Está en la página 1de 30

CAPITULO

16

Cncer
16-1 Biologa del cncer 16-2 Causas del cncer 16-3 Gentica del cncer La va experimental: El descubrimiento de los oncogenes

FIGURA 16-A. Mamografa que muestra la presencia de un tumor. (Vu SlU/Visuals Unmited.)

l cncer es una enfermedad producida por cambios en la conducta de las clulas, provocada por modificaciones en la informacin gentica subyacente de las mismas. Debido a estas alteraciones, las clulas cancerosas proliferan sin control formando tumores malignos que tienden a crecer de manera invasiva (fig. 16-), destruyendo tejidos y rganos normales. En tanto el crecimiento del tumor permanezca localizado, la enfermedad de ordinario se puede tratar y curar por extirpacin quirrgica del tumor y el tejido que lo rodea. Sin embargo, una de las caractersticas prominentes de los tumores malignos es su tendencia a formar metstasis, o sea, clulas que se desprenden de la masa original entran a la circulacin linftica o sangunea y se propagan a sitios distantes en el cuerpo, donde establecen tumores secundarios (metstasis) que ya no son susceptibles de extirpacin quirrgica. Los cambios en la superficie celular que promueven la conducta metasttica de las clulas cancerosas se analizan en La perspectiva humana del captulo 7. Debido a su impacto sobre la salud humana y a la esperanza de encontrar una curacin, el cncer ha sido foco de esfuerzos intensos de investigacin durante decenios. Aunque estos estudios han conducido a un notable avance en el conocimiento de las bases celulares y moleculares del cncer, prcticamente no tienen impacto en la prevencin o el aumento de la tasa de supervivencia de personas afectadas con la mayor parte de los tipos de cncer. En la figura 16-2 se muestra la tasa de ocurrencia de diferentes tipos de cncer y la mortalidad consecuente en Estados Unidos. Los tratamientos actuales, como la quimioterapia y la radiacin, son incapaces de destruir selectivamente a las clulas cancerosas sin daar en forma simultnea a clulas normales, segn puede juzgarse por los graves efectos colaterales que acompaan a estos tratamientos. Como resultado, los pacientes por lo general no se pueden someter a dosis suficientemente alt.is para destruir todas las clulas tumorales de su cuerpo.

671

672

CAPITULO 16 Cncer

>

--A-.>v'

contra dichas clulas para destruir hasta la ltima de ellas. Gran parte de este optimismo se desvaneci en aos recientes conforme se acumularon datos de que el sistema inrnunolgco no es tan eficiente para destruir clulas cancerosas, como alguna vez se pens. Aunque en la actualidad se estn planeando pruebas clnicas de numerosos agentes estimuladores inmunolgicos o "vacunas contra el cncer", las expectativas alguna vez relacionadas con este tipo de ensayos clnicos han disminuido notablemente.

16-1

Biologa del cncer

FIGURA 1 6 - 1 . Invasin del tejido normal por un tumor en crecimiento. Esta micrografa de luz de un corte de hgado humano muestra metstasis de un melanosarcoma (en rojo) que invade el tejido heptico normal. (Micrografa por Astrid y Hanns-Frieder Michler/ Science Photo Library/Photo Researchers, Inc.)

Es difcil afirmar si esta situacin puede cambiar en un futuro cercano. En la actualidad se han identificado muchos de los genes y productos de gen causantes de los cnceres humanos, y ios investigadores tienen mejores objetivos que cumplir. La idea del tratamiento del cncer mediante geneterapia se analiz en La perspectiva humana del captulo 10 (pg. 423). Una curacin basada en la geneterapia puede ser la mejor expectativa a largo plazo en la guerra contra el cncer, pero los tratamientos de este tipo requieren que la mayor parte, si no es que todas, de las clulas tumorales se alteren genticamente. En el momento actual, la modificacin del genoma de miles de millones de clulas malignas enterradas profundamente en los tejidos del cuerpo todava es un proyecto distante. La mayor parte de los esfuerzos actuales para lograr tratamientos innovadores contra el cncer se centran en los intentos de obtener que el sistema inmunolgico participe de manera ms activa en la lucha contra las clulas malignas. Hace diez o veinte aos, aproximadamente, hubo gran optimismo por la posibilidad de inducir en el sistema inmunolgico de una persona la capacidad para reconocer clulas cancerosas como cuerpos extraos y establecer un ataque

Gran parte del conocimiento adquirido acerca de la conducta de clulas cancerosas humanas proviene de estudios en los cuales se cultivan clulas derivadas de un tumor. A nivel celular, la caracterstica ms importante de una clula cancerosa, ya sea que resida en el cuerpo o en un plato de cultivo, es la prdida de control de su crecimiento. La capacidad de crecimiento y divisin no es tan diferente entre una clula cancerosa y la mayor parte de las clulas normales. Cuando estas ltimas crecen en un cultivo de tejidos, bajo condiciones que favorecen la proliferacin celular, se desarrollan y dividen a una velocidad similar a la de sus contrapartes malignas. Sin embargo, cuando las clulas normales proliferan hasta el punto de cubrir el fondo del plato de cultivo, su tasa de crecimiento disminuye notablemente y tienden a permanecer como una capa simple (monocapa] de clulas (fig. 16-3, a,b). La disminucin de la tasa de crecimiento se debe a que las clulas responden a influencias inhibidoras de su ambiente. Estas influencias inhibidoras del crecimiento pueden surgir como resultado de deplecin de factores del crecimiento en el medio de cultivo o de contacto con clulas circunvecinas en el plato de cultivo. En contraste, cuando se cultivan clulas malignas en las mismas condiciones, continan creciendo, apilndose una encima de otra para formar grumos (fig. 16-3, c,d). Es evidente que las clulas malignas no responden a las influencias que causan el cese de crecimiento y divisin en sus contrapartes normales. Esta misma falta de respuesta a seales externas es la razn de que las clulas cancerosas constituyan una amenaza dentro del cuerpo. El crecimiento incontrolado, combinado con la tendencia a producir metstasis, confiere a las clulas malignas su caracterstica de amenaza mortal. Retornaremos

300
mE

_ [/) :=

250 200

= E

150

FIGURA 16-2. Incidencia de varios tipos de cncer en Estados Unidos y nmero de muertes que causan por ao. Tomado de los datos comunicados por el National Cncer Institute.

I
Mamas Pulmn y Prstata bronquios

Colon/ Unfoma no Leucemias Pncreas Todos recto de Hodgkin los dems

CAPITULO 16 Cncer Clulas normales

673

FIGURA 16-3. Propiedades del crecimiento de clulas normales y clulas cancerosas. Tpicamente, las cWissi Tiwnireies ciecen en un p'iaXo e cuYirvo "nasta que cubren la superficie del plato como una monocapa (ay b). En contraste, las clulas transformadas por virus o carcingenos qumicos (o clulas malignas cultivadas a partir de tumores) de manera peculiar crecen formando

(a)

Las clulas normales crecen err rrrorracape Clulas cancerosas

^TOCfe fe mt^Vs, sapse,, > fess ft ^ fy.


de G. Stevcn Martin.)

(e)

Las clulas cancerosas crecen en grumos (focos)

(d)

a los tipos de cambios celulares que sirven como marcas caractersticas de as cufas malignas., pero primero consideraremos algunas de las propiedades morfolgicas y bioqumicas que distinguen a las clulas normales de las malignas. Fenotipo de una clula cancerosa Se han catalogado numerosas diferencias, tanto estructurales como bioqumicas, entre clulas normales y clulas cancerosas. Sin embargo, tambin hay muchas variables de un tipo de cua cancerosa a otra, haciendo imposible describir las propiedades de una clula cancerosa "tpica". Tambin resulta difcil afirmar cules, de todas las diferencias entre clulas normales y cancerosas, son la principal causa de que la clula se vuelva potencialmente una amenaza para la vida, y cules son las propiedades secundarias que resultan de los cambios primarios. La conducta de las clulas cancerosas es ms fcil de estudiar cuando las clulas crecen en cultivo. Se pueden obtener clulas de este tipo extirpando un tumor maligno, disociando el tejido para separar las clulas y luego cultivando las clulas in vitro. Alternativamente, las clulas normales se pueden convertir en "clulas cancerosas" mediante tratamiento con un carcingeno qumico, radiaciones o un virus tumoral infeccioso. Las clulas as transformadas por sustancias qumicas o virus en cultivo por lo general pueden formar un tumor cuando se introducen en un animal husped apropiado. Las alteraciones ms notables despus de la transformacin ocurren en los cromosomas. En general, las clulas normales conservan su dotacin cromosmica diploide normal conforme crecen y se dividen, tanto in vivo como in vitro. En contraste, las clulas cancerosas con frecuencia presentan

dotacin cromosmica muy aberrante,, alteracia denomina da aneuploidia (ftg. 16-4). Estos caotipos muy aberrantes al parecer son resultado de crecimiento anormal de las clulas cancerosas, ms bien que una causa de las mismas. De todas maneras, es evidente que el crecimiento de las clulas cancerosas depende mucho menos de un contenido cromosmico normal en comparacin con las clulas normales. Los cambios morfolgicos ms notables que ocurren en el citoplasma casi siempre afectan al citoesqueleto. En tanto una clula normal por lo general contiene una red bien organizada de microtbulos, microflamentos y filamentos intermedios, el citoesqueleto de las clulas cancerosas a menudo est reducido, desorganizado, o ambas cosas (fig. 16-5). Tambin se ha comunicado que ocurren numerosos cambios en la superficie celular, incluyendo la aparicin (o incremento) y desaparicin (o disminucin) de componentes particulares^ Algunas clulas cancerosas poseen nuevas protenas en la superficie celular conocidas como antgenos asociados al tumor porque pueden inducir la formacin de anticuerpos dirigidos contra las clulas. Debido a los cambios en la superficie celular, tpicamente las clulas cancerosas son menos adherentes, tanto entre s como a los sustratos no celulares. Se cree que esta prdida de adhesividad se correlaciona con la capacidad de las clulas cancerosas para abandonar una masa tumoral y emigrar a otros sitios dentro del cuerpo. La disminucin de las interacciones adhesivas entre clulas tumorales tambin se refleja en la reduccin de su tendencia a formar uniones de abertura entre s (pg. 271). Tambin se puede distinguir a las clulas cancerosas de las normales por su movilidad en cultivo. Como se hizo notar en el captulo 9, la membrana de una clula normal, cuando entra en contacto con otra clula, cesa su actividad y

674

CAPITULO 16 - Cncer

** 11
12

16
* 19
20

17

21

22

FIGURA 16-4. Cariotipo de un tumor maligno de pncreas en un paciente varn, mostrando una dotacin de cromosomas totalmente anormal. La clula a partir de ia cual se prepar este cariotipo contiene un total de'60 cromosomas en vez del nmero normal de 46 (fig. 12-17, c) con dos cromosomas (nmeros 18 y 21) totalmente ausentes. La redisposicin de los cromosomas est indicada por flechas pequeas. (Segn Suresh C. ]hanwar, Memorial Sloan-Kettcring Cncer Center.)

lireccin original. Cuando las clulas normales son rodeadas por todos lados por otras clulas, su motilidad cesa; no pueden desplazarse una sobre otra y formar una capa en ef foncfo cfef pato efe cuftivo. Las cernas cancerosas por lo general ignoran las seales transmitidas
por clulas vecinas y continan sus actividades locomotoras

acostumbradas. Como se hizo notar antes, la vecindad de otras clulas tiene poco efecto sobre el crecimiento de las clulas cancerosas que continan proliferando en cultivo celular hasta afcanzar una densidad cefufar muy afta en comparacin con sus contrapartes normales (como en la figura 16-3, d).

(a)

(b)

FIGUKA 16-5. Comparacin del citoesqueleto microtubular en clulas cultivadas transformadas y testigos. La disposicin de los microtbulos en estas clulas se revel mediante inmunofluorescencia utilizando anticuerpos antitubulina. a) Estos fibroblastos se infectaron con un virus tumorai sensible a temperatura y se cultivaron a temperatura ms alta restrictiva en la cual la protena que transforma las clulas no es funcional. Las propiedades de crecimiento y la disposicin de los microtbulos son normales, b) Las clulas del mismo cultivo mostradas en a crecen a la temperatura permisiva ms baja en la cual se expresa el fenotipo transformado. El aparato citoesqueltico est muy desorganizado. (Segn Rala L Brown y cois. Proc. Nati. Acad. Sci. U.S.A. 78:5595, 1981.)

CAPTULO 16 Cncer

675

Las clulas cancerosas tambin dependen mucho menos de la presencia de suero (fig. 16-6), el cual les suministra factores de crecimiento, como el factor de crecimiento epidrmico (FCE) o insulina. La falta de dependencia del suero refleja la capacidad de las clulas cancerosas de proliferar sin depender de seales transmitidas desde sus receptores de superficie (cap. 15). Adems, a diferencia de las clulas normales, que requieren un sustrato slido sobre el cual crecer, las clulas cancerosas generalmente pueden crecer suspendidas en un medio formado por agar suave o metilcelulosa viscosa. Por esta caracterstica, se dice que'las clulas cancerosas han perdido su dependencia a la fijacin, de la cual depende el crecimiento de clulas normales. Ms importante an, las clulas normales en cultivo muestran capacidad limitada para la divisin celular; luego de un nmero finito de divisiones mitticas sufren un proceso de envejecimiento que las incapacita para continuar creciendo y dividindose. Por otro lado, las clulas cancerosas aparentemente son inmortales en el sentido de que continan dividindose de manera indefinida.

Clulas cancerosas - factores de crecimiento Clulas cancerosas del suero - factores de crecimiento del suero Clulas normales - factores de crecimiento del s Clulas normales + factores de crecimiento del suero

Tiempo de cultivo (das)

FIGURA 16-6. Efectos de la privacin de suero sobre el crecimiento de las clulas normales y transformadas. En tanto contine el crecimiento de las clulas cancerosas, independientemente de la presencia o ausencia de factores de crecimiento exgenos, las clulas normales requieren estas sustancias en su medio para que el crecimiento siga adelante. El desarrollo de las clulas normales se interrumpe conforme se agotan los factores de crecimiento en el medio.

16-2

Causas del cncer

En 1775, el cirujano britnico Percival Pott estableci la primera correlacin conocida entre un agente ambiental y el desarrollo de cncer cuando concluy que la elevada incidencia de cncer en la cavidad nasal y en la piel del escroto, observada en limpiadores de chimeneas, se deba a su exposicin crnica al holln. En los ltimos decenios de esta poca se han aislado sustancias qumicas carcingenas del holln junto con cientos de otros compuestos que demostraron capacidad para causar cncer en animales de laboratorio. Adems de varias sustancias qumicas, se ha demostrado que un gran nmero de otros tipos de agentes son carcingenos, incluyendo varios tipos de radiacin ionizante y algunos virus que contienen DNA y RNA. Todos estos agentes muestran una propiedad en comn: pueden provocar cambios en el genoma. Las sustancias qumicas carcingenas, como las presentes en el holln o el humo de cigarrillos, casi siempre se puede demostrar que son mutgenos directos o se pueden convertir en compuestos rnutgenos por accin de las enzimas celulares (fig. 16-7). De igual manera, la radiacin ultravioleta, causa principal del cncer de piel, tambin es fuertemente mutgena (pg. 567). Algunos virus son capaces de infectar clulas de vertebrados y transformarlas en clulas cancerosas. Estos virus se dividen en dos grandes grupos: virus DNA tumorales y virus RNA tumorales, segn el tipo de cido nucleico encontrado en la partcula viral madura. Entre los virus DNA capaces de transformar clulas se erA.cuen.tran. el virus polioma, el virus del simio 40 (SV40), el adenovirus y virus parecidos al herpes. Los virus RNA tumorales o retrovims tienen una estructura similar al HIV (fig. 1-21) y son el tema de La va experimental al final de este captulo. Aunque el uso de virus tumorales en el laboratorio es muy valioso para identificar genes que participan en la carcinognesis, dichos virus slo causan unos cuantos tipos menores de cncer humano, indicados en el cuadro 16-1. Los virus tumorales pueden transformar clulas debido a que contienen

genes cuyos productos interfieren con las actividades normales de regulacin del crecimiento de la clula. La determinacin de las causas de diferentes tipos de cncer es una tarea realizada por epidemilogos. La causa de ciertos tipos de cncer es evidente; por ejemplo, fumar causa cncer de pulmn y la exposicin a la radiacin ultravioleta genera cncer de piel. Pero a pesar de numerosos estudios, todava se desconoce la causa de la mayor parte de los otros tipos de cncer humano. Por ejemplo, es imposible determinar el nmero de tipos de cncer que se pueden atribuir a carcingenos sintticos en comparacin con carcingenos naturales presentes en la dieta. El hombre vive en ambientes complejos y est expuesto a muchos carcingenos potenciales en un patrn cambiante durante periodos de varios decenios. Los intentos para determinar causas de cncer 3 partir e una montaa de atos estadsticos obtenidos de respuestas a cuestionarios acerca de los estilos de vida individuales han demostrado ser una tarea casi irrealizable. Esto se ilustra por los resultados recientemente obtenidos a partir de un estudio de 16 aos de duracin efectuado por 120 000 enfermeras que sugieren que la ingestin de grasas en la dieta no puede ser un factor significativo en el desarrollo de cncer mamario, como generalmente se piensa. Al mismo tiempo, el estudio suministr mayores datos para establecer un vnculo entre la ingestin de grasa en la dieta y el desarrollo de cncer de colon. El anlisis de algunos tipos de mutaciones causadas por carcingenos especficos ha proporcionado informacin ms especfica, como la causa de algunos pocos tipos de cncer. Por ejemplo, se cree que la aflatoxina B producida por ciertos mohos es uno de los principales factores que contribuyen a la elevada ocurrencia de cncer heptico en China, donde los granos y las nueces se almacenan en condiciones que favorecen el crecimiento del moho. La aflatoxina B causa una sustitucin caracterstica G >T en un par de bases del codn 149 dentro del gen p53 supresor del' tumor, y de esta manera permite a los epidemilogos efec-

676

CAPITULO 16 Cncer Precarcingeno Carcingeno parcial Posibles carcingenos primarios

sulfotransferasa(s) Ac RE heptico (P-450)


,, +NADPH + O-,

V
2-Acetilaminofluoreno (AAF)
O Ac

CH3

M
M

RE heptico ^ (no P-450) +NADPH + 0 2

sulfotransferasa(s) heptica + PAPS

CH3

oso;

A/-metil-4-aminoazobenceno (MAB}

enz.

Nitro na FIGURA 16-7. Activacin de un compuesto para convertirse en carcingeno activo mediante la accin de enzimas celulares. Ninguno de los dos compuestos a la izquierda es carcingeno, pero ambos pueden convertirse en carcingenos activos por accin de las enzimas hepticas. (PAPS [3'-fosfoadenosina-5'fosfosulfato] es un donador de sulfato activado empleado por algunas enzimas que transfieren sulfato.) (Segm }.A. Miller y E.C. Miller, Origins o Human Cncer, Hiatt, H.H. y co/s., eds. 1977. Colci Spring Hnrbor Labornton/ Press.)

CUADRO 1 6 - 1 . Virus vinculados con tumores humanos Tipo e virus Virus de Epstein-Barr Leucoplasia pilosa Mononucleosis infecciosa Linfoma de Burkitt Cncer nasofarngeo Linfoma de clulas B en pacientes inmunosuprimidos Carcinoma hepatocclular Carcinoma cutneo, de ordinario en sitios expuestos al sol en pacientes con aloinjerto renal y en pacientes con EV Cncer cervical Cncer vulvar Cncer de pene Cncer anal y j. anal Carcinoma verrugoso de vulva y pene, tumores de Buschke-Lowenstein Leucemia de clulas T del adulto

Virus de la hepatitis B Virus del papiloma humano tipos 5, 8, 14, 17, 20

Hiperplasia focal heptica Placas cutneas y papilomas en pacientes con EV**

Virus del papiloma humano tipos 16, 18, 31*, 33, 35*, 39*, 45*, 51*, 52, 56*, 58*, 59*, 61* Virus del papiloma humano tipos 6, 11

Neoplasia cervical intraepitelial; vulvar, del pene y neoplasias intraepiteliales perianales Condiloma acuminado

Virus de la leucemia humana de clulas T de tipo I

Leucemia latente

* Rara vez se encuentran. ** Epidermodisp]asia verruciforme. FUENTE: H. zur Hausen, Science 254:1168,1991. Copyright 1991 American Association Cor the Advancement of Science.

CAPITULO 16 - Cncer

677

tuar algunas determinaciones acerca del efecto del carcingeno en la poblacin.

16-3 Gentica del cncer


El cncer es una de las dos principales causas de muerte en los pases occidentales. Ms o menos afecta a uno de cada tres individuos. As considerado, el cncer es una enfermedad muy comn. Pero a nivel celular el desarrollo de un cncer es un acontecimiento notablemente raro. Siempre que se estudian en gentica las clulas de un tumor canceroso, casi de manera invariable se descubre que se originan a partir de una sola clula. Por lo tanto, a diferencia de otras enfermedades que requieren la modificacin de un gran nmero de clulas, el cncer se produce por la proliferacin descontrolada de una sola clula descarriada (por esta razn se dice que es motiodonal). Consideremos por un momento que el cuerpo humano contiene trillones de clulas, billones de las cuales sufren divisin celular en cualquier momento determinado. Aunque casi cualquiera de estas clulas en divisin tiene la posibilidad de cambiar su composicin gentica y desarrollar un tumor maligno, esto slo ocurre en casi un tercio de la poblacin humana durante todo su ciclo de vida. Una de las principales razones de que la mayor parte de las clulas no generen tumores cancerosos es que la transformacin maligna requiere ms que una simple alteracin gentica. El desarrollo de un tumor maligno (tumorignesis) es un proceso de mltiples etapas caracterizado por la progresin de alteraciones genticas que reducen cada vez ms la capacidad de respuesta de las clulas al mecanismo regulador normal del cuerpo y las vuelve ms capaces de invadir tejidos normales, lo que causa que el tumor amenace cada vez ms la vida de la persona. La evolucin de un tumor con frecuencia se compara a la evolucin biolgica. La evolucin biolgica y el avance del tumor son impulsados por un proceso en el cual el xito individual se mide por el nmero de descendientes que produce. Las clulas dentro de un tumor que crecen con mayor rapidez y de la manera menos controlada son favorecidas en comparacin con otras clulas del tumor que producen un menor nmero de clulas hijas. Como veremos en breve, las mutaciones en genes diferentes confieren propiedades diferentes a la clula en la cual ocurren. El resultado es la seleccin de cambios genticos que tienden a promover crecimiento y divisin descontrolados, y las clulas en las cuales ocurre esto tienden a convertirse en el tipo de clula predominante del tumor. En muchos casos, la primera etapa en el desarrollo de un tumor maligno es la formacin de un tumor benigno compuesto de clulas que ya no responden al control de crecimiento normal, pero que carecen de la capacidad para invadir tejidos normales, o provocar metstasis en sitios distantes. Algunos tumores benignos tienen pocas probabilidades de convertirse en malignos, pero otros, como los plipos que pueden aparecer en la pared del colon (fig. 16-17), es muy probable que produzcan clulas que atraviesan la frontera entre los estados benigno y maligno. Elfrotis de Papanicolaou es una prueba en busca de clulas pre-

cancerosas en el epitelio de revestimiento del cuello uterino. El desarrollo de cncer del cuello uterino tpicamente dura ms de 10 aos y se caracteriza por clulas de aspecto crecientemente anormal (menos bien diferenciadas que las clulas normales, con ncleos de mayor tamao, como en la figura 16-8), Cuando se descubren clulas de aspecto anormal, se puede localizar y destruir el sitio precanceroso en el cuello uterino mediante tratamiento con rayo lser, crioterapia o ciruga. Como se demostrar en el siguiente anlisis, los genes que participan en la carcinognesis constituyen un subconjunto especfico del genoma cuyos productos estn implicados en actividades tales como progresin de una clula a travs del ciclo celular, adherencia de la clula con sus vecinas y reparacin de daos al DNA. Estudios de diferentes tipos de cncer humano, como cncer de colon, cncer mamario o cncer renal, revelan que algunos genes pueden participar en varios tipos de cncer diferente, en tanto que otros genes slo participan en la formacin de uno o unos pocos tipos de cncer. Algunos genes tienden a sufrir mutaciones en las primeras etapas del desarrollo de un cncer particular y otros genes muestran tendencia a sufrir mutaciones en etapas tardas. Un ejemplo de este tipo de evolucin gentica que puede conducir al desarrollo de cncer de colon se muestra en la figura 16-9. La mayor parte de los estudios de cambios genticos en diferentes etapas de avance del tumor sugieren que e! orden preciso en el cual se pierden o alteran las funciones del gen tiene menor importancia que los efectos acumulativos de las prdidas. En otras palabras, se cree que el efecto combinado de varias mutaciones es la causa del desarrollo de un estado maligno completo. Antes de iniciar un estudio detallado de algunos genes prominentes en el desarrollo de cncer humano es necesario hacer notar que los cambios genticos no son los nicos factores importantes. Una clula puede mostrar algunos cambios genticos que sera de esperar produjeran el desarrollo de un tumor maligno, pero dichos cambios pueden permanecer en estado latente por el resto de la vida del individuo. No se sabe mucho acerca de las influencias no genticas, o "epigenticas", que actan sobre una clula para permitirle expresar su fenotipo maligno, pero dichas influencias repetidamente han demostrado que desempean cierto papel en la gnesis de numerosos tipos de cncer. La existencia de influencias no genticas en la tumorignesis fue demostrada por primera vez por Isaac Berenblum, de la Universidad de Oxford, en estudios sobre piel de ratn. En estos experimentos se demostr que se pueden distinguir dos fases distintas; stas se conocen como inicio y promocin. Berenblum observ que la aplicacin repetida de sustancias mutgenas a la piel, como alquitrn de hulla, provoca la aparicin de piel malignizada en animales de laboratorio, pero que la aplicacin de una sola dosis baja del agente no es suficiente para lograr este fin. Sin embargo, si la nica aplicacin de alquitrn de hulla va seguida de tratamiento con otro tipo de agente, como aceite de crotn, entonces se puede inducir la formacin de tumores en la piel. La mayor parte de los tumores fueron papilomas benignos, pero un pequeo porcentaje dio lugar a car-

678

CAPITULO 16 Cncer

(a)

(b)

FIGURA 16-8. Deteccin de clulas anormales (premalignas) en un frotis de Papanicolaou. a) Clulas epiteliales escamosas normales del cuello uterino. Las clulas presentan forma uniforme con un pequeo ncleo localizado en el centro, b) Clulas anormales de un caso de carcinoma in situ que constituye un cncer preinvasivo del cuello uterino. Las clulas tienen formas heterogneas y ncleos grandes. (Micrografa segn Visuals Unlimited/ Cabisco.)

cinomas malignos. El aceite de crotn por s mismo no es carcingeno, y requiere una aplicacin previa de alquitrn de hulla, El aceite de crotn es ms bien promotor del desarrollo de tumores ya iniciados por el carcingeno. Todava se pueden desarrollar tumores aun si el tratamiento con aceite de crotn se retrasa durante varios meses despus de la aplicacin del alquitrn de hulla, hecho que ilustra el cambio hereditario permanente inducido por el alquitrn de hulla mutgeno. En tanto los iniciadores del tumor acten provocando mutaciones genticas, se cree que los promotores tumorales funcionan principalmente estimulando el crecimiento y la proliferacin de las clulas, lo que favorece que ocurran mutaciones adicionales causantes de cncer necesarias para la rnalignizacin completa de las clulas. Por ejemplo, en 60% de los adenomas benignos ms pequeos del colon se observan mutaciones del gen PAC, lo que sugiere que este gen acta como iniciador en la formacin del cncer de colon (fig. 16-9). Una vez que el gen PAC sufre mutacin, el rpido crecimiento celular que ocurre en la capa epitelial del colon incrementa la probabilidad de alteraciones genticas subsecuentes que conducen a la aparicin del tumor maligno. Los estrgenos pueden actuar como promotores de tumor en el desarrollo del cncer mamario. Los datos epidemiolgicos indican una correlacin entre tiempo de exposicin de la mujer al estrgeno circulante y riesgo de desarrollar cncer mamario. Por ejemplo, las mujeres a quienes se les quitan los ovarios en etapas tempranas de vida y no se les suministra teraputica de sustitucin con estrgenos rara
Prdida del gen PAC Prdida de los grupos metilo del DNA

vez presentan cncer mamario. Puesto que el estrgeno no es mutgeno, al parecer la elevacin del riesgo de generar un tumor es por favorecer el crecimiento y la divisin de las clulas especficas. A la inversa, los compuestos que bloquean la accin estrognica pueden disminuir el riesgo de cncer mamario. El tamoxifn es un compuesto no esteroide que se enlaza a los receptores de estrgeno y bloquea su enlace, inhibiendo as el crecimiento de clulas cancerosas mamarias que con frecuencia depende de la estimulacin por estrgenos. Se ha empleado tamoxifn durante ms de 10 aos para tratar pacientes con cncer mamario, pero recientemente se aprob para ensayos a gran escala en mujeres saludables cuya historia familiar indica que se encuentran en alto riesgo de desarrollar la enfermedad. El protocolo de estos ensayos es motivo de gran debate, porque el tratamiento con tamoxifn puede incrementar el riesgo de una persona para desarrollar cncer endometrial y trastornos circulatorios. Carcinomas comunes, como los de mama, colon, prstata y pulmn, se originan en tejidos epiteliales que en general son afectados en un nivel relativamente elevado de divisin celular. Lo mismo se puede afirmar de las leucemias, que aparecen en las clulas sanguneas precursoras en rpida divisin. Estos tejidos contienen una poblacin de estirpes celulares que se dividen por mitosis, conservando un nmero relativamente constante de las estirpes celulares, aunque tambin suministra las clulas que se diferencian en clulas especializadas de vida corta del epitelio o de la sangre. Conforme se dividen, las estirpes celulares pueden
Prdida del gen DCC

Mutacin del gen ras

Prdida del gen p53

Prdida de otros genes

FIGURA 16-*J. Una de las diferentes secuencias posibles de cambios genticos en un linaje celular que puede conducir al desarrollo de cncer de colon. Las funciones de la mayor parte de estos genes se analizan posteriormente en el captulo.

CAPITULO 16 Cncer

679

acumular varias mutaciones que causan la transformacin maligna. Genes supresores de tumor y oncogenes Los genes implicados en la carcnognesis se dividen en dos amplias categoras: genes supresivos de tumor y oncogenes. Los genes supresores de tumor codifican protenas que restringen el crecimiento celular y evitan que las clulas se malignicen (fig. 16-10, a). Originalmente se descubri la existencia de estos genes por estudios efectuados a fines del decenio de 1960, en los cuales se fusionaron entre s clulas malignas y clulas normales de roedores. Se observ que algunas de las clulas hbridas formadas por este tipo de fusin perdieron sus caractersticas malignizantes, lo que sugiere que las clulas normales poseen alguna propiedad capaz de suprimir dichas caractersticas en las clulas cancerosas luego de la fusin. Se reunieron mayores datos acerca de la existencia de genes supresores de tumor a partir de la observacin de que regiones especficas de un cromosoma particular siempre se encuentran borradas en las clulas de ciertos tipos de cncer. Si se correlaciona la ausencia de estos genes con el desarrollo de un tumor, entonces se deduce que la presencia de estos genes normalmente evita la formacin del tumor. Una vez identificada una regin del cromosoma como sitio probable de un gen supresor de tumor, los genetistas moleculares pueden iniciar la bsqueda de dicho gen en esa regin del DNA. Las funciones de las protenas codificadas

por un gran nmero de estos genes es en la actualidad tema de intensa investigacin. Se dice que los genes supresores del tumor actan de manera recesiva porque ambas copias del gen fua de cada cromosoma homlogo) deben borrarse al sufrir mutacin antes de perder su funcin protectora. Los oncogenes, por otro lado, codifican protenas que promueven la prdida de control del crecimiento y la conversin de una clula a un estado maligno (fig. 16-10, b). La existencia de oncogenes se descubri en una serie de investigaciones acerca de virus RNA tumorales reseadas en La va experimental de este captulo. Estos virus pueden transformar una clula normal en una clula maligna porque son portadores de un gen que codifica una protena que interfiere con las actividades normales de la clula. Debido a su capacidad para transformar clulas, estos genes virales reciben el nombre de "oncogenes". El punto crtico en estos estudios se present en 1976 cuando se descubri que un oncogen llamado src que se encontraba en un virus RNA tumoral, llamado virus del sarcoma aviario (VSA), tambin estaba presente en el genoma de clulas no infectadas (comentado en la pgina 693). En realidad, el oncogen no es un gen viral, sino un gen celular incorporado al genoma del virus durante una infeccin previa. Pronto se comprob que las clulas poseen varios genes, ahora conocidos como protooncogenes, con potencial para alterar las actividades propias de la clula y llevarla hacia el estado maligno (fig. 16-11). Segn analizaremos ms adelante, los protooncogenes codifican protenas que tienen funciones diversas en las actividades normales de una clula. Los protooncogenes pue-

Protooncogenes

Crecimiento normal de la clula Gen supresor de tumor mutado Crecimiento normal de la clula Crecimiento normal de la clula Copias del gen supresor del tumor sobre ambos homlogos mutados El protooncogen mutado se convierte en oncogen

Crecimiento normal de la clula

Crecimiento normal de la clula

Prdida de control del crecimiento

Prdida de contro| del crecimiento

(a)

(b)

FIGURA 16- IO. Efectos contrastantes de mutaciones en genes supresores de tumor y en oncogenes. En tanto una mutacin en una de las dos copias (alclos) de un oncogene sea suficiente para causar la prdida de control del crecimiento, se deben alterar ambas copias tic un gen supresor de tumor para inducir el mismo efecto.

680

CAPITULO 16 - Cncer

den convertirse en oncogenes (activados) de diferentes maneras (fig. 16-11). Por ejemplo, 1. El gen puede sufrir mutaciones de modo que se alteran las propiedades del producto del gen y ya no puede efectuar su actividad normal. 2. Una mutacin en alguna secuencia reguladora cercana puede alterar la expresin del gen, de modo que el producto del gen es demasiado poco o excesivo. 3. Puede ocurrir redisposicin del cromosoma que lleva una secuencia DNA desde un sitio distante en el genoma hasta un punto muy prximo del gen, lo que puede alterar la expresin del gen o la naturaleza del producto del mismo, segn se indica en la figura 16-11, c. Cualquiera de estos tipos de alteraciones genticas puede causar que una clula responda menos a los controles normales de crecimiento y se comporte de cierta manera como clula maligna. A diferencia de los genes supresores de tumor que actan con carcter recesivo, los oncogenes actan con carcter dominante, o sea que una sola copia del oncogen puede provocar que la clula exprese el fenotipo alterado, sin importar si existe o no una copia normal no activada del gen sobre el cromosoma homlogo (fig. 16-10,
Protena codificada con funcin, estructura o ambas alteradas

b). Los investigadores han tomado ventaja de esta propiedad para identificar oncogenes introduciendo el DNA sospechoso de contener el gen en clulas cultivadas y observando las clulas en busca de datos de alteracin de las propiedades de crecimiento. Anteriormente se haba establecido que el desarrollo de malignidad en el hombre requiere ms que una simple alteracin gentica. La razn de esta afirmacin ser ms evidente ahora que hemos observado que hay dos tipos de genes causantes de la formacin del tumor. Se cree que mientras una clula posea su dotacin completa de genes supresores de tumor, estar protegida contra los efectos de un oncogen por razones que sern evidentes cuando analicemos las funciones de estos genes, ms adelante. Puesto que el efecto protector de un supresor de tumores slo se pierde despus de inactivar ambas copias del gen, es evidente que deben ocurrir dos mutaciones o supresiones independientes antes que la clula sea vulnerable a los sucesos que inician la formacin de un tumor. Adems, puesto que la mayor parte de los tumores contienen alteraciones tanto en los genes supresores de tumor como en los oncogenes, al parecer la prdida de las funciones de un supresor de tumor dentro de la clula de ordinario no es suficiente, por s mismo, para que la clula sufra un proceso de con-

Mutacin por supresin Incremento de la sntesis de la Protena codificada

Regin reguladora

Protooncogen

Protena codificada por protooncogen

La secuencia reguladora de DNA translocada desde un sitio distante altera la expresin del gen subsecuente

Sntesis de una protena que contiene porciones codificadas por genes diferentes. La fusin de protenas ya no se encuentra bajo control normal

Un gen que codifica protenas translocadas desde sitios distantes se fusiona con una parte del gen que provoca la formacin de un gen perfusin

Incremento de la sntesis de la protena codificada MGl'KA H-1 1. Activacin de un protooncogen para convertirlo en oncogen. La activacin se puede lograr de varas maneras, segn se indica en esta figura. En la va a, una mutacin del gen altera la estructura y funcin de la protena codificada. En la va b, una mutacin en una secuencia reguladora subsecuente altera el nivel de expresin del gen. En la va c, una redisposicin del DNA produce un nuevo segmento de DNA en la vecindad o adelante del gen, alterando su expresin o la naturaleza de la protena codificada.

CAPITULO 16 Cncer

681

versin maligna. Ms bien, cuando menos en la mayor parte de los casos, la prdida de las funciones del supresor de tumor debe acompaarse de la conversin de un protooncogen en un oncogen antes que las clulas se malignicen por completo. Aun entonces, a veces la clula no muestra todas las propiedades requeridas para invadir a los tejidos que la rodean o para formar colonias secundarias por metstasis, sino que puede requerir mutaciones oncognicas adicionales para configurar el fenotipo completo que ponga en riesgo la existencia del individuo. En general, el nmero de genes alterados aumenta paralelamente con la evolucin de la virulencia maligna del tumor. Los estudios de carcinoma colorrectal indican, por ejemplo, que se requieren mutaciones hasta de cuatro a seis genes diferentes para el desarrollo de un tumor completamente maligno (fig. 16-9). Podemos ahora retornar a las funciones de los productos codificados por genes supresores de tumor y oncogenes, y examinar de qu manera las mutaciones en estos genes pueden provocar que una clula se convierta en maligna.
Genes supresores de tumor

El desarrollo de casi todos los tipos de cncer humano parece acompaarse de la prdida o la mutacin de uno o ms genes supresores de tumor. En el momento actual, casi una docena de genes se han implicado como supresores de cncer humano (cuadro 16-2), y se espera que su nmero crezca rpidamente en unos cuantos aos ms. Algunos de los genes supresores de tumor identificados participan como factores causales en el desarrollo de una amplia gama de diferentes tipos de cncer, en tanto que otros parecen desempear un papel en la formacin de slo uno o un pequeo nmero de tipos de cncer. El descubrimiento de la importancia de los genes supresores de tumor en la carcinognesis humana abri la puerta al desarrollo de nuevas estrategias para luchar contra el cncer. Por ejemplo, si se pudiera introducir una copia normal de un gen supresor de tumor en clulas tumorales que carecen de una copia fun-

cional, entonces sera posible llevar de nuevo a la clula a obedecer los controles normales de crecimiento. Este tipo de geneterapia se ha aplicado con xito a clulas cancerosas aisladas de tumores humanos y desarrolladas en cultivo, pero todava est por verse si pueden o no aplicarse a clulas cancerosas que crecen en el cuerpo. Una estrategia alternativa podra ser tratar a los pacientes con frmacos que simulen los efectos de los productos del gen supresor de tumor, pero esto an es un proyecto lejano. El primer gen supresor de tumor bajo estudio se relaciona con un cncer raro de la infancia en la retina, llamado retinoblastoma. La ocurrencia de retinoblastoma sigue dos patrones distintos: aparece con elevada frecuencia en miembros de ciertas familias, y con baja frecuencia (espordicamente) entre los miembros de la poblacin general. El gen causante de esta enfermedad se denomina RB (o Rb). El hecho de que el retinoblastoma aparezca en ciertas familias sugiere que este cncer puede ser hereditario. El examen de las clulas de nios afectados de una versin hereditaria del retinoblastoma indica que un miembro del 13o. par de cromosomas homlogos carece de un pequeo fragmento de la parte interior del cromosoma. La supresin se encuentra en todas las clulas del nio, tanto en las clulas del cncer retiniano como en clulas de cualquier parte del cuerpo, lo que indica que la aberracin cromosmica se hereda de alguno de los progenitores. Puesto que la presencia de una supresin en uno solo de los dos cromosomas homlogos se acompaa del desarrollo de retinoblastoma, se dice que la enfermedad se hereda con rasgo gentico dominante. Sin embargo, el examen ms atento de la forma de transmisin del retinoblastoma revela que a diferencia de la mayor parte de las enfermedades hereditarias dominantes, como la enfermedad de Huntington, en la cual el individuo que hereda genes alterados o ausentes invariablemente desarrolla la enfermedad, los nios que heredan un cromosoma que ha perdido el gen del retinoblastoma heredan una fuerte disposicin a desarrollar retinoblastoma y no la propia enfermedad. En realidad,

CUADRO 16-2. Algunos genes conocidos o candidatos a supresores de tumor

Gen
PAC DCC NF1 NF2 p53 RR RET VHL 7W-I

Tipo de cncer Carcinoma de colon Carcinoma de colon Neurofibromas Schwannomas y meningiomas Cncer de colon; muchos otros Retinoblastoma Carcinoma de tiroides; feocromocitoma Carcinoma de rion Nefroblastoma

Localizador/ del producto Citoplasma? Membrana Citoplasma Membrana interna? Ncleo Ncleo Membrana Membrana? Ncleo

Modo de accin

Sndrome hereditario Poliposis adenomatosa familiar

7 Molcula de adherencia celular Activador GTPasa Unin de membrana al citoesqueleto? Factor de transcripcin

Neurofibromatoss tipo 1 Neurofibromatosis tipo 2 Sndrome L-Fraumeni Retinoblastoma Neoplasia endocrina mltiple tipo 2 Enfermedad de von Hippel-Lindau Tumor de Wilms

Factor de transcripcin Receptor de tirosincinasa


1

Factor de transcripcin

FUENTE: J. Marx, Science 261:1385, 1993. Copyright 1993 American Association for the Advancement of Science.

682

CAPITULO 16 Cncer

casi 10% de los individuos que heredan un cromosoma con supresin de RB nunca desarrollan cncer de retina. Sin embargo, la mayora de los individuos con esta predisposicin gentica presentan varios tumores de retina que se originan independientemente entre s y afectan ambos ojos. En contraste, pueden aparecer casos espordicos de .la enfermedad en forma de un tumor simple en un solo ojo, Las bases genticas del retinoblastoma fueron explicadas por primera vez en 1971 por Alfred Knudson, de la Universidad de Texas. Knudson propuso que el desarrollo de retinoblastoma requiere que ambas copias del gen RB de una clula retinal deben estar suprimidas o sufrir mutacin antes que la clula pueda dar origen a un retinoblastoma. En otras palabras, el cncer se origina como resultado de dos "golpes certeros" independientes. Entre las personas que desarrollan espordicamente este raro cncer, el tumor se inicia a partir de una clula de la retina en la cual ambas copias del gen RB han sufrido mutaciones sucesivas (fig. 16-12, a). Puesto que la probabilidad de que ambas copias del gen RB en la misma clula sean blanco de una mutacin debilitante es sumamente improbable, la ocurrencia del cncer en la poblacin general tambin es muy rara. En contraste, las clulas de una persona que hereda un cromosoma con supresin RB ya tienen recorrida "la mitad del camino" para la conversin maligna, lo que explica por qu

razn los individuos en estas condiciones estn ms predispuestos a desarrollar cncer. Una mutacin del gen RB restante en cualquiera de las clulas de la retina produce una clula que carece de un gen RB normal y por lo tanto es incapaz de producir una protena RB funcional (llamada pRb) (g. 16-12, b). Esto se confirma examinando clulas tumorales de pacientes con predisposicin heredada al retinoblastoma y la observacin de que una copia del gen ha sufrido supresin, y la otra, mutacin. La ausencia del producto funcional de un gen RB parece ser suficiente para promover el desarrollo de este cncer particular. Aunque las deficiencias del gen RB se manifiestan primero por el desarrollo de cncer de retina, este no es el fin de la historia. Las personas que sufren la forma hereditaria de retinoblastoma tambin estn en alto riesgo de desarrollar otros tipos de tumores en etapa tarda de la vida, particularmente sarcoma de tejido blando (tumores de origen mesenquimatoso). Adems, estudios recientes revelan que las mutaciones en ambos alelos RB son un hecho comn en clulas de muchos tumores diferentes, incluyendo los tumores de mama, prstata y pulmn.1 Cuando se cultivan
1 La razn de que las personas con un defecto hereditario en un alelo del gen RB desarrollen retinoblastoma y sarcomas de tejido blando, pero no cnceres ms comunes, todava se desconoce.

Clula retinal Crecimiento normal de la clula Mutacin espontnea de una copia del gen RB

( HrTT" Gen fiB mutado heredado \^/ de un progenitor

Crecimiento normal de la clula Crecimiento normal de la clula Crecimiento normal de la clula Prdida de control del crecimiento

Crecimiento normal de las clulas Mutacin espontnea en una segunda copia del gen RB Crecimiento normal de las clulas

Mutacin espontnea en una segunda copia del gen RB

Prdida de control del crecimiento

(b)
FHUKA J 6 - 1 2 . Mutaciones en el gen RB que pueden producir retinoblastoma. a) En casos espontneos (no familiares) de esta enfermedad, un individuo tiene al principio de su vida dos copias normales del gen RB en el cigoto, y el retinoblastoma aparece slo en aquellos casos raros donde una clula determinada de la retina acumula mutaciones independientes en ambas copias de genes homlogos, b) En casos familiares de la enfermedad, el individuo inicia su vida con una copia anormal del gen RB, que de ordinario presenta supresin. Por lo tanto, todas las clulas de la retina han perdido la funcin de cuando menos uno de los dos alelos RB. Si el otro alelo RB en una clula retinal se inactiva por alguna razn, en general como resultado de mutacin puntual, esta clula dar lugar a un tumor retinal.

CAPITULO 16 - Cncer

683

clulas de estos tumores in vitro, la reintroduccin de un gen RB de tipo nativo al interior de las clulas es suficiente para suprimir su fenotipo canceroso, indicando que la prdida de la funcin de este gen contribuye de manera significativa a la tumorignesis. Dada la importancia del gen RB en la regulacin del crecimiento de una gran variedad de tejidos, muchos laboratorios han dirigido su atencin a determinar el papel del producto del gen RB. Papel de la pRb en la regulacin del ciclo celular. La importancia del ciclo celular en el crecimiento y proliferacin de las clulas se analiz en los captulos 14 y 15, donde se hizo notar que los factores que controlan el ciclo celular pueden desempear un papel crucial en el desarrollo de cncer. Datos procedentes de diversos estudios indican que uno de los papeles primarios de la pRb es regular el paso de clulas desde la etapa GI del ciclo celular a la fase S, durante la cual ocurre la sntesis de DNA. Como se analiza en la pgina 585, captulo 14, la transicin de G^ a S es un momento de compromiso para la clula, puesto que una vez que la clula entra a S invariablemente prosigue a travs del resto del ciclo celular y entra en mitosis. La sntesis del DNA requiere de las diferentes enzimas que participan en la duplicacin, analizada en el captulo 13, pero tambin requiere muchas actividades adicionales que deben coordinarse estrechamente. Por ejemplo, la duplicacin de DNA requiere la sntesis de cuatro tipos de precursores nucletidos, en tanto que la duplicacin de los cromosomas requiere la sntesis de las histonas incorporadas en los nucleosomas recin ensamblados. Por consiguiente, la transicin de GI a S se acompaa de activacin de la expresin de una amplia variedad de genes diferentes, que al parecer estn controlados por diversos factores de transcripcin. Entre los factores de transcripcin implicados en la activacin de genes requeridos para las actividades de la fase S se encuentran los miembros de la familia E2F, que son objetivos clave de la pRb (fig. 16-13). El avance de las clulas desde GI a S se acompaa de fosforilacin de la pRb por la cinasa dependiente de ciclina que regula la transicin Gi-S. Al parecer, la forma no fosforilada de la pRb interacta con factores de transcripcin E2F, evitando que se una al DNA y activando los genes requeridos para ciertas actividades de la fase S. Una vez fosforilada la pRb, la protena libera su E2F unido, permitiendo que el factor de transcripcin active la expresin del gen. La importancia de la pRb en la regulacin del ciclo celular se observa en los resultados de varios experimentos. Por ejemplo, la inyeccin de cantidades excesivas de la protena pRb no fosforilada a clulas durante GI impide la progresin de las clulas hacia la fase S. Todava ms revelador es el hecho de que diversos virus DNA tumorales (incluyendo adenovirus, virus del papiloma humano y SV40) codifiquen una protena que se enlaza a pRb, bloqueando su capacidad para enlazarse a E2F. Al parecer, la capacidad de estos virus para inducir cncer en clulas infectadas depende de su capacidad para bloquear la influencia negativa que tiene pRb en la progresin de una clula a travs del ciclo celular. Empleando estas protenas bloqueadoras de pRb, estos virus pueden lograr el mismo resultado que ocu-

Protena codificada

FIGUKA 16-13. Papel de la pRb en el control de la transcripcin de genes requeridos para la progresin del ciclo celular. Durante C-, la pRb no fosforilada se enlaza a los factores de transcripcin E2F (paso 1). La activacin de la cinasa dependiente de ciclina (Cdk) conduce a la fosforilacin de la pRb que ya no puede enlazarse a un E2F (paso 2). Los factores de transcripcin liberados se enlazan a secuencias reguladoras en el DNA (paso 3), provocando la sntesis de los productos del gen (paso 4) requeridos para la progresin de las clulas desde GI a la fase S del ciclo celular (paso 5).

rre cuando el gen sufre supresin o mutacin durante el desarrollo de tumores humanos. Algunos de los estudios ms interesantes acerca del gen retinoblastoma provienen de la investigacin de los ratones knockout, o sea, ratones manipulados con tcnicas de ingeniera gentica que carecen de ambas copias del gen RB (son ratones RB"/"). Dado el papel aparente de la pRb en la restriccin del ciclo celular, se puede esperar que las clulas de ratones RB~/~ se dividan de manera descontrolada y produzcan embriones totalmente aberrantes. Pero en realidad, as etapas muy tempranas del desarrollo prosiguen de manera ms bien normal, sin efecto evidente alguno en el ciclo celular, lo que indica que pRb no juega un papel regulador crucial en toda la transicin Gj-S. El examen atento de ciertos tejidos, sin embargo, muestra claras pruebas de defectos en el ciclo celular, segn se ilustra en el siguiente ejemplo. Cuando un embrin normal alcanza cierta etapa, las clulas del cristalino en desarrollo se detienen en GI y luego se diferencian en las clulas altamente especializadas del cristalino. En contraste, estas mismas clulas en ratones RB ~l~ continan sintetizando DNA despus de este tiempo cuando sus contrapartes normales han sido eliminadas del ciclo celular, y en seguida las clulas mueren por un proceso de autodestruccin (llamado apoptosis, pg. 658) en vez de diferenciarse en clulas del cristalino. Estos resulta-

684

CAPITULO 16 Cncer

dos sugieren que el producto del gen RB normalmente controla la interrupcin del ciclo de las clulas del cristalino en GI, requerida para una diferenciacin normal del cristalino. Los embriones RB~f~ mueren al da 12 o 13 como resultado de una falla general del sistema nervioso central en desarrollo y de la eritropoyesis (formacin de eritrocitos). Todava no se aclara la razn de que estos ratones no puedan realizar estos procesos del desarrollo. El papel del gen RB en la formacin de tumores es ms evidente en ratones heterocigotos (RB+!~). Los animales con este genotipo se desarrollan durante el periodo embrionario y luego muestran un riesgo mucho mayor de desarrollar cncer, justo como el hombre, que posee un genotipo RB +/ ~; sin embargo, a diferencia de los humanos, estos ratones son afectados sobre todo por tumores de la hipfisis ms bien que retinoblastomas (que nunca se han observado en ratones). Estos resultados confirman la importancia del gen RB para suprimir la formacin de tumores, pero tambin indican que hay diferencias importantes entre roedores y humanos, y puede ser difcil extrapolar a los humanos los estudios de carcinogenicidad efectuados en ratones y ratas. Papel de p53 en la carcinognesis humana. A pesar de su nombre tan modesto, el gen p53 puede tener mucho qu hacer en el desarrollo del cncer humano en comparacin con cualquier otro componente del genoma. El genoma debe su nombre al producto que codifica, p53, que es un polipptido con peso molecular de 53 000 daltons. Durante muchos aos se crey que p53 era un oncogen con accin de naturaleza dominante, pero en 1990 se le reconoci como gen supresor de tumor que, cuando est ausente, causa una rara enfermedad hereditaria llamada sndrome de L-Fraumeni, cuyas vctimas sufren ciertos cnceres con elevada ocurrencia, incluyendo cncer mamario y leucemia. Como los individuos con la forma hereditaria de retinoblastoma, las personas con el sndrome de L-Fraumeni slo heredan una copia funcional del gen supresor de tumores v53, y por lo tanto son muy susceptibles al cncer como resultado de las mutaciones al azar que eliminan la funcin en la copia residual del gen. La importancia de p53 como arma antitumoral es ms evidente a partir del dato de que casi 50% de todos los cnceres humanos contienen clulas con mutaciones puntuales o supresiones en ambas copias del gen p>53. Adems, el grado de alteracin de p53 en un tumor puede servir

mos. En el captulo 14 vimos de qu manera acta p53 como factor de transcripcin que activa la expresin de un gen que codifica una protena (p21) e inhibe la cinasa dependiente de ciclina reguladora del avance de la clula a travs del ciclo celular (pg. 586). Como consecuencia de esta cascada de acontecimientos, las clulas que no estn preparadas para entrar a la fase S por alguna u otra razn son bloqueadas en el punto de verificacin G--S en tanto no estn listas para proseguir. Como se estudi en ei captulo 14, una de las mejores maneras de detener el ciclo celular por medio de p53 es someter el DNA de las clulas a dao mediante radiaciones. Este tratamiento estimula a la clula a producir protena p53, que detiene el ciclo celular en tanto se repara el dao al DNA. En realidad, los datos recientes sugieren que p53 puede desempear un papel directo en la estimulacin del proceso de reparacin del DNA. Los estudios indican que adems de retrasar el ciclo celular y posiblemente participar en la reparacin del DNA, p53 tambin puede dirigir a las clulas a lo largo de un camino que conduce a muerte por apoptosis. Por ejemplo, cuando un gen p53 normal se reintroduce en una clula cancerosa que ha perdido ambas copias de p53, la clula manipulada genticamente casi siempre responde por autodestruccin. Se cree que p53 desencadena la apoptosis en clulas que sufren daos del DNA ya imposibles de reparar o estn alteradas de alguna manera, lo que las hace candidatas para desarrollar un tumor. Son tantas las diferentes funciones atribuidas a p53 que se conoce como "guardin del genoma". Segn este concepto, cuando se inactivan ambas copias de p53, las clulas capaces de sobrevivir carecen de la integridad gentica necesaria para permanecer saludables (fig. 16-15). Sin la salvaguarda de p53 en su sitio, las clulas son genticamente inestables y acumulan dao gentico cada vez mayor, lo que las conduce a un fenotipo crecientemente maligno. La inactivacin de p53 tambin explica por qu las clulas cancerosas muestran exposicin extravagante de los cromosomas, incluyendo cromosomas extra y redisposicin de los cromosomas, que nunca se observa en clulas normales, sin afectar su capacidad para sobrevivir y proferar (fig. 16-4). Despus de todo lo dicho acerca del gran nmero de papeles de p53, se podra pronosticar que un embrin que carece de ambas copias de este gen no puede llegar muy lejos. --Sin embargo, este no es el caso, puesto que ratones que carecen totalmente de un gen p53 (p53~/~, ratones knockout) pueden desarrollarse a trmino y nacer con un
li-lL.^J 1.A . .m.J^H\AU ^i^iinJUL-ii^l^u ^, ,..v~ J ~ ^m..^-^^,

como indicador de la virulencia del mismo; los tumores


compuestos de clulas portadoras de mutaciones en p53 tienden a ser ms invasivos y con mayor probabilidad de provocar metstasis, y esto se correlaciona con una menor tasa de supervivencia. Est claro que la eliminacin de la funcin p53 es un paso importante en el avance de muchas clulas cancerosas hacia un estado de malignizacin completa. Se han identificado ms de mil diferentes mutaciones p53 entre muestras de tumores humanos, lo que indica que el funcionamiento apropiado de la protena es muy sensible a cambios incluso ligeros en la secuencia de aminocidos (fig. 16-14). Los estudios sugieren que p53 puede suprimir la formacin de clulas cancerosas mediante diferentes mecanis-

fenotipo normal. Entonces, es claro que el gen p53 no es


indispensable para regular el proceso normal relacionado con crecimiento y divisin o diferenciacin celular en un ratn. Despus de varias semanas de vida, sin embargo, estos animales comienzan a presentar tumores malignos cuyas clulas casi siempre se caracterizan por un nmero anormal de cromosomas. Este dato apoya claramente el papel propuesto de p53 de suprimir la formacin de tumores y mantener la estabilidad gentica aun en animales de corta vida, como los ratones. Los ratones p53~~ tambin suministran informacin acerca del papel de p53 en la apoptosis. Cuando se colocan en cultivo Hnfocitos procedentes de glndulas de timo inmaduras de un ratn normal, responden a dosis baja de

CAPITULO 16 Cncer
R175

685

100

L i JL i
150 160

VDSTPPPGTRVRAMAIYKQSr PGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGN 170 180 190 200

AL
Hl

m>
S4
24fi

R273

-R282

LRVEYLDORWTFRHSVWPYEPPEVGSOCTTIHYNYMCNSSCMGGMNRRPLTIITLEDSSGLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 201
=>

*ilL
280

210 S6

220

230

240

250

260

270

290

300

tm>
S7

310

H2

FIGURA 16-14. Residuos aminocidos imitados con mayor frecuencia en p53 de tumores humanos, a) Mapa de la frecuencia de mutaciones de p53 del dominio central. La secuencia de aminocidos est indicada con nomenclatura de una sola letra (fig. 2-26). Los residuos subrayados son los ms altamente conservados en la proieina ac diferentes especies. El nmero de mutaciones sin sentido derivadas del tumor en cada residuo est indicado por la altura de las barras. Se identifican los seis residuos que sufren mutaciones con mayor frecuencia. Las flechas y los cilindros representan las cadenas/ y las hlices a. b) Dibujo de listn que muestra la estructura tridimensional de la parte del polipptido p53 cuya frecuencia se indica en la parte a y su interaccin con la hlice de DNA. Los residuos mutados con mayor frecuencia en el cncer humano ocurren en la interfase protena-DNA o cerca de ella. (Reimpreso con autorizacin de Y. Cha, S. Gorma, P.D. Jeffrey y N.D. Pavletich, Science 265:352, 1994; copyright 1994 American Association for the Advancement of Science.)

radiacin nociva para DNA sufriendo apoptosis. Por lo contrario, los linfocitos tomados de ratones knockout p53~/~ sometidos al mismo tipo de radiacin no responden con autodestruccin. Estos resultados confirman la hiptesis planteada anteriormente de que el control del dao al DNA requiere un gen p53 funcional, encargado de que las clulas que contienen lesiones en el DNA sigan una va que conduce a la apoptosis. Dada su capacidad para desencadenar la apoptosis, el gen p53 puede desempear un papel crucial en el tratamiento del cncer mediante radiacin y quimioterapia. En general, se asume que las clulas cancerosas son ms susceptibles que las normales a frmacos y radiacin debido a que las clulas cancerosas se dividen con mayor rapidez. Pero con frecuencia las clulas cancerosas se dividen ms lentamente que sus contrapartes normales, pero aun as son ms susceptibles a frmacos y radiacin. Una teora alterna-

tiva sugiere que las clulas normales resisten ms los frmacos o las radiaciones, porque una vez que sufren dao gentico, tal vez detengan su ciclo celular en tanto se repara dicho dao. Por lo contrario, las clulas cancerosas que han sufrido dao gentico tienen mayor probabilidad de sufrir apoptosis en tanto posean un genp53 funcional. Si las clulas cancerosas pierden la funcin p53, no pueden sufrir apoptosis y se vuelven mucho ms resistentes a tratamiento adicional (fig. 16-16). Esta quiz sea la principal razn de que los tumores cuyas clulas carecen de un gen p53 funcional respondan muy poco a la radiacin y a la quimioterapia en comparacin con tumores que poseen una copia del tipo nativo del gen. Funciones en colaboracin de RB y p53. Ahora que hemos analizado los mecanismos mediante los cuales se cree que actan dos genes supresores de tumor, RB y p53, podemos

686

CAPITULO 16 Cncer Reparacin antes de divisin La elevacin de j*^ la concentracin ( *\e p53 Dao detiene al DNA aGI ^ / Divisin aun con el dao (mutacin, aneuploidia) Falta p53 ^^s Falta { H-Tumor detencin deG,

.0 0 '
(a)

Dao al DNA /

^>

o apoptosis

Falta de mitosis y muerte celular

(bi

FIGURA 16-15. Modelo de la funcin de p53. a) Normalmente la divisin celular no requiere la participacin de p53. b) Sin embargo, si el DNA de una clula se daa como consecuencia de la exposicin a mutgenos, la concentracin de p53 se eleva y acta para detener la progresin de la clula a travs de la fase G] o para dirigir la clula hacia la apoptosis. c) Cuando se inactivan ambas copias del gen p53, las clulas pierden la capacidad para detener el ciclo celular o de que la clula cometa apoptosis despus de dao al DNA. Como resultado, la clula muere por fallas en la mitosis o contina proliferando con una dotacin cromsomica anormal, que puede conducir a la formacin de crecimiento maligno. (Segn D.P. Lae, reimpreso con permiso de Nature 358:15, 1992. Copyright 1992, Macmiilan Magazines Ltd.)

ver de qu manera los productos de estos dos genes actan en conjunto como armas anti tumor ales. Reconsideraremos brevemente el fenotipo del cristalino en los ratones RB~~ knockout descritos anteriormente. Hicimos notar que a diferencia de las clulas del cristalino normal, las clulas de ratones deficientes RB no se detienen en la fase Gj del ciclo celular, y en vez de diferenciarse en las clulas fibrosas del cristalino mueren por apoptosis. Hemos visto cmo p53 codifica una protena que puede dirigir a una clula anor-

mal a lo largo de una va que conduce a la autodestruccin. Por lo tanto, sera de esperar que p53 fuera encargada de que las clulas del cristalino RB~~ sufran apoptosis. Esta posibilidad fue sometida a prueba recientemente en ratones con doble deficiencia en ambos tipos de genes supresores de tumor (ratones RB~/~, p53~!~}. El examen del cristalino en desarrollo de estos ratones doblemente knockout revela el fenotipo preciso pronosticado en los comentarios precedentes. Debido a la falta de un gen RB, estas clulas no

Sin tratamiento

5-fluorouracilo

Etopsido

Adriamicina

FIGURA 16-1 (>. Demostracin experimental del papel de p53 en la supervivencia de clulas tratadas con agentes quimioteraputicos. Se cultivaron clulas de ratn que tenan dos copias de un gen funcional p53 (lnea de arriba), una copia funcional del gen >53 (lnea de enmedio), o carecan de una copia funcional del gen (lnea de abajo). Los cultivos de cada uno de estos tipos de clulas se desarrollaron en ausencia de un agente quimoteraputico (primera columna) o en presencia de alguno de los tres compuestos indicados en la parte superior de las otras tres columnas. Es evidente que los compuestos tienen un efecto espectacular para detener el crecimiento e inducir la muerte celular {apoptosis) en clulas normales, en tanto que las clulas p53~!~ continan proliferando en presencia de estos compuestos. (Segn S.W. Lowe, H.E. Ritley, T. jacks y D.E. Housman, Cell 74:959, 1993; con permiso de Cell Press.)

CAPITULO 16 Cncer

687

se detienen en GI y se diferencian, pero a causa de que tambin carecen de un gen p53, en vez de sufrir apoptosis continan proliferando y finalmente forman tumores. Por lo tanto, al parecer estos dos genes actan en colaboracin para evitar la formacin de tumores, y al parecer esta es la razn de que en muchas clulas tumorales se observan versiones mutadas de ambos genes. Otra indicacin de las actividades en colaboracin de pRb y p53 proviene del estudio de virus DNA tumorales. Anteriormente se describi de qu manera estos virus codifican protenas que se enlazan a pRb interfiriendo con su capacidad para mantenerse en E2F. Estos virus tambin codifican otra protena cuya funcin es enlazarse a p53, inhibiendo su capacidad para actuar como factor de transcripcin. Por lo tanto, para transformar una clula normal en una clula maligna, estos virus mantienen inactivos a ambos genes supresores de tumor. En realidad, cuando se infectan clulas con virus DNA tumoral cuyo p53 enlazado a protena ha sufrido mutacin, las clulas ya no pueden ser transformadas y en vez de ello sufren apoptosis. En estas condiciones, parecera que la protena viral de tipo nativo que se enlaza a pRb provoca la entrada de las clulas a la fase S, pero la protena p53 no inactivada por el virus mutante reconoce las condiciones de crecimiento anormal y lleva a cabo la autodestruccin de la clula. Otros genes supresores de tumor. Las mutaciones en los genes RB y p53 se relacionan con la formacin de una gran variedad de procesos malignos en el hombre, pero las mutaciones en otros genes supresores de tumor slo se descubren en unos pocos tipos de cncer. Por ejemplo, algunos genes supresores de tumor de ordinario se encuentran inactivados en clulas provenientes de cncer del colon. En Estados Unidos y Europa, el cncer de colon, segundo cncer ms comn entre individuos del sexo masculino (despus del cncer pulmonar) y tercero ms comn en mujeres (des-

pus de cncer mamario y cncer pulmonar) es resultado de la acumulacin de mutaciones en varios genes diferentes (cuadro 16-3 y figura 16-9). Igual que con el gen RB, los genes supresores de tumor relacionados con cncer de colon fueron identificados originalmente en estudios de genomas de miembros de familias con alto riesgo de desarrollar esta enfermedad. La poliposis adenomatosa coli (PAC) es una enfermedad hereditaria en la cual los individuos desarrollan un gran nmero de plipos premalignos (adenomas) en las clulas epiteliales que revisten la pared del colon (fig. 16-17). Si no se eliminan, las clulas de estos plipos tienen gran probabilidad de progresar hasta una etapa totalmente maligna. Se observ que las clulas de pacientes con esta enfermedad contienen supresin en una pequea porcin del cromosoma 5, la cual posteriormente se identific como sitio del gen supresor de tumor llamado PAC. La persona que hereda supresin PAC se encuentra en posicin similar a la que hereda supresin RB; si la segunda copia del gen se daa, se pierde la funcin protectora de dicho gen. Se supone que la prdida de la segunda copia de PAC es causa de que la clula pierda algn aspecto del control de su crecimiento, lo que permite que la clula prolifere para formar plipos. La conversin de las clulas del plipo a un estado ms maligno, caracterizado por su capacidad para provocar metstasis e invadir otros tejidos, al parecer se logra por acumulacin de mutaciones adicionales, incluyendo mutaciones en p53. Aunque todava no se determina la funcin de PAC, la mutacin del gen no slo se observa en cncer de colon de personas con PAC, sino tambin en ms de 50% de los tumores espordicos del colon, lo que sugiere que el gen desempea un papel importante en el desarrollo de esta enfermedad. Se estima que el cncer mamario afecta aproximadamente a una de cada ocho mujeres que viven en Estados Unidos. De estos casos, casi 5% se presentan en familias

CUADRO 16-3. Genes alterados en el cncer de colon

Gen
"CHNPC"

Cromosoma

Tumores con mutaciones

Clase

Accin Mantiene la precisin durante la duplicacin del DNA Molcula de sea! intraceluiar Ayuda a regular el ciclo celular Receptor de factor de crecimiento Actividad reguladora del gen Desconocida Molculas de adherencia celular Regula la actividad del gen

-15%

K-Ras Ciclinas neu/HER2

12

-50% 4% 2% 2%

Oncogen Oncogen Oncogen Oncogen Tumor supresor Tumor supresor Tumor supresor

Varios

17

PAC DCC p53

5 18 17

>70% >70% >70%

FUENTE: J. Marx, Science 260:752, 1993. Copyright 1993 American Association for the Advancement of Science.

688

CAPITULO 16 - Cncer

(a)

pus de un esfuerzo intensivo efectuado en varios laboratorios, en 1994 se identificaron dos genes llamados BRCA1 y BRCA2 como causantes de la mayor parte de los casos hereditarios de cncer mamario. BRCA1 tambin predispone a las mujeres a desarrollar cncer ovrico, que tiene una tasa de mortalidad especialmente elevada. Las secuencias de nucletidos de estos genes relacionados demuestran que codifican polipptidos que contienen motivos de dedos de zinc enlazados a DNA (pg. 520); esto sugiere que las protenas codificadas actan como factores de transcripcin. En general, se supone que BRCA1 y BRCA2 son genes supresores de tumor, porque al parecer una mujer hereda un gen defectuoso (o supresin) y la otra copia del gen debe ser inactivada antes de que se desarrolle el tumor. Esto es una caracterstica primaria de los genes supresores de tumor. Pero a diferencia de otros genes supresores de tumor, ninguno de los genes BRCA parece sufrir mutacin en las formas espordicas del cncer. La razn de esta discrepancia todava no se ha determinado.
Oncogenes

(b)
t'H',l~.K\. Plipos premalignos en el epitelio del colon humano, a) Fotografa de un colon extirpado de un paciente con sndrome de Gardner que muestra el patrn de formacin de plipos. Se observan patrones similares en el colon de personas con la enfermedad hereditaria de poliposis adenomatosa coli (PAC), b) Amplificacin mayor de una porcin del colon mostrado en a, con un patrn discreto de poliposis. (Cortesa de Randall W. Burt.)

cuyos miembros tienen mayor riesgo de padecer la enfermedad y se puede atribuir a la herencia de un gen que predispone al individuo a desarrollar cncer mamario. La forma hereditaria de la enfermedad explica cerca de 25% de los casos diagnosticados antes de los 30 aos de edad. Des-

Como se describi anteriormente, los oncogenes codifican protenas que promueven la prdida de control del crecimiento y la conversin de una clula a un estado maligno. Se han identificado casi 100 oncogenes diferentes, muchos de ellos incluidos como parte del genoma de virus RNA tumorales, pero slo en una docena de ellos se ha demostrado un papel en la carcinognesis humana (cuadro 16-4). El encogen implicado con mayor frecuencia en los tumores humanos es ras, que codifica una protena (Ras) cuya funcin se describi en detalle en el captulo 15 (pg. 649). A diferencia de los genes supresores de tumor, en los cuales se ha comprobado que son causa de algunas formas hereditarias del cncer, ningn tipo de trastorno se puede atribuir a un encogen heredado (o sea, un protooncogen mutado). Por lo tanto, siempre que aparece un tumor, se supone que el oncogen se presenta como resultado de una mutacin somtica. Es posible que un oncogen hereditario conduzca a la muerte del embrin, lo que explicara por qu dichos genes no se relacionan con la predisposicin hereditaria a desarrollar cncer. Muchos de los oncogenes conocidos codifican protenas que tienen los siguientes tipos de funciones (fig. 16-18). Oncogenes que codifican factores de crecimiento o sus receptores. Los oncogenes se identificaron por primera vez como elementos del genoma de virus tumorales, segn se expone en La va experimental al final de este captulo. La primera relacin entre oncogenes y factores de crecimiento se estableci en 1983, cuando se descubri que el virus del sarcoma del simio (SIS) causante de cncer contena un oncogen (sis) derivado del gen celular que codifica al factor de crecimiento derivado de plaquetas (FCDP), una protena presente en la sangre humana. Las clulas cultivadas tratadas con este virus se convierten en cancerosas porque secretan grandes cantidades de FCDP en el medio, lo que provoca proliferacin celular de manera descontrolada. Aunque se ha demostrado que FCDP se produce en clulas cancerosas extradas de varios tumores humanos, todava no est claro si es un factor causal de la carcinognesis humana.

CAPITULO 16 Cncer CUADKO 16-4. Protooncogenes y tumores humanos: algunas incriminaciones consistentes
Pi-oto-

689

Factores de crecimiento p. ej., FCDP (sis)

Nsoplasia(s)

Lesin Translocacin Amplificacin Amplificacin Mutaciones puntuales Mutaciones puntuales Translocacin Amplificacin Amplificacin Amplificacin Mutaciones puntuales Mutaciones puntuales Mutaciones puntuales Redisposicin ? Amplificacin ? ? Redisposicin

Receptores de factores de crecimiento p. ej., receptor FCE ferbB)

abl ei'bB
nea 8V SSP mic

L-mic N-imc H-ras

K-ras N-ras
re ros K-sam sis src trk

Leucemia mielgena crnica Carcinoma de clulas escamosas; astrocitoma Adenocarcinoma mamario, ovrico y gstrico Carcinoma de ovario y de glndula suprarrenal Adenoma hipofisario, carcinoma tiroideo Linfoma de Burkitt Carcinoma de pulmn, glndula mamaria y cuello uterino Carcinoma de pulmn Neuroblastoma, carcinoma pulmonar de clulas pequeas Carcinoma de colon, pulmn y pncreas; melanorna Leucemia aguda mielgena y linfoblstica; carcinoma de tiroides, melanoma Carcinoma genitourinario y tiroideo; melanoma Carcinoma tiroideo Astrocitoma Carcinoma de estmago Astrocitoma Carcinoma de colon Carcinoma tiroideo

Src (src} CiclinaCdk Rasras) Proteincmasas o protenas que activan proteinci nasas

Protenas que controlan e! ciclo de la clula p. ej., ciclina D (bcID 0 Protenas que afectan la apoptosis p. ej., Bcl2 lbc!2)

Factores de transcripcin p. ej., Mic (mic)

FIGURA 16-18. Diagrama que resume los tipos de protenas codificadas por oncogenes. En estas se incluyen factores de crecimiento (1), receptores para factores de crecimiento (2), proteincinasas y las protenas que las activan (3), protenas que participan en el control del ciclo celular (4), protenas que activan o inhiben la apoptosis (5), y protenas enlazadas a DNA (6).

FUENTE: J.M. Bshop, Cell 64:236, 1991, con permiso de Cell Press.

Se ha observado que otro virus encogen, el virus de la eritroblastosis aviaria, es portador de un encogen (erbB) que dirige la formacin de un receptor FCE alterado, o sea, un receptor que ha perdido parte del dominio extracelular de la protena que se enlaza al factor de crecimiento. Se podra esperar que el receptor alterado fuera incapaz de sealar a una clula en el momento de dividirse, pero ocurre justamente lo contrario. Esta versin alterada del receptor estimula en forma constitutiva a la clula, independientemente de la presencia o ausencia del factor de crecimiento en el medio. Esta es la razn de que las clulas cultivadas portadoras del gen alterado proliferen de manera descontrolada. Se ha observado que algunos tipos de cncer humano espontneo contienen clulas con alteraciones genticas que afectan a receptores del factor de crecimiento. Con mayor frecuencia, las clulas malignas contienen un nmero mucho mayor de receptores en sus membranas plasmticas en comparacin con clulas normales. La presencia de un exceso de receptores provoca mayor sensibilidad de las clulas a concentraciones mucho menores de factor de crecimiento, y por lo tanto son estimuladas para dividirse en condiciones que no afectaran a clulas normales. Los protooncogenes que codifican a receptores para factores de

crecimiento tambin pueden activarse por mutaciones o translocaciones que inducen dimerizacin en receptores monmeros en ausencia de ligando exgeno, lo que conduce a la activacin de la actividad de su proteincinasa ffig. 15-25). Oncogenes que codifican proteincinasas citoplsmicas. Algunas proteincinasas citoplsmicas, incluyendo serintreonincinasas y tirosincinasas, se incluyen en la lista de oncogenes. Por ejemplo, Raf es una serintreonincinasa que se sita a la cabeza de la cascada cPAM, la va primaria para el control del crecimiento en muchas clulas. -Es evidente que Raf se encuentra en buena posicin para causar estragos dentro de una clula cuya actividad enzimtica debe alterarse como resultado de una mutacin en el gen raf. Igual que con los receptores de factor de crecimiento y Ras, las mutaciones que convierten a Raf en una enzima que. siempre permanece en la posicin "activa" tiene mayor probabilidad de convertir el protooncogen en un encogen y contribuir a que la clula pierda el control de su crecimiento. El primer encogen descubierto, src, tambin es una proteincinasa, pero fosforila residuos de tirosina sobre sustratos de protena, en vez de residuos de serina o treonina. La transformacin de una clula por un src contenido en el' virus tumoral se acompaa de la fosforilacin de una gran

690

CAPITULO 16 Cncer

variedad de protenas. Entre los aparentes sustratos de la proteincinasa Src se incluye entre un gran nmero de protenas que participan en la transduccin de seales (incluyendo proteinfosfatasas y protenas G heterotrimricas, pg, 634), protenas implicadas en el control de la configuracin del citoesqueleto y protenas que participan en la adherencia celular. Dada la naturaleza de las funciones afectadas, no es difcil entender por qu una protena Src alterada puede ser carcingena, pero las mutaciones src slo aparecen rara vez entre los cambios genticos encontrados en las clulas tumorales humanas. Adems, los ratones que han perdido el gen src no muestran efectos obvios del crecimiento, lo que indica que el producto del gen no es indispensable para el crecimiento de la clula y sugiere que las clulas contienen otras protenas que pueden efectuar la funcin del Src perdido. Oncogenes que codifican factores de transcripcin nucleares. Algunos oncogenes codifican protenas cuya estructura indica que actan como factores de transcripcin, pero todava no se identifican con claridad los genes cuya expresin controlan. La progresin de clulas a travs del ciclo celular requiere la activacin coordinada (y represin) de gran variedad de genes cuyos productos contribuyen de diferente manera al crecimiento y divisin celular. Por lo tanto, no es sorprendente que las alteraciones de protenas que controlan la expresin de estos genes puedan modificar gravemente a los patrones de crecimiento normal de la clula. Tal vez el oncogen mejor estudiado cuyo producto se cree que acta como factor de transcripcin sea mic. En la pgina 582 se hizo notar que las clulas que no se encuentran en crecimiento o divisin activa tienden a salirse del ciclo celular y entrar a una etapa conocida como GQ, de la cual pueden ser recuperadas. La protena Mic normalmente es una de las primeras protenas que aparecen cuando una clula en esta etapa de reposo se estimula para reingresar al ciclo celular y dividirse por adicin de factores cte crecimiento al medio. Mic. contina ntetSl\dQe en tanto las clulas se sigan dividiendo, lo que sugiere que la protena participa en la continuacin de la proliferacin celular. Cuando se bloquea selectivamente la expresin de mic utilizando ogonucletidos contra sentido, se bloquea la progresin de la clula a travs de GI. Uno de los oncogenes alterados en el cncer humano es mic, que con frecuencia se observa amplificado o redispuesto dentro del genoma como resultado de una inversin o translacin de cromosomas. Se cree que estos cambios cromosmicos apartan el gen mic de sus influencias reguladoras normales e incrementan su nivel de expresin celular, produciendo un exceso de protena Mic. Dado su papel en la promocin del avance del ciclo celular, se ha sugerido que la sobreexpresin de mic pueden causar que las clulas continen prollteranao porque superan las influencias inhibidoras ejercidas por los productos de genes supresores de tumor, como pRb y p53. Uno de los tipos ms comunes de cncer entre los pobladores de frica, llamado linf orna de Burkitt, ocurre como resultado de la translocacin de un gen mic a la posicin

cin que da como resultado la expresin del gen mic inicia el proceso maligno. En frica, la enfermedad se presenta principalmente en personas que se han infectado con el virus de Epstein-Barr parecido al del herpes. Por alguna razn, este mismo virus slo provoca infecciones menores (p. ej., mononucleosis) en personas que viven en pases occidentales y no se acompaa de tumorignesis. Oncogenes que codifican productos que afectan la apoptosis. La apoptosis puede ser uno de los mecanismos claves del cuerpo para librarse por s mismo de clulas tumorales en etapa temprana de su avance hacia la malignidad. S esta afirmacin es cierta, entonces toda alteracin en una clula que tienda a disminuir la capacidad de la misma a la autodestruccin sera de esperar que aumente la probabilU dad de que una clula produzca un tumor. El oncogen ms estrechamente vinculado con la apoptosis es bcl-2, que codifica una protena enlazada a membrana que normalmente acta para inhibir la apoptosis en estos tejidos. El papel de bcl-2 en la apoptosis se nota con mayor claridad en los fenotipos de los ratones knockout que carecen del gen bcl-2. Una vez formado, el tejido linfoide de estos ratones sufre regresin espectacular como resultado de una apoptosis ampliamente propagada. Igual que el mic, el producto del gen bcl-2 se convierte en oncognico cuando se expresa a niveles ms elevados que lo normal, como puede ocurrir cuando el gen se transloca a un sitio anormal sobre el cromosoma. Ciertos tipos de cncer linfoide humano (llamados linfomas foliculares de clulas B) se correlacionan con la translocacin del gen bcl-2 a la proximidad de un gen que codifica la cadena pesada de molculas de anticuerpos. Se ha sugerido que la sobreexpresin del gen bcl-2 conduce a suprimir la apoptosis en los tejidos linfoides, permitiendo proliferar a las clulas anormales para formar tumores linfoides. Bcl-2 tambin puede participar en la disminucin de la eficacia de las sustancias quimioteraputicas manteniendo vivas y con capacidad de proliferar a clulas daadas por los frmacos-.
Genes que promueven la formacin de tumores a travs de efectos secundarios sobre otros genes

Si consideramos que el cncer es una enfermedad conocida por alteraciones en el DNA de clulas somticas, entonces se dic que toda actividad que incremente la frecuencia de mutaciones genticas probablemente aumente el riesgo de desarrollar cncer. En el captulo 13 se describi de qu manera los nucletdos incorporados incorrectamente durante la duplicacin son eliminados selectivamente de las cadenas recin sintetizadas mediante un proceso llamado reparacin de las desigualdades (pg. 569). La reparacin de desigualdades requiere la accin coordinada de varias protenas, incluyendo aquellas que reconocen la lesin, que eliminan una parte de la cadena que contiene la lesin, y que sustituyen el segmento equivocado con nucletidos complementarios. Si alguna de estas protenas es defectuosa, sera de esperar que ia clula afectada muestre una tasa elevada anormal de mutaciones, lo que a su vez incrementa el riesgo de rnalignizacin.

adyacente a un gen que codifica una cadena de polipptidos de una molcula de anticuerpo. Se cree que la activa-

La primera gran demostracin de QUG un defecto en la


reparacin de desigualdades poda ser un factor en el desa-

CAPITULO 16 Cncer

691

rrollo de cncer fue dada a conocer en 1993 a partir de estudios efectuados en clulas de pacientes con la forma hereditaria ms comn de cncer de colon, llamada cncer hereditario no poliposo de colon (CHNPC) para distinguirlo del tipo que forma plipos descrito anteriormente. El gen defectuoso causante de CHNPC se encuentra en casi 0.5% de la poblacin y explica hasta 15% de los casos de cncer de colon. En la pgina 406, se hizo notar que el genoma contiene un gran nmero de secuencias DNA repetitivas muy cortas llamadas microsatlites. El anlisis de DNA de personas con CHNPC revela que los microsatlites de las clulas tumorales con frecuencia son de longitud diferente en comparacin con la secuencia correspondiente en el DNA de clulas normales. Se podran esperar estas variaciones en el DNA de individuo diferentes, pero no en el DNA de clulas diferentes de la misma persona. Los cambios de longitud de una secuencia microsatlite se deben a errores durante la duplicacin cuando la cadena plantilla copiada y la nueva cadena que se sintetiza se deslizan en cuanto a sus posiciones relativas entre s. Este tipo de deslizamiento ocurre con mayor frecuencia en regiones que contienen secuencias cortas altamente repetidas. Segn la direccin del deslizamiento, la cadena recin sintetizada

contiene nucletidos adicionales o falta de nucletidos en comparacin con la cadena plantilla. La diferencia de longitud en la secuencia de nucletidos de las dos cadenas genera una pequea asa de DNA donde no se forman pares en el dplex hija, que normalmente se reconocen por enzimas reparadoras de desigualdades y la reparacin efectuada. Este dato sugiere que una deficiencia en el sistema de reparacin de desigualdades puede ser la causa del desarrollo de estos tipos de cncer hereditario. El apoyo de esta hiptesis proviene de estudios sobre el DNA y las clulas de personas con CHNPC. En tanto los extractos de clulas normales puedan efectuar la reparacin de desigualdades in vitro, los extractos de clulas tumorales CHNPC presentan defectos de reparacin. El anlisis del DNA de un gran nmero de personas con HNPCC revela supresiones o mutaciones debilitantes en algunos de os genes que codifican protenas para establecer la va DNA para reparacin de desigualdades. Las clulas incapaces de reparar apropiadamente los sitios que contienen asas de una sola cadena o nucletidos mal apareados, pueden acumular mutaciones secundarias a travs de todo el genoma, incluyendo alteraciones que inactvan genes supresores de tumor y oncogenes activados. Estas clulas se encuentran en mucho

LA VIA

EXPERIMENTAL

El descubrimiento de los oncogenes


En 1911, Peyton Rous, del RockefeUer Institute for Medical Research, public un trabajo de menos de una pgina de extensin (comparti la pgina con una nota acerca del tratamiento de la sfilis) y prcticamente no tuvo impacto en la comunidad cientfica. Pero en este trabajo se public una de las observaciones ms perspicaces en el campo de la biologa celular y molecular.1 Rous haba estado trabajando con un sarcoma de pollo que se poda transmitir de una gallina a otra inoculando a un husped de la misma cepa con pedazos de tejido tumoral. En el trabajo de 1911, Rous describi una serie de experimentos que sugeran fuertemente que el tumor se poda transmitir de un animal a otro mediante un "virus filtrable", trmino acuado unos 10 aos antes para describir agentes patgenos lo suficientemente pequeos para pasar a travs de filtros impermeables a bacterias. En este experimento, Rous extirp los tumores de la pechuga de la gallina, moli las clulas en un mortero con arena estril, centrifug las partculas materiales para formar un pellet, elimin el sobrenadante, y forz el lquido sobrenadante a travs de un filtro de porosidad variable incluyendo algunos de tamao lo bastante pequeo para evitar el paso de bacterias. A continuacin inyect el filtrado en el msculo de li pechuga de una gallina receptora y observ que un porcentaje significativo de los animales inyectados desarrollaban tumor. El virus descubierto por Rous en 1911 es un virus que contiene RNA. A fines del decenio de 1960 se encontraron virus similares relacionados con tumores mamarios y leucemia en roedores y gatos. Se han criado ciertas cepas de ratones que desarrollaron tumores especficos con frecuencia muy elevada. Se pudieron observar partculas virales que contienen RNA dentro de las clulas tumorales y tambin como yemas de la superficie celular, segn se muestra en la micrografa de la figura VE 16-1. Es evidente que los tumores desarrollados en e^ta cepas puras se transmiten verticalmente, o sea, a-travs del vulo fertilizado de la madre a la cra, de modo que.los adultos de cada generacin invariablemente desarrollan el tumor. Estos estudios suministraron pruebas de que el genoma viral se puede heredar a travs de los gametos y transmitirse subsecuentemente de una clula a otra por medio de la mitosis sin mostrar efecto evidente alguno sobre la conducta de las clulas. La presencia de los genomas virales no es una peculiaridad de las cepas criadas en el laboratorio, puesto que se demostr que ratones salvajes (feral) tratados con carcingenos qumicos desarrollan tumores que a menudo contienen los mismos antgenos caractersticos de los virus tumorales RNA y muestran partculas virales al microscopio electrnico. Una de las principales preguntas respecto de la transmisin vertical de los virus RNA tumorales era si el genoma viral

692

CAPITULO 16 Cncer

mayor riesgo de convertirse en malignas. La razn de que estas mutaciones conduzcan principalmente a cncer de colon en oposicin a otros tipos de cncer todava es un enigma.
Conclusiones importantes acerca de la gentica del cncer

Iniciamos este captulo con un punto de vista pesimista acerca de los proyectos inmediatos para tratamiento del cncer. Ahora que hemos estudiado algunos de los datos recientes acerca de las bases genticas de la formacin de tumores, podemos entender por qu la lucha contra el cncer quiz requiera en ltimo trmino que se deba alterar permanentemente la composicin gentica de las clulas de un tumor. Mientras tanto, se espera desarrollar algn otro tipo de tratamiento eficaz contra el cncer sin recurrir a modificaciones genticas. Es til puntualizar que los conocimientos recin obtenidos acerca del papel de genes especficos en la tumorignesis ha cambiado una perspectiva importante acerca del cncer. Hace 10 aos, una de las afirmaciones escuchadas con mayor frecuencia era que el cncer consista en grupo de enfermedades muy diferentes y

cada tipo de cncer tal vez tuviera que ser tratado de manera particular. Hasta ahora hemos tenido la experiencia de que ciertos compuestos quimioteraputicos son ms adecuados para destruir un tipo de cncer en comparacin con otros. Pero el dato de que muchos tipos diferentes de cncer comparten los mismos defectos genticos, como alteraciones en p53, RB, ras, o todos juntos, nos hace concebir la esperanza de que muchos tipos de cncer distintos pueden tratarse mediante una tcnica comn. Por ejemplo, si se pudiera desarrollar un frmaco que imite los efectos de las protenas p53 o Ras, entonces sera posible tratar una gran variedad de tipos de cncer con el mismo agente. La identificacin de defectos genticos especficos tambin plantea la posibilidad de desarrollar procedimientos de deteccin capaces de identificar personas que debido a ciertos alelos que poseen se encuentran en mayor riesgo de desarrollar algn tipo particular de cncer. Puesto que cuanto ms temprano se descubra un cncer mayor es la probabilidad de supervivencia, estos procedimientos de deteccin podran tener un impacto significativo en la disminucin de la mortalidad debida a cncer.

se pasa de los padres a la descendencia como molculas RNA Ubres o integradas de alguna manera al DNA de la clula husped. Las pruebas indican que la infeccin y la transformacin efectuadas por estos virus requieren la sntesis de DNA. Howard Temin, de la Universidad de Wisconsin, sugiri que la duplicacin de los virus RNA tumorales poda ocurrir por medio de un DNA intermedio, un provirus, que entonces servira como plantilla para la sntesis del RNA viral. Pero este modelo requiere una enzima nica, una DNA polimerasa dependiente de RWA que nunca se na encontrado en agin fipo de clula. Esta situacin se modific en 1970 cuando se descubri una enzima con esta actividad independientemente por David Baltimore, del Massachusetts Institute of Technology, y por Temin y Satoshi Mizutani.2-3 Baltimore examin los virones (partculas virales maduras) de dos virus RNA tumorales, virus Rauscher de la leucemia murina (VRLM) y el virus del sarcoma de Rous (VSR). Se incub una preparacin de virus purificada bajo condiciones que promueven la actividad de una DNA polimerasa, incluyendo Mg2+ (o Mn2+), NaCl y ditiotreitol (que evita la oxidacin de los grupos -SH de la enzima}, y los cuatro fosfatos desoxirribonuclesidos, uno de los cuales (TTP) se marc con 3H. Se encontr que la preparacin incorpora los precursores DNA marcados en un producto cido insoluble (cuadro VE

16=1) aue mostr lis propiedades del DNA. Por ejemplo, 1


FIGURA VE 16-1. Micrografa electrnica del virus Friend de la leucemia murina surgiendo como una yema desde la superficie de una clula leucmica cultivada. (Cortesa de E. de Haruen.)

producto de la reaccin se convirti en cido soluble (indicando que se haba convertido a productos de bajo peso molecular) mediante tratamiento con la desoxirribonucleasa pancretica o la nucleasa microccica, pero no fue afectado por la ribonucleasa pancretica o por la hidrlisis alcalina (a las cuales es sensible el RNA) (cuadro VE 16-2). Se encontr que la enzima sedimenta junto con las partculas virales maduras, o

CAPITULO 16 Cncer

693

CUADRO VE 16-1. Propiedades de la DNA polimerasa del virus Rauscher de a leucemia murina pmoles 3H-TMP incorporado en 45 min

25

Sistema de reaccin Completo Sin acetato de magnesio Sin acetato de magnesio + 6 mM de MnCl2 Sin ditiotreitol Sin NaCl Sin dATP Sin dCTP Sin dGTP

20

3.31 0.04 1.59 0.38 2.18 <0.10 0.12 <0.10


15

10

FUENTE: D. Baltimore, reimpreso con permiso de Nature 226:1209, 1970. Copyright 1970, Macmillan Magazines Ltd.

que sugiere que forma parte del virin mismo y no es una enzima donada por la clula husped. Aunque el producto fue insensible al tratamiento con la ribonucleasa pancretica, la plantilla fue muy sensible a esta enzima (fig. VE 16-2), en particular cuando se trat el virin previamente con la ribonucleasa antes de la adicin de los otros componentes de la mezcla de reaccin (fig. VE 16-2, curva 4). Estos resultados fortalecen la hiptesis de que el RNA viral suministra la plantilla para la sntesis de una copia del DNA, la cual presumiblemente sirvi como plantilla para la sntesis del RNAm viral requerido para a infeccin y la transformacin. Estos experimentos no slo sugieren que la transformacin celular efectuada por un virus RNA tumoral procede a travs de un DNA intermedio, sino tambin modificaron el antiguo concepto originalmente propuesto por Francis Crick conocido como el dogma central, que establece que la informacin en una clula siempre fluye del DNA al RNA y a la protena. La DNA polimerasa dependiente de RNA se conoce como transcriptasa inversa. Durante el decenio de 1970 la atencin se volvi a la identificacin de genes de virus tumorales que causan la transformacin y al mecanismo de accin de ios productos del gen. Las pruebas de anlisis genticos indican que se pueden aislar

30

60
Mi u los

90

3H-TTP

FIGURA VE 16-2. Incorporacin de la radiactividad a partir de en un precipitado cido insoluole por accin de la DNA polimerasa del virus Rauscher de a leucemia murina en presencia y ausencia de ribonucleasas. Curva 1, sin adicin de ribonucleasa; curva 2, preincubacin sin adicin de ribonucleasa durante 20 minutos antes de aadir 3H-TTP; cuma 3, ribonucleasa aadida a la mezcla de reaccin; curva 4, preincubacin con ribonucleasa antes de aadir 3H-TTP. (Segn D. BaUimore, reimpreso con permiso de Nature 226:1210, 1970. Copyright 1970, Macmiilnn Magazines Ltd.)

cepas mutantes de virus que conservan la capacidad de crecer en clulas husped, pero que son incapaces de transformar la clula en otra que muestre propiedades malignas.4 Por lo tanto, la capacidad de transformar una clula reside en una porcin restringida del genoma viral. Estos datos fueron el antecedente de una serie de trabajos publicados por Harold Varmus, J. Michael Bishop, Dominique Stehein y sus colaboradores, de la Universidad de California,

CUADRO VE 16-2. Caracterizacin dei producto de la polimerasa Radiactividad insoluole en cido Porcentaje de producto no digerido

Exper. 1

Tratamiento
Sin tratamiento 20 fig desoxirribonucleasa 20 fig nucleasa microccica 20 fig ribonucleasa Sin tratamiento NaOH hidrolizado

1425 125 69 1361 1644 1684

(100) 9 5 96 (100) 100

FUENTE: D. Balttmore, reimpreso con permiso de Nature 226:1210, 1970. Copyright 1970, Macmillan Magazines Ltd.

694

CAPITULO 16 Cncer

en San Franciso. Estos investigadores comenzaron aislando cepas mutantes del virus del sarcoma aviario {VSA) portador de supresiones de 10 a 20% del genoma, constituyendo un virus incapaz de inducir sarcoma en pollos y transformar fibroblastos en cultivo. El gen encargado de la transformacin, que est ausente en estos mutantes, se conoce como src (para el sarcoma). Para aislar el DNA correspondiente a las regiones borradas, que al parecer son portadoras de los genes requeridos pasa, lateansQtrcva.o&sx,se emple la svguievte estaate.'jia experimental.5 Se emple RNA de los genomas de viriones completos (encgenos) como plantilla para la formacin de una cadena nica complementaria de DNA marcada con istopo radiactivo (DNAc) por medio de transcriptasa inversa. A continuacin se hibrid el DNAc marcado (presente como fragmentos) con RNA obtenido de uno de los mutantes con supresiones. Los fragmentos de DNA que no lograron hibridar al RNA representan porciones del genoma que han sufrido supresin a partir del muante defectuoso para la transformacin, y por !o tanto se supone que contienen el gen requerido por el virus para causar la transformacin. Los fragmentos de DNA que no hibridan al RNA se pudieron separar de los que forman parte e hbridos DNA -RNA, permitiendo que la mezcla pase a travs de una columna que contiene una sal particular de fosfato de calcio llamada hidroxapatita (extrada de tejido seo), Mediante esta estrategia bsica, se aisl una secuencia de DNA conocida como DNAcsarc, que corresponde aproximadamente a 16% del genoma viral (1 600 de los 10 000 nucletidos que constituyen toda la longitud del genoma). Una vez aislado, el DNAcsarc demostr ser muy til como sonda. AI menos se demostr que este DNAc marcado puede hibridar al DNA extrado de varias especies de aves (gallinas, pavos, codornices, patos y avestruz australiana), lo que indica que los genomas celulares de estas aves contienen una secuencia de DNA estrechamente relacionada a src.6 Por lo contrario, en estos primeros experimentos no se descubri homologa entre DNAcsarc y el DNA de mamferos (ratones y terneras). La cintica de la reaccin entre los DNA de estas aves y el DNAc sarc indica que las secuencias complementarias estn presentes como parte de fracciones no repetidas del genoma (pg. 425), y por lo tanto slo se presentan una vez (o muy pocas veces) por conjunto haploide de DNA. Estos datos suministraron la primera gran demostracin de que un gen presente en un virus tumoral que causa transformacin celular tambin est presente en el DNA de clulas normales (no infectadas) y por lo tanto al parecer es parte del genoma normal de las clulas. Estos resultados indican que los genes transformadores del genoma viral (oncogenes) no son verdaderos genes virales, sino ms bien genes celulares captados por el RNA del virus tumoral durante una infeccin previa. Este gen entregado por la clula al parecer confiere al virus el poder de transformar a las mismas clulas en las cuales se encuentra normalmente dicho gen. El hecho de que la secuencia src se encuentre en todas las especies aviarias estud iadas sugiere que la secuencia se ha conservado durante toda la evolucin de las aves y, por lo tanto, se asume que gobiernan una actividad bsica de las clulas normales. En un estudio subsecuente se efectu hibridacin entre el DNAc S3rc y el DNA celular procedente de varios animales bajo

condiciones estrictas, lo que permiti formar dplex con un porcentaje considerable de bases formando pares incorrectos. En estas condiciones se observ que DNAcsarc puede enlazarse al DNA de todas las ciclasas de vertebrados, incluyendo mamferos, pero no al DNA del erizo de mar, la mosca de la fruta o bacterias. Una manera de determinar el grado de bases mal apareadas en los dplex consiste en vigilar la temperatura a la cual se separan los complejos DNA-RNA (fusin). Cuanto ms elevada la tempe^ata^ de usvrv, mavOT eV posterA^e de pares de bases apropiadas (A-T y G-C). En el cuadro VE 16-3 se muestran ios resultados de estos experimentos. Las reducciones de la temperatura de fusin sugieren 3 a 4% de pares de bases impropias entre DNAc snrc con DNA de pollos y otro 10% de pares de bases impropias con el DNA de otros vertebrados. Segn estos resultados, es posible concluir que el gen src'no slo est presente en el RNA del genoma VSA y el genoma de las clulas de pollo que puede infectar, sino que tambin se encuentra un gen homlogo en el DNA de vertebrados evolutivamente distantes, lo que sugiere que desempea alguna funcin crtica en las clulas de todos los vertebrados.7 Los resultados de estos experimentos plantearon muchas preguntas, algunas e mayor importancia, que fueron: 1) Cu) es la funcin del producto del gen src? 2) De qu manera la presencia del gen viral src (referido como v-src) altera la conducta de una clula normal que ya posee una copia del gen (conocida como c-src)? El producto del gen src inicialmente fue identificado por Ray Erikson y sus colaboradores, de la Universidad de Colorado, por medio de dos procedimientos independientes: 1) precipitacin de la protena contenida en extractos de clulas transformadas por anticuerpos preparados a partir de animales infectados con VSR, y 2) sntesis de la protena en un sistema sintetizador de protena libre de clulas empleando el gen viral aislado como plantilla. A travs de estos procedimientos se encontr que el producto del gen src es una protena de 60 000 daltons, a la cual se le dio el nombre pp6sn:.8 Cuando la protena pp6O~V se incub con ^-P-ATP, se transfirieron grupos fosfato radiactivos a las cadenas pesadas de las molculas del anticuerpo relacionado (IgG) empleado en la inmunoprecipitacin. Este dato sugiere que el gen src codifica una enzima que posee actividad de proteincinasa/' Se obtuvieron datos para confirmar estos estudios de la protena producida por un muante del VSA sensible a temperatura capaz de transformar clulas cuando crecen a 35C pero no a 41C. Las pruebas indican que el producto del gen src codificado por estos mutantes se desnaturaliza irreversiblemente a la temperatura ms elevada. Para estudiar la actividad del producto del gen mutante src se infectaron cultivos parelelos de clulas de pollo con el mutante (designado NY68) o con el virus no defectuoso (designado nd), y se desarrollaron las clulas a 41C o a 35C (cuadro VE 16-4). De cada uno de los cuatro cultivos se prepararon extractos de clulas, la protena pp6O~'v fue inmunoprecipitada y el precipitado se analiz en busca de actividad de proteincinasa. En el cuadro VE 16-4 se puede ver que, en tanto la protena inmunoprccipitada codificada por el virus no defectuoso mostr elevada actividad de proteincinasa a 41C, la misma protena de la cepa sensible a temperatura mostr actividad muy disminuida. Estos datos suministraron mayo-

CAPITULO 16 Cncer

695

CUADRO VE l6-:i. Estabilidad trmica de los dplex entre DNAcsarc y DNA celular DNA XC* Pollo Hombre Ternera Ratn Salmn en los dplex 65 55 29 24 28 19 79 74.5 66.5 65 65.5 66.5 0 -4.5 -12.5 -14 -13.5 -12.5

* Las clulas XC son clulas de ratas infectadas que contienen casi 20 copias del genoma del virus del sarcoma aviario. El DNA XC y el DNAcSarc deben contener secuencias que son precisamente complementarias, de modo que la hibridacin de estos dos DNA suministra un estndar interno en cada anlisis. FUENTE: D.H. Spector, H.E. Varmus y J.M. Bishop, Proc, Nati. Acad. Sd. U.S.A. 75:4105, 1978.

res pruebas acerca de que el producto src es la proteincinasa. Cuando se fijaron clulas infectadas con VSA, se practicaron cortes y se incubaron con anticuerpos marcados con ferritina contra la protena pp60src, los anticuerpos se localizaron sobre la superficie interna de la membrana plasmtica, lo que sugiere una concentracin del producto del gen src en esa parte de la clula (fig. VE 16-3). Estos fueron los primeros estudios para dilucidar la funcin de un oncogen. Una proteincinasa es el tipo de producto del gen que sera de esperar tuviera posibilidad de actividad transformadora porque puede regular las actividades de un gran nmero de otras protenas, cada una de las cuales sirve a una funcin crtica en una u otra actividad relacionada con el crecimiento de la clula. Anlisis posteriores del papel del producto del gen src revelaron un dato inesperado. A diferencia de todas las proteincinasas cuya funcin se haba estudiado, la protena pp60src transfiri grupos fosfato a residuos de tirosina sobre la protena sustrato en vez de hacerlo sobre residuos de serina o treonina.11 La existencia de residuos de tirosina fosforilados no se haba descubierto previamente porque los

CUADRO VE 16-4. Incremento dependiente de temperatura de la actividad fosforante de la protena src inmunoprecipitada en clulas de pollo infectadas con un muante de transformacin ts del VSA Actividad fosforilante Temperatura de crecimiento Virus SR-VSA (nd) SR-VSA (nd) SR-NY68 SR-NY68
32P incorporado (fmol/mg protena)

WGL'RA VE 1 (>-.'[. Micrografa electrnica de un corte a travs de un par de fibroblastos adyacentes tratados con anticuerpos marcados con ferritina contra la protena pp60src. La protena se encuentra localizada (segn lo revelan los granulos densos de ferritina) en la membrana plasmtica de la clula y particularmente concentrada en los sitios de uniones de abertura. (Segn Mark C. Willingliam, Gilbert jay e Ira Pastan, Cell 18:128, 1979, con permiso de Cell Press.)

ec)
35 41 35 41

16.6 35.8 19.8 1.7

FUENTE: M.S. Collet y R.L. Erikson, Proc. Nati. Acad. Sci. U.S.A. 75:2023, 1978.

residuos de serina y treonina fosforilados son aproximadamente 3 000 veces ms abundantes en las clulas y porque los residuos de fosfotreonina y fosfotirosina son difciles de separar por los procedimientos tradicionales de electroforesis. No slo el producto del gen viral src (v-src) codifica una tirosincinasa, sino tambin la sintetiza la versin celular del gen c-src. Sin embargo, el nmero de residuos de tirosina fosforilados en las protenas de clulas RSV transformadas es aproximada-

696

CAPITULO 16 Cncer

mente ocho veces mayor que en las clulas testigo. Este dato sugiere que la versin viral del gen puede inducir transformacin porque funciona a nivel de actividad ms alto que la versin celular. La fosforilacin de residuos de tirosina adicionales en las protenas celulares se supone que es indispensable para la transformacin maligna de las clulas efectuada por el virus del sarcoma de Rous. Todava debe determinarse si los productos de los genes v-src y c-src son o no equivalentes funcionalmente. Los resultados del estudio del VSR suministraron datos preliminares de que un incremento en la actividad del producto de un oncogen poda ser la clave para convertir a una clula normal en clula maligna. Pronto se demostr que el fenotipo maligno tambin poda ser inducido por un oncogen que contiene una secuencia alterada de nucletidos. El estudio fundamental en este sentido fue realizado por Robert Weinberg y sus colegas, del Massachusetts Institute of Technology, utilizando la tcnica de transfeccin de DNA (seccin 17-12).12 Weinberg inici los estudios obteniendo 15 diferentes estirpes de clulas malignas derivadas de clulas de ratn tratadas con una sustancia qumica carcingena. As, estas clulas se haban convertido en malignas sin exponerlas a virus. El DNA de cada una de estas estirpes celulares se extrajo y utiliz para transfectar un tipo de fibroblasto de ratn no maligno llamado clula NIH3T3. Las clulas NIH3T3 se seleccionaron para estos experimentos porque captan DNA exgeno con gran eficiencia y se transforman rpidamente en clulas malignas en cultivo. Despus de la transfeccin con el DNA de las clulas tumorales los fibroblastos se desarrollaron in vitro, y los cultivos fueron estudiados en busca de la formacin de grumos (focos) que contienen clulas transformadas por el DNA aadido. De las 15 estirpes celulares probadas, cinco de ellas produjeron DNA capaz de transformar a las clulas NIH3T3 receptoras. El DNA de las clulas normales carece de esta capacidad. Estos resultados demostraron que las sustancias qumicas carcingenas producen alteraciones en a secuencia de nucletidos de genes que confieren a los genes alterados la capacidad para transformar otras clulas. As, los genes celulares se podan convertir en oncogenes de dos maneras diferentes: como resultado de su incorporacin al genoma de un virus o por alteracin mediante carcingenos qumicos. Hasta este punto, prcticamente todos los estudios acerca de genes causantes de cncer se haban efectuado en ratones, pollos y otros organismos cuyas clulas eran muy susceptibles a la transformacin. En 1981, la atencin se torn hacia el cncer humano cuando se demostr que el DNA aislado de clulas tumorales humanas tena capacidad de transformar a las clulas NIH3T3 de ratones despus de la transfeccin.13 De los 26 diferentes tipos de tumores humanos ensayados en este estudio, dos suministraron DNA capaz de transformar a los fibroblastos receptores de ratn. En ambos casos el DNA se extrajo de estirpes celulares procedentes de carcinoma de vejiga (identificados como EJ y J82). Se emprendieron grandes esfuerzos para determinar si los genes se derivan de virus tumorales, pero no se encontraron datos de DNA viral en estas clulas. Estos resultados proporcionaron la primera demostracin de que algunas clulas de cncer humano contienen un

oncogen activado que se puede transmitir a otras clulas y causar su transformacin. El conocimiento de que el cncer se puede transmitir de una clula a otra mediante fragmentos de DNA suministr una base para determinar qu genes de una clula, cuando son activados por mutacin o por algn otro mecanismo, se encargan de provocar la malignizacin de la clula. Para efectuar esta determinacin fue necesario aislar el DNA que cuando se capta causa a transformacin de la clula. Una vez aislado el DNA extrao causante de la transformacin se pudo analizar la presencia de alelos causantes de cncer. En 1982, en plazo de dos meses, tres laboratorios diferentes comunicaron el aislamiento y clonacin de un gen hasta entonces no identificado en clulas del carcinoma de vejiga humana capaces de transformar fibroblastos NIH3T3 de ratn.14'16 En uno de estos estudios, el DNA clonado capaz de transformar clulas se utiliz para examinar DNA humano normal en busca de la presencia de secuencias homologas.15 Se descubri que el DNA aislado de fibroblastos humanos normales contiene un fragmento de DNA que hibrida con la sonda oncogen del carcinoma de vejiga. Este dato indica que el DNA humano normal contiene una secuencia muy similar, hasta en lo ms mnimo, a la secuencia que activa el oncogen, por lo que es un argumento contra la posibilidad de que la secuencia entre a la clula por infeccin viral. Cuando se compar la susceptibilidad a la restriccin enzimtica de los dos DNA, del gen transformador, aislado de las clulas del carcinoma vesical humano y del gen homlogo aislado de fibroblastos humanos normales, no se encontraron diferencias en las posiciones de los sitios de restriccin, lo que indica que si hay diferencias entre las dos versiones del gen, deben ser muy sutiles. Estos resultados suministran fuerte apoyo a la proposicin de que las clulas cancerosas se originan como resultado de alteraciones en genes celulares preexistentes (o sea protooncogenes) que los convierten en genes activos causantes de cncer (oncogenes). En 1982 se haban identificado varios genes virales transformadores, cada uno de los cuales se demostr que tena un homlogo celular. Una vez aislado y clonado el gen transformador de las clulas del cncer de vejiga humana, el siguiente paso lgico era determinar si este gen muestra alguna relacin con los oncogenes de los virus RNA tumorales. Una vez ms, en plazo de dos meses se publicaron tres trabajos de diferentes laboratorios comunicando resultados similares.17'19 Las tres publicaciones demostraron que el oncogen capaz de transformar clulas NIH3T3 es el mismo oncogen {denominado ras) que se encuentra en el virus del sarcoma de Harvey, el cual es un virus RNA turnoral murino. Las comparaciones preliminares de las dos versiones de ras, la versin viral y su homlogo celular, no mostraron diferencia alguna, lo que indica que os dos genes son muy similares o idnticos. Estos datos sugirieron que el cncer que se desarrolla espontneamente en la poblacin humana se debe a una alteracin gentica similar a los cambios que ocurren en las clulas transformadas en el laboratorio por medio de virus. Es importante hacer notar que los tipos de cncer inducidos por el virus del sarcoma de Harvey (sarcomas y eritroleucemias) son muy diferentes de los tumores de vejiga, cuyo origen es epitelial. Esta fue la primera indicacin de que las alteraciones en el mismo gen, el ras, pueden

CAPITULO 16 - Cncer

697

provocar el desarrollo de una amplia gama de tumores diferentes. A fines de 1982 se publicaron tres trabajos ms de diferentes laboratorios acerca de los cambios precisos en el gen ras que lo activan para convertirse en encogen.20'22 La comparacin de fragmentos de DNA de restriccin preparados a partir de clulas malignas y clulas normales indica que la activacin de ras no significa cambios burdos en el DNA. Luego de ubicar con precisin la seccin del fragmento de DNA grande causante de la transformacin, est indicado el anlisis de la secuencia de nucletidos activada por el DNA de clulas vesicales malignas como resultado de la sustitucin de una sola base dentro de la regin codificante del gen. Es notable que las clulas de ambos tipos de carcinoma vesical estudiados (identificados como EJ y T24) contienen precisamente la misma alteracin: un nucletido que posee guanina en un sitio especfico del DNA del protoncogen es sustituida por una timidina en el encogen activado. Esta sustitucin de bases da como resultado el reemplazo de una valina por una glicina como el residuo aminocido nmero 12 del polipptido. La determinacin de la secuencia de nucletidos del gen v-ras del virus del sarcoma de Harvey revel una alteracin en la secuencia de bases que afecta precisamente al mismo codn modificado en el DNA del carcinoma de vejiga humana. El cambio en el gen viral consiste en sustituir la glicina normal por una arginina. Es evidente que este residuo glicina particular desempea un papel crtico en la estructura y funcin de esta protena. Es interesante hacer notar que el gen ras es un protooncogen, el cual, igual que src, se puede activar por unin a un promotor viral. Por lo tanto, ras puede ser activado para inducir la transformacin a travs de dos vas totalmente diferentes: incrementando su expresin o alterando la secuencia de aminocidos del polipptido que codifica. La investigacin descrita en La va experimental actual significa un gran paso hacia adelante en el conocimiento de las bases genticas de la transformacin maligna. Gran parte de la investigacin inicial acerca de virus RNA tumorales se origin de la idea de que estos agentes pueden ser causas importantes para el desarrollo de cncer humano. La bsqueda de la causa viral del cncer condujo al descubrimiento del encogen, que a su vez llev a comprobar que el oncogen es una secuencia celular adquirida por e! virus, lo que finalmente condujo al descubrimiento de que un oncogen puede causar cncer sin la participacin de un genoma viral. As, los virus tumorales, que por s mismos no participan directamente en la mayor parte de los tipos de cncer humano, han proporcionado la perspectiva necesaria a travs de la cual se puede visualizar nuestra propia herencia gentica en busca de informacin que quiz conduzca a nuestra propia destruccin.

BIBLIOGRAFA
1. Rous, P. 1911. Transmission of a malignant new growth by means of a cell-free fltrate. /. Amer. Mea. Assoc. 56:198.

2. Baltimore, D. 1970. RNA-dependent DNA polymerase in virions of RNA tumour viruses. Nature 226:1209-1211. 3. Temin, H. y Mizutani, S. 1970. RNA-dependent DNA polymerase in virions of Rous sarcoma virus. Nature 226:1211-1213. 4. Martin, G.S. 1970. Rous sarcoma virus: A function required for trie maintenance of the transformed state. Nature 227:1021-1023. 5. Stehelin, D. y cois. 1976. Purification of DNA complementary to nucleotide sequences required for neoplastic transformation of fibroblasts by avian sarcoma viruses. /. Mol. Biol. 101:349-365. 6. Stehelin, D. y cois. 1976. DNA related to the transforming gene(s) of avian sarcoma viruses is present in normal avian DNA. Nature 260:170-173. 7. Spector, D.H., Varmus, H.E. y Bishop, J.M. 1978. Nucleotide sequences related to the transforming gene of avian sarcoma virus are present in DNA of uninfected vertebrates. Proc. Nati. Acad. Sci. U.5.A. 75:4102-4106. 8. Purchio, A.F. y cois. 1978. Identification of a polypeptide encoded by tha avian sarcoma virus src gene. Proc. Nati. Acad. Sci. U.S.A. 75:1567-1671. 9. Collet, M.S. y Erikson, R.L. 1978. Protein kinase activity associated with the avian sarcoma virus src gene product. Proc. Nati. Acad. Sci. U.S.A. 75:2021-2924. 10. Willingham, M.C., Jay, G. y Pastan, I. 1979. Localization of the ASV src gene product to the plasma membrane of transformed cells by electrn microscopic immunocytochemistry. Cdl 18:125134. 11. Hunter, T. y Sefton, B.M. 1980. Transforming gene product of Rous sarcoma virus phosphorylates tyrosine. Proc. Nati. Acad. Sci. U.S.A. 77:1311-1315. 12. Shih, C. y cois. 1979. Passage of phenotypes of chemically transformed cells via transfection of DNA and chromatin. Proc, Nati. Acad. Sci. U.S.A. 76:5714-5718. 13. Krontiris, T.G. y Cooper, G.M. 1981. Transforming activity of human tumor DNAs. Proc. Nati. Acad. Sci. U.S.A. 78:1181-1184. 14. Goldfarb, M. y cois. 1982. Isolation and preliminary characterization of a human transforming gene from T24 bladder carcinoma cells. Nature 296:404-409. 15. Shih, C. y Weinberg, R.A. 1982. Isolation of a transforming sequence from a human bladder carcinoma cell line. Cell 29:161-169. 16. Pulciani, S. y cois. 1982. Oncogenes in human tumor cell lines: Molecular cloning of a transforming gene from human bladder carcinoma cells. Proc. Nati Acad. Sci. U.S.A. 79:2845-2849. 17. Parada, L.F. y cois. 1982. Human EJ bladder carcinoma oncogene is homologue of Harvey sarcoma virus ras gene. Nature 297:474478. 18. Der, CJ. y cois. 1982. Transforming genes of human bladder and lung carcinoma cell Unes are homologous to the ras genes of Harvey and Kirsten sarcoma viruses. Proc. Nati. Acad. Sci. U.S.A. 79:3637-3640. 19. Santos, E. y cois. 1982. T24 human bladder carcinoma oncogene is an activated form of the normal human homologue of BALB- and Harvey-MSV transforming genes. Nature 298:343-347. 20. Tabin, CJ. y cois. 1982. Mechanism of activation of a human oncogene. Nature 300:143-149. 21. Reddy, E.P. y cois. 1982. A point mutation is responsible for the acquisition of transforming properties by the T24 human bladder carcinoma oncogene. Nature 300:149-152. 22. Taparowsky, E. y cois. 1982. Activation of the T24 bladder carcinoma transforming gene is linked to a single amino acid change. Nature 300:762-765.

698

CAPITULO 16 Cncer

SINOPSIS
El cncer es una enfermedad que implica defectos hereditarios en los mecanismos de control celular, que dan como resultado la formacin de tumores invasivos capaces de liberar clulas que propagan la enfermedad a sitios distantes del cuerpo. Muchas de las caractersticas de las clulas tumorales se pueden observar en cultivo. En tanto las clulas normales proliferen en cultivo hasta formar una sola capa (monocapa) en el fondo del plato de cultivo, las clulas cancerosas continuarn creciendo apilndose una sobre otra para formar grumos. Otras caractersticas reveladas con frecuencia en las clulas cancerosas son su capacidad para crecer cuando estn suspendidas en agar suave, tendencia a mostrar un nmero anormal de cromosomas; capacidad para continuar dividindose de manera indefinida; desorganizacin del citoesqueleto; y falta de respuesta a las clulas vecinas, particularmente en relacin con actividades locomotoras (p. 672). Las clulas normales se pueden convertir en clulas cancerosas mediante tratamiento con una gran variedad de sustancias qumicas, radiacin ionizante y varios virus que contienen DNA y RNA; todos estos agentes actan provocando cambios en el genoma de la clula transformada. El anlisis de las clulas de un tumor canceroso casi siempre muestra que las clulas se originan por el crecimiento de una sola clula (se dice que el tumor es monoclonal). El desarrollo de un tumor maligno es un proceso de mltiples etapas caracterizado por progresin de las alteraciones genticas que disminuyen cada vez ms la respuesta de las clulas a los mecanismos reguladores normales y les confieren mayor capacidad para invadir tejidos normales. Los genes que participan en la carcinognesis constituyen un subconjunto especfico del genoma cuyos productos participan en actividades como control del ciclo celular, adherencia entre las clulas y reparacin del DNA. Se cree que es el efecto en conjunto de varias mutaciones y no la secuencia particular de las mismas lo que es importante para el desarrollo del estado maligno. Adems de alteraciones genticas, el crecimiento de clulas tumorales tambin est bajo la influencia de factores no genticos o epigenticos que permiten a la clula expresar su fenotipo maligno. Por ejemplo, los estrgenos parecen promover el desarrollo de tumores mamarios (/?, 675). Los genes implicados en la carcinognesis se dividen en dos amplias categoras: genes supresores de tumor y oncogenes. Los genes supresores de tumor codifican protenas que restringen el crecimiento de la clula y evitan la malignizacin de las mismas. Los genes supresores de tumor actan con caracterstica recesiva, puesto que se deben borrar ambas copias o sufrir mutacin antes que se pierda su funcin protectora. Los oncogenes, en contraste, codifican protenas que promueven a prdida de control del crecimiento y la malignizacin. Los oncogenes se originan de protooncogenes, genes que codifican protenas con participacin en las actividades normales de la clula. Las mutaciones que alteran la protena o su expresin provocan que el protooncogen acte de manera normal y promueva la formacin de tumor. Los oncogenes actan con caracterstica dominante; o sea, slo se requiere una sola copia para que la clula exprese el fenotipo alterado. La mayor parte de los tumores contienen alteraciones en ambos genes supresores de tumor y oncogenes. Mientras la clula tenga cuando menos una copia de todos sus genes supresores de tumor, debe estar protegida contra las consecuencias de la formacin del oncogene. Por lo contrario, la prdida de la funcin de los supresores de tumor no debe ser suficiente, por s soia, para provocar que la clula se malignice (/>. 679). El primer gen supresor de tumor identificado fue RB, causante de un raro tumor de la retina llamado retinoblastoma, que aparece con mayor frecuencia en ciertas familias pero tambin puede ocurrir espordicamente. Los nios con la forma familiar de la enfermedad heredan una copia mutada de genes. Estos individuos desarrollan el cncer slo despus de dao espordico al segundo alelo en una de las clulas de la retina. RB codifica una protena llamada pRb, que participa en la regulacin del paso de una clula de GI a S en el ciclo celular. La forma no fosforilada de pRb interacta con ciertos factores de transcripcin evitando que se unan al DNA y activando los genes requeridos para ciertas actividades de la fase S. Una vez fosforilado pRb, la protena libera su factor de transcripcin enlazado, que entonces puede activar la expresin del gen, conduciendo al inicio de la fase S (p. 681). El gen supresor del tumor implicado con mayor frecuencia en el cncer humano es p53, cuyo producto (p53) puede evitar la formacin de cncer mediante varios mecanismos diferentes. En una de sus acciones, p53 acta como factor de transcripcin que activa la expresin de una protena (p21) inhibidora de la cinasa dependiente de ciclina que mueva a la clula a travs del ciclo celular. El dao al DNA provoca la sntesis de p53, lo que conduce a la detencin del ciclo celular en tanto se repara el dao. p53 tambin puede reorientar clulas en camino hacia la malignizacin y dirigirlas por vas alternas que conducen a una muerte programada, o apoptosis. El p53 de ratones knockout inicia el desarrollo de tumores varias semanas despus del nacimiento. Otros genes supresores de tumor incluyen a PAC, que cuando sufre mutacin predispone a la persona al desarrollo de cncer de colon, y BRCA1 y 2, que cuando sufren mutacin predisponen a las mujeres a desarrollar cncer mamario (i. 6S4). La mayor parte de los oncogenes conocidos se derivan de protooncogenes que participan en las vas que transmiten seales de crecimiento desde el ambiente extracelular al interior de la clula, particularmente al ncleo celular. A diferencia de los genes supresores de tumor, los oncogenes no se han implicado en las formas hereditarias de cncer. Se han identificado algunos oncogenes que codifican factores de crecimiento o sus receptores, incluyendo sis, el gen que codifica a! factor de crecimiento derivado de plaquetas (FCDP), y crbB, el gen que codifica al receptor del factor de crecimiento epidrmico (FCE). A veces las clulas malignas contienen un nmero mucho mayor de uno de estos receptores de factores de crecimiento en sus membranas plasmticas en comparacin con clulas normales. El exceso de receptores hace sensibles a las

CAPITULO 16 Cncer

699

clulas a concentraciones ms bajas del factor de crecimiento, y por lo tanto, las estimula para dividirse en condiciones que no afectaran a clulas normales. Algunas proteincinasas citoplsmicas, incluyendo cinasas de serina-treonina y de tirosina, se encuentran en la lista de oncogenes, Estas incluyen raf, que codifica una proteincinasa en la cascada cPAM. Las mutaciones en ras se encuentran entre los oncogenes ms comunes observados en el cncer humano. Como se analiza en el captulo 15, Ras activa la funcin de proteincinasa de Raf. Si Raf permanece en estado activado, contina enviando seales a lo largo de la va cPAM, que conducen a la estimulacin continua de la proliferacin celular. Algunos oncogenes, como mic, codifican protenas que actan como factores de transcripcin. Mic normalmente es una de las primeras protenas que aparecen cuando se estimula una clula para reingresar al ciclo celular a partir de la fase en reposo GQ. La sobreexpresin de mic puede provocar que las clulas continen proliferando porque superan las influencias inhibidoras ejercidas por los productos de los genes supresores de tumor. Otro grupo de oncogenes, como el bd-2, al parecer codifica protenas que participan en la apoptosis. Las pruebas sugieren que la sobreexpresin del gen

bd-2 conduce a la supresin de la apoptosis de tejidos linfoides, permitiendo proliferar a clulas anormales para formar tumores linfoides (p. 638).

Los genes que codifican protenas que participan en la reparacin del DNA tambin se han implicado en la carcinognesis. El genoma de pacientes con la forma hereditaria ms comn de cncer de colon, llamado cncer hereditario no poliposo de colon (CHNPC), contiene secuencias microsatlites de varios nucletidos anormales. Los cambios de longitud de una secuencia microsatlite son productos de errores durante la duplicacin, que normalmente son reconocidos por enzimas encargadas de reparar los pares de bases impropios. Esto sugiere que el defecto en este sistema puede ser causa de cncer. Esta conclusin se apoya en el dato de que extractos de clulas de tumores CHNPC muestran deficiencia en la reparacin del DNA. Sera de esperar que las clulas con estas deficiencias muestren un nivel mucho mayor de mutaciones en los genes supresores de tumor y en los oncogenes que provocaran un riesgo mucho mayor de malignizacin (/>, 690).

BIBLIOGRAFA
Amato, I. 1993. Hope for a magic bullet that moves at the speed of light. Science 262:32-33. Beardsley, T. 1994. A war not won. Sci. Am. 270:130438 (ene.). Bishop, J.M. 1991. Molecular themes in oncogenesis. Cell 74:235-248. Brugge, J. y cois., eds. 1991. Origins of Human Cncer. Cold Spring Harbor Laboratory Press. Cavenee, W.K. y White, R.L. 1995. The genetic basis of cncer. Sci. Am. 272:72-79 (marzo). Cohn, J. 1993. Cncer vaccines get a shot in the arm. Science 262:842843. Cuthill, S. 1994. Cellular epigenetics and the origin of cncer. Bioess. 16:393-394. Evans, C.W. 1991. The Metastatic Cell: Behaviour and Biochemistry. Chapman & Hall. Fisher, D.E. 1994. Apoptosis in cncer therapy: Crossing the threshod. Cell 78:1051-1054, Franks, L.M. y Teich, N.M. eds. 1991. Introduccin to the Cellular and Molecular Biology of Cncer. 2a. ed. Oxford University Press. Friend, S. 1994. p53: A glimpse at the puppet behind the shadow play. Science 266:334-335. Hinds, P.W. y Weinberg, R.A. 1994. Tumor-suppressor genes. Curr, Opin. Gcnet. Dev. 4:135-141. Harrington, E.A. y cois. 1994. Oncogenes and cell death. Curr. Opin. Genes Deveop. 4:120-129. Harris, C.C. 1993, p53: At the crossroads of molecular carcinogens and risk assessment. Lae, D.P. 1992. p53, guardin of the genome. Nature 358:15. Lae, D.P. 1993. A death in the Ufe of p53. Nature 362:786-787, Lowy, D.R. y Wlum5en, B.M. 1995. Ratonal cncer therapy. Nnfure Medicine 1:747-748. Marshall, E. 1993. Search for a ker: Focus shifts from fats to hormones. Science 259:618-621. Marx, J. 1993. Cell death studies yield cncer clues. Science 259:760761. Marx, J. 1994. New look found between p53 and DNA repair. Science 266:1321-1322. Marx, J. 1994. How cells cycle toward cncer. Science 263:319-321. Marx, J. 1994. New tumor suppressor may rival p53. Science 264:344345. Nevins, J.R. 1994. Cell cycle targets of the DNA tumor viruses. Curr. Opin. Genet. Dev. 4:130-134. Nowak, R. 1994. Breast cncer offers surprises. Science 265:1796-1798. Nowak, R. 1994. A new gives early warning of a growing killer. Science 264:1847-1848. Nowak, R. 1995. Discovery of AT gene sparks biomedical research bonanza. Science 268:1700-1701. Parkham, P, 1994. Politically incorrect viruses. Nature 368:495-496. Pawson, T. y Hunter, T. eds. 1994. Oncogenes and cell proliferation. Curr. Opin. Genet. Dev. 4:1-141. Picksley, S.M. y Lae, D.P. 1994. p53 and Rb: Their cellular roles. Curr. Opin. Cell Bioi 6:853-858. Pietenpol, J.A. y Vogelstein, B. 1993. No room at the p53 inn. Nature 365:17-18. Rabbits, T.H. 1994. Chromosomal translocations n human cncer. Nature 372:143449. Radman, M. y Wagner, R, 1993. Missing mismatch repair. Nature 366:722. Raff, M.C. 1992. Social controls on cell survival and cell death. Nature 356:397-400. Rodrigues, G.A. y Park, M. 1994. Oncogenic activation of tyrosine kinases. Curr. Opin. Genet. Dev. 4:15-24. Rosenberg, S.A. y Barry, J.M. 1992. The Transfonned Cell. Putman. Rustgi, A.K. y cois. 1992. The molecular basis of cofon cncer. Aun. Rev. Med. 43:61-68.

700

CAPITULO 16 Cncer Varmus, H. y Weinberg, S.A. 1992. Cenes and the Biology of Canec: Scientific American Library. Vogelstein, B. y Kingler, K.W. 1994. X-rays strike p53 again. Nature 370:174-175. White, E. 1994. p53, guardin of Rb. Nature 371:1-2. Yokota, J. y Sugirnura, T. 1993. Mltiple steps in carcinogenesis involving alterations of mltiple tumor suppressor genes. PASEE }. 7:920925.

Service, R.E. 1994. Stalking the start of colon cncer. Science 263:15591560. Stetler, VV.G. y cois. 1993. Tumor cell interactions with the extracelluar matrix during invasin and metstasis. Ann. Rev. Cell Biol 9:541573-

Stillman, B. y cois. 1994. The molecular genetics of cncer. Cola Spring Harbor Symp. Quant. Biol. vol. 49. Travis, J. 1992. Closing in on melanoma susceptibility genes. Science 258:1080-1081. Varmus, H.E. y Levine, AJ. 1983. Rendngs in Tumor Biology. Cold Spring Harbor Laboratory Press.