paklaida
absoliuioji 11
atsitiktin 11
santykin 14
sistemingoji 11
Pasikliovimo tikimyb 12
Periodas 36, 62, 157
Perkaitintas skystis 134
Pernaos reikiniai 165
Poskio kampas 35
Precesija 52
PRIEDAI _________________________________________________________________________________ 209
Psichofizika 78
Psichrometras 133
Pulso banga 158
R
Rasos takas 128
Reinoldso skaiius 94
Ribin apkrova 28
Ruporas 75
S
Slyio kampas 114
Saugos taisykls 19
Sekund 10
Sekundmatis 17
Skysiai 88
idealieji 89
realieji 89
Skysi klampumas 92
Slankmatis 15
Slgis 102
dinaminis 91
garso (akustinis) 62
hidrostatinis 91
molekulinis 111
osmosinis 174
pilnutinis 91
soij gar 127
statinis 91
Sluoksnis
pasienio 93
Sotinimo deficitas 128
Spinduliavimas 139
Spindulys vektorius 37
Srovs vamzdis 90
Stebjimas 7
Stratosfera 125
Sukinys 42
Sunkis 27
Svarstykls
analizins 28
elektronins 17, 31
mikroanalizins 29
spyruoklins 28
svirtins 17
Svarstykli jautris 29
Svoris 27

ilumos
balansas 129
kiekis 146
laidumas 145
srauto tankis 146
lyties modulis 154
lipo bdas 162
T
Takumas 92
Tamprumas 151
Tampros (Jungo) modulis 153
Tankis 27
Tarptautin vienet sistema (SI) 10
Tekjimas
laminarusis 93
turbulentinis 94
Temperatra 102
efektyvioji 132
krizin 111
virimo 134
Teorema
apie ai perklim 38
apie mass centro judjim 37
Termometras 148
Termoreguliacija 131
Termosfera 125
Termostatas 148
Termoterapija 148
Tirpalas
izoosmosinis 174
hipertoninis 175
hipotoninis 175
Tonas 62
Triukmamatis 66
Triukmas 66
Tropopauz 124
Troposfera 124
Tris 102
210 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
U
Ultragarsas 67
Ultragarsinis jutiklis 69
V
Vaizdinimas ultragarsu 70
Vara 21
bangin (akustin) 63
elektrin 21
odos 22
savitoji 21
ilumin 146
Vidinis statmenasis tempis 151
Virimas 133
Viskozimetras
kapiliarinis 97
rotacinis 97
Stokso 97
Vyksmas
izobarinis 102
izochorinis 103
izoterminis 102

ems atmosfera 122


mogaus ausis 76
PRIEDAI _________________________________________________________________________________ 211
LITERATRA
1. P. Brazdinas. Bendroji fizika. III dalis. Vilnius, VPMLL, 1963.
2. B. Kukas, J. inknas, S. Vias. Fizika. I t. Vilnius, Mintis, 1973.
3. B. Kukas, S. Vias. Fizika. I t. Vilnius, Mokslas, 1987.
4. B. Kukas, S. Vias. Fizika. II t. Vilnius, Mokslas, 1988.
5. A. Tamaauskas. Fizika. I t. Vilnius, Mokslas, 1987.
6. A. Tamaauskas, J. Vosylius. Fizika. II t. Vilnius, Mokslas, 1989.
7. A. Tamaauskas, J. Vosylius, . Radvilaviius. Fizika. III t. Vilnius, Mokslas, 1992.
8. M. S. Venslauskas. Biofizika. (vadas). Kaunas, KMA leidykla, 1996.
9. J. Amenskas, A. Baubinas, V. Obelienis, B. imknien. Aplinkos medicina. Vilnius, Avicena, 1997.
10. E. Daktaraviien, G. Juodkait, K. Sukareviius. Aki ligos. Vilnius, Mokslas, 1992.
11. A.Matvejevas. Molekulin fizika. Vilnius, Mokslas, 1986.
12. R. Sidrys. Akies optika. Kaunas, KTU spaustuv, 1994.
13. J. Brdikis. irdies elektrins stimuliacijos pagrindai. Kaunas, 1985.
14. D. Mickeviius. Chemins analizs metodai. 1 dalis. Vilnius, iburio leidykla, 1998.
15. R. Karazija. Fizika humanitarams. 1 dalis. Vilnius, TEV, 1996.
16. R. Karazija. Fizika humanitarams. 2 dalis. Vilnius, TEV, 1997.
17. Fizikos praktikos darbai. I d./ Red. P. Brazdinas. Vilnius, Mintis, 1972.
18. Fizikos praktikos darbai. II d./ Red. P. Brazdinas. Vilnius, Mintis, 1968.
19. A. Valuis. Fizikos praktikos darbai. Mechanika ir molekulin fizika. Vilnius, VU, 1983.
20. B. Krisinien. Optikos laboratoriniai darbai. Vilnius, VU, 1980.
21. Optikos laboratoriniai darbai. 1 dalis. Red. V. alna. Vilnius, VU, 1991.
22. V. alna. Optikos laboratoriniai darbai. 2 dalis. Vilnius, VU, 1997.
23. Elektros ir magnetizmo laboratorinai darbai.Pareng J. Slavnas, V. Gudelis, J. Jaseviit. VU, 1997.
24. A. Medeiis. Fizikos praktikumo vadas. Vilnius, VU, 1998.
25. P. Misinas. Eksperimento rezultat apdorojimas. Vilnius, VU, 1990.
26. E. Kvelaitis, A. Ratkeviius, R. Miliauskas. Kompiuterizuoti fiziologijos praktikos darbai. I d., II d.
Christian-Albrechts-Universitt zu Kiel, 1993, 1994.
27. Audiologijos pradmenys. Pareng med. dr. V. Sakalinskas. Vilnius, Baltos lankos, 1999.
28. Medicinin diagnostin ir terapin aparatra(laboratoriniai darbai). I dalis. Pareng prof. Jonas Skuas.
Kaunas, KMA leidykla, 1996.
29. A. Tamaauskas, S. Tamuleviius. Fizikos laboratoriniai darbai. 1 dalis. Vilnius, Moksloir enciklopedij
leidybos institutas, 1998.
30. N. Astrauskien, R. Bendorius, A. Bogdanoviius ir kt. Mechanika, termodinamika, nuolatin
elektros srov. Elektromagnetizmas. Bangin ir kvantin optika. Atomo, branduolio ir puslaidininki
fizika.Fizikos laboratoriniai darbai. Vilnius, Technika, 1996, 1997.
31. R. Brazdinas, P. virblis. Optikos ir atomo fizikos laboratoriniai darbai. Kaunas, Technologija, 2000.
32. P. Pipinys. Radijacija aplink mus. Vilnius, 1996.
33. Iliustruotas fizikos inynas. I angl kalbos vert E. Kuoktis. Kaunas, viesa, 1997.
34. R. F. Farr. Physics for medical imaging. London, 1997.
35. P. Bergveld. Electromedical Instrumentation. Cambridge University Press, 1980.
36. J. R. Cameron. Medical physics. New York, 1978.
37. T. A. Delchar. Physics in Medical Diagnosis. London, Chapman & Hall, 1997.
212 _____________________________________ F I Z I KA biomedicinos ir fizini moksl studentams
38. G. Ronto and I. Tarjan. An introduction to biophysics (with medical orientation). Budapest, Akademiai
kiado, 1987.
39. P. B. Danes and E. N. Pinson. The Speech Chain: the Physics and Biology of Spoken Language. New
York, W. H. Freeman and Company, 1997.
40. P. A. Tipler. Physics. New York, Worth Publishers, 1982.
41. L. T. Cree, S. Richmiller. Science in nursing. Sidney, University of Technology, 1997.
42. M. E. Holwill and N. R. Silvester. Introduction to Biological Physics. London, John Wiley & Sons,
1973.
43. Physics for ofhthalmologists. Edited by D. J.Coster. Edinburgh, 1994.
44. E. G. Aird. A. An introduction to medical physics. London, 1975.
45. J. DuBovy. Introduction to biomedical electronics. NY/London, 1978.
46. H. M. Yanof. Biomedical electronics. London, 1972.
47. Principles of biomedical instrumentation and measurement. Edit. by R. Aston, 1990.
48. E. R. Cohen and N. Taylor. The Fundamental Physical Constants. Physics Today, August 1999.
49. Handbook of Physial Quantities. I. S. Grigoriev, E. Z. Meilikov. CRC Press, 1997.
50. Breuer Taschenatlas physik fr mediziner. Springer- Lehrbuch, 1995.
51. S. J. Williamson, H. Z. Cummins. Light and color in nature and art. New York, 1983.
52. D. Methling. Bestmmen von Sehhilfen. Stuttgart: Ferdinand Enke Verlag,1996.
53. . . . . , , 1978.
54. . . . , . , , 1982.
55. . . . a a a. , , 1999.
56. . . . . , , 1986.
57. . . , . . . . , , 1987.
58. . . . . , , 1986.
59. . . . . , , 1976.
60. . . , . . , . . . .
. . . . , , 1983.
61. . .
. . , . . , . . . , , 1983.
62. . . . . , . . . ,
, 1985.
63. . . . . . , . . . , ,
1991.
64. . . , . . . . . .
. . , . . . , , 1988.
65. . . . . . . , ,
1967.
LITERATRA
PRIEDAI _________________________________________________________________________________ 213
FIZIKABIOMEDICINOSIR
FIZINIMOKSLSTUDENTAMS. I dalis
Redaktor Zita Manstaviien
Korektor Asta Demien
Virelio dailininkas Gediminas Markauskas
Ileido Vilniaus universiteto leidykla
Spausdino Vilniaus universiteto leidyklos spaustuv. Tiraas 1500 egz.
Universiteto g. 1, Vilnius
El. patas: leidykla@leidykla.vu.lt
178 _____________________________________
F I Z I KA biomedicinos ir fizini moksl studentams
UDAVINIAI
Kai kurios udavini sprendimo formuls
Me c h a ni k a . Di na mi k a
Kno poslinkis s (kno neveikia iorins jgos)
s =v t (ds =v dt);
ia v greitis (m/s), lygus ds / dt, t trukm.
Tolygiai kintamo judesio (veikia pastovios iorins jgos):
Greitis (apibriamas taip pat) v = ds/dt (m/s).
Pagreitis a = dv/dt (m/s
2
).
Kno poslinkis
2
2
0
t
t
a
+ = v s ;
ia v
0
pradinis greitis.
Pastaba. i formul galioja ir esant vertikaliam
judesiui arba sudtingam judesiui, kai galimi
nepriklausomi judesiai vairiomis kryptimis.
Jg sukeltas pagreitis (antrasis Niutono dsnis)
a
m
N
F
=
;
ia F
N
kn veikianti jga ar jgatstojamoji.
Judesio apskritimu:
Nueitas kelias, trajektorija (m) s = r d;
ia r spindulys (judanio apskritimu kno
nuotolis nuo sukimosi aies, m), d poskio
kampas (rad).
Nueitas kampinis nuotolis (rad) = e t;
ia e kampinis greitis (rad/s).
Kampinis pagreitis c = de / dt (rad/s
2
).
Ryys sulinijiniais dydiais: v = e r,
a
t
= c r (tangentinis pagreitis),
a
n
= v
2
/r = r e
2
(normalinis, icentrinis pagreitis),
a
v
= r
2 4
c e +
(visas pagreitis a
v
= a
n
+ a
t
).
UDAVINIAI ____________________________________________________________________________ 179
Pagrindinis sukamojo judjimo c = M/I ;
dinamikos dsnis: ia M jg momentas,
M = r F, I = m r
2
(takins mass m)
inercijos momentas.
Sudtingos formos kno inercijos momentas:

=
2
r m I
i
,
v d
2

}
=
v
r I
.
Taisyklingos formos kno inercijos momentai:
Rutulio
5
2
m I = R
2
;
ia R rutulio spindulys.
Ritinio
2
1
m I = R
2
.
Tuiavidurio cilindro
;
2
1 2
2
2
1
|
.
|

\
|
+ = R R m I
iaR
1
ir R
2
vidinis ir iorinis spinduliai.
Plono ilgio l strypo, besisukanio apie esani
jo viduryje statmen a,
12
1
m I = l
2
.
Jei sukimosi ais nutolusi nuotoliu l
nuo kno mass centro,
0
I I + = m l
2
;
ia I
0
kno inercijos momentai, kai sukimosi
ais eina per mass centr.
Judesi o ki eki o moment as:
Materialiojo tako L=mvr.
Kno L = I e.
Sukamojo judesio darbas A=M ;
ia M jgos momentas.
Jgos momentas M=r F.
Kinetin energija
k
2
1
= I E e
2
.
Dalel veikianti nusodinimo
jga centrifuguojant
V F =
d
) (
t
e
2
R;
ia V dalels tris,
d
jos tankis,
t

tirpiklio tankis, e centrifugos kampinis grei-
tis, R dalels nuotolis nuo sukimosi aies.
180 _____________________________________
F I Z I KA biomedicinos ir fizini moksl studentams
S t a t i k a
Jgsudtis
2 1
F F F + = .
Jgos momentas M=r F .
Masi centro (kno pusiausvyros slyga) 0
k
=

M ;
ia M
k
jgos momentas.
Vi r pe s i a i i r ba ng os
Harmoninio osciliatoriaus lygtis: F
Niutono
=F
Huko
, m a =kx,
m
k
=
0
e
,
x
t
x
2
0
2
2
d
d
e = ;
sprendinys
( ) e + = t A x cos
;
periodas ir danis
g
l
T 2
1
= =
v
,
g
l
=
v 2
1
,
v
m
k
t
=
2
1
,
v
l
g
t
=
2
1
,
mgl
I
T t = 2
.
greitis
) sin( ) sin(
0
e e e + = + = ' = t t A x v v ;
pagreitis
a = Ae
2
) cos( e + t ;
kinetin energija
) ( sin
2
2
2
k
e + = t
kA
E ;
potencin energija
( ) e + = t
kA
E
2
2
p
cos
2
;
visa energija
2
2
p k
kA
E E = +
.
Sky s i a i . He modi na mi ka
Energijos tverms dsnis skysio trio vienetui
(idealiesiems skysiams, nenutrkstamamsrautui)
Bernulio lygtis
const
2
2
st
= + + gh p
v
;
ia p
st
statinis slgis, skysio tankis,
v greitis, h skysio pakilimo auktis
(kai vamzdis nehorizontalus).
UDAVINIAI ____________________________________________________________________________ 181
Niutono lygtis triniai
x
F
d
d
tr
v
q = S ;
ia F
tr
dviej plotu S besilieiani
sraut, tarpkurigreiiogradientas dv/dx,
trinties jga.
Hageno ir Puazeilio formul
l
p p R
Q
2 1
4
8

=
q
;
ia V pratekjusio per apval vamzd
skysio tris (kiekis), R vamzdio spin-
dulys, p
1
ir p
2
slgiai vamzdio galuose,
l vamzdio ilgis, q dinamin klampa.
Jei vamzdio skerspjvis kinta, Q
l
p R
d
d
8

4
q
= .
Skystyje judant rutuliuk veikia trinties
jga (Stokso formul)
v R F q t 6
tr
= ;
ia R rutuliuko spindulys.
Krizinis laminariojo srauto greitis ;
R
Re
kr

q
2
v =
ia Re Reinoldso skaiius, skysio
tankis, R vamzdio spindulys.
Paviriaus tempimo jga
F =o l;
iaopaviriaus tempimokoeficientas, l
plvels kontro ilgis.
Papildomas slgis oro burbuliuke
(Laplaso formul) r p / 4o = A .
Jei burbulo plvel turi tik vien paviri, r p / 2o = A ;
ia r burbulo spindulys, o paviriaus
tempimo koeficientas.
Skysio pakilimo (nusileidimo) kapiliare ; cos
2
0
u

o
g r
h =
auktis
r
0
kapiliaro spindulys, u ribinis (drki-
nimui) kampas.
Huko dsnis tampriajai deformacijai
= c o E;
ia o vidinis tempis kne, E Jungo
modulis, c santykin deformacija.
182 _____________________________________
F I Z I KA biomedicinos ir fizini moksl studentams
Vamzdelio (kraujagysls) sieneli tempimas
;
d
r
p T =
ia p slgis vamzdelyje, r jo spindulys,
d sienels storis.
Pulso bangos greitis arterijoje
r
Ed
2
= v
;
ia sienels tankis.
Darbas perpumpuojant krauj ;
2
1
V
V
}
= pdV A ia V kraujo tris, p slgis.
Ga r s a s , k l a us a
Atviro vamzdio rezonavimo slygos:
Pagrindinis tonas
1
=2L, v
1
L 2
1
1
1
v v
= =

,
2
1

= L
.
Auktesns harmonikos v
n
= n f
1
,
2
n
L
n
=
, n = 1, 2, 3 .
Vienugaluudaro vamzdio rezonavimo slygos:
4
;
4
;
4
;
4
7 5 3 1

= L
,
4
n
L
n

=
, n = 1, 3, 5, 7 .
v
n

v
= = nv
1
, v
1

v
= =

v 4
.
Cilindrinio vamzdio L

=L + 2 0,61 R;
ia R vamzdio spindulys.
Matematins vytuokls vytavimo danis v
l
g
2
1
= , v
m
K
2
1
= ;
ia K kreipimo momentas.
Cilindre stmoklis vytuoja daniu v ;
2
1
l m
S p o
=
ia p slgis cilindre esant stmokliui
pusiausvirojoje padtyje, S stmoklio
plotas, m mas, l eiga, o (orui) =1,4.
UDAVINIAI ____________________________________________________________________________ 183
Helmholco rezonatoriaus danis v
Vl
S c
2
=
;
ia S kaklelio plotas,
V kolbos tris,
l kaklelio ilgis.
U dav i ni s l ygos
1. Me c ha ni ka
1.1. Nuo platformos, esanios 1,5 mauktyje vir ems paviriaus, vertikaliai auktyn 20 m/s
greiiu metamas sviedinys. kok aukt jis pakils? Koks bus jogreitis krintant ant ems paviriaus?
Kiek laiko sviedinys ibus ore?
1.2. Mnulyje laisvojo kritimo pagreitis yra 1,63 m/s
2
. Koks yra astronauto sunkis Mnulyje, jei
emje jis lygus 800 N?
1.3. 1500 kg mass automobilis, vaiuodamas 20 m/s greiiu, trenkiasi sien. Automobilio
priekis 0,5 m sugniudomas. Raskite, kokia jga siena veik automobil, koks buvo tuo metu
automobilio pagreitis. Kokiu pagreiiu buvo stabdomas vairuotojas, jei saugos dirai leido jam
pajudti 20 cm priek? Dir tempimas stabdymo metu nesikeit.
1.4. Automobilis vaiavo pastoviu greiiu. Per 15 s jis nuvaiavo 300 m. Koks buvo jo greitis?
Per kiek laiko jis nuvaiuos i Vilniaus Kaun (100 km)? Kok keli nuvaiuot per 15 val.?
1.5. Iki artimiausios vaigds yra 410
16
m. Kokiu greiiu skriedamas erdvlaivis pasiekt t
vaigd per 30 met? Kiek energijos reikia suteikti erdvlaiviui (mas 100 t), kad jo greitis tapt
toks? Kiekmet jamturt tiekti energij Visagino elektrin (jos galia 3000 MW)?
1.6. Koks yra maiausias bii skridimo greitis, jei nuo avilio iki lankos yra 350 m, o bit,
iskridusi 12 h 15 min 15 s, gro 12 h 23 min 40 s?
1.7. Renault automobilis gyja 100 km/hgreit per 9,5 s. Kok keli jis nuvaiuoja per t laiko
tarp? Koks yra jo pagreitis? Kokia yra variklio traukos jga (automobilio mas yra 1100 kg)?
Nuostoli nepaisykite.
1.8. Blusa, kurios mas yra 0,15 mg, per 1 ms, atsispirdama upakalinmis kojytmis, gyja 1 m/s
greit. Koks yrajos pagreitis ir kokijg ivystojos kojos atsispyrimo metu? kok aukt ji pakyla?
Po kiek laiko ji nusileis toje paioje vietoje? Oro pasiprieinimo nepaisykite.
Helmholco rezonatorius
184 _____________________________________
F I Z I KA biomedicinos ir fizini moksl studentams
1.9. Apskaiiuokite 1 kg mass ritinio formos iedo, besisukanio apie simetrijos a, inercijos
moment:
a) iedo vidinis spindulys yra 0,2 m, iorinis 0,25 m;
b) sukimosi ais lygiagreti su simetrijos aimi ir nutolusi nuo pastarosios per 0,25 m;
c) sukimosi ais nutolusi per 0,2 m.
1.10. Apskaiiuokite 1 kg mass vienalyio strypo, kurio ilgis l =0,4 m, inercijos moment, kai
sukimosi ais:
a) statmena strypui ir eina per strypomass centr;
b) kaip ir a), tik pastumta iilgai strypo iki jo galo;
c) kaip ir a), tik pastumta nuotoliu 5 l nuo jo mass centro;
d) statmena ploktumai, kurioje guli strypas, ir yra nuotoliu 5 l nuo strypo centro, o strypo
galai vienodai nutol nuo sukimosi aies.
Atvejais c) ir d) strypo ilg laikykite labai mau, palyginti su nuotoliu iki sukimosi aies, o pat
stryp labai plonu.
1.11. Apskaiiuokite staiakamps 0,20,4 m dydio 1 kg mass plokts inercijos moment,
kai plokt sukasi apie a:
a) lygiagrei su ilgesnija (arba trumpesnija) kratine ir einani per mass centr;
b) sutampani suilgesnija (arba trumpesnija) kratine.
1.12. Centrifugai sukantis, mgintuvlis su koloidiniu tirpalu pasisuka kryptimi, statmena
sukimosi aiai. Koks yra koloidins dalels, esanios 20 cmnuotoliu nuo sukimosi aies, linijinis
greitis ir icentrinis pagreitis, jei centrifuga sukasi 100 rad/s kampiniu greiiu?
1.13. Naudodamiesi ankstesniojo udavinio slyga, raskite, kokia jga bus veikiama lstel,
kurios skersmuo lygus 100 nm, o tankis yra 1,110
3
kg/m
3
, vandeniniame tirpale, jei jos momentinis
nuotolis nuosukimosi aies yra 15 cm. Koks bus jos pagreitis 17 cmnuotoliu? trint neatsivelkite.
1.14. Kok darb reikia atlikti, norint sukti nejudani karusel iki 6 aps/mingreiio. Karusels
inercijos momentas yra 1000 kgm
2
. Trinties nepaisykite.
1.15. Skritulio pavidalo smagratis, kurio spindulys lygus 0,5 m, o mas yra 20 kg, sukasi
360 aps/min greiiu. Koks turi bti stabdymo jgos momentas, kad skritulys sustot per 10 s.
1.16. Apskaiiuokite, kok ilumos kiek gyja delnai, jei aplodismentai trunka 20 s, o danis yra
2 Hz. Rankos itiestos ir sukasi tik apie peties snar, kiekvienos platakos kampinis greitis smgio
metuyra1 rad/s. Rank laikykitevienalyiu4 kg mass ir 0,65 milgiostrypu. Nuostolinepaisykite.
1.17. Dailiojo iuoimo okjas, itiess rankas, sukasi 10 rad/s greiiu. Kaippasikeis sukimosi
greitis, jei jis rankas priglaus priekno? Inercijos momentas, priglaudus rankas, sumaja tredaliu.
1.18. Kokiu nuotoliu nuo akmens reikia padti atram, kad spausdamas 5 m ilgio sverto gal
50 kg mass vyras galt kilstelti 1 t mass akmen? Tariama, kadsverto galas sutampa su akmens
mass centru.
1.19. Ant 4 rad/s greiiu besisukanios platformos, kurios spindulys yra 2 mir mas lygi 200 kg,
kratostovi 60 kg mass mogus. Kokiugreiiuims suktis platforma, kai mogus pereis platformos
centr? mogaus, stovinio platformos centre, inercijos momentas lygus 1,6 kgm
2
? Nuostoli
nepaisykite.
UDAVINIAI ____________________________________________________________________________ 185
1.20. mogaus rankos mas yra 4 kg, ilgis lygus 60 cm. Laikydami rank vienalyiu strypu,
raskite, kokia horizontaliai itiestos ir paleistos laisvai (be raumen pasiprieinimo) kristi rankos
kinetin energija, jai pasiekiant vertikali padt. Apskaiiuokite, koks yra tuo metu pirt gal
linijinis greitis.
1.21. Kok darb atlieka 75 kg mass mogus, veikdamas 1 km nuotol ir padarydamas 1200
ingsni. Kojos vytuoja 30
o
laipsnikampu, darbas sunaudojamas tiktai jas stabdant ir greitinant.
Koj judes laikykite tolygiai kintamu sukamuoju. Kojos inercijos momentas lygus 1,5 kgm
2
.
1.22. 60 kg mass mogus, bgdamas liestins platformai kryptimi 5 m/s greiiu, uoko ant
krato nejudanios platformos, kurios skersmuo 5 m. Platformos inercijos momentas lygus
600 kgm
2
, mogaus inercijos momentas yra 1,5 kgm
2
(kai vertikali sukimosi ais eina per jo mass
centr). Apskaiiuokite platformos sukimosi greit ir kinetin energij. Nuostoli nepaisykite.
1.23. Kokia yra perkrova70 kg mass mogui okant nuo1 maukioplatformos, jeigustabdymo
kelias:
a) sulenkus kojas yra 10 cm;
b) itiesus kojas yra 0,5 cm.
2. Mol ekul i n f i zi ka. i l uma
2.1. Vabalas (iuoikas) stovi ant vandens paviriaus 6 kojomis. Po kiekviena koja vandens
paviriuje susidaro 1 mm gylio 90
o
kgin duba. Vabalo kojos gulsios dalies ilgis yra 5 mm,
tarkime, vabalo koja yra labai plona. Vandens paviriaus tempimo koeficientas lygus 0,073 N/m.
Raskite vabalo sunk ir jo mas?
2.2. Riebaluota 5 cmilgioadata, kurios skersmuoyra 0,5 mm, padedamaant vandens paviriaus.
Adata nesksta, otik susidaro duba, kurios kratai suvandens paviriumi sudaro 45
o
kamp. Koks
yra adatos svoris? (Adat laikykite ritiniu.)
2.3. Koks yraabsoliutusis slgis 3 cmspinduliomuiloburbulo viduje?Muilo paviriaus tempimo
koeficientas yra 0,03 N/m.
2.4. Imdama tyrimui krauj, sesel ispaudia i paciento pirto la kraujo ir prideda prie jo
stikliniokapiliaro(r =0,5mm) gal. kok aukt kapiliare pakils kraujas, jei jopaviriaus tempimo
koeficientas lygus 0,05 N/mir kraujas sudaro gaubt 30
o
kampo menisk.
2.5. Vaistai danai dozuojami laais. Kiek gramskyst vaist gauna pacientas, kuriamduota 20
la vaist? Laintuvo angos skersmuo yra 2 mm, vaist paviriaus tempimo koeficientas lygus
0,07 N/m.
2.6. Mginlis mikroskopiniams tyrimams daromas taip: dvi lygiagreios stiklins ploktels,
tarp kuri yra 0,5 mm tarpas, merkiamos tiriam skyst, ir skystis, veikiamas kapiliarini jg,
pakyla. Koks yra skysio paviriaus tempimo koeficientas, jei skystis pakilo 5 cmaukt? Skysio
tankis yra 1,110
3
kg/m
3
, skystis drkina stikl ir sudaro 20
o
kamp su stiklo paviriumi.
2.7. Inkstai kasdien perfiltruoja apie 150 l kraujo. Filtravimas vyksta nugalint osmosin slg
(kraujo plazmos p
0
=30 hPa). Kok darb atlieka inkstai per par?
186 _____________________________________
F I Z I KA biomedicinos ir fizini moksl studentams
2.8. Kiek sutrumpja launikaulis, jei koj slegia 500 Nmogaus sunkio jga. launikaulio ilgis
yra 0,4 m, skerspjvio plotas lygus 2 cm
2
, kaulo Jungo modulis yra 9,510
9
N/m
2
.
2.9. Kiek pailgja 70 kg svorio gimnasto 25 cm ilgio dilbio kaulas:
a) kai gimnastas pakibs ant skersinio abiemrankomis,
b) kai laikosi viena ranka?
Koks yra iuo atveju kaulo vidinis tempis? Kaulo skerspjvio plotas 2 cm
2
, Jungo modulis
1,610
9
N/m
2
.
2.10. Apskaiiuokite, koks ilumos kiekis prasiskverbia per 1,5 1 m
2
lango stikl per par,
esant 20Ckambario ir 10C iors temperatroms. Lango stiklo storis yra 4 mm, stiklo ilumos
laidumo koeficientas lygus 0,8 W/(mK).
2.11. Nuogo mogaus vidutin odos temperatra yra 30C. Kokia yra kno ilumos nuostoli
galia mogui ramiai stovint 20Ctemperatros patalpoje. mogaus kno paviriaus plotas lygus
1,5 m
2
. Prakaitavimo nepaisykite. Od laikykite absoliuiai juodu knu.
2.12. Kok ilumos kiek praranda mogus per par, jei per t laik jis prakaituodamas netenka
600 g vandens?
2.13. Kvpuodamas mogus netenka apie 500 ml vandens per par. Apskaiiuokite, kokia yra
organizmo ilumos nuostoli dl ios prieasties galia.
2.14. Bgiko varyb metu iskiriama (prakaituojant ir kitais bdais) aplink galia lygi 200 W.
Dl metabolizmo sukuriama 300 Wgalia. Kiek pakils jo kno temperatra per 30 min, jei bgiko
mas lygi 70 kg, o kno savitoji iluma yra 3500 J/(kgK)?
2.15. Ilgj nuotoli 70 kg mass bgiko metabolizmas paspartja tiek, kad sukuriama 400 W
galia. Kiek pakyla bgiko temperatra per 1 h, jei dl vairi prieasi kno ilumos nuosto-
li galia yra 370 W, o kno savitoji iluma lygi 3500 J/(kgK)?
2.16. Saunoje mogus per valand gali iprakaituoti 2 kg vandens. Kokia yra iomogaus ilumos
atidavimo galia?
2.17. Kok energijos kiek reikia suteikti, norint itirpinti 50 g 0Ctemperatros ledo?
2.18. mogaus knas per par netenka 10
7
J vidins energijos. Kiek kilogram vandens tekt
igarinti, jei i energija btprarandamatiktai prakaituojant? Vandens savitoji garavimoiluma lygi
2256 kJ/kg.
2.19. Baleto okjos batelio atramos plotas yra 4 cm
2
. Koks yra slgis grindis, kai 50 kg mass
balerina pasistiebia ant vienos kojos?
2.20. Kokia jga reikia spausti virkto stmokl, kurio skersmuo yra 1,5 cm, kad vaistai patekt
ven? Kraujo slgis venoje lygus 20 hPa.
2.21. irdis istumia apie 50 ml kraujo aort sistoliniu 1,310
4
Pa slgiu. Kok darb atlieka
irdis per par, jei pulsas yra 70 tvinksni per minut. Kokia yra irdies galia?
2.22. irdis istumia krauj aort 1,210
4
Pa slgiu. Aortos skersmuo yra 3 cm. Apskaiiuokite
vidutin jg, kuria irdis stumia krauj aort.
UDAVINIAI ____________________________________________________________________________ 187
2.23. Naras pasinr 30 m gyl. Koks yra absoliutusis slgis iame gylyje? Koks papildomas
slgis veikia nar?
2.24. Kraujoslgis venojeyra 500 Pa. Perpilant krauj, rezervuaras yra 1mauktyje vir kateterio.
Koks yra slgis, stumiantis kraujo plazm ven, jei kraujo plazmos tankis yra 1030 kg/m
3
?
3. Gars o bangos
3.1. iknosparnis skleidia 10
5
Hz danio ultragarso bangas. Kokio ilgio yra ios bangos ore?
3.2. Delfinas skleidia iki 2,510
5
Hz danioultragarsobangas. Koks yrajbangos ilgis vandenyje?
Garso greitis vandenyje lygus 1500 m/s.
3.3. Antena efektyvi tuomet, kai jos matmenys bent 10 kart didesni nei bangos ilgis. Kokio
didumo turi bti gyvno ausys, kad jos efektyviai stiprint 1000 Hz danio gars?
3.4. Koks yra garsis, jei garso stipris yra 510
6
W/m
2
?
3.5. Koks yra stipris 60 Hz danio garso, kurio garsis toks pat kaip 30 dB1000 Hz danio garso?
3.6. Koks yra 50 dB(arba 100 dB) garsio garso bangos stipris, jei bang danis yra 1000 Hz; 500
Hz; 10 Hz?
3.7. Motociklo motoras 2 mnuotoliu girdimas 80 dBgarsiu. Koks bus jo garsis 20 mnuotoliu?
3.8. Sirena 100 mnuotoliu girdima 80 dBgarsiu. Koks garsis bus 300 mnuotoliu nuo sirenos?
3.9. Kambaryje yra dulki siurblys ir radijas. Jei veikia tik radijas, susidaro 65 dB garsio
triukmas, jei jungtas dulki siurblys 70 dB. Koks bus triukmo lygis, jei veiks dulki siurblys ir
radijas vienu metu?
3.10. Auditorijoje dstytojas skaito paskait 50 dB garsiu (pagrindinis tonas 500 Hz). Kiek
kart skiriasi is garsis nuo fono, kur sudaro 100 student nabdesys? Vienas to paties danio
nabdesys yra 20 dBgarsio. Kiek student turi bti auditorijoje, kad dstytojo garsis bt lygus
fono garsiui?
3.11. Kok gars kambaryje sudaro trys vienodu 60 dBgarsiu vienu metu kalbantys mons?
3.12. Kokia yra garso altinio galia, jei jis skleidia 1000 Hz danio bangas ir 100 m nuotoliu
garsis lygus 50 dB? altinis skleidia garso bangas visomis kryptimis vienodai.
3.13. Kokia yra garso altinio galia, jei u 100 m jis girdimas 50 fon garsiu? Garso danis yra
500 Hz. altinis skleidia garso bangas visomis kryptimis vienodai.
3.14. Kok darb atlieka dstytojas, kalbdamas 1,5 valandos 55 dBgarsiu ir 300 Hz pagrindiniu
daniu?
3.15. Deinioji ausis registruoja garso bang, kurios faz, palyginti su kairija ausimi, atsilieka
0,2 rad. Garso danis yra 100 Hz. Kokiu kampu klausytojo atvilgiu yra garso altinis? Atstumas
tarp aus yra 12 cm.
3.16. Deinioji ausis registruoja garso bang, atsiliekani 10 cm kairiosios ausies atvilgiu.
Koks yra registruojam bang fazi postmis, jei garso danis lygus 500 Hz?
188 _____________________________________
F I Z I KA biomedicinos ir fizini moksl studentams
3.17. Kokia jga garsobanga veikia ausies bgnel (skersmuo 7 mm), jei 1000 Hz danio bangos
garsis yra 70 dB? Iorins ausies stiprinimo koeficientas lygus 1,5.
3.18. Nedidel kolb sudaro 10 cm skersmens rutulys ir 3 cm skersmens bei 10 cm ilgio
kaklelis. Kokiamgarso daniui i kolba rezonuoja?
3.19. Variklio cilindre, kurio skersmuo lygus 10 cm, auktin lygi 10 cm, o udaryto oro slgis
yra 2 10
5
Pa, be trinties ima judti 1 kg mass stmoklis. Kokiu daniu vytuos stmoklis?
3.20. vytuoklinis laikrodis tiksi kas sekund (tiksjimas girdimas vytuoklei atsilenkiant
kiekvien kratin padt). Koks yra vytuokls ilgis?
3.21. Raskite, kokiamdaniui rezonuoja skudutis, jei jo ilgis yra 10 cm. Koks yra pagrindinio ir
oberton danis? Kokiamdaniui rezonuos skudutis imus jo dugnel?
3.22. Iorins ausies kanalo ilgis yra 2,5 cm. Ausis girdi garsus nuo 20 Hz iki 20 kHz.
Apskaiiuokite, kuri dani garsus stiprina iorin ausis?
3.23. jungs 1000 Hz danio signal, automobilis vaiuoja 100 km/h greiiu. Kok dan girdi
nejudantis stebtojas, kai automobilis artja, ir kok, kai tolsta?
3.24. Ankstesnio udavinio slygoje signalizuojaniam automobiliui prieprieiais tokiu pat
greiiu vaiuoja kitas automobilis. Kokiodaniogars girds antrojo automobiliovairuotojas prie
jiems susitinkant ir prasilenkus?
3.25. Policininkas greiio matuokliu, kuris skleidia 10 GHz danio radijo bangas, kontroliuoja
automobil, kuris vaiuoja 100 km/h greiiu. Kok danio pokyt registruos matuoklis?
3.26. Griaustinio trenksmas pasigirdo 10 s vliau, negu blyksteljo aibas. Kokiu nuotoliu nuo
stebtojotrenk aibas?
3.27. Ausis girdi nuo 20 Hz iki 20 kHz danio bangas. Koki bang ilgi ore garsus girdime?
3.28. Gitaros styga tempta 100 N jga, jos skersmuo lygus 0,2 mm, stygos plieno tankis yra
7700 kg/m
3
. Koks iilgins bangos ioje stygoje danis?
3.29. Garso banga, kurios stipris yra 10
4
W/m
2
, krinta ausies bgnel. Ausies bgnelio plotas
yra 510
-5
m
2
. Apskaiiuokite, kiek energijos sugeria ausies bgnelis per 10 min.
3.30. Iorins ausies kanalo ilgis yra 2 cm. Apskaiiuokite, kokiam pagrindiniam daniui
rezonuos is kanalas.
3.31. Kok didiausi ultragarsoimpulspasikartojimodan galima vartoti, norint gauti atspind
nuo kaulo, esanio minktuosiuose audiniuose 20 mmgylyje? Ultragarso iuose audiniuose greitis
yra 1,610
3
m/s.
3.32. Kokio dydio Doplerio poslinkis gaunamas 100 kHz danio ultragarsu matuojant kraujo
tekjimoarterijagreit (apie10cm/s), jei ultragarsobanga kraujagyslsklinda30
o
kampu. Ultragarso
bangos greitis kraujyje yra 1,5710
3
m/s.
UDAVINIAI ____________________________________________________________________________ 189
Ka i k u r i u d a v i n i a t s a k y ma i
1.1. 21,9 m; 20,7 m/s; 4,1 s
1. 2. 133 N
1.3. 600 kN; 400 m/s
2
; 286 m/s
2
1. 4. 20 m/s; 1 h 23 min; 1080 km
1.5. 410
4
km/s; 932,3 met; 8,810
19
J
1. 6. 1,4 m/s
1. 7. 3,2 kN; 2,9 m/s
2
; 131 m
1.8. 1,510
-4
N; 1000 m/s
2
; 5 cm; 0,1 ms
1.9. 0,0513 kgm
2
; 0,1138 kgm
2
; 0,0913 kgm
2
1.10. 0,013 kgm
2
; 0,053 kgm
2
; 4,013 kgm
2
; 4,013 kgm
2
1. 11. 0,013 kgm
2
; 0,053 kgm
2
1. 12. 20 m/s; 2 km/s
2
1.13. 8,610
-16
N; 1,7 km/s
2
1.14. 197 J
1.15. 9,42 kgm
2
/s
2
1. 16. 22,5 J
1.17. 15 rad/s
1. 18. 0,24 m
1.19. 6,4 rad/s
2. 1. 21,610
3
N; 2,2 g
2. 2. 7,3 mN
2.3. 1,0110
5
Pa
2. 5. 0,88 g
2. 6. 0,146 N/m
2. 8. 0,1 mm
2.9. 27 m; 54 m; 3,43 MPa
2.18. 4,04 kg
3. 1. 3,4 mm
3.2. 6 mm
3. 5. 10
9
W/m
2
3.7. 60 dB
3. 8. 70,4 dB
3.16. 0,29t rad