Está en la página 1de 107

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 UNIVERSIDADDELASERENA FACULTADDEINGENIERIA DEPARTAMENTODEMINAS

PROYECTOPLANTA MINAOLIVIA

IIIIIIIIIII 1 PROFESOR:MARIOGAETE NOMBRES:MARIANICOLEJERIA PAULACARRASCO DIEGOCARRASCO CRISTOBALCORTES

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 PRESENTACIONDELPROYECTO PROYECTOQUESEPRESENTAAEVALUACINAMBIENTAL ElproyectoquesepresentaalaCOREMA4RegindeCoquimboparasersometidoalSistema deEvaluacindeImpactoAmbiental(SEIA),mediantelapresenteDeclaracindeImpacto Ambiental(DIA),sedenomina:"Plantadelixiviacinenpila,extraccinporsolventeyelectro obtencin, cuyo proponente es Estudiante de Ingeniera Civil de Minas, Universidad de La Serena. El proyecto en cuestin, considera la operacin de una planta con pila de lixiviacin dinmica, denominada Olivia, conformada por tres mdulos de lixiviacin con capacidad para procesar 45000 toneladas de mineral, una planta de chancado con capacidad para 45000 ton/mes, La pila se construir sobre un terreno impermeabilizado cuyas caractersticas se mencionan en el capitulo2. El manejo de soluciones, considera la construccin de estanques de procesos y planta de extraccinporsolventeseguidodeplantadeelectroobtencin, La disposicin de los ripios agotados que se generen en este proyecto, ser en los actuales botaderos de ripios agotados existentes en la faena. Esta disposicin evitara el impacto sobre elsuelonatural. Desde el punto de vista legal ambiental, el proyecto Planta Olivia se tipifica como proyecto dedesarrollominero,contempladoenelliterali)delartculo10delaLey19.300ydelartculo 3 del Reglamento del Sistema de Evaluacin de Impacto Ambiental (SEIA), razn por la cual ingresaalSEIAparaevaluarsusimpactosambientales.

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
INDICE ResumenEjecutivo..4 Introduccin..5 PresentacinDeclaracindeImpactoAmbienta(DIA)6 Capitulo1.AntecedentesGenerales UbicacinyAcceso,Rutas..9 PropiedadMinera10 AntecedentesTcnicos11 ClimaySismologa..13 FlorayFaunaenGeneral14 SistemaHidrogrfico.15 TurismoyArqueologa.16 AspectosGeolgicos..17 Capitulo2.AspectosLegales.18 PlandeCierredefaenasMineras.25 ComponentededescripcinImpactoAmbiental..26 DerechodeAgua.27 Capitulo3.AspectosdeDiseo DiagramadeFlujo33 DiseodeUbicacinPlanta..............................................34 Capitulo4.readeProcesamiento. CriteriosdeDiseo.37 SistemadeChancado38 DimensindeStockpile..44 Vistaplantayperfilesdereadeprocesamiento.45 DiseoCorreasTransportadoras..50 Costozonadeprocesamiento.56 Captulo5.TambordeAglomeracin.56 Capitulo6.LixiviacinenPilas58 Capitulo7.ExtraccinporSolvente68 Capitulo8.ElectroObtencin..93 DescripcinreadeServicio..98 Capitulo9.EvaluacinEconmicadelProyecto...99 SeleccinEquiposMineros....103 Conclusin105 BIBLIOGRAFIA106

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 RESUMENEJECUTIVO En el presente informe se logra obtener una estimacin de la evaluacin econmica de la construccin de una planta de lixiviacin en pilas, de la Mina Olivia ubicada en la Cuarta Regin,OvalleenChile.Losresultadossonfavorecidaenlacualesrentableelproyectoconun valor del actual neto superior a los 45 millones de dlares. Se estima una inversin inicial del proyectosobrelos2millonesdedlares. Esta mina se caracteriza por una ley alta de 1.6% de Cu, en la cual se estima su vida til de 9 aosconunaextraccinde540milton/aoenviadoalaplanta. A comienzo del informe se caracteriza la zona dndose a conocer los aspectos ambientales posteriormente se profundiza en la caracterizacin de los aspectos legales y permisos que es necesario cumplir, especificando en detalle los requerimientos para su desarrollo de las pilas delixiviacin,lacualesnecesariounbuendiseoybuenacalidaddelascapasimpermeablesa utilizaryaquepuedeprovocargrandesconsecuenciascomodrenajedeacido. A mediado del informe se especifica el anlisis de laboratorio hidrometalurgias y de procesamiento,lacualnoshapodidoayudarenestimarsucaracterizacinycuantificacinde los tipos de equipos a utilizar; diseo operacional; diseo y construccin de las pilas; cuantificar y especificar los insumos necesarios a utilizar para lograr un eficiente y eficaz estudioensuelaboracindedesarrollo. Este es un gran proyecto, la cual es fundamental la realizacin de anlisis de sondajes para lograr obtener mayor fiabilidad de los registros de datos de las leyes y cuantificando con mayor precisin su reserva y as lograr obtener ayuda de inversionistas extranjeras para lograr suinversininiciallacualesungranmonto. 4

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 INTRODUCCION ElproyectoplantadelacompaamineraOliviaposeecomoactividadcentrallaobtencinde ctodosdecobrecomoproductofinal,dichaminaseencuentraubicada28kmalnortedala plantaOvalle,enelsectorEstacinPejerreyes,comunadeOvalle,provinciadeLimar,cuarta regin,cuyopuntodeinterstienelassiguientescoordenadaUTM: Norte:6.635.400m Este:283.600m Altura:680m.s.n.m CartaIGM:Tongoy El proceso comenzar con la extraccin del mineral desde la mina el cual pasar por tres chancadoras para reducir el tamao de las partculas y se comprobar el estado de estas medianteelcribado, posteriormente el material, con un tamao de partculas ptimo, se verter sobre un silo de material fino para luego pasar al tambor de aglomerado cuya finalidad es la de reducir la cantidad de finos que se encuentra en el material y que dificulta la lixiviacin en pilas. La lixiviacin en pilas ser seguido por un proceso de extraccin por solventes y electro obtencinparafinalmentelograrnuestroobjetivoqueesuncatododecobreconun99,9%de pureza. Paracadaprocesosedescribesuimportanciayademsseincorporasuinfraestructura, estudiosdepruebaenlaboratorioyaspectostcnicosdeconstruccinypuestaenmarchade cadaprocesoyengeneraldelaplantaens. Seincorporaademsaspectosambientalescomotambinaspectosdeprevencinderiesgos paraelfuncionamientoapropiadodelaplanta.

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DESCRIPCIONDELPROYECTO TIPODEPROYECTO El Proyecto "Planta Olivia" se tipifica de acuerdo a la Ley 19.300 de Bases Generales del Medio Ambiente, como proyecto de desarrollo minero y consiste bsicamente en la incorporacin de tecnologaqueimplicabeneficiarmineralespropios. PertinenciadeIngresoalSEIA En conformidad a lo estipulado en el Artculo 10, letra i) de la Ley 19.300 Ley de Bases Generales del Medio Ambiente (LBGMA) y el Artculo 3, letra i) del Ttulo I del Decreto Supremo N 30 de 1997, del Ministerio Secretara General de la Presidencia, que aprueba el Reglamento del Sistema de Evaluacin de Impacto Ambiental (RSEIA), cuyo texto refundido, coordinado y sistematizado fue fijado por el Artculo 2 del Decreto Supremo N 95 de 2001, del Ministerio Secretara General de la Presidencia, los proyectos de desarrollo minero se consideran susceptibles de causar impacto ambiental, por cuanto se enmarcandentrodelsiguienteacpite,descritoenamboscuerposlegales: Proyectos de desarrollo minero, incluidos los de carbn, petrleo y gas, comprendiendo las prospecciones, explotaciones, plantas procesadoras y disposicin deresiduosestriles,ascomolaextraccinindustrialderidosturbaogreda. AnlisisdelaPertinenciadePresentarunEIAounaDIA. De acuerdo al Artculo 18 de la LBGMA y conforme a lo establecido en el Artculo 4 del RSEIA, el titular de un proyecto o actividad comprendida en el Artculo 3 de dicho Reglamento, deber presentar una Declaracin de Impacto Ambienta (DIA), salvo que dicho proyecto genere o presente alguno de los efectos,caractersticasocircunstanciascontempladosenelArtculo11delaLeyyenlosArtculos5,6, 8,9,10y11delmismoReglamento,encuyocasodeberpresentarunEstudiodeImpactoAmbiental (EIA). A objeto de definir la pertinencia de presentar un Estudio o una Declaracin de Impacto Ambiental, se analizanacontinuacinlossiguientesaspectosestablecidosenelartculo11delaLey19.300: a) Riesgo para la salud de la poblacin debido a la cantidad y calidad de efluentes, emisionesoresiduos.

Es posible indicar que en consideracin a la naturaleza y localizacin del proyecto, este no afectar la salud de la poblacin, puesto que se encuentra distante de centros poblados. Los trabajadores que se desempeen dentro del rea industrial minera, debern regirse por lo establecido en el DS N 594 (Condiciones ambientales bsicas en los lugares de trabajo) y DS N 72 mod por el DS N 132 (ReglamentodeSeguridadMinera). b) Efectos adversos significativos sobre la cantidad y calidad de los recursos naturales renovables,incluidoselsuelo,aguayaire. Esposibleindicarquelasactividadesdelproyectonoproducirnefectosadversossignificativossobrela cantidad y calidad de los recursos naturales renovables, incluidos el suelo, agua y aire. Lo anterior en atencinalascaractersticaspropiasdellugar,yaquelazonasecaracterizaporsuextremaaridezypor nopresentarlascondicionesbsicasparaeldesarrolloderecursosnaturalesrenovables

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
c) Reasentamiento decomunidadeshumanas, o alteracinsignificativa de lossistemasde vidas ycostumbresdegruposhumanos. No existe tal riesgo, en el rea de emplazamiento del proyecto, tanto directa como indirecta, incluida susobrasanexas,noexistenasentamientoshumanosquepuedanverseafectadoporlasactividadesdel proyecto. d) Valorambientaldelterritoriosusceptibledeserafectado.

En el rea del proyecto no existe declaracin de zona de proteccin y/o conservacin ecolgica. Las caractersticas propias de lugar en trminos de aridez, nula presencia de cursos de aguas superficiales y escasavegetacin,lerestanvalorambientalalterritorio,enconsecuenciaesposibleindicarqueelvalor ambientaldelterritorionoseverafectadoporlanaturalezadelasactividadesdelproyecto. e) Alteracinsignificativadelvalorpaisajsticoytursticodeunazona.

El proyecto se localiza en una zona, donde predomina la actividad minera. No existen lugares o sitios protegidos por disposiciones legales o tursticas. En general el rea carece de zonas exclusivas o de atractivo turstico, en consecuencia, es posible indicar que el proyecto y sus actividades, no producirn alteracinsignificativadelvalorpaisajsticoytursticodelazona. f) Alteracindesitiospertenecientesalpatrimoniocultural.

En el sitio, no existen monumentos u otros recursos pertenecientes al patrimonio cultural, en consecuencia es posible indicar que el proyecto y sus actividades no producirn alteracin de sitios pertenecientesalpatrimoniocultural. Conclusiones. De acuerdo al anlisis efectuado, las actividades del proyecto no generan ninguna de las consecuencias establecidas en el artculo 11 de la Ley 19.300 de Bases Generales del Medio Ambiente, que hacen exigible la presentacin de un Estudio de Impacto Ambiental, por lo tanto, el proyecto debe ingresar al Sistema de Evaluacin de Impacto Ambiental, mediante la presentacin de una Declaracin de Impacto Ambiental. InversionesyVidatildelProyecto El monto de las inversiones que requiere el proyecto ascienden a una inversin de US$ 10 milln dlares,conunavidatilde9aos. OcupacindeManodeObra. Elproyectoconsideraetapadeconstruccin. CronogramadeEjecucin. Dado que la infraestructura requerida por el proyecto no se encuentra disponible, el proyecto no se encuentra en condiciones de iniciar las operaciones en forma inmediata, una vez obtenida la autorizacinambiental. JUSTIFICACINDELPROYECTO Mina Olivia disponen de aproximadamente 8.000.000 de toneladas de mineral. Las pruebas metalrgicas de lixiviacin realizadas, demuestran la factibilidad econmica y operacional de lixiviarlos medianteunsistemadepilasdinmicas.

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CAPITULO1.
ANTECEDENTESGENERALES UBICACINYACCESO La mina se ubica a 28 km. al norte de la Planta Ovalle, en el sector Estacin Pejerreyes, comuna de Ovalle,provinciadeLimar,Cuartaregin,cuyopuntodeinterstienelassiguientescoordenadasUTM:


RUTAS

Norte: Este Altura: CartaIGM:

6.635.400m 283.600m 680m.s.n.m Tongoy

Encoordenadasgeogrficas: Longitud:71.25233E Latitud:30.39392S

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 PROPIEDADMINERA
La mina Olivia est amparada por la manifestacin Olivia 1/20, la cual se encuentra inscrita a fs 275 vta N179 del registro de Descubrimiento de Minas del Conservador de Minas de Ovalle correspondiente al ao 2002 a nombre de doa Gabriela Camargo Portales y cuya solicitud de mensura estenetapadetrmitedeconstitucindelapropiedadminera.

CatastroMineroMinaOlivia N
OLIVIAI1/9

9
OLIVIAIII1/9 OLIVIAII1/10 OLIVIAV1/7

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
ANTECEDENTESTECNICOS LABORESMINERAS Los laboreos de la mina son rampas tipo rajo que se ubican en el sector NE y en que se realizaron para reconoceryexplotarelcuerpomineralizadoquepresentamayorinters,queprofundizanhastalos6m, estandoaunenlazonadeoxidaciny,otroqueseubicaenelsectorSWyquecorrespondeaunrajode 6x5x3m YACIMIENTO Correspondeauncuerpomineralizadodealomenos5a7m,endondeconvergendosestructurastipo vetade1,2mdepotenciacadauna,derumbogeneralN20Ey55demateoalWlascualespresentan mayor mineralizacin econmica, emplazadas en una formacin de rocas volcnicas andesititas, en parteocotasysedimentariasmarinasfosilferaspertenecientesalosEstratosdeElReloj. MINERALIZACION La mineralizacin econmica son minerales de malaquita y atacamita en la zona de xidos, asociadas a limonitascomogangaycalcopiritaypiritaenlazonadesulfuros MUESTREO Serealizaronunmuestreoilustrativoenelrajodelsectornorteysur,entregandoelsiguienteresultado SEGURIDADMINERA Loslaboreosporsersuperficialesnopresentanmayorriesgodecadaderocas,salvounsectordelacaja W de la rampa N, que por su naturaleza se presenta un poco inestable y se deber dejar pilares correspondientes para asegurar este sector .Los futuros laboreos debern ser construido en lo posible comolaborcerradaytomartodaslasprecaucionesenseguridadminera. PLANODEUBICACION

10

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
UBICACIONYACCESO Las pertenencias mineras Olivia, se encuentra situadas en la IV regin,provincia de Limar, Comuna de Ovalle localizadas a unos 20 km. al norte de la ciudad de homnima y a unos 4 km al oeste de Estacin Pejerreyes Su acceso se consigue por el camino pavimentado que une la ciudad de Ovalle con La Serena, despus un recorrido de unos 20 km. hacia al norte en las inmediaciones de la estacin de ferrocarril de pejerreyes, se toma una bifurcacin hacia el oeste (camino minero) por unos 4 km. accediendo a los laboreosdeminaOlivia

11

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 GENERALDELAREGIONDECOQUIMBO CLIMA


La regin de Coquimbo presenta diversos climas como el Esteprico Costero o Nuboso, de Estepa Clido y Templado Fro de Altura. Es una de transicin, ya que se encuentra entre las zonas desrticas y regin templadamediterrnea. CLIMA ZONADELIMARI EstepaClido Este clima se sita en la parte interior de la regin, por sobre los 800 metros ysecaracterizaporlaausenciadenubosidadysequedaddelaire. Sustemperaturassonmayoresqueenlacosta,lasprecipitacionesnoson tanabundantes ylosperodosdesequasoncaractersticos.


SISMOLOGIA: TERREMOTOSENLAZONA Terremotode1943 El terremoto de Ovalle de 1943 fue un sismo registrado el 6 de abril de 1943 a las 12:07 hora local (16:07 UTC). Su epicentro se localiz en la comuna de Ovalle, Regin de Coquimbo, Chile, y tuvo una magnitudde8,2enlaescalasismolgicadeRichter. Terremotode1997 Aunque el terremoto de Punitaqui tuvo su epicentro en Punitaqui, Ovalle fue muy afectado ya que Ovalle se encuentra a pocos kilmetros; y a gran parte de la Regin de Coquimbo, Chile Hubo varias muertes y casas de adobe derrumbadas. El sismo registrado el 14 de octubre de 1997 a las 22:03 hora local(1:03delda15UTC),ytuvounamagnitudde6,8gradosenlaescalasismolgicadeRichter.

12

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
FLORAYFAUNAGENERAL VEGETACION La vegetacin que presenta la regin se conoce como estepa arbustiva abierta con predominio de la especie espino (acacia caven). Estas caractersticas varan por factores climticos y topogrficos. Es as como podemos observar en las planicies litorales un matorral arbustivo costero poco denso con especiescomocactceas,espinos,yuntapizherbceo. La abundante humedad que se presenta en la costa sur de la baha de Tongoy y al norte del ro Limar permite la subsistencia de los bosques Fray Jorge y Altos del Talinay de categora relictus (residual) del tipo selva valdiviana, con especies como olivillo, arrayn, canelo, boldos, peumos y litres. Al interior de la regin, especficamente al norte de La Serena, se presenta una estepa abierta de acacia caven, baja, dispersa y asociadas a cactceas y hierbas anuales. Hacia el sur aparecen especies mesfilas como boldo,peumo,chaar,molleyalgarrobo. Otras especies caractersticas de la flora en la zona son: varilla brava, guayacn, alcaparras cactus y uvillos visibles al costado del camino, desde el portn de entrada, al pie del cerro. Maitenes, romeros y huiganes y el papayo, en primavera y dependiendo de la cantidad de lluvia cada durante el ao, se puedenveraaucas,azulillos,liriosdelcampoycebollines. FAUNA AnimalescomoLaChinchilla(quehabitadesdeelsurdelaprovincia deChoapahastamsalnortede Atacama),aves,zorros,entreotros;estoesaccesiblepormediodelaCONAF,enelparquenacionalFray JorgeubicadoalsurestedeLaSerena(declaradoreservadelabiosferaporlaUNESCO).Esteparquees de carcter cuaternario antiguo y tiene la caracterstica de que se albergan especies vegetales propias delbosquevaldiviano. Existen otros parques nacionales como Punta del Viento, Talinay (este parque nacional tambin posee plantasdeltipodelbosquevaldiviano),ValledelEncantoyPichasca. La fauna est representada principalmente por aves, tambien se pueden observar perdices, codornices, loicas,tordos,diucas,picafloresytencas. SUELOS El tipo de suelo predominante en la regin de Coquimbo es rido y semirido, los suelos son aridisoles (en los valles interiores) y entioles (en la zona costera). En el sector norte de esta zona, los suelos presentanunhorizontepetroclcico(ricoencarbonatos)enelprimermetrodeprofundidad. En la precordillera, cordillera y sectores altos predominan los entisoles y aridisoles, que son de materialesgruesosyescasosendesarrollo. En la costa sur de la regin (Los Vilos), el suelo es granfico, son alfisoles (con un buen grado de evolucin)einceptisoles(condesarrolloincipiente). RELIEVEREGIONDECOQUIMBO Contiene planicies litorales, desaparece la depresin intermedia y se genera el cordn montaoso que une ambas cordilleras (de la Costa con Andes) de este a oeste. La cordillera de los Andes (est con una altura en promedio de unos 6.000 metros de altura), que genera los tres principales caudales de la regin:elElqui,elLimaryelChoapa.

13

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
SISTEMAHIDROGRAFICO La hidrografa del ro Limar, formado por la confluencia de los ros Hurtado y Grande, se muestra en el mapa 2. El afluente ms importante del ro Limar es el ro Grande (6.537 km2) que aporta un gran porcentajedelcaudaldelroLimar. ElroLimarcuentaconunodelosmejoressistemasderiegodelpascontresembalsesinterconectados que forman parte del Sistema Paloma, que dan a la provincia un gran potencial en cuanto a desarrollo agrcola,capacidadyseguridadderiego.ElSistemaPalomacuentaconlosembalsesLaPaloma,Cogoty Recoleta que en conjunto embalsan ms de un milln de metros cbicos y al mismo tiempo cuenta con canales de gran capacidad (466 canales) que potencian y mejoran las redes de distribucin de este recurso.


EMBALSELAPALOMA La Paloma es un embalse de agua localizado a 27 km al sureste de la ciudad de Ovalle, en la comuna de Monte Patria,Provincia del Limar, Reginde Coquimbo,Chile. Posee unacapacidad de 750 millones de metros cbicos y cubre una superficie de 3000 hectreas.[1] El embalse fue construido entre los aos 1959y1966,siendoinauguradoenelao1968.[2]EmbalsalasaguasdelRoGrandeyRoHuatulame. Es el embalse de riego ms grande de Chile y el segundo ms grande de Sudamrica.[3] Es asimismo el embalse ms grande de la Regin de Coquimbo.[4] En l se puede realizar diversos deportes nuticos, talescomowindsurfokitesurf,ademsdepescadeportiva.[3]SuaccesoprincipalesporlarutaD55.

14

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
TURISMOYARQUEOLOGIA El Patrimonio Arqueolgico de la Comuna de Ovalle, se expresa en la riqueza, calidad y cantidad, de petroglifos, pictografas cermicas y piedras tacitas, muchos de los cuales se encuentran ubicados en sitiosmsticos,talcomoValledelEncanto. PARQUENACIONAL:BOSQUEFRAYJORGE Su singularidad y extraordinaria belleza hacen de este parque un lugar ideal para la observacin de la vida silvestre y para la realizacin de actividades ecotursticas tales como el excursionismo y las del perodo cuaternario, vale decir, que es una muestra de lo que fue l, hoy, desierto de Atacama, el ms rido del mundo, en la ltima glaciacin ocurrida hace ms de 30.000 aos, cuando los bosque hmedos se distribuanhastalatitudesbastantesbajas.

VistadelParqueNacionalFrayJorge BOSQUEDEOLIVILLO
El Parque se encuentra ubicado en la regin del complejo montaoso andinocostero denominado "Altos de Talinay". Las mayores alturas sobre el nivel del mar son el cerro Mozambique (560 msnm), el cerroCentinela(556msnm)yelcerroElViento(667msnm). ElnicorecursohdricodelparqueeselroLimarqueseencuentra a 10 km de la Administracin del Parque. En este parque existe el Bosque Hmedo del tipo Valdiviano, cuya extraordinaria existencia en estas latitudes es causada por la permanente neblina costera da origen a un microclima apto para el desarrollo de olivillos, que canelos, arrayanes, helechos y enredaderas (medallita). Estas especies sepuedenobservarenlossectoresaltosdelareserva.

MONUMENTONATURALPICHASCA Ubicado en las cercanas de Ovalle, cuenta con los vestigios arqueolgicos ms antiguos de la zona, donde es posible apreciar troncos de bosques petrificados, huesos de animales prehistricos como el Antarctosaurio y el Tytanosaurio y rastros de asentamientos humanos de alrededor de 8.000 aos de antigedad. Al avanzar se descubre la "Quebrada La Cantera" con fuerte presencia de piedra laja, y "La Cueva del Diablo" una antigua mina de pique sobre la que existen diversasleyendasrelacionadasconsu"guardin". VALLEDELENCANTO En la zona se encuentra un antiguo asentamiento indgena en el que permanecen importantes vestigios arqueolgicos como petroglifos, pictografas, piedras tacitas o morteros. Este lugar fue descubierto arqueolgicamente en el ao 1946 y fue declarado monumento histrico nacional el5defebrerode1973. ValledelEncantorecibisunombrealconocersediversasleyendasque El dicenqueellugarestaraencantado, Petroglifos: En la superficie de las grandes rocas que conforman el lugar podrs ver gigantes petroglifos. El principal elemento decorativo de los dibujoseslafigurahumanaqueseencuentrageneralmenteenactitudde movimiento. Los rasgos faciales se advierten sealados con crculos y lneasparalosojos,naricesycejas;labocanosedibuja.

15

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 MAPAGEOLOGICO

FIG.2. MinaOlivia
EnelreaestudiadadeEsteaOesteafloranlassiguientesunidades: a)rocasgranticasqueformanelcerroPuntado,encontactoconesteseencuentraunafranjaelongada rocas de rumbo NS, de unos 10 km. de largo del tipo metaandesitas y rocas corneas que en Panulcillo incluyenunlentedecalizasmetamorfoseadas;Kc2enfig.2 b)EstratosElReloj:LosestratosElRelojtienesumayordistribucinymejorexposicinenunafranjade elongacin norte que se extiende por mas de 30 km. desde la confluencia de los ros Grande y hurtado hastalaminaLosMantosdePunitaqui;transversalmenteellaalcanzaunanchomximodeunos8km. LosestratosdeElRelojconsistenenunasecuenciaconstituidaporlavasybrechasandesticas,andesitas congrandesfenocristalesdefeldespatos(ocotas),calizasmarinasfosilferasyareniscasrojas.Kra.YKrb enfig2. Sehaasignadoestenombreaestosestratos,debidoaqueellosconstituyenbuenosafloramientosenel anfiteatro de serranas que rodea el fundo El Reloj, inmediatamente al sur de Ovalle. En esta zona (Corvaln 1066) ha estudiado algunas secciones que corresponden a una parte del espesor de estos estratos determinando su contenido faunstico, lo cual le ha permitido asignar una edad neocomiana a estos. c) Estratos de Tamaya. Los estratos de Tamaya, constituyen la parte estratigrficamente la parte mas baja de la zona de Ovalle. Estas series estratificadas y estn constituidas por lavas andesticas con intercalacionesderocasvolcnicasriolticasytraquticasdecolorcalor.

16

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
GEOLOGIA Las rocas que forman estas serranas en donde se ubican los afloramientos de xidos de cobre corresponden a los estratos de el reloj consisten en la zona en una secuencia constituida por lavas y brechas andesticas, andesitas con grandes fenocristales de feldespato (ocoitas), calizas marinas fosilferasyareniscasrojas,lascualespresentanunfuertemetamorfismodecontacto;locualhacemuy difcilsudiferenciacinmicroscpica,kc2enfign2 GEOLOGIALOCAL EnelreamuestreadaafloraunasecuenciaderocascorrespondientealosLosEstratosdeElReloj,los cuales estn constituidos por lavas y brechas andesticas, andesitas con grandes fenocristales de feldespato(ocotas),calizasmarinasfosilferasyareniscastobas(Kc2.Enfig.n2).Lasquesepresentanun fuerte metamorfismo y metasomatismo de contacto en su contacto por falla con el intrusivo grantico granodiortico del Cerro Puntado, sector de Pejerreyes (Kg.en fig.N2),en las Ocotas se observa una incorporacindeunagrancantidaddemagnetitaysilicatosespecialmenteenlascercanasdelcontacto conelintrusivo,ademsdeclorita,epidota,xidosdefierrocomomineralesdealteracin. Enlazonademuestreo,lossedimentoscalcreossepresentancomograndeslentesentrelascoladasde ocotas y brechas andesticas en los cuales se observa una silificacion intensa; algunos de ellos en pequeas fracturas contienen venillas de cuarzo. En el rea de la mina porvenir es posible observar estossedimentosunpicimejorconservados.Ademsenestemismosectorsepuedeobservarunainter digitacinentrelosflujosdelavaylossedimentoscalcreos. GEOLOGIAECONOMICA De los afloramientos metalizados del rea amparada por las concesiones mineras controladas por la S.M.L. Olivia Primera de Ovalle, slo la mina la Olivia (inactiva) Fig. N4 ha sido explotada superficialmente; habindose extrado hasta la fecha1.726 tons. de cobre soluble conuna ley mediade 1,64 % de Cu sol. Con un consumo de acido de 5,48 k/k (ENAMI 2003).La mina esta hospedada en un lente calcreo en contacto con una colada de ocota muy alterada; secuencia que esta cortada por un pardediquesandesticos. Hoy en da se ha puesto en evidencia que mina Olivia podra corresponder a un yacimiento mayor, considerando que la estructura de veta de rumbo N 20 E y 55 de manteo al oeste, de 5 a 7 mts. de potenciasegninforme(ENAMI2003).Yacimientoenelcual,consuactualdesarrollodeloslaboreosde laminanospermiteestablecerunacorridadealmenos200mts.Estacorridahasidocorroboradaporel estudio de geoqumica de donde se puede apreciar una zona anmala de cobre de una corrida de al menos300mtsdelargoporuso30mts.comomnimo. RESERVAS Considerando la informacin del estudio (Interpretacin geoqumica de mina Olivia Gutierrez y Zozulia 2005),elinformeENAMI2003,loobservadoenterrenoyelconocimientodelyacimientodePanulcillo el cual se hospeda en un ambiente geolgico similar del yacimiento Olivia podemos postular la existenciadeuncuerpomineralizadodelassiguientesdimensiones Corrida 200 mts. Potencia media 3 mts. profundidad 350 mts y una densidad de 2,3 nos da un tonelaje de: 200x350x5x2,3=805.000tonsdemineraldeCuconleyesperadade1,5% Es interesante destacar que la ENAMI con los sondajes del proyecto Delta en la mina Panulcillo encontrmineralizacineconmica100mts.bajoelnivelinferiordeestamina. En la zona sur oeste del rea estudiada, por medio del estudio de Interpretacin Geoqumica de mina Olivia Gutirrez y Zozulia 2005 se ha localizado un rea anmala de unos 1.200 mts de largo por unos 200mtsdeabcgi La cual contendra metalizacin cuprfera detectada en sus extremos norte y sur y su parte central; por lo cual se hara necesaria la ejecucin de una malla geoqumica adicional que permita determinar la continuidady/oconectividaddelossectoresestablecidoscomometalferos

17

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
POTENCIALMINERO A pesar que el estudio de evaluacin geolgica no cubre la totalidad del rea, amparada por las S.L.M OliviasdeOvalle,elpotencialderecursosminerosnoestablecidosaunesimportante.Considerandoque lasanomalasdemineralizacincuprferadetectadasabarcanunaextensindeunos5kms2sepodra esperar encontrar por lo menos unas 5.000.000 de toneladas adicionales de mineral contenidas en uno y/ovariosyacimientostipoSkarn EVALUACIONMETALOGENICADELAREA Elreaestudiadacubreunasuperficiede2,4x1,5km.Estareafuebarridaconunmuestreogeoqumica sistemtica de roca segn una malla de 400x200 m, dispuesta en direccin EW. Se recolectaron 43 muestrasanalizadasporICP30elementosquegenerunamatrizde1.290datosanalticos La interpretacin geoqumica estuvo dirigida a ubicar cuerpos metalferos que han generado anomalas deAs,Ba,B,Cu,K,Th,Uyotroselementosmenores. Porlaposicindeloselementosradioactivos,loselementosmetlicos(Cu,Ah,etc.)loselementosbase (K,Na,Ca),elflujomineralizantevendradesdeelNE,posiblementedesdealgnintrusitoubicadofuera delreaestudiada Considerando la presencia de rocas calcreas es posible que estos flujos hayan dado formacin a cuerpostiposkarn,conmineralizacindeCuconMo,LayBiasociados. Las anomalas de Cu, que cubren un sector importante del rea, son prcticamente la continuacin, hacia el sur, de las anomalas de Th y U y, por lo tanto, indicadoras de una mineralizacin suprgena de xidos de Cu (mina Olivia). La presencia de reservas econmicas de sulfuros (mineralizacin primera o hipgena)enestesector(bajolasanomalasdeCu)espocoprobable. Las anomalas multiplicativas compuestas por Mo, Cu, Fe, Th, Bi y La, forman campos con una seal informativa intensificada, que muestran los sectores metalognicos potenciales , dentro de los cuales pueden existir cuerpos metalferos. En el rea estudiada, estos cambos multiplicativos se ubican: en todoelbordeEsteincluyendolaMinaOlivia,enelsectordelaminaporveniryenelvrticeNW.

18

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CAPITULO2.
ASPECTOSLEGALES Ley 19.300, Artculo 64. Corresponder a los organismos del Estado que, en uso de sus facultades legales, participan en el sistema de evaluacin de impacto ambiental fiscalizar el permanente cumplimientodelasnormasycondicionessobrelabasedelascualesseaprobelEstudiooseaceptla Declaracin de Impacto Ambiental. En caso de incumplimiento, dichas autoridades podrn solicitar a la ComisinRegionaloNacionaldelMedioAmbiente,ensucaso,laamonestacin,laimposicindemultas de hasta quinientas unidades tributarias mensuales e, incluso, la revocacin de la aprobacin o aceptacin respectiva, sin perjuicio de su derecho a ejercer las acciones civiles o penales que sean procedentes. En contra de las resoluciones a que se refiere el inciso anterior, se podr recurrir, dentro del plazo de diez das, ante el juez y conforme al procedimiento que sealen los artculos 60 y siguientes, previa consignacin del equivalente al 10% del valor de la multa aplicada, en su caso, sin que esto suspenda el cumplimiento de la resolucin revocatoria, y sin perjuicio del derecho del afectado a solicitar orden de noinnovaranteelmismojuezdelacausa. El SERNAGEOMIN, como Servicio del Estado con Competencia Ambiental posee atribuciones asociadas directamente a los recursos naturales y mineros del pas, y por lo tanto, participa activamente en la evaluacin de impacto ambiental de proyectos mineros y no mineros que ingresan al Sistema de EvaluacindeImpactoAmbiental(SEIA). EVALUACIONDEPROYECTOSMINEROS Para aquellos proyectos propios de la industria extractiva minera, el D.S. N 95/2001, Reglamento del Sistema de Evaluacin Ambiental, le asigna al Servicio la competencia especfica de dos Permisos AmbientalesSectoriales:enelArtculoN84,elpermisoparaemprenderlaconstruccindetranquesde relaves, a lo cual se refiere el artculo 47 del D.S. N 86/70 del Ministerio de Minera, Reglamento de Construccin y Operacin de Tranques de Relaves1 y en el Artculo N 88 del Reglamento Ambiental, el permiso para establecer un apilamiento de residuos mineros, a que se refiere el Capitulo Cuarto Depsitos de Residuos Mineros en sus artculos 338, 339, 340 del D.S. N 72/85 Reglamento de Seguridad Minera modificado por Decreto Supremo 132/2004 del Ministerio de Minera. Sin perjuicio de los permisos anteriores y de la evaluacin sectorial particular llevada a cabo por el Servicio, son tambin materia de revisin en el contexto del SEIA, todos aquellos aspectos que dicen relacin con la seguridad de las obras e instalaciones para minimizar el riesgo de ocurrencia de daos a las personas y el medioambiente, el control de la contaminacin minera en todas sus formas y la generacinydisposicinderesiduos,paracadaunadelasetapasdelproyecto:construccin,operacin ycierre. Actualmente, referido al D.S. 248 Reglamento sobre Aprobacin de Proyectos de Diseo, Construccin, OperacinyCierredeDepsitosdeRelaves.

19

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
PERMISOSAMBIENTALESSECTORIALES: PAS80,PermisoAmbientalSectorialdelArtculo80 Es el permiso ambiental sectorial para realizar nuevas explotaciones o mayores extracciones de aguas subterrneas que las autorizadas, en zonas de prohibicin, a que se refiere el artculo 63 del D.F.L. 1.122/81, del Ministerio de Justicia, Cdigo de Aguas, los requisitos para su otorgamiento y los contenidos tcnicos y formales necesarios para acreditar su cumplimiento, sern los que se sealan en elpresenteartculo. En el Estudio o Declaracin de Impacto Ambiental, segn sea el caso, se debern sealar las medidas adecuadaspara la preservacin de acuferos que alimenten vegas y bofedales en las regiones indicadas, deacuerdoa: a) Ubicacin de la captacin, expresada en coordenadas Universal Transversal Mercator UTM, identificandolosbienesfiscalesobienesnacionalesdeusopblicoendondeserealizarlaexplotacin, sicorresponde. b) Las aguas a extraer debern haber sido previamente alumbradas, habiendo la captacin al menos atravesadoelniveldeaguasubterrnea. c)Lascaractersticasdelacufero,incluyendosuscomponentesambientalesrelevantesquesesustentan del. d)Elrgimendealimentacindelbofedalovega. e)Elcaudalmximodeaguaquesepretendeexplotar. f) El efecto esperado de las explotaciones o mayores extracciones de las aguas subterrneas, sobre la vegayelbofedal. PAS81,PermisoAmbientalSectorialdelArtculo81 Es el permiso ambiental sectorial para el emplazamiento, construccin, puesta en servicio, operacin, cierre y desmantelamiento, en su caso, de las instalaciones, plantas, centros, laboratorios, establecimientosyequiposnucleares,aqueserefiereelartculo4delaLeyN18.302,LeydeSeguridad Nuclear, los requisitos para su otorgamiento y los contenidos tcnicos y formales necesarios para acreditarsucumplimiento,sernlosquesesealanenelpresenteartculo. En el Estudio o Declaracin de Impacto Ambiental, segn sea el caso, se debern considerar las condicionesquepermitanpreservarelmedioambientelibredecontaminacin. PAS85,PermisoAmbientalSectorialdelArtculo85 Es el permiso ambiental sectorial para ejecutar labores mineras dentro de una ciudad o poblacin, en cementerios, en playas de puertos habilitados y en sitios destinados a la captacin de las aguas necesariasparaunpueblo;amenordistanciadecincuentametros(50m),medidoshorizontalmente,de edificios, caminos pblicos, ferrocarriles, lneas elctricas de alta tensin, andariveles, conductos, defensasfluviales,cursosdeaguaylagosdeusopblico,yamenordistanciadedoscientosmetros(200 m), medidos horizontalmente, de obras de embalse, estaciones de radiocomunicaciones, antenas e instalaciones de telecomunicaciones, a que se refiere el artculo 17 N 1 de la Ley N 18.248, Cdigo de Minera, los requisitos para su otorgamiento y los contenidos tcnicos y formales necesarios para acreditarsucumplimiento,sernlosquesesealanenelpresenteartculo. En el Estudio o Declaracin de Impacto Ambiental, segn sea el caso, se debern sealar las medidas queconvengaadoptarenintersdelapreservacindeloslugaresaintervenir,deacuerdoa: a)Lasvasdeaccesoalasfaenasmineras,transporteymovimientosdevehculos. b)Elmanejoydisposicinderesiduos. c)Lautilizacindeagua,energaycombustibles. d)Larestauracinoreparacindelreaintervenida,enloscasosquecorresponda. e)Tratndosedelaboresdeexploracinoprospeccinminera,deber,adems,considerarse:

20

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
e.1 el reconocimiento geofsico, especificando los mtodos a emplear, tales como magnetomtricos, de polarizacininducida,sistemadeposicionamientoglobaluotros; e.2Ubicacin,caractersticasymanejodepozosdemuestreogeoqumico; e.3tratndosedechips,canaletas,zanjasytrincheras,laespecificacindeltipodemarcacinyelusode marcadoresbiodegradables; e.4tratndosedecatas,ubicacinydimensionamientodelasexcavaciones; e.5 planificacin, caractersticas y manejo de sondajes y plataformas, especificando, entre otros, el uso decarpetasyaditivosbiodegradables; e.6Identificacinymanejodereasdeacopiodemuestras; f) Tratndose de labores subterrneas de exploracin o prospeccin, se deber adems especificar las dimensiones de las galeras de avance y su distancia vertical, desde el techo de la galera hasta la superficie, los sistemas de fortificacin, las reas de acopio de estril, la mineraloga de desmontes y la salidadeaguasdeminas. PAS86,PermisoAmbientalSectorialdelArtculo86 Es el permiso ambiental sectorial para ejecutar labores mineras en lugares declarados parques nacionales,reservasnacionalesomonumentosnaturales,aqueserefiereelartculo17N2delaLeyN 18.248, Cdigo de Minera, los requisitos para su otorgamiento y los contenidos tcnicos y formales necesariosparaacreditarsucumplimiento,sernlosquesesealanenelpresenteartculo. En el Estudio o Declaracin de Impacto Ambiental, segn sea el caso, se debern sealar las medidas queconvengaadoptarenintersdelapreservacindeloslugaresaintervenir,deacuerdoa: a)Lasvasdeaccesoalasfaenasmineras,transporteymovimientosdevehculos. b)Elmanejoydisposicinderesiduos. c)Lautilizacindeagua,energaycombustiblesydiseopaisajsticodelasinstalaciones. d)Larestauracinoreparacindelreaintervenida,enloscasosquecorresponda. e)Tratndosedelaboresdeexploracinoprospeccinminera,deberademsconsiderarse: e.1 el reconocimiento geofsico, especificando los mtodos a emplear, tales como magnetomtricos, de polarizacininducida,sistemadeposicionamientoglobaluotros; e.2Ubicacin,caractersticasymanejodepozosdemuestreogeoqumico; e.3tratndosedechips,canaletas,zanjasytrincheras,laespecificacindeltipodemarcacinyelusode marcadoresbiodegradables; e.4tratndosedecatas,ubicacinydimensionamientodelasexcavaciones; e.5 planificacin, caractersticas y manejo de sondajes y plataformas, especificando, entre otros, el uso decarpetasyaditivosbiodegradables; e.6Identificacinymanejodereasdeacopiodemuestras; f) Tratndose de labores subterrneas de exploracin o prospeccin, se deber, adems, especificar las dimensiones de las galeras de avance y su distancia vertical, desde el techo de la galera hasta la superficie, los sistemas de fortificacin, las reas de acopio de estril, la mineraloga de desmontes y la salidadeaguasdeminas. PAS87,PermisoAmbientalSectorialdelArtculo87 Es el permiso ambiental sectorial para ejecutar labores mineras en covaderas o en lugares que hayan sidodeclaradosdeintershistricoocientfico,aqueserefiereelartculo17,N6,delaLeyN18.248, Cdigo de Minera, los requisitos para su otorgamiento y los contenidos tcnicos y formales necesarios para acreditar su cumplimiento, sern los que se sealan en el presente artculo. En el Estudio o Declaracin de Impacto Ambiental, segn sea el caso, se debern sealar las medidas que convenga adoptarenintersdelapreservacindeloslugaresaintervenir,deacuerdoa: a)Lasvasdeaccesoalasfaenasmineras,transporteymovimientosdevehculos. b)Elmanejoydisposicinderesiduos. c)Lautilizacindeagua,energaycombustiblesydiseopaisajsticodelasinstalaciones. d)Larestauracinoreparacindelreaintervenida,enloscasosquecorresponda. e)Tratndosedelaboresdeexploracinoprospeccinminera,deberademsconsiderarse:

21

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
e.1 el reconocimiento geofsico, especificando los mtodos a emplear, tales como magnetomtricos, de polarizacininducida,SistemadePosicionamientoGlobaluotros; e.2Ubicacin,caractersticasymanejodepozosdemuestreogeoqumico; e.3tratndosedechips,canaletas,zanjasytrincheras,laespecificacindeltipodemarcacinyelusode marcadoresbiodegradables; e.4tratndosedecatas,ubicacinydimensionamientodelasexcavaciones; e.5 planificacin, caractersticas y manejo de sondajes y plataformas, especificando, entre otros, el uso decarpetasyaditivosbiodegradables; e.6Identificacinymanejodereasdeacopiodemuestras. f) Tratndose de labores subterrneas de exploracin o prospeccin, se deber adems especificar las dimensiones de las galeras de avance y su distancia vertical, desde el techo de la galera hasta la superficie, los sistemas de fortificacin, las reas de acopio de estril, la mineraloga de desmontes y la salidadeaguasdeminas. g) Tratndose de labores mineras en covaderas, adems, deber tenerse presente lo establecido en el D.F.L.NR.R.A.25,de1963,delMinisteriodeHacienda. PAS90,PermisoAmbientalSectorialdelArtculo90 Es el permiso ambiental sectorial para la construccin, modificacin y ampliacin de cualquier obra pblica o particular destinada a la evacuacin, tratamiento o disposicin final de residuos industriales o mineros,aqueserefiereelartculo71letrab)delD.F.L.725/67,CdigoSanitario,losrequisitosparasu otorgamiento y los contenidos tcnicos y formales necesarios para acreditar su cumplimiento, sern los que se sealan en el presente artculo. En el Estudio o Declaracin de Impacto Ambiental, segn sea el caso, se debern sealar las medidas adecuadas para el control de aquellos factores, elementos o agentesdelmedioambientequepuedanafectarlasaluddeloshabitantes,deacuerdoa: a) Caracterizacin fsicoqumico y microbiolgica correspondiente al residuo industrial de que se trate. b)Lacuantificacindelcaudalatratar,evacuarodisponer. c)Tipodetratamientodelosresiduosindustrialesymineros. d)Laevacuacinydisposicinfinaldelosresiduosindustrialesymineros,considerando,entreotros,los olores. e) El efecto esperado de la descarga sobre el cuerpo o curso receptor, identificando los usos actuales y previstosdedichoreceptor. f) La identificacin de existencia de lodos, su cantidad y su caracterizacin fsicoqumico y microbiolgica. g)Lascaractersticasdeltratamiento,disposicinoevacuacindeloslodos. PAS92,PermisoAmbientalSectorialdelArtculo92 Eselpermisoambientalsectorialparaejecutarlaboresminerasensitiosdondesehanalumbradoaguas subterrneas en terrenos particulares o en aquellos lugares cuya explotacin pueda afectar el caudal o la calidad natural del agua, a que se refiere el artculo 74 del D.F.L. N 725/67, Cdigo Sanitario, los requisitos para su otorgamiento y los contenidos tcnicos y formales necesarios para acreditar su cumplimiento,sernlosquesesealanenelpresenteartculo. En el Estudio o Declaracin de Impacto Ambiental, segn sea el caso, se debern sealar las medidas adecuadasparalapreservaciny/oproteccindelafuenteocaudalqueseafectar,deacuerdoa: a)Definicindelusoactualyprevistodelasaguas. b) Determinacin de la alteracin que produciran las labores mineras, en los usos previstos de las aguas. c)Caracterizacinfsicoqumicaybiolgicadelagua.

22

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
PAS93,PermisoAmbientalSectorialdelArtculo93 Permiso ambiental sectorial para la construccin, modificacin y ampliacin de cualquier planta de tratamientodebasurasydesperdiciosdecualquierclase;oparalainstalacindetodolugardestinadoa la acumulacin, seleccin, industrializacin, comercio o disposicin final de basuras y desperdicios de cualquier clase, a que se refieren los artculos 79 y 80 del D.F.L. N 725/67, Cdigo Sanitario, los requisitos para su otorgamiento y los contenidos tcnicos y formales necesarios para acreditar su cumplimiento,sernlosquesesealanenelpresenteartculo. En el Estudio o Declaracin de Impacto Ambiental, segn sea el caso, se debern sealar las medidas adecuadas para el control de aquellos factores, elementos o agentes del medio ambiente que puedan afectarlasaluddeloshabitantes,deacuerdoa: a)AspectosGenerales: a.1.Definicindeltipodetratamiento. a.2.Localizacinycaractersticasdelterreno. a.3.Caracterizacincualitativaycuantitativadelosresiduos. a.4.Obrascivilesproyectadasyexistentes. a.5.Vientospredominantes. a.6.Formasdecontrolymanejodematerialparticulado,delasemisionesgaseosas,delaspartculasde loscaminosdeaccesoeinternosquesepretendaimplementar,ydeolores,ruidos,emisioneslquidasy vectores. a.7.Caractersticashidrolgicasehidrogeolgicas. a.8. Planes de prevencin de riesgos y planes de control de accidentes, enfatizando las medidas de seguridadydecontroldeincendios,derramesyfugasdecompuestosyresiduos. a.9.Manejoderesiduosgeneradosdentrodelaplanta. b)Tratndosedeunaestacindetransferencia,ademsdelosealadoenlaletraa),laformadecargay descarga de residuos, el control de material particulado, gases y olores, producto de la descarga de residuos y operacin de la estacin; y residuos lquidos producto del lavado de superficie, as como el escurrimientodepercolados. c)Tratndosedeplantasdecompostage,ademsdelosealadoenlaletraa): c.1.Sistemademanejodelquidoslixiviados. c.2.Sistemademanejodelosrechazos. d) Tratndose de una planta de incineracin, adems de lo sealado en la letra a), el manejo de los residuos slidos, cenizas y escorias y residuos lquidos generados, el control de las temperaturas de los gases de emisin, el manejo de los gases de emisin, y control de la operacin de la planta de incineracin. e)Tratndosedeunrellenosanitarioydeseguridad,ademsdelosealadoenlaletraa): e.1.Sistemadeimpermeabilizacinlateralydefondo. e.2.Controlymanejodegasesovapores. e.3.Definicindelsistemadeintercepcinyevacuacindeaguaslluvias. e.4.Calidadyespesordematerialdecobertura. e.5.Sistemademonitoreodelacalidaddelaguasubterrnea. e.6.Controlymanejodelixiviadosopercolados. e.7.Plandecierre. f)Tratndosedealmacenamientoderesiduos,ademsdelosealadoenlaletraa): f.1.Caractersticasdelrecinto. f.2Establecimientodelasformasdealmacenamiento,talescomoagraneloencontenedores.

23

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
PLANDECIERREDEFAENASMINERAS UnPlandeCierreeseldocumentoenelquesedeterminanlasmedidasaserimplementadasdurantela vidadelaoperacin,conlafinalidaddeprevenir,minimizary/ocontrolarlosriesgosyefectosnegativos que se pueden generar o continen presentndose con posterioridad al cese de las operaciones de una faenaminera,enlavidaeintegridaddelaspersonasquesedesempeanenella,ydeaquellasquebajo circunstancias especficas y definidas estn ligadas a ella y se encuentren en sus instalaciones e infraestructura. Este documento debe ser presentado al SERNAGEOMIN para su aprobacin, antes del 7 de febrero del ao2009,deacuerdoalartculonicotransitorio,delReglamentodeSeguridadMinera(D.S.N72). UnPlandecierredeberincluir,almenoslosiguiente: Desmantelamientodeinstalaciones,sifuerenecesario, cierredeaccesos, estabilizacindetaludes, sealizacionesdeadvertencia, PlantasLIXSXEW El Proyecto de Plan de Cierre de Plantas LIXSXEW y sus Instalaciones Auxiliares deber referirse a lo menosalossiguientesaspectostcnicos: a) Desmantelamientodeinstalaciones,edificios,equiposymaquinarias,cuando b) fuese necesario: Significa el desarme de estructuras, demolicin y retiro de los materiales. Cubrirfundacionesremanentesconestrilesomaterialdeemprstito. c) Des energizar instalaciones: Cortar suministro elctrico. Retiro de cables conductores y postaciones.Retirodegeneradores,transformadoresyotrosequipos. d) Cierredeaccesos:Bloquearelpasodevehculosy/opeatones.Construccindemuros,pretiles oTerraplenes,cuandocorresponda. e) Estabilizacin de taludes: Dejar estables los taludes de las obras o nivelaciones que fueron necesariohacerparalaconstruccinyparaelcierredelasPlantasdeProcesamiento. f) Sealizaciones: Instalacin de letreros o seales que indiquen lo que alguna vez oper en esa reaylaindicacindepeligro,siserequiere. g) Retiro de materiales y repuestos: Retirar todo los elementos de desecho y envo a algn lugar dereciclajeodepsitoautorizado. h) Proteccin de estructuras remanentes: Aquellas estructuras o instalaciones que por alguna razn justificada permanecern en el lugar debern ser protegidas y reforzadas, evitando su deterioro. PilasyDepsitosdeRipiosdeLixiviacin: ElProyectodeCierredePilasyRipiosdeLixiviacindeberreferirsealomenosalossiguientes aspectostcnicos: a) Construccin de diques interceptores y canales evacuadores de aguas lluvia: Estas obras se requieren para impedir que lluvias o escorrentas superficiales inunden y debiliten estas estructuras. b) Estabilizacindetaludes:DejarestableslostaludesdePilasyDepsitodeRipios. c) Coberturas:Cubrimientoconestrilesysuelonatural,uotrosmateriales. d) Nivelacin:Compactacinydefinicindependientesdesuperficie. e) Lavado de ripios: Dejar los ripios neutralizados o con un sistema de captacin de drenajes y evaporacin.

24

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Deber considerarse adems, cuando corresponda, otros aspectos relativos al Cierre de Faenas, tales como: Evaluarloscaminosquesedejarntransitablesyloscaminosquedebensercerrados. Retiroydisposicinfinalderesiduos. Retirodeescombros. Disposicinfinalyestablederesiduosminerosquepermanecernenellugar. COMPONENTEYDESCRIPCIONIMPACTOAMBIENTAL SUELO Hayquetenerespecialcuidadoconeldrenajecidoquesepuedegenerareldrenajeseformadebidoa la oxidacin de minerales que contienen azufre, principalmente pirita (FeS2) y pirrotita (Fe 1x S), que expuestosalaireyaguareaccionanformandocidosulfricoyhierrodisuelto.Partedelhierrosepuede precipitarformandoenelfondodeloslechosunacaparoja,naranjaoamarilla,quecontieneeldrenaje delamina.stospuedenllegaralsueloysubsueloypodrancontaminarelsector. Los problemas ambientales asociados al drenaje cido son variados y dependen del componente del medioambienteenqueseemplacen;engeneral,perduranenellargoplazo. Entrelosproblemasasociadosalosefectosespecficosseencuentranlainterrupcindelcrecimientoy reproduccindefaunayfloraacutica. Daoalosecosistemas(cadenastrficas,comunidades,otros) Enalgunoscasos,contaminacindelasfuentesdeaguapotable Efectoscorrosivosenlasbasesdelospuentes VEGETACION En el norte del ro Limar se encuentra los bosques Fray Jorge (declarado reserva de la biosfera por la UNESCOyAltosdelTalinay,lacualseencuentraunagrancantidaddeespeciesdeplantas,arbustosetc FAUNA En este caso el impacto ambiental que puede generar es sobre los animales como La Chinchilla (que habitadesdeelsurdelaprovinciadeChoapahastamsalnortedeAtacama),aves,zorros,entreotros SOCIOCULTURAL En este aspecto el impacto ambiental que se puede generar en el tema cultural es que cerca del sector donde se va a instalar la planta, se encuentra el Monumento natural de Pichasca, ubicado en las cercanasdeOvalle,cuentaconlosvestigiosarqueolgicosmsantiguosdelazona. Al avanzar se descubre la "Quebrada La Cantera" con fuerte presencia de piedra laja, y "La Cueva del Diablo" una antigua mina de pique sobre la que existen diversas leyendas relacionadas con su "guardin".

25

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DEREECHODEAGUAYDATOSDEIMPACTOAMIENTAL Consumodeagua Elconsumodirectodelaguaenlamineradelcobre,oro,plata,zinc,aceromolibdeno,plomoynquel, seconsideraelusoindirectodelagua,lacual,seutilizafundamentalmenteenelprocesotradicionalde concentracinporflotacin,seguidodefusinyelectrorefinacin,oenelprocesohidrometalrgicoel queconstadelixiviacinextraccinporsolventesyelectroobtencin. Elaguadeconsumohumanoesfundamentalmenteparabebida,coccin,lavado,riego,ybaos.Los datosdisponiblesindicanqueestacantidaddeconsumohumano,varaentre130y200litrosporda porpersona(BechtelChile,1997).Estacantidadrepresentausualmentemenosdel1,5porcientodel aguaconsumidaenunaempresaminera. Enlamineraelaguaesusadaprincipalmentecomomediodetransporteendosprocesosmetalrgicos: Flotacintransportederesiduosymineral Lixiviacintransportedelcidoydelasolucinenriquecida Otros:procesosdemolienda,abatimientodepolvo,instalacionessanitariasyaguapotable Consumodeaguaenminera Consumo=1.238.356m3/da Consumounitarioplantaconcentradora=0,99m3/tonmineral Consumounitarioplantahidrometalrgica=0,20m3/tonmineral Consumounitariootrosprocesos=0,10m3/tonmineral Consumopromedio=0,75m3/tonmineral Consumopromedio=97,3lts/kgCufino Permisosyconsideracionesparaestudiodeimpactoambiental,entreotros 1.FactoresRelevantesdeControldelaCantidadyCalidaddelRecursoHdrico BalanceHdricoenProcesosdeConcentracinyLixiviacin Optimizacindetecnologasdedisposicinderelavesyrecuperacinde aguaenlaplanta(recirculacindeaguasclarasentranquesderelaves, reciclajedeaguasdedescartes,etc.) PrevencindecontaminacindeAcuferosyCursosdeAguaSuperficial porgeneracindeAguascidas:Mina,DepsitosdeEstriles,Minerales BajaLey,TranquesdeRelaves,PilasdeLixiviacin SegregacindeFlujosdeAguasLimpiasdelosContaminados 2.FuncionesdeSERNAGEOMINenHidrogeologa ConfeccindelaCartaGeolgicadeChileycartastemticas. Estudiodelosfactoresgeolgicosquecondicionanel almacenamiento,escurrimientoyconservacindelasaguassubterrneas,vaporesygasessubterrneos (energa, geotermia). Desarrolloyaplicacin,dentrodelcampodelageologa,delasinvestigacionescientficasy tecnolgicasquepuedancontribuirdirectaoindirectamentealdesenvolvimientoeconmicodel pas(ej:geologaambiental).

26

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Lossiguienteselementosy/ocompuestosqumicosresultantesoutilizadosenlas actividadesdelprocesosminero,sonpotencialmentecontaminanteshdricos: Acidos Metalesensuformadeionestalescomocobre,plomo,zinc,nquel,fierro, arsnico,cadmio Cianurodesodio(enlamineraaurfera) Reactivosqumicos: Acidos(H2SO4,cidosulfurico) Alcalis Espumasycolectores Modificadoresejemplo:cianurodesodioNaCN,sulfatodesodioNa2SO3 Floculantesycoagulantes,(ejemplo:salesdealuminioyfierro). Compuestosdenitrgeno,provenientesdelasvoladuras(dinamitaje) Aceitesypetrleousadoenlalubricacinycombustible. Slidossuspendidos,provenientesdelaguadelamina,efluentes,otros. INDENTIFICACIONDELOSPRINCIPALES CONTAMINANTESATMOSFERICOS Dentrodelosprincipalescontaminantesatmosfricossepuedenmencionar: Materialparticulado(polvoengeneral),cuyacomposicinessimilaraladelos elementosquecomponenlosslidossuspendidosdelosefluenteslquidos. Latoxicidaddelpolvodependerdelaproximidaddelosreceptoresambientalesy deltipodemina.Altosnivelesdearsnico,plomoyradionucleidostiendenaserlos mspeligrososparaelmedioambiente. Gasesproducidosporactividadestalescomodinamitaje,combustininternade motoresdiesel.Entreellos,monoxidoydioxidodecarbono,xidosdenitrgeno, dixidodeazufre(SO2). Uncasoaparteloconstituyelacontaminacinatmosfricapor(dixidodeazufre SO2),provenientedelasfundicionesdelmineral.Aunquepartedelaactividad minera,stapuedeserunaactividadaislada. 26 TIPODEMATERIALPARTICULADOYSUSFUENTESDEEMISION Elmaterialparticuladoquepermaneceenlaatmsfera,entrminosdetamaoseclasificacomosigue: <0.1mm:aerosolesproducidosporelprocesodecombustin 0.1mm1.0mm:formadosporcondensacindelvapor >0.1mm:partculasdepolvoprovenientesdelapulverizacin Elmaterialparticuladoesunodelasmayorespreocupacionesenlacontaminacin atmosfricaexternarelacionadaconlasfaenasminerasylosconcentradores.sta provienededosfuentes: Puntosofuentesdefcilidentificacin(fuentesfijas) Fuentesfugitivasodispersas

27

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DRENAJEACIDODEMINA Unodelosproblemasmsimportantesdelaminera,ymsdifcilesderesolver,esel referidoaldrenajecidodelamina,quepuedeemanardesdediferentesactividades ylugaresdelamina.Entreellos: Trabajosenlasuperficieysubterrneos Desechosrocosos(provenientesdelaplantachancadora) Sitiosdeacopiodeestrilesprovenientesdelamoliendauotro Desechosprovenientesdeembalsesderelave,flotacin,otros. El drenaje se forma debido a la oxidacin de minerales que contienen azufre, principalmente pirita (FeS2) y pirrotita (Fe 1x S), que expuestos al aire y agua reaccionan formando cido sulfrico y hierro disuelto. Parte del hierro se puede precipitar formando en el fondo de los lechos una capa roja, naranja o amarilla,quecontieneeldrenajedelamina. REACCIONESQUMICASINVOLUCRADASENDRENAJECIDO Aunqueesunprocesocomplejosepuedesimplificaren: 2FeS2+7O2+2H2O2Fe2++4SO42+4H+(etapainicial) FeS2+14Fe3++8H2O15Fe2++2SO42+16H+(etapafinal) PROBLEMASAMBIENTALESDERIVADOSDELDRENAJEACIDO Losproblemasambientalesasociadosaldrenajecidosonvariadosydependendelcomponentedel medioambienteenqueseemplacen;engeneral,perduranenellargoplazo. Entrelosproblemasasociadosalosefectosespecficosseencuentranlainterrupcindelcrecimientoy reproduccindefaunayfloraacutica. Daoalosecosistemas(cadenastrficas,comunidades,otros) Enalgunoscasos,contaminacindelasfuentesdeaguapotable Efectoscorrosivosenlasbasesdelospuentes FORMASDECONTROLDELDRENAJEACIDO Unadelasmejoresdefensascontraeldrenajecidoesprevenirqueelmaterialquepuedegenerarlo entreencontactoconelaireyelagua,porqueunavezquelareaccincomienzaescasiimposible detenerlaycontinuarporvariasdcadas. Elcontroldelageneracindecido,sepuedehaceratravsdelaremocindeunoo msdeloscomponentesesenciales,azufre,aire,agua. Algunasformasdecontrolson: Separacindelosdesechosymezcla.Enesenciasetratademezclarlarocageneradoradecidocon otrotipoderoca,cuyacomposicinseaneutralizadora,creandounphneutro. Aditivosbase.Materialalcalino,talescomocaliza,cal,cenizadesodapuedenser agregadosalarocasulfurosa,conelfindeamortiguarlasreaccionesproductorasdecido. Cubrimientos.Tierra,arcillaycoberturassintticaspuedenserpuestassobrelarocageneradorade cido,conelfindeminimizarlainfiltracindeaguayaire. Bactericidas.Laintroduccindeciertosqumicosquereducenlabacteria(thiobacillusferrooxidans) quecatalizalasreaccionesdelageneracindecidohasidoprobado comoefectiva. Coleccinytratamientodeloscontaminantes.Setratadecoleccionareldrenajecido

28

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
ysometerloatratamiento,atravsdemtodospasivosoactivos. ABANDONOYREHABILITACION SEDEBEIDENTIFICARASPECTOSRELEVANTESDELABANDONOYREABILITACINDELTERRENO OCUPADOPORLAEXPLOTACINDEUNAMINAYSUSRELACIONESCONELMEDIOAMBIENTE. PRINCIPALESPREOCUPACIONESAMBIENTALESDELABANDONODELAMINA Cuandolaoperacindeunaminallegaasutrmino,diversasmedidasdebensertomadasconelfinde protegerlaseguridaddelaspersonasylosdistintoscomponentesdelmedioambiente,entreellosagua, suelo,fauna,aire. Algunosdelosproblemasquerequierencontrolson: Controldeldrenajecido(provenientesdedistintasactividadesysectoresdelamina) Estabilizacindelaspilasdedesechos(estriles,finosychancados) Controldelasedimentacin Estabilizacinycontrolderelave Controldehundimientos(enparticulardelaminerasubterrnea) Enlaactualidadmuchasfaenasminerashanincorporadounplandecierreyabandonodurantelaetapa activadelamina,comounaformadeenmendarantiguoserrores,ydaosalmedioambiente. REHABILITACIONDETERRENOSYSUELOSOCUPADOSPORLAEXPLOTACIONMINERA Larehabilitacinorecuperacin(landreclamation),esunprocesodetratamientodelsueloocupadopor laexplotacinmineraquetiendeaminimizarladegradacindelrecursoagua,lacontaminacindelaire, el dao a la fauna acutica y terrestre. Tiende adems a evitar la erosin, los aluviones y otros efectos adversosquepuedenprovocarantiguasactividadesdelaexplotacinminera. El objetivo es que el suelo, o el lugar en s, pueda ser recuperado y sea factible desarrollar diferentes actividadessegnseanlascaractersticasdelterrenoeinteresessociales. Este proceso se puede extender a los suelos directamente impactados por la explotacin de la mina, y tambinaaquellaszonasindirectamenteafectadas. ACTIVIDADESRELACIONADASCONLAREHABILITACIONDETERRENOSYSUELOS Aunquelarehabilitacindelterrenoysuelosocupadoporlaexplotacindeunaminadependerde factorespropiosalemplazamientodesta,talescomogeologadellugar,clima,topografa,hidrologa, asentamientoshumanosyotros,algunasetapassoncomunes,variandoslolaformaenqueserealizan. Entreellassecitan: Nivelacindelterreno Rellenodelaslagunasdedescargadedesechos Retirodelosdesechos Controldeldrenajeyrecoleccindelmismo Recubrimientodelterrenoconsueloapropiado(uotromaterial)conelfindecontrolarelpolvoy reducirlainfiltracin. Revegetacinsobreelsubastratodesuelo,elcualprotegecontralaerosin.

29

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
PRINCIPALESOBJETIVOSDELAREVEGETACIONCOMOPARTEDELAREHABILITACION Revegetarunterreno,significadevolverlelascondicionesecosistmicasquepotencialmentelodejaran aptoparaotrosusos.Paraloscasosderehabilitacinlosobjetivosderevegetarsepuedenresumiren: Estabilidaddelsuelo(oterreno)alargoplazoqueloprotegecontralaerosinhdricayelica Reduccindelalixiviacinatravsdelterreno Disminucindelacantidaddeelementostxicosvertidosencursosdeaguasyaguassubterrneas Desarrollodeecosistemasacordesalmediocircundantequesirvaparalarecolinizacindeespecies. 37 CONDICIONESPARAELCUMPLIMIENTODELOSOBJETIVOSDEREVEGETACIN Elprimerobjetivorequieredeunacontinuarevegetacin,quecubreel100%delsuelo.Eslanicaforma deevitarquelaerosincomience. Laefectividaddelsegundoobjetivodependedelclimaydelcomportamientodelaevapotranspiracin comoformadecontroldelalixiviacin.Estoesvlidoparaeltercerobjetivo Elcuartoobjetivoestasociadoalaplanificacinpreviarespectoaculserelusodelarehabilitacin. DESECHOSMINEROSYSUSLIMITANTESPARALAREVEGETACION Losprincipalesproblemasdelosdesechosminerosrelacionadosconlasactividadesderevegetacin estnrelacionadosconnecesidadesdeestructuradesuelo,aguaynutrientes,querequierecualquier tipodevegetacinparapoderdesarrollarse. Enelprimercaso,losdesechosestriles(relavesenparticular),presentanuntipodepartculascasi uniformeymuypequeas(<0,04mm).Estoseasociaaunadesfavorableporosidad,aireacin,nivelde infiltracinypercolacin,todosfactoressignificativosparaelcrecimientodelavegetacin. Otraimportanteconsideracindelosdesechosminerosparalavegetacinesqueensumayora, presentanunamuybajaconcentracindenutrientesesencialesparalasplantas,talescomonitrgeno, fsforo,potasio,calcioymagnesio. Otrofactornegativoeslapresenciademetalestxicos(metalespesados),talescomoplomo,cobre, cinc,cadmio,muchosdeloscualessontxicosparalasplantas. DerechosdeAgua Deacuerdoalainformacinrecabada,elmontototaldederechosconsuntivosdeaguadelsector minero,paralasregionesindicadas,alcanzaa30,7m3/s(metroscbicosporsegundo),deloscuales13 m3/s(42%)correspondenaderechospermanentesyeventualesdeaguasuperficialy17,7m3/s(58%)a derechospermanentesyprovisionalesdeaguasubterrnea. Losderechospermanentesdeaguassuperficialesysubterrneasalcanzanunmontoestimadode24,7 m3/s,representandoun80%delosderechosconsuntivostotales.Elsectorminerocuenta,adems,con 76,8m3/sdederechosnoconsuntivosdeagua,deloscualesun91%y8%hansidootorgadosenla RegionesVIyVrespectivamente. LaIIReginconcentrael33%delosderechosconsuntivosdeaguadelsectorminero,seguidadelas RegionesIVyVI,con17%y16%respectivamente;luegoseubicanlasRegionesIIIy1XVRegin:Regin AricayParinacota

30

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Derechos,ExtraccionesyTasadeConsumodeAguaSectorMineroRegionesCentroNortedeChile DivisindeEstudiosyPlanificacinDGA3 I,con13%y10%respectivamente,ylaReginMetropolitanayVRegin,con6%y5% respectivamente. En las Regiones I, II y III predominan los derechos de agua subterrnea por sobre los derechos de agua superficial, destacndose la I Regin, donde ms del 97% de los derechos consuntivos son de agua subterrnea, seguidade la IIReginconcerca del 91%. En las dems regiones predominan los derechos de agua superficial por sobre los derechos de agua subterrnea, destacndose la VI Regin, donde ms del93%delosderechosconsuntivossondeaguasuperficial,seguidadelaIVReginconcercadel70%. El total de derechos consuntivos de agua informados por las empresas mineras es mayor en un 12,5% respecto de la informacin disponible en el Catastro Pblico de Aguas de la DGA. Esta diferencia se atribuye, en parte, a que algunos derechos de agua no estaran inscritos a nombre de las empresas mineras, y tambin a que el catastro podra no estar completamente actualizado. En todo caso, la diferenciaidentificadanoresultasignificativaparaefectosdelpresenteestudio. TasaUnitariadeConsumodeAgua Elconsumounitariodeaguafrescaenlosprocesosdebeneficiodemineralesdecobre, incluyendo concentracin (flotacin) e hidrometalurgia (lixiviacin, extraccin por solventes y electro obtencin) presenta una marcada diferencia entre procesos y condiciones operacionales de las faenas mineras.Latasadeconsumo,expresadaenmetroscbicosdeaguafrescaporcadatoneladademineral procesado (m3/ton), alcanza un valor promedio de 0,79 para los procesos de concentracin y de 0,13 paralosprocesosdehidrometalurgia. Latasadeconsumodeaguafrescaenlosprocesosdeconcentracinfluctaenunrangoampliode0,3a 2,1 m3/ton. Los valores ms altos corresponden a operaciones en que no es posible recircular las aguas desde los depsitos de relave. Por su parte, la tasa de consumo de agua fresca en los procesos de hidrometalurgiafluctaenunrangode0,08a0,25m3/ton.

31

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Camin Minero

DIAGRAMADEFLUJO

PilasdeLixiviacin (EtapadeRiego)

Harnero CH.1ario

CV012

PiscinadeRefino Stockpile

CV01 1


CH.2ario Harnero

CV022

CV021

PiscinadealimentacinaplantadeSX

EtapadeextraccinE1 Tanquede orgnicocargado

CV032 CV031 CV042


Harneros

EtapadereextraccinS1

EtapadeextraccinE2

CH.3ario

Silodemineralfino

Tambor Aglomeradores CorreaStaker Radial

CV041
Correaderecoleccinde Aglomeradores

CATOD0

Tanquerecirculacin electrolito CeldasElectrowinning

32

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CAPITULO 3. DISEOUBICACINPLANTAMINAOLIVIA N


Dentrodeestesectorseleccionamoslazonamsptima(cuadrorojo)debidoaqu: Lazonaseencuentraconunrelieveplano,esdecir,noseencuentrarelievesbruscos. Seencuentracercadelcaminolacualfacilitaraeltransporteycarguo. Seencuentralomsalejadodelasquebradaslacualimplicaraunimpactoambientalenmenor cantidaddebidoaquesepuedeproducircontaminacindelasaguasproductoaldrenajede acido.
OLIVIAIII 1/9 OLIVIAII1/10 OLIVIAI1/9

OLIVIAV1/7

Recomendamos realizar una concesin de servidumbres en este sector (cuadro azul) en la cual seria las instalaciones para la planta, ya que queda entre medio de las pertenencias siendo el punto optimo, la cual tiene una superficie aproximadamente de 100 hectreas y no se encuentra constituida. SupuntomediotienecoordenadasUTM: N6635400m,E283530m.

33

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DISEODEUBICACIN Enlazonaseleccionadasedefinilaubicacinenlacualsevaainstalarlosequiposminerosparaelprocesamientodelosminerales,laspilas,piscinasylosbotaderos,enlacual se busco de manera que no est dentro del permetro de las areas verdes donde se encuentra una mayor cantidad de vegetacin para disminuir la contaminacin hacia las plantasoarboles.

N AREASERVICIO (INSTALACIONDEENERGIA) AreadelazonadeProcesamiento:43mx33m. AreadelasPilas:160mx160m;AreadelosBotaderos:190x300

AREASERVICIO (TAMBORDEAGUA) AREAPISCINAS

34

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 DESCRIPCIONGENERALDELAZONADEPROCESAMIENTO. El mineral de mina es descargado en la cmara del harnero


primario por camiones, si hay rocas grandes un pica rocas las oacomodaauntamaomenora200mm. quiebra El chancador primario marca JOYAL reduce el mineral de 200mmauntamaomenor,descargndoloporunharnerode conuntamaodel30%<100mm,posteriormenteuna control correa alimentadora extrae el mineral a razn de 62,5 t/h y lo transfiere alacorreaCV01paradescargarloenunstockpilede 500toneladasdecapacidad. El mineral grueso es extrado del stockpile por correas alimentadoras estransferidoalacorreaCV02paradescargarlo en un harnero secundario, el bajo tamao es descargado directamente enlacorreaproductodemineralfino.

CAPITULO4.


El sobre tamao de los harneros con tamaos mayores a 50mm constituye la carga circulante es transportado por la correa CV02.3CV02.4CV02.5 Y CV02.6 para descargarlo a razn de 62,5 t/h al chancadorsecundariode62.5toncapacidad,posteriormentelascorreasalimentadorasseencargande extraerelmineralydescargarloalchancadorterciariodeconodemarcaJOYAL. Elmineraltrituradoconunagranulometramenora30mmy7mmsedescargaenlosharneroterciario yharnerocuaternariorespectivamentearaznde62,5t/h. El sobre tamao recirculaa chancadoterciario y el bajotamao con unagranulometramenor a 13mm y7mmaraznde62,5t/h. El producto final de mineral fino es almacenado en el silo a razn de 62,5 t/h para el proceso de aglomeracinlixiviacin.

35

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CRITERIOSDEDISEO
CRITERIOSOPERACIONAL DESCRIPCION UNIDADES d/ao d/semana HORARIOSOPERACIONAL h/d turno/dia h/turno DISPONIBILIDAD % TIEMPOOPERATIVONETO h/ao CARACTERISTICASMINERALOGICAS DESCRIPCION TIPO CovelitaCus BornitaCu2FeS4 Cusolubleenacido%tipiciodelCuTotal MineralOxido Analisis HumedaddelMineral Mina AngulodeReposo AngulodeExtraccin Abrasividad Crisocola Cusolubleenacido%tipiciodelCuTotal CuTotal Promedio Medio VALOR 355 7 24 2 12 85 7242

CalcopiritaCuFeS2 MineralSulfuro

UNIDADES % % % % % % % % grados grados

VALOR 50 70 1.6 1.2 35 60

Adherencia MedioAlto ReferenciaClculodeSuperficiedeCribasJuanLuisBOUSO SUPERFICIEDECRIBADO FactordeDensidad FactordeRechazo FactordeSemitamao FactordeEficiencia FactordeHumedad FactorFormaMalla FactorPosicinPao FactorInclinacinCriba FactorreaLibrePaso FactorTotalCorreccin AnchuraMnimadeCriba(mm) CapacidadBsica(t/m.h) CapacidadBsicaCorregida(t/m.h) TonelajePasanteMalla(t/h) SuperficieNecesaria(m) AnchoCriba(mm) LongitudCriba(mm) fd fr fs fe fh fm fp fi fo ft Am B Bc Tp S A L Pao1. 1.10 1.09 2.20 1.00 1.00 1.00 0.90 1.00 1.10 2.61 100 56 146.24 62.5 0.43 413 1034 Pao2. 1.10 1.09 2.20 1.00 1.00 1.00 0.90 1.00 1.05 2.49 50 39 97.22 62.5 0.64 507 1268 Pao3. 1.10 1.09 2.20 1.00 1.00 1.00 0.90 1.00 1.00 2.37 13 17 40.36 62.5 1.55 787 1968 Pao4. 1.10 1.09 2.20 1.00 1.00 1.00 0.90 1.00 0.90 2.14 7 10.8 23.08 62.5 2.71 1041 2602

36

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
SISTEMADECHANACDORPRIMARIOAUTILIZARDEMANDIBULA. El sistema de chancador primario es la primera etapa de la operacin de la planta sin embargo es la segunda etapa reduccin de tamao, posterior al minado. La operacin de chancado consiste en la reduccin del tamao de rocas grandes a ms pequeas utilizando fuerzas de compresin, friccin, flexin, cizallamiento u otras en menorproporcinquepermiten reducir el mineral que viene de la fase de minado pasando por un harnero de control y termina con la entrega de un producto cuya granulometraes30%<100mm.

Considerandolasvariables: E=90%,=80%<100mm 62,5T/h,30%<100mm


Modelo Tamaodeapertura dealimentacin (mm) Max.Tamaode alimentacin(mm) Rangodesalida ajustableTamaode (mm) Capacidad(t/h) Potenciademotor (kW) Peso(t) GeneralDimensin (mm) PE500750 500750 425 50100 40100 4555 11,2 203519212000

62,5T/h ShanghaiJoyalMiningMachineryCo.,Ltd

Es utilizado para la trituracin primaria y secundaria de rocas duras, tenaces y abrasivas, as como materiales arcillosos. Producto relativamente grueso con planos de separacin o lajas. El volante hace uniformeelconsumodepotencia.


Lascaractersticasdelatrituradorademandbula: Altorendimientodetriturar Lagranularidaddelosproductosesbien uniforme. estructurasencilla,estableyfiable fcilreparacin

Laintensidadresistentedelmaterialobjetopuedealcanzar320MPA. Laatencindelatrituradorademandbula: La trituradora de mandbula debe examinar cada parte de los sujetadores antes de usar, especialmente lapartelubricantesylosministeriospernos,laquenecesitamantenersuficientepetrleoylosquedebe fijarbienlospernos. Luegolimpiarelrestodelacavidadrotoempiezaafuncionar.

37

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
SISTEMADECHANACDORSECUNDARIO El sistema de chancado secundario es una operacin de conmunicin que reduce y acondiciona el tamaodelmineralproductodelchancadoprimariomenora100mmauntamaomenor50mmelcual esentregadoalsistemadechancadoterciario.

Considerandolasvariables: E=90%,=80%<50mm F=0,9x62,5x0,3=16,875T/h 62,5T/h,30%<100mm Ro=62,5F=62,516,875=45,625 Rn=45,625/(0,8x0,9)=63,37T/h Usa como flujos auxiliares la energa elctrica, aire comprimido, agua fresca y recuperada para el proceso. Desecha agua con finos, material particulado al medio ambienteyruido. Estesistemaconstade: recuperacindemineralgruesodelstockpile Harneado conmunicinsecundario

62,5T/h

CHANCADORSECUNDARIOAUTLIZARDEMARTILLO Se caracterizan por tener una parilla de barras cubriendo la salida. Las que hay de muchas formas. La mayora de la fractura se efecta por impacto y con friccin. Se utiliza para la trituracin primaria, secundariayterciaria,paraformascubicasymximodefinos.Esptimaparaunaalimentacinnodura niabrasiva. La chancadora de martillo aprovecha la alta velocidad de rotacin contra las materiales para romper. Tieneunaestructurasimpleyunaaltaeficiencia. Modelo Max.Alimentacin Tamao(mm) SalidaTamao(mm) PC1000800 200 <30


ShanghaiJoyalMiningMachineryCo.,Lt

Potenciademotor (kW) Capacidad(t/h) Peso(t)

110 1665 8,1

38

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
SISTEMADECHANACDORTERCIARIO. El sistema de chancado terciario es una operacin de conmunicin que reduce el tamao de mineral producto del chancado secundario de 50mm a un tamao menor 30mm el cual es entregado al sistema deaglomeracin. Reduce el tamao del mineral que viene del sistema de chancado secundario con una granulometra 30%< 30mm correspondiente al producto del chancador secundario , y termina con la entrega de un producto de mineral fino con un tamao menor a 7mm correspondiente al harnero terciario hacia el sistemadeaglomeracin. Elmineralmayora13mmrechazadocorrespondientealsobretamaodelosharnerosterciariosretorna al circuito como carga circulante para ser reducido nuevamente en los chancadores terciarios hasta alcanzar la granulometra adecuada. Usa como flujos auxiliares la energa elctrica, aire comprimido, agua fresca y recuperada para el proceso. Desecha agua con finos, material particulado al medio ambienteyruido.

Estafaseconsta: recepcinyalmacenamientodemineralaharnerosterciarios harneadoterciario recepcinyalmacenamientodemineralalchancadorterciaria conmunicinterciaria almacenamientodemineralfino Considerandolasvariables:

E=90%,=80%<100mm F=0,9x62,5x0,3=16,875T/h 62,5T/h,30%<100mm Ro=62,5F=62,516,875=45,625 Rn=45,625/(0,8x0,9)=63,37T/h

62,5T/h A:62,5T/h F1 F2

La chancadora trabaja en circuito cerrado con una criba de 2 cubiertasconaberturasde13mmy7mm.Laalimentacinfresca de 62,5 ton/h ingresa a la chancadora con un 30%<13mm, saliendo un producto chancado que contiene 85% de tamaos menores a 13mm.La primera criba rechaza el 20% de la alimentacinfresca.

At=Afresca+R1=62,5+62,5x0,20=75T/h E=Ff/(Aa)=62,5x1/(75x0,85)=0,98,E=98% Rn E=f(ar)/(a(fr)),0,98=1(0,85r)/(0,85(1r)) r=10,20% comoA2=F1yIs=30%,F2/A2=0,3 F2=0,3xA2=0,3x62,5=18,75T/h R2 R2=62,518,75=43,75T/h

39

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CHANCADORTERCIARIOAUTILIZARDECONO

Laschancadorasdeconosecaracterizanporsussuperficiesdetrituracinconvergentes.Se empleanparatrituracinsecundariayterciaria.Generalmentealdisminuireltamaodelas partculaslasuperficieexternadetrituracinsevuelvemsrectaymsparalelaaunconode inclinacinmsfuerte(cabezacorta).Elmodelodecabezacorta(PYD)seadaptaala trituracinfina.


Modelo Max.Alimentacin Tamao(mm) SalidaTamao(mm)
PYD1200 50

<30 110
18105 25,6


LascaractersticasdeLatrituradoradecono: Altaproductividad. Fcilajusteyregulacin. Deusoyoperacinmuyeconmica.

Potenciademotor (kW) Capacidad(t/h) Peso(t)

GeneralDimensin 279018782844 (mm) ShanghaiJoyalMiningMachineryCo.,Ltd

HARNEROS AUTILIZAR Segn nuestro criterio al buscar el harnero exacto que necesitamos en nuestro proyecto no se adoptan a nuestra realidad, as que preferiremos mandar a hacer las cribas, segn las caractersticas que ms nos acomode, al distribuidor JWJones Co. Cumpliendo conlassigtes.Caractersticas: TIPO HARNERO PRIMARIO SECUNDARIO TERCIARIO CUATERNARIO DIMENSIONDE SEPARACION (mm) 500x1100 500x1300 800x2000 1050x2600 DIMENSIONDE AGUJERO(mm) 100 50 13 7

TAMAO CAPACIDAD ALIMENTADORMAX. (T/h) (mm) 200 62.5 100 50 13 62.5 62.5 62.5

40

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
LASCURVASDEALIMENTACIONYPRODUCTO

41

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DISEODIMENSIONDELSTOCKPILE ALTERNATIVA1. Para asegurar el abastecimiento de mineral a la planta y que esta no tenga que detener sus funciones por problemas de abastecimiento de material consideraremos un stock pile que asegure el funcionamiento de la planta por dos das, tiempo en el cual los posibles problemas de desabastecimiento podrn ser solucionados. Por esta razn consideramos un stock pile con una capacidad de almacenamiento igual a 3000 m de volumen real. Las pruebas realizadas a nivel de laboratorioarrojaronqueelporcentajedehuecosparaelmaterialatrataresde20%yelporcentajede slidosesigualaun80%,porlotanto: Volumenaparente=(100*3000)/80=3750m3 Si consideramos un ngulo de reposo de 45 para el material a tratar, quiere decir que el radio de la basedelstockpile,elcualtienelaformadeuncono,serigualalaalturadeeste.

V=1/3**R2*h ComoR=h V=1/3**R3=3750m3 DespejandoRobtenemosqueelradiodelstockpileesiguala15,3myporlotanto,comoelradioes igualalaaltura,h=15,3m ALTERNATIVA2. Considerandounangulodeinclinacindelstockpilede45,esdecir

6.4m

=45 6.4m EnteoralainclinacindelStockpilees45,mediantelacuallah=r,(r=radiodelstockpile). Vcono=*r*h/3,conr=h,V=*r/3r=3*V/=3*272/,h=r=6.4m

laradiodelstockpileigualalaalturanospermiteconocerestos parmetros. EltonelajequetieneelStockpileequivalea8horasdelaproduccin, esdecir:8*62.5=500Ton. Considerandounadensidadde2.3T/msealadoenelestudio,se puededeterminarelvolumendelStockpile: V=500/2.3=217.4m(VOLUMENINSITU). Vaparente=272m.

42

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 VISTAPLANTADELAAREA DEPROCESAMIENTO

CV011
CHANCADOR PRIMARIO 2m.

CV012
19.6m

R=6.4m

STOCKPILE

CV024
2m.

CV021 CV025 CV023


1.5m 20 CHANCADOR SECUNDARIO 20 10 14.9m CV022 10m.

15

CV0342m.

CV035
25

CV031
3m.

CV033
12.2m.

14.3m

STAKERS
14m.

CV032
18.7m.

20

CV042
CHANCADOR TERCIARIO 18.7m.

CV041
3m.

CHANCADOR TERCIARIO

43

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 SECCIONPERFILTRAMO1:DesdeelChancadorPrimariohastaelStockpile:
0.6m


4m.

CV012 L=27m.

7m.

10 15 22.7

CV011 L=5M.

19.6m.

6.4m

44

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 SECCIONPERFILTRAMO2:DesdeelStockpilehastaelChancadorSecundario: PERFILSECCIONTRANSVERSAL.(Seccinenlacualsepuedeapreciarlascorreastransportadorasdelchancadorsecundarioalharnero). CV025 L=2m. CV026 L=10.m


6 1m. 4m. 15

CV022 L=15.5m

H=6.4m CV021 L=10m.

CV031 L=6m.

14.9m.

2m.

CV024 L=7.7m
15 7.4m 2m. 0.6m

3m.

CV023 L=2.5m.

45

10m.

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 SECCIONPERFILTRAMO3:DesdeelChancadorSecundarioalChancadorTerciario: CV032 L=19.3m 15 CV041 CV031 L=6m. L=6m. PERFILSECCIONTRANSVERSAL.(Seccinenlacualsepuedeapreciarlascorreastransportadorasdelchancadorterciarioalharnero).


3m. 1m.

5m.

CV036 L=14.3m
4

CV035 L=2m CV034 L=11.6m CV033 L=2m


15 14m.

46

0.8m.

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 SECCIONPERFILTRAMO4:ChancadorTerciarioalTamborAglomerador. 15 CV041 L=6m. SECCIONPERFILTRAMO5:TamborAglomeradoralasPilas. 5m.


15m.

CV042 L=19.3m
5m.

47

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
PARAMETROSDEDISEOCORREASTRANSPORTADORAS 1. PesoEspecificodelmaterial. ANGULOENREPOSO 2. Angulodereposodelmaterial() Es el ngulo con que el material forma con respecto al cuando este se deja de caer libremente horizontal unpiloenestadoesttico. formando dinmico, se habla de ngulo de talud del En estado material en movimiento el cual para la mayora de los material es de 1015, ms bajo que el ngulo de talud esttico. ANGULOSOBRECARGA 3. AngulodeSobrecarga() Es el ngulo con respecto a la horizontal que forma la seccin transversal del material sobre la banda transportadora, para la mayora de los materiales es conveniente emplear como ngulo de sobrecarga 15, para muyfinosopolvo10. materiales 4.Angulomximodeinclinacin() Es el ngulo bajo el cual el material puede ser transportado sobre la banda sin necesidad de bandas especiales, por ejemplo cintas con nervios para evitar el deslizamiento del material en la cinta. Este ngulo mximo de inclinacin est determinadopor la fricciny el material de la banda a diferencia del ngulodetaludelcualdependedelafriccininternadelmaterial. El ngulo mximo de inclinacin es menor al ngulo de talud dinmico, el cual es difcil de determinar con exactitud. Los nervios construidos en las bandas pueden ayudar a incrementar el ngulo de inclinacin, en caso de que la friccin entre la banda y el material sea menor que la friccin interna dinmicadelmaterial,locualdeterminaelngulomximodeinclinacin. 5.MaximoTamaodelMaterial Es la dimension maximo de tamao del material que se transporta sobre la cinta, en la cual su tamao es obtenida por pruebas de granulometra efectuadas en el laboratorio. Este valor es importante en la seleccin del ancho apropiado de la banda,;del tipo de rodillos depara la zona de impacto de carga; de la forma y dimensiones de la gua de carga; tambin es importante conocer el porcentaje relativo del volumenconformadoporfinosygruesos. 6.CaracteristicadelFlujo 7.AbrasividaddelMaterial. Estacaractersticaesimportanteenlaseleccindeltipodecintatransportadoraydelespesorynumero decapasdelacubiertadelamisma. 8.TemperaturadelMaterialTransportado(T) Determina el tipo y calidad de la cinta transportadora, asi tambin como influye en la vida de los rodillos. 9.CorrosovidaddelMaterial. Determinaeltipoycalidaddelacubiertadelacintatransportadora. 10.CapacidadRequerida. LacapacidadesexpresadaenTon/hrs.Lacualseempleaenlosclculosdelastensionesenlasbandasy lapotenciarequeridaparaaccionarlacintatransportadora.

48

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CALCULOSDELASCINTASTRANSPORTADORAS
CORREAS CV011 CV012 CV021 CV022 CV023 CV024 CV025 CV026 CV031 CV032 CV033 CV034 CV035 CV036 CV041 CV042 INCLINCACION 0 15 6 0 0 15 0 6 0 15 0 15 0 4 0 15 LONGITUD (m) 5 27 10 10 2.5 7.7 2 10 6 19.3 2 11.6 2 14.3 6 19.3 ANGULODE SOBRECARGA GRANOLOMETRIA TAMAOMAXDELMAT 100mm 100mm 100mm 100mm 100mm 100mm 100mm 100mm 50mm 50mm 50mm 50mm 50mm 50mm 7mm 7mm ABRASIVIDAD DELMATERIAL ALTO ALTO MODERADO MODERADO MODERADO MODERADO MODERADO MODERADO MODERADO MODERADO MODERADO MODERADO MODERADO MODERADO MODERADO MODERADO CARACTERISTICA DELTAMAO DIVERSO DIVERSO UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME UNIFORME CAPACIDADREQUIRIDA (TON/HRS.) 62.5 62.5 62.5 62.5 62.5 62.5 62.5 62.5 62.5 62.5 62.5 62.5 62.5 62.5 62.5 62.5 ANCHODELA BANDA(mm) 500 500 500 500 500 500 500 500 400 400 400 350 350 350 300 300 VELOCIDADMAXBANDA RECOMENDADA(m/s) 3.15 3.15 3.15 3.15 3.15 3.15 3.15 3.15 2.5 2.5 2.5 2 2 2 2 2

15 15 15 15 15 15 15 15 15 15 10 10 10 10 10 10

AnchosdeBandamnimorecomendadosyvelocidadesdebandamximorecomendados. ReferenciaGOODYEARHandbookofConveyorandElevatorbeltyROULLANDSCatlogodeBandasTransportadoras.

49

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CORREASTIPOSTACKER INCLINCACION LONGITUD(m) ANGULODESOBRECARGA GRANOLOMETRIATAMAOMAXDELMAT ABRASIVIDADDELMATERIAL CARACTERISTICADELTAMAO CAPACIDADREQUIRIDA(TON/HRS.) ANCHODELABANDA(mm) VELOCIDADMAXBANDARECOMENDADA (m/s) CV05 20 10 10 7mm CV06 20 10 10 7mm CV07 20 10 10 7mm

MODERADO MODERADO MODERADO UNIFORME UNIFORME UNIFORME 62.5 300 2 62.5 300 2 62.5 300 2

INFORMACIONESYCARACTERISTICASTECNICASDELASCORREASTRANSPORTADORASPLYLONEP REDUCIDOESTIRAMIENTO Por el hecho de poseer hilos de gran tenacidad, en el sentido longitudinal en la construccin de las carcasas, las correas PLYLON presentan un reducido estiramiento. Lo cual permite su utilizacin en transportesmslargos. MAYORCAPACIDADDECARGA LascorreastransportadorasPLYLON/PLYLONEPsonconstruidasdetejidossumamenteresistentes; portando una capa extra de goma entre las telas. Lo cual permite un soporte mayor de carga, an en grandesanchos. MAYORFLEXIBILIDAD:DIAMETROSDEPOLEASREDUCIDAS Porresistiralaselevadastensionesdetrabajoconmenornmerodetelas,estascorreaspresentanuna flexibilidad mayor. Consecuentemente, pueden trabajar con poleas de dimetro menores, lo cual resultarenunaeconomamayorquesignificauncostoinicialmsbajodelequipo. MEJORACANALAMIENTO Debidoalaconstruccindesucarcasadenylon/nylonypoliester/nylon,lascorreastransportadoras PLYLONpuedentransportarmaterialesconmayorpesoespecficoenpolinesdecargahasta45. MAYORADHESION Debido al tratamiento de las telas por el proceso exclusivo 3T, por tener una camada extra de goma entre las mismas, las correas PLYLON presentan excelente adhesin entre sus componentes. Exhibiendolaventajadenopresentarseparacinentrelastelasycubiertas/telas. GRANRESISTENCIAALOSCORTES Debidoalaconsistenciadesutejido,estascorreasposeenunaexcelenteresistenciaacortesydaos producidosporlaeventualpenetracindealgnmaterialentrelacorreaylapolea. EXCELENTERESISTENCIAALOSIMPACTOS Envirtuddeltipodeconstruccindesucarcasa,lascorreastransportadorasPLYLONposeenunagran resistenciaalosimpactos,sinlanecesidaddelusodeBreakersotejidosauxiliares,enlascondiciones normalesdediseoyoperacin,bajolascualeshansidoespecificadas. GRANRESISTENCIAALAHUMEDAD Yaquesucarcasaestconstrudadepoliesterynylonysiendoambosmaterialestotalmenteresistentes a la humedad, las correas transportadoras PLYLON son totalmente impermeables al paso de la humedad.Porlotanto,noexistelaposibilidaddequelacarcasasellegueadeteriorar.

50

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
INFORMACIONESTECNICASSOBRELASCORREASTRANSPORTADORASPOLIESTER/NYLON ANCHOMAXIMODELACORREA EXTENSION RECOMENDADADELTENSORAPARTIRDELADISTANCIAENTRECENTROS(%) ReferenciaCatlogopresentadelostiposdecorreastransportadorasyelevadorasPLYLON (nylon/nylon)yPLYLONEP(poliester/nylon)fabricadasactualmenteporTheGoodyearTireAnd RubberCompany. ANCHOMINIMODELACORREAPARAEL ACANALAMIENTOSOBREPOLINES. DIAMETROMINIMODELAPOLEAMOTRIZ ENFUNCIONDELATENSIONAPLICADA

51

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CUBIERTAS TIPOSDE A.RESISTENTESALAABRASION Stacker Presenta excelente resistencia a los cortes, desgarros y abrasin. Optimo rendimiento en el transportedematerialesconngulosvivos,talescomomineralesdehierro,manganeso,estao,cuarzo, etc.Formuladaconcauchonatural.Resisteamaterialescontemperaturasdehasta65. SuperSExcelenteresistenciaalaabrasin,cortesydesgarros.Optimodesempeoeneltransportede materialesabrasivosquepresentenngulosvivos,talescomopalletsdematerialdehierro,manganeso, etc.Resistematerialescontemperaturasdehasta65C. B Optima resistencia a cortes, desgarros y abrasin. Recomendada para materiales con abrasin media, tales como piedra, granito, escorias, arena, bauxita, carbn mineral, etc. Indicada tambin para usinasdecemento.Resistenteatemperaturasdehasta95. B.RESISTENTESAACEITES Ors Chemigun Recomendada donde exista la presencia de aceites minerales o vegetales. Resiste a temperaturasdehasta80C. Scor Est especialmente compuesta para resistir la trementina contenida en las astillas de madera y moderadamentelosgranosoleosostalescomosemillasdelino,algodn,mazysoya.ElcompuestoScor tiene conduccin esttica menor que un megaohm de resistencia elctrica. Su buena resistencia a la abrasinhacedeestacorrea,laindicadaparatransportarmaterialmoderadamenteoleoso. MSHA SBR El compuesto MSHA SBR est especialmente formulado para usarse en aplicaciones en las cualesserequierencorreastransportadoraspiroresistentesyautoextinguibles. El compuesto MSHA SBR cuenta con la designacin 283 de la secretara de seguridad y salud en minas deEE.UU.EscomparableconelcompuestoBencuantoalaresistenciaalaabrasin. C.RESISTENTESALATEMPERATURA 6740 A Excelente calidad para resistir al transporte de materiales calientes y abrasivos, recomendada para ser usada en temperaturas de hasta 180 C para materiales aterronados y hasta 120C para materialsdesmenuzadosomolidos. Super thermo flo Un compuesto con excelente resistencia a la abrasin y a los materiales calientes.Indicadaespecialmenteparatransportarescoriadecementoymaterialessimilaresquecubran la superficie de la correa y la expongan al calor de coccin. Bajo estas condiciones, soporta temperaturas hasta 200 C. Posee una camada especial de goma entre las telas que le asegura buena flexibilidad.

Los tipos de cubiertos utilizadas en nuestro proyecto son de tipo A, para las correas dentro del rango CV01 a CVO2 son de tipo Super S, la cual tiene un mnimo de espesor de cubierta 3mm y las que son dentrodelrangoCVO3YCVO4sondetipoB,lacualtieneunmnimodeespesordecubierta1.5mm. LoscubiertosparalosStakerssondetipoBconunmnimodeespesordecubierta2mm.

52

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
ESPESORES RECOMENDADOSPARACUBIERTASDECARGA CUBIERTAS REGULARES

CUBIERTASDELLADODELASPOLEAS Lacalidaddelascubiertasdelladodelaspoleas,debeserlamismaqueaquellasdelascubiertasdelladode carga.Salvo condiciones especiales o experiencias anteriores, recomendamos los siguientes espesores para lascubiertasdelladodelaspoleas:

Ennuestroproyectoutilizamosunespesordelacubiertadelladodelaspoleas1mm. LISTADEABRASIVIDADDEVARIOSTIPOSDEMATERIALES

53

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
TIPOSDECORREASTRANSPORTADORASAUTILIZAR DISTRIBUIDORJOYALSHANGAI.

Nuestro mineral se caracteriza por ser abrasivo dentro del comienzo del sistema de procesamiento de tipo nouniformeyamedidaquevaavanzandoelsistemade procesamientoeltamaose vaadquiriendomayor uniformidad. ANCHODELACINTA (mm) 300 <12/1 350 <12/1.2 1220/2 2025/2.7 0.82.6 4081 400 <12/1.5 1220/2.2 2030/3 0.82.7 4082

LONGITUDDELA CINTA(m) /POTENCIA(KW) VELOCIDADDELA CINTA(m/s) CAPACIDAD(t/h)

1220/1.5 2025/2.5 0.82.5 4080

54

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
COSTOSAREADEPROCESAMIENTO. Alternativa1. EQUIPO CHANCADORES TIPO PRIMARIO SECUNDARIO TERCIARIO PRIMARIO HARNEROS SECUNDARIO TERCIARIO Cuatenario NOMBRE Mandbula Martillo Cono MARCA JOYAL JOYAL JOYAL Jo.Jones Jo.Jones Jo.Jones Jo.Jones MODELO PE500x750 PC1000X800 PYD1200 UNIDAD 1 1 1 1 1 1 1 PRECIO(USD) 21647 16235 70353 70000 70000 70000 70000 TOTAL 21647 16235 70353 70000 70000 70000 70000 388235

COSTO
Alternativa 2. EQUIPO CHANCADORES HARNEROS TIPO PRIMARIO SECUNDARIO PRIMARIO SECUNDARIO NOMBRE Mandbula Cono MARCA METSO METSO METSO METSO MODELO C80 HP100 B1032V CVB15X402 UNIDAD 1 1 1 1 PRECIO(USD) 135000 187000 20000 100000

TOTAL 135000 187000 20000 100000 442000

COSTO

MARCA PRECIO(USD/m) LONG.TOTAL(m) COSTO CORREAS TRANSPORTADORAS JOYAL 525 400 210000 Adems se estima un costo de los aceros a utilizar para armar la planta de un total de 50000 USD. Est en disputalaseleccindelasalternativasdetiposdechancadoresyharnerosautilizar.Enlacualestimamosun costonomayorde450000USDenestosequipos. Porlotanto,elcostototaldeinversinenlazonadeprocesamientoesaproximadamente710000USD. (enlascorreastransportadorasseincluyenlasquetransportanelmaterialhacialaspilas).

55

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CAPITULO 5.

DESCRIPCIONGENERALAGLOMERACION El mineral fino almacenado en los silos es extrado por correas alimentadoras a razn de 62.5 t/h para descargarloen2tamboresaglomeradores,dondeseleagregaacidoyrefino. Luego el mineral aglomerado es trasferido a una correa que se extiende a lo largo de la pila para transferirlosaunaseriedecorreasmvilesydescargarlosenelstackerelcualseencargaapilarelmineral formandolaspilas En las pilas se armaran las lneas de riego, utilizando nebulizadores aspersores o goteros, y usando como solucin lixiviante refino o ILS que recircula hasta cumplir el ciclo de lixiviacin que dura aproximadamente 300das. La solucin cosecha denominada PLS se almacena en piscinas para luego unirse con la solucin de PLS provenientedelapiscinadePLSdelaplanta2enlaPiscinadePLSdealimentacinalaplantadeextraccin porsolventes(SX).

El rea de aglomeracin y lixiviacin produce PLS (Pregnant Leaching Solution) contenido: 3.38 g de Cu por litro de solucin, 1.5 g de acido sulfrico por litro de solucin y 5 grs. de fierro total por litro de solucin, esta solucin es evacuada con un pH de 1.9 a una temperatura aprox. 11C la cual ser extrado al rea de extraccinporsolvente.Luegoelmineralseenvaalsistemaalsistemadetransporteyapilamientodondeel mineralesconducidohastalaspilasdelixiviacinyesapiladoconlaayudadeunapiladorradial. El sistema de lixiviacin se encarga de la irrigacin de estas pilas para disolver el cobre contenido en el mineral, este sistema comprende la preparacin de las soluciones a travs del bombeo por tuberas e irrigando las pilas. La solucin obtenida es colectada en las piscinas donde es bombeada al rea de extraccin por solventes donde se purificara la solucin separando el cobre disuelto en la solucin de otros elementos la cual son nuevamente colectadas en el sistema de rea de aglomeracin y lixiviacin para ser utilizadasenelsistemadeaglomeracin.

56

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
FORMADELTAMBORDEAGLOMERACIONAUTILIZAR

SuconstruccinlovamosamandarahaceralextranjeroenAlemaniaporlacompaaKUTTNER,lacualse estimauncostode50000USDporunidadconunacapacidadde50150ton.Porlotanto,elcostodelos tamboresseria100000USD(yaquesondos). DIAGRAMADEFUNCIONALIDADDEAGLOMERACION Agua Aire Aglutinante Energa Elctrica Lubricante Acido Refino

MINERALCHANCADO

PLS

AGLOMERACIONYLIXIVIACION
Desecho Lubricante

Ripio

Evaporacin yfiltracin desolucin

57

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CAPITULO6.
DESCRIPCIONTECNICALIXIVIACIONENPILAS Los minerales de cobre en sus diferentes menas, se encuentran en la naturaleza asociados entre s y con otras especies mineralgicas, ms o menos diseminadas dentro de una roca matriz con la ganga correspondiente. Para el desarrollo de un proyecto de lixiviacin es necesario un conocimiento de las caractersticas del yacimientoydelamena,ylosfactoresqueinfluyenenlalixiviacin. Enparticularrespectoalascaractersticasdelyacimientoesimportanteconsiderar: Su composicin mineralgica, por las interferencias que puedan producir en la lixiviacin las diferentesespeciesconteniendoonocobre. Diseminacindelasespecies:frecuenciaytamaosdelosgranos Carcter de la ganga, ya que ciertos minerales pueden estar dentro de una ganga carbonatada y consumircidohaciendoelproyectoinviableeconmicamente. Caractersticas fsicas de la mena (cantidad de finos o lamas), as como sus propiedades de porosidadypermeabilidad,quesonfundamentalesenunalixiviacinesttica. Comportamiento de la roca en el chancado, en cuanto a crear o aumentar la fracturacin, exponiendounamayorsuperficiealataquequmico. VARIABLESDELSISTEMA Las variables que mas influyen en este proceso son: granulometra, altura de la pila, concentracin de solucinlixiviante,flujoderegadoypH(12). La materia que se desea lixiviar por este mtodo debe tener una granulometra entre 13 mm y 7 mm y la alturadelapilageneralmenteesde2a10mtdependiendodelgradodepercolacindelmaterial. Elregadodelapilapuedeserporaspersinoporgoteo,elflujoderegadopuedeserentre4a14L/Hrm2 ylaconcentracindelasolucinlixiviantevaadependerdelascaractersticasdelamina. DISEO. Despus del proceso de chancado, el material se transportara a un tambor de aglomerado para un ataque fuertedeacidosulfrico,posteriormentesetransportaraporcamionesycargadoresfrontaleshastalazona deapilamientoqueestarimpermeabilizada. Eldiseodelapilaserunconotruncadoconunabaseinclinadacuyapendientevaraentre2a5,comose muestraenlafigura1. La base ser construida por capas alternadas de arena, ripio, grava y una carpeta impermeable o geomembranade1.5mmdeespesor,comosemuestraenlafigura2.

58

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CONSIDERACIONESPRELIMINARESENELDISEODELAPILA Diseodecarpeta. Substrato: Para nuestro proyecto Utilizaremos una pendiente de 3% hacia el norte con un grado de compactacin de 95%. FinosdeProteccin: Capas de ridos finos (arena) totalmente exentos de elementos punzantes, para nuestro proyecto Utilizaremos20cmdeespesor. RipiodeProteccin: Constituye la ltima barrera de proteccin del revestimiento. Bsicamente es una capa de unos 20 cm. Su bandagranulomtricadebeirentre100%<3y100%>11/2. BaseImpermeable: UtilizaremosGeomembranade1.5mm,cuyacaractersticasseespecificanenlafigurasiguiente. La carpeta para lixiviar ser construida de tal manera que la solucin pueda percollar a travs de la pila en forma descendentehasta la base de lacarpeta, esta ser recolectada enun punto determinado canaleta de drenajedesdedondefluyealprimerestanquederecoleccin(pls). La carpeta impermeable es necesaria para recoger la solucin rica, esto elimina la posibilidad de perder las soluciones con contenido de cobre en el terreno y por lo tanto contaminar ros, arroyos y aguas subterrneas.

59

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
TuberasdeDrenaje: Tuberascorrugadasyperforadas,colocadasespaciadaslongitudinalmente,destinadasapermitirunarpida evacuacin de la solucin una vez que alcanza el fondo de la pila. Cumple el doble propsito de evitar la inundacin de la pila (y las consecuentes capas freticas) y permite la inoculacin de aire por las zonas inferiores. Su espaciamiento se calcula asumiendo que la tubera es una canaleta que a la salida de la pila est llena hasta 2/3 de su dimetro con el lquido recogido en su rea de influencia; en todo caso no se recomienda espaciamientosmayoresque2metros.

SacosdeRelleno: Colocados al borde de la pila y antes de la canaleta, proporcionan una barrera de contencin de los finos arrastradosporlasolucin,yunlugarparaelpasodepersonalsinpeligrodedaarlabaseimpermeable.Su disposicin tipo ladrillo debe permitir la salida de la tubera de drenaje. Se instalan sobre la carpeta plstica y alcanzan una altura tal que sirvan de contencin a todas las capas de ridos protectores bajo el mineral. Paranuestroproyectoserndeunaalturade1metro. CanaletasdeRecoleccin: Lugarderecuperacindelassoluciones;estintegradaalrevestimientoimpermeable.Enlaspilasdinmicas est nivelada, sectorizada y con salidas para cada sector. En ambos casos estn conectadas a estanques desarenadoresparaeliminarslidosensuspensin. Anclajes: Sectores de fijacin de la base impermeable al terreno. Una recomendacin muy importante consiste en realizar pruebas de arreglos de pila, con diversos tipos y espesores de revestimiento y capas de proteccin, bajolascondicionesdeoperacinantesdeprocederconlaconstruccindelapila.Tambindebedejarseun espaciolibreentreelpiedelmineralycomienzodelanclaje,porsiexistiesenescurrimientosdesolucinpor lostaludeslateralesyposterior,rematandolainstalacinconpequeospromontoriosenlosanclajes. Este espaciolibredebieratenerentre0.3y0.5metros.Ocuparemos0.5. Estanquesdeproceso. En un sistema de lixiviacin en pilas se encuentran normalmente los siguientes estanques para almacenamientodelquidos: EstanquesAuxiliares. Estanquedeaguaindustrial:Necesario,encasodenodisponerdeunaalimentacinregular,paramantener unareservadeaguaparaatender:

60

COMPAAMINERAOLIVIAPROYECTOPLANTA2010

Prdidasporevaporacin Prdidasporhumedadresidualenlosripiosagotados Necesidadesdeproceso,porejemplo;curado,aglomeracinypurgasdesolucin. Sudimensionamientocorrespondeaunaarmonizacinentreelabastecimientoylademanda. Estanquedesarenador. Recibe solucin desde la canaleta de recoleccin de la solucin de la pila y alimenta, por rebalse, a los estanques de proceso decantando los slidos suspendidos. Se dimensionan en funcin del tiempo de retencinnecesarioparaobtenerunabuenadecantacin. Estanquedeproceso. Sontresestanquesdeproceso,unoparaREFINO,ILSyPLS.

Para el diseo de los estanques utilizaremos un volumen de 30.000 m3, los que nos dan las dimensiones siguientes,L=60m,l=33m,H=14m. Lasuperficiederevestimientoesde,7000m2.X3=21000m2 Materialesautilizarparalacarpeta. Geomembranade2mm. Arena. Ripio. Colasdemoliendacompactadamezcladaconbentonita. Asfaltocolocadoenripiocompactadoycubiertoconunsellodeasfalto. Concretoreforzado Arcilla.

61

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Mtododeconstruccindelacarpeta. Lossiguientessonlospasosaseguirenlaconstruccindelacarpeta: Seseleccionaelsitioparalacarpeta,sedeterminounasuperficiede180mx180m. Se rellena el sitio hasta inclinacin determinada, mediante trabajo topogrfico, utilizando material extradodelafaena. Conunbulldozersedalainclinacinylacompactacinmencionadasanteriormente. Enlacadadependientesepreparanlosestanquescolectores. Secubreelreasobrelaqueseconstruirlacarpetaconarenafinayripiodetamaopequeo. Secompactanuevamenteelrea. Una vez que la base ha sido compactada y ya con la inclinacin adecuada, se coloca la geomembrana y se instalan las caeras de drenaje que llegan hasta la canaleta recolectora de solucinrica. Secubrenlasbasesyloscostadosdelosestanquescongeomembrana. Secubrelageomembranacon20cmdearena,estolosprevendrdeperforarlageomembranacon trozosdemenagruesosoangularqueseapilarasobreella. Cargadodelapila. El carguo de la pila es controlado por la naturaleza de la mena, la altura de la pila depender de la permeabilidad,fuerzadelacidoylamximaalturaalcanzadaporelbaldedelcargadorfrontal. Seutilizaracargadorfrontalycaminparasucarga,detalmanerademantenerhomognealamena. Despusdecargarlaspilasseprocedeanivelaryaseaamanooconbulldozer. Sistemaderiego. Una vez cargada la pila y ya previamente antes de cargar haber pasado por el tambor aglomerador, se instalaraunsistemaderegadoparaladistribucindelasolucindeacidosulfrico. El sistema de regado puedeconsistir en riego por goteo o por aspersores. Unavez instalados los estanques y el sistema de regado, el sistema es chequeado para ver su funcionamiento, llevando una estanque de solucinricaconaguafrescayestaesbombeadaalapila,dejandoqueelaguafluyaalpozodesolucinrica, siesqueexistenperdidasenelsistemadebenserreparadasyrepetirselaoperacindechequeoconagua.

62

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Detallecomponentesdelapila,Funcionamientodelapilayevaluacineconmica. Etapadeoperacin. Lixiviacin 30 das Lavado 4 das Descarga 2 das Carguo 2 das Elciclodeoperacinesmensualyrespectivohastatratarlas45000tondemineral. Serealizaraunaetapadecuradolocualnosdisminuireltiempodelixiviacin,laformadeprocederparael curado es mediante un tambor aglomerador en el cual se combina mena y acido al 100% con una duracin aproximadade1hrs. CALCULOSDEDISEODELAPILA Capacidaddelapila 45000ton/mes. Alturapila 2mt. Densidadaparente 1.84 Angulodetalud 45 L:A=3:1 Volumen=(A1+A2+A1*A2)*H/3 A1=L*A L=(L2H) a=(A2H) A2=(L2H)(A2H) Pero L=3*A; A1=3*A2 A2=3*A216*A+16 V=45000/1.84= 24456.52m3 24456.52*3/2=(A1+A2+A1*A2) A= 9.489m L= 28.467m

63

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DETALLEDISEOPILA

30 m

10 m 6m

26 m

SISTEMADERIEGO Seocuparaunsistemaderegadoporaspersoresdeunradiode1.5mt.Eltipodeaspersoresmarca SenningerWobbler.

64

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DISTRIBUICIONDEASPESORES. Paraladistribucindenuestrosaspersoresserealizaronlossiguientesclculos. Ndetiras=26m/3m=8.6tiras=peroutilizaremos9tiras. Largodelastiras=7m N de aspersores por tira = 7 m / 3 m = 2 aspersores por tira, pero con regado de pendiente serian 3 por cadatira. Ntotaldeaspersores=3*9=27aspersoresmaslos3aspersoresdeesquina. Conloanteriortendremosunacantidaddeaspersoresde29quemantendrnunabuenaeficiencia. Eficienciaderiego Efc=supregada/supporregar*100=(1.5)2*29/(10*30+6*26)/2*100=89.9% Lonormalqueseutilizaenlaindustriaesunaeficienciadel85%a90%,paralograresaeficienciaseutilizara una cantidad de 29 aspersores que sern distribuidos de tal manera de eliminar los sectores de inundacin, esto es no utilizando una estructura cuadrada de diseo, sino una estructura hexagonal. Como muestra la siguientefigura.

Encadainterseccinsecolocaraunaspersor,ademsdelosaspersoresauxiliares.

65

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
TUBERIAS. Seocuparanlassiguientescaeras. Drenaje. Sern 15 tuberas de 6 in (16 cm) como se muestra en la figura. La longitud de cada tubera ser de 16 m. costodeUSD6/m

Valorescalculadoscons=50kgf/cm2. LapresinnominalPNcorrespondealamximapresindeoperacinadmisibledelatuberaa20C,enbar. PN=mximapresindeoperacinadmisibledelatuberaa20CenKgf/cm2.

66

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CONDUCCIONDESOLUCIONAREGADIO

Latuberaserde2in(5cm)conunlargode26m. GeomembranaHDPE. Caractersticasgeomembranadepolietilenoaltadensidad.

Las geomembrana son fabricadas con resinas de polietileno, especialmente formuladas y certificadas, con unadensidadmnimade0,941gr/cc. Lasgeomembranaademsdesuexcelenteresistenciaalataquedeagentesqumicosyrayosultravioleta(uv con 23% negro de humo), presentan inmejorables propiedades mecnicas, su bajsima permeabilidad le permiteactuarcomobarreraalpasodefluidosygases,altafuerzatensibleyexcelenterigidez. Disponible en superficie lisa y texturada en espesores desde 0.5 a 2.5 mm con ancho mximo de 8 m y en largossegnrequerimiento. ParanuestrocasoutilizaremosgeomembranaHDPE2mm*8m*116m. Solamenteparalapilaserde924m2 Lasuperficiederevestimientoenestanquesserde10120m2 Valorxmetrocuadrado:$9.42+IVAdlaramerica

Rangode Aplicacionesy resultados LeydelMineral Inversin Granulometra Recuperaciones Tpicas(%) Tiempode tratamiento Soluciones

Mtodosdelixiviacin EnBotaderos Bajaley Mnima Corridodemina 4050 Variosaos Diluidas12g/LCu Recuperacin incompleta;Re precipitacindeFe yCu.; Canalizaciones evaporacin; Evaporacin; Perdidasde solucionesmuy diluidas. Enpilas Bajamedia Media Chancadogrueso 5070 Variassemanas Diluidas12g/LCu Recuperacin incompletarequiere degrandesreas; Canalizaciones;Re precipitacin; Evaporacin; Solucionesdiluir. Percolacin Mediaalta Mediaalta Chancadomedio 7080 Variosdas Diluidas2040g/LCu Bloqueporfinos; Requieredemas inversin;Manejode materiales;Necesita demayorcontrolen laplanta. Agitacin Ampliorango Alta Molienda hmeda 8090 Horas Diluidas515 g/LCu Molienda; Lavadoen contracorriente; Tanquede relaves; Inversinmuy alta;Requiere abundante agua;Control delaplantaes mssofisticado.

Problemas Principalesensu aplicacin

67

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CAPITULO7.

DESCRIPCIONEXTRACCIONPORSOLVENTE. Esta rea consta de cinco trenes ABCD y E dispuestos de dos etapas de extraccin y una de re extraccin en los cuales se purifica y concentra la solucin de PLS de 3.38 g/L a 50g/L de Cu+2 denominndose esta solucin electrolito rico para tal fin se utiliza en la etapa de extraccin un extractante disuelto en un diluyente, y electrolito pobre como solucin stripp en la etapa de re extraccinparadescargarelCu+2delorgnicocargado. El PLS empobrecido de iones cobre se dirige a piscina derefino el orgnico cargado recircula al tanque deorgnicocargadoyelelectrolitoricofluyeporgravedadaltanquedealimentacinafiltros. La extraccin por solventes consiste en poner en intimo contacto una fase acuosa portadora del elemento metlico Cu++ y una fase orgnica (extractante ms diluyente) capaz de extraerla selectivamente y transportarla a otra fase acuosa donde se re extrae. De esta manera se purifica y concentraenlanuevafaseacuosadenominadaelectrolitorico. El proceso de SX se basa en la reaccin reversible de intercambio inico entre la fase inmiscibles, controlado qumicamente por la acidez o pH de la fase acuosa. De esta manera se produce un intercambio inico que mantiene en equilibrio el sistema liberando acido de acuerdo a la estequiometriadelsistema. CONCERNTRACIONES ELEMENTO (g/L) En el proceso global de extraccin por solventes intervienen dos etapas: Cu 3.38 PLS Fe+3 5 Extraccin: H2SO4 5 La solucin PLS con baja acidez ingresa a la Cu 0.34 primera etapa de extraccin E1 es contactada REFINO en mezcladores con la fase orgnica Fe+3 4.99 H2SO4 9.7 parcialmente cargada proveniente de la etapa de extraccin E2. Como consecuencia la Cu 50 reaccin se desplaza hacia la derecha ELECRTOLITO Fe+3 1.53 RICO generandodosnuevosproductos: H2SO4 157 Cu 35 ELECRTOLITO Fe+3 1.5 POBRE H2SO4 180 OrgnicoCargado:FaseorgnicaquecontieneelelementometlicoquesaledelaetapaE1. Refino: Fase acuosa que ha entregado gran parte de contenido de cobre, incrementndose en acido libre, mantenindose el nivel de impurezas Fe,Al, Mn, Cl,NO3,Mo,Co etc. que sale de la etapaE2.

Reextraccin: El orgnico cargado obtenido en la primera etapa de extraccin E1 se contacta con el electrolito pobre en cobre pero alto en acido que retorna desde electroobtencin. Debido a la alta acidez del electrolito (170 a 180 gpl H2SO4 Y 35 A 38 g/L Cu), se produce la reaccin inversa, es decir, el cobre de la fase orgnica es transferido a la fase acuosa. De la etapa de reextraccin (stripping) se obtienen 2 soluciones: Orgnicodescargado:queesenviadoalasegundaetapadeextraccinE2parainiciarunnuevo ciclo. Electrolito rico: de 150 a 160 g/L de H2SO4 Y 45 a 55 g/L de Cu++ que sale de esta nica etapa dereextraccinS1yesenviadoaEW.

68

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 Pilade
lixiviacin Orgnico Cargado Ctodo deCude alto d
ETAPARE EXTRACCION ETAPA EXTRACCION

PROCESODEEXTRACCIONPORSOLVENTEYELECROBTENCION

Electrolito pobre

Electro obtencin


PLS

Refino

PiscinadePLS Orgnicodescargado PLS LIXIVIACCIN

Electrolito rico

EXTRACCIONPORSOLVENTE

Electrolito pobre

Electrolito rico

Refino Orgnico parcialmente descargado AvancePLS parcialmente descargado Electrolito pobre

ESTANQUERE CIRCULACION

Orgnico descargado

OrgnicoCargado

ESTANQUEDE ORGANICO CARGADO

OrgnicoCargado

69

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Laplantadeextraccinporsolventeconstade5trenesABCDE,enloscualessecontactanlassoluciones acuosascosechaPLSystrippconunasolucinorgnicapararealizarlatransferenciadecobre. El flujo total de PLS que ingresa a los trenes ABC del sistema de extraccin por solventes es aproximadamentede60m/hylostrenesdeDEde55m/h. Estesistemaconstade2fasesdeoperacinquesedescribenacontinuacin. EtapadeExtraccin Enlostreneslaoperacinserealizaen2celdasdeextraccin(E1E2)conectadasenserie. En la etapa de extraccin encontramos dos flujos de soluciones que sern descritos a travs de dos circuitos:elcircuitodePLS,elcircuitodeorgnico. CircuitoPLS La solucin proveniente del circuito de lixiviacin (PLS), contiene 3.38 g/L de Cu+2 almacenada en la piscina de PLS de alimentacin a planta de SX de 70m de capacidad, de esta piscina salen 2 lneas de PLS una para el tren ABC y otra para los trenes D y E, ambas son flujos regulados por 2 vlvulas tipo mariposa. El PLS fluye por gravedad hacia el tanque mezcladordecantador de la primera etapa de extraccin E1, cede un gran porcentaje de cobre orgnico y continua su ciclo ingresando a la segunda etapadeextraccinparaterminardecedersucontenidodecobreenelmezcladordecantadorE2. El PLS empobrecido en cobre (Refino), es enviado a la piscina de refino para completar su ciclo en el circuitodelixiviacincomosolucinlixiviante. CircuitoPLS PISCINAPLSALIMENTACION APLANTADESX PLSCu++ 3.38g/L PRIMERAETAPADE EXTRACCIONE1 PILASDE SEGUNDAETAPADE LIXIVIACION EXTRACCIONE2 PISCINADE REFINO RefinoCu++ 0.34g/L

70

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CircuitodeOrgnico El orgnico es una solucin compuesto de un extractante (LIX 860LIX 84N) y un diluyente Orfom SX12 capazdecapturarionesCu++delPLS. El ciclo de orgnico se inicia en los estanques del orgnico cargado 040TK01 y 240TK25. Esta solucin conunaconcentracinde3a4g/LCu++esbombeadoporbombascentrifugashorizontalesdistribuidas paralostrenesABCyDE,elorgnicocargadoingresaalmezcladorprimariodelaetapadereextraccin S1dondesemezclaconunelectrolitopobrequesaledeltanquederecirculacinladoelectrolitopobre vaintercambiadoresdecalor,esteelectrolitoesunasolucinacuosaconaltaconcentracindeacidoel cual permite descargar los iones Cu++ de la fase orgnica. El orgnico ahora descargado, ingresa a la segunda etapa de extraccin E2 para contactarse con el PLS capturando el cobre remanente del PLS pasandoluegoalaetapaE1paraterminardecargarsenuevamente,hastacompletarsuciclo. CircuitoOrgnico Orgnicodescargado SEGUNDAETAPADE EXTRACCIONE2 Orgnicoparcialmente cargado ETAPADERE PRIMERAETAPADE EXTRACCIONS1 EXTRACCIONE1 Orgnico Orgnico Cargado Cargado ESTANQUEDE ORGANICOCARGADO

71

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DESCRIPCCIONETAPADEEXTRACCIONE1 ElorgnicoparcialmentecargadodelasegundaetapadeextraccinE2yelPLSprovenientedelapiscina de alimentacin a la planta de SX ingresan con un flujo aproximado de 40 m/h y 35m/h respectivamente al compartimiento de falso fondo o falsa base de la caja mezcladora de la primera etapadeextraccinE1. El impulsador de la bomba mezcladora succiona el orgnico y el acuoso desde el falso fondo y los va mezclando completamente para que el Cu++ puede ser transferido a la fase orgnica. La mezcla fluye a travs de deflectores y vertederos hasta cumplir con el tiempo de residencia requerido que es aproximadamente3minutosentotal. La mezcladescargahacia el decantadordonde un piket fence distribuye la emulsinuniformementea travsdelanchodeldecantador,cuyopropsitoesproporcionarunareaestabledondeelorgnicoyel acuosopuedenseparase. Separada la fase orgnica de la acuosa, la fase orgnica por tener una menor gravedad especfica 0.83 flota en la superficie de la fase acuosa, rebalsa a su vertedero e ingresa a la canaleta de fase orgnica para luego dirigirse al tanque de orgnica cargado. La fase acuosa con una gravedad especifica 1.02 circuitapordebajodelascanaletasyluegorebosaasuvertedero,ingresaalacanaletadefaseacuosay sedirigealasegundaetapadeextraccinE2. El nivel general del lquido en la canaleta de fase del mezcladordecantador E1 es detectado por un sensordenivel.Losnivelesaltoybajoestncontroladosporalarmas.Unniveldelquidodefaseacuosa muyaltodesactivaelmezcladorprimarioycierrelavlvuladecontroldeflujoPLS. Un sensor de conductividad sumergido en el tanque del mezclador primario indica el mezclador decantadordeE1estfuncionandoonoenfaseorgnicacontinua.Enunacondicinorgnicacontinua, el sensor indica una conductividad relativamente baja, debido a que la fase orgnica no es un buen conductor. Si la continuidad de la fase cambia, la conductividad aumenta. Una alarma indica esta condicinnodeseada. Las fases acuosas y orgnica en los mezcladores tienden naturalmente a formar una fase orgnica continua. Normalmente se pueden cambiar de una a otra (inversin), al controlar la cantidad de recirculacin de fase acuosadesde la canaleta de fase acuosa hacia el mezclador primario o aumentado odisminuyendolosflujosdeorgnicoodeacuosodeingreso. FIG.VERTEDEROS

72

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
FIG.MezcladorDecantadorEtapaE1 ETAPADEEXTRACCIONE2 El acuoso procedente de la primera etapa de extraccin (avance del acuoso) y el organico descargado proveniente de la etapa re extraccin S1 ingresa en el compartimiento de base falsa o falso compartimientoenlabasedecajademezcladelasegundaetapadeextraccinE2. El impulsor de la bomba mezcladora succiona el orgnico y el acuoso del falso fondo mezclndolas completamente de manera que casi todo el cobre que todava quede en el acuosos pueda ser extraido. Lamezclasemuevepordeflectorespasandoaloscompartimientosdelosmezcladoresauxiliaresdonde sigue su proceso hasta cumplir con el tiempo de residencia de tres minutos en total, al cabo de los cualesrebosahaciaeldecantador.Enestemomentolaextraccinprcticamentesehacompletado. FIG.Mezclador Decantador

73

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Igual que en la primera etapa, la mezcla descarga en un canal donde un picket fence (des bordador) distribuye la emulsin uniformemente a lo ancho del decantador. El propsito de hacer pasar la emulsin a travs del decantador es proporcionar un rea de flujo relativamente tranquila para que las fasesorgnicayacuosapuedansepararse. El orgnico, ahora parcialmente cargado de cobre, es ms liviano que el acuoso y flota encima de l, dirigindose hacia el vertedero de orgnico por donde fluye por gravedad hacia la primera etapa de extraccinE1. El acuoso, ahora descargado de casi todo su contenido de iones Cu++ (refino), fluye por debajo de la capa orgnico y se dirige hacia el vertedero del acuosos, el cual es ajustable para controlar la posicin verticaldelainterfaseorgnicoacuoso,pordondefluyeporgravedadhacialapiscinaderefino. El nivel de la solucin en elmezcladordecantador es medido por sensores de nivel. Estos medidores de nivelestnlocalizadoseneldecantadoryenelvertederodeorgnicoenlacualcualquiernivelaltobajo detectadoporestoscontroladoresdenivelcortaralaalimentacindeflujosaltrenSX. Un sensor de conductividad sumergido en el tanque del mezclador primario indica si el mezclador decantadordeE2estfuncionandoonoenfaseorgnicacontinua.Enunacondicinorgnicacontinua, el sensor indica una conductividad relativamente baja, debido a que la fase orgnica no es buena conductoradeelectricidad. Al igual que en la primera etapa de extraccin E1 la segunda etapa de extraccin, la relacin de fase en el mezcladordecantador es orgnicocontinuo. El equipo se opera en orgnicocontinuo para asegurar quelasolucinderefinoquefluyealapiscinanoarrastregotasdemezclaorgnica. FIG.MezcladorDecantadorEtapaE2

74

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DESCRIPCIONDEREEXTRACCIONS1 Esta etapa consta del circuito de electrolito en la cual, la solucin electroltica empobrecida en iones cobreproveniente de las celdas deelectroobtencinconunaconcentracinde 35g/L, es transferidaal tanquederecirculacin(ladodelelectrolitopobre)paraluegoserbombeadaspor3bombascentrifugas horizontales de electrolito pobre como solucin stripp a la etapa de re extraccin S1 pasando por los intercambiadoresdecalorparaaumentarlatemperaturadelelectrolitoricoportransferenciadecalor. El stripp ingresa al mezclador primario de la etapa de re extraccin s1 para descargar el Cu++ del orgnicocargadoaumentandosuconcentracinhasta50g/Lconvirtindoseenelectrolitorico. Elelectrolitoricofluyeporgravedadhaciaelreadetanques,parasupurificacinyacondicionamiento, luegoelelectrolitofiltradoycalentadoingresaaltanquederecirculacindondesemezclaconelelectr olito a EW. El electrolito EW es bombeado por bombas de recirculacion de las celdas de electro obtencionconunaconcentracionde37.8g/L,luegodelprocesodeelectrolisisestasolucionelectrolitica sale de celdas como electrolito pobre regresando al tanque de recirculacion (lado del electrolito pobre) parareiniciarelciclo. ELECTRO OBTENCION Electrolitoaceldas Electrolitopobre Cu:37.8g/L Cu:35g/L ESTANQUEDE RECIRCULACION Electrolitopobre StrippCu:35g/L Cu:50g/L ETAPADE RE EXTRACCIONS1 FIG.MezcladorDecantadorEtapaS1

75

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
MECANISMODELATRANSFERENCIADECOBRE El proceso de SX se basa en la reaccin reversible de intercambio inico entre las dos fases inmiscibles, controlado qumicamente por la acidez o el pH de la fase acuosa. De esta manera se produce un intercambio inico que mantiene en equilibrio el sistema liberando acido de acuerdo a la estequiometriadelsistema. REACCIONESDEEXTRACCION El ion cprico reacciona con el extractante formando un compuesto organometalico insoluble en agua, totalmente soluble en el solvente orgnico (diluyente) con la cual se produce la extraccin del cobre desdelafaseacuosaalaorgnica.Medianteestemecanismo,cadaiondecobreseintercambiacondos iones de hidrogeno que pasan a la fase acuosa donde se regenera acido sulfrico en una proporcin de 1.54(kgdeacido/kgdecobre) DondeRHeselextractante(yaseaaldoxima,ketoximaounacombinacindeambos. REACCIONDEREEXTRACCION Ocurre por efecto del cambio de acidez en la fase acuosa, revertiendo la reaccin y generando un electrolitodealtapurezayaltaconcentracinencobre

76

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
FASEACUOSACONTINUA Se caracteriza por la presencia de gotas de fase orgnica en una matriz de fase acuosa. La fase acuosa continuagarantizaunafaseorgnicalimpia. El mezclador decantador de E1, debe funcionar en fase acuosa continua para asegurar un arrastre mnimodeacuosoenlafaseorgnicacargadaquecirculahacialasiguienteetapa. Mantenerunafaseacuosacontinuaenelmezcladordecantadorimplicadisminuirlavelocidaddelafase orgnicaoaumentarlavelocidaddelarecirculacindelafaseacuosa. FASEORGANICACONTINUA Se caracteriza por la presencia de gotas de fase acuosa en una matriz de fase orgnica. La fase orgnica continuagarantiza una fase acuosa limpia. La segunda etapa de extraccin E2 funciona en faseorgnica continuagarantizandoqueelrefinoqueabandonaelprocesodeextraccincontengalamenorcantidad deorgnicoposible. Trabajar en fase orgnica continua produce atrapamientos de acuoso en orgnico (el orgnico tiende a atrapargotitasdeacuoso),evitandocontaminarlafaseacuoso,pueselorgnicoalrecirculardentrodel circuitodeextraccin,fcilmenteoriginaelregresodegotitasdeacuosoalcircuito. Mantener una fase acuosa orgnica continua en el mezclador decantador de la segunda etapa de extraccin E2 implica disminuir la velocidad de la fase acuosa o aumentar el flujo de recirculacin de la faseorgnica. La profundidad de operacin de las fases orgnica y acuosa en el decantador es normalmente 310mm. Entre ambas fases se produce una capa de material mezclado llamada banda de dispersin, que se extiendeatodoloanchodeldecantador. Fig.FaseAcuosaContinua Fig.FaseOrgnicaContinua

77

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
TIPODEEXTRACTANTESPARALAEXTRACCIONDECOBRE El reactivo inicial usado para recuperar cobre fueron los reactivos ketoximas. Actualmente muchas plantas estn utilizando reactivos saliciladoximas. Los reactivos oximas fueron la alternativa en la extraccinporsolventesporsualtaselectividaddecobrerespectoalfierro. Los reactivos saliciladoxima son extractantes demasiado fuertes para el cobre, ocurriendo que en la etapa de reextraccin se generan dificultades. Consecuentemente estos reactivos fueron modificados para su uso comercial. La modificacin consisti en mezclar estos reactivos con alcoholes, esteres o alkifenoles. La perdida de reactivo extractante en las plantas de SX, es debido al atrapamiento de orgnico en solucin acuosa y por degradacin acida. Los reactivos oximas han demostrado una alta estabilidad a la degradacin acida. La degradacin es particularmente significativa en mezcladores de reextraccin dondeelorgnicoentraencontactoconsolucionesfuertementeacida. Hidroxioximas La estructura general para reactivos hidroxioximas es mostrada en la figura. Estos reactivos pueden ser divididosporestructurasypropiedadesendosclases: Lassaliciladoximas,sonextractantesmuyfuertesdecobre. Lasketoximas,sonmoderadamentefuertesextractantesdecobre. Es importante conocer que la fuerza de extraccin y reextraccin de un reactivo respecto al cobre est basadosobreelgradodeequilibrio: Fig.EstructuradeunaHidroxioximas UnaterceraclasedeextractantessegeneroapartirdelasmezcladasdeketoximasconSaliciladoximas enunaraznmolaraproximadade1:1,estaterceraclasesedistinguedelasanterioresprincipalmente porlatransferenciadecobre,fuerzadelreactivorespectoalcobreysobrelaformacindelcrud.

78

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Saliciladoximas Sonextractantesmuyfuertes,exhibenrpidacinticadetransferenciadecobre,ymuestranexcelente selectividaddecobrerespectoalfierro.Estereactivoysurespectivocomplejodecobre,sonsolublesen losdiluyentes,originandounarpidaseparacindefasesynotransfierenacidosulfricodesdelaetapa dereextraccinhacialaetapadeextraccin.Comosemenciono,ladesventajaesquenecesitandeun modificadordefasesparamejorarlaspropiedadesdereextraccin. El uso de un modificador de equilibrio afecta adversamente las propiedades del reactivo. Por ejemplo, los modificadores son conocidos para acelerar la degradacin del extractante y los modificadores nonifenolgeneranefectosdainossobrematerialesdeconstruccin. Las soluciones de lixiviacin contienen frecuentemente silica disuelta, con lo cual estos modificadores tienden a formar emulsiones estables cuando son contactadas con las soluciones de extraccin; esta tiende a aumentar con la presencia de nonifenol. Los modificadores contribuyen significativamente a la generacin del crud en los circuitos SX, incrementan el atrapamiento de orgnico en las soluciones de refino,tiendenaincrementarelatrapamientodeacuosoenlasolucindeorgnicocargado. Todas las oximas comercialmente disponibles se degradan por la accin cataltica del acido a su respectivo aldehdo o cetona. Aumentando la concentracin del modificador, incrementando la temperaturayunaaltaconcentracindeacidoenelelectrolitodereextraccin,dacomoresultadouna altavelocidaddedegradacin. Se resume que las ketoximas, son ms estables que las saliciladoximas, y dentro de las aldoximas, el derivadododecilesmsestablequeelderivadononil. Ketoximas: Son extractantes moderadamente fuertes tienen cintica de extraccin razonablemente rpida cuando son usados con catalizador cintico, tienen buena selectividad de cobre sobre fierro, y el reactivo y su complejometlicosonsolublesendiluyentes. Elreactivoextractanteesreextradoconmenosacido,comparadoconlasaldoximamodificadores.Son usados sin modificadores de equilibrio. Nos son sensibles a soluciones que contienen slidos o residuos defloculantesyslicecoloidal.

79

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
VARIABLESOPERACIONALESENEXTRACCINPORSOLVENTES Etapadeextraccin: 1.Capacidadmximadelsolventeparaelcobre La capacidad mxima depende fundamentalmente de la concentracin del extractante LIX 860N (50%) LIX84N(50%eneldiluyenteOrfomSX12yelpHdelasolucinacuosa. A mayor concentracin de extractante y con un pH mayor a 2, la capacidad ser mayor, pero a medida que aumenta la concentracin del extractante, la separacin de las dos fases acuosa y orgnica se hace msdifcildebidoaqueaumentalaviscosidadenlamezcla. 2.ConcentracindelextractanteLIX860NyLIX84N Lavariabledeconcentracindeextractanteeneldiluyenteeslamsimportanteyaqueestaenrelacin conelratiodeextraccindecobre. Con una concentracin dada, al subir el pH del PLS, la capacidad mxima tiende a un lmite; la concentracindenuestrasolucinorgnicaesde19,4%deextractantey80,6%dediluyente. 3.pHdelasolucinacuosa El pH de la solucin acuosa inicial (PLS), es la segunda variable en importancia, la experiencia ha demostrado que a menor acidez (o sea mayor pH) mayor ser la transferencia o extraccin de cobre. PudiendotrabajarelextractanteentrelosrangosdepHdesde1.8a2. 4.RelacindevolumenentrelassolucionesorgnicayacuosaenelmezcladorO/A. La relacin entre el flujo de solucinacuosa y el flujo solucin orgnica en el mezclador tiene incidencia notoria en la extraccin, quedando demostrado que cuanto menos sea el flujo de solucin orgnica respectoalflujodesolucinacuosa,msbajaserlaextraccin. 5.Tiempodemezclado El tiempo de mezcla es otra variable de consideracin que influye en la mayor o menor extraccin de cobre,correspondiendoparanuestrocasountiempoeficientedemezclade180segundosporetapa. 6.Tiempodeseparacindefases Eltiempoderetencinenelseparadordefases(sedimentador)estambindeconsideracinyaquecon tiempos de retencin adecuados se lograra separar totalmente las fases, evitando de esta manera los atrapamientosdeorgnicoyacuoso. 7.Continuidaddefases La continuidad de fase deseada se obtiene manteniendo el flujo de sta muy ligeramente ms alto que elflujodelaotrafase.Enunacontinuidadacuosaselograunaseparacindefasesmsrpidayseevita los atrapamientos de acuosos en el orgnico cargado, esta continuidad es de poca viscosidad y coloracin ms clara y tambin se caracteriza por su alta conductividad elctrica. En una continuidad orgnica se evitan los atrapamientos de orgnico en el refino. En esta continuidad se puede notar alta viscosidad,coloracinoscuraybajaconductividad. EnlaprimeraetapadeextraccinE1yenlasegundaE2setrabajaencontinuidadorgnica. 8.Bandadedispersinointerfaseacuoso/orgnico Es aquella zona que se ubica entre la fase orgnica y la fase acuosa del sedimentador, encontrndose mezcladasambasfasesenformadeburbujas. Normalmenteestazonaesanchaalasalidadelmezcladoryvadisminuyendohacialazonaderebosede soluciones dependiendo del tiempo de retencin en el mezclador y del sedimentador respectivo. Es aconsejable que esta fase tenga el espesor minimo posible y se ubique en el nivel medio del sedimentador.

80

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Etapadereextraccin,lasvariablesson: 1.RelacinO/Aenmezcladores La relacin entre el flujo de la solucin acuosa electroltica y el flujo de la solucin orgnica en el mezcladortienetambin,incidencianotoriaenlareextraccin. 2.Temperaturadelelectrolito La temperatura del electrolito influye decisivamente incrementando la eficiencia de reextraccin de cobre y a la vez que acelera la separacin de fase de esta etapa, influyendo indirectamente en forma similarenlaetapadeextraccin. 3.Contenidodecobreenlasolucinacuosaelectrolticadereextraccin El contenidode cobre en la solucin electroltica de re extraccin debe variar entre27a 30g/L, parano restarle acidez (concentracin de acido libre) al electrolito y pueda despojar al orgnico de la mayor cantidaddecobre. 4.Contenidodeacidosulfricoenlasolucindereextraccin Para los propsito de reextraccin caunto mas acido libre tenga el electrolito, mayor ser la eficiencia detransferencia,pudiendoconservarselaacidezen170g/L. 5.Tiempodemezclado Al igual que la etapa de extraccin, el tiempo de reaccin o agitacin de las fases es de 120 segundos por etapa, para asegurar un buena eficiencia de reextraccin y obtener un orgnico descargado con menorcantidaddecobre. 6.Separacindefases A travs de un contol minucioso de la relacin O/A altura de orgnico en el separador y una menor bandadedispersindebeconseguirseunabuenaseparacindelasfasesorgnicayacuosa,controlando losatrapamientosdeorgnicoyacuoso. 7.Continuidaddefases Se debe tener en cuenta al mismo criterio de la etapa de extraccin. En la primera etapa de re extraccinS1setrabajaencontinuidadorgnica.

81

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
PROBLEMASOPERATIVOSUSUALESENEXTRACCINPORSOLVENTE 1.Estabilidaddelextractante Lasprincipalescausasdelextractanteeslaaccindelaguayelacido,yaquesuaccinconjuntadalugar a la hidrlisis. Al hidrolizarse el reactante produce un compuesto inactivo soluble en la solucin acuosa, amayoracidezdelasolucinlahidrlisisseproduceenmayorgrado. Esteproblemasepuedeproducirenlaetapadereextraccinporelusodesolucionesextremadamente acidas(concentracionesmayoresa180gramosdeacidoporlitrodeelectrolito). 2.Volatilizacindeldiluyente Este problema se presenta cuando el sistema est operando a elevadas temperaturas o en climas cidos. La cubierta de los sedimentadores debe mantenerse para evitar el incremento de temperatura delsolventeporlaluzsolar. 3.Separacindefases Laseparacineficientedefasesdependedelavelocidaddeagitacinenlosmezcladores,alaumentarla velocidad hasta cierto lmite es posible obtener una dispersin ms fina y por lo tanto mejorar la eficiencia en las etapas, pero esto aumenta en los consumos de energa y los requerimientos de superficiedelossedimentadores. Otro aspecto relacionado con la separacin de fases es el flujo especifico que se refiere al flujo total de solucin (orgnico y acuoso) por unidad de rea del sedimentador o sea, en nuestro caso el flujo especificoesde2.5m/(h.m). 4.IncrementodelespesordelabandadedispersinointerfaseO/A Este problema evita una eficiente separacin de fases y produce altas perdidas de orgnico. Se consideran apropiadas bandas de dispersin de 8 a 12 cm. La altura de la banda de dispersin depende del flujo especfico ya que al aumentar ste, tambin aumenta proporcionalmente la banda de dispersin. El incremento de temperatura ayuda a disminuir el espesor de la banda de dispersin y mejoralaseparacindefases. A mayor concentracin del extractante es mayor la banda de dispersin. El incremento de la velocidad deagitacintambintieneelmismoefecto. 5.Atrapamientodesolucindeorgnicaenlasolucinacuosa Este es un problema que fuertes prdidas de orgnico. En la prctica conviene trabajar en orgnico continuo para evitar su prdida, pero se debe tener en cuenta la influencia de esta continuidad en el incremento de espesor de la banda de dispersin resultando que la separacin de fase es ms difcil en orgnicocontinuo.Enlaprcticasonaceptablesprdidasdeorgnicoentre50a80partespormilln. 6.Diferenciaentreelarrastredesolucinorgnicaenlasolucinorgnicaacuosa Ladiferenciaesqueelatrapamientodelasolucinacuosaenlasolucinorgnica,produceotrotipode problemas o consecuencias, como por ejemplo incremento de contaminacin del electrolito con impurezas no valiosas como el fiero, el cloro, el manganeso, etc. Los mismos que interfieren en el proceso de electroobtencin, en la eficiencia de corriente y en la calidad del cobre que se produce. El trabajar en acuoso continuo ayuda a disminuir estos atrapamientos pero por otro lado incrementa las prdidasdeorgnico. 7.Importanciadeladeterminacindearrastreorgnicoenacuoso Lapresenciadepequeascantidadesdefaseorgnicadelaetapadeextraccinporsolventescausauna decoloracin en los depsitos del ctodo y en los contornos. Esta porcin de depsito coloreado de marrn oscuro se conoce como Quemado Orgnico. Los depsitos de cobre en el rea quemada son suaves y polvorientos y es probable que un alto grado de impurezas solidas ocurra sobre las areas quemadas.

82

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Una buena operacin y tratamiento de limpieza de orgnico del electrolito proveniente de la etapa de extraccinporsolventesevitarelquemadoorgnico. Este quemado orgnico, es una consecuencia directa del solvente entrampado en las celdas de electrolisis.Eldiluyentedeextraccinporsolventesnogeneraunquemadoorgnico. 8.Formacindeemulsionesestablesocrud Este es un problema comn en todas las plantas de extraccin por solventes. Se trata de orgnico que repercutiranfuertementeenloscostosdeoperacin.Elcrudesdefinidocomoelmaterialresultantede la agitacin de una fase de una fase orgnica, una acuosa y partculas solidas finas que forman una mezcla estable que se ubica en la interfase de las fases, impidiendo la separacin de fases cuando alcanzaespesoresmayoresa710cm.

83

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
VARIABLEDE PROCESO METODODECONTROL IMPACTOSOBREELPROCESO EfectosdeunaaltaT:degradacindelreactivo orgnico,evaporacindeldiluyente EfectosdeunabajaT:Aumentodeviscosidad delassoluciones;disminuyelacinticade extraccin;aumentodeseparacindefases. RANGODEOPERACIN PLS:20Ca21C E1:21Ca22C E2:23Ca24C S:26Ca28C

TEMPERATURA

Inspeccionarcondicindecalor electrolito

Efectosdeunabandaalta:arrastrealaumentar EtapaE1: 40cmdebandadeorgnicoenel lavelocidaddedesplazamientodelacuoso, sector derebosedelvertederode debidoalpesoqueejerceelorgnico. orgnico. BandadeOrgnico EtapaE2,S: Efectosdeunabandabaja:arrastredeborra 25cma28cmdebandaorgnicoenel desdelainterfase,aumentanlosarrastres sectorderebosedelvertederode acuoso/orgnico. orgnico. Sedebeextraerborradesdelos Efectosdeunexcesodeborra: decantadoresysuposteriortratamiento. Lasborraspuedencontaminarelelectrolito. Anlisisycontroldeslidosen Ocasionaprdidasdereactivoorgnicopor suspensinenelPLS arrastrehaciaelrefino. Controldecalidaddeldiluyente Cambialascontinuidadesenetapasqueoperan Limpiezaperidicadeorgnicocon enorgnicocontinuo. <5cmdeborraaloanchodel arcillasyfiltracin Seproducenemulsionesmsestablesque AlturadeBorra decantador. Operarlosvertederosdeorgnico puedencausarunaoperacinincontroladadela inundadosparaevitartraspaso planta Efectosdeausenciadeborra:Nosedebe retirartodalaborra.

Lasbandasdeorgnico seajustan moviendoloslabiosmvilesdelos vertederosdeacuoso

84

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
VARIABLEDE PROCESO METODODECONTROL Sedebemantenerlasvelocidad de agitacinconelcriteriodebuscarun equilibrioentrevelocidaddeagitaciny transferencia Lacalidaddelaoperacinenunaplanta deSXsebasaenminimizarlosarrastres quepuedanafectarlasoperacionesenel readeelectroobtencinylixiviacin. IMPACTOSOBREELPROCESO Efectosdeunaaltavelocidaddemezclado: AumentanlosarrastresA/OyO/A Aumentanlostiemposdeseparacindefases. Mayorformacindeborra. Seproducenemulsionesmsestables,al generarseunagotamsfina. Efectosdeunabajavelocidaddemezclado: Sepuedeentorpecereltraspasodeflujosentre etapas. Bajalaeficienciadelaplanta. EfectosdeunaaltaraznO/A: Retencininnecesariadeorgnico puedecambiarlacontinuidadaorgnicadonde seoperaenacuosocontinuo RANGODEOPERACIN 94%a98%develocidadenmezcladores principales. (47a49RPMagitadoresprincipales) E1:1,11,2 E2:1,251,3 S:1,451,5 EtapaE1,E2,YS:ContinuidadOrgnica

Velocidadde Agitacin

RaznO/A

Continuidadde Fases

EfectosdeunabajaraznO/A: Bajaeficienciadelaplanta. Puedecambiarlacontinuidadaorgnicadonde seoperaenacuosocontinuo. Sedebemantenerlascontinuidadesde ContinuidadOrgnica: fasesdependiendodeltipodearrastre Elorgnicoarrastradoporlafaseacuosagenera queserequierecontrolar. contaminacinenlanavedeEWypilasde lixiviacin. Sepuedecontrolarlacontinuidadde fasespormtodovisual(tipodemezcla), ContinuidadAcuosa: conaccesorios(probeta)omediante Elacuosoarrastradoporlafaseorgnica instrumentacinsensorde produceaumentoenlaconcentracinde conductividad. impurezasenelelectrolito,loquesetraduceen undepsitodemalacalidad.

Sedebeajustarlasrazones0/Aconel propsitodemantenerestableslas continuidadesdefasesylograrlas eficienciasdeseadasenplantadeSX.

85

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
VARIABLEDE PROCESO METODODECONTROL IMPACTOSOBREELPROCESO RANGODEOPERACIN

Flujos

Sedebemanteneruncontrolpermanentedelos Efectosdeflujosaltos:mejoranlastransferencias,perosegeneranmayorescontaminaciones flujosdealimentacinhacialasetapasdeextraccin, alaumentarlosarrastres. reextraccinylavado. Sedebecompararlamedicindelcontrolderazones Efectosdeflujosbajos:noseaprovechanlacapacidadpotencialdelaplanta,disminuyendo O/Aconlostransmisoresdecaudal,paracomprobar laeficienciaglobal siexistendiferencias Disponerdefrascoslimpiosyrotulados.Enelcasode lasmuestrasdeacuososeaplicaunaambientacin delfrascotresvecesantesdetomarlamuestra definitiva Efectosdeunmuestreodeficiente:dacomoresultadoun perfildeoperacioneserrneoypuedellevaratomar decisionesequivocadasquerepercutenenbajas produccionesydemalacalidad.Unatardanzaentomarlas muestrasdeplantaimpedirtomarmedidascorrectivasa tiempo EfectosdelosarrastresO/A:Contaminaelelectrolitoyla calidaddelosctodosconorgnico,ademsseproducen grandesprdidasdelafaseorgnicaenelrefinoquevala lixiviacin.

Muestreode Soluciones

Muestraspuntualescada4 horasdeoperacincontinua

ArrastreO/AyA/O

Filtradode electrolito

OperarenorgnicocontinuolasetapasE1,E2,S. ERicoSX<20ppm Limpiezaperidicadelreactivoorgnicoconarcillas Refino:<20ppm activadas.Usodefloculantescompatiblesconlafase EfectosdelosarrastresA/O:Proveenunavapara E.Circulante:<5ppm orgnica. transferirimpurezasenformadeiones(fierro,cloruro, manganeso,partculassolidasfinasetc.)desdeelPLShacia elelectrolito. Realizarlosretrolavadosdelosfiltros;Mantener Dficitderetrolavados:Saturacindelechofiltranteconorgnicoyslidos,aumentode arrastresycontaminacindelelectrolitoquevahaciaEW. disponibleslosequiposauxiliares:bombasderetro lavado,niveldeaguaenlostanques.;Revisin Excesoderetro lavados:Aumentodeconsumodeaguaporsobreeldiseo,perdidas programadadeniveldeantracita;Mantencin mayoresdeantracitaporefectoderetrolavados programadaporfiltros;SacarmuestrasdeO/Aen horariosdefinidos.

86

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
VARIABLEDE PROCESO METODODECONTROL Sedebecontrolardemanerapermanentelos siguientesparmetros:Temperaturadelas soluciones,Flujodealimentacindelosmezcladores; Velocidaddeagitacin;Continuidaddefases;Banda orgnico;densidadyviscosidaddelassoluciones acuosas;Naturalezayconcentracindelreactivo orgnico. IMPACTOSOBREELPROCESO Efectosdeunabandaalta:Nopermiteunaseparacinde faseseficienteysernecesariobajarlosflujosde alimentacin,disminuyendolarecuperacintotaldeSX. Efectosdeunabandabaja:Unacompletaeliminacindela bandadedispersinnoesrecomendable,yaqueuna pequeacantidadproduceunbuenefectodefiltro. Efectosdeunaltotiempodeseparacindefases:Dificulta laseparacindelasfasesaumentandoelcortedecobrey larecuperacintotaldeSX. Efectosdeunbajotiempodeseparacindefases:Efectos muysimilaresalostiemposdeseparacindefasesaltos, sedeberevisarlaadicindetensoactivosyfloculantes. 120a180segundos RANGODEOPERACIN

Bandade Dispersin

5cmsenelpuntodemedicin delabandadeorgnico.

Sieltiempodeseparacindefasesempiezaa aumentargradualmente,sedebecomenzaralimpiar yfiltrarelorgnicoconarcillasactivadas.Sedebe revisaralgunosparmetrosqueinfluyensobreesta Tiempode variable: velocidaddeagitacin,temperatura, Separacindefases arrastredeairehacialosmezcladores,concentracin deslidosensuspensinyviscosidad.

87

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DESCRIPCIONDEEQUIPOSPRINCIPALES LostanquesmezcladoresTrenABCconstande: Mezcladores(principales,auxilares) Agitadores (consta de un motor, eje transmisin, eje de motor, impulsor de acero inoxidable; caja reductora; rodamientos; sello mecanico; cmara de aciete; guarda acople; cambio de marcha;plataforma;pedestal) Detectordellama Sistemadeespuma Cajademezcla Soporte Vertedero(orgnico,acuoso,fijodeavanceacuoso) TanqueSettler En el mezclador settler ingresa el electrolito al mezclador decantador en la parte central y detrs del picket fence y la descarga es en el extremo de donde salen avance de orgnico, avance acuoso, electrolitocargado(EtapaS1)yrefinoalapiscinaderefino(EtapaE2). Eltanqueconstade: Cajonessettler, Detectordellama, Deflectores, Picketfence, Cajademezcla Listones Soporte, Vertedero(orgnico,acuoso,fijoavanceacuoso) Cajademezcla, Listones, Soporte.

88

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
1. ANALISISDELABORATORIO EXTRACCIONPORSOLVENTE(SX) Diagrama de Mc-Cabe Thile Isoterma de Extraccin 10 9 8 7 6 5 4 3 2 1 0 0 1 2 3 4 5 6 [Cu++] A (gr/L) REEXTRACCION(STRIPPING) Elvolumendeorgnicosemantieneconstante gr.deCuorgnico=gr.inicialesdeCugr.finalesdeCu =[Cu]ac.ixVolumenac.i.[Cu]ac.f.xVolumenac.f. [Cu]o=Volumenacx([Cu]ac.i.[Cu]ac.f.) Volumeno Calculodegramos [Cu]o1*Volo1=2.54*60=152.4gr. [Cu]o2*Volo2=3.375*40=135gr. [Cu]o3*Volo3=5.625*20=112.5gr. [Cu]o4*Volo4=8.25*10=82.5g [Cu]o5*Volo5=9.33*6.7=62.51gr. [Cu]ocargado=gramos=544.911=3.98gr./L Volo136.7 [Cu]oinicial=3.98gr./L Vol.orgnico=20mL,yesconstante Calculo[Cu]ofinal=Volo*[Cu]oiVolA*[Cu]Af Volo
[Cu++] O (gr/L)

89

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
TabladeResultados V.Orgnico V.Acuoso GastoKCN [Cu++]A [Cu++]O Razn(O/A) (ml) (ml) (ml) (gr./L) (gr./L) 3/1 20 60 0.4 1 0.98 2/1 20 40 0.6 1.5 0.98 1/1 20 20 1.4 3.5 9.6 1/2 20 10 2.2 5.5 24.6 1/3 20 6.7 3.1 7.75 1.38 PARAMETROSINICIALESSECTOREXTRACCIONPORSOLVENTE Tiempoderetencindemezcladores(Tr): 3min Flujoespecificodedecantacin: 80lts/minm2. Velocidadtangencialagitador: 1050pies/min. Porcentajev/vdereactivo: 10%v/v Cu++enlaalimentacin: 9.375g/L Eficienciaglobaldeextraccin: 90% 1.1/1 Raznorgnico/acuoso: Raznacuoso/orgnico: 1/1 CALCULOSPREVIOS ExtraccindeCu++desdesolucinrica(tn) Tn=alimentacin*eficienciaglobal. Tn=9.375*0.9=8.4375gr/l Concentracindecobreenelrefino (Cu++)REF=(cu++)ALTn (Cu++)REF=9.3758.4375=0.9375gr/l. CALCULOSDEFLUJO Alimentacin. Qal=1x106(grcu++/da)/Tnx1440(min/da) Qal=82l/min Qal=Qorg=82L/min. Transferencianetadiariaalaplanta(Tn). Tn=Qalx1440x(Cu++)alxEG/1000 Tn=82*1440*9.375*0.9/1000=996.3kg/da. CALCULODELASDIMENSIONESDELOSMEZCLADORESDEEXTRACCIONYREEXTRACCION Vm=Qal*Tr*RO/A/1000 Vm=82*3*(1.1+1)/1000=0.5166m3 Mezcladorcubico. Lm=(Vm)1/3=0.80m.

90

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CALCULODELDIAMETRODEAGITADORYPOTENCIADELMOTOR Da=0.5*Lm Da=0.5*0.8=0.4m=1.31ft. Frecuenciaestdadapor. F=Vt/(*Da) F=1050/(*1.31)=255rpm=4.25rps. Vt:velocidadtangencialenpies/min F:frecuenciaenrpm. Da:dimetrodelagitadorenpies. Lapotenciadelmotorestdadapor: P=NP*Pesp*Da5*f3/(550*g*r) P:potenciadelmotorenHP. NP:ndepotencia. Pesp:pesoespecificodelamezclaenmezcladorenlbs./pie3. Da:dimetrodelagitadorenpies. f:frecuenciaenrps. g:aceleracindegravedadenpies/seg2. r:rendimientodelmotoren%. Adoptando: NP= 1.8 Pesp= 1.0kg/l=62.4lbs./pie3. Da= 1.31ft. f= 4.25rps. g= 32.2pies/seg2 r= 75% P= 2.50HP. Paranuestroproyectoseusaraunmotorde4hpporcomercializarmedemejormaneraenlaindustria. Losparmetrossernentonces. P= 4HP. Da= 1.43ft.=0.43m=0.5m Lm= 2.86ft.=0.87m=1m Laalturadellquidoenelmezcladorestdadapor: Alm=vm/lm2=0.5166/1=0.52m Considerandobordedeseguridad=0.40m Laalturatotalser= 0.92m

91

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CALCULODELASDIMENSIONESDELDECANTADOR Ad=Qal*RO/A/Fesp. Ad:readedecantacinenm2. Qal:flujodesol.dealimentacinenl/min. RO/A:sumadelosvaloresdelaraznO/A. Fesp:flujoespecificodedecantacinenl/min*m2. Ad=82*(1.1+1.0)/80=2.15m2. Adoptandounanchodedecantadorde1.4m,ellargodeldecantadoresde2.15/1.4=1.5m. CALCULODEINVENTARIODEORGANICO. Volumentotaldeorgnicoenmezcladores. Vtm=Qorg*(1.1+1.0+1.1)*Tr Vtm=82*3.2*3=787.2L Volumentotaldeorgnicoendecantadores. Vd=Ad*Co*n*1000 Vd:volumentotaldeorganicoendecantadoresenL. Ad:areadecantadorenm2. Co:capadeorganicoenm N:numerodedecantadores. Vd=2.15*0.15*3*1000=967.5L. Subtotalequipos:2570L 25%aprox.Enestanqueytuberas:643L TOTALINVENTARIOPLANTA:3213L PERDIDASPORARRASTRE(3MESESA70PPM) ARRASTRE=0.12*1440*90*0.07=1089L TOTALINVENTARIOPARAINVERSION:4302L CALCULODECOMPOSICIONYCOSTODELORGANICO. Composicin. Reactivo:LIX984(25%V/V) Volumendereactivo=0.25*4302=1076L Gravedadespecificadelreactivo=0.91kg/L Masadereactivo=0.91*1076=979.2kg Masadereactivo= =2176lbs Solvente:ESCAID100 Volumendesolvente=0.75*4302=3227L.=3.227m3.

92

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CAPITULO8.

DESCRIPCIONGENERALDEELECTROOBTENCION. El electrolito rico acondicionado con una concentracin de cobre no menor a 38gr/L y una temperatura de aproximada a 48C es bombeado por bombas a las celdas electrolticas, cada celda contiene de 14 placas catdicas y 14 nodos al cabo de 6 o 7 das se cosechan los ctodos con 99.99% de pureza empleando una densidad de corriente 190 A/m2. Luego se les separa de la plancha madre por medio de dos maquinas despegadoras de ctodos obtenindose lminas de cobre de 40 kilogramos los cuales son corrugados y empaquetados para su comercializacin. El electrolito que rebosalasceldasretornaaltanquederecirculacincomoelectrolitopobre. Laelectroobtencindecobre,serealizaenunaceldacompuestaporunacubaconelectrolito(solucin acuosa,concobreycidosulfricoensolucin,entreotros),yctodossobreloscualesserecuperarel cobre, y por nodos que deben ser inatacables, para evitar la contaminacin de la solucin y del depsito. El ctodo puede ser de cobre (tecnologa convencional de ctodos iniciales) o de acero inoxidable316Lynodosdeplomo. Bsicamente, en el ctodo se depositar el cobre metlico que hay en solucin (electrolito), y en el nodo,seproducelaoxidacindelagua,producindosegasdeoxgeno.Raznporlacual,vemosenlos nodos producirse burbujas (O2 oxgeno), burbujas que al salir fuera del electrolito, forman una neblina cida producto del arrastre de electrolito. En las celdas se colocan esferas u otro material, para controlarlaemisindeneblinaalaatmsfera.

DIAGRAMA ILUSTRATIVO
VAPOR ENERGIA CALOR OXIGENO DESCARTE ACIDO AGUA

Electrolito Rico

ELECTROOBTENCIN

Electrolito Pobre

CALOR

SULFATO FERROSO Y/O

GALACTASOL

CATODOS

93

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Parmetrosincialessectordeelectroobtencin. Energa/KgCu : : : 2.2KWH/KgCu. : 200amp/m2.

Densidaddecorriente(dc)

reacatdica(estndarENAMI)(ac) Eficienciadecorriente() a)

1.8335m2/ctodo. 90%.

Calculodelacapacidaddeltransformadorrectificador(CRT). CRT=(energa/kgCu)xPd/24

CRT:capacidaddeltransformadorrectificadorenKVA. Pd:produccindiariadecobrecatdicoenKg/da. CRT=2.2*1000/24=92KVA. b) Calculodeldepsitodiarioporctodoyndectodosausar.

Deposito/da*ctodo=dc*Ac*0.02844* 0.02844cantidaddecobredepositadodiariamenteporunampere. Deposito/da*ctodo=200*1.8335*0.02844*0.9=9.386kg/da Nctodosausar=Pd/Deposito/da*ctodo=1000/9.386=106

ReaccinAndica:H2O 1/2O2+2H++2e E:1.23(V) ReaccinCatdica:Cu+2+2eCuE:0.34(v)

94

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
Por conveniencia se adopta una configuracin de 8 celdas con 14 ctodos c/u, con ello, la densidad de corrientebajaa: dc=200*106/(8*14)=190amp/m2. Recalculandoeldepsitodiario/ctodoparaestanuevadensidaddecorriente,seobtiene: Deposito/da*ctodo=190*1.8335*0.02844*0.9=8.92kg/da.

EsquemadeCeldadeElectroobtencin

95

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CaractersticasdelCtodo Caractersticasdelnodo Composicinnodo Pb:98.1698.61% Ca:0.0550.1% Sn:1.301.70% Al:0.020% Ag:0.002% Bi:0.005% Material:AceroInoxidable:AISI316L ComposicinCtodo: Fe:61.468.90% C:Hasta0.030% Cr:16.0018.50% Mn:Hasta2.00% Mo:2.003.00% Ni:10.0014.00%

96

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CircuitoelctricoElectroobtencin

97

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
DESCRIPCIONGENERALDEAREASDESERVICIOS Esta rea comprende todos los servicios complementarios necesarios que requieren los procesos de chancado aglomeracin lixiviacin, extraccin por solventes y electro obtencin, tales como, sistemas deagua,aire,reactivos,ysistemasdedistribucindeenergaeiluminacin. Los sistemas de agua comprenden: agua de proceso, agua potable, agua contra incendio. El agua de procesoestdadaporelaguaquepasaporunprocesodepurificacinenlaplantadeosmosisinversa El sistema de aguacaliente, utiliza calderospara calentaraguaa una temperaturade85Cque ingresa a los intercambiadores de calor, que sirve para mantener a una temperatura adecuada del electrolito rico.Elaguacalienteesusada,adicionalmente,enellavadodectodosrealizadoenlacasadeceldasde electroobtencinaunatemperaturade75C. Lossistemasdeairecomprenden:airedeservicioydeinstrumentacin Losreactivosusadosenlaplantason:cidosulfrico,extractante,diluyente,guartec,sulfatodecobalto Estos reactivos son agregados en las etapas de Lixiviacin, Extraccin por solventes y Electrowinning,su funcin en LIX es disolver el mineral y formar una solucin acuosa PLS , en SX es la de formar la solucin orgnica que concentra cobre de la solucin acuosa, mientras que en el proceso de electro obtencin,mejoranlacalidadfinaldelctodoyalarganeltiempodevidadelnodo. El sistema de distribucin de energa para los equipos del proceso y para la iluminacin general, se distribuyeatravsdesubestaciones.

98

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CAPITULO9.

COSTODELPROYECTO PARAMETROSDECOSTOSENLAZONADELIXIVIACIONYELECTROBTENCION LIXIVIACION GeomembranaHDPE2mm*8m Pila USD8704 Estanques USD95330 ConexinlixiviacinSXEWeinteriorplanta,con USD36000 Soporteyotros. TOTAL USD140034 EXTRACCIONPORSOLVENTEYELECTROOBTENCION EquipoSX(mezcladores,decantadores,trampa USD55500 Deorgnico,medidoresdeflujo,pipingdirectoadosado) Agitadores(motorreductor,ejeagitador) USD11300 Bombas(3de1HPY3DEHP) USD6760 USD19400 Estanques(soluciones,orgnico,electroltico,sumidero, Compensadoresdeflujo) Inventariodeorgnico USD20315 Transformadorrectificador(amperostaticoregulable, USD37800 ConmedidordecontrolesybarrasdeconexinaEW). CeldasEWequipadas(cajasdeconcreto,revestimientos, USD36600 Barrasconductoras,colgadores). nodosdeplomo USD27500 USD57935 Varios(intercambiadordecalor,lavadodectodos, Gractodos,calefactor,laboratoriocontrol,varios Eimprevistos). TOTAL USD273110 (Incluyeingeniera,entrenamientodelpersonalyasistenciaenlapuestaenmarcha)

99

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
RESUMENESTIMACIONCOSTOAREAPLANTA ZONADEPROCESAMIENTOUSD710000 (Incluyendolostamboresdeaglomeracin) LIXIVIACIONUSD140034 EXTRACCIONPORSOLVENTEYELECTROOBTENCIONUSD273110 Seestimaqueelcostodelosaceros,hormign,tuberas,acerosparalaconstruccinyinstalacinde laplantaesalrededorde1,000,000USD. TOTALUSD2,123,144 COSTOTOTALDEOPERACIN Parmetrosinciales. Leydecobre 1.6% Recuperacinenlix 85% Ciclodelixiviacin 30das Alturadelapila 2m Tasaderiego 14l/hrm2 Pesoespecificoaparente 1.84ton/m3 Tonelaje/dademineralatratar 1500ton/da Estructuradecostosenlaoperacindelaplanta. Mineral(1.6%) 5.06USD/tonpuestoplanta. Chancado 12USD/tonmineral. Insumos. Acido(5.5kg/kgCu) 50USD/tonacido. ReactivoSX 5.03USD/L. Movimientodemineralyripio. 1.2USD/ton. Agua 0.15USD/m3. Energa(lix,chancado,sx) 510cUSD/KWH. EnergaEW 510cUSD/KWH. Personal. Flete. Supervisor Trabajador 2400USD/mes. 1300USD/mes. 0.08USD/ton*km

Gastosgeneralesyadm.

1.5USD/ton

100

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
CONSUMOSMENSUALESPARALACAPACIDADDETRATAMIENTODE1500TON/DIA Mineral 45000ton/mes Acidosulfrico(2kg/kgCu) 1224ton/mes Agua 24456.52m3/mes Mov.Material 45000ton/mes Energaelctrica(LXCHASX) 900000kwh/mes Energaelctrica(EW) 1267200kwh/mes. ReactivoSX 300l/mes Manodeobra supervisor 3sup/mes 13pers/mes Manodeobrapersonal Fleteproducto 30ton/mes.

CALCULODELCOSTOTOTALDIRECTO. Mineral 227700USD/mes Acidosulfrico(2kg/kgCu) 61200USD/mes Agua 3669USD/mes Mov.Material 54000USD/mes Energaelctrica(LXCHASX) 90000USD/mes Energaelctrica(EW) 126720USD/mes. ReactivoSX 1509USD/mes Manodeobra supervisor 7200USD/mes Manodeobrapersonal 16900USD/mes 145USD/mes Fleteproducto TOTALCOSTODIRECTO 661,398USD/mes COSTOTOTALINDIRECTO Administracinygastosgenerales 67500USD/mes. Mantencin(0.8%inversin/mes) 91281USD/mes. Varios(estimacin20%inv) 31756USD/mes. TOTALCOSTOINDIRECTO 190,537USD/mes. TOTALCOSTOMENSUAL 851,935USD/mes TOTALCOSTO(DIRECTO+INDIRECTO)ANUAL10,223,220USD/a ESTIMACIONCOSTOTOTALDEINVERSIONPLANTADEBENEFICIO:2,123,144USD ESTIMACIONCOSTOEQUIPOSMINEROS CAMIONCAT769(2camiones) USD252000 CARGADORFRONTAL(2unidades) USD86000 ESTIMACIONCOSTOTOTALDEINVERSIONEQUIPOSMINEROSUSD338,000 ESTIMACIONINGRESOS PRODUCCION(TonCuFino/mes) = 576TonCu/mes PRODUCCION(LbCuFino/mes) =1269863LbCu/mes COSTOUNITARIO =59.7cUSD/LbCu PRECIODELCOBRE:295c/lb INGRESOANUAL:36.307.688USD

101

COMPAAMINERAOLIVIAPROYECTOPLANTA2010
AOS INVERSION EquiposMineros PlantadeBeneficio CapitaldeTrabajo Prstamo 1,656,301 INGRESOS EGRESOS CostosOperacionales DEP.Eq.Mineros() DEP.PldeBeneficio() InteresesPrstamo UtilidadBruta Impuesto(17%) UtilidadNeta ValorResidual DEP.Eq.Mineros(+) DepPl.Beneficio(+) INVERSION(Io) FlujoNeto(Fn) Fn/(1+i)^n 1,419,686 10,223,220 10,223,220 10,223,220 10,223,220 10,223,220 10,223,220 10,223,220 10,223,220 10,223,220 24,300 24,300 24,300 24,300 24,300 24,300 24,300 24,300 24,300 212,314 1,002,274 1,002,274 1,002,274 1,002,274 1,002,274 1,002,274 1,002,274 1,002,274 1,177,047 1,294,751 1,424,221 1,566,643 1,723,308 24,670,807 5,609,299 5,479,829 5,337,407 5,180,742 6,904,050 6,904,050 6,904,050 6,904,050 4,194,037 953,581 931,571 907,359 880,726 1,173,689 1,173,689 1,173,689 1,173,689 20,476,769 4,655,718 4,548,258 4,430,048 4,300,016 5,730,362 5,730,362 5,730,362 5,730,362 1,026,574 24,300 24,300 24,300 24,300 24,300 24,300 24,300 24,300 24,300 212,314 1,002,274 1,002,274 1,002,274 1,002,274 1,002,274 1,002,274 1,002,274 1,002,274 20,713,384 5,682,292 5,574,832 5,456,622 5,326,590 6,756,936 6,756,936 6,756,936 7,783,510 18,830,349 4,696,109 4,188,454 3,726,946 3,307,393 3,814,114 3,467,376 3,152,160 3,300,968 36,307,688 18,153,844 18,153,844 18,153,844 18,153,844 18,153,844 18,153,844 18,153,844 18,153,844 243,000 2,123,144 709,843

ESTIMACIONFLUJODECAJA
0 1 2 3 4 Considerando: 5 6 7 8 9

TasadeInters:10%. VidatildelaMina:9aos

VAN:47,064,183.36

102

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 SELECCINDEEQUIPOS
CaractersticasdelcaminaUtilizar

Capacidadnominaldecarga til MximacapacidadalrasSAE Capacidad(2:1)SAE Capacidadmxima

36.4toneladas mtricas 17.0m3 24.2m3 36.58toneladas mtricas


Modelodecamin769D.

1 2 3 4 5 6 7 8

Pisoplano 7615 1390 5430 7751 3188 465 315 2541

Doble declive 5430 1454 5275 7709 3143 525 415 2380


9 10 Pisoplano 4072 3997 Dobledeclive 4027 3952

Costo Camin 769D = USD126.000

103

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 SELECCINCARGADORFRONTAL CargadorFrontalZL30F Caractersticas: Especificacionesdelamquina: Carga: 3000kg Tiempodelevantedelbrazo: 6.5s Tiempototaldelas3 12s operaciones: Capacidaddetrepado: 28 Radiomnimodegiro(Centrode 5770mm laruedatraseraexterna): Pesototal: 9950kg Capacidaddelestanquede 150L combustible: Capacidaddelestanquede 130L aceitehidrulico: MotorDiesel: Potencia: 125HP Consumoespecificode <224g/kW.h combustible: Velocidaddedesplazamiento: Velocidaddecambiosenreversa: 7.5~27(III)km/h Picaroca Es un equipo hidrulico que se encuentra ubicado en la parte superior de la cmara de recepcin de mineral del chancador primario. Este equipo consta principalmente de un conjunto de brazo articulado montado sobre un descanso oscilante (base balanceo), un accionamiento oscilante (balanceo) accionado por un cilindro hidrulico y un martillo hidrulicodeimpactopararomper. Fractura el mineral con tamao mayor a 200mm proveniente de mina y que por su sobre tamaonopuedesertrituradoporelchancador.

104

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 CONCLUSION El proyecto planta de la compaa minera Olivia posee como actividad central la obtencin de ctodos de cobre como producto final, posee un buen indicio de inversin generando un ganancia anual a partir del segundo ao un valor sobre los 29 millones de dlares con un preciodeCu295c/lb. En el anlisis de proyecto planta es fundamental conocer todas las variables del tipo de roca que se est tratando (granulometra, abrasividad etc.) y las impurezas de estas ya que cada parmetroafectaengrancantidadellogrodeobtenermayoreficienciayeficaciaenelsistema de tratamiento, por eso se debe realizar un estudio granulomtrica y mineralgica antes de empezar a realizar el proyecto o compra de maquinarias ya que s no se realiza el estudio e anlisisdecualquieradeestasvariablespuedegenerargrandesprdidas. El gran riesgo en que se puede producir en el proyecto es drenaje de acido debido a la lixiviacin y los cidos a utilizar se debe tener en cuenta que la recepcin de estos reactivos deben preservarse en una zona segura en la cual el relieve debe ser lo ms parejo y ser de buena calidad para luego no producir derrame y lo mismo con las capas impermeables, por lo tanto es aqu donde se deber invertir en mayor cantidad ya que lo ms importante es el cuidadodenuestroecologasuconservacin, El costo ms elevado dentro del proyecto son los costos directos e indirectos sumando un costo anual aproximado de 10 millones de dlares anuales, es aqu donde la ingeniera debe lograr mayor eficiencia y eficacia para disminuirlo con la innovacin de la tecnologa, buscandoenergalimpiaparasudesarrollodeinstalacinderedessolareseutilizandoenerga elica, la cual disminuir los costos, y tambin utilizar nuevos mtodos sofisticados como es la lixiviacin por agua del mar que es un mtodo nuevo patentado por grandes empresas mineras(clohrideLeah).

105

COMPAAMINERAOLIVIAPROYECTOPLANTA2010 BIBLIOGRAFIA Apuntesdeclasedehidrometalurgia. Apuntesdeprocesamientodeminerales. ApuntesClculosuperficiedeCribado ApuntesdeEconomiaMinera Informedelaboratoriohidrometalurgiayprocesamientodeminerales. Tesisingenieraconceptualysuaplicacinenunaplantapilotodeextraccinpor solvente,electroobtencin Tesisoptimizacindeplantadeextraccinporsolvente Pginasdeinternet:proveedoresMETSO,AQUAMARKET,SENNINGER,SOLING, CompaaZenithdeShanghaiChina,etc https://www.eseia.cl/documentos/documento.php?idDocumento=119588 http://www.sernageomin.cl http://www.cosmos.com.mx/i/4bn3.htm#cotiza http://www.haverbrasil.com.br/esp/equipamentos/index.php?sec=mineral http://es.wikipedia.org/wiki/Impacto_ambiental_potencial_de_la_extracci%C3%B3n_ y_procesamiento_de_minerales http://www.portalsonami.cl/pm_tramites01.htm AYUDA DE Renato Verdejo Daz, Sales Support Mining Equipment, Metso Mining & ConstructionTechnology,enlaconfeccindeldiseodechancador

106

COMPAAMINERAOLIVIAPROYECTOPLANTA2010

107