P. 1
Sistemas de Comunicacion de Datos

Sistemas de Comunicacion de Datos

|Views: 31|Likes:

More info:

Published by: Jose Luis Tubay Vergara on May 28, 2012
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as PDF, TXT or read online from Scribd
See more
See less

11/22/2013

pdf

text

original

Sistemas de Comunicacion de Datos

Luis B. Ramirez del Pino 1-1
Indice
1 PRESENTACION................................................................................................1-4
1.1 OBJETIVOS DE LA ASIGNATURA.......................................................................1-4
1.2 PROFESORADO................................................................................................1-4
1.3 PROGRAMA.....................................................................................................1-4
1.4 PRACTICAS EN LABORATORIO.........................................................................1-5
1.5 BIBLIOGRAFIA.................................................................................................1-5
2 INTRODUCCION...............................................................................................2-7
2.1 INTRODUCCION...............................................................................................2-7
2.2 CLASIFICACION DE LA REDES..........................................................................2-9
2.3 PROTOCOLOS Y ARQUITECTURA DE PROTOCOLOS .........................................2-15
2.4 MODELO DE REFERENCIA OSI.......................................................................2-15
2.5 PROTOCOLOS TCP-IP ...................................................................................2-18
2.5.1 Nivel de subred ....................................................................................2-19
2.5.2 Nivel de Inter-red.................................................................................2-19
2.5.3 Nivel de transporte...............................................................................2-19
2.5.4 Nivel de aplicacion ..............................................................................2-20
2.6 COMPARACION OSI VS TCP/IP ....................................................................2-20
2.7 ORGANISMOS DE NORMALIZACION ...............................................................2-21
3 TRANSMISION DE DATOS ...........................................................................3-22
3.1 TERMINOLOGIA.............................................................................................3-22
3.1.1 Transmision de datos analogica v digital............................................3-26
3.1.2 Perturbaciones en la transmision........................................................3-26
3.1.2.1 Atenuacion.......................................................................................3-26
3.1.2.2 Distorsion de retardo........................................................................3-27
3.1.2.3 Ruido................................................................................................3-27
3.2 CAPACIDAD DE UN CANAL ............................................................................3-28
3.3 MEDIOS DE TRANSMISION .............................................................................3-30
3.3.1 Guiados................................................................................................3-30
3.3.1.1 Par trenzado .....................................................................................3-30
3.3.1.2 Coaxial .............................................................................................3-33
3.3.1.3 Fibra optica ......................................................................................3-34
3.3.2 No guiados ...........................................................................................3-38
3.3.2.1 Microondas terrestres.......................................................................3-38
3.3.2.2 InIrarrojos ........................................................................................3-40
3.3.2.3 Ondas de radio.................................................................................3-40
4 CODIFICACION DE DATOS .........................................................................4-42
4.1 ALGORITMOS ................................................................................................4-43
4.1.1 NRZ (NRZ-L Non Return to :ero (Level))............................................4-43
4.1.2 NRZI (NRZ Invertido) ..........................................................................4-44
4.1.3 Manchester...........................................................................................4-45
4.1.4 Manchester diferencial ........................................................................4-45
4.1.5 Pseudo-ternario ...................................................................................4-45
4.1.6 AMI (Alternate Mark Inversion) ..........................................................4-46
4.1.7 B8ZS (Bipolar with 8-Zeros Substitution) ...........................................4-46
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 1-2
4.1.8 HDB3 ('High Densitv Bipolar-3 Zeros`) ...........................................4-47
4.1.9 Forma de onda de estas codificaciones...............................................4-47
4.2 DATOS DIGITALES A SEÑALE ANALOGICA .....................................................4-47
4.2.1 Despla:amiento en amplitud (ASK Amplitud-Shift Keving) ................4-48
4.2.2 Despla:amiento en frecuencia (FSK) ..................................................4-48
4.2.3 Despla:amiento en fase (PSK)............................................................4-48
4.3 DATOS ANALOGICOS A SEÑALES DIGITALES..................................................4-48
4.3.1 Modulacion por impulsos codificados.................................................4-49
4.4 DATOS ANALOGICOS A SEÑAL ANALOGICA ...................................................4-49
5 INTERFACES DE CAPA FISICA ..................................................................5-50
5.1 CONCEPTOS ..................................................................................................5-50
5.1.1 Transmision sincrona v asincrona.......................................................5-50
5.1.1.1 Transmision asincrona.....................................................................5-50
5.1.1.2 Transmision sincrona.......................................................................5-51
5.2 INTERFACES ..................................................................................................5-51
5.2.1 RS-232..................................................................................................5-52
5.2.2 MODEM de distancia limitada............................................................5-52
5.2.3 MODEM de la red telefonica...............................................................5-53
5.2.4 MODEM Nulo......................................................................................5-54
6 NIVEL DE ENLACE.........................................................................................6-55
6.1 INTRODUCCION.............................................................................................6-55
6.2 ENTRAMADO.................................................................................................6-55
6.3 CONTROL DE FLUJO.......................................................................................6-57
6.3.1 Parada v espera...................................................................................6-57
6.3.1.1 Analisis de prestaciones...................................................................6-60
6.4 VENTANA DESLIZANTE .................................................................................6-61
6.4.1.1 Analisis de prestaciones...................................................................6-62
6.5 CONTROL DE ERRORES ..................................................................................6-63
6.5.1 Codigos de proteccion frente a errores ...............................................6-64
6.5.1.1 Proteccion de errores: tipos..............................................................6-65
6.5.1.1.1 Paridad .......................................................................................6-65
6.5.1.1.2 Paridad bloque o multidimensional ...........................................6-65
6.5.1.1.3 Codigo Hamming.......................................................................6-65
6.5.1.1.4 CRC ...........................................................................................6-68
6.5.2 Tecnicas de correccion de errores.......................................................6-69
6.5.2.1 ARQ.................................................................................................6-69
6.5.2.1.1 ARQ de parada y espera ............................................................6-69
6.5.2.1.2 ARQ de rechazo simple.............................................................6-69
6.5.2.1.3 ARQ de rechazo selectivo..........................................................6-70
6.5.2.1.4 Prestaciones de ARQ.................................................................6-71
6.5.2.1.4.1 Arq de parada y espera........................................................6-71
6.5.2.1.4.2 ARQ con rechazo simple y selectivo..................................6-72
6.5.2.2 FEC (Forward Error Control)..........................................................6-72
6.5.2.3 Tecnicas mixtas................................................................................6-73
6.5.2.3.1 FEC ¹ FEC.................................................................................6-73
6.5.2.3.2 ARQ ¹ FEC...............................................................................6-73
6.6 PROTOCOLOS DE NIVEL DE ENLACE...............................................................6-73
6.6.1 SLIP (Serial Link IP) ...........................................................................6-73
6.6.2 PPP (Point to Point Protocol) .............................................................6-73
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 1-3
6.6.3 HDLC (High level Data Link Control) ................................................6-74
6.7 PROBLEMAS ..................................................................................................6-74
7 NIVEL DE ENLACE: MEDIO COMPARTIDO...........................................7-77
7.1 MULTIPLEXACION.........................................................................................7-77
7.1.1 TDM.....................................................................................................7-77
7.1.2 FDM.....................................................................................................7-78
7.1.3 WDM....................................................................................................7-78
7.1.4 CDM.....................................................................................................7-78
7.2 PROTOCOLO ALOHA...................................................................................7-78
7.2.1 ALOHA puro........................................................................................7-78
7.3 CALCULO DE PRESTACIONES.........................................................................7-79
7.3.1 ALOHA ranurado ................................................................................7-80
7.4 CSMA..........................................................................................................7-81
7.4.1 CSMA 1-persistente .............................................................................7-81
7.4.2 CSMA no persistente............................................................................7-81
7.4.3 CSMA p-persistente .............................................................................7-82
7.5 CSMA/CD...................................................................................................7-82
7.6 PASO DE TESTIGO..........................................................................................7-83
7.7 LAN.............................................................................................................7-83
7.7.1 Ethernet (IEEE 802.3) .........................................................................7-83
7.7.2 Token Ring (IEEE 802.5).....................................................................7-84
7.7.3 FDDI ....................................................................................................7-84
7.7.4 Token Bus (IEEE 802.4) ......................................................................7-84
7.8 PROBLEMAS .............................................................................................7-84
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 1-4
Sistemas de Comunicacion de Datos
1 Presentación
1.1 Objetivos de la asignatura
Se pretende que los alumnos:
- adquieran conocimientos generales acerca de las redes de datos
(clasiIicacion, tipos de conmutacion, conceptos de interIaz, servicio y protocolo)
- comprendan conceptos relativos al nivel Iisico de la comunicacion
- comprendan y sean capaces de analizar y recrear las tecnicas usadas en el nivel
de enlace, tanto en enlaces punto a punto como en enlaces de acceso multiple.
1.2 Profesorado
- Carlos Garcia Rubio (Responsable)
- Jose Luis Hernandez Fernandez
1.3 Programa
1. Introduccion
- Historia y uso de las redes de datos
- ClasiIicacion de redes de ordenadores
- Conceptos Basicos
- Descomposicion en niveles de los sistemas de comunicacion de datos:
ƒ InterIaces
ƒ Servicios
ƒ Protocolos
- Modelo de reIerencia OSI
- Modelo TCP/IP
2. Nivel Iisico
- Transmision de datos
- Medios de transmision
- CodiIicacion de datos
- InterIaces de comunicacion de datos
3. Nivel de enlace
- Control de enlace
ƒ DeIiniciones y representaciones
ƒ Funciones del nivel de enlace
ƒ Tipos de enlace
ƒ Codigos de deteccion y control de errores: Tecnicas FEC
ƒ Ejemplo: SLIP, PPP
ƒ Protocolos de control de errores: Tecnicas ARQ
ƒ Ejemplo: HDLC
- Tecnicas de acceso al medio
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 1-5
ƒ Reserva: FDM, TDM, TDM estadistica
ƒ Contienda: Aloha, CSMA
ƒ Seleccion: Paso de testigo
- Redes de area local:
ƒ Conceptos Basicos
ƒ Arquitectura
ƒ Ethernet (IEEE 802.3) y Fast Ethernet
ƒ Token Ring (IEEE 802.5)
ƒ FDDI (ISO 9314)
4. Interconexion de Subredes
- Nivel Fisico: Repetidores
- Nivel de Enlace: Bridges
ƒ Bridges Transparentes
ƒ Bridges con Encaminamiento Iuentes
ƒ Nomenclatura: Repetidores-Hubs, Bridge-Switch
1.4 Prácticas en laboratorio
Ademas de las clases de teoria y de problemas, se realizaran practicas en laboratorio.
- Las practicas comienzan el 8 de Noviembre de 2000.
- El horario de practicas sera los miercoles, coincidiendo con las horas
de clase (de 9:00 a 11:00 y de 15:00 a 17:00), si bien podran hacerse
tambien Iuera de horas de clase conectandose a los puestos del
laboratorio por telnet o slogin desde cualquier ordenador de Internet y
trabajando en remoto, cualquier dia de la semana a cualquier hora.
- Las practicas se realizaran en el laboratorio del Area de Ingenieria
Telematica 1.0A02, en PCs con sistema operativo Linux. Como ya
hemos comentado, puede conectarse a estos ordenadores a traves de
Internet (se llaman it001.lab.it.uc3m.es a it018.lab.it.uc3m.es).
- Para poder entrar en los ordenadores del laboratorio necesita tener una
cuenta abierta. Puede solicitarlo a traves del siguiente Iormulario. Las
cuentas se solicitaran individualmente (cada alumno tiene derecho a
tener una cuenta). Esta cuenta le servira ademas para el resto de las
asignaturas que curse en el Area de Ingenieria Telematica.
- Las practicas se haran y se entregaran obligatoriamente por parejas.
Lea en el enunciado de la practicas las normas sobre como notiIicar
cuales son los componentes de cada pareja.
- Pulse aqui para acceder al enunciado de la practica.
1.5 Bibliografía
|Tanenbaum 96|
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 1-6
Andrew S. Tanenbaum: Computer Networks, Third Edition, Prentice Hall
International 1996 (tambien en Español).
|Stallings 97|
William Stallings: Data and Computer Communications, FiIth Edition, Prentice
Hall International 1997 (tambien en Español).
|Perlman92|
Radia Perlman: Interconnections. Bridges and Routers. Addison Wesley, 1992
96|
Larry L. Peterson, Bruce S. Davie: Computer Networks, A Svstems Approach,
Morgan KauImann Publishers 1996.
|Schwartz 88|
Mischa Schwartz: Telecommunication Networks. Protocols, Modelling and
Analvsis, Addison Wesley, 1988.
|Peterson 96|
Larry L. Peterson, Bruce S. Davie: Computer Networks, A Svstems Approach,
Morgan KauImann Publishers 1996.
|Bertsekas 92|
Dimitri Bertsekas, Robert Gallager: Data Networks, Second Edition, Prentice
Hall International 1992.
|Halsall 96|
Fred Halsall: Data Communications, Computer Networks and Open Svstems,
Fourth Edition, Addison Wesley 1992.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-7
2 Introducción
2.1 Introducción
El procesamiento de la inIormacion (InIormatica) y la distribucion de la
inIormacion (Telecomunicaciones) convergen, ambas tienden hacia la telematica.
De los sistemas inIormaticos centralizados hay una evolucion a los sistemas
distribuidos.
Telematica es el estudio de las redes de ordenadores (SCD).
Algunas deIiniciones:
- Red de ordenadores: Es una coleccion interconectada (permite el intercambio de
inIormacion) de ordenadores autonomos (equipos que en principio no necesitan
la red para Iuncionar).
- Telecomunicacion: Comunicacion a distancia. Cualquier intercambio de
inIormacion, ya sea entre hombre o maquina, independientemente de la distancia
(unos pocos metros o hasta kilometros). En principio es una comunicacion
bilateral, aunque puede haber sistemas unilaterales (diIusion de radio o TV).
- Redes de ordenadores simetricas: en las que las comunicaciones se producen
igual en un sentido que en otro.
Modelo simpliIicado de un sistema de telecomunicaciones (una direccion, por
simpliIicar):
La Iuente es la que genera la inIormacion a transmitir (en nuestro caso el
ordenador). El transmisor transIorma la inIormacion de la Iuente en señales
electromagneticas susceptibles de ser enviadas a traves de una red. En el caso de un
ordenador seria un MODEM o una tarjeta de red. La red es un conjunto de recursos y
Iacilidades que permitiran la transmision de esas señales. El receptor capta las señales
de la red y las transIorma al Iormato que necesita el destino. El destino es el que recibe
los datos enviados por la Iuente. Un ejemplo no inIormatico seria:
DeIiniciones:
FUENTE S
max
÷ 1/2e÷0.18 RECEPTOR DESTINO RED
Podriamos verlos Iundidos en un solo ordenador
Podriamos verlos Iundidos en un solo ordenador
RED
FUENTE DESTINO RECEPTOR TRANSMISOR
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-8
- Transmision: Proceso de envio de inIormacion a traves de una red. En principio,
la inIormacion ha de transIormarse para poder ser enviada por la red (electro-
magnetico).
- Señal: InIormacion transIormada adecuadamente para ser enviada por red.
- Protocolo: Reglas que deIinen como se codiIica la señal y su organizacion para
ser transmitida por red (protocolo de comunicaciones). Estos necesitan el
intercambio de otras señales que no son inIormacion.
- Señalizacion: Señales que no son inIormacion pero intervienen en la
comunicacion y transmision de esta.
El sistema de comunicacion mas elemental constara de dos equipos unidos por
un medio de transmision:
- Medios de transmision: Se clasiIican en dos tipos:
- Guiados: Las ondas electromagneticas se conIinan en el interior de un
medio solido (cable metalico: red, coaxial, etc... o no metalico: Iibra
optica).
- No guiados: Se transmiten las señales sin conIinarlas en ningun medio (a
traves del aire o vacio). Tambien se llama transmision inalambrica.
Si en lugar de 2 equipos tenemos 3, necesitamos 3 medios de transmision, y en
cada maquina 2 interIaces de
comunicacion.
Con 4 equipos seia 6
medios de transmision y 3
interIaces por maquina.
Con n equipos
interconectados
necesitariamos
2
) 1 ( ÷ n n
medios de transmision y cada
maquina habria de tener n-1
interIaces.
- Red de comunicaciones: Sistema compartido que permite reducir el numero de
medios de transmision y el
numero de interIaces
necesarios en cada maquina,
compartiendolos y haciendo
que cada maquina conectada
a la red tenga un solo interIaz
(una sola via de entrada y
salida de inIormacion).
FUENTE TRANSMISOR RECEPTOR DESTINO
Medio de Tx. 1
Medio de Tx. 2 Medio de Tx. 3
I
3
I
2
I
4
I
6
I
5
I
1
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-9
2.2 Clasificación de la redes
Se pueden clasiIicar segun diversos criterios:
- Segun su tecnica de comunicacion:
- Redes punto a punto (dedicadas o malladas): Existe una red de
comunicacion para cada pareja de equipos conectados.
VENTAJAS: Comunicacion muy sencilla, pues cada pareja de
equipos tiene un medio exclusivo, sin compartir. No hay que elegir el
camino por donde llevar la inIormacion.
INCONVENIENTES: Su coste y complejidad cuando hay
muchos equipos.
- Redes de diIusion: Existe un unico medio de transporte compartido por
todos los equipos, por ello se necesita un mecanismo en la red de control
de acceso a ese medio compartido para evitar que este sea usado por
varias maquinas simultaneamente. La comparticion se consigue mediante
multiplexacion. Otra caracteristica es que como el medio es compartido,
cuando alguien transmite algo en el medio, es recibido por el resto de los
equipos de la red.
VENTAJAS: Un unico medio de transmision. Si queremos
transmitir a todas les llega con una unica transmision.
INCONVENIENTES: Privacidad, no solo le llega al destino, sino
a todas las maquinas de la red. La capacidad del canal se divide entre el
numero de estaciones (para un numero de estaciones elevado bajan las
prestaciones).
Un ejemplo es la diIusion de paquetes por
radio.
Otro ejemplo son las redes por satelite.
Son redes con un medio de transmision
no guiado.
Otro ejemplo serian las redes en bus.
- Redes de conmutacion: Ademas del medio de
transmision va a haber unos equipos llamados nodos de conmutacion, de
tal Iorma que los equipos que se conectan a la red no estan unidos
directamente, sino que se unen a un nodo de conmutacion en el interior
de la red. Cuando un equipo quiere transmitir algo pasa a su nodo de
conmutacion y este se encarga de hacerlo llegar hasta el nodo de
conmutacion del equipo destino.
Los nodos de conmutacion estan
conectados entre si. Si la red es pequeña y tiene
pocos nodos, entonces los nodos pueden
conectarse como si Iuera una red interna punto a
punto. Pero si la red es mas grande, no existiran tantos enlaces, por lo que
siempre debe existir al menos un camino para llegar de cualquier punto a
otro, aun pasando por varios nodos. Por motivos de Iiabilidad suele haber
mas de un camino.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-10
Dependiendo del tipo de red, los nodos reciben un nombre u otro
(en TCP/IP son encaminadores, en teleIonia son centralitas,...). Segun el
Iuncionamiento de los nodos, se
dividen en tres tipos:
ƒ Conmutacion de circuitos:
Son los mas antiguos que
existen y se basan en que los
enlaces entre nodos de
conmutacion. Estan
Iormados por varios medios
de transmision.
La comunicacion se produce en tres Iases:
1- Establecimiento de conexion: El origen indica con que
destino quiere comunicar. Los nodos van conectando
Iisicamente una de sus entradas y una de sus salidas
hasta encontrar un camino que va al emisor y al
receptor. Si tiene exito, tenemos un enlace dedicado
punto a punto (exclusivo).
2- TransIerencia de inIormacion: Se intercambia la
inIormacion que se desee.
3- Liberacion de conexion: Se comunica a los nodos de
conmutacion que se pueden liberar los enlaces. Se
libera los enlaces internos que crean los nodos,
dejandolos libres para otras comunicaciones.
Veamos un ejemplo con un diagrama de tiempos:
3
2
1
A
B
DATOS
Mira si hay enlace libre
Hasta aqui es todo
señalizacion, aun no se
ha enviado inIormacion
I
(A)
Libera conexion
1 2 3 B A
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-11
VENTAJAS: Una vez establecida la conexion e como si
tuviesemos un cable dedicado para la comunicacion de A con B,
por ello NO hay retado en los nodos de conmutacion (retardo que
si se produce al principio hasta que se encuentra el circuito), solo
el retardo implicito del medio. Es una tecnologia conocida (por lo
que se tiene experiencia en ella).
INCONVENIENTES: Se nos tariIicara por el circuito
establecido, independientemente de lo que transmitamos. Aunque
en ciertos momentos no generemos traIico, seguiremos
disponiendo del canal.
El retardo de establecimiento de conexion es muy grande
(A). Cuando la red se comienza a congestionar, el primero que
consiga establecer comunicacion tiene un servicio perIecto
(mientras no desconecte) y el resto no consigue transmitir, no
consigue un circuito. En una red de datos lo ideal es ocupar
recursos de la red mientras se esta transmitiendo.
Si hay congestion de la red, el servicio no se degrada igual
para todos los usuarios. Empiezan a escasear enlaces entre nodos
de conmutacion, quien tiene suerte y encuentra enlaces libres
tiene un servicio perIecto, pero el resto no tiene ningun servicio.
Pese a ser una de las tecnologias mas antiguas y no ser un
de las mejores Iormas de transmitir inIormacion, es de las mas
empleadas. Ej. Red deleIonico, RDSI,...
ƒ Conmutacion de mensajes: No existen realmente, sino
conceptualmente. Son redes
dirigidas especialmente a la
transmision de datos, los nodos de
conmutacion son ordenadores con
su memoria, disco, etc..., donde
guardan cosas temporalmente. No
hay establecimiento de conexion, sino que cuando A quiere
enviar algo a B, inserta una cabecera en la inIormacion a enviar
donde indicara el destinatario. A se lo envia al nodo que lo
almacenara. El nodo lo distribuira al nodo del destinatario Iinal.
Se dice que son redes de almacenamiento y reenvio. Los
3
2
1
A
B
HEADER
DATA
Retardo Variable
1 2 3 B A
Cabecera
Mensaje
El retardo en el nodo es variable por
que puede recibir varios mensajes
simultaneamente
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-12
1 2 3 B A
Se tariIica por
traIico (no hay
canal dedicado)
1
2
3
1
2
3
1
2
3
1
2
3
t
B
1
B
3
B
2
3
2
1
A
B
mensajes se encolan y el nodo los va desencolando y procesando.
En el nodo destino tambien se encolan al recibir.
VENTAJAS: No hay que establecer circuito, se envia y ya
esta. No consumimos ningun recurso al transmitir. Solo se nos
tariIicara por el uso que hacemos de la red, de la cantidad de
inIormacion que enviamos. Las prestaciones son mas grandes y
equitativas. Gradual, por que segun hay mas traIico, hay mas
retardo, pero todos pueden enviar.
INCONVENIENTES: Hay que limitar el tamaño del
mensaje, pues si no, el retardo en cada salto podria elevarse
demasiado, o incluso, por retardo ocupar el canal mucho tiempo.
Ese tamaño maximo es el que obliga a Iragmentar la
inIormacion a enviar, llamando a cada Ireagmento PAQUETE.
ƒ Conmutacion de paquetes: El mensaje se trocea en paquetes con
una longitud maxima especiIica. Segun el tipo de envio puede
ser:
ƒ Por datagrama: Cada uno de los Iragmentos tiene una
cabecera que indica el destino y un numero de secuencia
(entre otras cosas). Cada paquete se envia por separado
como en conmutacion de mensajes y el destino debe
reordenar los paquetes a su recepcion.
INCONVENIENTES:
En cada paquete va la
direccion de destino, teniendo
que decidir por cada nodo de
conmutacion y paquete, el
camimo de las tramas para ir
al destino. Otro inconveniente
es que, como se puede ir
desde el origen al destino por
varios caminos, unos paquetes
llegan antes que otros. Esto
obliga al destino a tener
memoria para almacenar los
paquetes y reordenarlos luego.
VENTAJAS: Es muy
sencillo. Un ejemplo es
Internet (protocolo IP).
Es mas rapido que la
conmutacion de mensajes:
Antes teniamos que esperar a
recibir todo el mensaje para
reenviar, aunque no haya
recibido el resto.
ƒ Por circuitos virtuales: La decision de encaminamiento de
A a B solo se produce una vez. Se hace comunicacion en
tres Iases, como en las redes de conmutacion de circuitos.
Primero se envia un paquete especial a la red donde se
dice que se quiere establecer un circuito virtual con el
destino (este circuito virtual no es real, no se establece
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-13
realmente un circuito virtual con el destino). El primer
nodo nos contesta con un identiIicador de circuito virtual.
El nodo, a continuacion decide por donde deben ir esos
paquetes. Crea una tabla que asigna un identiIicador de
circuito virtual a un nodo, que sera el siguiente nodo de
conmutacion. Un nodo le solicita al otro el
establecimiento de un circuito virtual, guardando el
segundo en una tabla que para el circuito virtual nº X se
envia a traves del nodo n o se entrega al destino. Al
terminar de decidir el camino, se inicia el envio de los
paquetes, añadiendo en la cadena el nº de circuito virtual a
seguir.
Si Ialla la red o un
nodo, se cierra el circuito y
hay que volver a solicitar
circuito y reenviar. Se llaman
circuitos virtuales por que se
parecen a la conmutacion de
circuitos, pero son virtuales
por que realmente no existen.
Si no transmitimos no consumimos, pues no tenemos la
ruta dedicada. Si hay pocos paquetes es mejor por
datagrama, pues no pierdes tiempo estableciendo un
circuito. Si son muchos paquetes compensa establecer el
circuito. Es adecuado para redes de alta velocidad. El
numero de circuito virtual es mas pequeño que en una
direccion de red, por lo que la cabecera es mas pequeña.
Ejemplo: X.25, Frame-Relay(1600 bytes), ATM
(53 bytes) o conmutacion de celulas (los paquetes son muy
pequeños).
Al Iinal se envia un mensaje especial para liberar el
circuito virtual, borrando los numeros de las tablas de
encaminamiento, quedando ese identiIicador libre para
otro circuito virtual. El diagrama de tiempo seria el
siguiente:
El retardo () se
dupone que es menor
por que ya esta
calculada la ruta y
aunque se tarde en
establecer y liberar
compensa la suma de
retardos.
Hay una
pequeña parte de
tariIicacion por el
tiempo que tenemos
establecido el circuito y
el resto es por el traIico
de red.
B
1
B
3
B
2
3
2
1
A
B
9 3
9 B
Establecimiento
de circuito virt.
1 2 3 B A
1
2
3
1
2
3
1
2
3
1
2
3
Liberacion del cv

Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-14
Si no se transmite, no se consume ningun recurso
de la red, ya que cualquiera podria enviar por ese enlace
(a diIerencia de los circuitos virtuales).
Una vez establecida la conexion, cada paquete
incluira en las cabeceras el nº de circuito virtual
unicamente, mandandolos a la red en el orden adecuado.
La accion de encaminamiento se realiza al comienzo de la
conexion y no se vuelve a hacer.
VENTAJAS: La decision de encaminamiento se
realiza una sola vez al comienzo de la conexion. Los
paquetes llegan ordenados.
INCONVENIENTES: Se ha de establecer y liberar
la conexion. Si se envian pocos paquetes es mejor por
datagrama, si son muchos , por circuito virtual, porque
solo hay que encaminar una vez.
La tariIicacion realizada es, en conmutacion de circuitos
por el tiempo que este establecido el circuito, independientemente
del traIico generado. En datagramas (comunicacion por paquetes)
por el traIico generado, si se transmite se cobra, si no se transmite,
no. En conmutacion de paquetes por circuitos virtuales se cobra
una pequeña cantidad por el tiempo que pasa desde que se
establece el circuito virtual hasta que se libera (por el espacio en
memoria para almacenar el circuito virtual). Pero
Iundamentalmente se cobra por la cantidad de bits que se mandan,
consumen ancho de banda el los enlaces de la red.
- Segun su extension geograIica: Se pueden clasiIicar en Redes locales (LAN),
redes metropolitanas (MAN), redes extensas (WAN) o redes de sobremesa
(DAN).
- LAN: Desde un laboratorio (unos pocos metros), pasando por un ediIicio
o varios ediIicios proximos entre si (a lo sumo 1 Km de diametro). Por
ejemplo, un campus.
- MAN: Cubrira una ciudad y sus alrededores.
- WAN: Cubre una region (comunidad, pais, continente e incluso todo el
planeta). El tamaño de la red inIluye en el protocolo a utilizar.
- DAN: Las redes metropolitanas (MAN) estan cayendo en desuso.
Incluso estan apareciendo unas nuevas redes, las redes de sobremesa
(Desk Area Network o DAN). Son redes de centimetros que unen un
procesador con los periIericos. En maquinas multiprocesador sirven para
unir los distintos procesadores.
- Segun su explotacion: Tenemos redes privadas y publicas.
- Redes Privadas: Son las que tienen las organizaciones para darse servicio
a si mismas.
- Redes Publicas: Propiedad de una empresa que cobra por su uso a
terceros. Dependiendo del tipo de red existen protocolos mas o menos
adecuados (coste, tiempo, etc...).
El hecho de que sea publica o privada va a aIectar a los protocolos de
comunicaciones. En las redes publicas hay que cuidar aspectos no necesarios en
las privadas, como tariIicacion (cobrar a los usuarios), seguridad (los datos que
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-15
envia un usuario han de ser recibidos por el destinatario. En una red privada no
es tan importante garantizar la conIidencialidad de los datos en la red),
garantizar la calidad del servicio (el usuario paga por el servicio, paga por unos
Mbits por segundo, y hay que darselo).
Tambien ha habido una tendencia a identiIicar LAN con red privada y
WAN con red publica.
2.3 Protocolos y arquitectura de protocolos
Para que usuarios heterogeneos (S.O., etc...) se puedan comunicar, han de
ponerse de acuerdo en el lenguaje a utilizar, que cosas se van a decir, como y cuando.
Un protocolo de comunicaciones es un conjunto de reglas mutuamente aceptadas
que van a regir el dialogo entre los equipos de una red. Se compone de una sintaxis
(Iormato de envio de datos, como codiIicarlos, tipos de mensajes a intercambiar, ...),
una semántica (a cada mensaje le da un signiIicado concreto), y una temporización
(indica cuando puedo enviar un mensaje o que respuestas puedo mandar a un mensaje).
El problema de la comunicacion entre ordenadores de divide en subproblemas
mas Iaciles de atacar (tipos de cables, de conectores, como son las señales, etc...). Esto
es lo que persiguen las arquitecturas de protocolos de comunicaciones: descomponer el
problema de la comunicacion de ordenadores en una serie de subproblemas llamados
niveles o capas.
Cada Iabricante deIinio su propio protocolo (IBM con SNA, Serox con DNA... )
pero se requeria una arquitectura normalizada para que todo el mundo usase la misma.
Entre ellos estan el modelo de reIerencia OSI, arquitectura TCP,...
2.4 Modelo de referencia OSI
1997- ISO (Organizacion internacional de estandarizacion) creo un comite para
deIinir una arquitectura de protocolos que pudiera ser una reIerencia
universal. Lo llamo Modelo de Arquitectura de Interconexion de sistemas
abiertos (MARISA en español u OSI).
1984- Fecha de publicacion de la norma Iinal (ISO 7498). DeIine la
descomposicion del problema de la comunicacion en una serie de niveles
(7 niveles: Fisico, enlace, red, transporte, sesion, presentacion y
aplicacion).
Este modelo es generico: esta dividido en capas. Cada capa agrupa un conjunto
de Iunciones relacionadas, y a su vez, cada capa hace uso de las Iunciones del nivel
inIerior para realizar sus Iunciones. Esta muy inIluido por la arquitectura SNA de IBM.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-16
En general un nivel n hace uso de los servicios del nivel n-1 y oIrece servicios al
nivel n¹1. Se dice que el nivel n recibe servicio del nivel n-1 y oIrece servicio al nivel
n¹1.
El nivel n accede al servicio del nivel n-1 a traves de unos puntos de acceso
(SAP o Service Access Point). A su vez, oIrece estos puntos de acceso al nivel superior.
Se pueden ver como Iunciones que pueden ser llamadas para enviar y recibir datos.
El conjunto de los SAP que oIrece cada nivel es el interIaz de ese nivel.
- Nivel Fisico: Nivel mas bajo de la torre OSI. Es el que realmente va a utilizar el
medio Iisico para enviar y recibir datos. El servicio que va a oIrecer al nivel
superior es el envio y recepcion de bits. Para ello, los estandares de este nivel
deben deIinir el medio de transmision y los conectores desde cuatro puntos de
vista: mecanico, electrico, Iuncional y procedimental.
o Mecánico: cable (cobre, etc), aislante a utilizar, etc...
o Eléctrico: Señales a enviar, como representar 0 y 1, Irecuencia, Iorma de
onda, velocidad, etc...
o Funcionales: Conectores, cuantos pines, para que sirve cada pin,...
o Procedimentales: Nos dice los pasos a seguir en los envios: mandar un
ACK por el pin 7, espera respuesta por el pin 14 (o sea, secuencia de
ordenes a seguir con el conector).
Ejemplos de normas de nivel Iisico: RS232 (puerto serie), Vx (V14,
V24,...), ISDN (RDSI) y LAN.
- Nivel de enlace: El servicio que oIrece al nivel de red es transmision y
recuperacion Iiable de tramas. Realiza ciertas Iunciones: Control de errores
(deteccion / correccion), delimitacion de tramas y multiplexacion.
El nivel Iisico solo ve bits, debemos determinar donde acaba un mensaje y
comienza el siguiente. Eso es lo que hace el control de tramas. A nivel de enlace
se llama tramas y a nivel de red se llama paquetes. La inIormacion se enmarca
con bits de control (Frame en ingles). En las redes de diIusion todos los
ordenadores estan interconectados, necesitando algo que regule el acceso al
medio compartido (la red). Esto es lo que se llama multiplexacion. Es tarea
tambien del nivel de enlace.
En una red conmutada el nivel Iisico y el nivel de red nos resuelven entre
un equipo y su nodo de conmutacion, y entre nodos de conmutacion, puede que
para los saltos haya medios de transmision y protocolos de enlace distintos. Se
garantiza que (salto a salto) los bits estan libres de errores entre esos dos.
Un protocolo del nivel de enlace no tiene por que implementar todas las
Iunciones. Algunos protocolos del nivel de enlace son DIC, SLIP, PPP, ISDN y
LAN, LAPB, LAPD.
El nivel Iisico y el de enlace son los que vemos en la asignatura.
- Nivel de red: Nos va a dar un servicio de transmision y recepcion de paquetes
extremo a extremo. Implementa
las Iunciones de
encaminamiento, Iragmentacion
y re-ensamblado. En una red de
conmutacion, el nivel Iisico y de
enlace trabajan salto a salto. El
nivel que se encarga de encontrar
el trayecto de origen a destino es
el de red.
Nivel Fisico (no tienen
que ser iguales)
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-17
En las redes punto a punto y en las redes de diIusion no va a hacer Ialta el
nivel de red (tenemos conexiones extremo a extremo). Es mas necesario en las
de conmutacion, tanto en datagramas (hara el encaminamiento de los
datagramas) y en las de circuitos virtuales el establecimiento de circuito.
Sera necesario tambien el nivel de red cuando interconectemos redes.
La interconexion de esas
redes se hace conectando
encaminadores, que se unen
entre si en un enlace punto a
punto. Es entonces una red de
conmutacion de paquetes, cuyos
dispositivos conectados son a su
vez redes de distintas
tecnologias.
Los encaminadores o
nodos de conmutacion (de redes
conmutadas) solo necesitan
implementar hasta el nivel de red de la torre OSI.
El nivel de red tiene que ser el
mismo en toda la red.
Ejemplos de protocolos de
nivel de red son X.25, IP,...
- Nivel de transporte: Va a proporcionar
tres servicios:
o Conmutacion Iiable extremo a
extremo: Pueden llegar los datos desordenados al destino (datagramas) si
siguen distintos caminos, e incluso puede que algunos no lleguen, no por
errores en el medio de transmision (ñpor que se asegura que de A a B va a
llegar sin errores, se veriIica salto a salto), sino por congestion. Notese que
es una red de almacenamiento y reenvio, que a un nodo llegan muchos
paquetes y los va almacenando hasta que el enlace de salida queda libre. Si la
memoria se llena (congestion), cuando llega un nuevo paquete, el nodo lo
tira (se pierde). El nivel de transporte debe reordenar los datos enviados asi
como pedir aquellos paquetes que no le llegan.
o OIrecer la calidad de servicio demandada por el usuario: que el retardo
maximo sea x, que haya un retardo constante entre los paquetes (ej. Envio de
voz).
o Multiplexacion de aplicaciones: Al enviar mensajes de varias aplicaciones
distintas pueden estar intercambiando datos entre el mismo origen y el
mismo destino de res. Ej. De nivel de transporte: UDP, TCP, TRP.
Con el nivel de transporte tenemos comunicaciones Iiables entre
cualquier maquina de una red.
- Nivel de sesion: Realiza Iunciones de organizacion y sincronizacion de la
comunicacion, que son mecanismos complejos que consiguen determinar en que
punto se encuentra exactamente la comunicacion si ocurre un error Iatal (Ej.
Cajero). No se suele usar, son para aplicaciones muy especiIicas.
- Nivel de presentacion: Realiza 3 Iunciones:
o Representacion de datos: Se deIinen mecanismos independientes de la
maquina de codiIicacion de inIormacion, de tal manera que todas las
maquinas representen los datos recibidos de la misma Iorma (los caracteres
Encaminadores
7
6
5
4
3
2
1
2
1
2`
1`
3
2`
1`


3
7
6
5
4
3
2
1
El nivel de enlace y Iisico pueden ser
distintos para el siguiente salto
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-18
sean los mismos, etc...). Ejemplos de modelos de representacion son XDR,
ASN-1, ...
o Compresion de los datos
o CiIrado de los datos
En la practica estas 3 Iunciones suelel llevarse a nivel de aplicacion.
- Nivel de aplicacion: No son las aplicaciones, son unas Iunciones de uso comun
para muchas aplicaciones, las aplicaciones estan por encima (ej. Envio de
Iicheros,...). Este nivel tiene una arquitectura muy compleja.
Los niveles de sesion, presentacion y aplicacion suelen obviarse en la practica y
se consideran como aplicaciones.
En la parte superior de la torre OSI se encuentra la aplicacion que quiere enviar
unos datos a otra maquina. Los datos los pasa al nivel de aplicacion, que añade una
cabeceradel nivel de aplicacion.
El conjunto de los datos y la cabecera Iorman una PDU (Protocol Data Unit) o
unidad de datos de protocolo para cada nivel.
Asi se hace para todos los niveles.
En el nivel de enlace se añade ademas de la cabecera una cola, para determinar
las tramas, pero no siempre es asi.
El nivel Iisico no añade nada.
Cada nivel lo unico que procesa es la cabecera y el resto se lo va pasando al
nivel superior hasta que al Iinal lo entrega al destino.
Cada nivel trata a la cabecera del nivel superior como si Iueran datos.
Puede ocurrir que la T-PDU sea mayor que el tamaño maximo permitido por lo
que se ha de Iragmentar en el nivel de red.
2.5 Protocolos TCP-IP
- TriunIaron Irente as ISO.
- Son mas sencillos, menos ambiciosos.
- Las implementaciones son mas Iaciles de hacer y salen antes al mercado que los
protocolos que deIine ISO.
- Se desarrollan dentro del departamento de deIensa americano (es el mayor
cliente de SW del mundo), muchas empresas empiezan a desarrollar estos
protocolos.
7
6
5
4
3
2
1
DATOS
APLICACION
DATOS
EH T
DATOS
DATOS
DATOS
DATOS
DATOS
AH
PH
SH
TH
RH
Cola
01010000111101010110001
7
6
5
4
3
2
1
APLICACION
TH
NH NH NH
EH
T-PDU
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-19
- No se diseño una arquitectura, segun las necesidades de comunicacion se iban
creando protocolos y asociandolas con la arquitectura.
La arquitectura que deIine es:
Cada subred puede ser distinta y con distintos protocolos, una red puede estar
compuesta por un conjunto de subredes.
2.5.1 Nivel de subied
DeIine como se realiza la comunicacion entre equipos conectados a la misma
subred. Esta capa hara mas o menos Iunciones, dependiendo de la complejidad de la red
(ej. Punto a punto, Irame-relay,...).
2.5.2 Nivel de Intei-ied
Hace posible que los datos viajen entre maquinas conectadas en subredes
distintas. Hacen el encaminamiento a traves de los routers. Para ello sera necesario dar
varios saltos de origen a destino utilizando varios encaminadores. El router es un equipo
que tiene enlaces a varias subredes (esta conectado a dos o mas subredes). Estos datos
podran llegar desordenados y con errores.
2.5.3 Nivel de tianspoite
Da un servicio extremo a extremo Iiable (no hay perdida de datos y llegan
ordenados) y todos los parametros de calidad del servicio que exija el usuario. Asegura
que los datos lleguen desde la aplicacion origen a la aplicacion de destino en el mismo
orden, etc...
TRANSPORTE
APLICACIONES
(No el nivel de
aplicaciones)
7
6
5
4
INTER-RED
SUBRED
FISICO
ACCESO A LA RED
3
1
2
APLICACIONES
TCP/IP OSI
SUBRED
FRAME-RELAY
SUBRED
SATELITE
SUBRED
Encaminadores o routers
(gateway)
LAN
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-20
2.5.4 Nivel de aplicacion
Estan directamente las aplicaciones (ej. E-mail, telnet, ...) en contraposicion a
OSI.
El encaminador solo implementa los protocolos de subres y de Inter-red. Los
protocolos de transporte y apliacion son protocolos extremo a extremo, solo estan
implementados en los sistemas Iinales.
La cabecera de transporte incluye en su cabecera el puerto origen y destino
(aplicaciones origen y destino de los datos).
El control de errores sirve para saber si se ha perdido algun paquete en la red y
pedir la retransmision.
Este segmento es pasado al nivel IP, que seguramente lo primero que haga sea
Iragmentarlo, incluyendo en cada Iragmento una cabecera. La cabecera IP contiene la
direccion IP origen y destino para encaminar la inIormacion entre subredes del origen al
destino.
Los datos se pasan al nivel de subred y se les añade una cabecera y una cola. La
cabecera incluye la direccion de subred origen y destino de cada salto (salto a salto).
La trama se envia a traves de la red. Con el paquete IP se contruyen sucesivas
tramas para el nivel de sibred y el paquete IP no cambia). El router recibe la trama,
extrae la cabecera y la cona y la encapsula con la subred 2.
2.6 Comparación OSI vs TCP/IP
APLICACION
TRANSPORTE
IP
SUBRED 1
IP
SUBRED
1
SUBRED
2
APLICACION
TRANSPORTE
IP
SUBRED 2
SISTEMA FINAL SISTEMA FINAL
ROUTER
APLICACION
TRANSPORTE
IP
SUBRED
DATOS PUERTO
Nº SECUENDIA
CONTROL DE ERRORES
SEGMENTO
DIR IP ORIGEN/DESTINO
DATAGRAMAS
TRAMAS
DIR SUBRED ORIGEN Y DESTINO
SALTO A SALTO
.
.
.
.
.
.
.
.
.
.
APLICACIONES
7
6
5
4
3
2
1
Subred
Inter-red
Transporte
Aplicacion
A
T
M
X
.
2
5
R
T
C
L
A
N
IP
UDP
RTP
S
M
T
P
S
N
M
P
H
T
T
P
T
F
T
P
F
T
P
TCP
ICMP OSPF RIP
OSI TCP/IP PROTOCOLOS
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 2-21
2.7 Organismos de normalización
Las normas se dividen en dos tipos:
- De Iacto: Son aquellas que aparecen sin ninguna intencion de crearlas,
simplemente por su bran diIusion en el mercado. En el mundo de las
comunicaciones, las normas de ipso son raras.
- De Iure: Son normas creadas por algun organismo de normalizacion legalmente
aceptado.
Los organismos de normalizacion son de dos tipos:
- Establecidos por organizaciones internacionales:
o ITU: Union internacional de comunicaciones. Dependiente de la ONU.
Creado en 1865. Las normas que hace la ITU se llaman recomendaciones
y su Iormato es: ITU-T (telecomunicaciones), ITU-R
(radiocomunicaciones). Ej. ITU-T .163, ITU-T X25 (Letra
mayuscula/numero).
o ISO: organizacion Internacional de estandarizacion. Tiene un ambito
mucho mas amplio que el de las telecomunicaciones. Surgio en 1940,
como agrupacion de organizaciones de normalizacion de distintos paises
(en España AENOR,...). ISO esta dividido en 200 comites tecnicos que
estandarizan distintas cosas, el TC97 estandariza ordenadores y
procesamiento de la inIormacion.
- Realizadas por organismos sin animo de lucro:
o IEEE: Instituto de Ingenieros Electricos y Electronicos. Ha patrocinado
algunas normas, las mas importantes son las normas LAN, realizadas por
el comite 602.
o IAB: Comite de actividades de Internet. Comite de 10 expertos para
decidir que cosas era necesario normalizar en Internet. Estas normas se
llaman RTC`s.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-22
3 Transmisión de datos
(Stallings)
3.1 Terminología
La transmision de datos entre un emisor y un receptor siempre se realiza a traves
de un medio de transmision. Los medios de transmision se pueden clasiIicar en guiados
y no guiados. En ambos casos, la comunicacion se realiza con ondas electromagneticas.
En los medios guiados, como por ejemplo en los pares trenzados, los cables coaxiales y
las Iibras opticas, las ondas se transmiten conIinandolas a lo largo del camino Iisico. Por
el contrario, los medios no guiados proporcionan una Iorma de transmitir las ondas
electromagneticas pero sin encauzarlas, como por ejemplo en la propagacion a traves
del aire, el mar o el vacio.
El termino enlace directo hace reIerencia al camino de transmision entre dos
dispositivos en el que la señal se propaga directamente del emisor al receptor sin ningun
otro dispositivo intermedio que no sea un ampliIicador o repetidor. Estos ultimos se
usan para incrementar la energia de la señal.
El medio de transmision guiado es punto a punto si
proporciona un enlace directo entre los dos unicos
dispositivos que comparten el medio. En una conIiguracion guiada multipunto, el
mismo medio es compartido por mas de dos dispositivos.
Un medio de transmision puede ser simplex, half-duplex o full-duplex. En la
transmision simplex, las señales se transmiten solo en una unica direccion; siendo una
estacion la emisora y otra la receptora. En halI-duplex, ambas estaciones pueden
transmitir, pero no simultaneamente. En Iull-duplex, ambas estaciones pueden
igualmente transmitir, pero ahora simultaneamente. En este ultimo caso, el medio
transporta señales en ambos sentidos al mismo tiempo. Posteriormente se explicara
como se realiza este tipo de trasmision.
La señal es la representacion en Iorma de ondas electromagneticas de la
inIormacion emitida por una estacion. La señal es una Iuncion del tiempo, pero tambien
se puede representar en Iuncion de la Irecuencia, es decir, la señal esta constituida por
componentes de distintas Irecuencias.
Teniendo en cuenta la señal como Iuncion del tiempo, podemos tener señales
continuas y discretas. Una señal continua es aquella en la que la intensidad de la señal
varia suavemente en el tiempo. Es decir, no se presentan saltos o discontinuidades. La
deIinicion matematica de señal es, S(t) es continua si:
a a S t S
a t
¬ =
÷
), ( ) ( lim
Una señal discreta es aquella en la que la intensidad se mantiene constante
durante un determinado periodo de tiempo, tras el cual la señal cambia a otro valor
constante. La señal continua puede corresponder a la voz y la discreta a los valores
binarios (0,1).
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-23
El tipo de señales mas sencillas que se pueden considerar son las periodicas, que
se caracterizan por contener un patron que se repite a lo largo del tiempo. A
continuacion se muestra un ejemplo de señal periodica continua (una onda sinusoidal) y
un ejemplo de señal periodica discreta (una onda cuadrada).
Matematicamente, una señal s(t) se dice que es periodica si y solo si:
t T t S t S ¬ + = ), ( ) (
donde la constante T es el periodo de la señal (T debe ser el menor valor que
cumple la ecuacion). En cualquier otro caso, la señal no es periodica.
señal la de frecuencia f
T
= =
1
La onda seno es la señal continua Iundamental por excelencia. Cualquier onda
seno se representa mediante tres parametros: la amplitud (A), la Irecuencia (I) y la Iase
(N). La amplitud es el valor de pico de la señal en el tiempo; tipicamente este valor se
mide en voltios. La Irecuencia es la razon (en ciclos por segundo o Hertzios |Hz|) a la
que la señal se repite. Un parametro equivalente es el periodo (T) deIinido como la
cantidad de tiempo transcurrido entre dos repeticiones consecutivas de la señal; por
tanto. Teniendo en cuenta la ecuacion anterior se obtiene:
T
f
1
=
La Iase es una medida de la posicion relativa de la señal dentro de un periodo de
la misma.
La expresion general para una onda senoidal es:
) · 2 ( · ) ( u + H = ft sen A t s
Para una señal, se deIine la longidud de onda como la distancia que ocupa un
ciclo, en otras palabras, la distancia entre dos puntos de igual Iase en dos ciclos
consecutivos. Supongase que la señal se propaga a una velocidad v. En ese caso, la
longitud de onda se puede relacionar con el periodo de la señal a traves de la siguiente
expresion: v T· = O , de Iorma equivalente: v f = · O . Es Irecuente el caso en el que v ÷ c,
esto es, el caso en el que la velocidad de propagacion en el medio es igual a la de la luz
en el espacio libre, que como es sabido es c ÷ 3·10
8
m/s.
Analisis de Fourier
Toda señal (continua o discreta) se puede descomponer como suma de ondas
sinusoidales de distintas Irecuencias y amplitudes. Por lo general el nº de ondas que
hacen Ialta es inIinito.
Longitud de onda ()
Periodo ÷ T ÷ 1/I Periodo ÷ T ÷ 1/I
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-24
El conjunto de ondas sinusoidales de distintas Irecuencias que componen la
señal se llama espectro de la señal. Ese espectro se puede obtener mediante la
transformada de Fourier.
}
·
· ÷
H
= df e f S t s
ft f 2
)· ( ) (
}
·
· ÷
H ÷
= dt e f x t
ft f 2
)· ( ) (
Esta transIormada de Fourier nos permite pasar de una representacion en el
tiempo de la señal a una representacion en Irecuencia.
Si cogemos ondas seno de
las Irecuencias del segundo graIico
con la amplitud S(I), obtenemos la
señal S(t).
La TransIormada de Fourier
de una señal va a tener un aspecto en Iuncion de como sea esa señal. Ej. Onda
sinusoidal:
Es un solo valor de la
Irecuencia y amplitud de la señal.
Ya que la transIormada de
Fourier es la suma de señales
sinusoidales, con una unica onda
seno quedaria representada.
En general hay cuatro tipos de transIormadas:
- Suma de un numero Iinito de ondas. Como este
ejemplo con 4 ondas.
- Suma de inIinitas Irecuencias. Por ejemplo la
transIormada de una onda cuadrada. En este caso si T
÷ 1/I, la transIormada tendra puntos en I
1
, 2· I
1
, 3· I
1
,...
- Suma de inIinitas Irecuencias, inIinitamente
juntas unas de las otras.
- Suma de inIinitas Irecuencias que es extienden
hasta el inIinito.
Estas señales
han de ser integrables, por lo que las amplitudes
van tendiendo a cero para que la suma sea Iinita.
En toda transIormada, siempre podemos identiIicar la Irecuencia mas alta (puede
ser inIinito) y la mas baja que sea distinta de cero. A la diIerencia entre ambas se le
llama ancho de banda de la señal (BW). Este ancho de banda es inIinito ñpara los tipos
2 y 4.
En los casos en los que el BW es inIinito, se deIine
el Ancho de Banda EIectivo a las Irecuencias que suman
hasta el 80° de la señal.
En concreto, la S(t) derivada del 80° de una onda
inIinita y de otra no inIinita que coincida con el 80° de la primera, son tan similares
que muchas aplicaciones las consideran identicas.
El ancho de banda tambien se mide en Hertzios.
Por ultimo, indicar que hay espectros onde S(0) ÷ 0 y otros donde S(0) = 0. El
valor en el punto 0 (S(0) se llama conponente continua de la señal y equivale al valor
medio de la señal en el dominio del tiempo.
I
S(t)
t
S(I)
Amplitudes
Frecuencias
t
S(t)
I
S(I)
S(I)
I
S(I)
I
.....
S(I)
I S(I)
I
S(I)
I ABE
80º 20º
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-25
El comportamiento de los medios de transmision es distinto segun la Irecuencia.
Las señales, al viajar, disminuyen su
amplitud por varios problemas (calor, ...).
Esta atenuacion es distinta segun la
Irecuencia de la señal, por lo que la 1ª señal
podria llegar con amplitud A/2 y la segunda
con una amplitud de A/10.
Ademas, la velocidad de transmision
tambien cambia con la Irecuencia, aunque el
cambio en la velocidad se nota menos que el
de la amplitud.
Si lo que se transmite es la suma de las dos señales, la señal destino se parecera
poco a la original ya que una componente se atenua menos que la otra. S decir, cada
componente de una transIormada se atenua de una Iorma distinta.
La respuesta o comportamiento en Irecuencia de un medio de transmisision es la
atenuacion que va a introducir en los distintos componentes de la Irecuencia.
Se representa en el dominio de la Irecuencia indicando como atenua para los
distintos valores de Irecuencia.
Es decir, ante 3 señales con la misma amplitud y
Irecuencias I
1
, I
2
y I
3
, la amplitud de salida seria 1·B, 0.5·B y
0.1·B para cada una de ellas. Si se transmite con una Irecuencia
I
n
, la salida tendra una amplitud 0. Por ultimo, la relacion entre A (amplitud original) y
B (amplitud maxima en recepcion) depende de la longitud del cable.
El ancho de banda de un medio es la diIerencia entre la Irecuencia mas alta y la
mas baja que pueden atravesar dicho medio de comunicacion.
El medio de transmision ideal tendria esta Iorma. Es decir,
una Irecuenica o no pasa o pasa con atenuacion. En la realidad, la
respuesta de un medio real tiene una zona central casi plana, pero
al acercarse a I
1
y I
2
caera la respuesta.
Para medios metalicos (1), esta respuesta
es muy regular, pero para el aire, la respuesta es
irregular (2).
Si se envia una señal espectro entre I
2
y I
4
cuando el medio admite entre I
1
y I
3
, la salida entre I
1
y I
2
sera nada`, entre I
2
y I
3
sera
parecido al original y la zona entre I
3
y I
4
no pasara.
Es decir, si la respuesta del medio esta entre I
1
y I
3
, solo se pueden enviar
señales dentro del ancho de banda eIectivo entre I
1
y I
3
.
Ademas en un medio de transmision real, como hay zonas intermedias entre 0 y
1 cerca de los bordes para transmitir una señal con un BW ÷ W, el ancho de banda ha de
ser aproximadamente 2W.
En concreto, el ancho de banda de una
señal digital dependera de la tecnica de
codiIicacion y de la velocidad de transmision
(que no es lo mismo que la de propagacion). El
ancho de banda del medio, limitara el BW de la
A
F
1
A
F
2
1
0.5
0.1
I
2
I
1
I
3
I
4
I
I
1
I
2
1
I
1
I
2
1
I
1
I
2
1
(1) (2)
I
1
I
2
I
3
I
4
I
I
1
F
3
Respuesta Medio
I
1
I
2
I
3
I
4
I
Señal Espectro
Señal salida espectro
¹
I
1 I
2
Medio
Real
W
Señal
2W
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-26
señal que puedo meter, y por consigueinte, la velocidad de transmision.
3.1.1 Tiansmision de datos analogica y digital
Analogico y digital es asimilable a continuo y discontinuo, y puede ser aplicado
a los datos, la señal y la transmision.
Los datos (inIormacion) pueden ser analogicos o digitales. Los primeros podrian
tomar cualquier valor en un intervalo continuo (la voz, ya que son ondas de presion). Os
datos digitales solo pueden tomar ciertos valores concretos (texto en ANSI). Estos datos
se representan mediante señales.
Una señal es analogica cuando es continua, es decir, su amplitud varia de Iorma
continua, y es digital cuando es discreta. Cualquier tipo de datos (Analogico o Digital)
puede ser transmitido de cualquiera de las Iormas. Por ejemplo:
Datos Señal
TeleIono A A
PC (MODEM) D A
CODEL (Voz o video digitalizado) A D
Transmisor digital (PC: 0001111..) D D
Un transmisor digital sencillo se basa en asignar ¹5v al 1 y 5v al 0 digital.
Por ultimo, la transmision de la señal del origen al destino tambien puede ser
Analogica o Digital.
- Sera analogica cuando la señal se propaga a base de ampliIicadores.
- Sera digital si se propaga a base de repetidores.
Un ampliIicador simplemente aumenta la amplitud de la onda por un
determinado valor (p.ej. x10). Su problema es que tambien se ampliIica el ruido y las
perturbaciones.
Un repetidor puede ser usado solo con señales digitales. En concreto, no
ampliIica, sino que lee la señal y la retransmite (sin perturbaciones) con la misma
amplitud que el original. Son mas complejos y mas caros (ahora no tanto), pero se
pueden usar tantos como se quiera sin estropear la señal (a diIerencia de los
ampliIicadores). Por eso se tiende a usar transmision digital. Ademas, las señales
digitales ocupan menos ancho de banda.
3.1.2 Peituibaciones en la tiansmision
Estas perturbaciones pueden ser atenuacion, distorsion de retardo o ruido.
3.1.2.1 Atenuación
Es la perdida de energia que oIrece la señal segun viaja por el medio. Esto
ocurre en todos los medios, por ejemplo, en un cable metalico la amplitud baja por la
resistencia de los electrones, lo que hace que aparezca un calentamiento en el cable y
por la generacion de radiaciones electromagneticas, ya que todo cable Iunciona como
una antena que radia parte de la señal que conduce.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-27
Si llamamos P
i
y P
o
a la potencia (en watios) de la entrada y la salida, la
atenuacion (en decibelios) es:
o
i
P
P
dB A ·log 10 ) ( =
En el medio ideal P
i
÷P
o
y A ÷ 0Db y en el peor de los casos P
o
÷0 , por lo que
A÷· dB.
Se usan los dB como medida ya que especialmente en medios guiados, la
atenuacion es proporcional a la longitud del cable (en medidas logaritmicas).
Ademas la atenuacion tambien depende de la Irecuencia, por lo que no tyodas las
Irecuencias suIren la misma atenuacion en un medio.
3.1.2.2 Distorsión de retardo
La velocidad de propagacion de las señales en un
medio varia con la Irecuencia. Esta diIerencia es algo mas
apreciable en los medios metalicos.
3.1.2.3 Ruido
Cualquier emision no deseada que se inserte entre el emisor y el receptor.
Segun el origen del ruido, este puede ser de cuatro tipos, termico, de
intermodulacion, de diaIonia e impulsivo.
- Termico: Ruido blanco o gaussiano, proviene de la agitacion de las moleculas
del medio de transmision debido a la temperatura.
BW T K W N · · ) ( =
Siendo K la constante de Boltzman (1.3803·10
-23
Julios/ºk), T la
temperatura en grados Kelvin y Bw el ancho de banda (en hertzios).
- Intermodulacion: Tiene su origen en no linealidades del medio de transmision.
Pero si
metemos, por
S
i
(t) S
o
(t)
Calor
Radiacion
P÷10w
P
i
÷100w P
o
÷1w
v
Emisor
Receptor
Ruido
I
1
I
2
I
2
I
1
I
1
, I
2
I
1
, I
2
I
1
¹ I
2
, I
1
- I
2
n(I
1
¹ I
2
), n(I
1
- I
2
)
Ruido de intermodulacion
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-28
ejemplo, la suma de dos ondas seno.
- DiaIonia: Se debe al acoplamiento electrico entre medios de transmision
cercanos, de Iorma que parte de la señal de un medio pasa como ruido al otro
medio. En ingles se llama CROSS-TALK.
- Impulsivo: Es un ruido irregular, consistiendo en un pico de corta duracion que
se introduce en el medio de transmision y tiene una amplitud relativamente
grande.
Una causa pueden ser las tormentas electricas, los tubos Iluorescentes
que consumen mucha energia al encenderse pudiendo aIectar a cables cercanos.
Para la transmision analogica, la atenuacion, intermodulacion y la diaIonia son
dañinas, pues transIorman la señal, obteniendo algo a la salida en don de es diIicil
discernir que es señal y que es ruido. Para la transmision digital no son tan
problematicos.
Sin embargo, el ruido impulsivo es peor por la transmision digital (pista al
reves): a 14400 bits/seg, un pico de 1 centesima nos cambia un 0 por un 1. Se corrigen
con tecnicas de deteccion y correccion de errores.
3.2 Capacidad de un canal
Esta capacidad representa el numero maximo de bits por segundo de un medio.
El ancho de banda de un medio es limitado:
- Fisicamente: por la respuesta en Irecuencia, esta limitado por la inIormacion que
se puede meter en su BW. Este BW podria ser muy grande, pero esta siempre
limitado (p.e. en el vacio se puede transmitir desde KHz hasta THz). Por lo que
no se deja transmitir en todo el BW, sino que se divide en canales, unos para
radio, para TV, para moviles, satelite,...
- Economicamente: la banda asignada al medio de comunicacion.
Algunos medios tienen un BW muy alto, y la señal la tiene muy baja, por lo que
se suele dividir en canales y se asigna un canal a cadausuario.
Dividimos en varios canales y le asignamos a cada
usuario un canal, pero con la
Irecuencia que hay que transmitir
le sobra.
Vamos a disponer de un
ancho de banda limitado (ya bien sea del medio o de un
solo canal). Nos preguntaremos cuantos bits por segundo
podre transmitir con ese ancho de banda.
Va a haber cuatro Iactores:
- C(bits/seg) -~ Capacidad
- BW (Hz) -~ Ancho de banda
- N (watt) -~ Ruido
- P
e
( ) -~ Tasa de errores o posibilidad de error que toleramos (bits que
seremos capaces de recibir mal).
Fijados 3 Iactores, el cuarto viene dado.
La rama de las telecomunicaciones que estudia esto se llama 'teoria de la
inIormacion¨.
Medio
I
Señal
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-29
Supongamos un canal sin ruido, con un ancho de banda BW Hertzios, y en el
que se emplea una codiIicacion a dos niveles (para un 0 envio 5v y para el 1 envio 5v,
o sea, solo dos niveles de voltaje). Nyquist demostro que en este medio:
Si tenemos un ancho de banda de 100 KHz podremos transmitir 200 Kb/seg.
Se podrian transmitir mas bits por segundo, pero empleando codiIicacion
multinivel, consistente en agrupar varios bits asignando a cada grupo un valor de
tension.
Multinivel con cuatro niveles (M ÷ 4), se coge de 2 en 2 los bits.
Si cogemos 3 bits, M÷2
3
÷ 8 niveles de tension.
Si queremos enviar muchos bits por segundo, deberiamos tener un M muy
grande, lo que implica minimas diIerencias entre los niveles, con lo que al mas minimo
ruido Iallaria el envio. Solo seria posible en un medio libre de errores. ¿En un canal con
ruido, cuando puede ser el valor de M?
Canal con ruido: la relacion señal/ruido a la salida del canal es la division entre S
y N (señal y ruido).
Para un sistema asi, Shanon, en 1984 demostro que:
Es la cantidad de bits a transmitir sin errores.
Ejemplo: Linea teleIonica basica.
BW ÷ 3100 Hz.
(S/N)dB ÷ 30 dB
(S/N)db ÷ 10 log (S/N)
S/N ÷ 10
3
÷ 1000 La potencia de la voz al teleIono es 1000 veces superior al
ruido que se genera e interIiere.
C ÷ 3100·log
2
(1¹1000) ÷ 30984 bits/seg. (o sea, que de igual que te compres un
MODEM de 56600)
Esta Iormula nos dice el maximo, pero no como alcanzarlo. Nos da el regimen
binario nada mas.
A la vista de la Iormula, ¿que se puede hacer para aumentar el regimen binario?
Aumentar el BW, la potencia de la señal (S) o disminuir el ruido (N). No es tan sencillo:
el ruido es por causas externas. Aumentar el BW tiene un eIecto de aumento de la
BW
seg
bits
C · 2 =
|
|
.
|

\
|
11
10
01
00
10111010001011
M BW
seg
bits
C
2
·log · 2 ) ( =
) (
) (
Watts N
Watts S

N
S
N
S
dB
·log 10 =
|
.
|

\
|
+ =
|
.
|

\
|
N
S
seg
bit
C 1 ·log 10
2
Limite de Shanon
I
3400 Hz 300 Hz
La mayor parte de la
voz se concentra entre
300 y 3400 Hz.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-30
temperatura, y por ello del ruido. Aumentar la potencia de la señal nos lleva a introducir
no linealidades, aumentando el ruido de intermodulacion.
3.3 Medios de transmisión
Pueden ser guiados (par trenzado, coaxial o Iibra optica) o no guiados (micro-
ondas, radio e inIrarrojo).
3.3.1 Cuiados
3.3.1.1 Par trenzado
Es el medio mas barato y mas usado.
Descripción física
Son dos hilos de cobre, uno envueltos con un aislante y entrecruzados en Iorma
de espiral. Cada par de cables constituye solo un enlace de comunicacion. Tipicamente,
se utilizan haces en los que se encapsulan varios pares mediante una envoltura
protectora. En aplicaciones de larga distancia, la envoltura puede contener cientos de
pares. El uso del trenzado tiende a disminuir las interIerencias electromagneticas
(diaIonia) entre los pares adyacentes dentro de una misma envoltura. Para este Iin, los
pares adyacentes dentro de una misma envoltura protectora se trenzan con pasos de
torsion diIerentes. Tipicamente, para enlaces de larga distancia, la longitud del trenzado
varia entre 5 y 15 cm. Los conductores que Iorman el par tienen un grosor que varia
tipicamente entre 0.04 y 0.09 pulgadas. Comunmente en comunicaciones es mas
Irecuente el de 4 pares.
Aplicaciones
Tanto para señales analogicas como para señales digitales, el par trenzado es con
diIerencia el medio de transmision mas usado. Por supuesto es el emedio mas usado en
las redes de teleIonia, igualmente su uso es basico en el establecimiento de redes de
comunicacion dentro de ediIicios.
En teleIonia, el terminal de abonado se conecta a la central local mediante cable
de par trenzado, denominado 'bucle de abonado¨. Igualmente, dentro de un ediIicio de
oIicinas, cada teleIono se conecta a la central privada (PBX, 'Private Branch
Exchange¨) mediante un par trenzado. Estas instalaciones basadas en pares trenzados,
se diseñaron para transportar traIico de voz mediante señalizacion analogica. No
obstante, con el uso de los modems, esta inIraestructura puede utilizarse para transportar
traIico digital a velocidades de transmision reducidas.
En aplicaciones digitales, el par trenzado es igualmente el mas utilizado.
Tipicamente, los pares trenzados se utilizan para las conexiones al conmutador digital o
a la PBX digital, con velocidades de hasta 64 Kbps. El par trenzado se utiliza tambien
en redes de area local dentro de ediIicios para los 10 Mbps. No obstante recientemente
se ah desarrollado redes de area local con velocidad de 100 Mbps mediante pares
trenzados, aunque estas conIiguraciones estan bastante limitadas por el numero de
posibles dispositivos conectados y extension geograIica de la red. Para aplicaciones de
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-31
larga distancia, el par trenzado se puede utilizar a velocidades de 4 Mbps o incluso
mayores.
El par trenzado es mucho menos costoso que cualquier otro medio de
transmision guiado (cable coaxial y Iibra optica), y a la vez es sencillo de manejar.
Ahora bien, comparado con los anteriores esta mas limitado en terminos de velocidad de
transmision y de distancia maxima.
Características de transmisión
Los cables de pares se pueden usar para transmitir tanto señales analogicas como
digitales. Para señales analogicas, se necesitan ampliIicadores cada 5 0 6 Km. Para
señales digitales, se requieren repetidores cada 2 o 3 Km.
Comparado con otros medios guiados (coaxial y Iibra optica), el par trenzado
permite menores distancias, menor ancho de banda y menor velocidad de transmision.
Este medio se caracteriza por su gran susceptibilidad a las interIerencias y al ruido, por
ejemplo campos electromagneticos exteriores pueden aIectarle negativamente. Asi por
ejemplo, un cable conductor situado en paralelo con una linea de potencia que conduzca
corriente alterna se vera negativamente aIectado por esta. El ruido impulsivo tambien
aIecta a los pares trenzados.
Para reducir estos eIectos negativos es posible tomar algunas medidas. Por
ejemplo, el apantallamiento del cable con una malla metalica reduce las interIerencias
externas. El trenzado en los cables reduce las interIerencias de baja Irecuencia, y el uso
de distintos pasos de torsion entre pares adyacentes reduce la diaIonia.
Para la señalizacion analogica punto a punto, un par trenzado puede oIrecer
hasta 250 kHz de ancho de banda. En el caso de señalizacion digital punto a punto de
larga distancia, se pueden conseguir del orden de unos pocos Mbps; para distancias
cortas, actualmente ya hay disponibles productos comerciales que alcanzan los 100 bps.
Pares trenzados apantal lados y sin apantallar
Hay dos variantes de pares trenzados: apantallado y sin apantallar. El par
trenzado no apantallado (UTP, 'Unshielded Twisted Pair¨) es el medio habitual en
teleIonia. Actualmente es practica habitual en el cableado de ediIicios, utilizando
dimensiones que estan muy por encima de las necesidades reales de lo que se necesita
para teleIonia. Esto es asi ya que hoy por hoy, el par sin apantallar es el menos caro de
todos los medios de transmision que se usan en las redes de area local, ademas de ser
Iacil de instalar y de manipular.
El par trenzado sin apantallar se puede ver aIectado por interIerencias
electromagneticas externas, incluyendo interIerencias con pared cercanos y Iuentes de
ruido. Una manera de mejorar las caracteristicas de transmision de este medio es
embutiendolo dentro de una malla metalica, reduciendose asi las interIerencias. El par
trenzado apantallado (STP, 'Shielded Twisted Pair¨) proporciona mejores resultados a
velocidades de transmision bajas. Ahora bien, este ultimo es mas costoso y diIicil de
manipular que el anterior.
En el par trenzado apantallado, cada par va envuelto por una malla metalica y a
su vez por otra, para luego estar todo el conjunto cubierto por aislante. Las mallas estan
a masa (0 voltios) Iormando una 'Jaula de Faraday¨. Asi reduce las emisiones y
recepciones de señales electromagneticas.
UTP tipo 3 y tipo 5
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-32
En la mayoria de los ediIicios se hace una pre-instalacion con un par trenzado de
100 ohmios denominado de calidad teleIonica. Por tanto, este tipo de pre-instalaciones
se deben considerar siempre como una alternativa bastante atractiva y poco costosa para
LAN. No obstante, hay que tener en cuentaque las velocidades de transmision y las
distancias que se peuden alcanzar con este medio no siempre alcanzan las necesidades
minimas.
En 1991, la EIA ('Electronic Industries Association¨) publicon el estandar EIA-
568, denominado 'Commercial Building Telecommunications Cabling Standard¨, que
deIine el uso de pares trenzados sin apantallar de calidad teleIonica y de pares
apantallados como medios para aplicaciones de transmision de datos en ediIicios.
Notese que por aquel tiempo, las caracteristicas de dichos medios eran suIicientes para
el rango de Irecuencias y velocidades tipicas necesarias en entornos oIimaticos. Es mas,
en esa epoca el intervalo de interes para el diseño de LAN estaba entre 1 y 16 Mbps.
Con el tiempo, los usuarios han ido migrando tanto a estaciones de trabajo como a
aplicaciones de mayores prestaciones. Por tanto, habia cada vez un interes creciente en
diseñar LANs que proporcionaran hasta 100 Mbps sobre medios no costosos. Como
respuesta a esa necesidad, en 1995 se propuso el EIA-568-~. Este estandar incorpora los
mas recientes avances tanto en el diseño de cables y conectores como en metodos de
test. En esta especiIicacion se consideran tanto cables de pares apantallados a 150
ohmios como pares no apantallados de 100 ohmios.
En el estandar EIA-568-A se consideran 3 tipos de cables UTP:
- Tipo 3: consiste en cables y su hardware asociado, diseñados para Irecuencias de
hasta 16 MHz
- Tipo 4: consiste en cables y su hardware asociado, diseñados para Irecuencias de
hasta 20 MHz.
- Tipo 5: consiste en cables y su hardware asociado, diseñados para Irecuencias de
hasta 100 MHz.
De entre los anteriores, los tipos 3 y 5 son los mas utilizados en los entornos
LAN. El tipo 3 corresponde a los cables de calidad teleIonica que existen en la
mayoria de los ediIicios de oIicinas. Con un diseño apropiado y a distancias limitadas,
con cables tipo 3 se pueden conseguir velocidades de hasta 16 Mbps. El tipo 5 es un
cable de mejores caracteristicas para la transmision de datos, y cada vez se esta
utilizando mas y mas como pre-instalacion en los nuevos ediIicios de oIicinas. Con un
diseño apropiado y a distancias limitadas, con tipo 5 se pueden alcanzar 100 Mbps.
La diIerencia esencial entre los cables tipo 3 y 5 esta en el numero de trenzas por
unidad de distancia. El paso de torsion en el tipo 5 es del orden de 1 a 2 trenzas por
centimetro, mientras que en le tipo 3 tiene una trenza cada 7 o 10 centimetros. El
trenzado del tipo 5 es por supuesto mas caro, ahora bien, proporciona prestaciones
superiores que el de tipo 3.
Los conectores son RJ-45 (cable de red o latiguillo). Muy parecido al del
teleIono (RJ-11).
El conector STP es muy parecido, pero con una cubierta metalica, donde se
conectan las mallas metalicas para ponerlas a masa.
La norma (EIA/TIA-568, comentada anteriormente) que deIinia el cableado de
un ediIicio no residencial, se conoce como'Sistema de cableado estructurado¨:
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-33
1. Debe haber una sala principal de equipos, en la
planta baja o sotano. A ella llegan todas las
lineas del exterior.
2. En cada planta habra uno o varios repetidores de
planta. Los suIicientes para que haya en cada
punto de la planta un repetidor a menos de 100
metros.
3. En cada puesto de usuario debe haber una
roseta, consistente en (al menos) dos tomas de
red (una para voz y otra para datos).
4. La norma dice que los cables deben ser tendidos
desde la sala de equipos a cada uno de los
repetidores. Es el cableado troncal o vertical.
Esta norma recomienda Iibra optica de hasta 2 Km de longitud.
5. De cada repetidor de planta salen 2 cables para cada roseta. Se le llama cableado
horizontal. Debe medir, como maximo 100 metros, recomendandose par
trenzado sin apantallado (UTP).
Impedancia caracteristica de un cable.
Es la resistencia que tiene un cable de longitud inIinita a Irecuencia inIinita. Con
corriente continua la resistencia de un cable crece. Con corriente alterna, crece hasta
aproximarse a la impedancia caracteristica.
Si un cable tiene impedancia de 100 ohmios, pongo una impedancia de 100
ohmios al Iinal, la señal que llega al extremo es maxima. Con otra conIiguracion llegara
menos señal, no la maxima.
Aplicaciones del par trenzado
- Linea teleIonica.
- Comunicacion de datos: RDSI (ISDN), LAN (a 100 metros se llega a conseguir
entre 10 y 155 Mb/s)
- ADSL: ·÷ 2 Km y jhasta 4 M/seg.
3.3.1.2 Coaxial
Descripción física
El cable coaxial, al igual que el par trenzado, tiene dos conductores pero esta
construido de Iorma diIerente para que pueda operar sobre un rango mayor de
Irecuencias. Consiste en un conductor cilindrico externo que rodea a un cable
conductor. El conductor interior se mantiene a lo largo del eje axial mediante una serie
de anillos aislantes regularmente espaciados o bien mediante un material solido
dielectrico. El conductor exterior se cubre con una
cubierta o Iunda protectora. El cable exterior se
une a masa Iormando una jaula de Iaraday. El
cable coaxial tiene un diametro que va de 1 a 2.5
cm aproximadamente. Debido al tipo de
apantallamiento realizado, es decir, a la
disposicion concentrica de los dos conductores, el
cable coaxial es mucho menos susceptible a interIerencias y diaIonias que el par
2
2
2
1
2
2
2
4
Cobre
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-34
trenzado. Comparando con este, el cable coaxial se puede usar para cubrir mayores
distancias, asi como conectar un numero mayor de estaciones en una linea compartida.
Aplicaciones
El cable coaxial es quiza el medio de transmision mas versatil, por lo que esta
siendo cada vez mas utilizado en una gran variedad de aplicaciones. Las mas
importantes son:
- Distribucion de television
- TeleIonia a larga distancia
- Conexion con periIericos a corta distancia
- Redes de Area Local
El cable coaxial se esta utilizando para la distribucion de la TV por cable hasta
los hogares de los usuarios. Diseñado inicialmente para proporcionar servicio de acceso
a areas remotas (CATV, 'Community Antenna Television¨), la TV por cable en un
Iuturo muy cercano llegara a casi tantos hogares y oIicinas como el actual sistema
teleIonico. El sistema de TV por cable puede transportar docenas e incluso cientos de
canales a decenas de kilometros.
Tradicionalmente, el coaxial ha sido Iundamental en la red de teleIonia a larga
distancia, aunque en la actualidad tiene una Iuerte competencia en la Iibra optica, las
microondas terrestres y las comunicaciones via satelite. Cuando se usa multiplexacion
con division en Irecuencia (FDM, 'Frecuency Division Multiplexing¨), el cable coaxial
puede transportar mas de 10.000 canales de voz simultaneamente.
El cable coaxial tambien se usa con Irecuencia para conexiones entre periIericos
a corta distancia. Con señalizacion digital, el coaxial se puede usar como medio de
transmision en canales de entrada salida en computadores.
Otro area de aplicacion del cable coaxial es en las redes de area local. El cable
coaxial admite un gran numero de dispositivos con una gran diversidad de tipos de
datos y traIico con coberturas que van desde un solo ediIicio a varios, siempre proximos
entre ellos.
Características de transmisión
El cable coaxial se usa para transmitir tanto señales analogicas como digitales.
Tiene respuesta en Irecuencia superior a la del par trenzado, permitiendo por tanto
mayores Irecuencias y velocidades de transmision. Como ya se ha dicho, por
construccion el cable coaxial es mucho menos susceptible que el par trenzado tanto a
interIerencias como a diaIonia. Sus principales limitaciones son la atenuacion, el ruido
termico, y el ruido de intermodulacion. Este ultimo aparece solo cuando se usan
simultaneamente varios canales o bandas de Irecuencias.
Para la transmision de señales analogicas a larga distancia, se necesitan
ampliIicadores separados por muy pocos kilometros, estando menos separados cuanto
mayor es la Irecuencia de trabajo. El espectro de la señalizacion analogica se extiende
hasta los 400 MHz. Para señalizacion digital, en cambio, se necesita un repetidor
aproximadamente cada kilometro, esto es, la separacion entre repetidores es menor.
3.3.1.3 Fibra óptica
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-35
Descripción física
La Iibra optica es un medio Ilexible y extremadamente Iino (de 2 a 125µm),
capaz de conducir energia de naturaleza optica. Para la Iibra se pueden usar diversos
tipos de cristales y plasticos. Las perdidas menores se han conseguido con la utilizacion
de Iibras de silicio Iundido ultra puro. Las Iibras ultra-puras son muy diIiciles de
Iabricar; las Iibras de cristal multicomponente tienen mayores perdidas y son mas
economicas, pero proporcionan unas prestaciones suIicientes. La Iibra de plastico tiene
todavia un coste menor y se pueden utilizar para enlaces de distancias cortas, para los
que son aceptables perdidas moderadamente altas.
Un cable de Iibra optica tiene Iorma
cilindrica y esta Iormado por tres secciones
concentricas: el nucleo, el revestimiento y la
cubierta. El nucleo es la seccion mas interna, esta
constituido por una o varias hebras o Iibras muy
Iinas de cristal o plastico. Cada Iibra esta rodeada por su propio revestimiento, que no es
sino otro cristal o plastico con propiedades opticas distintas a las del nucleo. La capa
mas exterior que envuelve a uno o varios revestimientos es la cubierta. La cubierta esta
hecha de plastico y otros materiales dispuestos en capas para proporcionar proteccion
contra la humedad, la abrasion, aplastamientos y otros peligros.
Aplicaciones
Uno de los avances tecnologicos mas signiIicativos en la transmision de datos ha
sido el desarrollo de los sistemas de comunicacion de Iibra optica. No en vano, la Iibra
disIruta de una gran aceptacion para las telecomunicaciones a larga distancia, y cada vez
mas esta siendo mas popular en las aplicaciones militares. Su perIeccionamiento
continuado asi como su reduccion en precio han contribuido a convertirla en un medio
atractivo para los entornos LAN. Las caracteristicas diIerenciales de la Iibra optica
Irente al cable coaxial y al par trenzado son:
- Mavor ancho de banda: El ancho de banda y por tanto la velocidad de
transmision, en las Iibras es enorme. Experimentalmente se ha demostrado que
se pueden conseguir velocidades de transmision de 2 Gbps para decenas de
kilometros de distancia. Comparese con el maximo que se puede conseguir en el
cable coaxial: cientos de Mbps sobre aproximadamente 1 Km, y con los escasos
Mbps que se pueden obtener en la misma distancia para parez trenzados, o con
los 100 Mbps que se consiguen en pares trenzados si la distancia se reduce a
unas pocas decenas de metros.
- Menor tamaño v peso: Las Iibras opticas son apreciablemente mas Iinas que el
cable coaxial o que los pares trenzados embutidos, por lo menos en un orden de
magnitud para capacidades de transmision comparables. En las conducciones
estrechas previstas en las ediIicaciones para el cableado, asi como en las
conducciones publicas subterraneas, la utilizacion de tamaños pequeños tiene
unas ventajas evidentes. La reduccion en tamaño lleva a su vez aparejada una
reduccion en peso que disminuye la inIraestructura necesaria.
- Atenuacion menor: La atenuacion es signiIicativamente menor en las Iibras
opticas que en los cables coaxiales y peras trenzados, ademas es constante en un
gran intervalo de Irecuencias.
- Aislamiento electromagnetico: Los sistemas de Iibra optica no se ven aIectados
po los eIectos de campos electromagneticos exteriores. Estos sistemas no son
nucleo
envoltura
cubierta
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-36
vulnerables a interIerencias, ruido impulsivo o diaIonia. Y por la misma razon,
las Iibras no radian energia, produciendo interIerencias despreciables con otros
equipos y proporcionando a la vez un alto grado de privacidad; ademas,
relacionado con esto, la Iibra es por construccion, diIicil de intervenir o,
coloquialmente, 'pinchar¨.
- Mavor separacion entre repetidores: Cuantos menos repetidores haya el coste
sera menor, ademas de haber menos Iuentes de error. Desde este punto de vista,
las prestaciones de los sistemas de Iibra optica han sido mejoradas
progresivamente. Por ejemplo, AT&T ha desarrollado un sistema de transmision
que consigue 3.5 Gbps sobre una distancia de 318 Km sin necesidad de
repetidores. Los sistemas basados en coaxial y pares trenzados requieren
repetidores cada pocos kilometros.
Las cinco aplicaciones basicas en las que la Iibra optica es importante son:
- Transmisiones a larga distancia
- Transmisiones metropolitanas
- Acceso a areas rurales
- Bucles de abonado
- Redes de area local
La transmision a largas distancias mediante Iibras es cada vez mas comun en la
red de teleIonos. En estas redes, las distancias medias son aproximadamente 1500 km y
tienen una gran capacidad (tipicamente de 20.000 a 60.000 canales de voz). Estos
sistemas son competitivos, en cuanto a coste, con los enlaces de microondas y estan
muy por debajo, en coste, del cable coaxial. La diIerencia es tal que incluso en algunos
paises en desarrollo el coaxial se esta quedando desIasado para su utilizacion en redes
de teleIonia.
Los circuitos metropolitanos tienen una longitud media de 12,5 km y pueden
tener hasta 100.000 canales de voz. La mayoria de los servicios se estan instalando
usando conducciones subterraneas sin repetidores, que se usan para enlazar centrales
teleIonicas dentro del area metropolitana. En esta categoria estan las rutas que enlazan
las lineas de larga distancia de microondas, que llegan hasta las areas perimetrales de las
ciudades, con las centrales de teleIonia situadas dentro del casco urbano.
Los accesos a areas rurales tienen tipicamente longitud4es que van desde los 40
a los 160 km. En Estados Unidos, estos enlaces a su vez conectan Irecuentemente
centrales teleIonicas pertenecientes a diIerentes compañias. La mayoria de estos
sistemas tienen menos de 5000 canales de voz. Usualmente, la tecnologia utilizada en
estas aplicaciones compite con las microondas.
Los bucles de abonado son Iibras que van directamente desde las centrales al
abonado. El uso de la Iibra en estos servicios esta empezando a desplazar a los enlaces
mediante pares trenzados y coaxiales, dado que cada vez mas las redes de teleIonia
estan evolucionando hacia redes integradas capaces de gestionar no solo voz y datos,
sino tambien imagenes y video. El uso de la Iibra en estas aplicaciones esta encabezado
Iundamentalmente por grandes clientes (empresas); no obstante, la Iibra como medio de
acceso desde los domicilios particulares aparecera en un Iuturo a corto plazo.
Finalmente, una aplicacion importante de la Iibra optica esta en las redes de area
local. Recientemente, se han desarrollado estandares y productos para redes de Iibra
optica que tienen una capacidad de 100 Mbps y permiten cientos o incluso miles de
estaciones en grandes ediIicios de oIicinas.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-37
Las ventajas de la Iibra optica respecto del par trenzado odel cable coaxial son
cada vez mas convincentes conIorme va aumentando la demanda de la inIormacion
multimedia (voz, datos, imagenes y video).
Características de transmisión
La Iibra optica Iunciona en un rango de Irecuencias que va desde 1014 hasta
1015 Hz, cubriendo todo el espectro visible y parte del espectro inIrarrojo.
El principio que rige la transmision en la Iibra optica es el siguiente. La luz
proveniente de la Iuente penetra en el nucleo cilindrico de cristal o plastico. Los rayos
que inciden con angulos superIiciales se reIlejan y se propagan dentro del nucleo de la
Iibra, mientras que para otros angulos, los rayos son absorbidos por el material que
Iorma el revestimiento. Este tipo de propagacion se llama multimodal, aludiendo al
hecho de que hay multitud de angulos para los que se la reIlexion total. Cuando el radio
del nucleo se reduce, la reIlexion se dara en un numero menor de angulos. Al reducir el
radio del nucleo a dimensiones del orden de la magnitud de la longitud de onda, un solo
angulo o modo podra pasar: el rayo axial. Esta propagacion monomodo proporciona
prestaciones superiores por las razones que se esgrimen a continuacion. En la
transmision multimodo existen multiples caminos de propagacion, cada uno con
longitud diIerente y por tanto, con diIerentes tiempos de propagacion en la Iibra. Esto
hace que los elementos de la señal se dispersen en el tiempo, lo que limita la velocidad
de transmision al a que se puede recibir adecuadamente. Dado que en la transmision
monomodo solo hay un camino posible, el tipo de distorsion indicado no puede darse.
Finalmente, se puede conseguir un tercer modo de transmision variando
gradualmente el indice de reIraccion del nucleo, denominado multimodo de indice
gradual. Las caracteristicas de este ultimo modo estan entre las de los otros dos modos
comentados. El indice de reIraccion variable tiene como consecuencia un mejor enIoque
de los rayos que en el caso de la transmision multimodo ordinaria, tambien denominada
multimodo de indice discreto.
En los sistemas de Iibra optica se usan dos tipos diIerentes de Iuentes de luz: los
diodos LED ('Ligth Emitting Diodes¨) y los diodos ILD ('Injection Laser Diode¨).
Ambos son dispositivos semiconductores que emiten un haz de luz cuando se les aplica
una tension. El LED es menos costoso, opera en un mayor rango de temperaturas y tiene
una vida media superior. El ILD es mas eIicaz y puede proporcionar velocidades de
transmision superiores.
Existe una relacion establecida entre la longitud de onda utilizada, el tipo de
transmision y la velocidad de transmision que se puede conseguir. Tanto el monomodo
como el multimodo pueden admitir varias longitudes de onda diIerentes y pueden
utilizar como Iuentes tanto laceres como diodos LED. En las Iibras opticas, la luz se
propaga mejor en tres regiones o 'ventanas¨ de longitudes de onda, centradas a 850,
1300 y 1500 nanometros (nm). Todas estas Irecuencias estan en la zona inIrarroja del
espectro, por debajo del espectro visible que esta situado entre los 400 y 700 nm. Las
perdidas son menores cuanto mayor es la longitud de onda. En la actualidad, la mayoria
de las aplicaciones usan como Iuentes los diodos LED a 850 nm. Aunque esta eleccion
es relativamente barata, su uso esta generalmente limitado a velocidades de transmision
por debajo de 100 Mbps y a distancias de pocos kilometros. Para conseguir mayores
velocidades de transmision y mayores distancias es necesario transmitir en la ventana
centrada a 1300 nm (usando tanto laser como diodos), y si todavia se necesitan mejores
prestaciones, entonces hay que recurrir al uso de emisores laser a 1500 nm-.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-38
3.3.2 No guiados
En medios guiados, tanto la transmision como la recepcion se lleva a cabo
mediante antenas. En la transmision, la antena radia energia electromagnetica en el
medio (normalmente el aire), y en la recepcion la antena capta las ondas
electromagneticas del medio que la rodea. Basicamente hay dos tipos de
conIiguraciones para las transmisiones inalambricas: direccional y omnidireccional. En
la primera, la antena de transmision emite la energia electromagnetica concentrandola
en un haz; por tanto, en este caso las antenas de emision y recepcion deben estar
perIectamente alineadas. En el caso omnidireccional, por el contrario, el diagrama de
radiacion de la antena es disperso, emitiendo en todas direcciones, pudiendo la señal ser
recibida por varias antenas. En este caso, la señal se atenua mucho mas rapido. En
general, cuando mayor es la Irecuencia de la señal transmitida es mas Iactible conIinar
la energia en un haz direccional.
En el estudio de las comunicaciones inalambricas, se van a considerar tres
rangos de Irecuencias. El primer intervalo que va desde los 2 GHz (Gigahertzio ÷ 19
9
Hertzios) hasta los 40 GHz se denomina Irecuencias microondas. En estas Irecuencias
de trabajo se pueden conseguir haces altamente direccionales, por lo que las microondas
son adecuadas para enlaces punto a punto. Las microondas tambien se usan para las
comunicaciones via satelite. Las Irecuencias que van desde 30 MHz h 1 GHz son
adecuadas para las aplicaciones omnidireccionales. A este rango de Irecuencias lo
denominaremos intervalo de ondas de radio. Las microondas cubren parte de la banda
de UHF y cubren totalmente la banda SHF; la bande de ondas de radio cubre la VHF y
parte de la banda UHF.
Es preIerible la comunicacion direccional, aunque solo es posible a Irecuencas
elevadas, por que deberiamos tener una antena del tamaño de la longitud de onda. Sl la
Irecuencia es baja, la longitud de la onda es muy alta y no podemos construir antenas
muy grandes.
Otro rango de Irecuencias importante, para las aplicaciones de indole local, es la
zona de inIrarrojos del espectro que va en terminos generales desde los 3·10
11
hasta los
2·10
14
Hz. Los inIrarrojos son utiles para las conexiones locales puntoa punto asi como
para aplicaciones multipunto dentro de areas de cobertura limitada como por ejemplo
una habitacion.
3.3.2.1 Microondas terrestres
Descripción física
La antena mas comun en las microondas es la de tipo parabolico. El tamaño
tipico es de un diametro de unos 3 metros. Esta antena se Iija rigidamente y transmite un
haz estrecho que debe estar perIectamente enIocado hacia la antena receptora. Las
antenas de microondas se situan a una altura apreciable sobre el nivel del suelo, para
con ello conseguir mayores separaciones posibles entre ellas y para ser capaces de
salvar posibles obstaculos. Si no hay obstaculos intermedios, la distancia maxima entre
antenas veriIica:
Kh d 14 . 7 =
Siendo d la distancia de separacion entre las antenas expresada en kilometros, h
es la altura de la antena en metros y k es un Iactor de correccion que tiene en cuenta que
las microondas se desvian o reIractan con la curvatura de la tierra llegando, por tanto,
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-39
mas lejos de lo que lo harian si se propagasen en linea recta. Una buena aproximacion
es considerar K÷4/3. Por tanto, a modo de ejemplo, dos antenas de microondas con
altura de 100 metros pueden separarse una distancia igual a Km d 82 133 14 . 7 = = .
Para llevar a cabo transmisiones a larga distancia, se utiliza la concatenacion de
enlaces punto a punto entre antenas situadas en torres adyacentes, hasta cubrir la
distancia deseada.
Aplicaciones
El uso principal de los sistemas de microondas terrestres son los servicios de
telecomunicacion de larga distancia, como alternativa al cable coaxial o a las Iibras
opticas. La utilizacion de microondas requiere menor numero de repetidores o
ampliIicadores que el cable coaxial, pero por el contrario, necesita que las antenas esten
alineadas. El uso de las microondas es Irecuente en la transmision de television y de
voz.
Otro uso, cada vez mas Irecuente, es para enlaces punto a punto a cortas
distancias entre ediIicios. En este ultimo caso, se puede emplear para circuitos cerrados
de TV o para la interconexion de redes locales. Ademas, las microondas a corta
distancia tambien se utilizan en las aplicaciones denominadas de 'bvpass¨, con las que
una determinada compañia puede establecer un enlace privado hasta el centro proveedor
de transmisiones a larga distancia, evitando asi tener que contratar el servicio a la
compañia teleIonica local.
Características de transmisión
El rango de las microondas cubre una parte sustancial del especto. La banda de
Irecuencias esta comprendida entre 2 y 40 GHz. Cuanto mayor sea la Irecuencia
utilizada, mayor es el ancho de banda potencial, y por tanto mayor es virtualmente la
velocidad de transmision.
Al igual que en cualquier sistema de transmision, la principal causa de perdidas
en las microondas es la atenuacion. Para las microondas (y tambien para la banda de
Irecuencias de radio), las perdidas se pueden expresar como:
dB
d
L
2
4
·log 10
|
.
|

\
| H
=
O
donde d es la distancia y ì es la longitud de onda, expresadas en las mismas
unidades. Por tanto las perdidas varian con el cuadrado de la distancia. Por el contrario,
en el cable coaxial y el par trenzado las perdidas tienen una dependencia logaritmica
con la distancia (lineal en decibelios). Por tanto, en los sistemas que usan microondas,
los ampliIicadores o repetidores se pueden distanciar mas (de 10 a 100 km tipicamente)
que en los coaxiales y pares trenzados. La atenuacion aumenta con las lluvias, siendo
este eIecto signiIicativo para Irecuencias por encima de 10 GHz. Otra diIicultad
adicional son las interIerencias. Con la popularidad creciente de las microondas, las
areas de cobertura se pueden solapar, haciendo que las interIerencias sean siempre un
peligro potencial. Asi pues, la asignacion de bandas tiene que realizarse siguiendo una
regulacion estricta.
Las bandas mas usuales en la transmision a larga distancia se situan entre 4 GHz
y 6 GHz. Debido a la congestion progresiva que estan suIriendo estas bandas,
recientemente la banda de 11 GHz se esta empezando a utilizar. La banda de los 12
GHz se usa para la TV por cable. Los enlaces de microondas se usan igualmente para
transmitir señal de TV en las instalaciones CATV locales; posteriormente, dicha señal
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-40
se hace llegar al usuario individual mediante cable coaxial. Finalmente, cabe citar que
las microondas de altas Irecuencias se estanutilizando para enlaces cortos punto a punto
entre ediIicios. Para tal Iin se usa tipicamente la banda de 22 GHz. Las bandas de
Irecuencias superiores son menos utiles para distancias mas largas, debido a que cada
vez la atenuacion es mayor, ahora bien, son bastante adecuadas para distancias mas
cortas. Y ademas a Irecuencias superiores, las antenas son mas pequeñas y mas baratas.
3.3.2.2 Infrarrojos
Las comunicaciones mediante inIrarrojos se llevan a cabo mediante
transmisores/receptores ('transceivers¨) que modulan luz inIrarroja no coherente. Los
transceivers deben estar alineados bien directamente o mediante la reIlexion en una
superIicie coloreada como puede ser el techo de una habitacion.
Una diIerencia signiIicativa entre la transmision de rayos inIrarrojos y las
microondas es que los primeros no pueden atravesar las paredes. Por tanto, los
problemas de seguridad y de interIerencias que aparecen en las microondas no se
presentan en este tipo de transmision. Es mas, no hay problemas de asignacion de
Irecuencias, ya que en esta banda no se necesitan permisos.
3.3.2.3 Ondas de radio
Descripción física
La diIerencia mas palpable entre las microondas y las ondas de radio es que estas
ultimas son omnidireccionales, mientras que las primeras tienen un diagrama de
radiacion mucho mas direccional. Por tanto, las ondas de radio no necesitan antenas
parabolicas, ni necesitan que dichas antenas esten instaladas sobre una plataIorma rigida
para estar alienadas.
Aplicaciones
Con el termino ondas de radio se alude de una manera poco precisa a todas las
bandas de Irecuencias desde 3 kHz a 300 GHz. Aqui dicho termino se considera que
abarca la banda VHF y parte de la UHF: de 30 MHz a 1 GHz. Este Iango cubre la radio
comercial FM, asi como television UHF y VHF. Este Iango tambien se utiliza para una
serie de aplicaciones de redes de datos.
Características de transmisión
El rango de Irecuencias comprendido entre 30 MHz y 1 GHz es muy adecuado
para la diIusion simultanea a varios destinos. A diIerencia de las ondas
electromagneticas con Irecuencias menores, la inonosIera es transparente para las ondas
de radio superiores a 30 MHz. Asi pues, la transmision es posible cuando las antenas
estan alienadas, no produciendose interIerencias entre los transmisores debidas a las
reIlexiones con la atmosIera. A diIerencia de la region de las microondas, las ondas de
radio son menos sensibles a la atenuacion producida por la lluvia.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 3-41
Como en el caso anterior donde la transmision sigue una linea recta, en este caso
tambien se veriIica la ecuacion Kh d 14 . 7 = , es decir, la distancia maxima entre el
transmisor y el receptor es ligeramente mayor que el alcance visual. Al igual que en las
microondas, la atenuacion debida simplemente a la distancia veriIica la ecuacion
dB
d
L
2
4
·log 10
|
.
|

\
| H
=
O
. Ya que tienen una longitud de onda mayor, las ondas de radio
suIren, en terminos relativos, una atenuacion menor.
Un Iactor determinante en las ondas de radio son las interIerencias por
multitrayectorias. Entre las antenas, debido a la reIlexion en la superIicie terrestre, el
mar y otros objetos, pueden aparecer multitrayectorias. Este eIecto se observa con
Irecuencia en el receptor de TV y consiste en que se pueden observar varias imagenes (o
sombras) cuando pasa un avion.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 4-42
4 Codificación de datos
Una señal digital es una secuencia de pulsos de tension discretos y discontinuos,
donde cada pulso es un elemento de señal. Los datos binarios se transmiten codiIicando
cada bit de datos en cada elemento de señal. En el caso mas sencillo, habra una
correspondencia uno a uno entre los bits y dichos elementos.
Un poco de terminologia. Si todos los elementos de señal tienen el mismo signo
algebraico, es decir, si son todos positivos o todos negativos, la señal se dice unipolar.
En una señal polar, por el contrario, un estado logico se representara mediante un nivel
positivo de tension y el otro, mediante un nivel negativo. La razon de datos de una señal
es la velocidad de transmision, expresada en bits por segundo, a la que se transmiten los
datos. La duracion o longitud de un bit se deIine como el tiempo empleado en el
transmisor para transmitir un bit; para una rezon de datos R, la duracion de un bit es 1/R.
La razon de modulacion, por el contrario, es la velocidad o razon con la que cambia el
nivel de la señal, que dependera del esquema de codiIicacion elegido. La razon o
velocidad de modulacion se expresa en baudios, que equivale a un elemento de señal
por segundo. Para concluir, por razones historicas se usan los terminos marca y espacio,
aludiendo a los digitos binarios 1 y 0 respectivamente.
Para interpretar las señales digitales, en primer lugar el receptor debe conocer o
determinar la duracion de cada bit. Es decir, el receptor con mayor o menor precision
debe conocer cuando comienza y acaba cada bit. En segundo lugar el receptor debe
determinar si el nivel para cada bit es alto (1) o bajo (0).
¿Que Iactores determinan el exito o el Iracaso del receptor al interpretar la señal
de entrada? Hay 3 Iactores importantes: la relacion señal-ruido (o mejor E
b
/N
0
), la razon
de datos (o velocidad de transmision) y el ancho de banda. Se suponen los otros Iactores
constantes, se pueden establecer las siguientes aIirmaciones:
- Un aumento de la razon de datos aumentara la razon de error por bit (es decir, la
probabilidad de que un bit se reciba erroneamente.
- Un aumento de la relacion S/N reduce la tasa de error por bit
- Un incremento del ancho de banda permite un aumento en la razon de datos.
Hay otro Iactor que se puede utilizar para mejorar las prestaciones del sistema, y
este no es otro que el propio esquema de codiIicacion. El esquema de codiIicacion es
simplemente la correspondencia que se establece entre los bits de los datos con los
elementos de señal.
Se han intentado una gran diversidad de aproximaciones. En lo que sigue, se
describen algunas de las mas utilizadas.
Algunos procedimientos para evaluar y comparar las distintas tecnicas son:
- Espectro de la señal Hay varios aspectos del espectro de la señal que son
importantes. La ausencia de componentes a altas Irecuencias signiIica que se
necesita menos ancho de banda para su transmision. Es mas, la ausencia de
componente en continua (dc) es tambien una caracteristica deseable. Si la señal
tiene continua, para su transmision se requiere la existencia de una conexion
Iisica directa; si la señal no tiene componente continua, es posible su transmision
mediante transIormadores acoplados. Esto proporciona un aislamiento electrico
excelente, reduciendo asi las interIerencias. Por ultimo, la importancia de los
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 4-43
eIectos relacionados con la distorsion de la señal y las interIerencias depende de
las propiedades espectrales de la señal trasmitida. En la practica es Irecuente que
la Iuncion de transIerencia del canal sea peor cerca de los limites de la banda.
Por tanto, un buen diseño deberia concentrar la potencia transmitida en la parte
central del ancho de banda de la señal. En tal caso, se tendra una distorsion
menor en la señal recibida. Para conseguir este objetivo, se pueden diseñar los
codigos de Iorma que se modele adecuadamente el espectro de la señal
transmitida.
- Sincroni:acion: Ya se ha mencionado la necesidad de determinar el principio y
Iin de cada bit. Esto no es una tarea Iacil. Una aproximacion bastante costosa es
transmitir una señal de reloj por separado para sincronizar el receptor con el
transmisor. La alternativa es proporcionar la sincronizacion mediante la propia
señal transmitida, lo que puede conseguirse si se adopta un esquema de
codiIicacion adecuado.
- Deteccion de errores: Es util disponer de alguna capacidad de deteccion de
errores incorporada en el esquema de codiIicacion situado en la capa Iisica.
Permitiendose con ello que los errores se detecten mas rapidamente.
- Inmunidad al ruido e interferencias: Algunos codigos exhiben un
comportamiento superior que otros en presencia de ese ruido. Esto se mide en
terminos de la tasa de error por bit.
- Coste v complefidad: aunque el coste de la logica digital continua bajando, no se
debe ignorar este Iactor. En particular, cuanto mayor es la razon de elementosde
señal para una velocidad de transmision dada, mayor es el coste.
4.1 Algoritmos
4.1.1 NRZ (NRZ-L Non Retuin to zeio
(Level))
La Iorma mas Irecuente y Iacil de transmitir señales digitales es mediante la
utilizacion de un nivel de tension diIerente para cada uno de los bits. Los codigos que
siguen esta estrategia comparten la propiedad de que el nivel de tension se mantiene
constante durante la duracion de un bit; es decir, no hay transiciones (no hay retorno al
0 0 1 0 1 1 0 0 0 1 1
NRZ-L
NRZI
Bipolar AMI
Pseudoternario
Manchester
Manchester
diIerencial
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 4-44
nivel cero de tension). Por ejemplo, la ausencia de tension se puede usar para
representar un 0 binario, mientras que un nivel constante y positivo de tension puede
representar al 1. Aunque es mas Irecuente utilizar un nivel negativo para representar un
valor binario y una tension positiva para representar al otro. Este ultimo se denomina
codigo Nivel no retorno a cero (NRZ-L 'Nonreturn-to-Zero-Level¨). NRZ-L se usa
generalmente para generar o interpretar los datos binarios en los terminales y otros
dispositivos. Si se utiliza un codigo diIerente, este se generara usualmente a partir de la
señal NRZ-L.
Por lo tanto, para representar el valor logico 0 se utilizara un nivel alto y para
representar el valor logico 1 se utilizara un nivel bajo.
Ventajas: es muy sencillo.
Inconvenientes: tiene problemas de sincronizacion, ya que si tenemos una secuencia
muy larga de 0 o 1, tendremos durante mucho tiempo el nivel de tension, diIicultando al
receptor el saber cuantos bits llegan de ese nivel. Si no hay el mismo numero de 1 y 0,
la señal tiene componente continua (la media es distinta de 0), dando problemas con
muchos medios de transmision porque estos suelen atenuar mas la corriente continua.
4.1.2 NRZI (NRZ Inveitido)
Una variante del NRZ se denomina NRZI ('Nonreturn to zero, inver on ones¨).
Al igual que NRZ-L, el NRZI mantiene constante el nivel de tension mientras dura un
bit. Los datos se codiIican mediante la presencia o ausencia de una transicion de la señal
al principio del intervalo de duracion de un bit. Un 1 se codiIica mediante la transicion
(bajo a alto o alto a bajo) al principio del intervalo del bit, mientras que un cero se
representa por la ausencia de transicion.
Por lo tanto, 0-~ No se cambia la tension (Hay que decidir un valor de arranque),
y 1 se invierte la tension.
NRZI es un ejemplo de codificacion diferencial. En la codiIicacion diIerencial,
en lugar de determinar el valor absoluto, la señal se codiIica comparando la polaridad de
los elementos de señal adyacentes. Una ventaja de este esquema es que en presencia de
ruido puede ser mas seguro detectar una transicion en lugar de comparar un valor con
un umbral. Otra ventaja es que en un sistema complicado de transmision, no es diIicil
perder la polaridad de la señal. Por ejemplo, en una linea de par trenzado, si los cables
se invierten accidentalmente, todos los 1 y 0 en el NTZ-L se invertiran. Esto no pasa en
un esquema diIerencial.
Los codigos NRZ son los mas Iaciles de implementar y ademas se caracterizan
por hacer un uso eIicaz del ancho de banda.
La principal limitacion de los codigos NRZ es la presencia de una componente
continua y la ausencia de capacidad de sincronizacion. Para ilustrar esta ultima
desventaja, tengase en cuenta que una cadena larga de unos o de ceros en un esquema
NRZ-L o una cadena de ceros en NRZI, se codiIicara como un nivel de tension
constante durante un largo intervalo de tiempo. En estas circunstancias, cualquier
Iluctuacion entre las temporizaciones del transmisor y el receptor daran lugar a una
perdida de sincronizacion entre ambos.
Debido a su sencillez y a la respuesta en bajas Irecuencias, los codigos NRZ se
utilizan con Irecuencia en las grabaciones magneticas. No obstante, sus limitaciones
hacen que estos codigos no sean atractivos para aplicaciones de transmision de señales.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 4-45
4.1.3 Manchestei
En el codigo Manchester siempre hay una transicion en mitad del intervalo de
duracion del bit. Esta transicion en la mitad del bit sirve como un procedimiento de
sincronizacion a la vez que se transmiten los datos: una transicion de bajo a alto
representa un 1 y una transicion de alto a bajo representa un 0.
0-~ Nivel alto y a mitad del bit se cambia
1-~ Nivel bajo y a mitad del bit se cambia
Asignamos en todos los bits un cambio, no teniendo el mismo nivel de tension
durante mucho tiempo.
4.1.4 Manchestei difeiencial
La transicion a mitad del intervalo se utiliza tan solo para proporcionar
sincronizacion, y siempre existe transicion a mitad del intervalo. La codiIicacion de un
0 se representa por la presencia de una transicion al principio del intervalo del bit y un 1
se representa mediante la ausencia de transicion. El Manchester diIerencial tiene como
ventajas adicionales las derivadas de la utilizacion de una aproximacion diIerencial. No
es preciso que el receptor tenga un reloj muy preciso. Siempre tendra una señal media
de 0, no habiendo componente continua. El inconveniente es que consume mas ancho
de banda.
La codiIicacion Manchester es una codiIicacion 1B2B, por que es como si
cogiese un bit y lo sustituyese por 2 bits.
0-~01-~ NRZ
1-~10-~ NRZ
Hay codiIicaciones generales xByB, como 4B5B-~ FDI y 5B6B en FAST-ETH.
El resultado se transmite como NRZ.
Ejemplo de 4B5B
0000÷00100
0001÷00110
0010÷01001
De las transiciones de 5 bits (32), cogeremos solo las que
tengan 1 y 0 por medio
.. ..
1110
1111
Vemos ahora algunos algoritmos ternarios (tres niveles de tension: ¹, 0 y -).
4.1.5 Pseudo-teinaiio
1-~ 0 volt.
0-~ Alterna ¹ y
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 4-46
El bit 1 se representa por la ausencia de señal, y el 0 mediante pulsos de
polaridad alternante. No hay ventajas particulares de esta codiIicacion respecto de AMI,
si bien es la base de muchas aplicaciones.
4.1.6 AMI (Alteinate Maik Inveision)
0-~0 volt.
1-~ alterna ¹ y
Un 0 binario se representa por ausencia de señal y el 1 binario se representa
como un pulso positivo o negativo. Los pulsos correspondientes a los 1 deben tener una
polaridad alternante.
Ventajas de los ternarios: Este tipo de esquema tiene las siguientes ventajas. En primer
lugar, no habra problemas de sincronizacion en el caso de que haya una cadena larga de
1. Cada 1 Iuerza una transicion por lo que el receptor se puede sincronizar en dicha
transicion. Una cadena larga de ceros, todavia es un problema. En segundo lugar, ya que
los elementos de señal correspondientes a 1 alternan el nivel de tension, no hay
componente continua. Ademas el ancho de banda de la señal resultante es
considerablemente menor que el correspondiente a NRZ. Por ultimo, la alternancia entre
los pulsos proporciona una Iorma sencilla de detectar errores. Cualquier error aislado,
tanto si elimina como si introduce un pulso, signiIica un incumplimiento de dicha
propiedad.
Inconvenientes de los ternarios: Si tenemos una cadena larga de 0 en AMI o de 1`s en el
otro, tendremos durante mucho tiempo el mismo nivel, teniendo problemas de
sincronismo. Para solventar estos problemas existen 2 variantes que veremos a
continuacion: B8ZS (USA), HDB3 (EUR, JPN).
4.1.7 B8ZS (Bipolai with 8-Zeios Substitution)
Se basa en AMI bipolar. Ya sabemos que la presencia de una secuencia larga de
ceros puede dar lugar a una perdida de sincronizacion. Para evitar este problema se
realiza una codiIicacion de acuerdo con las siguientes reglas:
- Si aparece un octeto todo ceros (ocho ceros) y el ultimo valor de tension anterior
a dicho octeto Iue positivo, codiIicar dicho octeto como 000¹-0-¹.
- Si aparece un octeto con todo ceros y el ultomo valor de tension anterior a dicho
octeto Iue negativo, codiIicar dicho octeto como 000-¹0¹-.
Con este procedimiento se Iuerzan dos violaciones de codigo del codigo AMI, lo
cual es muy improbable que haya sido causado por ruido u otros deIectos en la
1 0 1 0 0 0 0 0 0 0 1
AMI
B8ZS
HDB6
0 1 0 0 0 0 1 0
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 4-47
transmision. El receptor identiIicara ese patron y lo interpretara convenientemente como
un octeto todo ceros.
4.1.8 HDB3 ("High Density Bipolai-3 Zeios")
Este esquema se utiliza en Europa y Japon. Al igual que el anterior, se basa en la
codiIicacion AMI. En este esquema se reemplazan las cadenas de cuatro ceros por
cadenas que contienen uno o dos pulsos. En este caso, el cuarto cero se sustituye por un
estado de señal no permitido en el codigo, esteprocedimiento se denomina violacion del
codigo. En este codigo se sigue el siguiente esquema de sustitucion:
Numero de pulsos bipolares (unos) desde la
ultima sustitucion
Polaridad del
pulso anterior
Impar Par
- 000- ¹00¹
¹ 000¹ -00-
4.1.9 Ioima de onda de estas codificaciones
Veamos la densidad espectral de potencia:
Si quiero transmitir 1 MB/seg:
4.2 Datos digitales a señale analógica
Se suele emplear el modem para la conversion.
0100110...... ÷MODEM ÷Señal analogica
0.5 1 2
NRZ, NRZ-I
AMI, Pseudoternario,
B8ZS, HDB3
Manchester,
Manchester diIerencial
Por que tienen
componente continua = 0
I/R
Frecuencia (Hz) .
Regimen binario(bits/seg)
1 MHz
Con NRZ, NRZ-I
1 MHz
Con AMI, pseudoternario
2 MHz
Con Manchester
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 4-48
Disponemos de varios tipos de codiIicacion:
4.2.1 Desplazamiento en amplitud (ASK
Amplitud-Shift Keying)
¹
´
¦
÷
H ÷
=
0 0
) 2 ( · 1
) (
ft sen A
t s
4.2.2 Desplazamiento en fiecuencia (ISK)
¹
´
¦
H ÷
H ÷
=
) 2 ( · 0
) 2 ( · 1
) (
2
1
t f sen A
t f sen A
t s
Solo se cambia la Irecuencia de la onda seno.
4.2.3 Desplazamiento en fase (PSK)
¹
´
¦
H + H ÷
H ÷
=
) 2 ( · 0
) 2 ( · 1
) (
ft sen A
ft sen A
t s
Misma Irecuencia pero desplazada en Iase
Se suele emplear una combinacion de los 3 esquemas.
Las normas V22 (1200 bps), V22 bis (2400 bps), V32 (9600 bps), V32 bis
(14400 bps), V34 (28800 bps), V90 (56600 bps) se basan en combinaciones de Iase,
Irecuencia y amplitud.
4.3 Datos analógicos a señales digitales
Datos analogicos ÷Datos digitales ÷Señales digitales
La voz, audio, video o imagenes se transIorman a datos binarios mediante la
digitalizacion, que permite pasar datos analogicos a digitales.
Algunos algoritmos de digitalizacion son para video, MPEG o para audio MP3.
Hace algunos años, en la comunicacion teleIonica se comenzo a transmitir
digitalmente. Es lo que se llama modulacion por impulsos codiIicados (MIC o PCM en
ingles de Pulse Code Modulation).
0 1 0 1
0 1 0 1
1 0 1 0 0
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 4-49
4.3.1 Modulacion poi impulsos codificados
Consiste en transIormar un canal teleIonico o de voz en una secuencia de bits. Se
hace mediante 2 procesos: Muestreo y cuantiIicacion.
Mediante la vibracion de la membrana del microIono, se crea una onda electrica,
una señal. Para digitalizar esa onda, primero se muestrea, o sea, se mide el valor de esa
onda n veces por segundo. Se tendran tambien n niveles de tension. Cada uno de esos
valores se aproxima al valor mas cercano, eso es la cuantiIicacion.
En la recepcion se tienen muestras (valores sueltos). Se recupera la señal
midiendo todos esos puntos.
Tomando muchas muestras por segundo y teniendo muchos niveles, la señal que
se recompone en el destino se parecera mucho a la original. Para voz es suIiciente tomar
8000 muestras por segundo. Los niveles no estan espaciados pues la recepcion del oido
depende de las amplitudes de las Irecuencias.
Aun habiendo mas diIerencia, el oido lo percibe peor
(cree que se parecen los sonidos).
8000 muestras/seg cuantiIicadas con 8 bits (en Europa)
son 64 Kb/seg. En USA serian 56 Kb/seg.
Ley m: 128 niveles (7 bits) en USA.
Ley A: 256 niveles (8 bits) en Europa
4.4 Datos analógicos a señal analógica
Hay varios tipos:
- Modulacion de amplitud: ) 2 ( )· ( · ) ( ft sen t x A t s H = (En radio es AM)
- Modulacion de Iase: )) ( · 2 ( ) ( t x A ft sen t s + H =
- Modulacion de Irecuencia: )) ( · · 2 ( ) ( t x f A ft sen t s + H = (En radio es FM)
N veces por segundo
N niveles
t t
En la recepcion
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 5-50
5 Interfaces de capa física
5.1 Conceptos
5.1.1 Tiansmision sinciona y asinciona
Al enviar y recibir datos, debe haber una temporizacion entre emisor y receptor:
los dos tienen que estar de acuerdo en donde empieza y acaba cada bit, cuanto dura la
transmision, etc...
Suponiendo que empleamos codiIicacion NRZ y enviando 1 Mb/seg (i bit cada
micro segundo):
El receptor, usto en el punto medio
(cuando pasan 0,5µs) deberia ver que nivel hay
para deducir el bit correspondiente.
¿Que pasa si hay un error del 1° entre
los relojes del transmisor y del receptor? (cada
10 µs el otro ha contado 99µs).
Tras 50 bits, el receptor estara haciendo el muestreo en la transicion de un nivel a otro.
La solucion sincrona es mas rudimentaria y antigua, y la sincrona es mejor y mas
moderna.
5.1.1.1 Transmisión asíncrona
En sus origenes habia que remontarse al telegraIo. Aun hoy se emplea en
comunicaciones puerto serie.
Transmitimos siempre grupos pequeños de bit (por evitar el Iallo tras unos
cuantos bits). La transmision se realiza caracter a caracter, donde un caracter es un
grupo de bits (en 5 y 8 bits dependiendo del sistema (ASCII con 7 bits, EBCDIC con 8
bits)).
Si no hay nada que transmitir, se envia una señal de reposo, que se corresponde
con un 1 binario (nivel bajo de tension).
Si hay que transmitir algo se envia un bit de comienzo (0 binario, nivel alto), a
continuacion el caracter codiIicado con NRZ (0 nivel alto, 1 nivel bajo), despues un bit
de paridad (1 o 0 dependiendo del nº total de '1¨: paridad par: numero par de 1 entre el
caracter y el bit de paridad, Impar, nº impar de unos entre el caracter y el bit de paridad).
Al Iinal se envia un elemento de parada (1 binario de duracion 1, 1.5 o 2 bits).
- Bit de comienzo
- Caracter NRZ
- Bit paridad (1 o 0)
- Elemento de parada -~ 1 de duracion 1, 1.5 o 2 bits dependiendo del sistema.
1µs
0.5µs
1 0 1 1 0 0 1 Transmisor
Receptor
Reposo
B
i
t

d
e

c
o
m
i
e
n
z
o
Caracter (pueden ser 1`s o 0`s)
B
i
t

d
e

p
a
r
i
d
a
d
Parada Reposo
Si hubiese que transmitir mas, vendria un
bit de comienzo
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 5-51
Ventajas de la transmision asincrona
- Es muy sencilla
- Poco exigente en cuanto a la sincronizacion (al transmitirse pocos bits se tolera
un error de hasta el 20°)
Inconvenientes
- Es poco eIiciente: Por cada 7 bits que queremos transmitir, transmitimos 11 en
realidad.
5.1.1.2 Transmisión síncrona
Cuando el receptor puede recuperar el sincronismo del transmisor. Con NRZ,
esta secuencia:
No se permite al receptor sincronizarse, saber cuando se pasa de un bit al otro,
pues esta mucho tiempo en el mismo nivel de tension.
El problema es saber cuando termina un envio y comienza otro. Por ello la
inIormacion se encapsula en XIrames.
TRAMA÷ PREAMBULO CONTROL DATOS CONTROL PREAMBULO CONTROL etc...
En los protocolos de transmision sincrona (DIC por ejemplo) estos campos
nunca exceden de los 10 bits (en DIC sin 48 bits) mientras que los datos pueden ser
muchos bits.
Mucha eIiciencia: Transmitimos miles de bits con solo 48 de cabecera.
5.2 Interfaces
Cuando un ordenador se conecta a una red, llamamos interIaz a la especiIicacion
de caracteristicas mecanicas, electricas, Iuncionales y de procedimiento de conexion.
- Caracteristicas mecanicas: Tamaño del conector, pines, distancia entre estos,
etc...
- Caracteristicas eclecticas: Que codiIicacion se usa (NRZ, Manchester, etd, ...),
que niveles de tension, que regimen binario (bits/seg), distancia que puede medir
el cable.
- Caracteristicas Iuncinales: Cada uno de los pines o hilos del cable que señal
lleva (¹5 v, tierra, reloj, etc...).
- Caracteristicas de procedimiento: Por realizarse la comunicacion en que orden
han de intercambiarse las señales por ese interIaz.
A veces utilizamos un equipo intermedio (MODEM, por ejemplo). Aqui nos
encontramos 2 interIaces: ordenador-MODEM y MODEM-red. Esto presenta las
siguientes ventajas: Nuestro ordenador puede tener una interIaz muy comun (RS232 o
USB), al que conectamos el equipo intermedio. El ordenador sigue con el mismo
interIaz, y solo cambiamos cuando es necesario el equipo intermedio.
0 1 0 0 0 0
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 5-52
El equipo que es el transmisor/receptor de datos, se llama DTE (Data Terminal
Equipment).
El equipo intermedio se
denomina DCE (Data Circuiot-
terminating Equipment).
Hay un interIaz muy
importante entre DTE y DCE,
llamado RS-232.
5.2.1 RS-232
Es el puerto serie. El nombre actual es EIA-232-E. Esta norma especiIica los 4
tipos de caracteristicas de la conexion.
- Mecanica: ISO 2110
- Electricas: ITU-T V.28
- Funcionales y procedimentales : ITU-T V.24
Es el interIaz que emplean los modems, entre otros.
¾ Mecanicas: Conector de 25 pines. Se suelen utilizar como mucho 9 pines.
¾ Electricas: Se emplea codigo NRZ. 0-~ ¹ 3v. Y 1 3v. Puede alcanzar 20 Kbps a
15 metros de distancia.
¾ Funcionales: EspeciIica la señal que lleva cada pin, esas señales se pueden
agrupar en:
o Datos (4 pines): 1 para transmitir, 1 para recibir y otros 2 secundarios
para Iuncionamientos semiduplex (para controlar errores en este tipo de
conexiones).
o Temporizacion (3 pines): 1 pin-~ DTE manda reloj a DCE, 1 pin -~ DCE
manda reloj a DTE, y otro secundario.
o Tierra (1 pin).
o Control (el resto): Se establece una llamada, etc...
5.2.2 MODEM de distancia limitada
Sirven para conectar 2 ordenadores entre si a traves de un cable.
Estos modems solo usan 7 pines:
¾ Señal tierra (gnd): 7
¾ Transmision (Tx): 2; DTE÷DCE
¾ Recepcion de datos (RxD): 3; DTE÷DCE
¾ Peticion de envio (RTS, Request To Send): 4; DTE÷DCE
DTE
Dispositivo
interIaz de
linea
RED
DCE
1
13 pines
12 pines
DTE RS232 DCE
MODEM
RS232
MODEM
DCE DCE
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 5-53
¾ Preparado para enviar (CTS, Clear To Send): 5; DTE÷DCE
¾ DCE preparado (DSR): 6; DTE÷DCE
¾ Deteccion de señal (CD, Carrier Detect): 8; DTE÷DCE
Al encenderse el MODEM pone a ON la señal DSR (pin 6) y sigue asi:
Si quiero enviar algo:
5.2.3 MODEM de la ied telefonica
De los 25 pines, solo se usan 9 pines, los siete del caso anterior, mas otros dos:
¾ DTE Preparado (DTR): 20
¾ Indicacion de llamada (RI): 22
Suponiendo que el de la izquierda llama al de la derecha:
Comandos Hayes:
Empieza a transmitir el que recibira los datos.
DTE DCE
MODEM
DSR ON
RTS
CTS
TxD
RXD
CD
DTE RS232
DCE
RS232
DCE
DTE
RTC
DTE DTE
RTC DCE DCE
DTR
DSR
DTR
DSR
TxD RI Llamada
RTS
Negociacion entre MODEM: velocidades de Tx, etc.
Esto no es RS-232
CD
TxD RxD
RTS oII
CD oII CTS oII
CTS
Envio de
comandos Hayes
para conIirmar el
MODEM
ATD
T (Tonos)
P (Pulsos)
Nº al que se llama
XXXXXXXXXXX
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 5-54
Una vez que acaba de enviar el receptor, comienza a enviar el llamante:
A partir de aqui, el llamado puede volver a transmitir.
Cuando nadie quiere transmitir mas, para colgar se hace esto:
5.2.4 MODEM Nulo
RTS
CTS
RxD TXD
CD oII
RTS oII
CTS oII
CD
DSR oII
DTR
DTR oII
DSR
Para
volver a
comenzar
DTE
CTS
RS-232
Tierra
RXD
CD
RTS
TXD
DSR
RI
DTR
CTS
Tierra
RXD
CD
RTS
TXD
DSR
RI
DTR
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-55
6 Nivel de enlace
6.1 Introducción
Nivel Iisico: Transmision de bits no Iiable.
Nivel de enlace: Servicio de transIerencia de bloques de bits que Iorman un
mensaje (llamado trama), que se hace ademas de Iorma segura.
Funciones del nivel de enlace (no siempre estan todas presentes):
¾ Entramado (sincronizacion de trama): Consiste en detectar en ese Ilujo de bits
donde esta el Iin de una trama y el comienzo de la siguiente.
¾ Control de Ilujo: A veces, la estacion receptora no es capaz de absorber o
procesar los datos que recibe tan rapido como son enviados por el emisor. Esto
se debe a que al recibir una trama hay que hacer algo de procesamiento (pasarlo
a niveles superiores, etc...) Se van almacenando las tramas en una memoria hasta
su proceso, pudiendose desbordar. Esta Iuncion es para controlar y Irenar al
transmisor por parte del receptor.
¾ Control de errores: Al nivel Iisico se pueden introducir errores debidos a
cuestiones de los medios de transmision (ruidos, etc...). Hay que saber cuando se
produce un error y corregirlo.
¾ Gestion del enlace (a veces no esta presente): A veces, la comunicacion entre
origen u destino no es permanente, teniendo que establecer y liberar el enlace
cada vez que se quiera intercambiar inIormacion. De incluir control por el inicio,
mantenimiento y liberacion del enlace.
¾ Control del acceso al medio compartido (a veces): En redes de diIusion o
multipunto, varias estaciones compartiran el medio de transmision. Por ello hace
Ialta regular el uso de ese medio para evitar que todas transmitan a la vez.
¾ Direccionamiento: En redes de diIusion o multipunto, si recibimos una
transmision no sabemos el origen. Por ello hay que proporcionar un
direccionamiento que permita identiIicar el origen y el destino de cada
transmision.
Las tres primeras Iunciones estan presentes en todas las redes, y en terminologia
OSI se las engloba como Iunciones de CONTROL DEL ENLACE LOGICO (LLC,
logical link control).
Las 2 ultimas Iunciones tienen un sentido en redes compartidas de diIucion, en
las que el medio es compartido por varias maquinas, englobandose con el nombre de
Iunciones de CONTROL DE ACCESO AL MEDIO (MAC, medium access control).
En este tema 6 veremos la Iunciones LLC. El siguiente tema sera para MAC.
6.2 Entramado
Red
Enlace
Fisico
LLC
MAC Necesario solo en medios compartidos
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-56
Consiste en identiIicar el comienzo y Iin de trama en el Ilujo de bits. Esto lo
hace la tarjeta de interIaz de red. Hay cuatro metodos:
1. Cuenta de caracteres: Consiste en que un campo en la cabecera de la trama nos
diga cuantos bits o caracteres Iorman la trama. Presenta los siguientes
problemas: Hay que saber donde empieza la trama. El campo que lleva la cuenta
puede contener error y perderiamos la sincronizacion. Por ello, este metodo no
se emplea por si solo (aunque si combinandolo con otrols).
2. Protocolos orientados a caracter: Se considera la trama como compuesta por un
conjunto de caracteres de un determinado codigo o juego. Estan muy orientados
a la transmision asincrona. Algunos ememplos son BSC |EBCDIC| (IBM), SLC
|ASCII|.
Se emplean ciertos caracteres del codigo para indicar inicio y Iin de trama.
Ej.
Codigo ASCII ÷7 bits ÷128 caracteres.
Hay 3 caracteres en el Ilujo de 0 a 31 (caracter de control) que se empleaba para
estos Iines:
÷ DLE (Data Link Escape).
÷ STX (Start oI Text)
÷ ETX (End oI Text).
Para indicar el comienzo de una trama se enviaban 2 caracteres: un Del seguido
de un STX. Para Iinalizar la trama, DLE y ETX.
¿Que sucede si en los propios datos van incluidos esos caracteres?: Por eso se
emplea relleno de caracteres o caracteres stuIIing, consistente en, cada vez que
encontramos en los datos el caracter DLE, lo sustituimos por DLE DLE, duplicandolo.
DLE STX
÷
Inicio
DLE ETX
÷
Fin
DLE DLE
÷
DLE
DLE *
÷
Error
Inconveniente de esta tecnica es que esta muy ligada al codigo de caracteres.
3. Protocolos orientados a bit: Son protocolos para transmision sincrona, donde
transmitimos un continuo de bits. Dentro de ese Ilujo se indica el comienzo y
Iinal de la trama con una cadena especial de bits llamado INDICADOR.
01111110 ÷Indicador.
Donde encontremos ese patron, Iinalizara una trama y comenzara la siguiente.
Si en los datos aparece el patron, corregiremos el problema con relleno de bits
(bit stuIIing), consistente en que cada vez que tenemos en emision un 0 seguido
de 5 unos, insertamos un cero antes de seguir con el envio de datos.
En recepcion, si se recibe un 0 seguido de 5 unos, si a continuacion viene un 0,
se ignora (es de relleno); si viene un 1 y un 0 es un indicador (Iin / inicio de
trama), y si llegan 2 unos es un error. Algunos protocolos con este mecanismo
son: DIC (de la Iamilia de DLC (IBM), LAAPB), PPP.
4. Violacion de codigo: El principio y Iinal de trama se marca con codigos del
nivel Iisico no validos. Ejemplo:
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-57
Dos codigos no validos de
Manchester seran dos ceros
seguidos (00, llamado J en algunas
redes), y 11 (codigo K).
En general, en combinaciones
4B5B por ejemplo, , combinaciones de 4 bits se codiIican con 5, habria 16
violaciones de codigo.
Un ejemplo de uso lo encontramos en las redes TOKEN RING, FDD, etc... La
ventaja es que no tenemos que hacer stuIIing (relleno).
Muchas redes emplean la combinacion de los 4 metodos vistos anteriormente.
Por ejemplo: pueden usar protocolos orientados a caracter y una cuenta de
caracteres.
Esto se hace por redundancia.
6.3 Control de flujo
Consiste en que el transmisor no envia tramas mas rapido que lo que es capaz de
procesar el receptor.
La tarjeta de red realiza las Iunciones del
nivel Iisico y de enlace. Una vez procesada la trama
(control de errores, etc...) la trama pasa al buIIer y
la tarjeta lanza una interrupcion que atendera el
procesador (IRQ).
La rutina adecuada atrapara la interrupcion y
copiara la trama a la RAM para procesarla.
El buIIer suele ser pequeño (16 Kb, 32 Kb). Podra almacenar entre 10 y 30
tramas (como mucho). Cuando se llena el buIIer, tira las tramas. Y aqui es donde entra
el control de Ilujo.
Este control de Ilujo consiste en que el receptor tenga algun mecanismo de
retroalimentacion hacia el emisor para decirle que no transmita mas tramas. Su mision
es evitar que se llene el buIIer.
Los mecanismos para el control de Ilujo sonlos siguientes:
6.3.1 Paiada y espeia
Consiste en que el emisor, al transmitir una trama debe esperar una conIirmacion
del receptor antes de transmitir una segunda trama. Se manda la conIirmacion al sacar la
trama del buIIer (no al terminar de procesarla en la memoria). La conIirmacion se llama
ACK o asentimiento.
Suponiendo que no existen errores tenemos el caso 1.
Si hay una trama que no llega (error en la transmision), el receptor no manda el
ACK y el emisor se queda esperando eternamente.
Manchester 1B2B
|1 bit con 2 bits|)
0
1
0 1
1 0
DLE STX ETX DLE
N
N
PHY
MAC LLC
BuIIer
Tarjeta de red
Cable de red
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-58
El protocolo de parada y espera incorpora para solventar esto un temporizador.
Si tras un tiempo T
El tiempo T ha
de ser lo
suIicientemente grande
como para que le de a la
trama tiempo a llegar.
Lo mismo podria
ocurrir con el ACK, con
lo cual, el receptor, al
acabar el temporizador,
reenviaria el ACK.
La maquina
emisora manda la
trama, llega, pero el
emisor tarda en mandar
el ACK por que la
maquina receptora esta muy cargada y tarda en procesar
la interrupcion. El temporizador expira antes de llegar el
ACK, con lo cual se retransmite y llega un duplicado.
Puede ocurrir el caso contrario tambien, o sea, que
suceda lo mismo con el ACK.
Para distinguir que tramas llegan repetidas,
existe lo que se llama BIT ALTERNANTE. Es un bit en
la cabecera de la trama que vale 0 y 1 alternativamente
en cada envio de trama. Lo mismo para el ACK.
ACK
Trama
Trama
1
E R
ACK
T
Trama
E R
Error
Error
T
T
ACK
Parada y espera
- ACK
- TEMPORIZADOR
- BIT ALTERNANTE
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-59
El gran inconveniente de parada y espera es que se pasa mucho tiempo el emisor
y el receptor esperando el ACK, y muy poco tiempo enviando datos.
ACK
E R
T1
T
ACK
ACK1
Error
Trama
ACK
Trama
T0
T0
ACK0
ACK
Trama
Se pierde una trama
ACK
E R
T0
T
Trama duplicada,
se tira y se reenvia
el ACK
ACK0
Error
Trama
T0
ACK0
ACK
Trama
Se pierde un ACK
ACK0
E R
T0
T0
T
ACK1
ACK0
ACK0
T1
ACK1
ACK1
T1
Tarda mucho en contestar
con el ACK el receptor
T0
T0
ACK0
T0 duplicado
ACK0
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-60
6.3.1.1 Análisis de prestaciones
Salvo indicacion en contra, los tiempos de procesamiento T
PROC-TRAMA
y T
PROC-
ACK
se consideran despreciables. La trama de asentimiento (ACK) es muy pequeña
respecto a una trama, por lo que asumiremos tambien (salvo indicacion en contra)
despreciable su tiempo. La Iormula quedaria asi:
T
TRAMA
÷ T
TX
¹ 2 · T
PROP
DeIinicion:
Factor a de un enlace:
Lv
dR
R
L
v
d
T
T
a FACTOR
TX
prop
= = =
Con lo que: T
TRAMA
÷ T
TX
¹ T
PROP
La eIiciencia va medida por 'U¨, que es el tiempo que realmente se esta
transmitiendo. El resto del tiempo esperamos por el ACK.
Lo ideal seria una utilizacion U ÷ 1 (100 °). Sera mejor la
utilizacion cuanto mas pequeña sea a.
a sera pequeña si d·R es mjuy grande, parada y espera resulta
poco eIiciente.
v L
R d
a
·
·
=
La distancia entre las estaciones y el regimen binario, lo mas pequeño y la trama,
cuanto mas grande mejor (la v no podemos alterarla).
Se transmiten R bits por segundo, pero el usuario solo ve que transmite L bits
cada T
TRAMA
segundos (se puede esperando por ACK).
ef
TRAMA
C
seg T
bit L
=
) (
) (
Caudal eficaz: Regimen binario medio que consigue el usuario.
TPROC-TRAMA : Tiempo de
procesamiento antes
de enviar ACK
E R
TACK : Tiempo de transmision
del ACK
TPROP : Igual en redes simetricas
(suelen serlo)
TPROP : Tiempo de propagacion
TPROC-ACK : Tiempo de
procesamiento del
ACK (si lo tira, etc)
TTX : Tiempo de transmision
TTRAMA : Tiempo desde que envio
una trama hasta que
puedo enviar otra (sin
Cable: Distancia en metros
v(m/seg)
R(bits/seg)
Tramas de tamaño
L (bits)
L
T
TRAMA
÷ T
TX
¹ T
PROP
¹ T
PROP-TRAMA
¹ T
ACK
¹ T
PROP
¹ T
PROC-ACK
a T T
T
T
T
U
PROP TX
TX
TRAMA
TX
2 1
1
· 2 +
=
+
= =
a
U
2 1
1
+
=
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-61
Se demuestra que : U R C
ef
· =
6.4 Ventana deslizante
La idea es poder transmitir mas de una trama antes de recibir el asentimiento de
la primera. Para ello se necesita un buIIer o memoria de varias tramas tanto en el
receptor como en el emisor. En el emisor sirve para guardar las tramas aun no
conIirmadas por si se necesita retransmision. Esos buIIers se llaman ventana de
transmision y ventana de recepcion. En la primera se copian las tramas enviadas a la
espera de ACK. En la ventana de recepcion se guardan las tramas que se reciben
mientras no se pasen al nivel superior y se envie el ACK correspondiente.
El emisor y el receptor tienen que aconrdar un tamaño de ventana (conIigurado
por deIecto o negociado). Se llamara W. Solo se pueden enviar W tramas sin recibir
conIirmacion. Por ello, el receptor tendra mas de 2 tramas esperando a ser pasadas al
nivel superior.
El buIIer es circular, y se puede representar asi:
En el emisor, cada trama que se transmite se guarda en el buIIer. Cada trama se
transmite indicando en un campo un numero llamado secuencia de transmision,
indicando su posicion en el buIIer (N(s)).
Al transmitir una trama tras haber enviado W tramas, volvemos a comenzar con
el numero 1. Al llegar un ACK, el emisor cambia un puntero que tiene a la posicion de
la ultima trama de la que recibio su ACK. Tambien tiene un puntero a la ultima trama
enviada. La distancia entre estos punteros no puede ser mayor de W.
Ademas, el transmisor asocia un temporizador a las tramas, retransmitiendolas
en caso de que no se reciba el ACK en el tiempo establecido para la trama.
En el receptor, las tramas recibidas se van guardando en un buIIer. Hay un
puntero a las ultima trama asentida, y otro a la ultima trama recibida.
Si se conIirma una trama, se
conIirman todas las ateriores.
Podemos seguir recibiendo tramas
mientras la distancia entre los punteros sea
menor o igual que W.
Ejemplo:
Nº de bits ÷ 3, W ÷ 7.
1
2
3
6 7 8 1 2 3 4 5 6 7 8 1 2 3 4 ....... ....... W ÷ 8
....... .......
Ultimo ACK
recibido
Ultimo trama
enviada
W como mucho
6 7 8 1 2 3 4 5 6 7 8 1 2 3 4 ....... .......
Ultima trama
recibida
Ultimo trama
asentida
·÷ W
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-62
Existe otro tipo de asentimiento (RNR, Receiver Not Ready), para cuando el
receptor esta muy cargado. Para que el emisor no piense que se perdio y retransmita, se
envia esta señal. Asi dice que han llegado las tramas pero no ha liberado el buIIer. No
tiene eIectos desde el punto de vista de las ventanas.
Como suele haber traIico bidireccional, las tramas de datos (en la cabecera)
disponen de 2 campos: nº de secuencia de transmision y nº de secuencia de recepcion.
Para el caso: n ÷ 3; Ws2
n
-1s7.
Si W Iuese 8:
Podria parecer valido (no se repiten los numeros de
secuencia.
Si nos llega RR0 no sabemos si conIirmar que han
llegado todos o ninguno.
6.4.1.1 Análisis de prestaciones
Podemos transmitir 7 tramas sin recibir ACK
0 1 2 3 4 5 6 7 0 1 2 3 4 0 1 2 3 4 5 6 7 0 1 2 3 4
Podemos recibir 7 tramas sin asentir ninguna
0 1 2 3 4 5 6 7 0 1 2 3 4
Solo puedo enviar 4 mas sin haber recibido ACKs
I0
I2
I1
0 1 2 3 4 5 6 7 0 1 2 3 4
Recogidas pero no
pasadas al nivel superior
0 1 2 3 4 5 6 7 0 1 2 3 4 0 1 2 3 4 5 6 7 0 1 2 3 4
RR3
I3
I5
I4
I6
RR4
0 1 2 3 4 5 6 7 0 1 2 3 4
0 1 2 3 4 5 6 7 0 1 2 3 4
0 1 2 3 4 5 6 7 0 1 2 3 4
RNR7
RR7
N(S) N(R)
Cabecera
DATOS
I00
I10
I20
Nº de secuencia de trama
Nº de trama asentimiento
E R
I03
I13
I23
I33
Emitido el 2, asentido el 0
Emitido el 0, asentidos los
3 primeros
5 6 7 0 1 2 3 4 5 6 7 0 1
RR0 RR0
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-63
Tendremos envio continuo si antes de agotar la ventana recibimos algun ACK.
Si la ventana es pequeña, gastaremos la
ventana y tendremos que esperar algun
asentimiento para poder seguir
enviando.
¿Condicion del envio continuo?
a W 2 1+ < ÷Envio no continuo.
T
T W
U
TX
·
= ÷Uso de la red.
a
W
T T
T W
U
PROP TX
TX
2 1 · 2
·
+
=
+
=
a
W
U
2 1+
=
6.5 Control de errores
Se encarga de detectar cuando hay errores en los bits que Iorman una trama y
recuperarse de esos errores.
La recuperacion de errores se puede hacer de 2 Iormas: corrigiendolos o tirando
la trama y pidiendo retransmision. La primera Iorma se llama REC (Forward Error
Control), la segunda ARQ (Automatic Repeat Request).
TPROC-TRAMA
E R
TACK
TPROP
TPROP
TPROC-ACK
TTX
TTX
T
W
E R
W
Espera
Envio no
continuo
T T W
TX
> ·
PROP X TX
T T T W 2 · + >
a W 2 1+ >
Nos da el 100 ° la U ÷ 1
Recordando el valor de T ÷ T
TX
¹ T
PROP
¹ T
PROP-TRAMA
¹ T
ACK
¹ T
PROP
¹ T
PROC-ACK
T ~ T
TX
¹ 2 · T
PROP
despreciables
Recordamos que deIiniamos un Iactor a
TX
PROP
T
T
a =
1
1¹2a
U
W
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-64
6.5.1 Codigos de pioteccion fiente a eiioies
La idea es que en el emisor se recibiran del nivel superior (normalmente el nivel
de red) los datos a retransmitir. El nivel de enlace le añadira una cabecera donde, entre
otras cosas, metera el numero de secuencia de transmision y el de asentimiento, ademas
de las direcciones origen y destino si es una trama ETH, etc... Ademas de esa cabecera,
a toda la inIormacion le pasara una Iuncion que da como resultado su codigo de
proteccion contra errores, llamado E. En la cola del mensaje es donde va el codigo E,
que generalmente es una Iuncion de los datos.
En el receptor se calcula la Iuncion sobre la cabecera y los datos, obteniendose
E`. Entonces comparamos E` con E, y si son iguales, todo ha ido bien. Si son distintos,
algo ha Iallado, pidiendose la retransmision. Otros codigos incluso son capaces de
averiguar donde esta el error y corregirlo. Hay una probabilidad de que no se haya
detectado error y lo haya e incluso de que lo detecte y lo corrija mal.
Cuantos mas bits sea capaz de corregir, mas bits conseguira detectar.
A cada mensaje se le asigna una palabra codigo distinta. Ejemplo:
Dado un codigo, se deIine la
DISTANCIA de ese codigo (o distancia
Hamming) como el minimo numero de bits
en que se diIerencian 2 palabras codigo de
ese codigo (d). Viendo el codigo anterior, la
minima es d ÷ 3. Con lo que este codigo
tendra distancia Hamming de 3.
De la distancia de un codigo
dependen sus propiedades detectoras y correctoras de errores.
Si un codigo tiene una distancia d:
- Puede detectar, como maximo d-1 errores
- Puede corregir
2
) 1 ( ÷ d
errores
- Si queremos detectar y corregir a la vez (detectar x` y corregir y`), la distancia
tiene que cumplir que: d>x¹y¹1
Si queremos detectar 5 errores, necesitamos un codigo con d>6.
Si queremos corregir 5 errores, necesitamos un codigo con d>11.
Si queremos detectar errores de hasta 6 bits y corregir los de 3 bits o menos,
hace Ialta un codigo con d>10.
Cabecera Datos
I(Datos¹Cab)
Cabecera Datos E
Cabecera Datos E
Receptor
I(Datos¹Cab)÷E`
m
inIormacion o
mensaje
CodiIicador t
palabra codigo (tiene
mas bits que el
original)(la diIerencia
de bits se llama
redundancia)
00
10
11
01
00000
10110
11011
01101
d ÷ 3
d ÷ 4
d ÷ 3
d ÷ 3
d ÷ 4
d ÷ 3
redundancia
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-65
6.5.1.1 Protección de errores: tipos
ô.5.1.1.1 Paridad
Consiste en añadir un bit en los mensajes (bit de paridad). Cuando hay paridad
par, contando ese bit y el resto han de completar un numero par de 1`. Para la paridad
impar, es justo lo mismo, paro tiene que haber un numero impar de 1`.
ASCII 7bit ¹ 1 bit paridad
La mayor parte de los protocolos asincronos emplean paridad impar, y la
mayoria de los sincronos paridad par, y no por ningun motivo especial. La distancia d÷2
permite detectar 1 error (solo uno). No tiene potencia para corregirlo.
ô.5.1.1.2 Paridad bloque o multidimensional
Consiste en dividir el bloque de bits a enviar en trozos de 5, 6, 7 o m bits (da
igual). Calculamos el bit de paridad por cada uno de los bloques de m bits (por ejemplo,
paridad par):
Calculamos las paridades verticales
tambien. Transmitiremos el bloque enviando
bits de izquierda a derecha y de arriba abajo
(como se lee).
Los bloques no tienen por que ser
cuadrados.
¿Cual seria la distancia de este codigo?
Si cambiamos solo un bit, cambiamos 3
bits de paridad. O sea, que la distancia
es d ÷ 4.
Se detectan hasta 3 errores. Si
se producen mas, puede que se detecte
puede que no.
Se demuestra tambien que detecta hasta
4 errores si no cambian los 4 bits que Iorman un cuadrado.
Esto que hemos visto es paridad bidimensional. Hay mas
procedimientos para calcular la paridad tridimensional, n-dimensional,
etc...
No es Iacil corregir errores con este metodo.
ô.5.1.1.3 Código Hamming
Es un codigo de paridad con distancia d ÷ 3. Por cada m bits de mensaje, añade r
bits de redundancia, de Iorma que se cumpla que 2
r
>m¹r¹1. r sera el ninimo valor que
cumpla esto.
Los bits de paridad no se colocan al Iinal de cada mensaje, sino en posiciones
que son potencia de 2.
Cada bit del mensaje va a aparecer en la paridad de 2 o mas de esos r bits, los
cuales calculan la paridad de un subconjunto de m. No va a haber 2 bits de m que
aparezcan en los mismos r, en la paridad del mismo conjunto.
1011011
Paridad par, pondriamos 1
Paridad par, pondriamos 0
1011010
0010100
1001101
1100101
1001101
1110011
0001100
0
0
0
0
0
1
0
P
a
r
i
d
a
d

h
o
r
i
z
o
n
t
a
l
m ÷ 7
n ÷ m
10101001
Paridad vertical
PARIDAD CRUZADA: Aparece tanto
en la vertical como en la horizontal y
tiene que coincidir.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-66
No puede haber en 2 conjuntos la misma secuencia de bits. Si en 4 aparecen 5, 6
y 7, no puede haber otro conjunto con 5, 6 y 7, pues no sabriamos mas tarde que
conjunto ha Iallado.
Ej.
CodiIicar mediante Hamming el mensaje: 1011001
m ÷ 7 bits.
r minimo tal que 2
r
>m¹r¹1
Probamos con r ÷ 3-~ 2
3
>7¹3¹1 NO
r ÷ 4-~ 2
4
>7¹3¹1 SI
Por lo tanto, el mensaje tendra 11 bits (m¹r):
1 2 3 4 5 6 7 8 9 10 11
1 0 1 1 0 0 1
2
0
2
1
2
2
2
3
Las posiciones que no son potencia de 2 se ponen como suma de potencias de 2:
Ahora miramos en cuales de ellas aparecen las potencias de
2:
Con esto hemos conseguido
que los bits de mensaje aparezcan en
3 conjuntos diIerentes, etc...
Una vez que tenemos todo
esto, solo queda componer el
mensaje como se va a transmitir, para ello hay que insertar en las posiciones potencia de
2 los bits de paridad que acabamos de obtener:
Veamos ahora que sucede al recibir los datos:
Como es Hamming, los bits de
redundancia estan en las posiciones 2
x
. Se
ha recibido correctamente la cadena:
0100011.
Otro ejemplo de cadena recibida es:
Hamming solo corrige 1 error. Si
se emplea como corrector, solo detecta
1. Si solo se usa como detector, hasta 2.
3 ÷ 2 ¹ 1
5 ÷ 4 ¹ 1
6 ÷ 4 ¹ 2
7 ÷ 4 ¹ 2 ¹ 1
9 ÷ 8 ¹ 1
10 ÷ 8 ¹ 2
11 ÷ 8 ¹ 2 ¹ 1
1: 3,5,7,9,11÷1
2:3,6,7,10,11÷0
4:5,6,7÷0
8:9,10,11÷1
10100111001
0 0 1 1 0 0 0 0 1 1 0
1 7 4 3 5 6 2 11 8 9 10
8:9,10,11 OK 4:5,6,7 OK
2:3,6,7,10,11 OK
1:3,5,7,9,11 OK
0 1 0 0 0 1 0 0 1 1 1
1 7 4 3 5 6 2 11 8 9 10
8:9,10,11 OK 4:5,6,7 MAL
2:3,6,7,10,11 MAL
1:3,5,7,9,11 MAL
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-67
Si suponemos que ha habido un error, el culpable es el bit 7, pues aparece en el
grupo del 1, el 2 y el 4. O sea, que sumando los bits que Iallan (1, 2 y 4) nos da la
posicion erronea.
Otro ejemplo:
Los bits 5, 6 y 7 no pueden ser
erroneos (sino serian erroneos los grupos
en que aparecen). Por ello es el propio
bit de paridad el que Iallo.
Una Iorma de codiIicacion mas sencilla es la siguiente:
1011001
m ÷ 7; r ÷ 4
Cogemos las posiciones que tienen valor 1 (3, 6, 7 y 11) y las escribimos en
binario con tantos bits como salga (4 bits).
La suma se realiza sin acarreo.
Una vez realizada la suma, los bits obtenidos
se colocan en las posiciones que Ialtan en la cadena
anterior, comenzando por el bit mas a la derecha en
la posicion uno y continuando hacia la izquierda en
orden.
Resultando la cadena: 10100111001
¿Que se hace en el receptor?
Cogemos las
posiciones de los bits
que valen 1 y se ponen en
binario y se suman.
Si el resultado es 0, no hay error (la suma se hace sin acarreo).
Otro ejemplo:
01100010011
No es 0000, con lo que tenemos algun error, y el bit erroneo es el
que indica la suma en decimal (el 7).
1 0 0 0 0 1 1 0 1 0 0
1 7 4 3 5 6 2 11 8 9 10
8:9,10,11 OK 4:5,6,7 MAL
2:3,6,7,10,11 OK
1:3,5,7,9,11 OK
X 1 X 0 1 1 X 0 0 1 X
1 7 4 3 5 6 2 11 8 9 10
3 ÷ 0011
6 ÷ 0110
7 ÷ 0111
11 ÷ 1011
1001
Primer bit de paridad (1)
Segundo bit de paridad (2)
Tercer bit de paridad (4)
Cuarto bit de paridad (8)
0 0 1 1 0 0 0 0 1 1 0
1 7 4 3 5 6 2 11 8 9 10
4 ÷ 0100
5 ÷ 0101
10 ÷ 1010
11 ÷ 1011
0000
2 ÷ 0010
3 ÷ 0011
7 ÷ 0111
10 ÷ 1010
11 ÷ 1011
0111
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-68
Los codigos correctores se emplean cuando es muy diIicil, costoso, ineIiciente,
etc... pedir retransmisiones. Hacer un codigo corrector es muy complicado y precisa de
mucha redundancia, con lo que se preIiere codigos detectores (que pueden detectar
muchos Iallos con poca redundancia) y al detectar Iallo pedir retransmision.
Se suelen emplear en enlaces satelite, pues el retardo es muy grande y en redes
de un solo sentido (television digital).
ô.5.1.1.4 CRC
Codigos de redundancia ciclica o polinomicos.
Tendremos un mensaje M de m bits, al que se le añadiran r bits de redundancia
que Iorman el CRC o FCS (Frame Check Sequense). El total es una trama T
m r ÷ T
Estos codigos se basan en un patron de bits (r¹1) llamado P (polinomio
generador).
En emision, r ÷ m·2
r
° p (resto).
En recepcion no hay error si la trama (T) dividido por P da resto 0.
P:r¹1 bits
Se representan como un polinomio de grado r (de ahi su nombre):
P(X) ÷ X
7
¹ X
4
¹ X
3
¹1 ÷ 1·X
7
¹ 0·X
6
¹ 0·X
5
¹ 1·X
4
¹ 1·X
3
¹ 0·X
2
¹ 0·X
1
¹ 1·X
0
÷ 10011001
Ejemplo
Determinar el resultado de codiIicar este dato de 7 bits: 1001100 mediante CRC
y un polinomio generador P(X) ÷ X
3
¹ X
2
¹ 1
P÷1101 (r¹1) Si el grado de P es 3, r ÷ 3
P
M
r
2 ·
÷añadir r ceros al polinomio.
Se transmitira:
En recepcion, se divide lo recibido entre P y miramos el resto. Si el resto da 0
signiIica que no ha habido errores de transmision, En caso contrario, signiIica que ha
habido algun error en la transmision, pero no nos dice como podemos localizarlo.
Si se elige adecuadamente el polinomio, se pueden detectar muchos errores.
Todos los codigos CRC detectan todos los errores de 1 bit.
r m
1 0 0 1 1 0 0 0 0 0 1 1 0 1
1 1 0 1
1 0 0 1
1 1 0 1
1 0 0 0
1 1 0 1
1 0 1 0
1 1 0 1
1 1 1 0
1 1 0 1
0 1 1 0
1 1 0 1
0 0 1
0
El resto debe tener r bits
Division binaria OR exclusivo si empieza
por 1, el cociente empieza por 1 y 0 si
empieza por 0 (en este caso bajamos el
siguiente)
1001100001
m r
CRC
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-69
Si P(X) tiene al menos 3 unos, se detectan todos los errores de 2 bits. Si
P(X)/(X¹1) ¦1101/11} da resto 0, detecta cualquier nº impar de errores. Siempre detecta
todas las raIagas de hasta r errores consecutivos.
6.5.2 Tecnicas de coiieccion de eiioies
- ARQ: (Automatic Repeat Request): Si detectamos Iallo (por CRC, etc...) se
pide retransmision de esa trama.
- FEC(Forward Error Control)
ARQ esta muy ligado al control de Ilujo (recordemos parada-espera y ventana
deslizante).
Hay 3 variantes de ARQ:
- ARQ de parada y espera
- ARQ de rechazo simple
- ARQ de rechazo selectivo
6.5.2.1 ARQ
ô.5.2.1.1 ARQ de parada y espera
O ARQ simple. Se basa en el control de Ilujo de parada y espera, y tambien se
basa en ACK al recibir una trama correctamente. Tambien puede emplear un
temporizador, y si en el tiempo establecido no se recibe la
trama, se retransmite. Tambien se usa el bit alternante para
las tramas consecutivas.
¿Como se recupera el receptor de errores gracias a
estos 4 puntos?
Al recibir una trama 0, el ACK se envia con 1 (el
siguiente que se espera). Si la trama se pierde o llega erronea
(X), al acabar el tiempo del temporizador, se reenvia. Si el
asentimiento llega mal, al Iinalizar el temporizador se
reenvia.
En este ultimo caso, dado que el receptor ya tiene la
trama que el emisor acaba de enviar, simplemente la tira y
asiente su llegada con un nuevo ACK.
Ventajas: Es un metodo muy sencillo.
Inconvenientes: Sus prestaciones son pobres (hay que
esperar a los temporizadores si algo Ialla).
ô.5.2.1.2 ARQ de rechazo simple
O ARQ de rechazo continuo. Se basa en el control de Ilujo de ventana
deslizante. Tambien se le suele llamar 'ARQ de vuelta atras (n)¨. Se empleantambien
I0
ACK1
I1
E R
I1
T
i
m
e
r
ACK0
I0
ACK1
T
i
m
e
r
I0
ACK1
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-70
conIirmaciones (RR y RNR), aparte de las usuales, se emplea otro tipo de
conIirmaciones (conIirmacion negativa: Rechazo simple (REJ)).
Tambien, al igual que antes, se emplearan temporizadores. Se emplean numeros
de secuencia, y en ocasiones se emplea el llamado bit P (polling).
Cuando se pierde o el nº de secuencia no es el esperado, el receptor genera una
trama negativa, (REJ), que es un rechazo (reject). Este rechazo se llama simple, por que
indica al emisor que tiene que retransmitir esa trama y todas las posteriores: o sea, un
rechazo indica que se deben reenviar todas las tramas a partir de la trama rechazada.
N ÷ 3 ; 3 bits para indicar el nº de secuencia
W s 2
N
-1; W s 7 (supondremos W ÷ 2 para este
ejemplo).
(no puede enviar mas de 2 tramas sin naber recibido
conIirmacion).
El bit 'P¨ suele ir a 0, poniendose a 1 cuando
queremos obligar al otro extremo a mandarnos su
estado. No todos los protocolos admiten o emplean el
bit P; suele pedir la retransmision de todas las tramas
desde la que Iallo en adelante.
Si rechazamos la 1 (por cualquier Iallo) eso
implica asentir la 0 (suponiendo que el Iallo se produce
en la 2ª trama, llegando bien a la primera).
El receptor podria enviar y recibir ACK en vez
de esperar. Lo normal es esperar para asentir varias
tramas.
ô.5.2.1.3 ARQ de rechazo selectivo
O ARQ con rechazo continuo. Se basa en el control de Ilujo de ventana
deslizante. Es como el anterior, pero en vez de emplear una trama de rechazo REJ, se
emplea una trama de rechazo selectivo (SREJ). Cuando se rechaza una trama, solo se
rechaza esa trama, y solo hay que reenviar esa trama. Es mas eIiciente, pues solo hay
que retransmitir las tramas deIectuosas, pero a cambio obliga a mas complejidad en el
receptor.
Ventajas: Solo se retransmite la trama
rechazada.
Inconvenientes: Obliga en el receptor a
reordenar las tramas (y esto no es sencillo).
Aunque parece mejor que el rechazo simple,
se emplea menos, pues es un gran problema el
reordenamiento de tramas.
Con rechazo selectivo, si no se usa el bit 'P¨,
el tamaño de ventana tiene que ser mas pequeño (W ÷ 2
N-1
) para que no haya problemas
de ambigüedades.
I0
E R
T
i
m
e
r
Se tira
RR2
I1
I3
I2
REJ2
I3
I2
RR4
I4
I5
REJ4
I4
RR6
I5
I7
I6
RR0
P÷1
RR0
I0
I1
P÷1
RR0
I0
I1
T
i
m
e
r
Se tira
I0
E R
No se tira la
trama
RR2
I1
I3
I2
REJ2
I2
RR4
Se ha recibido bien
las tramas 2 y 3
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-71
Ej.
Si N ÷ 3 y W ÷ 7
Veamos que con N ÷ 3 y W ÷ 4 no hay ese problema:
ô.5.2.1.4 Prestaciones de ARQ
P-~ Probabilidad de error de bit, independientemente y uniIormemente
distribuida.
P
EB
-~ Probabilidad de error de trama Trama ÷ bloque de n bits.
P
EB
÷1-(1-P)
n
.
6.5.2.1.4.1 Arq de parada y espera
T~T
TX
¹2T
PROP
N
T
÷ nº medio de transmisiones que hay que
nacer de una trama hasta que llega sin errores.
T ÷ N
T
(T
TX
¹2T
PROP
)
Nº de transmisiones Prob
1 1-P
EB
2 P
EB
(1- P
EB
)
3 P
EB
·P
EB
(1- P
EB
)÷ P
EB
2
(1- P
EB
)
..... ..
i P
EB
(i-1)
(1- P
EB
)
Suponemos que no hay error en los asentimientos.
I0
E R
RR7
I1
I3
I2
I4
REJ7
I5
I6
I0
I1
I2
4 5 6 7 0 1 2 3 4 5 6 7 0 0 1 2 3 1
Para evitar esto, Ws 2
N-1
I0
E R
RR4
I1
I3
I2
I0
I1
I2
4 5 6 7 0 1 2 3 4 5 6 7 0 0 1 2 3 1
No se conIunde con tramas Iuturas
Timer
I3
E R
TTX TPROP
T
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-72
N
T
÷1(1- P
EB
)¹2(P
EB
(1- P
EB
))¹3(P
EB
2
(1- P
EB
))¹..
6.5.2.1.4.2 ARQ con rechazo simple y selectivo
Tambien se cumple que
T
ideal
errores
N
U
U = ÷U de la ventana deslizante (ver antes)
- N
T
en rechazo selectivo es igual que parada y espera:
EB
T
P
N
÷
=
1
1
- N
T
en rechazo simple vale:
EB
EB
T
P
P a
N
÷
+
=
1
· 2 1
6.5.2.2 FEC (Forward Error Control)
Codigo de control de errores con propiedades correctoras sin pedir
retransmision. Se emplean cuando pedir una retransmision es muy costoso (o
imposible): emisiones de television o radio digital, cuando hay un retardo muy grande
(transmisiones via satelite), envio de audio/video en tiempo real.
Un ejemplo es el codigo Hamming. Son bastante complejos.
Presentan una serie de inconvenientes:
- Se necesita mucha redundancia, para obtener cierta Iiabilidad es preciso enviar
muchos bits de codigo.
- Son algoritmos muy complejos, siendo su implementacion muy costosa, tanto en
el emisor como en el receptor.
- Estan orientados a ciertos errores: algunos Iuncionan mejor para errores
consecutivos, otros para errores dispersos, etc...
Tambien presentan una serie de ventajas Irente a ARQ:
- No se necesita un canal de retorno (de receptor a emisor).
- El caudal eIicaz y el retardo son constantes: en ARQ,
desde que mandas un paquete hasta que recibes otro es
variable (te lo pueden rechazar, pedirte retransmision). En
FEC no es asi.
¿ ¿ ¿
·
=
·
=
÷
·
=
÷ ÷
÷
= = ÷ = ÷ =
1
2
1
1
1
1 1
) 1 (
1
· · ) 1 ( ) 1 ( ·
i i
i
i
i
EB EB EB
i
EB T
X
X i P i P P P i N
2
) 1 (
1
EB
T
P
N
÷
=
) 2 (
PROP TX T
TX TX
T T N
T
T
T
U
+
= =
Utilizacion del caso ideal
(sin errores)
2
) 1 ( 2 1
1
X
T
a siendo
a
PROP
÷
=
+
=
a
P
N
ideal U
U
EB
T
2 1
1
+
÷
= =
a
P
U
EB
2 1
1
+
÷
=
E R
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-73
6.5.2.3 Técnicas mixtas
ô.5.2.3.1 FEC + FEC
Emplean 2 FEC, uno para solventar errores dispersos y el otro para errores
seguidos.
ô.5.2.3.2 ARQ + FEC
Emplean un codigo en principio corrector, pero si en X tramas consecutivas el
algoritmo tiene que corregir errores, asume que enesas condiciones hay mucho ruido y
se pone en Iuncionamiento en modo detector. Si recibe X tramas correctas
consecutivamente, asume que la situacion de ruido ha Iinalizado y vuelve al modo
corrector.
6.6 Protocolos de nivel de enlace
Ejemplos de protocolos de nivel de enlace son SLIP, PPP y HDLC.
6.6.1 SLIP (Seiial Link IP)
Pensado para mandar por una linea serie, punto a punto, entre 2 ordenadores
paquetes IP.
SLIP, de todas las Iunciones del nivel de enlace, solo hace la de entramado
(donde acaba un paquete IP y comienza el siguiente). Es un protocolo orientado a
caracter (byte).
Si el separador aparece dentro del paquete, se sustituye por otro patron.
No tiene control de Ilujo, se un ordenador es mas rapido enviando, el otro no
podra procesar los datos y los paquetes se perderan. Se conIia en que un nivel superior
lo detecta y pode la retransmision.
Tampoco hay control de errores, se deja para niveles superiores. Tampoco se
hace nada sobre la gestion de enlace.
6.6.2 PPP (Point to Point Piotocol)
Pensado para comunicaciones punto a punto entre 2 maquinas. No es un
protocolo ligado al nivel de red (se puede emplear IP o cualquier otro, es independiente
del nivel de red).
Es un protocolo orientado a bit, pues el delimitador de comienzo y Iin es:
01111110 DATOS FCS 01111110
FCS son 16 bits de correccion de errores.
Si se repite el patron en los datos, se hace bit stuIIing. Los datos tienen que ser
un numero entero de bytes (numero de bits multiplo de 8). Tiene deteccion de errores y
puede pedir retransmision. Lo mas importante es que incluye gestion del enlace.
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-74
Cuando 2 maquinas comienzan a comunicarse con PPP, emplean el protocolo LCP
(Link Central Protocol), consistente en un intercambio de mensajes para ponerse de
acuerdo en el protocolo del nivel de red a emplear (tipo de datos a transportar), que tipo
de control de Ilujo van a hacer, si los datos se van a comprimir o no, etc... Al acabar la
negociacion, se pasa a otra Iase, llamada NCP (Network Control Protocol), que depende
del protocolo de nivel de red escogido anteriormente, se encarga de que el usuario
mande un login y un password, ademas de asignarnos una direccion IP.
6.6.3 HDLC (High level Data Link Contiol)
Bastante antiguo, pero muy importante, pues de el se han derivado muchos
protocolos, mas que derivarse, es que HDLC tiene muchas variante u opciones de
Iuncionamiento. Hay muchos protocolos que en el nivel de enlace emplean HDLC con
ciertas opciones.
En RDSI (ISDN) se emplean 2 protocolos de nivel de enlace, LAP-B y LAP-D,
que son particularizaciones de HDLC.
En los Frame-Relay, se emplea LAP-F, y en los LAN es LLC.
Es un protocolo orientado a bit, y su Iormato de trama es:
8 8 a 16 16 8
01111110 CONTROL DATOS CRC 0111110
El control lleva:
- Tipo de trama: Datos, si es un RR, RNR, REJ, SREJ,...
- Nº de secuencia (de trama y de asentimiento)
- Bit P
HDLC tambien tiene gestion del enlace: al principio se negocia en que nodo
Iuncionara el enlace (ARQ de parada y espera, rechazo simple, etc...).
6.7 Problemas
Realice un estudio compartido del canal eIicazpor las tecnicas ARQ de parada y espera,
rechazo simple y rechazo selectivo, considerando los siguientes datos:
- Nº de bits de inIormacion en trama de datos: 1000 bits.
- Nº de bits de control en tramas de datos: 48 bits.
- Nº de bits en tramas ACK: 48 bits.
- Velocidad de transmision: 1200 bits/seg.
- Probabilidad de error de bit: 5·10
-6
.
- Retardo de propagacion: 100 ms.
ARQ con parada y espera:
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-75
Suponemos que los errores se producen en la trama
seg
seg
bits
bits L
T
TX
TX
8773 . 0
1300
1048
R binario Regimen
trama de Longitud
= =
÷
÷
=
. 1 . 0 100 enunciado el en dado seg ms T
PROP
= = =
seg bit
bit
R
L
T
ACK
ACK
/ 1200
48
binario Regimen
ACK bits longitud
= =
÷
÷
÷~Flujo mas pequeño de transmision, so no
lo despreciamos tendriamos que contar los errores producidos en el envio de ACK. No
lo consideramos: T
ACK
~0
1145 . 0
8733 . 0
1 . 0
= = =
TX
PROP
T
T
a
0052 . 0 ) 1 ( 1 = ÷ ÷ =
TX
L
eb
P P
Probabilidad de error de bloque.
ARQ con parada y espera
809 . 0
2 1
1
=
+
÷
=
a
P
U
eb
Utilizacion del 80° de los 1200 bits empleados. El otro 20° se
pierde en retransmisiones o esperas de ACK.
El regimen binario o caudal eficaz (CeI) es:: 1200·80.9° ÷ 971 bits/seg.
Se emplearian estas Iormulas si no existe envio
continuo.
Envio continuo, si al llegar el ACK de la primera trama, la ventana no se ha
agotado y no nos hemos tenido que parar.
°) 3 . 99 ( 993 . 0
2 1
1
=
+
÷
=
eb
eb
aP
P
U
seg bits Cef / 1192 =
En el ARQ de rechazo selectivo (solo se reenvia la trama erronea):
9948 . 0 1 = ÷ =
eb
P U
seg bits Cef / 76 . 1193 =
TPROP
TTX
TPROC
TACK
TPROP
T
errores Sin
T
T
T
T
U
ACK
PROC
TX
¦
¦
)
¦
¦
`
¹
~
~
=
0
0
1
2
3
4
ACK1
E R
1 2
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 6-76
La utilizacion de ARQ de parada y espera es muy grande, por que vimos que si
la duracion de la trama es mucho mas grande que el retardo es menos malo.
Con los otros dos mecanismos, se obtienen mejores resultados que con parada y
espera, siendo mucho mas complejos.
¿Por que no hay mucha diIerencia entre rechazo simple y selectivo? Por que el
tamaño de trama es muy grande y el error de bit es muy pequeño.
Si hubiesemos escogido la 2ª aproximacion, la Iormula de a seria:
PROP
ACK TX
T
T T
a
+
=
PROBLEMA
Supongamos 2 estaciones terrestres que se comunican via satelite. La capacidad del
canal del satelite es de 64 Kbits/seg., pero se divide en 2 canales de 32 Kbits/seg (uno
para cada sentido). Se decide utilizar control de Ilujo por ventana deslizante con
'piggybacking¨ (aprovechar el asentimiento para enviar inIormacion adicional por el
otro canal se envia la tarma y el asentimiento de la ultima recibida).
Suponemos que amas testaciones siempre tienentramas que enviar. El tiempo de
propagacion entre tierra y satelite es 135 ms. Y que la longitud de la trama n es de 17
bytes.
Se pide calcular los siguiente parametros:
a) T
TX
:
ms
seg bits
bits
R
L
T
TX
25 . 4
/ 32000
8 · 17
= = =
b) Tiempo desde la transmision del 1
er
bit de una trama hasta la recepcion del ultimo:
T ÷ T
TX
¹ T
PROP
÷ 4.25 ¹ 2*135 ÷ 274.25 ms
c) Tiempo de la transmision desde el 1
er
bit de una trama hasta el ultimo bit de la trama
de asentimiento:
T ÷ 2 T
TX
÷ 548.5 ms
d) tamaño de ventana optimo
W·T
TX
> 548.3 ms
W > 129.2
W ~ 130 ÷ necesitamos 8 bits por el numero de
secuencia. Podemos enviar 130 tramas numeradas con
codiIicacion binaria de 8 bits.
TTX
TPROP TT
TTX
TPROP TT
TTX
TPROP
17 bytes (por el piggybacking
manda tambien inIormacion)
1
2
TT
3
n
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-77
7 Nivel de enlace: Medio compartido
En medios compartidos, hay que regular que no todos transmitan a la vez.
Meremos que medios hay para regular el acceso al medio compartido.
7.1 Multiplexación
Consiste en dividir el uso del medio de transmision de Iorma estatica entre los
usuarios.
Esa division se puede hacer de varias Iormas:
- Multiplexacion por division en el tiempo: TDM o TDMA
- Multiplexacion por division en Irecuencia: FDM o FDMA
- Multiplexacion por division en longitud de onda: WDM o WDMA
- Multiplexacion por division de codigo: CDM o CDMA
7.1.1 TDM
En ese medio compartido se va a asignar a cada estacion unintervalo de tiempo
para transmitir, de tal Iorma que se van pasando el turno sucesivamente.
Por el medio circula una trama periodica que comienza en un instante t y va una
sucesion de bits enviados por cada estacion.
A veces hay una cabecera que es la que comienza a generar la trama. Si no
existe, todas las estaciones tienen que tener un reloj comun. Aun asi, con cabecera,
todas las estaciones escuchan la trama para sincronizarse.
Al Iinal, en el medio, en un instante x, solo puede transmitir uno, y si puede
enviar mas de x bits tiene que esperar a que le llegue de nuevo el turno.
Si se transmiten R bits/seg por el medio, cada estacion puede enviar R/N
bits/seg. (algo menos, por que tambien hay cabeceras).
Se emplean desde hace mucho en la red teleIonica.
- Europa: voz a 64 Kbits/seg.
- USA: voz a 54 Kbits/seg.
En europa hay un sistema TDM (el E1, de 2,048 Mbits/seg) que consiste en una
trama de 32 canales de 8 bits.
1 2 3 ........ 32
8 bits
Un solo cable para todas
las comunicaciones
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-78
Se repite cada 125 µseg. Se repiten 32 canales a 64 Kbits/seg, dando lugar a los
2 Mbits/seg.
7.1.2 IDM
Este divide el ancho de banda del medio de transmision.
Se asigna una porcion a cada estacion. A la estacion 3
por ejemplo, la obligamos a modular su señal para que su
transmision se encuentre justo entre la banda de Irecuencias
que se le ha asignado.
El regimen binario es W ÷ 2Wlog
2
M
El regimen binario que puede obtener esa estacion es R/N (puesto que W/N).
Con FDM transmiten todos a la vez, pero por bandas de Irecuencia distintas, y a menor
velocidad (R/N bits/seg).
En FDM, dada estacion transmite a velocidad R, pero solo durante un pequeño
tiempo. En media transmite a R/N, pero puntualmente a R.
Se usa menos en redes digitales, aunque se usa en redes de teleIonia (es previo a
TDM y se una menos que este).
7.1.3 WDM
Es lo mismo que FDM, solo que es cuando hablemos de Irecuencias muy altas
(en el espectro de la luz). La idea es la misma. Se utiliza en Iibra optica, mandando por
esta pulsos de luz de diIerente Irecuencia (o longitud de onda), o sea, como mandar luz
de diIerentes colores.
7.1.4 CDM
Son tecnicas de espectro ensanchado pensadas para entornos con mucho ruido.
Por su complejidad no los veremos. En teleIonia movil se emplean CDM con FDM.
Ventajas de la multiplexacion: Son metodos sencillos, y cada usuario tiene un
rango o gama por emitir por el, teniendo cada usuario su porcion de ancho de banda.
Inconvenientes: Es poca Ilexible, pues a cada usuario se le asigna
permanentemente su porcion independientemente de si transmite o no. Para
asignaciones dinamicas hay otros mecanismos.
7.2 Protocolo ALOHA
7.2.1 ALOHA puio
Este sistema se dice que es un sistema de contienda porque los usuarios no
tienen asignada una porcion, sino que tienen que competir por el uso de esa red.
W
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-79
Fue desarrollado en los 500 en la universidad de Hawai y consiste en: se suele
emplear en redes para radio o satelite. En teleIonia movil, el movil envia una peticion de
llamada por el metodo ALOHA, compitiendo con el resto de moviles.
Cuando una estacion quiere transmitir, transmite. Puede ocurrir que otra estacion
transmita a la vez, produciendose una colision.
Por cuestiones de retardo, las estaciones no escuchan el medio a ver si esta
ocupado.
Lo que si hace despues de haber transmitido es escuchar, y si escucha una
colision, reintente el envio. El reintento se produce tras un tiempo aleatorio. Espera
escuchando el tiempo maximo de retardo de la red para asegurarse que su envio no
produjo colision.
Este tipo de redes esta bien para poco traIico, porque si no habria muchas
colisiones, provocando retransmisiones y mas colisiones.
7.3 Cálculo de prestaciones
Supondremos que las tramas transmitidas son de tamaño Iijo (L bits). El regimen
binario es R bits/seg.
Lo que se tarda en transmitir una trama (tiempo de trama t):
Tambien se supuso que la poblacion era muy grande (tiende a inIinito).
S sera el numero medio de tramas nuevas que esa poblacion quiere transmitir por
el tiempo de trama
S tambien se llama trafico nuevo ofrecido. El numero de tramas total:
Se llama tambien trafico total ofrecido.
¿Cuantas tramas se enviaran sin colision?
TraIico cursado ÷ S porque se retransmitira la trama tantas veces como haga
Ialta.
P
0
÷ Probabilidad de que una trama no colisiones ÷
0
·P G S
G
S
= =>
Nadie debe emitir durante el intervalo de duracion 2t.
R
L
t =
trama tiempo
nuevas tramas N
S
º
=
trama de tiempo
iones retransmis nuevas
G
+
=
t
0
-t t
0
¹t t
0
L
L
L
L
L
S
max
÷ 1/2e÷0.18
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-80
Supondremos que las tramas seran generadas por las estaciones de Iorma aleatoria
siguiendo una distribucion de poison: > @
! k
e N
k P
N k ÷
=
W
(con k retransmisiones), donde N
es el nº medio de transmisiones en el intervalo t (en tiempo).
En caso de que no queramos colisionar t ÷ 2t, N ÷ 2G y k ÷ 0.
P
0
÷ e
-2G
S ÷ G·e
-2G
La representacion graIica es la siguiente:
Estos valores maximos nos dicen que podemos
enviar como traIico nuevo el 18°. Si es una red
de 100 Kbits/seg, con aloha podremos transmitir
18 Kbits/seg.
El traIico total nuevo sera del 50°, y la
diIerencia entre 18° y 50° seran
retransmisiones.
Calculamos el numero medio de intentos hasta transmitir con exito una trama.
Antes de eso tenemos que ver la posibilidad de que transmitamos en k intentos.
Prob k intentos ÷ (1-P
0
)
k-1
· P
0
÷ (1-e
-2G
)
k
· e
-2G
(1-P
0
) si hay colision; P
0
no colision.
Nº medio de transmisiones:
¿
·
=
÷
= = + + + =
1
2
k 3 2 1
P · ... ·P 3 ·P 2 1·P E
K
G
e k
P
1
: Probabilidad de enviarla a la primera; P
2
: probabilidad de enviarla a la segunda...
7.3.1 ALOHA ianuiado
Todas las estaciones comparten un reloj, no transmitiendo cuando quieran, sino
que cuando se quiere transmitir hay que esperarse al siguiente instante de tiempo
multiplo del tiempo de transmision de trama.
R
L
t
seg bit R
bit L
=
)
`
¹
/
La ventaja es que se
reducen las colisiones.
G
e E
2
=
0 t 2t 3t t 2t 3t
..................
L
Espero hasta 2t
G
max
÷ 0.5
G
S
S
max
÷ 1/2e÷0.18
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-81
Solo colisionan con nosotros las tramas que llegan
entre t
0
-t y t
0
, siendo un periodo t (no 2t como en
ALOHA puro).
¿Como aIecta esto a las prestaciones?
t ÷ t
N ÷ G (no 2t como antes).
Sustituyendo en poisson:
P
0
÷ e
-G
÷~ S ÷ G·e
-G
E ÷ e
G
E es el numero medio de intentos.
GraIicamente:
Con ALOHA ranurado podemos
llegar hasta el 36° en una red de 100
Kbits/s, podemos enviar hasta tramas
nuevas a 36 Kbits/s, siendo el resto
retransmisiones.
7.4 CSMA
Carrier Sense Multiple Access (Acceso multiple con deteccion de portadora).
Es una variante de ALOHA para redes con un retardo de propagacion bajo. En
ALOHA se toleran grandes distancias, y se transmite cuando se quiere (no se escucha).
Los envios pueden tardar en llegar.
Si la red es mas pequeña, la transmision tarda menos en llegar al receptor. Al ser
el retardo menor, se pueden evitar colisiones si antes de emitir escucha a ver si alguien
esta transmitiendo se espera hasta que el medio quedalibre.
Hay diIerentes variante de CSMA:
7.4.1 CSMA 1-peisistente
Consiste en que, si al escuchar el medio esta ocupado, se espera a que quede
libre para transmitir. Si colisiona, se reintenta un tiempo aleatorio, por que si no
colisionaria siempre.
7.4.2 CSMA no peisistente
t0-2t t0-t t0 t0¹t t0-2t
Espera
colision
Espera
Espera
G
max
÷ 0.5
G
S
S
max
÷ 1/e÷0.36
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-82
Si el medio esta ocupado se espera un tiempo aleatorio antes de volver a intentar
el envio.
7.4.3 CSMA p-peisistente
P esta entre 0 y 1 (es una probabilidad). Se escucha el medio, y si esta ocupado,
con probabilidad p permanezco a la escucha hasta que este libre y envio, y con
probabilidad 1-p espera un tiempo aleatorio y reintento el envio.
Intuitivamente, CSMA 1-persistente consigue transmitir antes, pero es mayor la
probabilidad de colision. No es recomendable con traIico alto: da lugar a muchas
colisiones.
En el CSMA no persistente el retardo es mayor, pues si esta ocupado no
transmito cuando queda libre, sino cuando pueda y tras un periodo aleatorio de tiempo.
Tiene menos colisiones.
7.5 CSMA/CD
Carrier Sense Multiple Access / Collision Detection (Acceso multiple con
deteccion de portadora /deteccion de colision).
Mejora de CSMA para cuando el retardo es menor aun.
Si las distancias son muy pequeñas, solo podra haber colisiones en la primera
parte de la trama.
T
P
es el tiempo de propagacion.
Se produce colision si en un instante antes de t la otra estacion transmite.
La colision procede de la suma de 2 señales electicas, por lo que hasta que no
pasa un tiempo 2t no se detectara la colision.
Despues de t ÷ T
P
no puede haber colision, pues la estacion destino ya ha
recibido la transmision.
Se suele emplear en ethernet:
R ÷ 10 Mbits/seg
El retardo es de 51.2 µs
El peor caso de colision se produce tras 51.2 µs. Como transmito 10 bits/µs (ver
R) desde que empiezo a transmitir hasta que recibo la colision he transmitido 512 bits
(64 bytes). El tamaño naximo de trama ethernet es 1518 bytes. Despues de haber
T
P
t ÷ 2T
P
t ÷ 0
t ÷ T
P
- c
t ÷ T
P
¹ c
2.5 Km
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-83
enviado 64 bytes es imposible que haya colision ya. Con ello concluimos que las
colisiones se producen en los primeros 64 bytes.
Si colisiono tras enviar 64 bytes, es tonteria seguir transmitiendo, asi que se
aborta la transmision.
En las redes CSMA/CD se impone un tamaño mínimo de trama, que el el
caso de ethernet es de 64 Kbytes igual a los bytes que se pueden propagar hasta que
recibo la colision en el peor caso. Esta imposicion es para saber al transmitir si la trama
llego con exito.
El inconveniente es que ese tamaño minimo esta relacionado con el retardo, el
regimen binario, etc...
Si se quisiera diseñar una eternet con R ÷100 Mbits/s con los mismos 2.5 Km de
cable, el tamaño minimo pasa a ser 650 bytes. En la p´ractica se han concervado el
tamaño minimo de 64 bytes, por lo que la red, para que tenga un retardo de 5.12 µs en
vez de 51.2 µs se corta el cable a 250 m.
Para conseguir 1 Gbit/seg como maximo, el cable medira 25 m.
NOTA:
Tanto ALOHA puro, como el ranurado y todos los CSMA son tecnicas de
contienda porque hay colision entre estaciones. Hay otras tecnicas sin colision, como
puede ser el 'paso de testigo¨.
7.6 Paso de testigo
Una estacion, para transmitir, tiene que haber recibido una trama especial
llamada 'Testigo¨. Esa trama la tiene inicialmente una estacion, y lo que hace es
transmitirla a la siguiente. Todas las estaciones saben cual es la siguiente.
Para transmitir hay que esperar a tener el testigo. Al recibir el testigo se puede
transmitir. Al acabar, pasa el testigo a la estacion siguiente.
Una estacion no puede tener el testigo diempre: puede transmitir durante un
tiempo maximo. Si tras ese tiempo quere seguir transmitiendo, tiene que esperar y soltar
el testigo.
Otro problema puede llegar si la estacion del testigo se cae. Debe haber una
estacion de mantenimiento que vigile el testigo y si hace Ialta ponga otro en circulacion.
7.7 LAN
Las principales son:
7.7.1 Etheinet (IEEE 8O2.3)
Tecnologia en bus con CSMA/CD.
Testigo
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-84
Hay variantes a 10 Mb/s, 100 Mb/s, 1 Gb/s. Hay sobre coaxial de diIerentes
tipos, Iibra optica, par trenzado, etc...
Variantes:
- 10 BASE 2 y 10 BASE 5: coaxial a 10 Mbit/s (base 2 coaxial de baja calidad,
base 5 alta calidad). El 2 y el 5 (*100, o sea 200m y 500m) dan el nº de metros
que puede medir el cable. Se pueden alargar con repetidores siempre y cuando
no se superen los 205 Km (51.2 µs).
- 10 BASE T: 10Mbit/s con un cable de tipo T (par trenzado). Puede medir hasta
100m sin repetidores.
- 10 BASE F: Fibra optica (hasta 2 Km).
- 100 BASE T
- 100 BASE F
- Gigabit Ethernet : 1 Gbit/s.
7.7.2 Token Ring (IEEE 8O2.5)
Topologia en anillo, emplea el paso de testigo. Hay 4 y a 16Mbit/seg. Emplea
par trenzado y Iibra optica.
7.7.3 IDDI
En anillo con paso de testigo. Es de 100 Mbit/s. De Iibra optica.
7.7.4 Token Bus (IEEE 8O2.4)
Tecnologia de bus con paso de testigo. Se emplea en redes internas para
comunicar robots en cadenas de montaje.
7.8 PROBLEMAS
PROBLEMA 1
Un grupo de N estaciones comparten un canal ALOHA puro de R ÷ 64 Kbits/s. Cada
estacion manda como media una trama de L ÷ 1000 bits cada 100 segundos, incluso si
la anterior no ha sido enviada.
¿Cual es el nº maximo de estaciones Iuncionando?
Solución:
S
MAX
÷1/2e ÷ 0.18
¿Cuanto es el tiempo de trama?
T
TRAMA
÷ L/R ÷ 1000 bit / 64000 bits ÷ 1/64 seg.
0.18
1
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-85
¿Cuantas tramas nuevas/tiempo trama genera cada estacion?
T
TRAMA
/T
TRAMA ESTACION
÷
TRAMA
ESTACION TRAMA
NUEJAS
T
TRAMAS
trama
seg
seg
trama
T
T
6400
1
64
1
·
100
1
= = (Cada estacion genera esto)
¿Cuantas tramas nuevas se generan en total?
18 . 0
6400
1
· a igualamos
T
TRAMAS
N S
TRAMA
MAX
=
estaciones N N
MAX MAX
1177 18 . 0
6400
1
· = => =
PROBLEMA 2
Una gran poblacion de usuarios de ALOHA ranurado genera 50 peticiones por segundo
(50 tramas/seg) incluyendo tramas nuevas y retransmisiones. El tamaño de la ranura del
ALOHA es de 40 ms.
¿Cual es la probabilidad de exito en el primer intento?
S ÷ G·e
-G
En Aloha ranurado transmitimos en t, con lo cual el tiempo
de trama es 40 ms.
t ÷ 40 ms ÷ 40 · 10
-3
seg/trama
G ÷ 50 tramas/seg· 40·10
-3
seg/trama ÷ 2 Tramas/T
TRAMA
P
0
(prob. de envio sin colisiones) ÷ e
-G
÷ 0.135 (solo el
13.5° de las tramas van a la 1ª).
¿Cual es el numero medio de intentos de transmitir necesarios?
E ÷ e
G
÷ 7.38 intentos
PROBLEMA 3
Las medidas hechas en un canal Aloha ranurado con un numero inIinito de usuarios
muestran que solo el 10° de las ranuras estan vacias.
¿Cual es el traIico o carga total G en esta red?
Ranura vacia es en la que nadie
transmite.
0.36
1 G
S
0.36
1 G
S
2
zona mala, muchas colisiones
0 t 2t 3t 4t 5t 6t 7t .. .. .. nt
vacia
Sistemas de Comunicacion de Datos
Luis B. Ramirez del Pino 7-86
> @ ) (
!
·
bisson
k
e G
k P
G k ÷
=
P|0| ÷ P
0
÷ e
-G
(probabilidad de que no transmite nadie)
P
0
÷ 0.1
e
-G
÷ 0.1 ÷~ G ÷ 2.3
¿Cuanto es el traIico cursado (S) de la red?
S ÷ G·e
-G
÷ 0.23
¿En que condiciones esta este ALOHA: sobrecargado o inIrautilizado?
Esta saturado.
0.36
1 G
S
2.3
inIrautilizado
0.23
saturado

  15=, 15=,QYHUWLGR

  0DQFKHVWHU  0DQFKHVWHUGLIHUHQFLDO   3VHXGRWHUQDULR   $0, $OWHUQDWH0DUN,QYHUVLRQ

  %=6 %LSRODUZLWK=HURV6XEVWLWXWLRQ.

).Ï1  75$160.6.Ï1'( '$726  /XLV%5DPtUH]GHO3LQR  .Ï1'('$726   &2'.  .1752'8&&.&$&.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV   +'% ³+LJK'HQVLW\%LSRODU=HURV´.

7$/(6$6(f$/($1$/Ï*.H\LQJ.&$   'HVSOD]DPLHQWRHQDPSOLWXG $6.   )RUPDGHRQGDGHHVWDVFRGLILFDFLRQHV   '$726'.*.$PSOLWXG6KLIW.

  'HVSOD]DPLHQWRHQIUHFXHQFLD )6.

  'HVSOD]DPLHQWRHQIDVH 36.

1752'8&&.  '$726$1$/Ï*.&26$6(f$/$1$/Ï*.Ï1   (175$0$'2   &21752/'()/8-2   3DUDGD\HVSHUD   $QiOLVLVGHSUHVWDFLRQHV  9(17$1$'(6/.*.&26$6(f$/(6'.=$17(   $QiOLVLVGHSUHVWDFLRQHV  &21752/'((5525(6   &yGLJRVGHSURWHFFLyQIUHQWHDHUURUHV   3URWHFFLyQGHHUURUHVWLSRV  3DULGDG   3DULGDGEORTXHRPXOWLGLPHQVLRQDO   &yGLJR+DPPLQJ  &5&   7pFQLFDVGHFRUUHFFLyQGHHUURUHV  $54   $54GHSDUDGD\HVSHUD   $54GHUHFKD]RVLPSOH  $54GHUHFKD]RVHOHFWLYR  3UHVWDFLRQHVGH$54   $UTGHSDUDGD\HVSHUD  $54FRQUHFKD]RVLPSOH\VHOHFWLYR  )(& )RUZDUG(UURU&RQWURO.&$    &21&(3726   7UDQVPLVLyQVtQFURQD\DVtQFURQD  7UDQVPLVLyQDVtQFURQD  7UDQVPLVLyQVtQFURQD  .7$/(6   0RGXODFLyQSRULPSXOVRVFRGLILFDGRV   '$726$1$/Ï*.17(5)$&(6   56  02'(0GHGLVWDQFLDOLPLWDGD  02'(0GHODUHGWHOHIyQLFD  02'(01XOR  .

3.9(/'((1/$&(   6/.3 6HULDO/LQN.  7pFQLFDVPL[WDV  )(&)(&  $54)(&   35272&2/26'(1.

  333 3RLQWWR3RLQW3URWRFRO.

17(5)$&(6'(&$3$)Ë6.9(/'((1/$&( /XLV%5DPtUH]GHO3LQR  .&$  1.  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV   +'/& +LJKOHYHO'DWD/LQN&RQWURO.

*2   /$1   (WKHUQHW .Ï1   7'0   )'0  :'0   &'0  35272&2/2 $/2+$   $/2+$SXUR   &È/&8/2'(35(67$&.$&.(((.3/(.   352%/(0$6   08/7.21(6   $/2+$UDQXUDGR   &60$   &60$SHUVLVWHQWH   &60$QRSHUVLVWHQWH  &60$SSHUVLVWHQWH   &60$&'   3$62'(7(67.

  7RNHQ5LQJ .(((.

  )''.   7RNHQ%XV .(((.

'2  /XLV%5DPtUH]GHO3LQR  .9(/'((1/$&(0('.2&203$57.   352%/(0$6  1.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  3UHVHQWDFLyQ 6HSUHWHQGHTXHORVDOXPQRV x x x 6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  2EMHWLYRVGHODDVLJQDWXUD DGTXLHUDQ FRQRFLPLHQWRV JHQHUDOHV DFHUFD GH ODV UHGHV GH GDWRV FODVLILFDFLyQWLSRVGHFRQPXWDFLyQFRQFHSWRVGHLQWHUID]VHUYLFLR\SURWRFROR.

 FRPSUHQGDQFRQFHSWRVUHODWLYRVDOQLYHOItVLFRGHODFRPXQLFDFLyQ FRPSUHQGDQ\VHDQFDSDFHVGHDQDOL]DU \UHFUHDUODVWpFQLFDVXVDGDVHQHOQLYHO GHHQODFHWDQWRHQHQODFHVSXQWRDSXQWRFRPRHQHQODFHVGHDFFHVRP~OWLSOH  3URIHVRUDGR  3URJUDPD x x &DUORV*DUFtD5XELR 5HVSRQVDEOH.

3333 ƒ 3URWRFRORVGHFRQWUROGHHUURUHV7pFQLFDV$54 ƒ (MHPSOR+'/& x 7pFQLFDVGHDFFHVRDOPHGLR  /XLV%5DPtUH]GHO3LQR . x 0RGHOR7&3. -RVp/XLV+HUQiQGH])HUQiQGH]  .3  1LYHO ItVLFR x 7UDQVPLVLyQGHGDWRV x 0HGLRVGHWUDQVPLVLyQ x &RGLILFDFLyQGHGDWRV x .QWHUIDFHV ƒ 6HUYLFLRV ƒ 3URWRFRORV x 0RGHORGHUHIHUHQFLD26.QWHUIDFHVGHFRPXQLFDFLyQGHGDWRV  1LYHOGHHQODFH x &RQWUROGHHQODFH ƒ 'HILQLFLRQHV\UHSUHVHQWDFLRQHV ƒ )XQFLRQHVGHOQLYHOGHHQODFH ƒ 7LSRVGHHQODFH ƒ &yGLJRVGHGHWHFFLyQ\FRQWUROGHHUURUHV7pFQLFDV)(& ƒ (MHPSOR6/.QWURGXFFLyQ x +LVWRULD\XVRGHODVUHGHVGHGDWRV x &ODVLILFDFLyQGHUHGHVGHRUGHQDGRUHV x &RQFHSWRV%iVLFRV x 'HVFRPSRVLFLyQHQQLYHOHVGHORVVLVWHPDVGHFRPXQLFDFLyQGHGDWRV ƒ .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  3UiFWLFDVHQODERUDWRULR 5HVHUYD)'07'07'0HVWDGtVWLFD &RQWLHQGD$ORKD&60$ 6HOHFFLyQ3DVRGHWHVWLJR x 5HGHVGHiUHDORFDO ƒ &RQFHSWRV%iVLFRV ƒ $UTXLWHFWXUD ƒ (WKHUQHW .(((.

(((.\)DVW(WKHUQHW ƒ 7RNHQ5LQJ .

 ƒ )'', ,62

  ,QWHUFRQH[LyQGH6XEUHGHV x 1LYHO)tVLFR5HSHWLGRUHV x 1LYHOGH(QODFH%ULGJHV ƒ %ULGJHV7UDQVSDUHQWHV ƒ %ULGJHVFRQ(QFDPLQDPLHQWRIXHQWHV ƒ 1RPHQFODWXUD5HSHWLGRUHV+XEV%ULGJH6ZLWFK
ƒ ƒ ƒ

$GHPiVGHODVFODVHVGHWHRUtD\GHSUREOHPDVVHUHDOL]DUiQSUiFWLFDVHQODERUDWRULR x /DVSUiFWLFDVFRPLHQ]DQHOGH1RYLHPEUHGH x (OKRUDULRGHSUiFWLFDVVHUiORVPLpUFROHV FRLQFLGLHQGRFRQODVKRUDV GH FODVH GH  D  \ GH  D 

 VL ELHQ SRGUiQ KDFHUVH WDPELpQ IXHUD GH KRUDV GH FODVH FRQHFWiQGRVH D ORV SXHVWRV GHO ODERUDWRULR SRU WHOQHW R VORJLQ GHVGH FXDOTXLHU RUGHQDGRU GH ,QWHUQHW \ WUDEDMDQGRHQUHPRWRFXDOTXLHUGtDGHODVHPDQDDFXDOTXLHUKRUD

x /DV SUiFWLFDV VH UHDOL]DUiQ HQ HO ODERUDWRULR GHO ÈUHD GH ,QJHQLHUtD 7HOHPiWLFD $ HQ 3&V FRQ VLVWHPD RSHUDWLYR /LQX[ &RPR \D KHPRV FRPHQWDGR SXHGH FRQHFWDUVH D HVWRV RUGHQDGRUHV D WUDYpV GH ,QWHUQHW VHOODPDQLWODELWXFPHV DLWODELWXFPHV



x 3DUDSRGHUHQWUDUHQORVRUGHQDGRUHVGHOODERUDWRULRQHFHVLWDWHQHUXQD FXHQWD DELHUWD 3XHGH VROLFLWDUOR D WUDYpV GHO VLJXLHQWHIRUPXODULR /DV FXHQWDV VH VROLFLWDUiQ LQGLYLGXDOPHQWH FDGD DOXPQR WLHQH GHUHFKR D WHQHU XQD FXHQWD

QJHQLHUtD7HOHPiWLFD x /DV SUiFWLFDV VH KDUiQ \ VH HQWUHJDUiQ REOLJDWRULDPHQWH SRU SDUHMDV /HD HQ HO HQXQFLDGR GH OD SUiFWLFDV ODV QRUPDV VREUH FyPR QRWLILFDU FXiOHVVRQORVFRPSRQHQWHVGHFDGDSDUHMD  %LEOLRJUDItD >7DQHQEDXP@ /XLV%5DPtUH]GHO3LQR x 3XOVHDTXtSDUDDFFHGHUDOHQXQFLDGRGHODSUiFWLFD  . (VWD FXHQWD OH VHUYLUi DGHPiV SDUD HO UHVWR GH ODV DVLJQDWXUDVTXHFXUVHHQHOÈUHDGH.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV $QGUHZ 6 7DQHQEDXP &RPSXWHU 1HWZRUNV 7KLUG (GLWLRQ 3UHQWLFH +DOO .QWHUQDWLRQDO  WDPELpQHQ(VSDxRO.

 >6WDOOLQJV@ :LOOLDP6WDOOLQJV'DWDDQG&RPSXWHU&RPPXQLFDWLRQV)LIWK(GLWLRQ3UHQWLFH +DOO.QWHUQDWLRQDO  WDPELpQHQ(VSDxRO.

 >3HUOPDQ@ 5DGLD3HUOPDQ.DXIPDQQ3XEOLVKHUV  >%HUWVHNDV@ 'LPLWUL %HUWVHNDV 5REHUW *DOODJHU'DWD 1HWZRUNV 6HFRQG (GLWLRQ 3UHQWLFH +DOO.QWHUQDWLRQDO  >+DOVDOO@ )UHG +DOVDOO 'DWD &RPPXQLFDWLRQV &RPSXWHU 1HWZRUNV DQG 2SHQ 6\VWHPV )RXUWK(GLWLRQ $GGLVRQ:HVOH\  /XLV%5DPtUH]GHO3LQR  .DXIPDQQ3XEOLVKHUV  >6FKZDUW]@ 0LVFKD 6FKZDUW] 7HOHFRPPXQLFDWLRQ 1HWZRUNV 3URWRFROV 0RGHOOLQJ DQG $QDO\VLV$GGLVRQ:HVOH\ >3HWHUVRQ@ /DUU\ / 3HWHUVRQ %UXFH 6 'DYLH&RPSXWHU 1HWZRUNV $ 6\VWHPV $SSURDFK 0RUJDQ.QWHUFRQQHFWLRQV %ULGJHVDQG 5RXWHUV $GGLVRQ :HVOH\ @ /DUU\ / 3HWHUVRQ %UXFH 6 'DYLH&RPSXWHU 1HWZRUNV $ 6\VWHPV $SSURDFK 0RUJDQ.

QIRUPiWLFD.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  .QWURGXFFLyQ (O SURFHVDPLHQWR GH OD LQIRUPDFLyQ .QWURGXFFLyQ  .

 \ OD GLVWULEXFLyQ GH OD LQIRUPDFLyQ 7HOHFRPXQLFDFLRQHV.

FRQYHUJHQDPEDVWLHQGHQKDFLDODWHOHPiWLFD 'H ORV VLVWHPDV LQIRUPiWLFRV FHQWUDOL]DGRV KD\ XQD HYROXFLyQ D ORV VLVWHPDV GLVWULEXLGRV 7HOHPiWLFDHVHOHVWXGLRGHODVUHGHVGHRUGHQDGRUHV 6&'.

 $OJXQDVGHILQLFLRQHV 5HGGHRUGHQDGRUHV(VXQDFROHFFLyQLQWHUFRQHFWDGD SHUPLWHHOLQWHUFDPELRGH LQIRUPDFLyQ.

GHRUGHQDGRUHVDXWyQRPRV HTXLSRVTXHHQSULQFLSLRQRQHFHVLWDQ ODUHGSDUDIXQFLRQDU.

 7HOHFRPXQLFDFLyQ &RPXQLFDFLyQ D GLVWDQFLD &XDOTXLHU LQWHUFDPELR GH LQIRUPDFLyQ\DVHDHQWUHKRPEUHRPiTXLQDLQGHSHQGLHQWHPHQWHGHODGLVWDQFLD XQRV SRFRV PHWURV R KDVWD NLOyPHWURV.

 (Q SULQFLSLR HV XQD FRPXQLFDFLyQ ELODWHUDODXQTXHSXHGHKDEHUVLVWHPDVXQLODWHUDOHV GLIXVLyQGHUDGLRR79.

 5HGHV GH RUGHQDGRUHV VLPpWULFDV HQ ODV TXH ODV FRPXQLFDFLRQHV VH SURGXFHQ LJXDOHQXQVHQWLGRTXHHQRWUR x x x 0RGHOR VLPSOLILFDGR GH XQ VLVWHPD GH WHOHFRPXQLFDFLRQHV XQD GLUHFFLyQ SRU VLPSOLILFDU.

 )8(17( 6PD[ H  5(' 5(&(3725 '(67.12 3RGUtDPRVYHUORVIXQGLGRVHQXQVRORRUGHQDGRU 3RGUtDPRVYHUORVIXQGLGRVHQXQVRORRUGHQDGRU /D IXHQWH HV OD TXH JHQHUD OD LQIRUPDFLyQ D WUDQVPLWLU HQ QXHVWUR FDVR HO RUGHQDGRU.

625 5(&(3725 '(67. (O WUDQVPLVRU WUDQVIRUPD OD LQIRUPDFLyQ GH OD IXHQWH HQ VHxDOHV HOHFWURPDJQpWLFDV VXVFHSWLEOHV GH VHU HQYLDGDV D WUDYpV GH XQD UHG (Q HO FDVR GH XQ RUGHQDGRUVHUtDXQ02'(0RXQDWDUMHWDGHUHG/DUHGHVXQFRQMXQWRGHUHFXUVRV \ IDFLOLGDGHVTXH SHUPLWLUiQ ODWUDQVPLVLyQGHHVDV VHxDOHV(OUHFHSWRU FDSWD ODVVHxDOHV GHODUHG\ODVWUDQVIRUPD DOIRUPDWRTXHQHFHVLWDHOGHVWLQR(OGHVWLQRHVHOTXHUHFLEH ORVGDWRVHQYLDGRVSRUODIXHQWH8QHMHPSORQRLQIRUPiWLFRVHUtD 5(' )8(17( 75$160.12 'HILQLFLRQHV /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV x x x x (OVLVWHPDGH FRPXQLFDFLyQPiVHOHPHQWDOFRQVWDUiGHGRV HTXLSRVX QLGRVSRU XQPHGLRGHWUDQVPLVLyQ )8(17( 75$160.625 5(&(3725 7UDQVPLVLyQ3URFHVRGHHQYtRGHLQIRUPDFLyQDWUDYpVGHXQDUHG(QSULQFLSLR OD LQIRUPDFLyQ KD GH WUDQVIRUPDUVH SDUD SRGHU VHU HQYLDGD SRU OD UHG HOHFWUR PDJQpWLFR.

QIRUPDFLyQWUDQVIRUPDGDDGHFXDGDPHQWHSDUDVHUHQYLDGDSRUUHG 3URWRFROR5HJODVTXHGHILQHQFRPRVHFRGLILFDODVHxDO\VXRUJDQL]DFLyQSDUD VHU WUDQVPLWLGD SRU UHG SURWRFROR GH FRPXQLFDFLRQHV. 6HxDO.

12 x 6LHQOXJDUGHHTXLSRVWHQHPRVQHFHVLWDPRVPHGLRVGHWUDQVPLVLyQ\HQ FDGD PiTXLQD  LQWHUIDFHVGH . . FRPXQLFDFLyQ &RQ  HTXLSRV VHtD  0HGLRGH7[ PHGLRV GH WUDQVPLVLyQ \  LQWHUIDFHVSRUPiTXLQD . . &RQ Q HTXLSRV 0HGLRGH7[ 0HGLRGH7[ LQWHUFRQHFWDGRV Q Q  . (VWRV QHFHVLWDQ HO LQWHUFDPELRGHRWUDVVHxDOHVTXHQRVRQLQIRUPDFLyQ 6HxDOL]DFLyQ 6HxDOHV TXH QR VRQ LQIRUPDFLyQ SHUR LQWHUYLHQHQ HQ OD FRPXQLFDFLyQ\WUDQVPLVLyQGHHVWD '(67.

 PHGLRVGHWUDQVPLVLyQ\FDGD PiTXLQD KDEUtD GH WHQHU Q LQWHUIDFHV x 5HGGHFRPXQLFDFLRQHV6LVWHPDFRPSDUWLGRTXHSHUPLWHUHGXFLU HOQ~PHURGH PHGLRV GH WUDQVPLVLyQ \ HO Q~PHUR GH LQWHUIDFHV QHFHVDULRV HQ FDGD PiTXLQD FRPSDUWLpQGRORV \ KDFLHQGR TXH FDGD PiTXLQD FRQHFWDGD DODUHGWHQJDXQVRORLQWHUID] XQD VROD YtD GH HQWUDGD \ VDOLGDGHLQIRUPDFLyQ. . QHFHVLWDUtDPRV  .

 0HGLRVGHWUDQVPLVLyQ6HFODVLILFDQHQGRVWLSRV  *XLDGRV /DV RQGDV HOHFWURPDJQpWLFDV VH FRQILQDQ HQ HO LQWHULRU GH XQ PHGLR VyOLGR FDEOH PHWiOLFR UHG FRD[LDO HWF R QR PHWiOLFR ILEUD ySWLFD.

  1RJXLDGRV6HWUDQVPLWHQODVVHxDOHVVLQFRQILQDUODVHQQLQJ~QPHGLR D WUDYpVGHODLUHRYDFtR.

7DPELpQVHOODPDWUDQVPLVLyQLQDOiPEULFD /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  &ODVLILFDFLyQGHODUHGHV x 6HSXHGHQFODVLILFDUVHJ~QGLYHUVRVFULWHULRV 6HJ~QVXWpFQLFDGHFRPXQLFDFLyQ  5HGHV SXQWR D SXQWR GHGLFDGDV R PDOODGDV.

 ([LVWH XQD UHG GH FRPXQLFDFLyQSDUDFDGDSDUHMDGHHTXLSRVFRQHFWDGRV 9(17$-$6 &RPXQLFDFLyQ PX\ VHQFLOOD SXHV FDGD SDUHMD GH HTXLSRV WLHQH XQ PHGLR H[FOXVLYR VLQ FRPSDUWLU 1R KD\ TXH HOHJLU HO FDPLQRSRUGRQGHOOHYDUODLQIRUPDFLyQ .1&219(1.1&219(1.(17(6 6X FRVWH \ FRPSOHMLGDG FXDQGR KD\ PXFKRVHTXLSRV 5HGHVGHGLIXVLyQ ([LVWHXQ~QLFRPHGLRGHWUDQVSRUWHFRPSDUWLGRSRU WRGRVORVHTXLSRVSRUHOORVHQHFHVLWDXQPHFDQLVPRHQODUHGGHFRQWURO GH DFFHVR D HVH PHGLR FRPSDUWLGR SDUD HYLWDU TXH HVWH VHD XVDGR SRU YDULDVPiTXLQDVVLPXOWiQHDPHQWH/DFRPSDUWLFLyQVHFRQVLJXHPHGLDQWH PXOWLSOH[DFLyQ2WUDFDUDFWHUtVWLFDHVTXHFRPRHOPHGLRHVFRPSDUWLGR FXDQGRDOJXLHQWUDQVPLWHDOJRHQHOPHGLRHVUHFLELGRSRUHOUHVWRGHORV HTXLSRVGHODUHG 9(17$-$6 8Q ~QLFR PHGLR GH WUDQVPLVLyQ 6L TXHUHPRV WUDQVPLWLUDWRGDVOHVOOHJDFRQXQD~QLFDWUDQVPLVLyQ .(17(63ULYDFLGDGQRVyOROHOOHJDDOGHVWLQRVLQR DWRGDVODVPiTXLQDVGHODUHG/DFDSDFLGDGGHOFDQDOVHGLYLGHHQWUHHO Q~PHUR GH HVWDFLRQHV SDUD XQ Q~PHUR GH HVWDFLRQHV HOHYDGR EDMDQ ODV SUHVWDFLRQHV.

 8Q HMHPSOR HV OD GLIXVLyQ GH SDTXHWHV SRU UDGLR 2WURHMHPSORVRQODVUHGHVSRUVDWpOLWH 6RQ UHGHV FRQ XQ PHGLR GH WUDQVPLVLyQ QRJXLDGR 2WURHMHPSORVHUtDQODVUHGHVHQEXV 5HGHVGHFRQPXWDFLyQ$GHPiVGHOPHGLRGH WUDQVPLVLyQYDDKDEHUXQRVHTXLSRVOODPDGRVQRGRVGHFRQPXWDFLyQGH WDO IRUPD TXH ORV HTXLSRV TXH VH FRQHFWDQ D OD UHG QR HVWiQ XQLGRV GLUHFWDPHQWHVLQRTXHVHXQHQDXQQRGRGHFRQPXWDFLyQHQHOLQWHULRU GH OD UHG &XDQGR XQ HTXLSR TXLHUH WUDQVPLWLU DOJR SDVD D VX QRGR GH FRQPXWDFLyQ \ HVWH VH HQFDUJD GH KDFHUOR OOHJDU KDVWD HO QRGR GH FRQPXWDFLyQGHOHTXLSRGHVWLQR /RV QRGRV GH FRQPXWDFLyQ HVWiQ FRQHFWDGRV HQWUH Vt 6L OD UHG HV SHTXHxD \ WLHQH SRFRV QRGRV HQWRQFHV ORV QRGRV SXHGHQ FRQHFWDUVH FRPR VL IXHUD XQD UHG LQWHUQD SXQWR D SXQWR3HURVLODUHGHVPiVJUDQGHQRH[LVWLUiQWDQWRVHQODFHVSRUORTXH VLHPSUHGHEHH[LVWLUDOPHQRVXQFDPLQRSDUDOOHJDUGHFXDOTXLHUSXQWRD RWURDXQSDVDQGRSRUYDULRVQRGRV3RUPRWLYRVGHILDELOLGDGVXHOHKDEHU PiVGHXQFDPLQR   /XLV%5DPtUH]GHO3LQR  .

3VRQHQFDPLQDGRUHVHQWHOHIRQtDVRQFHQWUDOLWDV.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 'HSHQGLHQGRGHOWLSRGHUHGORVQRGRVUHFLEHQXQQRPEUHXRWUR HQ7&3.

6HJ~QHO IXQFLRQDPLHQWR GH ORV QRGRV VH GLYLGHQHQWUHVWLSRV ƒ &RQPXWDFLyQ GH FLUFXLWRV 6RQ ORV PiV DQWLJXRV TXH H[LVWHQ\VHEDVDQHQTXHORV HQODFHV HQWUH QRGRV GH FRQPXWDFLyQ (VWiQ IRUPDGRV SRU YDULRV PHGLRV GHWUDQVPLVLyQ /DFRPXQLFDFLyQVHSURGXFHHQWUHVIDVHV  (VWDEOHFLPLHQWRGHFRQH[LyQ(ORULJHQLQGLFDFRQTXH GHVWLQR TXLHUH FRPXQLFDU /RV QRGRV YDQ FRQHFWDQGR ItVLFDPHQWH XQD GH VXV HQWUDGDV \ XQD GH VXV VDOLGDV KDVWD HQFRQWUDU XQ FDPLQR TXH YD DO HPLVRU \ DO UHFHSWRU 6L WLHQH p[LWR WHQHPRV XQ HQODFH GHGLFDGR SXQWRDSXQWR H[FOXVLYR.

  7UDQVIHUHQFLD GH LQIRUPDFLyQ 6H LQWHUFDPELD OD LQIRUPDFLyQTXHVHGHVHH  /LEHUDFLyQ GH FRQH[LyQ 6H FRPXQLFD D ORV QRGRV GH FRQPXWDFLyQ TXH VH SXHGHQ OLEHUDU ORV HQODFHV 6H OLEHUD ORV HQODFHV LQWHUQRV TXH FUHDQ ORV QRGRV GHMiQGRORVOLEUHVSDUDRWUDVFRPXQLFDFLRQHV 9HDPRVXQHMHPSORFRQXQGLDJUDPDGHWLHPSRV % $    . $    % 0LUDVLKD\HQODFHOLEUH $.

'$726 +DVWD DTXt HV WRGR VHxDOL]DFLyQ D~Q QR VH KDHQYLDGRLQIRUPDFLyQ /LEHUDFRQH[LyQ /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 9(17$-$6 8QD YH] HVWDEOHFLGD OD FRQH[LyQ H FRPR VL WXYLpVHPRVXQFDEOHGHGLFDGRSDUDODFRPXQLFDFLyQGH$FRQ% SRUHOOR12KD\UHWDGRHQORVQRGRVGHFRQPXWDFLyQ UHWDUGRTXH VLVHSURGXFHDOSULQFLSLRKDVWDTXHVHHQFXHQWUDHOFLUFXLWR.

VROR HOUHWDUGRLPSOtFLWRGHOPHGLR(VXQDWHFQRORJtDFRQRFLGD SRUOR TXHVHWLHQHH[SHULHQFLDHQHOOD.

1&219(1. .(17(6 6H QRV WDULILFDUi SRU HO FLUFXLWR HVWDEOHFLGRLQGHSHQGLHQWHPHQWHGHORTXHWUDQVPLWDPRV$XQTXH HQ FLHUWRV PRPHQWRV QR JHQHUHPRV WUiILFR VHJXLUHPRV GLVSRQLHQGRGHOFDQDO (OUHWDUGRGHHVWDEOHFLPLHQWRGH FRQH[LyQHVPX\ JUDQGH $.

 &XDQGR OD UHG VH FRPLHQ]D D FRQJHVWLRQDU HO SULPHUR TXH FRQVLJD HVWDEOHFHU FRPXQLFDFLyQ WLHQH XQ VHUYLFLR SHUIHFWR PLHQWUDV QR GHVFRQHFWH.

 \ HO UHVWR QR FRQVLJXH WUDQVPLWLU QR FRQVLJXH XQ FLUFXLWR (Q XQD UHG GH GDWRV OR LGHDO HV RFXSDU UHFXUVRVGHODUHG PLHQWUDVVHHVWiWUDQVPLWLHQGR 6LKD\FRQJHVWLyQGHODUHGHOVHUYLFLRQRVHGHJUDGDLJXDO SDUDWRGRVORVXVXDULRV(PSLH]DQDHVFDVHDUHQODFHVHQWUHQRGRV GH FRQPXWDFLyQ TXLHQ WLHQH VXHUWH \ HQFXHQWUD HQODFHV OLEUHV WLHQHXQVHUYLFLRSHUIHFWRSHURHO UHVWRQRWLHQHQLQJ~QVHUYLFLR 3HVHDVHUXQDGHODVWHFQRORJtDVPiVDQWLJXDV\QRVHUXQ GH ODV PHMRUHV IRUPDV GH WUDQVPLWLU LQIRUPDFLyQ HV GH ODV PiV HPSOHDGDV(M5HGGHOHIyQLFR5'6. ƒ &RQPXWDFLyQ GH PHQVDMHV 1R H[LVWHQ UHDOPHQWH VLQR FRQFHSWXDOPHQWH 6RQ UHGHV GLULJLGDV HVSHFLDOPHQWH D OD %  WUDQVPLVLyQGHGDWRVORVQRGRVGH $ +($'(5   FRQPXWDFLyQ VRQ RUGHQDGRUHV FRQ '$7$ VX PHPRULD GLVFR HWF GRQGH JXDUGDQ FRVDV WHPSRUDOPHQWH 1R KD\ HVWDEOHFLPLHQWR GH FRQH[LyQ VLQR TXH FXDQGR $ TXLHUH HQYLDUDOJRD% LQVHUWD XQDFDEHFHUD HQODLQIRUPDFLyQDHQYLDU GRQGH LQGLFDUi HO GHVWLQDWDULR $ VH OR HQYtD DO QRGR TXH OR DOPDFHQDUi (O QRGR OR GLVWULEXLUi DO QRGR GHO GHVWLQDWDULR ILQDO 6H GLFH TXH VRQ UHGHV GH DOPDFHQDPLHQWR \ UHHQYtR /RV $    % 5HWDUGR9DULDEOH &DEHFHUD 0HQVDMH (OUHWDUGRHQHOQRGRHVYDULDEOHSRU TXHSXHGHUHFLELUYDULRVPHQVDMHV VLPXOWiQHDPHQWH /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV %  %  %  W PHQVDMHVVHHQFRODQ\HO QRGRORVYDGHVHQFRODQGR\SURFHVDQGR (QHOQRGRGHVWLQRWDPELpQVHHQFRODQDOUHFLELU 9(17$-$61RKD\TXHHVWDEOHFHUFLUFXLWRVHHQYLD\\D HVWi 1R FRQVXPLPRV QLQJ~Q UHFXUVR DO WUDQVPLWLU 6ROR VH QRV WDULILFDUi SRU HO XVR TXH KDFHPRV GH OD UHG GHOD FDQWLGDG GH LQIRUPDFLyQ TXH HQYLDPRV /DV SUHVWDFLRQHV VRQ PiV JUDQGHV \ HTXLWDWLYDV *UDGXDO SRU TXH VHJ~Q KD\ PiV WUiILFR KD\ PiV UHWDUGRSHURWRGRVSXHGHQHQYLDU .(17(6 +D\ TXH OLPLWDU HO WDPDxR GHO PHQVDMH SXHV VL QR HO UHWDUGR HQ FDGD VDOWR SRGUtD HOHYDUVH GHPDVLDGRRLQFOXVRSRUUHWDUGRRFXSDUHOFDQDOPXFKRWLHPSR (VH WDPDxR Pi[LPR HV HO TXH REOLJD D IUDJPHQWDU OD LQIRUPDFLyQDHQYLDUOODPDQGRDFDGDIUHDJPHQWR3$48(7( ƒ &RQPXWDFLyQGHSDTXHWHV(OPHQVDMHVHWURFHDHQSDTXHWHVFRQ XQD ORQJLWXG Pi[LPD HVSHFtILFD 6HJ~Q HO WLSR GH HQYLR SXHGH VHU ƒ 3RU GDWDJUDPD &DGD XQR GH ORV IUDJPHQWRV WLHQH XQD FDEHFHUD TXHLQGLFD HOGHVWLQR \XQQ~PHURGHVHFXHQFLD HQWUH RWUDV FRVDV.1&219(1.

1&219(1.QWHUQHW SURWRFROR.(17(6 (Q FDGD SDTXHWH YD OD % GLUHFFLyQ GH GHVWLQR WHQLHQGR $ TXH GHFLGLU SRU FDGD QRGR GH   FRQPXWDFLyQ \ SDTXHWH HO  FDPLPR GH ODV WUDPDV SDUD LU DOGHVWLQR2WURLQFRQYHQLHQWH HV TXH FRPR VH SXHGH LU $    % GHVGH HO RULJHQDO GHVWLQR SRU YDULRVFDPLQRVXQRVSDTXHWHV OOHJDQ DQWHV TXH RWURV (VWR  REOLJD DO GHVWLQR D WHQHU  PHPRULD SDUD DOPDFHQDU ORV  SDTXHWHV\UHRUGHQDUORVOXHJR  9(17$-$6 (V PX\  VHQFLOOR 8Q HMHPSOR HV  6HWDULILFDSRU  .3. &DGD SDTXHWH VH HQYtD SRU VHSDUDGR FRPR HQ FRQPXWDFLyQ GH PHQVDMHV \ HO GHVWLQR GHEH UHRUGHQDUORVSDTXHWHVDVXUHFHSFLyQ .

 WUiILFR QRKD\  FDQDOGHGLFDGR.

(V PiV UiSLGR TXH OD  FRQPXWDFLyQ GH PHQVDMHV  $QWHV WHQtDPRV TXH HVSHUDU D  UHFLELU WRGR HO PHQVDMH SDUD  UHHQYLDU DXQTXH QR KD\D UHFLELGRHOUHVWR ƒ 3RUFLUFXLWRVYLUWXDOHV/DGHFLVLyQGHHQFDPLQDPLHQWRGH $D%VyORVHSURGXFHXQDYH]6HKDFHFRPXQLFDFLyQHQ WUHVIDVHVFRPRHQODVUHGHVGHFRQPXWDFLyQGHFLUFXLWRV 3ULPHUR VH HQYtD XQ SDTXHWH HVSHFLDO D OD UHG GRQGH VH GLFH TXH VH TXLHUH HVWDEOHFHU XQ FLUFXLWR YLUWXDO FRQ HO GHVWLQR HVWH FLUFXLWR YLUWXDO QR HV UHDO QR VH HVWDEOHFH  /XLV%5DPtUH]GHO3LQR .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV %  %  %  $ (VWDEOHFLPLHQWR GHFLUFXLWRYLUW $     UHDOPHQWH XQ FLUFXLWR YLUWXDO FRQ HO GHVWLQR.

 )UDPH5HOD\  E\WHV. VH HQYtD D WUDYpV GHO QRGR Q R VH HQWUHJD DO GHVWLQR $O WHUPLQDU GH GHFLGLU HO FDPLQR VHLQLFLD HO HQYtR GH ORV SDTXHWHVDxDGLHQGRHQODFDGHQDHOQžGHFLUFXLWRYLUWXDOD VHJXLU 6L IDOOD OD UHG R XQ % QRGR VH FLHUUD HO FLUFXLWR \ KD\ TXH YROYHU D VROLFLWDU  %   FLUFXLWR\UHHQYLDU6HOODPDQ   FLUFXLWRV YLUWXDOHV SRU TXH VH  SDUHFHQ D OD FRQPXWDFLyQ GH FLUFXLWRV SHUR VRQ YLUWXDOHV SRUTXHUHDOPHQWHQRH[LVWHQ 6L QR WUDQVPLWLPRV QR FRQVXPLPRV SXHV QR WHQHPRV OD UXWD GHGLFDGD 6L KD\ SRFRV SDTXHWHV HV PHMRU SRU GDWDJUDPD SXHV QR SLHUGHV WLHPSR HVWDEOHFLHQGR XQ FLUFXLWR 6L VRQ PXFKRV SDTXHWHV FRPSHQVD HVWDEOHFHU HO FLUFXLWR (V DGHFXDGR SDUD UHGHV GH DOWD YHORFLGDG (O QXPHUR GH FLUFXLWR YLUWXDO HV PiV SHTXHxR TXH HQ XQD GLUHFFLyQGHUHGSRUORTXHODFDEHFHUDHVPiVSHTXHxD (MHPSOR . (O SULPHU QRGRQRVFRQWHVWDFRQXQLGHQWLILFDGRUGHFLUFXLWRYLUWXDO (O QRGR D FRQWLQXDFLyQ GHFLGH SRU GRQGH GHEHQ LU HVRV SDTXHWHV &UHD XQD WDEOD TXH DVLJQD XQ LGHQWLILFDGRU GH FLUFXLWR YLUWXDO D XQ QRGR TXH VHUi HO VLJXLHQWH QRGR GH FRQPXWDFLyQ 8Q QRGR OH VROLFLWD DO RWUR HO HVWDEOHFLPLHQWR GH XQ FLUFXLWR YLUWXDO JXDUGDQGR HO VHJXQGR HQ XQD WDEOD TXH SDUD HO FLUFXLWR YLUWXDOQž .

 $70 E\WHV.

RFRQPXWDFLyQGHFpOXODV ORVSDTXHWHVVRQPX\ SHTXHxRV.

 $OILQDOVHHQYtDXQPHQVDMHHVSHFLDOSDUDOLEHUDUHO FLUFXLWR YLUWXDO ERUUDQGR ORV Q~PHURV GH ODV WDEODV GH HQFDPLQDPLHQWR TXHGDQGR HVH LGHQWLILFDGRU OLEUH SDUD RWUR FLUFXLWR YLUWXDO (O GLDJUDPD GH WLHPSR VHUtD HO VLJXLHQWH (OUHWDUGR .

VH   % GXSRQH TXH HV PHQRU SRU TXH \D HVWi FDOFXODGD OD UXWD \ DXQTXH VH WDUGH HQ  HVWDEOHFHU \ OLEHUDU   FRPSHQVD OD VXPD GH    UHWDUGRV   +D\ XQD     SHTXHxD SDUWH GH    WDULILFDFLyQ SRU HO   WLHPSR TXH WHQHPRV  /LEHUDFLyQGHOFY HVWDEOHFLGRHOFLUFXLWR\ HOUHVWRHVSRUHOWUiILFR GHUHG  /XLV%5DPtUH]GHO3LQR .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV x x (O KHFKR GH TXH VHD S~EOLFD R SULYDGD YD D DIHFWDU D ORV SURWRFRORV GH FRPXQLFDFLRQHV(QODVUHGHVS~EOLFDVKD\TXHFXLGDUDVSHFWRVQRQHFHVDULRVHQ ODVSULYDGDVFRPRWDULILFDFLyQ FREUDUDORVXVXDULRV.

VHJXULGDG ORVGDWRVTXH /XLV%5DPtUH]GHO3LQR  /D WDULILFDFLyQ UHDOL]DGD HV HQ FRQPXWDFLyQ GH FLUFXLWRV SRUHOWLHPSRTXHHVWpHVWDEOHFLGRHOFLUFXLWRLQGHSHQGLHQWHPHQWH GHOWUiILFRJHQHUDGR(QGDWDJUDPDV FRPXQLFDFLyQSRUSDTXHWHV.

 SRUHOWUiILFRJHQHUDGRVLVHWUDQVPLWHVHFREUDVLQRVHWUDQVPLWH QR (Q FRQPXWDFLyQ GH SDTXHWHV SRU FLUFXLWRV YLUWXDOHV VH FREUD XQD SHTXHxD FDQWLGDG SRU HO WLHPSR TXH SDVD GHVGH TXH VH HVWDEOHFHHOFLUFXLWRYLUWXDOKDVWDTXHVHOLEHUD SRUHOHVSDFLRHQ PHPRULD SDUD DOPDFHQDU HO FLUFXLWR YLUWXDO.

 3HUR IXQGDPHQWDOPHQWHVHFREUDSRUODFDQWLGDGGHELWVTXHVHPDQGDQ FRQVXPHQDQFKRGHEDQGDHOORVHQODFHVGHODUHG 6HJ~Q VX H[WHQVLyQ JHRJUiILFD 6H SXHGHQ FODVLILFDU HQ 5HGHV ORFDOHV /$1.

 UHGHV PHWURSROLWDQDV 0$1.

 UHGHV H[WHQVDV :$1.

 R UHGHV GH VREUHPHVD '$1.

  /$1'HVGHXQODERUDWRULR XQRVSRFRVPHWURV.

SDVDQGRSRUXQHGLILFLR RYDULRVHGLILFLRVSUy[LPRVHQWUHVt DORVXPR.PGHGLiPHWUR.

3RU HMHPSORXQFDPSXV  0$1&XEULUiXQDFLXGDG\VXVDOUHGHGRUHV  :$1&XEUHXQDUHJLyQ FRPXQLGDG SDtVFRQWLQHQWHHLQFOXVRWRGR HO SODQHWD.

(OWDPDxRGHODUHGLQIOX\HHQHOSURWRFRORDXWLOL]DU  '$1 /DV UHGHV PHWURSROLWDQDV 0$1.

 HVWiQ FD\HQGR HQ GHVXVR .QFOXVR HVWiQ DSDUHFLHQGR XQDV QXHYDV UHGHV ODV UHGHV GH VREUHPHVD 'HVN $UHD 1HWZRUN R '$1.

 6RQ UHGHV GH FHQWtPHWURV TXH XQHQ XQ SURFHVDGRUFRQORVSHULIpULFRV(QPiTXLQDVPXOWLSURFHVDGRUVLUYHQSDUD XQLUORVGLVWLQWRVSURFHVDGRUHV 6HJ~QVXH[SORWDFLyQ7HQHPRVUHGHVSULYDGDV\S~EOLFDV  5HGHV3ULYDGDV6RQODVTXHWLHQHQODVRUJDQL]DFLRQHVSDUDGDUVHVHUYLFLR DVtPLVPDV  5HGHV 3~EOLFDV 3URSLHGDG GH XQD HPSUHVD TXH FREUD SRU VX XVR D WHUFHURV 'HSHQGLHQGR GHO WLSR GH UHG H[LVWHQ SURWRFRORV PiV R PHQRV DGHFXDGRV FRVWHWLHPSRHWF.

 6L QR VH WUDQVPLWH QR VH FRQVXPH QLQJ~Q UHFXUVR GHODUHG \DTXHFXDOTXLHUDSRGUtDHQYLDUSRUHVHHQODFH DGLIHUHQFLDGHORVFLUFXLWRVYLUWXDOHV.

(17(66HKDGHHVWDEOHFHU\OLEHUDU OD FRQH[LyQ 6L VH HQYtDQ SRFRV SDTXHWHV HV PHMRU SRU GDWDJUDPD VL VRQ PXFKRV  SRU FLUFXLWR YLUWXDO SRUTXH VRORKD\TXHHQFDPLQDUXQDYH] . 8QD YH] HVWDEOHFLGD OD FRQH[LyQ FDGD SDTXHWH LQFOXLUi HQ ODV FDEHFHUDV HO Qž GH FLUFXLWR YLUWXDO ~QLFDPHQWH PDQGiQGRORV D OD UHG HQ HO RUGHQ DGHFXDGR /DDFFLyQGHHQFDPLQDPLHQWRVHUHDOL]DDOFRPLHQ]RGHOD FRQH[LyQ\QRVHYXHOYHDKDFHU 9(17$-$6 /D GHFLVLyQ GH HQFDPLQDPLHQWR VH UHDOL]D XQD VROD YH] DO FRPLHQ]R GH OD FRQH[LyQ /RV SDTXHWHVOOHJDQRUGHQDGRV .1&219(1.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  3URWRFRORV\DUTXLWHFWXUDGHSURWRFRORV HQYtDXQXVXDULRKDQGHVHUUHFLELGRVSRUHOGHVWLQDWDULR(QXQDUHGSULYDGDQR HV WDQ LPSRUWDQWH JDUDQWL]DU OD FRQILGHQFLDOLGDG GH ORV GDWRV HQ OD UHG.

 JDUDQWL]DUODFDOLGDGGHOVHUYLFLR HOXVXDULRSDJDSRUHOVHUYLFLRSDJDSRUXQRV 0ELWVSRUVHJXQGR\KD\TXHGiUVHOR.

 7DPELpQ KD KDELGR XQD WHQGHQFLD D LGHQWLILFDU /$1 FRQ UHG SULYDGD \ :$1FRQUHGS~EOLFD 3DUD TXH XVXDULRV KHWHURJpQHRV 62 HWF.

 VH SXHGDQ FRPXQLFDU KDQ GH SRQHUVHGHDFXHUGRHQHOOHQJXDMHDXWLOL]DUTXHFRVDVVHYDQDGHFLUFRPR\FXDQGR 8QSURWRFRORGHFRPXQLFDFLRQHVHVXQFRQMXQWRGHUHJODVPXWXDPHQWHDFHSWD GDV TXH YDQ D UHJLU HO GLiORJR HQWUH ORV HTXLSRV GH XQD UHG 6H FRPSRQH GH XQDVLQWD[LV IRUPDWR GH HQYtR GH GDWRV FRPR FRGLILFDUORV WLSRV GH PHQVDMHV D LQWHUFDPELDU .

 XQD VHPiQWLFD D FDGD PHQVDMH OH GD XQ VLJQLILFDGR FRQFUHWR.

 \ XQDWHPSRUL]DFLyQ LQGLFDFXDQGRSXHGRHQYLDUXQPHQVDMHRTXpUHVSXHVWDVSXHGRPDQGDUDXQPHQVDMH.

 (O SUREOHPD GH OD FRPXQLFDFLyQ HQWUH RUGHQDGRUHV GH GLYLGH HQ VXESUREOHPDV PiVIiFLOHVGHDWDFDU WLSRVGHFDEOHVGHFRQHFWRUHVFRPRVRQODVVHxDOHVHWF.

%0FRQ61$6HUR[FRQ'1$  .(VWR HVORTXHSHUVLJXHQODVDUTXLWHFWXUDVGHSURWRFRORVGHFRPXQLFDFLRQHVGHVFRPSRQHUHO SUREOHPD GH OD FRPXQLFDFLyQ GH RUGHQDGRUHV HQ XQD VHULH GH VXESUREOHPDV OODPDGRV QLYHOHV RFDSDV &DGDIDEULFDQWHGHILQLyVXSURSLRSURWRFROR .

SHURVHUHTXHUtDXQDDUTXLWHFWXUDQRUPDOL]DGDSDUDTXHWRGRHOPXQGRXVDVHODPLVPD (QWUHHOORVHVWiQHOPRGHORGHUHIHUHQFLD26.  .DUTXLWHFWXUD7&3  0RGHORGHUHIHUHQFLD26.62 2UJDQL]DFLyQ LQWHUQDFLRQDO GH HVWDQGDUL]DFLyQ.

6$HQHVSDxROX26.QWHUFRQH[LyQGHVLVWHPDV DELHUWRV 0$5. FUHy XQ FRPLWp SD UD GHILQLU XQD DUTXLWHFWXUD GH SURWRFRORV TXH SXGLHUD VHU XQD UHIHUHQFLD XQLYHUVDO/ROODPy0RGHORGH$UTXLWHFWXUDGH.

62 .  )HFKD GH SXEOLFDFLyQ GH OD QRUPD ILQDO .

 'HILQH OD GHVFRPSRVLFLyQGHOSUREOHPDGHODFRPXQLFDFLyQHQXQDVHULHGHQLYHOHV  QLYHOHV )tVLFR HQODFH UHG WUDQVSRUWH VHVLyQ SUHVHQWDFLyQ \ DSOLFDFLyQ.

%0 /XLV%5DPtUH]GHO3LQR  . (VWHPRGHORHVJHQpULFRHVWiGLYLGLGRHQFDSDV&DGDFDSDDJUXSDXQFRQMXQWR GH IXQFLRQHV UHODFLRQDGDV \ D VX YH] FDGD FDSD KDFH XVR GH ODV IXQFLRQHV GHO QLYHO LQIHULRUSDUDUHDOL]DUVXVIXQFLRQHV(VWiPX\LQIOXLGRSRUODDUTXLWHFWXUD61$GH.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (QJHQHUDOXQQLYHOQ KDFHXVRGHORVVHUYLFLRVGHOQLYHOQ \RIUHFHVHUYLFLRVDO QLYHOQ6HGLFHTXHHOQLYHO QUHFLEHVHUYLFLRGHOQLYHOQ \RIUHFHVHUYLFLRDOQLYHO Q (O QLYHO Q DFFHGH DO VHUYLFLR GHO QLYHOQ D WUDYpV GH XQRV SXQWRV GH DFFHVR 6$3R6HUYLFH$FFHVV3RLQW.

(VHOTXHUHDOPHQWHYDDXWLOL]DUHO PHGLR ItVLFR SDUD HQYLDU \ UHFLELU GDWRV (O VHUYLFLR TXH YD D RIUHFHU DO QLYHO VXSHULRU HV HO HQYtR \ UHFHSFLyQ GH ELWV 3DUD HOOR ORV HVWiQGDUHV GH HVWH QLYHO GHEHQ GHILQLUHO PHGLRGH WUDQVPLVLyQ \ ORV FRQHFWRUHVGHVGH FXDWUR SXQWRVGH YLVWDPHFiQLFRHOpFWULFRIXQFLRQDO\SURFHGLPHQWDO R 0HFiQLFRFDEOH FREUHHWF.$VXYH]RIUHFHHVWRVSXQWRVGHDFFHVRDOQLYHOVXSHULRU 6HSXHGHQYHUFRPRIXQFLRQHVTXHSXHGHQVHUOODPDGDVSDUDHQYLDU\UHFLELUGDWRV (OFRQMXQWRGHORV6$3TXHRIUHFHFDGDQLYHOHVHOLQWHUID]GHHVHQLYHO 1LYHO)tVLFR1LYHOPiVEDMRGHODWRUUH26.

DLVODQWHDXWLOL]DUHWF R (OpFWULFR6HxDOHVDHQYLDUFRPRUHSUHVHQWDU\IUHFXHQFLDIRUPDGH RQGDYHORFLGDGHWF R )XQFLRQDOHV&RQHFWRUHVFXDQWRVSLQHVSDUDTXHVLUYHFDGDSLQ R 3URFHGLPHQWDOHV1RVGLFHORVSDVRVDVHJXLUHQORVHQYtRVPDQGDUXQ $&. SRU HO SLQ  HVSHUD UHVSXHVWD SRU HO SLQ  R VHD VHFXHQFLD GH RUGHQHVDVHJXLUFRQHOFRQHFWRU.

 (MHPSORV GH QRUPDV GH QLYHO ItVLFR 56 SXHUWR VHULH.

 9[ 9 9.

6'1 5'6..

\/$1 x 1LYHO GH HQODFH (O VHUYLFLR TXH RIUHFH DO QLYHO GH UHG HV WUDQVPLVLyQ \ UHFXSHUDFLyQ ILDEOH GH WUDPDV 5HDOL]D FLHUWDV IXQFLRQHV &RQWURO GH HUURUHV GHWHFFLyQFRUUHFFLyQ.

GHOLPLWDFLyQGHWUDPDV\PXOWLSOH[DFLyQ (O QLYHO ItVLFR VyOR YH ELWV GHEHPRV GHWHUPLQDU GRQGH DFDED XQ PHQVDMH \ FRPLHQ]DHOVLJXLHQWH(VRHVORTXHKDFHHOFRQWUROGHWUDPDV$QLYHOGHHQODFH VHOODPDWUDPDV \DQLYHOGHUHGVHOODPDSDTXHWHV/DLQIRUPDFLyQVHHQPDUFD FRQ ELWV GH FRQWURO )UDPH HQ LQJOpV.

 (Q ODV UHGHV GH GLIXVLyQ WRGRV ORV RUGHQDGRUHV HVWiQ LQWHUFRQHFWDGRV QHFHVLWDQGR DOJR TXH UHJXOH HO DFFHVR DO PHGLR FRPSDUWLGR OD UHG.

 (VWR HV OR TXH VH OODPD PXOWLSOH[DFLyQ (V WDUHD WDPELpQGHOQLYHOGHHQODFH (QXQDUHGFRQPXWDGDHOQLYHOItVLFR\HOQLYHOGHUHGQRVUHVXHOYHQHQWUH XQHTXLSR\VXQRGRGHFRQPXWDFLyQ\HQWUHQRGRVGHFRQPXWDFLyQSXHGHTXH SDUDORVVDOWRVKD\DPHGLRVGHWUDQVPLVLyQ \SURWRFRORVGHHQODFHGLVWLQWRV6H JDUDQWL]DTXH VDOWRDVDOWR.

6'1\ /$1/$3%/$3' (OQLYHOItVLFR\HOGHHQODFHVRQORVTXHYHPRVHQODDVLJQDWXUD x 1LYHOGH UHG 1RV YD DGDUXQ VHUYLFLR GHWUDQVPLVLyQ \ UHFHSFLyQ GH SDTXHWHV H[WUHPR D H[WUHPR .PSOHPHQWD ODV IXQFLRQHV GH HQFDPLQDPLHQWR IUDJPHQWDFLyQ \ UHHQVDPEODGR (Q XQD UHG GH FRQPXWDFLyQHOQLYHOItVLFR\GH HQODFH WUDEDMDQ VDOWR D VDOWR (O 1LYHO)tVLFR QRWLHQHQ TXHVHULJXDOHV.3333.&6/.ORVELWVHVWiQOLEUHVGHHUURUHVHQWUHHVRVGRV 8QSURWRFRORGHOQLYHOGHHQODFHQRWLHQHSRUTXHLPSOHPHQWDUWRGDVODV IXQFLRQHV$OJXQRVSURWRFRORVGHOQLYHOGHHQODFHVRQ'.

QLYHOTXHVHHQFDUJDGHHQFRQWUDU HOWUD\HFWRGHRULJHQDGHVWLQRHV HOGHUHG x  /XLV%5DPtUH]GHO3LQR .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (QODVUHGHVSXQWRDSXQWR\HQODVUHGHVGHGLIXVLyQQRYDDKDFHUIDOWDHO QLYHOGHUHG WHQHPRVFRQH[LRQHVH[WUHPRDH[WUHPR.

(VPiVQHFHVDULRHQODV GH FRQPXWDFLyQ WDQWR HQ GDWDJUDPDV KDUi HO HQFDPLQDPLHQWR GH OR V GDWDJUDPDV.

\HQODVGHFLUFXLWRVYLUWXDOHVHOHVWDEOHFLPLHQWRGHFLUFXLWR 6HUiQHFHVDULRWDPELpQHOQLYHOGHUHGFXDQGRLQWHUFRQHFWHPRVUHGHV /D LQWHUFRQH[LyQ GH HVDV UHGHV VH KDFH FRQHFWDQGR HQFDPLQDGRUHV TXH VH XQHQ HQWUH Vt HQ XQ HQODFH SXQWR D SXQWR (V HQWRQFHV XQD UHG GH FRQPXWDFLyQ GH SDTXHWHV FX\RV (QFDPLQDGRUHV GLVSRVLWLYRV FRQHFWDGRV VRQ D VX YH] UHGHV GH GLVWLQWDV WHFQRORJtDV /RV HQFDPLQDGRUHV R QRGRV GH FRQPXWDFLyQ GH UHGHV FRQPXWDGDV.

 VyOR QHFHVLWDQ LPSOHPHQWDUKDVWDHOQLYHOGHUHGGHODWRUUH26..3      x 1LYHOGHWUDQVSRUWH9DDSURSRUFLRQDU    ¶ ¶ ´  WUHVVHUYLFLRV   ¶ ¶ ´  R &RQPXWDFLyQ ILDEOH H[WUHPR D H[WUHPR 3XHGHQ OOHJDU ORV GDWRV GHVRUGHQDGRV DO GHVWLQR GDWDJUDPDV. (O QLYHOGH UHG WLHQH TXH VHUHO PLVPRHQWRGDODUHG   (O QLYHO GH HQODFH\ ItVLFR SXHGHQ VHU (MHPSORV GH SURWRFRORV GH   GLVWLQWRVSDUDHOVLJXLHQWHVDOWR   QLYHOGHUHGVRQ.

 VL VLJXHQ GLVWLQWRV FDPLQRV H LQFOXVR SXHGH TXH DOJXQRV QR OOHJXHQ QR SRU HUURUHVHQHOPHGLRGHWUDQVPLVLyQ xSRUTXHVHDVHJXUDTXHGH$D%YDD OOHJDUVLQHUURUHVVHYHULILFDVDOWRDVDOWR.

VLQRSRU FRQJHVWLyQ1yWHVHTXH HV XQD UHG GH DOPDFHQDPLHQWR \ UHHQYtR TXH D XQ QRGR OOHJDQ PXFKRV SDTXHWHV\ORVYDDOPDFHQDQGRKDVWDTXHHOHQODFHGHVDOLGDTXHGDOLEUH6LOD PHPRULD VH OOHQD FRQJHVWLyQ.

 FXDQGR OOHJD XQ QXHYR SDTXHWH HO QRGR OR WLUD VHSLHUGH.

(OQLYHOGHWUDQVSRUWHGHEH UHRUGHQDUORVGDWRVHQYLDGRVDVt FRPRSHGLUDTXHOORVSDTXHWHVTXHQROHOOHJDQ R 2IUHFHU OD FDOLGDG GH VHUYLFLR GHPDQGDGD SRU HO XVXDULR TXH HO UHWDUGR Pi[LPRVHD[TXHKD\DXQUHWDUGRFRQVWDQWHHQWUHORVSDTXHWHV HM(QYtRGH YR].

 R 0XOWLSOH[DFLyQ GH DSOLFDFLRQHV $O HQYLDU PHQVDMHV GH YDULDV DSOLFDFLRQHV GLVWLQWDV SXHGHQ HVWDU LQWHUFDPELDQGR GDWRV HQWUH HO PLVPR RULJHQ \ HO PLVPRGHVWLQRGHUHV(M'HQLYHOGHWUDQVSRUWH8'37&3753 &RQ HO QLYHO GH WUDQVSRUWH WHQHPRV FRPXQLFDFLRQHV ILDEOHV HQWUH FXDOTXLHUPiTXLQDGHXQDUHG x 1LYHO GH VHVLyQ 5HDOL]D IXQFLRQHV GH RUJDQL]DFLyQ \ VLQFURQL]DFLyQ GH OD FRPXQLFDFLyQTXHVRQPHFDQLVPRVFRPSOHMRVTXHFRQVLJXHQGHWHUPLQDUHQTXH SXQWR VH HQFXHQWUD H[DFWDPHQWH OD FRPXQLFDFLyQ VL RFXUUH XQ HUURU IDWDO (M &DMHUR.

1RVHVXHOHXVDUVRQSDUDDSOLFDFLRQHVPX\HVSHFtILFDV x 1LYHOGHSUHVHQWDFLyQ5HDOL]DIXQFLRQHV R 5HSUHVHQWDFLyQ GH GDWRV 6H GHILQHQ PHFDQLVPRV LQGHSHQGLHQWHV GH OD PiTXLQD GH FRGLILFDFLyQ GH LQIRUPDFLyQ GH WDO PDQHUD TXH WRGDV ODV PiTXLQDVUHSUHVHQWHQORVGDWRVUHFLELGRVGHODPLVPDIRUPD ORVFDUDFWHUHV /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV /RVQLYHOHVGHVHVLyQSUHVHQWDFLyQ\DSOLFDFLyQVXHOHQREYLDUVHHQODSUiFWLFD\ VHFRQVLGHUDQFRPRDSOLFDFLRQHV (QODSDUWHVXSHULRUGHODWRUUH26.VHHQFXHQWUDODDSOLFDFLyQTXHTXLHUHHQYLDU XQRV GDWRV D RWUD PiTXLQD /RV GDWRV ORV SDVD DO QLYHO GH DSOLFDFLyQ TXH DxDGH XQD FDEHFHUDGHOQLYHOGHDSOLFDFLyQ (OFRQMXQWRGHORVGDWRV\ODFDEHFHUDIRUPDQXQD3'8 3URWRFRO'DWD8QLW.

R XQLGDGGHGDWRVGHSURWRFRORSDUDFDGDQLYHO $VtVHKDFHSDUDWRGRVORVQLYHOHV (QHOQLYHOGHHQODFHVHDxDGHDGHPiVGHODFDEHFHUDXQDFRODSDUDGHWHUPLQDU ODVWUDPDVSHURQRVLHPSUHHVDVt (OQLYHOItVLFRQRDxDGHQDGD &DGD QLYHO OR ~QLFR TXH SURFHVD HV OD FDEHFHUD \ HO UHVWR VH OR YD SDVDQGR DO QLYHOVXSHULRUKDVWDTXHDOILQDOORHQWUHJDDOGHVWLQR &DGDQLYHOWUDWDDODFDEHFHUDGHO QLYHOVXSHULRUFRPRVLIXHUDQGDWRV $3/.&$&.21 VHDQORVPLVPRVHWF.

'5 $61 R &RPSUHVLyQGHORVGDWRV R &LIUDGRGHORVGDWRV (QODSUiFWLFDHVWDVIXQFLRQHVVXHOHOOOHYDUVHDQLYHOGHDSOLFDFLyQ x 1LYHOGHDSOLFDFLyQ1RVRQODVDSOLFDFLRQHVVRQXQDVIXQFLRQHVGHXVRFRP~Q SDUD PXFKDV DSOLFDFLRQHV ODV DSOLFDFLRQHV HVWiQ SRU HQFLPD HM (QYtR GH ILFKHURV. (MHPSORV GH PRGHORV GH UHSUHVHQWDFLyQ VRQ .

62 6H GHVDUUROODQ GHQWUR GHO GHSDUWDPHQWR GH GHIHQVD DPHULFDQR HV HO PD\RU FOLHQWH GH 6: GHO PXQGR.(VWHQLYHOWLHQHXQDDUTXLWHFWXUDPX\FRPSOHMD 3XHGHRFXUULUTXHOD73'8VHDPD\RUTXHHOWDPDxRPi[LPRSHUPLWLGRSRUOR TXHVHKDGHIUDJPHQWDUHQHOQLYHOGHUHG 73'8 7+ 1+ (+ 1+ 1+        '$726 '$726 6+ '$726 7+ '$726 5+ '$726 (+ 7 '$726  3+ $+ '$726 $3/.3 x x x x 7ULXQIDURQIUHQWHDV.&$&.62 6RQPiVVHQFLOORVPHQRVDPELFLRVRV /DVLPSOHPHQWDFLRQHVVRQPiVIiFLOHVGHKDFHU\VDOHQDQWHVDOPHUFDGRTXHORV SURWRFRORVTXHGHILQH.21 &ROD         3URWRFRORV7&3.

 PXFKDV HPSUHVDV HPSLH]DQ D GHVDUUROODU HVWRV SURWRFRORV /XLV%5DPtUH]GHO3LQR  .

&$&.21(6 1RHOQLYHOGH DSOLFDFLRQHV.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV x /DDUTXLWHFWXUDTXHGHILQHHV 1R VH GLVHxy XQD DUTXLWHFWXUD VHJ~QODV QHFHVLGDGHV GH FRPXQLFDFLyQ VH LEDQ FUHDQGRSURWRFRORV\DVRFLiQGRODVFRQODDUTXLWHFWXUD 7&3.&$&. $3/.21(6        $3/.3 26.

6.7( 68%5(' /$1 (QFDPLQDGRUHVRURXWHUV JDWHZD\.17(55(' $&&(62$/$5(' ). 75$163257( .&2 68%5(' 68%5(' )5$0(5(/$< 68%5(' 6$7(/.

&DGD VXEUHG SXHGH VHU GLVWLQWD \ FRQ GLVWLQWRV SURWRFRORV XQD UHG SXHGH HVWDU FRPSXHVWDSRUXQFRQMXQWRGHVXEUHGHV 'HILQH FRPR VH UHDOL]D OD FRPXQLFDFLyQ HQWUH HTXLSRV FRQHFWDGRV D OD PLVPD VXEUHG(VWDFDSDKDUiPiVRPHQRVIXQFLRQHVGHSHQGLHQGRGHODFRPSOHMLGDGGHODUHG HM3XQWRDSXQWRIUDPHUHOD\.

 +DFH SRVLEOH TXH ORV GDWRV YLDMHQ HQWUH PiTXLQDV FRQHFWDGDV HQ VXEUHGHV GLVWLQWDV+DFHQHOHQFDPLQDPLHQWRDWUDYpVGHORVURXWHUV3DUDHOORVHUiQHFHVDULRGDU YDULRVVDOWRVGHRULJHQDGHVWLQRXWLOL]DQGRYDULRVHQFDPLQDGRUHV(OURXWHUHVXQHTXLSR TXHWLHQHHQODFHVDYDULDVVXEUHGHV HVWiFRQHFWDGRDGRVRPiVVXEUHGHV.

(VWRVGDWRV SRGUiQOOHJDUGHVRUGHQDGRV\FRQHUURUHV 'D XQ VHUYLFLR H[WUHPR D H[WUHPR ILDEOH QR KD\ SHUGLGD GH GDWRV \ OOHJDQ RUGHQDGRV.

\WRGRVORVSDUiPHWURVGH FDOLGDGGHOVHUYLFLRTXHH[LMDHOXVXDULR$VHJXUD TXHORVGDWRVOOHJXHQGHVGHODDSOLFDFLyQRULJHQDODDSOLFDFLyQGHGHVWLQRHQHOPLVPR RUGHQHWF  1LYHOGHVXEUHG  1LYHOGH.QWHUUHG  1LYHOGHWUDQVSRUWH /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 26. (VWiQ GLUHFWDPHQWH ODV DSOLFDFLRQHV HM (PDLO WHOQHW .

3 68%5(' '$726 38(572 1ž6(&8(1'.Ï1 75$163257( .3 68%5(' 5287(5 .1$/ $3/.3 68%5(' 68%5('    1LYHOGHDSOLFDFLyQ 6.1$/ $3/.QWHUUHG /RV SURWRFRORV GH WUDQVSRUWH \ DSOLDFLyQ VRQ SURWRFRORV H[WUHPR D H[WUHPR VROR HVWiQ LPSOHPHQWDGRVHQORVVLVWHPDVILQDOHV $3/.5.$ &21752/'((5525(6 6(*0(172 '.&$&.&$&.325.12 75$0$6 '$7$*5$0$6 /D  FDEHFHUD GH WUDQVSRUWH LQFOX\H HQ VX FDEHFHUD HO SXHUWR RULJHQ \ GHVWLQR DSOLFDFLRQHVRULJHQ\GHVWLQRGHORVGDWRV. HQ FRQWUDSRVLFLyQD 6.*(1'(67.Ï1 75$163257( .&$&.3 68%5(' (O HQFDPLQDGRU VROR LPSOHPHQWD ORV SURWRFRORV GH VXEUHV \ GH .67(0$).Ï1 75$163257( .67(0$).

 (OFRQWUROGHHUURUHVVLUYHSDUDVDEHUVLVHKDSHUGLGRDOJ~QSDTXHWHHQODUHG\ SHGLUODUHWUDQVPLVLyQ (VWHVHJPHQWRHVSDVDGRDOQLYHO.3 TXHVHJXUDPHQWHORSULPHURTXHKDJDVHD IUDJPHQWDUOR LQFOX\HQGR HQ FDGD IUDJPHQWR XQD FDEHFHUD /D FDEHFHUD .3 FRQWLHQH OD GLUHFFLyQ.3RULJHQ\GHVWLQRSDUDHQFDPLQDUODLQIRUPDFLyQHQWUHVXEUHGHVGHORULJHQDO GHVWLQR /RVGDWRVVHSDVDQDOQLYHOGHVXEUHG\VHOHVDxDGHXQDFDEHFHUD\XQDFROD/D FDEHFHUDLQFOX\HODGLUHFFLyQGHVXEUHGRULJHQ\GHVWLQRGHFDGDVDOWR VDOWRDVDOWR.

3 QR FDPELD.3VHFRQWUX\HQ VXFHVLYDV WUDPDV SDUD HO QLYHO GH VLEUHG \ HO SDTXHWH . /DWUDPDVH HQYtD DWUDYpVGHODUHG&RQHOSDTXHWH.

&$&.YV7&3.QWHUUHG 6XEUHG  . 7&3  6103 7)73 573 8'3  +773 6073 )73 .21(6 $SOLFDFLyQ       26.5 68%5(' 25. 7&3. (O URXWHU UHFLEHOD WUDPD H[WUDHODFDEHFHUD\ODFRQD\ODHQFDSVXODFRQODVXEUHG '.3 .12 6$/72$6$/72  &RPSDUDFLyQ26.3 7UDQVSRUWH .3 $70 /$1 35272&2/26 /XLV%5DPtUH]GHO3LQR 57&  .&03 263) 5.*(1 < '(67.3 $3/.

78VHOODPDQUHFRPHQGDFLRQHV \ VX IRUPDWR HV .787 WHOHFRPXQLFDFLRQHV.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  2UJDQLVPRVGHQRUPDOL]DFLyQ x x /DVQRUPDVVHGLYLGHQHQGRVWLSRV 'H IDFWR 6RQ DTXHOODV TXH DSDUHFHQ VLQ QLQJXQD LQWHQFLyQ GH FUHDUODV VLPSOHPHQWH SRU VX EUDQ GLIXVLyQ HQ HO PHUFDGR (Q HO PXQGR GH ODV FRPXQLFDFLRQHVODVQRUPDVGHLSVRVRQUDUDV 'H.78 8QLyQ LQWHUQDFLRQDO GH FRPXQLFDFLRQHV 'HSHQGLHQWH GH OD 218 &UHDGRHQ/DVQRUPDVTXHKDFHOD.XUH6RQQRUPDVFUHDGDVSRUDOJ~QRUJDQLVPRGHQRUPDOL]DFLyQOHJDOPHQWH DFHSWDGR (VWDEOHFLGRVSRURUJDQL]DFLRQHVLQWHUQDFLRQDOHV R .

 .785 UDGLRFRPXQLFDFLRQHV.

 (M .787  . /HWUD PD\XVFXODQ~PHUR.787 .

62 RUJDQL]DFLyQ . R .QWHUQDFLRQDO GH HVWDQGDUL]DFLyQ 7LHQH XQ iPELWR PXFKR PiV DPSOLR TXH HO GH ODV WHOHFRPXQLFDFLRQHV 6XUJLy HQ  FRPRDJUXSDFLyQGHRUJDQL]DFLRQHVGHQRUPDOL]DFLyQGHGLVWLQWRVSDtVHV HQ (VSDxD $(125.

$% &RPLWp GH DFWLYLGDGHV GH .QWHUQHW (VWDVQRUPDV VH OODPDQ57&¶V x /RVRUJDQLVPRVGHQRUPDOL]DFLyQVRQGHGRVWLSRV x /XLV%5DPtUH]GHO3LQR  .QWHUQHW &RPLWp GH  H[SHUWRV SDUD GHFLGLU TXH FRVDV HUD QHFHVDULR QRUPDOL]DU HQ .QVWLWXWR GH .((( .62 HVWi GLYLGLGR HQ  FRPLWpVWpFQLFRV TXH HVWDQGDUL]DQ GLVWLQWDV FRVDV HO 7& HVWDQGDUL]D RUGHQDGRUHV \ SURFHVDPLHQWRGHODLQIRUPDFLyQ 5HDOL]DGDVSRURUJDQLVPRVVLQiQLPRGHOXFUR R ..QJHQLHURV (OpFWULFRV \ (OHFWUyQLFRV +D SDWURFLQDGR DOJXQDVQRUPDVODVPiVLPSRUWDQWHVVRQODVQRUPDV/$1UHDOL]DGDVSRU HOFRPLWp R .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  7UDQVPLVLyQGHGDWRV 6WDOOLQJV.

 7HUPLQRORJtD /DWUDQVPLVLyQGHGDWRVHQWUHXQHPLVRU\XQUHFHSWRUVLHPSUHVHUHDOL]DDWUDYpV GHXQPHGLRGHWUDQVPLVLyQ/RVPHGLRVGHWUDQVPLVLyQVHSXHGHQFODVLILFDUHQJXLDGRV \QRJXLDGRV(QDPERVFDVRVODFRPXQLFDFLyQ VHUHDOL]DFRQRQGDVHOHFWURPDJQpWLFDV (QORVPHGLRVJXLDGRVFRPRSRUHMHPSORHQORVSDUHVWUHQ]DGRVORVFDEOHVFRD[LDOHV\ ODVILEUDVySWLFDVODVRQGDVVHWUDQVPLWHQFRQILQiQGRODVDORODUJRGHOFDPLQRItVLFR3RU HO FRQWUDULR ORV PHGLRV QR JXLDGRV SURSRUFLRQDQ XQD IRUPD GH WUDQVPLWLU ODV RQGDV HOHFWURPDJQpWLFDV SHUR VLQ HQFDX]DUODV FRPR SRU HMHPSOR HQ OD SURSDJDFLyQ D WUDYpV GHODLUHHOPDURHOYDFtR (O WHUPLQR HQODFH GLUHFWR KDFH UHIHUHQFLD DO FDPLQR GH WUDQVPLVLyQ HQWUH GRV GLVSRVLWLYRVHQHOTXHODVHxDOVHSURSDJDGLUHFWDPHQWHGHOHPLVRUDOUHFHSWRUVLQQLQJ~Q RWUR GLVSRVLWLYR LQWHUPHGLR TXH QR VHD XQ DPSOLILFDGRU R UHSHWLGRU (VWRV ~OWLPRV VH XVDQSDUDLQFUHPHQWDUODHQHUJtDGHODVHxDO (OPHGLRGHWUDQVPLVLyQJXLDGRHVSXQWRDSXQWR VL SURSRUFLRQD XQ HQODFH GLUHFWR HQWUH ORV GRV ~QLFRV GLVSRVLWLYRV TXH FRPSDUWHQ HO PHGLR (Q XQD FRQILJXUDFLyQ JXLDGD PXOWLSXQWR HO PLVPRPHGLRHVFRPSDUWLGRSRUPiVGHGRVGLVSRVLWLYRV 8Q PHGLR GH WUDQVPLVLyQ SXHGH VHUVLPSOH[ KDOIGXSOH[ R IXOOGXSOH[ (Q OD WUDQVPLVLyQVLPSOH[ ODVVHxDOHVVHWUDQVPLWHQVyORHQXQD~QLFDGLUHFFLyQ VLHQGRXQD HVWDFLyQ OD HPLVRUD \ RWUD OD UHFHSWRUD (Q KDOIGXSOH[ DPEDV HVWDFLRQHV SXHGHQ WUDQVPLWLU SHUR QR VLPXOWiQHDPHQWH (Q IXOOGXSOH[ DPEDV HVWDFLRQHV SXHGHQ LJXDOPHQWH WUDQVPLWLU SHUR DKRUD VLPXOWiQHDPHQWH (Q HVWH ~OWLPR FDVR HO PHGLR WUDQVSRUWD VHxDOHV HQ DPERV VHQWLGRV DO PLVPR WLHPSR 3RVWHULRUPHQWH VH H[SOLFDUi FyPRVHUHDOL]DHVWHWLSRGHWUDVPLVLyQ /D VHxDO HV OD UHSUHVHQWDFLyQ HQ IRUPD GH RQGDV HOHFWURPDJQpWLFDV GH OD LQIRUPDFLyQHPLWLGDSRUXQDHVWDFLyQ/DVHxDOHVXQDIXQFLyQGHOWLHPSRSHURWDPELpQ VHSXHGHUHSUHVHQWDUHQIXQFLyQGHODIUHFXHQFLDHVGHFLUODVHxDOHVWiFRQVWLWXLGDSRU FRPSRQHQWHVGHGLVWLQWDVIUHFXHQFLDV 7HQLHQGR HQ FXHQWD OD VHxDO FRPR IXQFLyQ GHO WLHPSR SRGHPRV WHQHU VHxDOHV FRQWLQXDV \GLVFUHWDV8QDVHxDOFRQWLQXDHVDTXHOODHQODTXHODLQWHQVLGDGGHODVHxDO YDUtDVXDYHPHQWHHQHOWLHPSR(VGHFLUQRVHSUHVHQWDQVDOWRVRGLVFRQWLQXLGDGHV/D GHILQLFLyQPDWHPiWLFDGHVHxDOHV6 W.

HVFRQWLQXDVL OLP 6 W .

6 D .

 D 8QD VHxDO GLVFUHWD HV DTXHOOD HQ OD TXH OD LQWHQVLGDG VH PDQWLHQH FRQVWDQWH GXUDQWH XQ GHWHUPLQDGR SHUtRGR GH WLHPSR WUDV HO FXDO OD VHxDO FDPELD D RWUR YDORU FRQVWDQWH /D VHxDO FRQWLQXD SXHGH FRUUHVSRQGHU D OD YR] \ OD GLVFUHWD D ORV YDORUHV ELQDULRV .

 W oD /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (OWLSRGHVHxDOHVPiVVHQFLOODVTXHVHSXHGHQFRQVLGHUDUVRQODVSHULyGLFDVTXH VH FDUDFWHUL]DQ SRU FRQWHQHU XQ SDWUyQ TXH VH UHSLWH D OR ODUJR GHO WLHPSR $ FRQWLQXDFLyQVHPXHVWUDXQHMHPSORGHVHxDOSHULyGLFDFRQWLQXD XQDRQGDVLQXVRLGDO.

\ XQHMHPSORGHVHxDOSHULyGLFDGLVFUHWD XQDRQGDFXDGUDGD.

 0DWHPiWLFDPHQWHXQDVHxDOV W.

VHGLFHTXHHVSHULyGLFDVL\VRORVL 6 W .

6 W  7 .

 W GRQGH OD FRQVWDQWH 7 HV HO SHUtRGR GH OD VHxDO 7 GHEH VHU HO PHQRU YDORU TXH FXPSOHODHFXDFLyQ.

(QFXDOTXLHURWURFDVRODVHxDOQRHVSHULyGLFD  I IUHFXHQFLD GH OD VHxDO 7 /D RQGD VHQR HV OD VHxDO FRQWLQXD IXQGDPHQWDO SRU H[FHOHQFLD &XDOTXLHU RQGD VHQRVHUHSUHVHQWDPHGLDQWHWUHVSDUiPHWURVODDPSOLWXG $.

ODIUHFXHQFLD I.

\ODIDVH N.

/DDPSOLWXGHVHOYDORUGHSLFRGHODVHxDOHQHOWLHPSRWtSLFDPHQWHHVWHYDORUVH PLGHHQYROWLRV/DIUHFXHQFLDHVODUD]yQ HQFLFORVSRUVHJXQGRR+HUW]LRV>+]@.

DOD TXH OD VHxDO VH UHSLWH 8Q SDUiPHWURHTXLYDOHQWH HV HO SHUtRGR 7.

 GHILQLGR FRPR OD FDQWLGDG GH WLHPSR WUDQVFXUULGR HQWUH GRV UHSHWLFLRQHV FRQVHFXWLYDV GH OD VHxDO SRU WDQWR7HQLHQGRHQFXHQWDODHFXDFLyQDQWHULRUVHREWLHQH  I 7 /DIDVHHVXQDPHGLGDGHODSRVLFLyQUHODWLYDGHODVHxDOGHQWURGHXQSHUtRGRGH ODPLVPD /DH[SUHVLyQJHQHUDOSDUDXQDRQGDVHQRLGDOHV V W .

$ÂVHQ Â3 IW  ) .

3HUtRGR 7 I 3HUtRGR 7 I 3DUDXQDVHxDOVHGHILQHODORQJLGXGGHRQGD FRPRODGLVWDQFLDTXHRFXSDXQ FLFOR HQ RWUDV SDODEUDV OD GLVWDQFLD HQWUH GRV SXQWRV GH LJXDO IDVH HQ GRV FLFORV FRQVHFXWLYRV 6XSyQJDVH TXH OD VHxDO VH SURSDJD D XQD YHORFLGDGY (Q HVH FDVR OD ORQJLWXGGHRQGDVHSXHGHUHODFLRQDUFRQHOSHULRGRGHODVHxDODWUDYpVGHODVLJXLHQWH H[SUHVLyQ O 7 ÂY GHIRUPDHTXLYDOHQWH O Â I Y (VIUHFXHQWHHOFDVRHQHOTXHY F HVWRHVHOFDVRHQHOTXHODYHORFLGDGGHSURSDJDFLyQHQHOPHGLRHVLJXDODODGH DOX] O HQHOHVSDFLROLEUHTXHFRPRHVVDELGRHVF ÂPV /RQJLWXGGHRQGD .

$QiOLVLVGH)RXULHU 7RGD VHxDO FRQWLQXD R GLVFUHWD.

 VH SXHGH GHVFRPSRQHU FRPR VXPD GH RQGDV VLQXVRLGDOHV GH GLVWLQWDV IUHFXHQFLDV \ DPSOLWXGHV 3RU OR JHQHUDO HO Qž GH RQGDV TXH KDFHQIDOWDHVLQILQLWR /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (O FRQMXQWR GH RQGDV VLQXVRLGDOHV GH GLVWLQWDV IUHFXHQFLDV TXH FRPSRQHQ OD VHxDO VH OODPD HVSHFWUR GH OD VHxDO (VH HVSHFWUR VH SXHGH REWHQHU PHGLDQWH OD WUDQVIRUPDGDGH)RXULHU W .

V W .

(VWD WUDQVIRUPDGD GH )RXULHU QRV SHUPLWH SDVDU GH XQD UHSUHVHQWDFLyQ HQ HO WLHPSRGHODVHxDODXQDUHSUHVHQWDFLyQHQIUHFXHQFLD 6L FRJHPRV RQGDV VHQR GH 6 W.

6 I.

ODVIUHFXHQFLDVGHOVHJXQGRJUiILFR $PSOLWXGHV FRQ OD DPSOLWXG6 I.

 REWHQHPRV OD I VHxDO6 W.

 W )UHFXHQFLDV /D7UDQVIRUPDGDGH)RXULHU GH XQD VHxDO YD D WHQHU XQ DVSHFWR HQ IXQFLyQ GH FyPR VHD HVD VHxDO (M 2QGD VLQXVRLGDO (V XQ VROR YDORU GH OD 6 W.

6 I.

IUHFXHQFLD\DPSOLWXGGHODVHxDO <D TXH OD WUDQVIRUPDGD GH W I )RXULHU HV OD VXPD GH VHxDOHV VLQXVRLGDOHV FRQ XQD ~QLFD RQGD VHQRTXHGDUtDUHSUHVHQWDGD (QJHQHUDOKD\FXDWURWLSRVGHWUDQVIRUPDGDV 6 I.

x 6XPD GH XQ Q~PHUR ILQLWR GH RQGDV &RPR HVWH I HMHPSORFRQRQGDV x 6XPD GH LQILQLWDV IUHFXHQFLDV 3RU HMHPSOR OD 6 I.

 WUDQVIRUPDGDGHXQDRQGDFXDGUDGD(QHVWHFDVRVL7 I IODWUDQVIRUPDGDWHQGUiSXQWRVHQIÂIÂI x 6XPD GH LQILQLWDV IUHFXHQFLDV LQILQLWDPHQWH 6 I.

MXQWDVXQDVGHODVRWUDV x 6XPD GH LQILQLWDV IUHFXHQFLDV TXH HV H[WLHQGHQ KDVWD HO LQILQLWR 6 I.

I (VWDV VHxDOHV KDQGHVHULQWHJUDEOHVSRUORTXHODVDPSOLWXGHV I YDQWHQGLHQGRDFHURSDUDTXHODVXPDVHDILQLWD (QWRGDWUDQVIRUPDGDVLHPSUHSRGHPRVLGHQWLILFDUODIUHFXHQFLDPiVDOWD SXHGH VHU LQILQLWR.

 \ OD PiV EDMD TXH VHD GLVWLQWD GH FHUR $ OD GLIHUHQFLD HQWUH DPEDV VH OH OODPDDQFKRGHEDQGD GHODVHxDO %:.

(VWHDQFKRGHEDQGDHV LQILQLWRxSDUDORVWLSRV \ (QORVFDVRVHQORVTXHHO%:HVLQILQLWRVHGHILQH 6 I.

HO $QFKR GH %DQGD (IHFWLYR D ODV IUHFXHQFLDV TXH VXPDQ   KDVWDHOGHODVHxDO $%( I (Q FRQFUHWR OD 6 W.

 GHULYDGD GHO  GH XQD RQGD LQILQLWD \ GH RWUDQR LQILQLWD TXH FRLQFLGD FRQ HO  GH OD SULPHUDVRQ WDQVLPLODUHV TXHPXFKDVDSOLFDFLRQHVODVFRQVLGHUDQLGpQWLFDV (ODQFKRGHEDQGDWDPELpQVHPLGHHQ+HUW]LRV 3RU~OWLPRLQGLFDUTXHKD\HVSHFWURVRQGH6 .

 \RWURVGRQGH6 .

(O YDORUHQHOSXQWR 6 .

VHOODPDFRQSRQHQWHFRQWLQXDGHODVHxDO\ HTXLYDOHDOYDORU PHGLRGHODVHxDO HQHOGRPLQLRGHOWLHPSR /XLV%5DPtUH]GHO3LQR  ³ ³ f f f f [ I .

ÂH M3IW GW 6 I .

ÂH M  3IW GI .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (OFRPSRUWDPLHQWRGHORVPHGLRVGHWUDQVPLVLyQHVGLVWLQWRVHJ~QODIUHFXHQFLD /DV VHxDOHV DO YLDMDUGLVPLQX\HQ VX $ DPSOLWXG SRU YDULRV SUREOHPDV FDORU .

 (VWD DWHQXDFLyQ HV GLVWLQWD VHJ~Q OD IUHFXHQFLDGHODVHxDOSRUORTXHODVHxDO ) SRGUtDOOHJDUFRQDPSOLWXG$\ODVHJXQGD $ FRQXQDDPSOLWXGGH$ $GHPiVODYHORFLGDGGHWUDQVPLVLyQ WDPELpQFDPELDFRQODIUHFXHQFLDDXQTXHHO FDPELRHQODYHORFLGDGVHQRWDPHQRVTXHHO ) GHODDPSOLWXG 6LORTXHVHWUDQVPLWHHVODVXPDGHODVGRVVHxDOHVODVHxDOGHVWLQRVHSDUHFHUi SRFR D OD RULJLQDO \D TXH XQD FRPSRQHQWH VH DWHQXD PHQRV TXH OD RWUD 6 GHFLU FDGD FRPSRQHQWHGHXQDWUDQVIRUPDGDVHDWHQ~DGHXQDIRUPDGLVWLQWD /DUHVSXHVWDRFRPSRUWDPLHQWRHQIUHFXHQFLD GHXQPHGLRGHWUDQVPLVLVLyQHVOD DWHQXDFLyQTXHYDDLQWURGXFLUHQORVGLVWLQWRVFRPSRQHQWHVGHODIUHFXHQFLD 6H UHSUHVHQWD HQ HO GRPLQLR GH OD IUHFXHQFLD LQGLFDQGR FyPR DWHQ~D SDUD ORV GLVWLQWRVYDORUHVGHIUHFXHQFLD (V GHFLU DQWH  VHxDOHV FRQ OD PLVPD DPSOLWXG \   IUHFXHQFLDV I I \ I OD DPSOLWXG GH VDOLGD VHUtDÂ%Â% \  I I I I I Â%SDUDFDGDXQDGHHOODV6LVHWUDQVPLWHFRQXQDIUHFXHQFLD IQODVDOLGDWHQGUiXQDDPSOLWXG3RU~OWLPRODUHODFLyQHQWUH$ DPSOLWXGRULJLQDO.

\ % DPSOLWXGPi[LPDHQUHFHSFLyQ.

GHSHQGHGHODORQJLWXGGHOFDEOH (ODQFKRGHEDQGDGHXQPHGLR HVODGLIHUHQFLDHQWUHODIUHFXHQFLDPiVDOWD\OD PiVEDMDTXHSXHGHQDWUDYHVDUGLFKRPHGLRGHFRPXQLFDFLyQ (O PHGLR GH WUDQVPLVLyQ LGHDO WHQGUtD HVWD IRUPD  (V GHFLU XQD IUHFXHQLFD R QR SDVD R SDVD FRQ DWHQXDFLyQ (Q OD UHDOLGDG OD UHVSXHVWD GH XQ PHGLR UHDO WLHQH XQD ]RQD FHQWUDO FDVL SODQD SHUR I I DODFHUFDUVHDI \I FDHUiODUHVSXHVWD   3DUD PHGLRV PHWiOLFRV .

 HVWD UHVSXHVWD HVPX\UHJXODUSHURSDUDHODLUHODUHVSXHVWDHV .

.

LUUHJXODU .

 I I I I 6LVHHQYtDXQDVHxDOHVSHFWURHQWUHI \I FXDQGRHOPHGLRDGPLWHHQWUHI \IODVDOLGDHQWUHI \I VHUiµQDGD¶HQWUHI \I VHUi SDUHFLGRDORULJLQDO\OD]RQDHQWUHI \I QRSDVDUi             5HVSXHVWD0HGLR 6HxDO(VSHFWUR  I ) I I I I I 6HxDOVDOLGDHVSHFWUR I I I I I (V GHFLU VL OD UHVSXHVWD GHO  PHGLR HVWi HQWUH I \ I VyOR VH SXHGHQ HQYLDU VHxDOHVGHQWURGHODQFKRGHEDQGDHIHFWLYRHQWUHI \I $GHPiVHQXQPHGLRGHWUDQVPLVLyQUHDOFRPRKD\]RQDVLQWHUPHGLDVHQWUH\ FHUFDGHORVERUGHVSDUDWUDQVPLWLUXQDVHxDOFRQXQ%: :HODQFKRGHEDQGDKDGH VHUDSUR[LPDGDPHQWH: (Q FRQFUHWR HO DQFKR GH EDQGD GH XQD 0HGLR 6HxDO VHxDO GLJLWDO GHSHQGHUi GH OD WpFQLFD GH 5HDO FRGLILFDFLyQ \ GH OD YHORFLGDG GH WUDQVPLVLyQ TXH QR HV OR PLVPR TXH OD GH SURSDJDFLyQ.

 (O I : I : DQFKR GH EDQGD GHOPHGLROLPLWDUi HO %: GH OD   /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV VHxDOTXHSXHGRPHWHU\SRUFRQVLJXHLQWHODYHORFLGDGGHWUDQVPLVLyQ $QDOyJLFR\GLJLWDOHVDVLPLODEOHDFRQWLQXR\GLVFRQWLQXR\SXHGHVHUDSOLFDGR DORVGDWRVODVHxDO\ODWUDQVPLVLyQ /RVGDWRV LQIRUPDFLyQ.

SXHGHQVHUDQDOyJLFRVRGLJLWDOHV/RVSULPHURVSRGUtDQ WRPDUFXDOTXLHUYDORUHQXQLQWHUYDORFRQWLQXR ODYR]\DTXHVRQRQGDVGHSUH VLyQ.

2V GDWRVGLJLWDOHVVyORSXHGHQWRPDUFLHUWRVYDORUHVFRQFUHWRV WH[WRHQ$16.

(VWRVGDWRV VHUHSUHVHQWDQPHGLDQWHVHxDOHV 8QDVHxDOHVDQDOyJLFDFXDQGRHVFRQWLQXDHVGHFLUVXDPSOLWXGYDUtDGHIRUPD FRQWLQXD\HVGLJLWDOFXDQGRHVGLVFUHWD&XDOTXLHUWLSRGHGDWRV $QDOyJLFRR'LJLWDO.

 SXHGHVHUWUDQVPLWLGRGHFXDOTXLHUDGHODVIRUPDV3RUHMHPSOR 'DWRV 6HxDO 7HOpIRQR $ $ 3& 02'(0.

' $ &2'(/ 9R]RYtGHRGLJLWDOL]DGR.

$ ' 7UDQVPLVRUGLJLWDO 3&.

' ' 8QWUDQVPLVRUGLJLWDOVHQFLOORVHEDVDHQDVLJQDUYDO\±YDOGLJLWDO 3RU ~OWLPR OD WUDQVPLVLyQ GH OD VHxDO GHO RULJHQ DO GHVWLQR WDPELpQ SXHGH VHU $QDOyJLFDR'LJLWDO x 6HUiDQDOyJLFDFXDQGRODVHxDOVHSURSDJDDEDVHGHDPSOLILFDGRUHV x 6HUiGLJLWDOVLVHSURSDJDDEDVHGHUHSHWLGRUHV  7UDQVPLVLyQGHGDWRVDQDOyJLFD\GLJLWDO 8Q DPSOLILFDGRU VLPSOHPHQWH DXPHQWD OD DPSOLWXG GH OD RQGD SRU XQ GHWHUPLQDGR YDORU SHM [.

6X SUREOHPD HV TXH WDPELpQVH DPSOLILFD HO UXLGR \ ODV SHUWXUEDFLRQHV 8Q UHSHWLGRU SXHGH VHU XVDGR VROR FRQ VHxDOHV GLJLWDOHV (Q FRQFU HWR QR DPSOLILFD VLQR TXH OHH OD VHxDO \ OD UHWUDQVPLWH VLQ SHUWXUEDFLRQHV.

 FRQ OD PLVPD DPSOLWXG TXH HO RULJLQDO 6RQ PiV FRPSOHMRV \ PiV FDURV DKRUD QR WDQWR.

 SHUR VH SXHGHQ XVDU WDQWRV FRPR VH TXLHUD VLQ HVWURSHDU OD VHxDO D GLIHUHQFLD GH ORV DPSOLILFDGRUHV.

 3RU HVR VH WLHQGH D XVDU WUDQVPLVLyQ GLJLWDO $GHPiV ODV VHxDOHV GLJLWDOHVRFXSDQPHQRVDQFKRGHEDQGD  $WHQXDFLyQ (VWDVSHUWXUEDFLRQHVSXHGHQVHUDWHQXDFLyQGLVWRUVLyQGHUHWDUGRRUXLGR  3HUWXUEDFLRQHVHQODWUDQVPLVLyQ (V OD SHUGLGD GH HQHUJtD TXH RIUHFH OD VHxDO VHJ~Q YLDMD SRU HO PHGLR (VWR RFXUUHHQWRGRVORVPHGLRVSRU HMHPSORHQXQFDEOHPHWiOLFROD DPSOLWXGEDMDSRU OD UHVLVWHQFLD GH ORVHOHFWURQHV OR TXH KDFH TXH DSDUH]FD XQ FDOHQWDPLHQWR HQ HO FDEOH \ SRU OD JHQHUDFLyQ GH UDGLDFLRQHV HOHFWURPDJQpWLFDV \D TXH WRGR FDEOH IXQFLRQD FRPR XQDDQWHQDTXHUDGLDSDUWHGHODVHxDOTXHFRQGXFH /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV &DORU 6L OODPDPRV  3L \ 3R D OD SRWHQFLD HQ ZDWLRV.

 GH OD HQWUDGD \ OD VDOLGD OD DWHQXDFLyQ HQGHFLEHOLRV.

HV 3 $ G% .

ÂORJ L 3R (QHOPHGLRLGHDO3L 3R \ $ 'E \ HQHOSHRUGHORVFDVRV3R  SRUORTXH $ f G% 6H XVDQ ORV G% FRPR PHGLGD \D TXH HVSHFLDOPHQWH HQ PHGLRV JXLDGRV OD DWHQXDFLyQHVSURSRUFLRQDODODORQJLWXGGHOFDEOH HQPHGLGDVORJDUtWPLFDV.

 3L Z 3 Z 3R Z 6L W.

5DGLDFLyQ 6R W.

$GHPiVODDWHQXDFLyQWDPELpQGHSHQGHGHODIUHFXHQFLDSRUORTXHQRW\RGDVODV IUHFXHQFLDVVXIUHQODPLVPDDWHQXDFLyQHQXQPHGLR  'LVWRUVLyQGHUHWDUGR /D YHORFLGDG GH SURSDJDFLyQ GH ODV VHxDOHV HQ XQ PHGLRYDUtDFRQOD IUHFXHQFLD (VWDGLIHUHQFLD HVDOJRPiV DSUHFLDEOHHQORVPHGLRVPHWiOLFRV  5XLGR Y &XDOTXLHUHPLVLyQQRGHVHDGDTXHVHLQVHUWHHQWUHHOHPLVRU\HOUHFHSWRU (PLVRU 5HFHSWRU I I 5XLGR 6HJ~Q HO RULJHQ GHO UXLGR HVWH SXHGH VHU GH FXDWUR WLSRV WpUPLFR GH LQWHUPRGXODFLyQGHGLDIRQLDHLPSXOVLYR x 7pUPLFR 5XLGR EODQFR R JDXVVLDQR SURYLHQHGH OD DJLWDFLyQ GH ODV PROpFXODV GHOPHGLRGHWUDQVPLVLyQGHELGRDODWHPSHUDWXUD 1 : .

. OD FRQVWDQWH GH %ROW]PDQ Â -XOLRVžN. Â7 Â%: 6LHQGR .

HOYLQ\%ZHODQFKRGHEDQGD HQKHUW]LRV. 7 OD WHPSHUDWXUDHQJUDGRV.

 x ËQWHUPRGXODFLyQ 7LHQHVXRULJHQHQQROLQHDOLGDGHVGHOPHGLRGHWUDQVPLVLyQ 3HUR VL I II II PHWHPRV SRU I 5XLGRGHLQWHUPRGXODFLyQ III I Q II.

Q I I.

/XLV%5DPtUH]GHO3LQR  .

PSXOVLYR(VXQUXLGRLUUHJXODUFRQVLVWLHQGRHQXQSLFRGHFRUWDGXUDFLyQTXH VH LQWURGXFH HQ HO PHGLR GH WUDQVPLVLyQ \ WLHQH XQD DPSOLWXG UHODWLYDPHQWH JUDQGH 8QD FDXVD SXHGHQ VHU ODV WRUPHQWDV HOpFWULFDV ORV WXERV IOXRUHVFHQWHV TXHFRQVXPHQPXFKDHQHUJtDDOHQFHQGHUVHSXGLHQGRDIHFWDUDFDEOHVFHUFDQRV 3DUDOD WUDQVPLVLyQ DQDOyJLFD OD DWHQXDFLyQ LQWHUPRGXODFLyQ \ OD GLDIRQtD VRQ GDxLQDV SXHV WUDQVIRUPDQ OD VHxDO REWHQLHQGR DOJR D OD VDOLGD HQ GRQ GH HV GLItFLO GLVFHUQLUTXHHVVHxDO\TXHHVUXLGR 3DUD OD WUDQVPLVLyQ GLJLWDO QR VRQ WDQ SUREOHPiWLFRV 6LQ HPEDUJR HO UXLGR LPSXOVLYR HV SHRU SRU OD WUDQVPLVLyQ GLJLWDO SLVWD DO UHYpV. x .6LVWHPDVGH&RPXQLFDFLyQGH'DWRV HMHPSORODVXPDGHGRVRQGDVVHQR x 'LDIRQtD 6H GHEH DO DFRSODPLHQWR HOpFWULFR HQWUH PHGLRV GH WUDQVPLVLyQ FHUFDQRV GH IRUPD TXH SDUWH GH OD VHxDOGH XQ PHGLR SDVD FRPR UXLGR DO RWUR PHGLR(QLQJOpVVHOODPD&52667$/.

+]KDVWD7+].DELWVVHJXQSLFRGHFHQWpVLPDQRVFDPELDXQSRUXQ6HFRUULJHQ FRQWpFQLFDVGHGHWHFFLyQ\FRUUHFFLyQGHHUURUHV  &DSDFLGDGGHXQFDQDO (VWDFDSDFLGDGUHSUHVHQWDHOQ~PHURPi[LPRGHELWVSRUVHJXQGRGHXQPHGLR (ODQFKRGHEDQGDGHXQPHGLRHVOLPLWDGR x )tVLFDPHQWHSRUODUHVSXHVWDHQIUHFXHQFLDHVWiOLPLWDGRSRUODLQIRUPDFLyQTXH VH SXHGH PHWHUHQ VX %: (VWH %: SRGUtD VHUPX\ JUDQGHSHURHVWi VLHPSUH OLPLWDGR SHHQHOYDFtRVHSXHGHWUDQVPLWLUGHVGH.

3RUORTXH QR VH GHMD WUDQVPLWLU HQ WRGR HO %: VLQR TXH VH GLYLGH HQ FDQDOHV XQRV SDUD UDGLRSDUD79SDUDPyYLOHVVDWpOLWH x (FRQyPLFDPHQWHODEDQGDDVLJQDGDDOPHGLRGHFRPXQLFDFLyQ $OJXQRVPHGLRVWLHQHQXQ%:PX\DOWR\ODVHxDOODWLHQHPX\EDMDSRUORTXH VHVXHOHGLYLGLUHQFDQDOHV\VHDVLJQDXQFDQDODFDGDXVXDULR 'LYLGLPRV HQ YDULRV FDQDOHV \ OH DVLJQDPRV D FDGD XVXDULR XQ FDQDO SHUR FRQ OD 0HGLR IUHFXHQFLD TXH KD\ TXH WUDQVPLWLU I OHVREUD 9DPRV D GLVSRQHU GH XQ 6HxDO DQFKR GH EDQGD OLPLWDGR \D ELHQ VHD GHO PHGLR R GH XQ VROR FDQDO.

 1RV SUHJXQWDUHPRV FXDQWRV ELWV SRU VHJXQGR SRGUpWUDQVPLWLUFRQHVHDQFKRGHEDQGD 9DDKDEHUFXDWURIDFWRUHV x & ELWVVHJ.

!&DSDFLGDG x %: +].

!$QFKRGHEDQGD x 1 ZDWW.

!5XLGR x 3H  .

 ! 7DVD GH HUURUHV R SRVLELOLGDG GH HUURU TXH WROHUDPRV ELWV TXH VHUHPRVFDSDFHVGHUHFLELUPDO.

 )LMDGRVIDFWRUHVHOFXDUWRYLHQHGDGR /D UDPD GH ODV WHOHFRPXQLFDFLRQHV TXH HVWXGLD HVWR VH OODPD ³WHRUtD GH OD LQIRUPDFLyQ´ /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 6XSRQJDPRV XQ FDQDO VLQ UXLGR FRQ XQ DQFKR GH EDQGD %: +HUW]LRV \ HQ HO TXHVHHPSOHDXQDFRGLILFDFLyQDGRVQLYHOHV SDUDXQHQYtR±Y\SDUDHOHQYtRY RVHDVyORGRVQLYHOHVGHYROWDMH.

1\TXLVWGHPRVWUyTXHHQHVWHPHGLR § ELWV · &¨ ¨ VHJ ¸ Â%: ¸ © ¹ 6LWHQHPRVXQDQFKRGHEDQGDGH.EVHJ 6H SRGUtDQ WUDQVPLWLU PiV ELWV SRU VHJXQGR SHUR HPSOHDQGR FRGLILFDFLyQ PXOWLQLYHO FRQVLVWHQWH HQ DJUXSDU YDULRV ELWV DVLJQDQGR D FDGD JUXSR XQ YDORU GH WHQVLyQ 0XOWLQLYHOFRQFXDWURQLYHOHV 0 .+]SRGUHPRVWUDQVPLWLU.

VHFRJHGHHQORVELWV            6LFRJHPRVELWV0  QLYHOHVGHWHQVLyQ & ELWV .

Â%: ÂORJ  0 VHJ 6L TXHUHPRV HQYLDU PXFKRV ELWV SRU VHJXQGR GHEHUtDPRV WHQHU XQ 0 PX\ JUDQGHORTXHLPSOLFDPtQLPDVGLIHUHQFLDVHQWUHORVQLYHOHVFRQORTXHDOPiVPtQLPR UXtGRIDOODUtDHOHQYtR6yORVHUtDSRVLEOHHQXQPHGLROLEUHGHHUURUHV¢(QXQFDQDOFRQ UXLGRFXDQGRSXHGHVHUHOYDORUGH0" &DQDOFRQUXLGR ODUHODFLyQVHxDOUXLGRDODVDOLGDGHOFDQDOHVODGLYLVLyQHQWUH6 \1 VHxDO\UXLGR.

 6 :DWWV .

6 6 ÂORJ 1 G% 1 :DWWV .

1 3DUDXQVLVWHPDDVt6KDQRQHQGHPRVWUyTXH .

(VODFDQWLGDGGHELWVDWUDQVPLWLUVLQHUURUHV %:  +] 61.

G% G% 61.

GE ORJ 61.

(MHPSOR/tQHDWHOHIyQLFDEiVLFD 6· § & § ELW ¨ VHJ · ÂORJ  ¨  ¸ ¸ © ¹ 1¹ © /LPLWHGH6KDQRQ +] I +] /D PD\RU SDUWH GH OD YR] VH FRQFHQWUD HQWUH \+] /DSRWHQFLDGHODYR]DOWHOpIRQRHVYHFHVVXSHULRUDO UXLGRTXHVHJHQHUDHLQWHUILHUH & ÂORJ .

 ELWVVHJ RVHDTXHGHLJXDOTXHWHFRPSUHVXQ 02'(0GH.

61   (VWDIRUPXODQRVGLFHHOPi[LPRSHURQRFyPRDOFDQ]DUOR1RVGDHOUpJLPHQ ELQDULRQDGDPiV $ODYLVWDGHODIRUPXOD¢TXpVHSXHGHKDFHUSDUDDXPHQWDUHOUpJLPHQELQDULR" $XPHQWDUHO%:ODSRWHQFLDGHODVHxDO 6.

RGLVPLQXLUHOUXLGR 1.

1RHVWDQVHQ FLOOR HO UXLGR HV SRU FDXVDV H[WHUQDV $XPHQWDU HO %: WLHQH XQ HIHFWR GH DXPHQWR GH OD /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV WHPSHUDWXUD\SRUHOORGHOUXLGR$XPHQWDUODSRWHQFLDGHODVHxDOQRVOOHYDDLQWURGXFLU QROLQHDOLGDGHVDXPHQWDQGRHOUXLGRGHLQWHUPRGXODFLyQ  0HGLRVGHWUDQVPLVLyQ 3XHGHQ VHU JXLDGRV SDU WUHQ]DGR FRD[LDO R ILEUD ySWLFD.

 R QR JXLDGRV PLFUR  RQGDVUDGLRHLQIUDUURMR.

  3DUWUHQ]DGR  *XLDGRV (VHOPHGLRPiVEDUDWR\PiVXVDGR 'HVFULSFLyQItVLFD 6RQGRVKLORVGHFREUHXQRHQYXHOWRVFRQXQDLVODQWH\HQWUHFUX]DGRVHQIRUPD GHHVSLUDO&DGDSDUGHFDEOHVFRQVWLWX\HVyORXQHQODFHGHFRPXQLFDFLyQ7tSLFDPHQWH VH XWLOL]DQ KDFHV HQ ORV TXH VH HQFDSVXODQ YDULRV SDUHV PHGLDQWH XQD HQYROWXUD SURWHFWRUD (Q DSOLFDFLRQHV GH ODUJD GLVWDQFLD OD HQYROWXUD SXHGH FRQWHQHU F LHQWRV GH SDUHV (O XVR GHO WUHQ]DGR WLHQGH D GLVPLQXLU ODV LQWHUIHUHQFLDV HOHFWURPDJQpWLFDV GLDIRQtD.

 ³3ULYDWH %UDQFK ([FKDQJH´.JXDOPHQWHGHQWURGHXQHGLILFLRGH RILFLQDV FDGD WHOpIRQR VH FRQHFWD D OD FHQWUDO SULYDGD 3%.HQWUHORVSDUHVDG\DFHQWHVGHQWURGHXQDPLVPDHQYROWXUD3DUDHVWHILQORV SDUHV DG\DFHQWHV GHQWUR GH XQD PLVPD HQYROWXUD SURWHFWRUD VH WUHQ]DQ FRQ SD GH VRV WRUVLyQGLIHUHQWHV7tSLFDPHQWHSDUDHQODFHVGHODUJDGLVWDQFLDODORQJLWXGGHOWUHQ]DGR YDUtD HQWUH  \  FP /RV FRQGXFWRUHV TXH IRUPDQ HO SDU WLHQHQ XQ JURVRU TXH YDUtD WtSLFDPHQWH HQWUH  \  SXOJDGDV &RP~QPHQWH HQ FRPXQLFDFLRQHV HV Pi V IUHFXHQWHHOGHSDUHV $SOLFDFLRQHV 7DQWRSDUDVHxDOHVDQDOyJLFDVFRPRSDUDVHxDOHVGLJLWDOHVHOSDUWUHQ]DGRHVFRQ GLIHUHQFLDHOPHGLRGHWUDQVPLVLyQPiVXVDGR3RUVXSXHVWRHVHOHPHGLRPiVXVDGRHQ ODV UHGHV GH WHOHIRQtD LJXDOPHQWH VX XVR HV EiVLFR HQ HO HVWDEOHFLPLHQWR GH UHGHV GH FRPXQLFDFLyQGHQWURGHHGLILFLRV (QWHOHIRQtDHOWHUPLQDOGHDERQDGRVHFRQHFWDDODFHQWUDOORFDOPHGLDQWHFDEOH GHSDUWUHQ]DGRGHQRPLQDGR³EXFOHGHDERQDGR´.

 PHGLDQWH XQ SDU WUHQ]DGR (VWDV LQVWDODFLRQHV EDVDGDV HQ SDUHV WUHQ]DGRV VH GLVHxDURQ SDUD WUDQVSRUWDU WUiILFR GH YR] PHGLDQWH VHxDOL]DFLyQ DQDOyJLFD 1R REVWDQWHFRQHOXVRGHORVPyGHPVHVWDLQIUDHVWUXFWXUDSXHGHXWLOL]DUVHSDUDWUDQVSRUWDU WUiILFRGLJLWDODYHORFLGDGHVGHWUDQVPLVLyQUHGXFLGDV (Q DSOLFDFLRQHV GLJLWDOHV HO SDU WUHQ]DGR HV LJXDOPHQWH HO PiV XWLOL]DGR 7tSLFDPHQWHORVSDUHVWUHQ]DGRVVHXWLOL]DQSDUDODVFRQH[LRQHVDOFRQPXWDGRUGLJLWDOR DOD3%.ESV(OSDUWUHQ]DGRVHXWLOL]DWDPELpQ HQUHGHVGHiUHDORFDOGHQWURGHHGLILFLRVSDUDORV0ESV1RREVWDQWHUHFLHQWHPHQWH VH DK GHVDUUROODGR UHGHV GH iUHD ORFDO FRQ YHORFLGDG GH  0ESV PHGLDQWH SDUHV WUHQ]DGRV DXQTXH HVWDV FRQILJXUDFLRQHV HVWiQ EDVWDQWH OLPLWDGDV SRU HO Q~PHUR GH SRVLEOHVGLVSRVLWLYRVFRQHFWDGRV\H[WHQVLyQJHRJUiILFDGHODUHG3DUDDSOLFDFLRQHVGH /XLV%5DPtUH]GHO3LQR  .GLJLWDOFRQYHORFLGDGHVGHKDVWD.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV ODUJD GLVWDQFLD HO SDU WUHQ]DGR VH SXHGH XWLOL]DU D YHORFLGDGHV GH  0ESV R LQFOXVR PD\RUHV (O SDU WUHQ]DGR HV PXFKR PHQRV FRVWRVR TXH FXDOTXLHU RWUR PHGLR GH WUDQVPLVLyQ JXLDGR FDEOH FRD[LDO \ ILEUD ySWLFD.

 \ D OD YH] HV VHQFLOOR GH PDQHMDU $KRUDELHQFRPSDUDGRFRQORVDQWHULRUHVHVWiPiVOLPLWDGRHQWpUPLQRVGHYHORFLGDGGH WUDQVPLVLyQ\GHGLVWDQFLDPi[LPD &DUDFWHUtVWLFDVGHWUDQVPLVLyQ /RVFDEOHVGHSDUHVVHSXHGHQXVDUSDUDWUDQVPLWLUWDQWRVHxDOHVDQDOyJLFDVFRPR GLJLWDOHV 3DUD VHxDOHV DQDOyJLFDV VH QHFHVLWDQ DPSOLILFDGRUHV FDGD    .P 3DUD VHxDOHVGLJLWDOHVVHUHTXLHUHQUHSHWLGRUHVFDGDR.P &RPSDUDGR FRQ RWURV PHGLRV JXLDGRV FRD[LDO \ ILEUD ySWLFD.

 HO SDU WUHQ]DGR SHUPLWHPHQRUHVGLVWDQFLDVPHQRUDQFKRGHEDQGD\PHQRUYHORFLGDGGHWUDQVPLVLyQ (VWHPHGLRVHFDUDFWHUL]DSRUVXJUDQ VXVFHSWLELOLGDGDODVLQWHUIHUHQFLDV\DOUXLGRSRU HMHPSOR FDPSRV HOHFWURPDJQpWLFRV H[WHULRUHV SXHGHQDIHFWDUOH QHJDWLYDPHQWH$Vt SRU HMHPSORXQFDEOHFRQGXFWRUVLWXDGRHQSDUDOHORFRQXQDOtQHDGHSRWHQFLDTXHFRQGX]FD FRUULHQWH DOWHUQD VH YHUi QHJDWLYDPHQWH DIHFWDGR SRU pVWD (O UXLGR LPSXOVLYR WDPELpQ DIHFWDDORVSDUHVWUHQ]DGRV 3DUD UHGXFLU HVWRV HIHFWRV QHJDWLYRV HV SRVLEOH WRPDU DOJXQDV PHGLGDV 3RU HMHPSOR HO DSDQWDOODPLHQWR GHO FDEOH FRQ XQD PDOODPHWiOLFD UHGXFH ODVLQWHUIHUHQFLDV H[WHUQDV(OWUHQ]DGRHQORVFDEOHVUHGXFHODVLQWHUIHUHQFLDVGHEDMDIUHFXHQFLD\HOXVR GHGLVWLQWRVSDVRVGHWRUVLyQHQWUHSDUHVDG\DFHQWHVUHGXFHODGLDIRQtD 3DUD OD VHxDOL]DFLyQ DQDOyJLFD SXQWR D SXQWR XQ SDU WUHQ]DGR SXHGH RIUHFHU KDVWDN+]GHDQFKRGHEDQGD(QHOFDVRGHVHxDOL]DFLyQGLJLWDOSXQWRDSXQWRGH ODUJD GLVWDQFLD VH SXHGHQ FRQVHJXLU GHO RUGHQ GH XQRV SRFRV 0ESV SDUD GLVWDQFLDV FRUWDVDFWXDOPHQWH\DKD\GLVSRQLEOHVSURGXFWRVFRPHUFLDOHVTXHDOFDQ]DQORVESV 3DUHVWUHQ]DGRVDSDQWDOODGRV\VLQDSDQWDOODU +D\ GRV YDULDQWHV GH SDUHV WUHQ]DGRV DSDQWDOODGR \ VLQ DSDQWDOODU (O SDU WUHQ]DGR QR DSDQWDOODGR 873 ³8QVKLHOGHG 7ZLVWHG 3DLU´.

 HV HO PHGLR KDELWXDO HQ WHOHIRQtD $FWXDOPHQWH HV SUiFWLFD KDELWXDO HQ HO FDEOHDGR GH HGLILFLRV XW OL]DQGR L GLPHQVLRQHVTXHHVWiQPX\SRUHQFLPDGHODVQHFHVLGDGHVUHDOHVGHORTXHVHQHFHVLWD SDUDWHOHIRQtD(VWRHVDVt\DTXHKR\SRUKR\HOSDUVLQDSDQWDOODUHVHOPHQRVFDURGH WRGRVORVPHGLRVGHWUDQVPLVLyQTXHVHXVDQHQODVUHGHVGH iUHD ORFDODGHPiVGHVHU IiFLOGHLQVWDODU\GHPDQLSXODU (O SDU WUHQ]DGR VLQ DSDQWDOODU VH SXHGH YHU DIHFWDGR SRU LQWHUIHUHQFLDV HOHFWURPDJQpWLFDV H[WHUQDV LQFOX\HQGR LQWHUIHUHQFLDV FRQ SDUHG FHUFDQRV \ IXHQWHV GH UXLGR 8QD PDQHUD GH PHMRUDU ODV FDUDFWHUtVWLFDV GH WUDQVPLVLyQ GH HVWH PHGLR HV HPEXWLpQGRORGHQWURGH XQDPDOODPHWDOLFD UHGXFLpQGRVH DVtODVLQWHUIHUHQFLDV(OSDU WUHQ]DGRDSDQWDOODGR 673³6KLHOGHG7ZLVWHG3DLU´.

SURSRUFLRQD PHMRUHVUHVXOWDGRVD YHORFLGDGHV GH WUDQVPLVLyQ EDMDV $KRUD ELpQ HVWH ~OWLPR HV PiV FRVWRVR \ GLItFLO GH PDQLSXODUTXHHODQWHULRU (QHOSDUWUHQ]DGRDSDQWDOODGRFDGDSDUYDHQYXHOWRSRUXQDPDOODPHWiOLFD\D VXYH]SRURWUDSDUDOXHJRHVWDUWRGRHOFRQMXQWRFXELHUWRSRUDLVODQWH/DVPDOODVHVWiQ D PDVD  YROWLRV.

 IRUPDQGR XQD ³-DXOD GH )DUDGD\´ $Vt UHGXFH ODV HPLVLRQHV \ UHFHSFLRQHVGHVHxDOHVHOHFWURPDJQpWLFDV 873WLSR\WLSR /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (QODPD\RUtDGHORVHGLILFLRVVHKDFHXQDSUHLQVWDODFLyQFRQXQSDUWUHQ]DGRGH RKPLRVGHQRPLQDGRGHFDOLGDGWHOHIyQLFD3RUWDQWRHVWHWLSRGHSUHLQVWDODFLRQHV VHGHEHQFRQVLGHUDUVLHPSUHFRPRXQDDOWHUQDWLYDEDVWDQWHDWUDFWLYD\SRFRFRVWRVDSDUD /$1 1R REVWDQWH KD\ TXH WHQHU HQ FXHQWDTXH ODV YHORFLGDGHV GH WUDQVPLVLyQ \ ODV GLVWDQFLDVTXHVHSHXGHQDOFDQ]DUFRQHVWHPHGLRQRVLHPSUHDOFDQ]DQODVQHFHVLGDGHV PtQLPDV (QOD(.$ ³(OHFWURQLF.QGXVWULHV$VVRFLDWLRQ´.

SXEOLFyQHOHVWiQGDU(.$   GHQRPLQDGR ³&RPPHUFLDO %XLOGLQJ 7HOHFRPPXQLFDWLRQV &DEOLQJ 6WDQGDUG´ TXH GHILQH HO XVR GH SDUHV WUHQ]DGRV VLQ DSDQWDOODU GH FDOLGDG WHOHIyQLFD \ GH SDUHV DSDQWDOODGRV FRPR PHGLRV SDUD DSOLFDFLRQHV GH WUDQVPLVLyQ GH GDWRV HQ HGLILFLRV 1yWHVHTXHSRUDTXHOWLHPSRODVFDUDFWHUtVWLFDVGHGLFKRVPHGLRVHUDQVXILFLHQWHVSDUD HOUDQJRGHIUHFXHQFLDV\YHORFLGDGHVWtSLFDVQHFHVDULDVHQHQWRUQRVRILPiWLFRV(VPiV HQ HVD pSRFD HO LQWHUYDOR GH LQWHUpVSDUD HO GLVHxR GH /$1 HVWDED HQWUH  \  0ESV &RQ HO WLHPSR ORV XVXDULRV KDQ LGR PLJUDQGR WDQWR D HVWDFLRQHV GH WUDEDMR FRPR D DSOLFDFLRQHVGHPD\RUHVSUHVWDFLRQHV3RUWDQWRKDEtDFDGDYH]XQLQWHUpVFUHFLHQWHHQ GLVHxDU /$1V TXH SURSRUFLRQDUDQ KDVWD  0ESV VREUH PHGLRV QR FRVWRVRV &RPR UHVSXHVWDDHVDQHFHVLGDGHQVHSURSXVRHO(.$!(VWHHVWiQGDULQFRUSRUDORV PiV UHFLHQWHV DYDQFHV WDQWR HQ HO GLVHxR GH FDEOHV \ FRQHFWRUHV FRPR HQ PpWRGRV GH WHVW (Q HVWD HVSHFLILFDFLyQ VH FRQVLGHUDQ WDQWR FDEOHV GH SDUHV DSDQWDOODGRV D  RKPLRVFRPRSDUHVQRDSDQWDOODGRVGHRKPLRV (QHOHVWiQGDU(.$$VHFRQVLGHUDQWLSRVGHFDEOHV873 x 7LSRFRQVLVWHHQFDEOHV\VXKDUGZDUH DVRFLDGRGLVHxDGRVSDUDIUHFXHQFLDVGH KDVWD0+] x 7LSRFRQVLVWHHQFDEOHV\VXKDUGZDUHDVRFLDGRGLVHxDGRVSDUDIUHFXHQFLDVGH KDVWD0+] x 7LSRFRQVLVWHHQFDEOHV\VXKDUGZDUHDVRFLDGRGLVHxDGRVSDUDIUHFXHQFLDVGH KDVWD0+] 'H HQWUH ORV DQWHULRUHV ORV WLSRV  \  VRQ ORV PiV XWLOL]DGRV HQ ORV HQWRUQRV /$1(OWLSR FRUUHVSRQGHDORVFDEOHVGHFDOLGDGWHOHIyQLFDTXHH[LVWHQHQOD PD\RUtDGHORVHGLILFLRVGHRILFLQDV&RQXQGLVHxRDSURSLDGR\DGLVWDQFLDVOLPLWDGDV FRQ FDEOHV WLSR VH SXHGHQ FRQVHJXLU YHORFLGDGHV GH KDVWD  0ESV (O WLSR  HV XQ FDEOH GH PHMRUHV FDUDFWHUtVWLFDV SDUD OD WUDQVPLVLyQ GH GDWRV \ FDGD YH] VH HVWi XWLOL]DQGRPiV\PiVFRPRSUHLQVWDODFLyQHQORVQXHYRVHGLILFLRVGHRILFLQDV&RQXQ GLVHxRDSURSLDGR\D GLVWDQFLDVOLPLWDGDVFRQWLSRVHSXHGHQDOFDQ]DU0ESV /DGLIHUHQFLDHVHQFLDOHQWUHORVFDEOHVWLSR\HVWiHQHOQ~PHURGHWUHQ]DVSRU XQLGDG GH GLVWDQFLD (O SDVR GH WRUVLyQ HQ HO WLSR  HV GHO RUGHQ GH  D  WUHQ]DV SRU FHQWtPHWUR PLHQWUDV TXH HQ OH WLSR  WLHQH XQD WUHQ]D FDGD  R  FHQWtPHWURV (O WUHQ]DGR GHO WLSR  HV SRU VXSXHVWR PiV FDUR DKRUD ELHQ SURSRUFLRQD SUHVWDFLRQHV VXSHULRUHVTXHHOGHWLSR /RV FRQHFWRUHV VRQ 5- FDEOH GH UHG R ODWLJXLOOR.

 0X\ SDUHFLGR DO GHO WHOpIRQR 5-.

 (O FRQHFWRU 673 HV PX\ SDUHFLGR SHUR FRQ XQD FXELHUWD PHWiOLFD GRQGH VH FRQHFWDQODVPDOODVPHWiOLFDVSDUDSRQHUODVDPDVD /D QRUPD (.$ FRPHQWDGD DQWHULRUPHQWH.$7.

 TXH GHILQtD HO FDEOHDGR GH XQHGLILFLRQRUHVLGHQFLDOVHFRQRFHFRPR ³6LVWHPDGHFDEOHDGRHVWUXFWXUDGR´ /XLV%5DPtUH]GHO3LQR  .

PSHGDQFLDFDUDFWHUtVWLFDGHXQFDEOH  'HEH KDEHU XQDVDOD SULQFLSDOGH HTXLSRV HQ OD SODQWD EDMD R VyWDQR $ HOOD OOHJDQ WRGDV ODV OtQHDVGHOH[WHULRU   (QFDGDSODQWDKDEUiXQRRYDULRVUHSHWLGRUHV GH  SODQWD /RV VXILFLHQWHV SDUD TXH KD\D HQ FDGD SXQWR GH OD SODQWD XQ UHSHWLGRU D PHQRVGH    PHWURV  (Q FDGD SXHVWR GH XVXDULR GHEH KDEHU XQD URVHWD FRQVLVWHQWH HQ DO PHQRV.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV .

 GRV WRPDV GH   UHG XQDSDUDYR]\RWUDSDUDGDWRV.

  /DQRUPDGLFHTXHORVFDEOHVGHEHQVHUWHQGLGRV  GHVGH OD VDOD GH HTXLSRV D FDGD XQR GH ORV  UHSHWLGRUHV (V HO FDEOHDGR WURQFDO R YHUWLFDO (VWDQRUPDUHFRPLHQGDILEUDySWLFDGHKDVWD.PGHORQJLWXG  'HFDGDUHSHWLGRUGHSODQWDVDOHQFDEOHVSDUDFDGDURVHWD6HOHOODPD DEOHDGR F KRUL]RQWDO 'HEH PHGLU FRPR Pi[LPR  PHWURV UHFRPHQGiQGRVH SDU WUHQ]DGRVLQDSDQWDOODGR 873.

 (VODUHVLVWHQFLDTXHWLHQHXQFDEOHGHORQJLWXGLQILQLWDDIUHFXHQFLDLQILQLWD&RQ FRUULHQWH FRQWLQXD OD UHVLVWHQFLD GH XQ FDEOH FUHFH &RQ FRUULHQWH DOWHUQD FUHFH KDVW  D DSUR[LPDUVHDODLPSHGDQFLDFDUDFWHUtVWLFD 6L XQ FDEOH WLHQH LPSHGDQFLD GH  RKPLRV SRQJR XQD LPSHGDQFLD GH  RKPLRVDOILQDOODVHxDOTXHOOHJDDOH[WUHPRHVPi[LPD&RQRWUDFRQILJXUDFLyQOOHJDUi PHQRVVHxDOQRODPi[LPD $SOLFDFLRQHVGHOSDUWUHQ]DGR x /tQHDWHOHIyQLFD x &RPXQLFDFLyQGHGDWRV5'6.6'1. .

/$1 DPHWURVVHOOHJDDFRQVHJXLU HQWUH\0EV.

P\MKDVWD0VHJ  &RD[LDO 'HVFULSFLyQItVLFD (O FDEOH FRD[LDO DO LJXDO TXH HO SDU WUHQ]DGR WLHQH GRV FRQGXFWRUHV SHUR HVWi FRQVWUXLGR GH IRUPD GLIHUHQWH SDUD TXH SXHGD RSHUDU VREUH XQ UDQJR PD\RU GH IUHFXHQFLDV &RQVLVWH HQ XQ FRQGXFWRU FLOtQGULFR H[WHUQR TXH URGHD D XQ FDEOH FRQGXFWRU(OFRQGXFWRULQWHULRUVHPDQWLHQHDORODUJRGHOHMHD[LDOPHGLDQWHXQDVHULH GH DQLOORV DLVODQWHV UHJXODUPHQWH HVSDFLDGRV R ELHQ PHGLDQWH XQ PDWHULDO VyOLGR GLHOpFWULFR(OFRQGXFWRUH[WHULRUVHFXEUHFRQXQD &REUH FXELHUWD R IXQGD SURWHFWRUD (O FDEOH H[WHULRU VH XQH D PDVD IRUPDQGR XQD MDXOD GH IDUDGD\ (O FDEOHFRD[LDOWLHQHXQGLiPHWUR TXHYDGHD FP DSUR[LPDGDPHQWH 'HELGR DO WLSR GH DSDQWDOODPLHQWR UHDOL]DGR HV GHFLU D OD GLVSRVLFLyQFRQFpQWULFDGHORVGRVFRQGXFWRUHVHO FDEOH FRD[LDO HV PXFKR PHQRV VXVFHSWLEOH D LQWHUIHUHQFLDV \ GLDIRQtDV TXH HO SDU /XLV%5DPtUH]GHO3LQR  . x $'6/ .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV WUHQ]DGR &RPSDUDQGR FRQ HVWH HO FDEOH FRD[LDO VH SXHGH XVDU SDUD FXEULU PD\RUHV GLVWDQFLDVDVtFRPRFRQHFWDUXQQ~PHURPD\RUGHHVWDFLRQHVHQXQDOtQHDFRPSDUWLGD $SOLFDFLRQHV (O FDEOH FRD[LDOHV TXL]i HO PHGLR GH WUDQVPLVLyQ PiVYHUViWLO SRU OR TXH HVWi VLHQGR FDGD YH] PiV XWLOL]DGR HQ XQD JUDQ YDULHGDG GH DSOLFDFLRQHV /DV PiV LPSRUWDQWHVVRQ x 'LVWULEXFLyQGHWHOHYLVLyQ x 7HOHIRQtDDODUJDGLVWDQFLD x &RQH[LyQFRQSHULIpULFRVDFRUWDGLVWDQFLD x 5HGHVGHÈUHD/RFDO (OFDEOHFRD[LDOVHHVWiXWLOL]DQGRSDUDODGLVWULEXFLyQGHOD79SRUFDEOHKDVWD ORVKRJDUHVGHORVXVXDULRV'LVHxDGRLQLFLDOPHQWHSDUDSURSRUFLRQDUVHUYLFLRGHDFFHVR D iUHDV UHPRWDV &$79 ³&RPPXQLW\ $QWHQQD 7HOHYLVLyQ´.

 OD 79 SRU FDEOH HQ XQ IXWXUR PX\ FHUFDQR OOHJDUi D FDVL WDQWRV KRJDUHV \ RILFLQDV FRPR HO DFWXDO VLVWHPD WHOHIyQLFR (O VLVWHPD GH 79 SRU FDEOH SXHGH WUDQVSRUWDUGRFHQDVH LQFOXVR FLHQWRV GH FDQDOHVDGHFHQDVGHNLOyPHWURV 7UDGLFLRQDOPHQWHHO FRD[LDOKD VLGR IXQGDPHQWDO HQ OD UHG GH WHOHIRQtD D ODUJD GLVWDQFLD DXQTXH HQ OD DFWXDOLGDG WLHQH XQD IXHUWH FRPSHWHQFLD HQ OD ILEUD ySWLFD ODV PLFURRQGDVWHUUHVWUHV \ ODVFRPXQLFDFLRQHVYtD VDWpOLWH&XDQGRVH XVD PXOWLSOH[DFLyQ FRQGLYLVLyQHQIUHFXHQFLD )'0³)UHFXHQF\'LYLVLRQ0XOWLSOH[LQJ´.

HOFDEOHFRD[LDO SXHGHWUDQVSRUWDUPiVGHFDQDOHVGHYR]VLPXOWiQHDPHQWH (OFDEOHFRD[LDOWDPELpQVHXVDFRQIUHFXHQFLDSDUDFRQH[LRQHVHQWUHSHULIpULFRV D FRUWD GLVWDQFLD &RQ VHxDOL]DFLyQ GLJLWDO HO FRD[LDO VH SXHGH XVDU FRPR PHGLR GH WUDQVPLVLyQHQFDQDOHVGHHQWUDGDVDOLGDHQFRPSXWDGRUHV 2WURiUHDGHDSOLFDFLyQGHOFDEOHFRD[LDOHVHQODVUHGHVGHDUHDORFDO(OFDEOH FRD[LDO DGPLWH XQ JUDQ Q~PHUR GH GLVSRVLWLYRV FRQ XQD JUDQ GLYHUVLGDG GH WLSRV GH GDWRV\WUiILFRFRQFREHUWXUDVTXHYDQGHVGHXQVRORHGLILFLRDYDULRVVLHPSUHSUy[LPRV HQWUHHOORV &DUDFWHUtVWLFDVGHWUDQVPLVLyQ (O FDEOH FRD[LDOVH XVD SDUDWUDQVPLWLU WDQWR VHxDOHVDQDOyJLFDV FRPR GLJLWDOHV 7LHQH UHVSXHVWD HQ IUHFXHQFLD VXSHULRU D OD GHO SDU WUHQ]DGR SHUPLWLHQGR SRU WDQWR PD\RUHV IUHFXHQFLDV \ YHORFLGDGHV GH WUDQVPLVLyQ &RPR \D VH KD GLFKR SRU FRQVWUXFFLyQ HO FDEOH FRD[LDOHV PXFKR PHQRV VXVFHSWLEOH TXH HO SDU WUHQ]DGR WDQWR D LQWHUIHUHQFLDVFRPRDGLDIRQtD6XVSULQFLSDOHVOLPLWDFLRQHVVRQODDWHQXDFLyQHOUXLGR WpUPLFR \ HO UXLGR GH LQWHUPRGXODFLyQ (VWH ~OWLPR DSDUHFH VyOR FXDQGR VH XVDQ VLPXOWiQHDPHQWHYDULRVFDQDOHVREDQGDVGHIUHFXHQFLDV 3DUD OD WUDQVPLVLyQ GH VHxDOHV DQDOyJLFDV D ODUJD GLVWDQFLD VH QHFHVLWDQ DPSOLILFDGRUHV VHSDUDGRV SRU PX\ SRFRV NLOyPHWURV HVWDQGR PHQRV VHSDUDGRV FXDQWR PD\RUHVODIUHFXHQFLD GHWUDEDMR(OHVSHFWURGHODVHxDOL]DFLyQDQDOyJLFDVHH[WLHQGH KDVWD ORV  0+] 3DUD VHxDOL]DFLyQ GLJLWDO HQ FDPELR VH QHFHVLWD XQ UHSHWLGRU DSUR[LPDGDPHQWHFDGDNLOyPHWURHVWRHVODVHSDUDFLyQHQWUHUHSHWLGRUHVHVPHQRU  )LEUDySWLFD /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 'HVFULSFLyQItVLFD /D ILEUD ySWLFD HV XQ PHGLR IOH[LEOH \ H[WUHPDGDPHQWH ILQR GH  D PP.

 FDSD] GH FRQGXFLU HQHUJtD GH QDWXUDOH]D ySWLFD 3DUD OD ILEUD VH SXHGHQ XVDU GLYHUVRV WLSRVGHFULVWDOHV\SOiVWLFRV/DVSpUGLGDVPHQRUHVVHKDQFRQVHJXLGRFRQODXWLOL] DFLyQ GH ILEUDV GH VLOLFLR IXQGLGR XOWUD SXUR /DV ILEUDV XOWUDSXUDV VRQ PX\ GLItFLOHV GH IDEULFDU ODV ILEUDV GH FULVWDO PXOWLFRPSRQHQWH WLHQHQ PD\RUHV SpUGLGDV \ VRQ PiV HFRQyPLFDVSHURSURSRUFLRQDQXQDVSUHVWDFLRQHVVXILFLHQWHV/DILEUDGHSOiVWLFRW HQH L WRGDYtDXQFRVWHPHQRU\ VHSXHGHQXWLOL]DUSDUDHQODFHVGHGLVWDQFLDVFRUWDVSDUDORV TXHVRQDFHSWDEOHVSpUGLGDVPRGHUDGDPHQWHDOWDV 8Q FDEOH GH ILEUD ySWLFD WLHQH IRUPD HQYROWXUD FLOtQGULFD \ HVWi IRUPDGR SRU WUHV VHFFLRQHV Q~FOHR FRQFpQWULFDV HO Q~FOHR HO UHYHVWLPLHQWR \ OD FXELHUWD FXELHUWD (O Q~FOHR HV OD VHFFLyQ PiV LQWHUQD HVWi FRQVWLWXLGR SRU XQD R YDULDV KHEUDV R ILEUDV PX\ ILQDVGHFULVWDORSOiVWLFR&DGDILEUDHVWiURGHDGDSRUVXSURSLRUHYHVWLPLHQWRTXHQRHV VLQR RWUR FULVWDO R SOiVWLFR FRQ SURSLHGDGHV ySWLFDV GLVWLQWDV D ODVGHO Q~FOHR /D FDSD PiVH[WHULRUTXHHQYXHOYHDXQRRYDULRVUHYHVWLPLHQWRVHVODFXELHUWD/DFXELHUWDHVWi KHFKD GH SOiVWLFR \ RWURV PDWHULDOHV GLVSXHVWRV HQ FDSDV SDUD SURSRUFLRQDU SURWHFFLyQ FRQWUDODKXPHGDGODDEUDVLyQDSODVWDPLHQWRV\RWURVSHOLJURV $SOLFDFLRQHV 8QRGHORVDYDQFHVWHFQROyJLFRVPiVVLJQLILFDWLYRVHQODWUDQVPLVLyQGHGDWRVKD VLGRHOGHVDUUROORGHORVVLVWHPDVGHFRPXQLFDFLyQGHILEUDySWLFD1RHQYDQRODILEUD GLVIUXWDGHXQDJUDQDFHSWDFLyQSDUDODVWHOHFRPXQLFDFLRQHVDODUJDGLVWDQFLD\FDGDYH] PiV HVWi VLHQGR PiV SRSXODU HQ ODV DSOLFDFLRQHV PLOLWDUHV 6X SHUIHFFLRQDPLHQWR FRQWLQXDGRDVtFRPRVXUHGXFFLyQHQSUHFLRKDQFRQWULEXLGRDFRQYHUWLUODHQXQPHGLR DWUDFWLYR SDUD ORV HQWRUQRV /$1 /DV FDUDFWHUtVWLFDV GLIHUHQFLDOHV GH OD ILEUD ySWLFD IUHQWHDOFDEOHFRD[LDO\DOSDUWUHQ]DGRVRQ x 0D\RU DQFKR GH EDQGD (O DQFKR GH EDQGD \ SRU WDQWR OD YHORFLGDG GH WUDQVPLVLyQHQODVILEUDVHVHQRUPH([SHULPHQWDOPHQWHVHKDGHPRVWUDGRTXH VH SXHGHQ FRQVHJXLU YHORFLGDGHV GH WUDQVPLVLyQ GH  *ESV SDUD GHFHQDV GH NLOyPHWURVGHGLVWDQFLD&RPSiUHVHFRQHOPi[LPRTXHVHSXHGHFRQVHJXLUHQHO FDEOHFRD[LDOFLHQWRVGH0ESVVREUHDSUR[LPDGDPHQWH.P\FRQORVHVFDVRV 0ESVTXHVHSXHGHQREWHQHUHQODPLVPDGLVWDQFLDSDUDSDUH]WUHQ]DGRVRFRQ ORV  0ESV TXH VH FRQVLJXHQ HQ SDUHV WUHQ]DGRV VL OD GLVWDQFLD VH UHGXFH D XQDVSRFDVGHFHQDVGHPHWURV x 0HQRUWDPDxR\SHVR /DVILEUDVySWLFDVVRQDSUHFLDEOHPHQWHPiVILQDVTXHHO FDEOHFRD[LDORTXHORVSDUHVWUHQ]DGRVHPEXWLGRVSRUORPHQRVHQXQRUGHQGH PDJQLWXG SDUD FDSDFLGDGHV GH WUDQVPLVLyQ FRPSDUDEOHV (Q ODV FRQGXFFLRQHV HVWUHFKDV SUHYLVWDV HQ ODV HGLILFDFLRQHV SDUD HO FDEOHDGR DVt FRPR HQ ODV FRQGXFFLRQHV S~EOLFDV VXEWHUUiQHDV OD XWLOL]DFLyQ GH WDPDxRV SHTXHxRV WLHQH XQDV YHQWDMDV HYLGHQWHV /D UHGXFFLyQ HQ WDPDxR OOHYD D VX YH] DSDUHMDGD XQD UHGXFFLyQHQSHVRTXHGLVPLQX\HODLQIUDHVWUXFWXUDQHFHVDULD x $WHQXDFLyQ PHQRU /D DWHQXDFLyQ HV VLJQLILFDWLYDPHQWH PHQRU HQ ODV ILEUDV ySWLFDVTXHHQORVFDEOHVFRD[LDOHV\SHUDVWUHQ]DGRVDGHPiVHVFRQVWDQWHHQXQ JUDQLQWHUYDORGHIUHFXHQFLDV x $LVODPLHQWRHOHFWURPDJQpWLFR/RVVLVWHPDVGHILEUDySWLFDQRVHYHQDIHFWDGRV SR ORV HIHFWRV GH FDPSRV HOHFWURPDJQpWLFRV H[WHULRUHV (VWRV VLVWHPDV QR VRQ /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV x /DWUDQVPLVLyQDODUJDVGLVWDQFLDVPHGLDQWHILEUDVHVFDGDYH]PiVFRP~QHQOD UHGGHWHOpIRQRV(QHVWDVUHGHVODVGLVWDQFLDVPHGLDVVRQDSUR[LPDGDPHQWHNP\ WLHQHQ XQD JUDQ FDSDFLGDG WtSLFDPHQWH GH  D  FDQDOHV GH YR].

 (VWRV VLVWHPDV VRQ FRPSHWLWLYRV HQ FXDQWR D FRVWH FRQ ORV HQODFHV GH PLFURRQGDV \ HVWiQ PX\SRUGHEDMRHQFRVWHGHOFDEOHFRD[LDO/DGLIHUHQFLDHVWDOTXHLQFOXVRHQDOJXQRV SDtVHVHQGHVDUUROORHOFRD[LDOVHHVWiTXHGDQGRGHVIDVDGRSDUDVXXWLOL]DFLyQHQUHGHV GHWHOHIRQtD /RV FLUFXLWRV PHWURSROLWDQRV WLHQHQ XQD ORQJLWXG PHGLD GH  NP \ SXHGHQ WHQHU KDVWD  FDQDOHV GH YR] /D PD\RUtD GH ORV VHUYLFLRV VH HVWiQ LQVWDODQGR XVDQGR FRQGXFFLRQHV VXEWHUUiQHDV VLQ UHSHWLGRUHV TXH VH XVDQ SDUD HQOD]DU FHQWUDOHV WHOHIyQLFDVGHQWURGHOiUHDPHWURSROLWDQD(QHVWDFDWHJRUtDHVWiQODVUXWDVTXHHQOD]DQ ODVOtQHDVGHODUJDGLVWDQFLDGHPLFURRQGDVTXHOOHJDQKDVWDODViUHDVSHULPHWUDOHVGHODV FLXGDGHVFRQODVFHQWUDOHVGHWHOHIRQtDVLWXDGDVGHQWURGHOFDVFRXUEDQR /RVDFFHVRVDiUHDVUXUDOHVWLHQHQWtSLFDPHQWHORQJLWXGHVTXHYDQGHVGHORV D ORV  NP (Q (VWDGRV 8QLGRV HVWRV HQODFHV D VX YH] FRQHFWDQ IUHFXHQWHPHQWH FHQWUDOHV WHOHIyQLFDV SHUWHQHFLHQWHV D GLIHUHQWHV FRPSDxtDV /D PD\RUtD GH HVWRV VLVWHPDVWLHQHQPHQRVGH  FDQDOHV GH YR] 8VXDOPHQWHOD WHFQRORJtD XWLOL]DGD HQ HVWDVDSOLFDFLRQHVFRPSLWHFRQODVPLFURRQGDV /RV EXFOHV GH DERQDGR VRQ ILEUDV TXH YDQ GLUHFWDPHQWH GHVGH ODV FHQWUDOHV DO DERQDGR(OXVRGHODILEUDHQHVWRVVHUYLFLRVHVWiHPSH]DQGRDGHVSOD]DUDORVHQODFHV PHGLDQWH SDUHV WUHQ]DGRV \ FRD[LDOHV GDGR TXH FDGD YH] PiV ODV UHGHV GH WHOHIRQtD HVWiQ HYROXFLRQDQGR KDFLD UHGHV LQWHJUDGDV FDSDFHV GH JHVWLRQDU QR VyOR YR] \ GDWRV VLQRWDPELpQLPiJHQHV\YLGHR(OXVRGHODILEUDHQHVWDVDSOLFDFLRQHVHVWiHQFDEH]DGR IXQGDPHQWDOPHQWHSRUJUDQGHVFOLHQWHV HPSUHVDV.

P VLQ QHFHVLGDG GH UHSHWLGRUHV /RV VLVWHPDV EDVDGRV HQ FRD[LDO \ SDUHV WUHQ]DGRV UHTXLHUHQ UHSHWLGRUHVFDGDSRFRVNLOyPHWURV /XLV%5DPtUH]GHO3LQR  .QRREVWDQWHODILEUDFRPRPHGLRGH DFFHVRGHVGHORVGRPLFLOLRVSDUWLFXODUHVDSDUHFHUiHQXQIXWXURDFRUWRSOD]R )LQDOPHQWHXQDDSOLFDFLyQLPSRUWDQWHGHODILEUDySWLFDHVWiHQODVUHGHVGHiUHD ORFDO 5HFLHQWHPHQWH VH KDQ GHVDUUROODGR HVWiQGDUHV \ SURGXFWRV SDUD UHGHV GH ILEUD ySWLFD TXH WLHQHQ XQD FDSDFLGDG GH  0ESV \ SHUPLWHQ FLHQWRV R LQFOXVR PLOHV GH HVWDFLRQHVHQJUDQGHVHGLILFLRVGHRILFLQDV x x x x x /DVFLQFRDSOLFDFLRQHVEiVLFDVHQODVTXHODILEUDySWLFDHVLPSRUWDQWHVRQ 7UDQVPLVLRQHVDODUJDGLVWDQFLD 7UDQVPLVLRQHVPHWURSROLWDQDV $FFHVRDiUHDVUXUDOHV %XFOHVGHDERQDGR 5HGHVGHiUHDORFDO YXOQHUDEOHVDLQWHUIHUHQFLDVUXLGRLPSXOVLYRRGLDIRQtD<SRUODPLVPDUD]yQ ODVILEUDVQRUDGLDQHQHUJtDSURGXFLHQGRLQWHUIHUHQFLDVGHVSUHFLDEOHVFRQRWURV HTXLSRV \ SURSRUFLRQDQGR D OD YH] XQ DOWR JUDGR GH SULYDFLGDG DGHPiV UHODFLRQDGR FRQ HVWR OD ILEUD HV SRU FRQVWUXFFLyQ GLItFLO GH LQWHUYHQLU R FRORTXLDOPHQWH³SLQFKDU´ 0D\RU VHSDUDFLyQ HQWUH UHSHWLGRUHV &XDQWRV PHQRV UHSHWLGRUHV KD\D HO FRVWH VHUiPHQRUDGHPiVGHKDEHUPHQRVIXHQWHVGHHUURU'HVGHHVWHSXQWRGHYLVWD ODV SUHVWDFLRQHV GH ORV VLVWHPDV GH ILEUD ySWLFD KDQ VLGR PHMRUDGDV SURJUHVLYDPHQWH3RUHMHPSOR$7 7KDGHVDUUROODGRXQVLVWHPDGHWUDQVPLVLyQ TXH FRQVLJXH  *ESV VREUH XQD GLVWDQFLD GH  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV /DVYHQWDMDVGHODILEUDySWLFDUHVSHFWRGHOSDUWUHQ]DGRR GHOFDEOHFRD[LDOVRQ FDGD YH] PiV FRQYLQFHQWHV FRQIRUPH YD DXPHQWDQGR OD GHPDQGD GH OD LQIRUPDFLyQ PXOWLPHGLD YR]GDWRVLPiJHQHV\YLGHR.

 &DUDFWHUtVWLFDVGHWUDQVPLVLyQ /D ILEUD ySWLFD IXQFLRQD HQ XQ UDQJR GH IUHFXHQFLDV TXH YD GHVGH  KDVWD +]FXEULHQGRWRGRHOHVSHFWURYLVLEOH\SDUWHGHOHVSHFWURLQIUDUURMR (O SULQFLSLR TXH ULJH OD WUDQVPLVLyQ HQ OD ILEUD ySWLFD HV HO VLJXLHQWH /D OX] SURYHQLHQWHGHODIXHQWHSHQHWUDHQHOQ~FOHRFLOtQGULFRGHFULVWDORSOiVWLFR/RVUD\RV TXHLQFLGHQFRQiQJXORVVXSHUILFLDOHVVHUHIOHMDQ\VHSURSDJDQGHQWURGHOQ~FOHRGHOD ILEUD PLHQWUDV TXH SDUD RWURV iQJXORV ORV UD\RV VRQ DEVRUELGRV SRU HO PDWHULDO TXH IRUPD HO UHYHVWLPLHQWR (VWH WLSR GH SURSDJDFLyQ VH OODPD PXOWLPRGDO DOXGLHQGR DO KHFKRGHTXHKD\PXOWLWXGGHiQJXORVSDUDORVTXHVHODUHIOH[LyQWRWDO&XDQGRHOUDGLR GHOQ~FOHRVHUHGXFHODUHIOH[LyQVHGDUiHQXQQ~PHURPHQRUGHiQJXORV$OUHGXFLUHO UDGLRGHOQ~FOHRDGLPHQVLRQHVGHORUGHQGHODPDJQLWXGGHODORQJLWXGGHRQGDXQVROR iQJXOR R PRGR SRGUi SDVDU HO UD\R D[LDO (VWD SURSDJDFLyQ PRQRPRGR SURSRUFLRQD SUHVWDFLRQHV VXSHULRUHV SRU ODV UD]RQHV TXH VH HVJULPHQ D FRQWLQXDFLyQ (Q OD WUDQVPLVLyQ PXOWLPRGR H[LVWHQ P~OWLSOHV FDPLQRV GH SURSDJDFLyQ FDGD XQR FRQ ORQJLWXGGLIHUHQWH \SRU WDQWRFRQGLIHUHQWHVWLHPSRVGHSURSDJDFLyQHQODILEUD(VWR KDFHTXHORVHOHPHQWRVGHODVHxDOVHGLVSHUVHQHQHOWLHPSRORTXHOLPLWDODYHORFLGDG GH WUDQVPLVLyQ DO D TXH VH SXHGH UHFLELU DGHFXDGDPHQWH 'DGR TXH HQ OD WUDQVPLVLyQ PRQRPRGRVyORKD\XQFDPLQRSRVLEOHHOWLSRGHGLVWRUVLyQLQGLFDGRQRSXHGHGDUVH )LQDOPHQWH VH SXHGH FRQVHJXLU XQ WHUFHU PRGR GH WUDQVPLVLyQ YDULDQGR JUDGXDOPHQWH HO tQGLFH GH UHIUDFFLyQ GHO Q~FOHR GHQRPLQDGR PXOWLPRGR GH tQGLFH JUDGXDO/DVFDUDFWHUtVWLFDVGHHVWH~OWLPRPRGRHVWiQHQWUHODVGHORVRWURVGRVPRGRV FRPHQWDGRV(OtQGLFHGHUHIUDFFLyQYDULDEOHWLHQHFRPRFRQVHFXHQFLDXQPHMRUHQIRTXH GHORVUD\RVTXHHQHOFDVRGHODWUDQVPLVLyQPXOWLPRGRRUGLQDULDWDPEtHQGHQRPLQDGD PXOWLPRGRGHtQGLFHGLVFUHWR (QORVVLVWHPDVGHILEUDySWLFDVHXVDQGRVWLSRVGLIHUHQWHVGHIXHQWHVGHOX]ORV GLRGRV /(' ³/LJWK (PLWWLQJ 'LRGHV´.

/' ³.QMHFWLRQ /DVHU 'LRGH´. \ ORV GLRGRV .

/' HV PiV HILFD] \ SXHGH SURSRUFLRQDU YHORFLGDGHV GH WUDQVPLVLyQVXSHULRUHV ([LVWH XQD UHODFLyQ HVWDEOHFLGD HQWUH OD ORQJLWXG GH RQGD XWLOL]DGD HO W SR GH L WUDQVPLVLyQ\ODYHORFLGDGGHWUDQVPLVLyQTXHVHSXHGHFRQVHJXLU7DQWRHOPRQRPRGR FRPR HO PXOWLPRGR SXHGHQ DGPLWLU YDULDV ORQJLWXGHV GH RQGD GLIHUHQWHV \ SXHGHQ XWLOL]DU FRPR IXHQWHV WDQWR ODFHUHV FRPR GLRGRV /(' (Q ODV ILEUDV ySWLFDV OD OX] VH SURSDJD PHMRU HQ WUHV UHJLRQHV R ³YHQWDQDV´ GH ORQJLWXGHV GH RQGD FHQWUDGDV D   \  QDQyPHWURV QP. $PERVVRQGLVSRVLWLYRVVHPLFRQGXFWRUHVTXHHPLWHQXQKD]GHOX]FXDQGRVHOHVDSOLFD XQDWHQVLyQ(O/('HVPHQRVFRVWRVRRSHUDHQXQ PD\RUUDQJRGHWHPSHUDWXUDV\WLHQH XQD YLGD PHGLD VXSHULRU (O .

 7RGDVHVWDV IUHFXHQFLDV HVWiQ HQ OD ]RQDLQIUDUURMD GHO HVSHFWURSRU GHEDMRGHOHVSHFWURYLVLEOHTXH HVWiVLWXDGRHQWUHORV \ QP /DV SpUGLGDVVRQPHQRUHVFXDQWRPD\RUHVODORQJLWXGGHRQGD(QODDFWXDOLGDGODPD\RUtD GHODVDSOLFDFLRQHVXVDQFRPRIXHQWHVORVGLRGRV/('DQP$XQTXHHVWDHOHFFLyQ HVUHODWLYDPHQWHEDUDWDVXXVRHVWiJHQHUDOPHQWHOLPLWDGRDYHORFLGDGHVGHWUDQVPLVL Q y SRU GHEDMR GH  0ESV \ D GLVWDQFLDV GH SRFRV NLOyPHWURV 3DUD FRQVHJXLU PD\RUHV YHORFLGDGHV GH WUDQVPLVLyQ \ PD\RUHV GLVWDQFLDV HV QHFHVDULR WUDQVPLWLU HQ OD YHQWDQD FHQWUDGDDQP XVDQGRWDQWROiVHUFRPRGLRGRV.

\VLWRGDYtDVHQHFHVLWDQPHMRUH V SUHVWDFLRQHVHQWRQFHVKD\TXHUHFXUULUDOXVRGHHPLVRUHVOiVHUDQP  /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (Q PHGLRV JXLDGRV WDQWR OD WUDQVPLVLyQ FRPR OD UHFHSFLyQ VH OOHYD D FDER PHGLDQWH DQWHQDV (Q OD WUDQVPLVLyQ OD DQWHQD UDGLD HQHUJtD HOHFWURPDJQpWLFD HQ HO PHGLR QRUPDOPHQWH HO DLUH.

 \ HQ OD UHFHSFLyQ OD DQWHQD FDSWD ODV RQGDV HOHFWURPDJQpWLFDV GHO PHGLR TXH OD URGHD %iVLFDPHQWH KD\ GRV WLSRV GH FRQILJXUDFLRQHVSDUDODVWUDQVPLVLRQHVLQDOiPEULFDVGLUHFFLRQDO \RPQLGLUHFFLRQDO(Q OD SULPHUD OD DQWHQD GH WUDQVPLVLyQ HPLWH OD HQHUJtD HOHFWURPDJQpWLFD FRQFHQWUiQGROD HQ XQ KD] SRU WDQWR HQ HVWH FDVR ODV DQWHQDV GH HPLVLyQ \ UHFHSFLyQ GHEHQ HVWDU SHUIHFWDPHQWH DOLQHDGDV (Q HO FDVR RPQLGLUHFFLRQDO SRU HO FRQWUDULR HO GLDJUDPD GH UDGLDFLyQGHODDQWHQDHVGLVSHUVRHPLWLHQGRHQWRGDVGLUHFFLRQHVSXGLHQGRODVHxDOVHU UHFLELGD SRU YDULDV DQWHQDV (Q HVWH FDVR OD VHxDO VH DWHQ~D PXFKR PiV UiSLGR (Q JHQHUDOFXDQGRPD\RUHVODIUHFXHQFLDGHODVHxDOWUDQVPLWLGDHVPiVIDFWLEOHFRQILQDU ODHQHUJtDHQXQKD]GLUHFFLRQDO (Q HO HVWXGLR GH ODV FRPXQLFDFLRQHV LQDOiPEULFDV VH YDQ D FRQVLGHUDU WUHV  UDQJRVGHIUHFXHQFLDV(OSULPHULQWHUYDORTXHYDGHVGHORV*+] *LJDKHUW]LR  +HUW]LRV.

KDVWDORV*+] VHGHQRPLQDIUHFXHQFLDVPLFURRQGDV(QHVWDVIUHFXHQFLDV GHWUDEDMRVHSXHGHQFRQVHJXLUKDFHVDOWDPHQWHGLUHFFLRQDOHVSRUORTXHODVPLFURRQGDV VRQ DGHFXDGDV SDUD HQODFHV SXQWR D SXQWR /DV PLFURRQGDV WDPELpQ VH XVDQ SDUD ODV FRPXQLFDFLRQHV YtD VDWpOLWH /DV IUHFXHQFLDV TXH YDQ GHVGH  0+] K  *+] VRQ DGHFXDGDV SDUD ODV DSOLFDFLRQHV RPQLGLUHFFLRQDOHV $ HVWH UDQJR GH IUHFXHQFLDV OR GHQRPLQDUHPRVLQWHUYDORGHRQGDVGHUDGLR/DV PLFURRQGDVFXEUHQSDUWHGHODEDQGD GH8+)\FXEUHQWRWDOPHQWHODEDQGD6+)ODEDQGHGHRQGDVGHUDGLRFXEUHOD9+)\ SDUWHGHODEDQGD8+) (V SUHIHULEOH OD FRPXQLFDFLyQ GLUHFFLRQDO DXQTXH VROR HV SRVLEOH D IUHFXHQFDV HOHYDGDVSRUTXHGHEHUtDPRVWHQHUXQDDQWHQDGHOWDPDxRGHODORQJLWXGGHRQGD6OOD IUHFXHQFLDHVEDMDODORQJLWXGGHODRQGDHVPX\ DOWD \QRSRGHPRVFRQVWUXLUDQWHQDV PX\JUDQGHV 2WURUDQJRGHIUHFXHQFLDVLPSRUWDQWHSDUDODVDSOLFDFLRQHVGHtQGROHORFDOHVOD  ]RQDGHLQIUDUURMRVGHOHVSHFWURTXHYDHQWpUPLQRVJHQHUDOHVGHVGHORVÂ KDVWDORV  Â +]/RVLQIUDUURMRVVRQ~WLOHVSDUDODVFRQH[LRQHVORFDOHVSXQWR DSXQWRDVtFRPR SDUD DSOLFDFLRQHV PXOWLSXQWR GHQWUR GH iUHDV GH FREHUWXUD OLPLWDGD FRPR SRU HMHPSOR XQDKDELWDFLyQ  1RJXLDGRV  0LFURRQGDVWHUUHVWUHV 'HVFULSFLyQItVLFD /D DQWHQD PiV FRP~Q HQ ODV PLFURRQGDV HV OD GH WLSR SDUDEyOLFR (O WDPDxR WtSLFRHVGHXQGLiPHWURGHXQRVPHWURV(VWDDQWHQDVHILMDUtJLGDPHQWH\WUDQVPLWHXQ KD] HVWUHFKR TXH GHEH HVWDU SHUIHFWDPHQWH HQIRFDGR KDFLD OD DQWHQD UHFHSWRUD /DV DQWHQDV GH PLFURRQGDV VH VLW~DQ D XQD DOWXUD DSUHFLDEOH VREUH HO QLYHO GHO VXHOR SDUD FRQ HOOR FRQVHJXLU PD\RUHV VHSDUDFLRQHV SRVLEOHV HQWUH HOODV \ SDUD VHU FDSDFHV GH VDOYDUSRVLEOHVREVWiFXORV6LQRKD\REVWiFXORVLQWHUPHGLRVODGLVWDQFLDPi[LPDHQWUH DQWHQDVYHULILFD G  .K 6LHQGRGODGLVWDQFLDGHVHSDUDFLyQHQWUHODVDQWHQDVH[SUHVDGDHQNLOyPHWURVK HVODDOWXUDGHODDQWHQDHQPHWURV\NHVXQIDFWRUGHFRUUHFFLyQTXHWLHQHHQFXHQWDTXH ODVPLFURRQGDVVHGHVYtDQRUHIUDFWDQFRQODFXUYDWXUDGHODWLHUUDOOHJDQGRSRUWDQWR /XLV%5DPtUH]GHO3LQR  .

 3RU WDQWR D PRGR GH HMHPSOR GRV DQWHQDV GH PLFURRQGDV FRQ DOWXUDGHPHWURVSXHGHQVHSDUDUVHXQDGLVWDQFLDLJXDODG    .P  3DUDOOHYDUDFDERWUDQVPLVLRQHVDODUJDGLVWDQFLDVHXWLOL]DODFRQFDWHQDFLyQGH HQODFHV SXQWR D SXQWR HQWUH DQWHQDV VLWXDGDV HQ WRUUHV DG\DFHQWHV KDVWD FXEULU OD GLVWDQFLDGHVHDGD $SOLFDFLRQHV (O XVR SULQFLSDO GH ORV VLVWHPDV GH PLFURRQGDV WHUUHVWUHV VRQ ORV VHUYLFLRV GH WHOHFRPXQLFDFLyQ GH ODUJD GLVWDQFLD FRPR DOWHUQDWLYD DO FDEOH FRD[LDO R D ODV ILEUDV ySWLFDV /D XWLOL]DFLyQ GH PLFURRQGDV UHTXLHUH PHQRU Q~PHUR GH UHSHWLGRUHV R DPSOLILFDGRUHVTXHHOFDEOHFRD[LDOSHURSRUHOFRQWUDULRQHFHVLWDTXHODVDQWHQDVHVWpQ DOLQHDGDV (O XVR GH ODV PLFURRQGDVHV IUHFXHQWH HQ OD WUDQVPLVLyQ GH WHOHYLVLyQ \ GH YR] 2WUR XVR FDGD YH] PiV IUHFXHQWH HV SDUD HQODFHV SXQWR D SXQWR D FRUWDV GLVWDQFLDVHQWUHHGLILFLRV(QHVWH~OWLPRFDVRVHSXHGHHPSOHDUSDUDFLUFXLWRVFHUUDGRV GH 79 R SDUD OD LQWHUFRQH[LyQ GH UHGHV ORFDOHV $GHPiV ODV PLFURRQGDV D FRUWD GLVWDQFLDWDPELpQVHXWLOL]DQHQODVDSOLFDFLRQHVGHQRPLQDGDVGH³E\SDVV´FRQODVTXH XQDGHWHUPLQDGDFRPSDxtDSXHGHHVWDEOHFHUXQHQODFHSULYDGRKDVWDHOFHQWURSURYHHGRU GH WUDQVPLVLRQHV D ODUJD GLVWDQFLD HYLWDQGR DVt WHQHU TXH FRQWUDWDU HO VHUYLFLR D OD FRPSDxtDWHOHIyQLFDORFDO &DUDFWHUtVWLFDVGHWUDQVPLVLyQ (OUDQJRGHODVPLFURRQGDVFXEUHXQDSDUWHVXVWDQFLDOGHOHVSHFWR/DEDQGDGH IUHFXHQFLDV HVWi FRPSUHQGLGD HQWUH  \  *+] &XDQWR PD\RU VHD OD IUHF XHQFLD XWLOL]DGD PD\RU HV HO DQFKR GH EDQGD SRWHQFLDO \ SRU WDQWR PD\RU HV YLUWXDOPHQWH OD YHORFLGDGGHWUDQVPLVLyQ $OLJXDOTXHHQFXDOTXLHUVLVWHPDGHWUDQVPLVLyQODSULQFLSDOFDXVDGHSpUGLGDV HQ ODV PLFURRQGDV HV OD DWHQXDFLyQ 3DUD ODV PLFURRQGDV \ WDPELpQ SDUD OD EDQGD GH IUHFXHQFLDVGHUDGLR.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV PiVOHMRVGHORTXHORKDUtDQVLVHSURSDJDVHQHQOtQHDUHFWD8QDEXHQDDSUR[LPDFLyQ HV FRQVLGHUDU .

ODVSHUGLGDVVHSXHGHQH[SUHVDUFRPR  § 3 G · / ÂORJ¨ ¸ G% © O ¹ GRQGH G HV OD GLVWDQFLD \O HV OD ORQJLWXG GH RQGD H[SUHVDGDV HQ ODV PLVPDV XQLGDGHV3RUWDQWRODVSpUGLGDVYDUtDQFRQHOFXDGUDGRGHODGLVWDQFLD3RUHOFRQWUDULR HQ HO FDEOH FRD[LDO \ HO SDU WUHQ]DGR ODV SpUGLGDV WLHQHQ XQD GHSHQGHQFLD ORJDUtWPLFD FRQODGLVWDQFLD OLQHDOHQGHFLEHOLRV.

3RUWDQWRHQORVVLVWHPDVTXHXVDQPLFURRQGDV ORVDPSOLILFDGRUHVRUHSHWLGRUHVVHSXHGHQGLVWDQFLDU PiV GHDNPWtSLFDPHQWH.

 TXH HQ ORVFRD[LDOHV \ SDUHV WUHQ]DGRV /D DWHQXDFLyQ DXPHQWD FRQ ODVOOXYLDV VLHQGR HVWH HIHFWR VLJQLILFDWLYR SDUD IUHFXHQFLDV SRU HQFLPD GH  *+] 2WUD GLILFXOWDG DGLFLRQDO VRQ ODV LQWHUIHUHQFLDV &RQ OD SRSXODULGDG FUHFLHQWH GH ODV PLFURRQGDV ODV iUHDV GH FREHUWXUDVH SXHGHQVRODSDUKDFLHQGR TXH ODVLQWHUIHUHQFLDV VHDQ VLHPSUHXQ SHOLJURSRWHQFLDO$VtSXHVODDVLJQDFLyQGHEDQGDVWLHQHTXHUHDOL]DUVHVLJXLHQGRXQD UHJXODFLyQHVWULFWD /DVEDQGDVPiVXVXDOHVHQODWUDQVPLVLyQDODUJDGLVWDQFLDVHVLW~DQHQWUH*+] \  *+] 'HELGR D OD FRQJHVWLyQ SURJUHVLYD TXH HVWiQ VXIULHQGR HVWDV EDQGDV UHFLHQWHPHQWH OD EDQGD GH  *+] VH HVWi HPSH]DQGR D XWLOL]DU /D EDQGD GH ORV  *+]VHXVDSDUDOD79SRUFDEOH /RV HQODFHVGHPLFURRQGDVVHXVDQLJXDOPHQWHSDUD WUDQVPLWLUVHxDOGH79 HQODVLQVWDODFLRQHV&$79ORFDOHVSRVWHULRUPHQWHGLFKDVHxDO /XLV%5DPtUH]GHO3LQR  .

QIUDUURMRV /DV FRPXQLFDFLRQHV PHGLDQWH LQIUDUURMRV VH OOHYDQ D FDER PHGLDQWH WUDQVPLVRUHVUHFHSWRUHV ³WUDQVFHLYHUV´.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV VHKDFHOOHJDUDOXVXDULRLQGLYLGXDOPHGLDQWHFDEOHFRD[LDO)LQDOPHQWHFDEHFLWDUTXH ODVPLFURRQGDVGHDOWDVIUHFXHQFLDVVHHVWiQ XWLOL]DQGRSDUDHQODFHVFRUWRVSXQWRDSXQWR HQWUH HGLILFLRV 3DUD WDO ILQ VH XVD WtSLFDPHQWH OD EDQGD GH  *+] /DV EDQGDV GH IUHFXHQFLDV VXSHULRUHVVRQ PHQRV~WLOHVSDUDGLVWDQFLDVPiVODUJDV GHELGR D TXH FDGD YH] OD DWHQXDFLyQ HV PD\RU DKRUD ELHQ VRQ EDVWDQWH DGHFXDGDV SDUD GLVWDQFLDV PiV FRUWDV<DGHPiVDIUHFXHQFLDVVXSHULRUHVODVDQWHQDVVRQPiVSHTXHxDV\PiVEDUDWDV  .

 TXH PRGXODQ OX] LQIUDUURMD QR FRKHUHQWH /RV WUDQVFHLYHUV GHEHQ HVWDU DOLQHDGRV ELHQ GLUHFWDPHQWH R PHGLDQWH OD UHIOH[LyQ HQ XQD VXSHUILFLHFRORUHDGDFRPRSXHGHVHUHOWHFKRGHXQDKDELWDFLyQ 8QD GLIHUHQFLD VLJQLILFDWLYD HQWUH OD WUDQVPLVLyQ GH UD\RV LQIUDUURMRV \ ODV PLFURRQGDV HV TXH ORV SULPHURV QR SXHGHQ DWUDYHVDU ODV SDUHGHV 3RU WDQWR ORV SUREOHPDV GH VHJXULGDG \ GH LQWHUIHUHQFLDV TXH DSDUHFHQ HQ ODV PLFURRQGDV QR VH SUHVHQWDQ HQ HVWH WLSR GH WUDQVPLVLyQ (V PiV QR KD\ SUREOHPDV GH DVLJQDFLyQ GH IUHFXHQFLDV\DTXHHQHVWDEDQGDQRVHQHFHVLWDQSHUPLVRV  2QGDVGHUDGLR 'HVFULSFLyQItVLFD /DGLIHUHQFLDPiVSDOSDEOHHQWUHODVPLFURRQGDV\ODVRQGDVGHUDGLRHVTXHHVWDV ~OWLPDV VRQ RPQLGLUHFFLRQDOHV PLHQWUDV TXH ODV SULPHUDV WLHQHQ XQ GLDJUDPD GH UDGLDFLyQ PXFKR PiV GLUHFFLRQDO 3RU WDQWR ODV RQGDV GH UDGLR QR QHFHVLWDQ DQWHQDV SDUDEyOLFDVQLQHFHVLWDQTXHGLFKDVDQWHQDVHVWpQLQVWDODGDVVREUHXQDSODWDIRUPDUtJLGD SDUDHVWDUDOLHQDGDV $SOLFDFLRQHV &RQHOWpUPLQRRQGDVGHUDGLRVHDOXGHGHXQDPDQHUDSRFRSUHFLVDDWRGDVODV EDQGDV GH IUHFXHQFLDV GHVGH  N+] D  *+] $TXt GLFKR WpUPLQR VH FRQVLGHUD TXH DEDUFDODEDQGD9+)\SDUWHGHOD8+)GH0+]D*+](VWHIDQJRFXEUHODUDGLR FRPHUFLDO)0DVtFRPRWHOHYLVLyQ8+)\9+)(VWHIDQJRWDPE LpQVHXWLOL]DSDUDXQD VHULHGHDSOLFDFLRQHVGHUHGHVGHGDWRV &DUDFWHUtVWLFDVGHWUDQVPLVLyQ (OUDQJRGHIUHFXHQFLDVFRPSUHQGLGRHQWUH0+]\*+]HVPX\DGHFXDGR SDUD OD GLIXVLyQ VLPXOWiQHD D YDULRV GHVWLQRV $ GLIHUHQFLD GH ODV RQGDV HOHFWURPDJQpWLFDVFRQIUHFXHQFLDVPHQRUHVODLQRQRVIHUDHVWUDQVSDUHQWHSDUDODVRQGDV GH UDGLR VXSHULRUHV D  0+] $Vt SXHV OD WUDQVPLVLyQ HV SRVLEOH FXDQGR ODV DQWHQDV HVWiQ DOLHQDGDV QR SURGXFLpQGRVH LQWHUIHUHQFLDV HQWUH ORV WUDQVPLVRUHV GHELGDV D ODV UHIOH[LRQHVFRQODDWPyVIHUD$GLIHUHQFLDGHODUHJLyQGHODVPLFURRQGDVODVRQGDVGH UDGLRVRQPHQRVVHQVLEOHVDODDWHQXDFLyQSURGXFLGDSRUODOOXYLD /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV &RPRHQHOFDVRDQWHULRUGRQGHODWUDQVPLVLyQVLJXHXQDOtQHDUHFWDHQHVWHFDVR WDPELpQ VH YHULILFD OD HFXDFLyQ G  .K  HV GHFLU OD GLVWDQFLD Pi[LPD HQWUH HO WUDQVPLVRU\HOUHFHSWRUHVOLJHUDPHQWHPD\RUTXHHODOFDQFHYLVXDO$OLJXDOTXHHQODV PLFURRQGDV OD DWHQXDFLyQ GHELGD VLPSOHPHQWH D OD GLVWDQFLD YHULILFD OD HFXDFLyQ § 3 G · / ÂORJ¨ ¸ G%  <D TXH WLHQHQ XQD ORQJLWXG GH RQGD PD\RU ODV RQGDV GH UDGLR © O ¹ VXIUHQHQWpUPLQRVUHODWLYRVXQDDWHQXDFLyQPHQRU 8Q IDFWRU GHWHUPLQDQWH HQ ODV RQGDV GH UDGLR VRQ ODV LQWHUIHUHQFLDV SRU PXOWLWUD\HFWRULDV (QWUH ODV DQWHQDV GHELGR D OD UHIOH[LyQHQ OD VXSHUILFLH WHUUHVWUH HO PDU \ RWURV REMHWRV SXHGHQ DSDUHFHU PXOWLWUD\HFWRULDV (VWH HIHFWR VH REVHUYD FRQ IUHFXHQFLDHQHOUHFHSWRUGH79\FRQVLVWHHQTXHVHSXHGHQREVHUYDUYDULDVLPiJHQHV R VRPEUDV.

FXDQGRSDVDXQDYLyQ  /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  &RGLILFDFLyQGHGDWRV 8QDVHxDOGLJLWDOHVXQDVHFXHQFLDGHSXOVRVGHWHQVLyQGLVFUHWRV\GLVFRQWLQXRV GRQGHFDGDSXOVRHVXQHOHPHQWRGHVHxDO/RVGDWRVELQDULRVVHWUDQVPLWHQFRGLILFDQGR FDGD ELW GH GDWRV HQ FDGD HOHPHQWR GH VHxDO (Q HO FDVR PiV VHQFLOOR KDEUi XQD FRUUHVSRQGHQFLDXQRDXQRHQWUHORVELWV\GLFKRVHOHPHQWRV 8QSRFRGHWHUPLQRORJtD6LWRGRVORVHOHPHQWRVGHVHxDOWLHQHQHOPLVPRVLJQR DOJHEUDLFRHVGHFLUVLVRQWRGRVSRVLWLYRVRWRGRVQHJDWLYRVODVHxDOVHGLFHXQLSRODU (QXQDVHxDOSRODUSRUHOFRQWUDULRXQHVWDGROyJLFRVHUHSUHVHQWDUiPHGLDQWHXQQLYHO SRVLWLYRGHWHQVLyQ\HORWURPHGLDQWHXQQLYHOQHJDWLYR/DUD]yQGHGDWRVGHXQDVHxDO HVODYHORFLGDGGHWUDQVPLVLyQH[SUHVDGDHQELWVSRUVHJXQGRDODTXHVHWUDQVPLWHQORV GDWRV /D GXUDFLyQ R ORQJLWXG GH XQ ELW VH GHILQH FRPR HO WLHPSR HPSOHDGR HQ HO WUDQVPLVRUSDUDWUDQVPLWLUXQELWSDUDXQDUH]yQGHGDWRV5ODGXUDFLyQGHXQELWHV5 /DUD]yQGHPRGXODFLyQSRUHOFRQWUDULRHVODYHORFLGDGRUD]yQFRQODTXHFDPELDHO QLYHO GH OD VHxDO TXH GHSHQGHUi GHO HVTXHPD GH FRGLILFDFLyQ HOHJLGR /D UD]yQ R YHORFLGDG GH PRGXODFLyQ VH H[SUHVD HQ EDXGLRV TXH HTXLYDOH D XQ HOHPHQWR GH VHxDO SRUVHJXQGR3DUDFRQFOXLUSRUUD]RQHVKLVWyULFDVVHXVDQORVWpUPLQRVPDUFD\HVSDFLR DOXGLHQGRDORVGtJLWRVELQDULRV\UHVSHFWLYDPHQWH 3DUDLQWHUSUHWDUODVVHxDOHVGLJLWDOHVHQSULPHUOXJDUHOUHFHSWRUGHEHFRQRFHUR GHWHUPLQDUOD GXUDFLyQ GH FDGD ELW (V GHFLUHO UHFHSWRU FRQ PD\RUR PHQRUSUHFLVLyQ GHEH FRQRFHU FXDQGR FRPLHQ]D \ DFDED FDGD ELW (Q VHJXQGR OXJDU HO UHFHSWRU GHEH GHWHUPLQDUVLHOQLYHOSDUDFDGDELWHVDOWR .

REDMR .

 ¢4XpIDFWRUHVGHWHUPLQDQHOp[LWRRHOIUDFDVRGHOUHFHSWRUDOLQWHUSUHWDUODVHxDO GHHQWUDGD"+D\IDFWRUHVLPSRUWDQWHVODUHODFLyQVHxDOUXLGR RPHMRU(E1.

ODUD]yQ GHGDWRV RYHORFLGDGGHWUDQVPLVLyQ.

\HODQFKRGHEDQGD6HVXSRQHQORVRWURVIDFWRUHV FRQVWDQWHVVHSXHGHQHVWDEOHFHUODVVLJXLHQWHVDILUPDFLRQHV x x x 8QDXPHQWRGHODUD]yQGHGDWRVDXPHQWDUiODUD]yQGHHUURUSRUELW HVGHFLUOD SUREDELOLGDGGHTXHXQELWVHUHFLEDHUUyQHDPHQWH 8QDXPHQWRGHODUHODFLyQ61UHGXFHODWDVDGHHUURUSRUELW 8QLQFUHPHQWRGHODQFKRGHEDQGDSHUPLWHXQDXPHQWRHQODUD]yQGHGDWRV +D\RWURIDFWRUTXHVHSXHGHXWLOL]DUSDUDPHMRUDUODVSUHVWDFLRQHVGHOVL WHPD\ V HVWH QR HV RWUR TXH HO SURSLR HVTXHPD GH FRGLILFDFLyQ (O HVTXHPD GH FRGLILFDFLyQ HV VLPSOHPHQWH OD FRUUHVSRQGHQFLD TXH VH HVWDEOHFH HQWUH ORV ELWV GH ORV GDWRV FRQ ORV HOHPHQWRVGHVHxDO 6H KDQ LQWHQWDGR XQD JUDQ GLYHUVLGDG GH DSUR[LPDFLRQHV (Q OR TXH VLJXH VH GHVFULEHQDOJXQDVGHODVPiVXWLOL]DGDV $OJXQRVSURFHGLPLHQWRVSDUDHYDOXDU\FRPSDUDUODVGLVWLQWDVWpFQLFDVVRQ x (VSHFWUR GH OD VHxDO +D\ YDULRV DVSHFWRV GHO HVSHFWUR GH OD VHxDO TXH VRQ LPSRUWDQWHV /D DXVHQFLD GH FRPSRQHQWHV D DOWDV IUHFXHQFLDV VLJQLILFD TXH VH QHFHVLWD PHQRV DQFKR GH EDQGD SDUD VX WUDQVPLVLyQ (V PiV OD DXVHQFLD GH FRPSRQHQWHHQFRQWLQXD GF.

HVWDPELpQXQDFDUDFWHUtVWLFDGHVHDEOH6LODVHxDO WLHQH FRQWLQXD SDUD VX WUDQVPLVLyQ VH UHTXLHUH OD H[LVWHQFLD GH XQD FRQH[LyQ ItVLFDGLUHFWDVLODVHxDOQRWLHQHFRPSRQHQWHFRQWLQXDHVSRVLEOHVXWUDQVPLVLyQ PHGLDQWHWUDQVIRUPDGRUHVDFRSODGRV(VWRSURSRUFLRQDXQDLVODPLHQWRHOpFWULFR H[FHOHQWH UHGXFLHQGR DVt ODV LQWHUIHUHQFLDV 3RU ~OWLPR OD LPSRUWDQFLD GH ORV  /XLV%5DPtUH]GHO3LQR .

QPXQLGDG DO UXLGR H LQWHUIHUHQFLDV $OJXQRV FyGLJRV H[KLEHQ XQ FRPSRUWDPLHQWR VXSHULRU TXH RWURV HQ SUHVHQFLD GH HVH UXLGR (VWR VH PLGH HQ WpUPLQRVGHODWDVDGHHUURUSRUELW &RVWH\FRPSOHMLGDGDXQTXHHOFRVWHGHODOyJLFDGLJLWDOFRQWLQ~DEDMDQGRQRVH GHEHLJQRUDUHVWHIDFWRU(QSDUWLFXODUFXDQWRPD\RUHVODUD]yQGHHOHPHQWRVGH VHxDOSDUDXQDYHORFLGDGGHWUDQVPLVLyQGDGDPD\RUHVHOFRVWH  15=/ 15=.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV x x x x HIHFWRVUHODFLRQDGRVFRQODGLVWRUVLyQGHODVHxDO\ODVLQWHUIHUHQFLDVGHSHQGHGH ODVSURSLHGDGHVHVSHFWUDOHVGHODVHxDOWUDVPLWLGD(QODSUiFWLFDHVIUHFXHQWHTXH OD IXQFLyQ GH WUDQVIHUHQFLD GHOFDQDO VHDSHRU FHUFD GH ORVOtPLWHVGH OD EDQGD 3RUWDQWRXQEXHQGLVHxRGHEHUtDFRQFHQWUDUODSRWHQFLDWUDQVPLWLGDHQODSDUWH FHQWUDO GHO DQFKR GH EDQGD GH OD VHxDO (Q WDO FDVR VH WHQGUi XQD GLVWRUVLyQ PHQRUHQ OD VHxDOUHFLELGD 3DUD FRQVHJXLU HVWH REMHWLYR VH SXHGHQ GLVHxDUORV FyGLJRV GH IRUPD TXH VH PRGHOH DGHFXDGDPHQWH HO HVSHFWUR GH OD VHxDO WUDQVPLWLGD 6LQFURQL]DFLyQ<DVHKDPHQFLRQDGRODQHFHVLGDGGHGHWHUPLQDUHOSULQFLSLR\ ILQGHFDGDELW(VWRQRHVXQDWDUHDIiFLO8QDDSUR[LPDFLyQEDVWDQWHFRVWRVDHV WUDQVPLWLU XQD VHxDO GH UHORM SRU VHSDUDGR SDUD VLQFURQL]DU HO UHFHSWRU FRQ HO WUDQVPLVRU /D DOWHUQDWLYD HV SURSRUFLRQDU OD VLQFURQL]DFLyQ PHGLDQWH OD SURSLD VHxDO WUDQVPLWLGD OR TXH SXHGH FRQVHJXLUVH VL VH DGRSWD XQ HVTXHPD GH FRGLILFDFLyQDGHFXDGR 'HWHFFLyQ GH HUURUHV (V ~WLO GLVSRQHU GH DOJXQD FDSDFLGDG GH GHWHFFLyQ GH HUURUHV LQFRUSRUDGD HQ HO HVTXHPD GH FRGLILFDFLyQ VLWXDGR HQ OD FDSD ItVLFD 3HUPLWLpQGRVHFRQHOORTXHORVHUURUHVVHGHWHFWHQPiVUiSLGDPHQWH . %LSRODU$0. 3VHXGRWHUQDULR 0DQFKHVWHU 0DQFKHVWHU GLIHUHQFLDO            $OJRULWPRV  /D IRUPD PiV IUHFXHQWH \ IiFLO GH WUDQVPLWLU VHxDOHV GLJLWDOHV HV PHGLDQWH OD XWLOL]DFLyQGHXQQLYHOGHWHQVLyQGLIHUHQWHSDUDFDGDXQRGHORVELWV/RV FyGLJRVTXH VLJXHQ HVWD HVWUDWHJLD FRPSDUWHQ OD SURSLHGDG GH TXH HO QLYHO GH WHQVLyQ VH PDQWLHQH FRQVWDQWHGXUDQWHODGXUDFLyQGHXQELWHVGHFLUQRKD\WUDQVLFLRQHV QRKD\UHWRUQRDO /XLV%5DPtUH]GHO3LQR  15= 15=/1RQ5HWXUQWR]HUR /HYHO.

.

.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV QLYHO FHUR GH WHQVLyQ.

 3RU HMHPSOR OD DXVHQFLD GH WHQVLyQ VH SXHGH XVDU SDUD UHSUHVHQWDU XQ  ELQDULR PLHQWUDV TXH XQ QLYHO FRQVWDQWH \ SRVLWLYR GH WHQVLyQ SXHGH UHSUHVHQWDUDO$XQTXHHVPiVIUHFXHQWHXWLOL]DUXQQLYHOQHJDWLYRSDUDUHSUHVHQWDUXQ YDORU ELQDULR \ XQD WHQVLyQ SRVLWLYD SDUD UHSUHVHQWDU DO RWUR (VWH ~OWLPR VH GHQRPLQD FyGLJR 1LYHO QR UHWRUQR D FHUR 15=/ ³1RQUHWXUQWR=HUR/HYHO´.

 15=/ VH XVD JHQHUDOPHQWH SDUD JHQHUDU R LQWHUSUHWDU ORV GDWRV ELQDULRV HQ ORV WHUPLQDOHV \ RWURV GLVSRVLWLYRV6LVHXWLOL]DXQFyGLJRGLIHUHQWHpVWHVHJHQHUDUiXVXDOPHQWHDSDUWLUGHOD VHxDO15=/ 3RUOR WDQWR SDUD UHSUHVHQWDU HO YDORU OyJLFR VH XWLOL]DUiXQ QLYHODOWR \ SDUD UHSUHVHQWDUHOYDORUOyJLFRVHXWLOL]DUiXQQLYHOEDMR 9HQWDMDVHVPX\VHQFLOOR .QFRQYHQLHQWHV WLHQH SUREOHPDV GH VLQFURQL]DFLyQ \D TXH VL WHQHPRV XQD VHFXHQFLD PX\ODUJDGHR WHQGUHPRVGXUDQWHPXFKRWLHPSRHOQLYHOGHWHQVLyQGLILFXOWDQGRDO UHFHSWRUHOVDEHUFXDQWRVELWVOOHJDQGHHVHQLYHO6LQRKD\HOPLVPRQ~PHURGH\ OD VHxDO WLHQH FRPSRQHQWH FRQWLQXD OD PHGLD HV GLVWLQWD GH .

³1RQUHWXUQWR]HURLQYHURQRQHV´. GDQGR SUREOHPDV FRQ PXFKRVPHGLRVGHWUDQVPLVLyQSRUTXHpVWRVVXHOHQDWHQXDUPiVODFRUULHQWHFRQWLQXD 8QDYDULDQWHGHO15=VHGHQRPLQD15=.

 $OLJXDOTXH15=/HO 15=.PDQWLHQHFRQVWDQWHHOQLYHOGHWHQVLyQPLHQWUDVGXUDXQ ELW/RVGDWRVVHFRGLILFDQPHGLDQWHODSUHVHQFLDRDXVHQFLDGHXQDWUDQVLFLyQGHODVHxDO DOSULQFLSLRGHOLQWHUYDORGHGXUDFLyQGHXQELW8QVHFRGLILFDPHGLDQWHODWUDQVLFLyQ EDMR D DOWR R DOWR D EDMR.

 DO SULQFLSLR GHO LQWHUYDOR GHO ELW PLHQWUDV TXH XQ FHUR VH UHSUHVHQWDSRUODDXVHQFLDGHWUDQVLFLyQ 3RUORWDQWR!1RVHFDPELDODWHQVLyQ +D\TXHGHFLGLUXQYDORUGHDUUDQTXH.

HVXQHMHPSORGHFRGLILFDFLyQGLIHUHQFLDO(QODFRGLILFDFLyQGLIHUHQFLDO HQOXJDUGHGHWHUPLQDUHOYDORUDEVROXWRODVHxDOVHFRGLILFDFRPSDUDQGRODSRODULGDGGH ORVHOHPHQWRVGHVHxDODG\DFHQWHV8QDYHQWDMDGHHVWHHVTXHPDHVTXHHQSUHVHQFLDGH UXLGRSXHGHVHUPiVVHJXURGHWHFWDUXQD WUDQVLFLyQ HQOXJDUGHFRPSDUDUXQYDORUFRQ XQXPEUDO2WUDYHQWDMD HVTXHHQXQVLVWHPDFRPSOLFDGRGHWUDQVPLVLyQQRHVGLItFLO SHUGHUODSRODULGDGGHODVHxDO3RUHMHPSORHQXQDOtQHDGHSDUWUHQ]DGRVLORVFDEOHV VHLQYLHUWHQDFFLGHQWDOPHQWHWRGRVORV\HQHO17=/VHLQYHUWLUiQ(VWRQRSDVDHQ XQHVTXHPDGLIHUHQFLDO /RVFyGLJRV15=VRQORVPiVIiFLOHVGHLPSOHPHQWDU\DGHPiVVHFDUDFWHUL]DQ SRUKDFHUXQXVRHILFD]GHODQFKRGHEDQGD /DSULQFLSDOOLPLWDFLyQGHORVFyGLJRV15=HVODSUHVHQFLDGHXQDFRPSRQHQWH FRQWLQXD \ OD DXVHQFLD GH FDSDFLGDG GH VLQFURQL]DFLyQ 3DUD LOXVWUDU HVWD ~OWLPD GHVYHQWDMDWpQJDVHHQFXHQWDTXHXQDFDGHQDODUJDGHXQRVRGHFHURVHQXQHVTXHPD 15=/ R XQD FDGHQD GH FHURV HQ 15=. 15=. \VHLQYLHUWHODWHQVLyQ 15=. VH FRGLILFDUi FRPR XQ QLYHO GH WHQVLyQ FRQVWDQWH GXUDQWH XQ ODUJR LQWHUYDOR GH WLHPSR (Q HVWDV FLUFXQVWDQFLDV FXDOTXLHU IOXFWXDFLyQ HQWUH ODV WHPSRUL]DFLRQHV GHO WUDQVPLVRU \ HO UHFHSWRU GDUiQ OXJDU D XQD SpUGLGDGHVLQFURQL]DFLyQHQWUHDPERV 'HELGRDVXVHQFLOOH]\DODUHVSXHVWDHQEDMDVIUHFXHQFLDVORVFyGLJRV15=VH XWLOL]DQ FRQ IUHFXHQFLD HQ ODV JUDEDFLRQHV PDJQpWLFDV 1R REVWDQWH VXV OLPLWDFLRQHV KDFHQTXHHVWRVFyGLJRVQRVHDQDWUDFWLYRVSDUDDSOLFDFLRQHVGHWUDQVPLVLyQGHVHxDOHV  15=.QYHUWLGR.

/XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (Q HO FyGLJR 0DQFKHVWHU VLHPSUH KD\ XQD WUDQVLFLyQ HQ PLWDG GHO LQWHUYDOR GH GXUDFLyQ GHO ELW (VWD WUDQVLFLyQ HQ OD PLWDG GHO ELW VLUYH FRPR XQ SURFHGLPLHQWR GH VLQFURQL]DFLyQ D OD YH] TXH VH WUDQVPLWHQ ORV GDWRV XQD WUDQVLFLyQ GH EDMR D DOWR UHSUHVHQWDXQ \XQDWUDQVLFLyQGHDOWRDEDMRUHSUHVHQWDXQ !1LYHODOWR\DPLWDGGHOELWVHFDPELD !1LYHOEDMR\DPLWDGGHOELWVHFDPELD  0DQFKHVWHU $VLJQDPRVHQWRGRVORVELWVXQFDPELRQRWHQLHQGRHOPLVPRQLYHOGHWHQVLyQ GXUDQWHPXFKRWLHPSR /D WUDQVLFLyQ D PLWDG GHO LQWHUYDOR VH XWLOL]D WDQ VROR SDUD SURSRUFLRQDU VLQFURQL]DFLyQ\VLHPSUHH[LVWHWUDQVLFLyQDPLWDGGHOLQWHUYDOR/DFRGLILFDFLyQGHXQ VHUHSUHVHQWDSRUODSUHVHQFLDGHXQDWUDQVLFLyQDOSULQFLSLRGHOLQWHUYDORGHOELW\XQ VHUHSUHVHQWDPHGLDQWHODDXVHQFLDGHWUDQVLFLyQ(O0DQFKHVWHUGLIHUHQFLDOWLHQHFRPR YHQWDMDVDGLFLRQDOHVODVGHULYDGDVGHODXWLOL]DFLyQGHXQDDSUR[LPDFLyQGLIHUHQFLDO1R HVSUHFLVRTXHHOUHFHSWRUWHQJDXQUHORMPX\SUHFLVR6LHPSUHWHQGUiXQDVHxDOPHGLD GH  QR KDELHQGR FRPSRQHQWH FRQWLQXD(O LQFRQYHQLHQWH HV TXH FRQVXPH PiVDQFKR GHEDQGD /D FRGLILFDFLyQ 0DQFKHVWHU HV XQD FRGLILFDFLyQ %% SRU TXH HV FRPR VL FRJLHVHXQELW\ORVXVWLWX\HVHSRUELWV !!15= !!15= +D\FRGLILFDFLRQHVJHQHUDOHV[%\%FRPR%%!)'.\%%HQ)$67(7+ (OUHVXOWDGRVHWUDQVPLWHFRPR15= (MHPSORGH%% o o o ««    0DQFKHVWHUGLIHUHQFLDO 'HODVWUDQVLFLRQHVGH ELWV .

FRJHUHPRVVyOR ODVTXH WHQJDQ\SRUPHGLR 9HPRVDKRUDDOJXQRVDOJRULWPRVWHUQDULRV WUHVQLYHOHVGHWHQVLyQ\ .

  !YROW !$OWHUQD\±  3VHXGRWHUQDULR /XLV%5DPtUH]GHO3LQR  .

QYHUVLRQ. VLELHQHVODEDVHGHPXFKDVDSOLFDFLRQHV 8Q  ELQDULR VH UHSUHVHQWD SRU DXVHQFLD GH VHxDO \ HO  ELQDULR VH UHSUHVHQWD FRPRXQSXOVRSRVLWLYRRQHJDWLYR/RVSXOVRVFRUUHVSRQGLHQWHVDORVGHEHQWHQHUXQD SRODULGDGDOWHUQDQWH !YROW !DOWHUQD\±  $0. $OWHUQDWH0DUN.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (O ELW  VH UHSUHVHQWD SRU OD DXVHQFLD GH VHxDO \ HO  PHGLDQWH SXOVRV GH SRODULGDGDOWHUQDQWH1RKD\YHQWDMDVSDUWLFXODUHVGHHVWDFRGLILFDFLyQUHVSHFWRGH$0.

9HQWDMDVGHORVWHUQDULRV(VWHWLSRGHHVTXHPDWLHQHODVVLJXLHQWHVYHQWDMDV(QSULPHU OXJDUQRKDEUiSUREOHPDVGHVLQFURQL]DFLyQHQHOFDVRGHTXHKD\DXQDFDGHQDODUJDGH  &DGD  IXHU]D XQD WUDQVLFLyQ SRU OR TXH HO UHFHSWRU VH SXHGH VLQFURQL]DU HQ GLFKD WUDQVLFLyQ8QDFDGHQDODUJDGHFHURVWRGDYtDHVXQSUREOHPD(QVHJXQGROXJDU\DTXH ORV HOHPHQWRV GH VHxDO FRUUHVSRQGLHQWHV D  DOWHUQDQ HO QLYHO GH WHQVLyQ QR KD\ FRPSRQHQWH FRQWLQXD $GHPiV HO DQFKR GH EDQGD GH OD VHxDO UHVXOWDQWH HV FRQVLGHUDEOHPHQWHPHQRUTXHHOFRUUHVSRQGLHQWHD15=3RU~OWLPRODDOWHUQDQFLDHQWUH ORVSXOVRV SURSRUFLRQD XQDIRUPD VHQFLOOD GH GHWHFWDU HUURUHV &XDOTXLHU HUURU DLVODGR WDQWR VL HOLPLQD FRPR VL LQWURGXFH XQ SXOVR VLJQLILFD XQ LQFXPSOLPLHQWR GH GLFKD SURSLHGDG .RGH¶VHQHO RWUR WHQGUHPRV GXUDQWH PXFKR WLHPSR HO PLVPR QLYHO WHQLHQGR SUREOHPDV GH VLQFURQLVPR 3DUD VROYHQWDU HVWRV SUREOHPDV H[LVWHQ  YDULDQWHV TXH YHUHPRV D FRQWLQXDFLyQ%=6 86$.QFRQYHQLHQWHVGHORVWHUQDULRV6LWHQHPRVXQDFDGHQDODUJDGHHQ$0.

+'% (85-31.

ELSRODU<DVDEHPRVTXHODSUHVHQFLDGHXQDVHFXHQFLDODUJDGH FHURV SXHGH GDU OXJDU D XQD SpUGLGD GH VLQFURQL]DFLyQ 3DUD HYLWDU HVWH SUREOHPD VH UHDOL]DXQDFRGLILFDFLyQGHDFXHUGRFRQODVVLJXLHQWHVUHJODV x 6LDSDUHFHXQRFWHWRWRGRFHURV RFKRFHURV. %=6 +'%                   6HEDVDHQ$0.  $0.

\HO~OWLPRYDORUGHWHQVLyQDQWHULRU DGLFKRRFWHWRIXHSRVLWLYRFRGLILFDUGLFKRRFWHWRFRPR x 6LDSDUHFHXQRFWHWRFRQWRGRFHURV\HO~OWRPRYDORUGHWHQVLyQDQWHULRUDGLFKR RFWHWRIXHQHJDWLYRFRGLILFDUGLFKRRFWHWRFRPR &RQHVWHSURFHGLPLHQWRVHIXHU]DQGRVYLRODFLRQHVGHFyGLJRGHOFyGLJR$0.OR FXDO HV PX\ LPSUREDEOH TXH KD\D VLGR FDXVDGR SRU UXLGR X RWURV GHIHFWRV HQ OD /XLV%5DPtUH]GHO3LQR   %=6 %LSRODUZLWK=HURV6XEVWLWXWLRQ.

.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV WUDQVPLVLyQ(OUHFHSWRULGHQWLILFDUiHVHSDWUyQ\ORLQWHUSUHWDUiFRQYHQLHQWHPHQWHFRPR XQRFWHWRWRGRFHURV (VWHHVTXHPDVHXWLOL]DHQ(XURSD\-DSyQ$OLJXDOTXHHODQWHULRUVHEDVDHQOD FRGLILFDFLyQ $0. (Q HVWH HVTXHPD VH UHHPSOD]DQ ODV FDGHQDV GH FXDWUR FHURV SRU FDGHQDVTXHFRQWLHQHQXQRRGRVSXOVRV(QHVWHFDVRHOFXDUWRFHURVHVXVWLWX\HSRUXQ HVWDGRGHVHxDOQRSHUPLWLGRHQHOFyGLJRHVWH SURFHGLPLHQWRVHGHQRPLQDYLRODFLyQGHO FyGLJR(QHVWHFyGLJRVHVLJXHHOVLJXLHQWHHVTXHPDGHVXVWLWXFLyQ 3RODULGDGGHO SXOVRDQWHULRU   1XPHURGHSXOVRVELSRODUHV XQRV.

PSDU 3DU      +'% ´+LJK'HQVLW\%LSRODU=HURVµ.GHVGHOD ~OWLPDVXVWLWXFLyQ .

$0.  9HDPRVODGHQVLGDGHVSHFWUDOGHSRWHQFLD 3RUTXHWLHQHQ FRPSRQHQWHFRQWLQXDz  )RUPDGHRQGD GHHVWDVFRGLILFDFLRQHV 15=15=. 3VHXGRWHUQDULR %=6+'% 0DQFKHVWHU 0DQFKHVWHUGLIHUHQFLDO 6LTXLHURWUDQVPLWLU0%VHJ    I5 )UHFXHQFLD +].

  5pJLPHQELQDULR ELWVVHJ.

0+] &RQ$0. &RQ15=15=.SVHXGRWHUQDULR 0+] &RQ0DQFKHVWHU 0+]  'DWRVGLJLWDOHVDVHxDOHDQDOyJLFD 6HVXHOHHPSOHDUHOPRGHPSDUDODFRQYHUVLyQ o 02'(0o 6HxDODQDOyJLFD /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  V W .

'LVSRQHPRVGHYDULRVWLSRVGHFRGLILFDFLyQ ­ o $ÂVHQ 3 IW .

H\LQJ. $PSOLWXG6KLIW. ® o ¯ 'HVSOD]DPLHQWRHQDPSOLWXG $6.

     V W .

'HVSOD]DPLHQWRHQIUHFXHQFLD )6.

    ­  o $ÂVHQ 3 IW .

® ¯ o $ÂVHQ 3 I W .

6yOR VH FDPELD OD  'HVSOD]DPLHQWRHQIDVH 36.

     IUHFXHQFLDGHODRQGDVHQR V W .

­  o $ÂVHQ 3 IW .

® ¯ o $ÂVHQ 3 IW  3 .

6HVXHOHHPSOHDUXQDFRPELQDFLyQGHORVHVTXHPDV /DV QRUPDV 9  ESV.

 9 ELV  ESV.

 9  ESV.

 9 ELV  ESV.

 9  ESV.

 9  ESV.

&R3&0HQ LQJOpVGH 3XOVH&RGH0RGXODWLRQ. VH EDVDQ HQ FRPELQDFLRQHV GH IDVH IUHFXHQFLD\DPSOLWXG 0LVPDIUHFXHQFLDSHURGHVSOD]DGDHQIDVH  'DWRVDQDOyJLFRVDVHxDOHVGLJLWDOHV /D YR] DXGLR YLGHR R LPiJHQHV VH WUDQVIRUPDQ D GDWRV ELQDULRV PHGLDQWH OD GLJLWDOL]DFLyQTXHSHUPLWHSDVDUGDWRVDQDOyJLFRVDGLJLWDOHV $OJXQRVDOJRULWPRVGHGLJLWDOL]DFLyQVRQSDUDYLGHR03(*RSDUDDXGLR03 +DFH DOJXQRV DxRV HQ OD FRPXQLFDFLyQ WHOHIyQLFD VH FRPHQ]y D WUDQVPLWLU GLJLWDOPHQWH(VORTXHVHOODPDPRGXODFLyQSRULPSXOVRVFRGLILFDGRV 0.

 'DWRVDQDOyJLFRVo 'DWRVGLJLWDOHVo 6HxDOHVGLJLWDOHV /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV &RQVLVWHHQWUDQVIRUPDUXQFDQDOWHOHIyQLFRRGHYR]HQXQDVHFXHQFLDGHELWV6H KDFHPHGLDQWHSURFHVRV0XHVWUHR \FXDQWLILFDFLyQ 0HGLDQWHODYLEUDFLyQGHODPHPEUDQDGHOPLFUyIRQRVHFUHDXQDRQGDHOpFWULFD XQDVHxDO3DUDGLJLWDOL]DUHVDRQGDSULPHURVHPXHVWUHDRVHDVHPLGHHOYDORUGHHVD RQGDQYHFHVSRUVHJXQGR6HWHQGUiQWDPELpQQQLYHOHVGHWHQVLyQ&DGDXQRGHHVRV YDORUHVVHDSUR[LPDDOYDORUPiVFHUFDQRHVRHVODFXDQWLILFDFLyQ (Q OD UHFHSFLyQ VH WLHQHQ PXHVWUDV YDORUHV VXHOWRV.

 6H UHFXSHUD OD VHxDO PLGLHQGRWRGRVHVRVSXQWRV  0RGXODFLyQSRULPSXOVRVFRGLILFDGRV 1YHFHVSRUVHJXQGR 1QLYHOHV W W 7RPDQGRPXFKDVPXHVWUDVSRUVHJXQGR\WHQLHQGRPXFKRVQLYHOHVODVHxDOTXH VHUHFRPSRQHHQHOGHVWLQRVHSDUHFHUiPXFKRDODRULJLQDO3DUDYR]HVVXILFLHQWHWRPDU PXHVWUDVSRUVHJXQGR/RVQLYHOHVQRHVWiQHVSDFLDGRVSXHVODUHFHSFLyQGHORtGR GHSHQGHGHODVDPSOLWXGHVGHODVIUHFXHQFLDV $~Q KDELHQGR PiV GLIHUHQFLD HO RtGR OR SHUFLEH SHRU FUHHTXHVHSDUHFHQORVVRQLGRV.

 PXHVWUDVVHJFXDQWLILFDGDVFRQELWV HQ(XURSD.

 VRQ.EVHJ(Q86$VHUtDQ.EVHJ /H\PQLYHOHV ELWV.

HQ86$ /H\$QLYHOHV ELWV.

HQ(XURSD (QODUHFHSFLyQ  'DWRVDQDOyJLFRVDVHxDODQDOyJLFD +D\YDULRVWLSRV x 0RGXODFLyQGHDPSOLWXG V W .

$Â [ W .

ÂVHQ 3 IW .

(QUDGLRHV$0.

x 0RGXODFLyQGHIDVH V W .

VHQ 3 IW  $Â [ W .

.

x 0RGXODFLyQGHIUHFXHQFLD V W .

VHQ 3 IW  $Â I Â [ W .

.

(QUDGLRHV)0.

/XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  .QWHUIDFHVGHFDSDItVLFD  &RQFHSWRV $OHQYLDU\UHFLELUGDWRVGHEHKDEHUXQDWHPSRUL]DFLyQHQWUHHPLVRU\UHFHSWRU ORVGRVWLHQHQTXHHVWDUGHDFXHUGRHQGRQGHHPSLH]D\DFDEDFDGDELWFXDQWRGXUDOD WUDQVPLVLyQHWF 6XSRQLHQGRTXHHPSOHDPRVFRGLILFDFLyQ15= \HQYLDQGR0EVHJ LELWFDGD PLFURVHJXQGR.

 7UDQVPLVRU PV         7UDQVPLVLyQVtQFURQD\DVtQFURQD ¢4Xp SDVD VL KD\ XQ HUURU GHO  HQWUH ORV UHORMHV GHO WUDQVPLVRU \ GHO UHFHSWRU" FDGD PV PVHORWURKDFRQWDGRPV.

 7UDVELWVHOUHFHSWRUHVWDUiKDFLHQGRHOPXHVWUHRHQODWUDQVLFLyQGHXQQLYHODRWUR /D VROXFLyQ VtQFURQD HV PiV UXGLPHQWDULD \ DQWLJXD \ OD VLQFURQD HV PHMRU \ PiV PRGHUQD 5HFHSWRU (O UHFHSWRU XVWR HQ HO SXQWR PHGLR FXDQGRSDVDQPV.

GHEHUtDYHUTXHQLYHOKD\ SDUDGHGXFLUHOELWFRUUHVSRQGLHQWH  7UDQVPLVLyQDVtQFURQD (Q VXV RUtJHQHV KDEtD TXH UHPRQWDUVH DO WHOpJUDIR $~Q KR\ VH HPSOHD HQ FRPXQLFDFLRQHVSXHUWRVHULH 7UDQVPLWLPRV VLHPSUH JUXSRV SHTXHxRV GH ELW SRU HYLWDU HO IDOOR WUDV XQRV FXDQWRV ELWV.

.FRQELWV(%&' . /D WUDQVPLVLyQ VH UHDOL]D FDUiFWHU D FDUiFWHU GRQGH XQ FDUiFWHU HV XQ JUXSRGHELWV HQ\ELWVGHSHQGLHQGRGHOVLVWHPD $6&.&FRQ ELWV.

.

 6LQRKD\QDGDTXHWUDQVPLWLUVHHQYtDXQDVHxDOGHUHSRVRTXHVHFRUUHVSRQGH FRQXQELQDULR QLYHOEDMRGHWHQVLyQ.

 6LKD\TXHWUDQVPLWLUDOJRVHHQYtDXQELWGHFRPLHQ]R ELQDULRQLYHODOWR.

D FRQWLQXDFLyQHOFDUiFWHUFRGLILFDGRFRQ15= QLYHODOWRQLYHOEDMR.

PSDUQžLPSDUGHXQRVHQWUHHOFDUiFWHU\HOELWGHSDULGDG.GHVSXpVXQELW GHSDULGDG RGHSHQGLHQGRGHOQžWRWDOGH³´SDULGDGSDUQ~PHURSDUGHHQWUHHO FDUiFWHU\HOELWGHSDULGDG.

 $OILQDOVHHQYtDXQHOHPHQWRGHSDUDGD ELQDULRGHGXUDFLyQRELWV.

 5HSRVR 6LKXELHVHTXHWUDQVPLWLUPiVYHQGUtDXQ ELWGHFRPLHQ]R 5HSRVR %LWGH FRPLHQ]R %LWGH SDULGDG x x x x %LWGHFRPLHQ]R &DUiFWHU15= %LWSDULGDG R.

(OHPHQWRGHSDUDGD!GHGXUDFLyQRELWVGHSHQGLHQGRGHOVLVWHPD &DUiFWHU SXHGHQVHU¶VR¶V.

3DUDGD /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 9HQWDMDVGHODWUDQVPLVLyQDVtQFURQD x (VPX\VHQFLOOD x 3RFRH[LJHQWHHQFXDQWRDODVLQFURQL]DFLyQ DOWUDQVPLWLUVHSRFRVELWVVHWROHUD XQHUURUGHKDVWDHO.

& SRU HMHPSOR.QFRQYHQLHQWHV x (VSRFRHILFLHQWH3RUFDGDELWVTXHTXHUHPRVWUDQVPLWLUWUDQVPLWLPRVHQ UHDOLGDG  7UDQVPLVLyQVtQFURQD &XDQGR HO UHFHSWRU SXHGH UHFXSHUDU HO VLQFURQLVPR GHO WUDQVPLVRU &RQ 15= HVWDVHFXHQFLD       1RVHSHUPLWHDOUHFHSWRUVLQFURQL]DUVHVDEHUFXDQGRVHSDVDGHXQELWDORWUR SXHVHVWiPXFKRWLHPSRHQHOPLVPRQLYHOGHWHQVLyQ (O SUREOHPD HV VDEHU FXDQGR WHUPLQD XQ HQYtR \ FRPLHQ]D RWUR 3RU HOOR OD LQIRUPDFLyQVHHQFDSVXODHQ.IUDPHV 75$0$o 35(È0%8/2 &21752/ '$726 &21752/ (Q ORV SURWRFRORV GH WUDQVPLVLyQ VtQFURQD '. .

&VLQ  ELWV. HVWRV FDPSRV QXQFD H[FHGHQ GH ORV  ELWV HQ '.

QWHUIDFHV &XDQGRXQRUGHQDGRUVHFRQHFWDDXQDUHGOODPDPRVLQWHUID]DODHVSHFLILFDFLyQ GHFDUDFWHUtVWLFDVPHFiQLFDVHOpFWULFDVIXQFLRQDOHV\GHSURFHGLPLHQWRGHFRQH[LyQ x &DUDFWHUtVWLFDV PHFiQLFDV 7DPDxR GHO FRQHFWRU SLQHV GLVWDQFLD HQWUH HVWRV HWF x &DUDFWHUtVWLFDV HFOpFWLFDV 4XH FRGLILFDFLyQ VH XVD 15= 0DQFKHVWHU HWG . PLHQWUDVTXH ORV GDWRV SXHGHQ VHU PXFKRVELWV 0XFKDHILFLHQFLD7UDQVPLWLPRVPLOHVGHELWVFRQVRORGHFDEHFHUD 35(È0%8/2 &21752/ HWF  .

 TXHQLYHOHVGHWHQVLyQTXHUpJLPHQELQDULR ELWVVHJ.

GLVWDQFLDTXHSXHGHPHGLU HOFDEOH x &DUDFWHUtVWLFDV IXQFLQDOHV &DGD XQR GH ORV SLQHV R KLORV GHO FDEOH TXH VHxDO OOHYD YWLHUUDUHORMHWF.

 x &DUDFWHUtVWLFDV GH SURFHGLPLHQWR 3RU UHDOL]DUVH OD FRPXQLFDFLyQ HQ TXH RUGHQ KDQGHLQWHUFDPELDUVHODVVHxDOHVSRUHVHLQWHUID] $ YHFHV XWLOL]DPRV XQ HTXLSR LQWHUPHGLR 02'(0 SRU HMHPSOR.

 $TXt QRV HQFRQWUDPRV  LQWHUIDFHV RUGHQDGRU02'(0 \ 02'(0UHG (VWR SUHVHQWD ODV VLJXLHQWHVYHQWDMDV1XHVWURRUGHQDGRUSXHGH WHQHUXQDLQWHUID]PX\FRP~Q 56R 86%.

 DO TXH FRQHFWDPRV HO HTXLSR LQWHUPHGLR (O RUGHQDGRU VLJXH FRQ HO PLVPR LQWHUID]\VRORFDPELDPRVFXDQGRHVQHFHVDULRHOHTXLSRLQWHUPHGLR /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (OHTXLSRTXHHVHOWUDQVPLVRUUHFHSWRUGHGDWRVVHOODPD'7( 'DWD7HUPLQDO (TXLSPHQW.

 (O HTXLSR LQWHUPHGLR VH GHQRPLQD '&( 'DWD &LUFXLRW 5(' WHUPLQDWLQJ(TXLSPHQW.

7879 (VHOLQWHUID]TXHHPSOHDQORVPRGHPVHQWUHRWURV ¾ 0HFiQLFDV&RQHFWRUGHSLQHV6HVXHOHQXWLOL]DUFRPRPXFKRSLQHV  SLQHV SLQHV  56 +D\ XQ LQWHUID] PX\ LPSRUWDQWH HQWUH '7( \ '&( ¾ (OpFWULFDV6HHPSOHDFyGLJR15=!Y<±Y3XHGHDOFDQ]DU.ESVD PHWURVGHGLVWDQFLD ¾ )XQFLRQDOHV (VSHFLILFD OD VHxDO TXH OOHYD FDGD SLQ HVDV VHxDOHV VH SXHGHQ DJUXSDUHQ R 'DWRV  SLQHV.7879 x )XQFLRQDOHV\SURFHGLPHQWDOHV .$((VWDQRUPDHVSHFLILFDORV WLSRVGHFDUDFWHUtVWLFDVGHODFRQH[LyQ x 0HFiQLFD. '7( OODPDGR56 'LVSRVLWLYR LQWHUIi]GH OtQHD '&( (VHOSXHUWRVHULH(OQRPEUHDFWXDOHV(.62 x (OpFWULFDV.

  SDUD WUDQVPLWLU  SDUD UHFLELU \ RWURV  VHFXQGDULRV SDUDIXQFLRQDPLHQWRVVHPLGXSOH[ SDUDFRQWURODUHUURUHVHQHVWHWLSRGH FRQH[LRQHV.

 R 7HPSRUL]DFLyQ SLQHV.

SLQ!'7(PDQGDUHORMD'&(SLQ!'&( PDQGDUHORMD'7(\RWURVHFXQGDULR R 7LHUUD SLQ.

 R &RQWURO HOUHVWR.

6HHVWDEOHFHXQDOODPDGDHWF 6LUYHQSDUDFRQHFWDURUGHQDGRUHVHQWUHVLDWUDYpVGHXQFDEOH 02'(0 '7( 56 '&( 02'(0 '&( 56 '&(  02'(0GHGLVWDQFLDOLPLWDGD ¾ ¾ ¾ ¾ (VWRVPRGHPVVyORXVDQSLQHV 6HxDOWLHUUD JQG.

 7UDQVPLVLyQ 7[.

 5HFHSFLyQGHGDWRV 5['.

 3HWLFLyQGHHQYtR 5765HTXHVW7R6HQG.

 '7(o'&( '7(m'&( '7(o'&(  /XLV%5DPtUH]GHO3LQR .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV ¾ 3UHSDUDGRSDUDHQYLDU &76&OHDU7R6HQG.

 ¾ '&(SUHSDUDGR '65.

 ¾ 'HWHFFLyQGHVHxDO &'&DUULHU'HWHFW.

 02'(0 '&( 576 7[' $OHQFHQGHUVHHO02'(0SRQHD21ODVHxDO'65 SLQ.

\VLJXHDVt '7( '7(m'&( '7(m'&( '7(m'&( 6LTXLHURHQYLDUDOJR '6521 &76  '7( 56 02'(0GHODUHGWHOHIyQLFD '&( 57& '&( 56 '7( &' 5.' 'HORVSLQHVVyORVHXVDQSLQHVORVVLHWHGHOFDVRDQWHULRUPDVRWURVGRV ¾ '7(3UHSDUDGR '75.

QGLFDFLyQGHOODPDGD 5. ¾ .

 6XSRQLHQGRTXHHOGHODL]TXLHUGDOODPDDOGHODGHUHFKD '&( '65 57& '&( '65 5. '7( '75 7[' '7( '75 576 (QYtRGH FRPDQGRV+D\HV SDUDFRQILUPDUHO 02'(0 /ODPDGD 1HJRFLDFLyQHQWUH02'(0YHORFLGDGHVGH7[HWF (VWRQRHV56 &'RII &' 5[' &76 &76RII 7[' 576RII &RPDQGRV+D\HV $7' 7 7RQRV.

3 3XOVRV.

(PSLH]DDWUDQVPLWLUHOTXHUHFLELUi ORVGDWRV /XLV%5DPtUH]GHO3LQR  .......... 1žDOTXHVHOODPD ..

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 8QDYH]TXHDFDEDGHHQYLDUHOUHFHSWRUFRPLHQ]DDHQYLDUHOOODPDQWH 7. '65 '65RII 02'(01XOR 7LHUUD 7.' 5.' 576 &76 &' '65 '75 5.' 5.' 576 &76 &' '65 '75 5.' 576RII &76RII 576 &76 &' &'RII 5[' $SDUWLUGHDTXtHOOODPDGRSXHGHYROYHUDWUDQVPLWLU &XDQGRQDGLHTXLHUHWUDQVPLWLUPiVSDUDFROJDUVHKDFHHVWR 3DUD YROYHUD FRPHQ]DU '75RII '75  56 '7( 7LHUUD 7. /XLV%5DPtUH]GHO3LQR  .

QWURGXFFLyQ 1LYHOItVLFR7UDQVPLVLyQGHELWVQRILDEOH 1LYHO GH HQODFH 6HUYLFLR GH WUDQVIHUHQFLD GH EORTXHV GH ELWV TXH IRUPDQ XQ PHQVDMH OODPDGRWUDPD.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  1LYHOGHHQODFH  .

&2 //& ORJLFDOOLQNFRQWURO.TXHVHKDFHDGHPiVGHIRUPDVHJXUD /DVWUHVSULPHUDVIXQFLRQHVHVWiQSUHVHQWHVHQWRGDVODVUHGHV\HQWHUPLQRORJtD 26. VH ODV HQJORED FRPR IXQFLRQHV GH &21752/ '(/ (1/$&( /Ï*.

 /DV~OWLPDVIXQFLRQHVWLHQHQXQVHQWLGRHQUHGHVFRPSDUWLGDVGHGLIXFLyQHQ ODV TXH HO PHGLR HV FRPSDUWLGR SRU YDULDV PiTXLQDV HQJOREiQGRVH FRQ HO QRPEUH GH IXQFLRQHVGH&21752/'($&&(62$/0('.2 0$&PpGLXPDFFHVVFRQWURO.

 5HG (QODFH )tVLFR //& 0$& 1HFHVDULRVyORHQPHGLRVFRPSDUWLGRV )XQFLRQHVGHOQLYHOGHHQODFH QRVLHPSUHHVWiQWRGDVSUHVHQWHV.

 ¾ (QWUDPDGR VLQFURQL]DFLyQ GH WUDPD.

 &RQVLVWH HQ GHWHFWDU HQ HVH IOXMR GH ELWV GRQGHHVWiHOILQGHXQDWUDPD\HOFRPLHQ]RGHODVLJXLHQWH ¾ &RQWURO GH IOXMR $ YHFHV OD HVWDFLyQ UHFHSWRUD QR HV FDSD] GH DEVRUEHU R SURFHVDUORVGDWRVTXHUHFLEHWDQUiSLGRFRPRVRQ HQYLDGRVSRUHOHPLVRU(VWR VHGHEHDTXHDOUHFLELUXQDWUDPDKD\TXHKDFHUDOJRGHSURFHVDPLHQWR SDVDUOR DQLYHOHVVXSHULRUHVHWF.

6HYDQDOPDFHQDQGRODVWUDPDVHQXQDPHPRULDKDVWD VX SURFHVR SXGLpQGRVH GHVERUGDU (VWD IXQFLyQ HV SDUD FRQWURODU\ IUHQDU DO WUDQVPLVRUSRUSDUWHGHOUHFHSWRU ¾ &RQWURO GH HUURUHV $O QLYHO ItVLFR VH SXHGHQ LQWURGXFLU HUURUHV GHELGRV D FXHVWLRQHVGHORVPHGLRVGHWUDQVPLVLyQ UXLGRVHWF.

+D\TXHVDEHUFXDQGRVH SURGXFHXQHUURU\FRUUHJLUOR ¾ *HVWLyQ GHO HQODFH D YHFHV QR HVWi SUHVHQWH.

 $ YHFHV OD FRPXQLFDFLyQ HQWUH RULJHQ X GHVWLQR QR HV SHUPDQHQWH WHQLHQGR TXH HVWDEOHFHU \ OLEHUDU HO HQODFH FDGDYH]TXHVHTXLHUDLQWHUFDPELDULQIRUPDFLyQ'HLQFOXLUFRQWUROSRUHOLQLFLR PDQWHQLPLHQWR\OLEHUDFLyQGHOHQODFH ¾ &RQWURO GHO DFFHVR DO PHGLR FRPSDUWLGR D YHFHV.

 (Q UHGHV GH GLIXVLyQ R PXOWLSXQWRYDULDVHVWDFLRQHVFRPSDUWLUiQHOPHGLRGHWUDQVPLVLyQ3RUHOORKDFH IDOWDUHJXODUHOXVRGHHVHPHGLRSDUDHYLWDUTXHWRGDVWUDQVPLWDQDODYH] ¾ 'LUHFFLRQDPLHQWR (Q UHGHV GH GLIXVLyQ R PXOWLSXQWR VL UHFLELPRV XQD WUDQVPLVLyQ QR VDEHPRV HO RULJHQ 3RU HOOR KD\ TXH SURSRUFLRQDU XQ GLUHFFLRQDPLHQWR TXH SHUPLWD LGHQWLILFDU HO RULJHQ \ HO GHVWLQR GH FDGD WUDQVPLVLyQ  (QWUDPDGR (QHVWHWHPDYHUHPRVODIXQFLRQHV//&(OVLJXLHQWHWHPDVHUiSDUD0$& /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV &RQVLVWH HQ LGHQWLILFDU HO FRPLHQ]R \ ILQ GH WUDPD HQ HO IOXMR GH ELWV ( OR VWR KDFHODWDUMHWDGHLQWHUID]GHUHG+D\FXDWURPpWRGRV (M &yGLJR$6&.o ELWVo FDUDFWHUHV +D\FDUDFWHUHVHQHOIOXMRGHD FDUiFWHUGHFRQWURO..

TXHVHHPSOHDEDSDUD HVWRVILQHV  '/( 'DWD/LQN(VFDSH.

 6WDUWRI7H[W.  67.

 (7. (QGRI7H[W.

  &XHQWDGHFDUDFWHUHV&RQVLVWHHQTXHXQFDPSRHQODFDEHFHUDGHODWUDPDQRV GLJD FXDQWRV ELWV R FDUDFWHUHV IRUPDQ OD WUDPD 3UHVHQWD ORV VLJXLHQWHV SUREOHPDV+D\TXHVDEHUGyQGHHPSLH]DODWUDPD(OFDPSRTXHOOHYDODFXHQWD SXHGHFRQWHQHUHUURU \SHUGHUtDPRVODVLQFURQL]DFLyQ3RUHOORHVWHPpWRGRQR VHHPSOHDSRUVtVROR DXQTXHVtFRPELQiQGRORFRQRWUROV.

%0.&@ .  3URWRFRORVRULHQWDGRVDFDUiFWHU6HFRQVLGHUDODWUDPDFRPRFRPSXHVWDSRUXQ FRQMXQWRGHFDUDFWHUHVGHXQGHWHUPLQDGRFyGLJRRMXHJR(VWiQPX\RULHQWDGRV DODWUDQVPLVLyQDVtQFURQD$OJXQRVHPHPSORVVRQ%6&>(%&'.

1'.. ¢4Xp VXFHGH VL HQ ORV SURSLRV GDWRV YDQ LQFOXLGRV HVRV FDUDFWHUHV" 3RU HVR VH HPSOHD UHOOHQR GH FDUDFWHUHV R FDUDFWHUHV VWXIILQJ FRQVLVWHQWH HQ FDGD YH] TXH HQFRQWUDPRVHQORVGDWRVHOFDUiFWHU'/(ORVXVWLWXLPRVSRU'/('/(GXSOLFiQGROR '/( 67.QLFLR '/( (7. o .&$'25 'RQGHHQFRQWUHPRVHVHSDWUyQILQDOL]DUiXQDWUDPD\FRPHQ]DUiODVLJXLHQWH 6LHQORVGDWRVDSDUHFH HOSDWUyQFRUUHJLUHPRV HOSUREOHPDFRQUHOOHQR GHELWV ELWVWXIILQJ. o )LQ '/( '/( o '/( '/( (UURU m .QFRQYHQLHQWHGHHVWDWpFQLFDHVTXHHVWiPX\OLJDGDDOFyGLJRGHFDUDFWHUHV  3URWRFRORV RULHQWDGRV D ELW 6RQ SURWRFRORV SDUD WUDQVPLVLyQ VtQFURQD GRQGH WUDQVPLWLPRV XQ FRQWLQXR GH ELWV 'HQWUR GH HVH IOXMR VH LQGLFD HO FRPLHQ]R \ ILQDOGHODWUDPDFRQXQDFDGHQDHVSHFLDOGHELWVOODPDGR.3DUDILQDOL]DUODWUDPD'/(\(7.@ 6HHPSOHDQFLHUWRVFDUDFWHUHVGHOFyGLJRSDUDLQGLFDULQLFLR\ILQGHWUDPD 3DUDLQGLFDUHOFRPLHQ]RGHXQDWUDPDVHHQYLDEDQFDUDFWHUHVXQ'HOV HJXLGR GHXQ67.6/& >$6&.

FRQVLVWHQWHHQTXHFDGDYH]TXHWHQHPRVHQHPLVLyQXQVHJXLGR GHXQRVLQVHUWDPRVXQFHURDQWHVGHVHJXLUFRQHOHQYtRGHGDWRV (QUHFHSFLyQVLVHUHFLEHXQVHJXLGRGHXQRVVLDFRQWLQXDFLyQYLHQHXQ VH LJQRUD HV GH UHOOHQR.

 VL YLHQH XQ  \ XQ  HV XQ LQGLFDGRU ILQ  LQLFLR GH WUDPD.

%0.& GHODIDPLOLDGH'/& . \VLOOHJDQXQRVHVXQHUURU$OJXQRVSURWRFRORVFRQHVWHPHFDQLVPR VRQ'.

/$$3%.

QGLFDGRU .333  9LRODFLyQ GH FyGLJR (O SULQFLSLR \ ILQDO GH WUDPD VH PDUFD FRQ FyGLJRV GHO QLYHOItVLFRQRYiOLGRV(MHPSOR /XLV%5DPtUH]GHO3LQR  o .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 'RV FyGLJRV QR YiOLGRV GH 0DQFKHVWHU VHUiQ GRV FHURV 0DQFKHVWHU%%  VHJXLGRV OODPDGR-HQDOJXQDV   >ELWFRQELWV@.

 UHGHV.

\ FyGLJR.

(15. (Q JHQHUDO HQ FRPELQDFLRQHV %% SRU HMHPSOR  FRPELQDFLRQHV GH  ELWV VH FRGLILFDQ FRQ  KDEUtD  YLRODFLRQHVGHFyGLJR 8QHMHPSORGHXVRORHQFRQWUDPRVHQODVUHGHV72.1*)''HWF/D YHQWDMDHVTXHQRWHQHPRVTXHKDFHUVWXIILQJ UHOOHQR.

1 1 (7. '/( (VWRVHKDFHSRUUHGXQGDQFLD  &RQWUROGHIOXMR &RQVLVWHHQTXHHOWUDQVPLVRUQRHQYtDWUDPDVPiVUiSLGRTXHORTXHHVFDSD]GH SURFHVDUHOUHFHSWRU /D WDUMHWD GH UHG UHDOL]D ODV IXQFLRQHV GHO QLYHOItVLFR\GHHQODFH8QDYH]SURFHVDGDODWUDPD %XIIHU 3+< FRQWURO GH HUURUHV HWF. 0XFKDV UHGHV HPSOHDQ ODFRPELQDFLyQ GH ORV  PpWRGRV YLVWRV DQWHULRUPHQWH 3RU HMHPSOR SXHGHQ XVDU SURWRFRORV RULHQWDGRV D FDUiFWHU \ XQD FXHQWD GH FDUDFWHUHV   '/( 67.

 OD WUDPD SDVD DO EXIIHU \ &DEOHGHUHG 0$& //& OD WDUMHWD ODQ]D XQD LQWHUUXSFLyQ TXH DWHQGHUi HO SURFHVDGRU .54.

E.E  . /DUXWLQDDGHFXDGDDWUDSDUiODLQWHUUXSFLyQ\ 7DUMHWDGHUHG FRSLDUiODWUDPDDOD5$0SDUDSURFHVDUOD (O EXIIHU VXHOH VHU SHTXHxR  .

 3RGUi DOPDFHQDU HQWUH  \  WUDPDV FRPRPXFKR.

&XDQGRVHOOHQDHOEXIIHUWLUDODVWUDPDV<DTXtHVGRQGHHQWUD HOFRQWUROGHIOXMR (VWH FRQWURO GH IOXMR FRQVLVWH HQ TXH HO UHFHSWRU WHQJD DOJ~Q PHFDQLVPR GH UHWURDOLPHQWDFLyQKDFLDHOHPLVRUSDUDGHFLUOHTXHQRWUDQVPLWDPiVWUDPDV6XPLVLyQ HVHYLWDUTXHVHOOHQHHOEXIIHU /RVPHFDQLVPRVSDUDHOFRQWUROGHIOXMRVRQ ORVVLJXLHQWHV &RQVLVWHHQTXHHOHPLVRUDOWUDQVPLWLUXQDWUDPDGHEHHVSHUDUXQDFRQILUPDFLyQ GHOUHFHSWRUDQWHVGHWUDQVPLWLUXQDVHJXQGDWUDPD6HPDQGDODFRQILUPDFLyQDOVDFDUOD WUDPDGHOEXIIHU QRDOWHUPLQDUGHSURFHVDUODHQODPHPRULD.

/DFRQILUPDFLyQVHOODPD $&.RDVHQWLPLHQWR 6XSRQLHQGRTXHQRH[LVWHQHUURUHVWHQHPRVHOFDVR 6LKD\XQDWUDPDTXHQROOHJD HUURUHQODWUDQVPLVLyQ.

HOUHFHSWRUQRPDQGDHO $&.\HOHPLVRUVHTXHGDHVSHUDQGRHWHUQDPHQWH  3DUDGD\HVSHUD /XLV%5DPtUH]GHO3LQR  .

(UURU 7 7UDPD 7 $&.FRQ $&. 3DUDGD\HVSHUD  $&.7$/7(51$17((VXQELWHQ ODFDEHFHUDGHODWUDPDTXHYDOH\ DOWHUQDWLYDPHQWH HQFDGDHQYtRGHWUDPD/RPLVPRSDUDHO$&.  7(0325.7$/7(51$17( /XLV%5DPtUH]GHO3LQR  . 3DUD GLVWLQJXLU TXp WUDPDV OOHJDQ UHSHWLGDV H[LVWHORTXHVHOODPD%. 7UDPD /D PiTXLQD HPLVRUD PDQGD OD WUDPD OOHJD SHUR HO HPLVRU WDUGD HQ PDQGDU HO $&. (OSURWRFRORGHSDUDGD \HVSHUDLQFRUSRUDSDUDVROYHQWDUHVWRXQWHPSRUL]DGRU 6LWUDVXQWLHPSR7 ( 5 ( 5 7 (UURU $&. FRQ OR FXDO VH UHWUDQVPLWH \ OOHJD XQ GXSOLFDGR 3XHGH RFXUULU HO FDVR FRQWUDULR WDPELpQ R VHD TXH VXFHGDORPLVPRFRQHO$&. OR FXDO HO UHFHSWRU DO DFDEDU HO WHPSRUL]DGRU UHHQYLDUtDHO$&. SRU TXH OD PiTXLQDUHFHSWRUDHVWiPX\FDUJDGD\WDUGDHQSURFHVDU ODLQWHUUXSFLyQ(OWHPSRUL]DGRUH[SLUDDQWHVGHOOHJDUHO $&.=$'25  %.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (O WLHPSR 7 KD  GH VHU OR VXILFLHQWHPHQWH JUDQGH 7UDPD FRPRSDUDTXHOHGHDOD WUDPD WLHPSR D OOHJDU /R PLVPR SRGUtD RFXUULUFRQHO$&.

7UDPD $&. 7 (UURU $&. 6HSLHUGHXQDWUDPD ( 7 7 7 6HSLHUGHXQ$&.HOUHFHSWRU $&. 7DUGD PXFKR HQ FRQWHVWDU FRQHO$&. 7GXSOLFDGR $&. 7UDPDGXSOLFDGD VHWLUD\VHUHHQYtD HO$&. (OJUDQLQFRQYHQLHQWHGHSDUDGD\HVSHUDHVTXHVHSDVDPXFKRWLHPSRHOHPLVRU \HOUHFHSWRUHVSHUDQGRHO$&. $&. $&.\PX\SRFRWLHPSRHQYLDQGRGDWRV /XLV%5DPtUH]GHO3LQR  . 7 (UURU 7UDPD 7 7 7UDPD 7 $&. $&. $&. $&. 7 $&. 5 7 7 $&. $&. $&. 7 $&. $&. $&.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV ( 7UDPD 7 5 ( 7UDPD 7 5 $&.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  $QiOLVLVGHSUHVWDFLRQHV &DEOH'LVWDQFLDHQPHWURV Y PVHJ.

5 ELWVVHJ.

7UDPDVGHWDPDxR / ELWV.

 VLORWLUDHWF. ( 5 77.  7LHPSRGH SURFHVDPLHQWRGHO $&.  7LHPSRGHWUDQVPLVLyQ 73523  7LHPSRGH SURSDJDFLyQ 775$0$  7LHPSRGHVGHTXHHQYtR XQDWUDPDKDVWDTXH SXHGRHQYLDURWUD VLQ 7352&$&.

 7LHPSRGHWUDQVPLVLyQ GHO$&. 7$&.JXDOHQUHGHVVLPpWULFDV VXHOHQVHUOR. / 7352&75$0$  7LHPSRGH SURFHVDPLHQWRDQWHV GHHQYLDU$&. 73523  .

 73523 7352375$0$ 7$&. 775$0$ 77. 73523 7352&$&. 6DOYRLQGLFDFLyQHQFRQWUDORVWLHPSRVGHSURFHVDPLHQWR7352&75$0$ \7352& VH FRQVLGHUDQ GHVSUHFLDEOHV /D WUDPD GH DVHQWLPLHQWR $&.

UHVSHFWR D XQD WUDPD SRU OR TXH DVXPLUHPRV WDPELpQ VDOYR LQGLFDFLyQ HQ FRQWUD. HV PX\ SHTXHxD $&.

Â73523 7SURS 77. G Y )DFWRUD GHXQHQODFH )$&725 D &RQORTXH775$0$ 77. 77.  8 775$0$ 77.  Â73523   D 8    D /R LGHDO VHUtD XQD XWLOL]DFLyQ 8    . GHVSUHFLDEOHVXWLHPSR/DIRUPXODTXHGDUtDDVt 'HILQLFLyQ 775$0$ 77. 77. 73523 / 5 G5 /Y /D HILFLHQFLD YD PHGLGD SRU ³8´ TXH HV HO WLHPSR TXH UHDOPHQWH VH HVWi WUDQVPLWLHQGR(OUHVWRGHOWLHPSRHVSHUDPRVSRUHO$&.

 6HUi PHMRU OD XWLOL]DFLyQFXDQWRPiVSHTXHxDVHDD D VHUi SHTXHxD VL GÂ5 HV PMX\ JUDQGH SDUDGD \ HVSHUD UHVXOWD G Â5 SRFRHILFLHQWH D /ÂY /DGLVWDQFLDHQWUHODVHVWDFLRQHV\HOUpJLPHQELQDULRORPiVSHTXHxR\ODWUDPD FXDQWRPiVJUDQGHPHMRU ODY QRSRGHPRVDOWHUDUOD.

 6H WUDQVPLWHQ5 ELWV SRU VHJXQGR SHURHO XVXDULR VyOR YH TXH WUDQVPLWH / ELWV FDGD775$0$ VHJXQGRV VHSXHGHHVSHUDQGRSRU$&.

 / ELW .

&HI &DXGDOHILFD]5pJLPHQELQDULRPHGLRTXHFRQVLJXHHOXVXDULR 775$0$ VHJ .

/XLV%5DPtUH]GHO3LQR  .

 (Q OD YHQWDQD GH UHFHSFLyQ VH JXDUGDQ ODV WUDPDV TXH VH UHFLEHQ PLHQWUDVQRVHSDVHQDOQLYHOVXSHULRU\VHHQYtHHO$&.FRUUHVSRQGLHQWH (OHPLVRU\HOUHFHSWRUWLHQHQTXHDFRQUGDUXQWDPDxRGHYHQWDQD FRQILJXUDGR SRU GHIHFWR R QHJRFLDGR.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 6HGHPXHVWUDTXH &HI  9HQWDQDGHVOL]DQWH 5Â8 /DLGHDHVSRGHUWUDQVPLWLUPiVGHXQDWUDPDDQWHVGHUHFLELUHODVHQWLPLHQWRGH OD SULPHUD 3DUD HOOR VH QHFHVLWD XQ EXIIHU R PHPRULD GH YDULDV WUDPDV WDQWR HQ HO UHFHSWRU FRPR HQ HO HPLVRU (Q HO HPLVRU VLUYH SDUD JXDUGDU ODV WUDPDV D~Q QR FRQILUPDGDV SRU VL VH QHFHVLWD UHWUDQVPLVLyQ (VRV EXIIHUV VH OODPDQ YHQWDQD GH WUDQVPLVLyQ \ YHQWDQD GH UHFHSFLyQ (Q OD SULPHUD VH FRSLDQ ODV WUDPDV HQYLDGDV D OD HVSHUD GH $&.

 6H OODPDUi: 6yOR VH SXHGHQ HQYLDU: WUDPDV VLQ UHFLELU FRQILUPDFLyQ 3RU HOOR HO UHFHSWRU WHQGUi PiV GH  WUDPDV HVSHUDQGR D VHU SDVDGDV DO QLYHOVXSHULRU (OEXIIHUHVFLUFXODU\VHSXHGHUHSUHVHQWDUDVt                     :  (QHOHPLVRUFDGDWUDPDTXHVHWUDQVPLWHVHJXDUGDHQHOEXIIHU&DGDWUDPDVH WUDQVPLWH LQGLFDQGR HQ XQ FDPSR XQ Q~PHUR OODPDGR VHFXHQFLD GH WUDQVPLVLyQ LQGLFDQGRVXSRVLFLyQHQHOEXIIHU 1 V.

.

7DPELpQWLHQHXQSXQWHURDOD~OWLPDWUDPD HQYLDGD/DGLVWDQFLDHQWUHHVWRVSXQWHURVQRSXHGHVHUPD\RUGH:  :FRPRPXFKR  $GHPiV HO WUDQVPLVRU DVRFLD XQ WHPSRUL]DGRU D ODV WUDPDV UHWUDQVPLWLHQGRODV HQFDVRGHTXHQRVHUHFLEDHO$&.HQHOWLHPSRHVWDEOHFLGRSDUDODWUDPD (Q HO UHFHSWRU ODV WUDPDV UHFLELGDV VH YDQ JXDUGDQGR HQ XQ EXIIHU +D\ XQ SXQWHURDODV~OWLPDWUDPDDVHQWLGD\RWURDOD~OWLPDWUDPDUHFLELGD  : 6L VH FRQILUPD XQD WUDPD VH FRQILUPDQWRGDVODVDWHULRUHV                  8OWLPDWUDPD UHFLELGD 8OWLPRWUDPD DVHQWLGD 8OWLPR$&. UHFLELGR 8OWLPRWUDPD HQYLDGD (MHPSOR 1žGHELWV :  /XLV%5DPtUH]GHO3LQR 3RGHPRV VHJXLU UHFLELHQGR WUDPDV PLHQWUDVODGLVWDQFLDHQWUHORVSXQWHURVVHD PHQRURLJXDOTXH:  . $OWUDQVPLWLUXQDWUDPDWUDVKDEHUHQYLDGR:WUDPDVYROYHPRVDFRPHQ]DUFRQ HOQXPHUR$OOOHJDUXQ$&.HOHPLVRUFDPELDXQSXQWHURTXHWLHQHDODSRVLFLyQGH OD~OWLPDWUDPDGHODTXHUHFLELyVX$&.

 . .6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 3RGHPRVWUDQVPLWLUWUDPDVVLQUHFLELU$&. . 55              6RORSXHGRHQYLDUPiVVLQKDEHUUHFLELGR$&. 3RGHPRVUHFLELUWUDPDVVLQDVHQWLUQLQJXQD . . .V              5HFRJLGDVSHURQR SDVDGDVDOQLYHOVXSHULRU                                                                               .              55 515 55 ([LVWH RWUR WLSR GH DVHQWLPLHQWR 515 5HFHLYHU 1RW 5HDG\.

 SDUD FXDQGR HO UHFHSWRUHVWiPX\FDUJDGR3DUDTXHHOHPLVRUQRSLHQVHTXHVHSHUGLy\UHWUDQVPLWDVH HQYtDHVWDVHxDO$VtGLFHTXHKDQOOHJDGRODVWUDPDVSHURQRKDOLEHUDGRHOEXIIHU1R WLHQHHIHFWRVGHVGHHOSXQWRGHYLVWDGHODVYHQWDQDV &RPR VXHOH KDEHU WUiILFR ELGLUHFFLRQDO ODV WUDPDV GH GDWRV HQ OD FDEHFHUD.

 GLVSRQHQGHFDPSRVQžGHVHFXHQFLDGHWUDQVPLVLyQ\QžGHVHFXHQFLDGHUHFHSFLyQ &DEHFHUD 1 6.

1 5.

 . . '$726 1žGHVHFXHQFLDGHWUDPD 1žGHWUDPDDVHQWLPLHQWR ( . . 5 (PLWLGR HO  DVHQWLGRV ORV SULPHURV (PLWLGRHODVHQWLGRHO 3DUDHOFDVRQ :dQd 6L:IXHVH              55 55 3RGUtD SDUHFHU YiOLGR QR VH UHSLWHQ ORV QXPHURV GH VHFXHQFLD 6LQRVOOHJD55QRVDEHPRVVLFRQILUPDUTXHKDQ OOHJDGRWRGRVRQLQJXQR  $QiOLVLVGHSUHVWDFLRQHV /XLV%5DPtUH]GHO3LQR  . . . .

¢&RQGLFLyQGHOHQYtRFRQWLQXR" t 7 5HFRUGDQGRHOYDORUGH7 77. t 7. 1RVGDHOOD8  :    D o (QYtRQRFRQWLQXR : Â77. 73523 7352375$0$ 7$&.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 73523 7HQGUHPRVHQYtR FRQWLQXRVLDQWHVGHDJRWDUOD YHQWDQDUHFLELPRVDOJ~Q$&. 77. : 7$&. 7 73523 7352&$&. 6LODYHQWDQDHVSHTXHxDJDVWDUHPRVOD ( 5 YHQWDQD\WHQGUHPRVTXHHVSHUDUDOJ~Q DVHQWLPLHQWR SDUD SRGHU VHJXLU HQYLDQGR 7 7. 8 o 8VRGHODUHG 7 : : Â77. 73523 7352&$&. 5HFRUGDPRVTXHGHILQtDPRVXQIDFWRUD 7| 77. 7352&75$0$ (VSHUD : ( 5 (QYtRQR FRQWLQXR : Â77.  73523 : t  D : Â 7 7. : 8 8  D 77.  Â73523   D 8   &RQWUROGHHUURUHV D : 6H HQFDUJDGH GHWHFWDU FXDQGR KD\ HUURUHV HQ ORV ELWV TXH IRUPDQ XQD WUDPD \ UHFXSHUDUVHGHHVRVHUURUHV /DUHFXSHUDFLyQGHHUURUHVVHSXHGHKDFHUGHIRUPDVFRUULJLpQGRORVRWLUDQGR OD WUDPD \ SLGLHQGR UHWUDQVPLVLyQ /D SULPHUD IRUPD VH OODPD 5(& )RUZDUG (UURU &RQWURO. Â73523 GHVSUHFLDEOHV D 73523 77.

ODVHJXQGD$54 $XWRPDWLF5HSHDW5HTXHVW.

 /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV /DLGHDHVTXHHQHOHPLVRUVHUHFLELUiQGHOQLYHOVXSHULRU QRUPDOPHQWHHOQLYHO GHUHG.

ORVGDWRVDUHWUDQVPLWLU(OQLYHO GHHQODFHOHDxDGLUiXQDFDEHFHUDGRQGHHQWUH RWUDVFRVDVPHWHUiHOQXPHURGHVHFXHQFLDGHWUDQVPLVLyQ\HOGHDVHQWLPLHQWRDGHPiV GHODVGLUHFFLRQHVRULJHQ\GHVWLQRVLHVXQDWUDPD(7+HWF$GHPiVGHHVDFDEHFHUD D WRGD OD LQIRUPDFLyQ OH SDVDUi XQD IXQFLyQ TXH GD FRPR UHVXOWDGR VX FyGLJR GH SURWHFFLyQFRQWUDHUURUHV OODPDGR((QODFROD GHOPHQVDMHHVGRQGHYDHOFyGLJR( TXHJHQHUDOPHQWHHVXQDIXQFLyQGHORVGDWRV &DEHFHUD 'DWRV &DEHFHUD 'DWRV I 'DWRV&DE.

5HFHSWRU  &yGLJRVGHSURWHFFLyQIUHQWHDHUURUHV ( &DEHFHUD 'DWRV ( (QHOUHFHSWRUVHFDOFXODODIXQFLyQVREUHODFDEHFHUD\ORVGDWRVREWHQLHQG RVH (¶(QWRQFHVFRPSDUDPRV(¶FRQ(\VLVRQLJXDOHVWRGRKDLGRELHQ6LVRQGLVWLQWRV DOJR KD IDOODGR SLGLHQGRVH OD UHWUDQVPLVLyQ 2WURV FyGLJRV LQFOXVR VRQ FDSDFHV GH DYHULJXDU GyQGH HVWi HO HUURU \ FRUUHJLUOR +D\ XQD SUREDELOLGDG GH TXH QR VH KD\ D GHWHFWDGRHUURU\ORKD\DHLQFOXVRGHTXHORGHWHFWH\ORFRUULMDPDO &XDQWRVPiVELWVVHDFDSD]GHFRUUHJLUPiVELWVFRQVHJXLUiGHWHFWDU LQIRUPDFLyQR PHQVDMH I 'DWRV&DE.

(¶ P &RGLILFDGRU $FDGDPHQVDMHVHOHDVLJQDXQDSDODEUDFyGLJRGLVWLQWD(MHPSOR 'DGR XQ FyGLJR VH GHILQH OD UHGXQGDQFLD '.67$1&.$ GH HVH FyGLJR R GLVWDQFLD   +DPPLQJ.

FRPR HO PtQLPR Q~PHUR GH ELWV G  HQ TXH VH GLIHUHQFLDQ  SDODEUDV FyGLJR GH G    G  G  HVHFyGLJR G.

9LHQGRHOFyGLJRDQWHULRUOD G    G  PtQLPD HV G   &RQ OR TXH HVWH FyGLJR   WHQGUiGLVWDQFLD+DPPLQJGH 'H OD GLVWDQFLD GH XQ FyGLJR GHSHQGHQVXVSURSLHGDGHVGHWHFWRUDV\FRUUHFWRUDVGHHUURUHV 6LXQFyGLJRWLHQHXQDGLVWDQFLDG x 3XHGHGHWHFWDUFRPRPi[LPRGHUURUHV G  .

HUURUHV x 3XHGHFRUUHJLU  x 6LTXHUHPRVGHWHFWDU\FRUUHJLUDODYH] GHWHFWDUµ[¶\FRUUHJLUµ\¶.

ODGLVWDQFLD WLHQHTXHFXPSOLUTXHGt[\ SDODEUDFyGLJR WLHQH PiVELWVTXHHO RULJLQDO.

ODGLIHUHQFLD GHELWVVHOODPD UHGXQGDQFLD.

W 6LTXHUHPRVGHWHFWDUHUURUHVQHFHVLWDPRVXQFyGLJRFRQGt 6LTXHUHPRVFRUUHJLUHUURUHVQHFHVLWDPRVXQFyGLJRFRQGt 6L TXHUHPRV GHWHFWDU HUURUHV GH KDVWD  ELWV \ FRUUHJLU ORV GH  ELWV R PHQRV KDFHIDOWDXQFyGLJRFRQGt /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  3URWHFFLyQGHHUURUHVWLSRV  3DULGDG &RQVLVWHHQDxDGLUXQELWHQORVPHQVDMHV ELWGHSDULGDG.

&XDQGRKD\SDULGDG SDUFRQWDQGRHVHELW\HOUHVWRKDQGHFRPSOHWDUXQQ~PHURSDUGHµ¶3DUDODSDULGDG LPSDUHVMXVWRORPLVPRSDURWLHQHTXHKDEHUXQQ~PHURLPSDUGHµ¶ $6&.ELWELWSDULGDG  3DULGDGSDUSRQGUtDPRV 3DULGDGSDUSRQGUtDPRV /D PD\RU SDUWH GH ORV SURWRFRORV DVtQFURQRV HPSOHDQ SDULGDG LPSDU \ OD PD\RUtDGHORVVtQFURQRVSDULGDGSDU\QRSRUQLQJ~QPRWLYRHVSHFLDO/DGLVWDQFLDG  SHUPLWHGHWHFWDUHUURU VyORXQR..

1RWLHQHSRWHQFLDSDUDFRUUHJLUOR  3DULGDGEORTXHRPXOWLGLPHQVLRQDO &RQVLVWH HQ GLYLGLU HO EORTXH GH ELWV D HQYLDU HQ WUR]RV GH    R P ELWV GD LJXDO.

&DOFXODPRVHOELWGHSDULGDGSRUFDGDXQRGHORVEORTXHVGHPELWV SRUHMHPS OR SDULGDGSDU.

 &DOFXODPRV ODV SDULGDGHV YHUWLFDOHV   WDPELpQ 7UDQVPLWLUHPRV HO EORTXH HQYLDQGR   ELWV GH L]TXLHUGD D GHUHFKD \ GH DUULED DEDMR   FRPRVHOHH.

 Q P   /RV EORTXHV QR WLHQHQ SRU TXH VHU   FXDGUDGRV     ¢&XiOVHUtDODGLVWDQFLDGHHVWHFyGLJR" 6L FDPELDPRV VyOR XQ ELW FDPELDPRV  P  ELWVGHSDULGDG2VHDTXHODGLVWDQFLD 3DULGDGYHUWLFDO HVG   6H GHWHFWDQ KDVWD  HUURUHV 6L 3$5.'$' &58=$'$ $SDUHFH WDQWR VHSURGXFHQPiVSXHGHTXHVHGHWHFWH HQ OD YHUWLFDO FRPR HQ OD KRUL]RQWDO \ SXHGHTXHQR WLHQHTXHFRLQFLGLU 6H GHPXHVWUD WDPELpQ TXH GHWHFWD KDVWD HUURUHVVLQRFDPELDQORVELWVTXHIRUPDQXQFXDGUDGR (VWR TXH KHPRV YLVWR HV SDULGDG ELGLPHQVLRQDO +D\ PiV SURFHGLPLHQWRV SDUD FDOFXODU OD SDULGDG WULGLPHQVLRQDO QGLPHQVLRQDO HWF 1RHVIiFLOFRUUHJLUHUURUHVFRQHVWHPpWRGR  &yGLJR+DPPLQJ (VXQFyGLJRGHSDULGDGFRQGLVWDQFLDG 3RUFDGDPELWVGHPHQVDMHDxDGHU ELWVGHUHGXQGDQFLDGHIRUPDTXHVHFXPSODTXHUtPUU VHUiHOQtQLPRYDORUTXH FXPSODHVWR /RV ELWV GH SDULGDG QR VH FRORFDQ DO ILQDO GH FDGD PHQVDMH VLQR HQ SRVLFLRQHV TXHVRQSRWHQFLDGH &DGDELWGHOPHQVDMHYDDDSDUHFHUHQODSDULGDGGHRPiVGHHVRVU ELWVORV FXDOHV FDOFXODQ OD SDULGDG GH XQ VXEFRQMXQWR GHP 1R YD D KDEHU  ELWV GH P TXH DSDUH]FDQHQORVPLVPRVUHQODSDULGDGGHOPLVPRFRQMXQWR /XLV%5DPtUH]GHO3LQR 3DULGDGKRUL]RQWDO  .

3RUORWDQWRHOPHQVDMHWHQGUiELWV PU.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 1RSXHGHKDEHUHQFRQMXQWRVODPLVPDVHFXHQFLDGHELWV6LHQDSDUHFHQ \  QR SXHGH KDEHU RWUR FRQMXQWR FRQ   \  SXHV QR VDEUtDPRV PiV WDUGH TXH FRQMXQWRKDIDOODGR (M &RGLILFDUPHGLDQWH+DPPLQJHOPHQVDMH P ELWV U PtQLPRWDOTXHUtPU U !t12 3UREDPRVFRQ U !t6.

2.   8QD YH] TXH WHQHPRV WRGR HVWR VyOR TXHGD FRPSRQHU HO PHQVDMHFRPRVHYDDWUDQVPLWLUSDUDHOORKD\TXHLQVHUWDUHQODVSRVLFLRQHV RWHQFLDGH S ORVELWVGHSDULGDGTXHDFDEDPRVGHREWHQHU                /DVSRVLFLRQHVTXHQRVRQSRWHQFLDGHVHSRQHQFRPRVXPDGHSRWHQFLDVGH                      $KRUDPLUDPRVHQFXiOHVGHHOODVDSDUHFHQODVSRWHQFLDVGH o o o o &RQ HVWR KHPRV FRQVHJXLGR TXHORVELWVGHPHQVDMHDSDUH]FDQHQ FRQMXQWRVGLIHUHQWHVHWF   9HDPRVDKRUDTXHVXFHGHDOUHFLELUORVGDWRV &RPR HV +DPPLQJ ORV ELWV GH           UHGXQGDQFLDHVWiQHQODVSRVLFLRQHV[6H           KD UHFLELGR FRUUHFWDPHQWH OD FDGHQD  2. 2. 2WURHMHPSORGHFDGHQDUHFLELGDHV                       +DPPLQJVyORFRUULJHHUURU6L VH  HPSOHD FRPR FRUUHFWRU VyOR GHWHFWD 6LVRORVHXVDFRPRGHWHFWRUKDVWD 0$/ 0$/ 0$/ 2. /XLV%5DPtUH]GHO3LQR  . 2.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 6LVXSRQHPRVTXHKDKDELGRXQHUURUHOFXOSDEOHHVHOELWSXHVDSDUHFHHQHO JUXSR GHO  HO  \ HO  2 VHD TXH VXPDQGR ORV ELWV TXH IDOODQ   \ .

2. 0$/ 2. /RV ELWV   \  QR SXHGHQ VHU HUUyQHRV VLQRVHUtDQHUUyQHRVORVJUXSRV HQ TXH DSDUHFHQ. QRV GD OD SRVLFLyQHUUyQHD  2WURHMHPSOR                      2.

 3RU HOOR HV HO SURSLR ELWGHSDULGDGHOTXHIDOOy  P U  8QDIRUPDGHFRGLILFDFLyQPiVVHQFLOODHVODVLJXLHQWH .        &RJHPRV ODV SRVLFLRQHV TXH WLHQHQ YDORU     \ .     . .        .

 \ ODV HVFULELPRV HQ ELQDULRFRQWDQWRVELWVFRPRVDOJD ELWV.

          /DVXPDVHUHDOL]DVLQDFDUUHR 8QDYH]UHDOL]DGDODVXPDORVELWVREWHQLGRV VHFRORFDQHQODVSRVLFLRQHVTXHIDOWDQHQODFDGHQD DQWHULRUFRPHQ]DQGRSRUHOELWPiVDODGHUHFKDHQ ODSRVLFLyQXQR\FRQWLQXDQGRKDFLDODL]TXLHUGDHQ RUGHQ 5HVXOWDQGRODFDGHQD 3ULPHUELWGHSDULGDG .

6HJXQGRELWGHSDULGDG .

7HUFHUELWGHSDULGDG .

&XDUWRELWGHSDULGDG .

TXH ELQDULR\VHVXPDQ 6LHOUHVXOWDGRHVQRKD\HUURU ODVXPDVHKDFHVLQDFDUUHR.

 2WURHMHPSOR               ¢4XpVHKDFHHQHOUHFHSWRU"                     &RJHPRV ODV SRVLFLRQHV GH ORV ELWV YDOHQ\VHSRQHQHQ          1RHVFRQORTXHWHQHPRVDOJ~QHUURU\HOELWHUUyQHRHVHO TXHLQGLFDODVXPDHQGHFLPDO HO.

 /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV /RV FyGLJRVFRUUHFWRUHVVHHPSOHDQFXDQGRHVPX\GLItFLOFRVWRVRLQHILFLHQWH HWFSHGLUUHWUDQVPLVLRQHV+DFHUXQFyGLJRFRUUHFWRUHVPX\FRPSOLFDGR\SUHFLVDGH PXFKD UHGXQGDQFLD FRQ OR TXH VH SUHILHUH FyGLJRV GHWHFWRUHV TXH SXHG GHWHFWDU HQ PXFKRVIDOORVFRQSRFDUHGXQGDQFLD.

\DOGHWHFWDUIDOORSHGLUUHWUDQVPLVLyQ 6HVXHOHQHPSOHDUHQHQODFHVVDWpOLWHSXHVHOUHWDUGRHVPX\JUDQGH\HQUHGHV GHXQVRORVHQWLGR WHOHYLVLyQGLJLWDO.

  &5& &yGLJRVGHUHGXQGDQFLDFtFOLFDRSROLQyPLFRV 7HQGUHPRVXQPHQVDMH0GHP ELWVDOTXHVHOHDxDGLUiQU ELWVGHUHGXQGDQFLD TXHIRUPDQHO&5&R)&6 )UDPH&KHFN6pTXHQVH.

(OWRWDOHVXQDWUDPD7 P U 7 (VWRV FyGLJRV VH EDVDQ HQ XQ SDWUyQ GH ELWV U.

 OODPDGR 3 SROLQRPLR JHQHUDGRU.

 (QHPLVLyQU PÂU S UHVWR.

 (QUHFHSFLyQQRKD\HUURUVLODWUDPD 7.

GLYLGLGRSRU3GDUHVWR 3UELWV 6HUHSUHVHQWDQFRPRXQSROLQRPLRGHJUDGRU GHDKtVXQRPEUH.

 3 .

Â.Â..Â.Â. .Â. Â.Â.  (MHPSOR 'HWHUPLQDUHOUHVXOWDGRGHFRGLILFDUHVWHGDWRGHELWVPHGLDQWH&5& \XQSROLQRPLRJHQHUDGRU3 ..Â.

. 3o U. .

6LHOJUDGRGH3HVU  U 0 Â mDxDGLUUFHURVDOSROLQRPLR 3             P                              U     'LYLVLyQELQDULD25H[FOXVLYRVLHPSLH]D SRUHOFRFLHQWHHPSLH]DSRU\VL HPSLH]DSRU HQHVWHFDVREDMDPRVHO VLJXLHQWH.

                 (OUHVWRGHEHWHQHUUELWV 6HWUDQVPLWLUi (QUHFHSFLyQVHGLYLGHORUHFLELGRHQWUH 3 \PLUDPRVHOUHVWR6LHOUHVWRGD VLJQLILFD TXH QR KD KDELGR HUURUHV GH WUDQVPLVLyQ (Q FDVR FRQWUDULR VLJQLILFD TXH KD KDELGRDOJ~QHUURUHQODWUDQVPLVLyQSHURQRQRVGLFHFRPRSRGHPRVORFDOL]DUOR 6L VH HOLJH DGHFXDGDPHQWH HO SROLQRPLR VH SXHGHQ GHWHFWDU PXFKRV HUURUHV 7RGRVORVFyGLJRV&5&GHWHFWDQWRGRVORVHUURUHVGHELW &5&  P U /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 6L 3 .

 WLHQH DO PHQRV  XQRV VH GHWHFWDQ WRGRV ORV HUURUHV GH  ELWV 6L 3 .

 ..

^`GDUHVWRGHWHFWDFXDOTXLHUQžLPSDUGHHUURUHV6LHPSUHGHWHFWD WRGDVODVUiIDJDVGHKDVWDUHUURUHVFRQVHFXWLYRV  7pFQLFDVGHFRUUHFFLyQGHHUURUHV x x $54 HVWi PX\ OLJDGR DO FRQWURO GH IOXMR UHFRUGHPRV SDUDGDHVSHUD \ YHQWDQD GHVOL]DQWH.

 +D\YDULDQWHVGH$54 x $54GHSDUDGD\HVSHUD x $54GHUHFKD]RVLPSOH x $54GHUHFKD]RVHOHFWLYR $54 $XWRPDWLF 5HSHDW 5HTXHVW.

 6L GHWHFWDPRV IDOOR SRU &5& HWF.

 VH SLGHUHWUDQVPLVLyQGHHVDWUDPD )(& )RUZDUG(UURU&RQWURO.

 ¢&yPR VH UHFXSHUD HO UHFHSWRU GH HUURUHV JUDFLDV D HVWRVSXQWRV" . $O UHFLELU XQD WUDPD  HO $&. ODVWUDPDVFRQVHFXWLYDV $&. VH HQYtD FRQ  HO VLJXLHQWHTXHVHHVSHUD. DO UHFLELU XQD WUDPD FRUUHFWDPHQWH 7DPELpQ SXHGH HPSOHDU XQ WHPSRUL]DGRU \ VL HQ HO  WLHPSR HVWDEOHFLGR QR VH UHFLEH OD ( 5 WUDPD VH UHWUDQVPLWH 7DPELpQ VH XVD HO ELW DOWHUQDQWH SDUD .  $54  $54GHSDUDGD\HVSHUD 2$54VLPSOH6HEDVDHQHOFRQWUROGHIOXMRGHSDUDGD\HVSHUD\WDPELpQVH EDVD HQ $&.

 .6LODWUDPDVHSLHUGHROOHJDHUUyQHD .

 . DO DFDEDU HO WLHPSR GHO WHPSRUL]DGRU VH UHHQYtD 6L HO $&. DVHQWLPLHQWR OOHJD PDO DO ILQDOL]DU HO WHPSRUL]DGRU VH UHHQYtD . (Q HVWH ~OWLPR FDVR GDGR TXH HO UHFHSWRU \D WLHQH OD $&.QFRQYHQLHQWHV6XVSUHVWDFLRQHVVRQSREUHV KD\TXH HVSHUDUDORVWHPSRUL]DGRUHVVLDOJRIDOOD. WUDPD TXH HO HPLVRU DFDED GH HQYLDU VLPSOHPHQWH OD WLUD \ DVLHQWHVXOOHJDGDFRQXQQXHYR$&. $&. 7LPHU 7LPHU  $54GHUHFKD]RVLPSOH 9HQWDMDV(VXQPpWRGRPX\VHQFLOOR .

 2 $54 GH UHFKD]R FRQWLQXR 6H EDVD HQ HO FRQWURO GH IOXMR GH YHQWDQD GHVOL]DQWH7DPELpQVHOHVXHOHOODPDU³$54GHYXHOWDDWUiV Q.

´6HHPSOHDQWDPELpQ /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV FRQILUPDFLRQHV 55 \ 515.

 DSDUWH GH ODV XVXDOHV VH HPSOHD RWUR WLSR GH FRQILUPDFLRQHV FRQILUPDFLyQQHJDWLYD5HFKD]RVLPSOH 5(-.

.

 7DPELpQDOLJXDOTXHDQWHVVHHPSOHDUiQWHPSRUL]DGRUHV6HHPSOHDQQ~PHURV GHVHFXHQFLD\HQRFDVLRQHVVHHPSOHDHOOODPDGRELW3 SROOLQJ.

 &XDQGRVHSLHUGHRHOQžGHVHFXHQFLDQRHVHOHVSHUDGRHOUHFHSWRUJHQHUDXQD WUDPDQHJDWLYD 5(-.

TXHHVXQUHFKD]R UHMHFW.

(VWHUHFKD]RVHOODPDVLPSOHSRUTXH LQGLFDDOHPLVRUTXHWLHQH TXHUHWUDQVPLWLUHVDWUDPD \WRGDVODVSRVWHULRUHVRVHDXQ UHFKD]RLQGLFDTXHVHGHEHQUHHQYLDUWRGDVODVWUDPDVDSDUWLUGHODWUDPDUHFKD]DGD ( . . 6HWLUD 1  ELWVSDUDLQGLFDUHOQžGHVHFXHQFLD :d 1 : d  VXSRQGUHPRV :   SDUD HVWH HMHPSOR. . 55 . . 55 5 5(- . .

 QR SXHGH HQYLDU PiV GH  WUDPDV VLQ QDEHU UHFLELGR FRQILUPDFLyQ.

 55 3  55 3  55 . 55 . . 5(- . 6HWLUD (O ELW ³3´ VXHOH LU D  SRQLpQGRVH D  FXDQGR TXHUHPRV REOLJDU DO RWUR H[WUHPR D PDQGDUQRV VX HVWDGR 1R WRGRV ORV SURWRFRORV DGPLWHQ R HPSOHDQ HO ELW 3 VXHOH SHGLU OD UHWUDQVPLVLyQ GH WRGDV ODV WUDPDV GHVGHODTXHIDOOyHQDGHODQWH 6L UHFKD]DPRV OD  SRU FXDOTXLHU IDOOR. . . . . 7LPHU .

 HVR LPSOLFDDVHQWLUOD VXSRQLHQGRTXHHOIDOORVHSURGXFH HQODWUDPDOOHJDQGRELHQDODSULPHUD.

 HQ YH] GH HVSHUDU /R QRUPDO HV HVSHUDU SDUD DVHQWLU YDULDV WUDPDV 7LPHU  $54GHUHFKD]RVHOHFWLYR 2 $54 FRQ UHFKD]R FRQWLQXR 6H EDVD HQ HO FRQWURO GH IOXMR GH YHQWDQD GHVOL]DQWH(VFRPRHODQWHULRUSHURHQYH]GHHPSOHDUXQDWUDPD GHUHFKD]R 5(-VH HPSOHD XQD WUDPD GH UHFKD]R VHOHFWLYR 65(-. (O UHFHSWRU SRGUtD HQYLDU \ UHFLELU $&.

 UHRUGHQDUODVWUDPDV \HVWRQRHVVHQFLOOR.QFRQYHQLHQWHV 2EOLJD HQ HO UHFHSWRU D . 55 . &XDQGR VH UHFKD]D XQD WUDPD VyOR VH UHFKD]D HVD WUDPD \ VyOR KD\ TXH UHHQYLDU HVD WUDPD (V PiVHILFLHQWH SXHV VyOR KD\ TXHUHWUDQVPLWLUODVWUDPDVGHIHFWXRVDVSHURDFDPELRREOLJDDPiVFRPSOHMLGDGHQHO UHFHSWRU ( 5 9HQWDMDV 6yOR VH UHWUDQVPLWH OD WUDPD . UHFKD]DGD .

 1RVHWLUDOD $XQTXHSDUHFHPHMRUTXHHOUHFKD]RVLPSOH 55 WUDPD VH HPSOHD PHQRV SXHV HV XQ JUDQ SUREOHPD HO UHRUGHQDPLHQWRGHWUDPDV 6HKDUHFLELGRELHQ ODVWUDPDV\ &RQUHFKD]RVHOHFWLYRVLQRVHXVDHOELW ³3´ HOWDPDxRGHYHQWDQDWLHQHTXHVHUPiVSHTXHxR : 1. . 5(- .

SDUDTXHQRKD\DSUREOHPDV GHDPELJHGDGHV /XLV%5DPtUH]GHO3LQR  .

 . . . 5                   7LPHU 55 1RVHFRQIXQGHFRQWUDPDVIXWXUDV .  3UHVWDFLRQHVGH$54 3! 3UREDELOLGDG GH HUURU GH ELW LQGHSHQGLHQWHPHQWH \ XQLIRUPHPHQWH GLVWULEXtGD 3(%!3UREDELOLGDGGHHUURUGHWUDPD7UDPD EORTXHGHQELWV 3(%  3. . . . . .6LVWHPDVGH&RPXQLFDFLyQGH'DWRV (M 6L1 \:  ( . . . . 5(- 5                   3DUDHYLWDUHVWR:d 1 9HDPRVTXHFRQ1 \: QRKD\HVHSUREOHPD ( . 55 . . . .

73523 73523 7 17  Qž PHGLR GH WUDQVPLVLRQHV TXH KD\ TXH QDFHUGHXQDWUDPDKDVWDTXHOOHJDVLQHUURUHV 77. 7 17 77.73523.Q  $UTGHSDUDGD\HVSHUD 7|77.

1žGHWUDQVPLVLRQHV 3URE  3(%  3(%  3(%.

 3(%Â3(%  3(%.

3(%  3(%.

« «« L 3(% L.

 3(%.

6XSRQHPRVTXHQRKD\HUURUHQORVDVHQWLPLHQWRV ( 5  /XLV%5DPtUH]GHO3LQR .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 17   3(%.

 3(%  3(%.

.

 3(%  3(%.

.

«« 17 17 8 8 8 ¦ LÂ3(%   3(% .

  3(% .

7    3(% .¦ LÂ3(% f L  f L  L    3(%   D 8 LGHDO 17 77.

.  L  ¦ LÂ . f L  L     .

 73523   . .

 77.  73523 . 17 77.

  3(%   D 8WLOL]DFLyQGHOFDVRLGHDO VLQHUURUHV.

   D VLHQGR D  $54FRQUHFKD]RVLPSOH\VHOHFWLYR 7DPELpQVHFXPSOHTXH8 HUURUHV x x 8 LGHDO o8GHODYHQWDQDGHVOL]DQWH YHUDQWHV.

17  17 HQUHFKD]RVHOHFWLYRHVLJXDOTXHSDUDGD\HVSHUD 1 7   3(%   DÂ3(% 17 HQUHFKD]RVLPSOHYDOH 1 7   3(%  )(& )RUZDUG(UURU&RQWURO.

&yGLJR GH FRQWURO GH HUURUHV FRQ SURSLHGDGHV FRUUHFWRUDV VLQ SHGLU UHWUDQVPLVLyQ 6H HPSOHDQ FXDQGR SHGLU XQD UHWUDQVPLVLyQ HV PX\ FRVWRVR R LPSRVLEOH.

HPLVLRQHVGHWHOHYLVLyQRUDGLRGLJLWDOFXDQGRKD\XQUHWDUGRPX\ JUDQGH WUDQVPLVLRQHVYtDVDWpOLWH.

HQYtRGHDXGLRYLGHRHQWLHPSRUHDO 8QHMHPSORHVHOFyGLJR+DPPLQJ6RQEDVWDQWHFRPSOHMRV 3UHVHQWDQXQDVHULHGHLQFRQYHQLHQWHV x 6HQHFHVLWDPXFKDUHGXQGDQFLDSDUDREWHQHUFLHUWDILDELOLGDGHVSUHFLVRHQYLDU PXFKRVELWVGHFyGLJR x 6RQDOJRULWPRVPX\FRPSOHMRVVLHQGRVXLPSOHPHQWDFLyQPX\FRVWRVDWDQWRHQ HOHPLVRUFRPRHQHOUHFHSWRU x (VWiQ RULHQWDGRV D FLHUWRV HUURUHV DOJXQRV IXQFLRQDQ PHMRU SDUD HUURUHV FRQVHFXWLYRVRWURVSDUDHUURUHVGLVSHUVRVHWF x x 7DPELpQSUHVHQWDQXQDVHULHGHYHQWDMDVIUHQWHD$54 1RVHQHFHVLWDXQFDQDOGHUHWRUQR GHUHFHSWRUDHPLVRU.

 (O FDXGDO HILFD] \ HO UHWDUGR VRQ FRQVWDQWHV HQ $54 GHVGH TXH PDQGDV XQ SDTXHWH KDVWD TXH UHFLEHV RWUR HV YDULDEOH WHORSXHGHQUHFKD]DUSHGLUWHUHWUDQVPLVLyQ.

(Q )(&QRHVDVt ( 5 /XLV%5DPtUH]GHO3LQR  .

 WUDPDV FRQVHFXWLYDVHO DOJRULWPRWLHQHTXHFRUUHJLUHUURUHVDVXPHTXHHQ HVDVFRQGLFLRQHVKD\PXFKRUXLGR\ VH SRQH HQ IXQFLRQDPLHQWR HQ PRGR GHWHFWRU 6L UHFLEH .6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  7pFQLFDVPL[WDV  )(&)(& (PSOHDQ  )(& XQR SDUD VROYHQWDU HUURUHV GLVSHUVRV \ HO RWUR SDUD HUURUHV VHJXLGRV  $54)(& (PSOHDQ XQFyGLJRHQ SULQFLSLR FRUUHFWRU SHURVL HQ .3333\+'/& 3HQVDGR SDUD PDQGDU SRU XQD OtQHD VHULH SXQWR D SXQWR HQWUH  RUGHQDGRUHV SDTXHWHV.3 GH WRGDV ODV IXQFLRQHV GHO QLYHO GH HQODFH VyOR KDFH OD GH HQWUDPDGR GRQGH DFDED XQ SDTXHWH .3 6/. WUDPDV FRUUHFWDV FRQVHFXWLYDPHQWH DVXPH TXH OD VLWXDFLyQ GH UXLGR KD ILQDOL]DGR \ YXHOYH DO PRGR FRUUHFWRU  3URWRFRORVGHQLYHOGHHQODFH (MHPSORVGHSURWRFRORVGHQLYHOGHHQODFHVRQ6/.3 \ FRPLHQ]D HO VLJXLHQWH.

 (V XQ SURWRFROR RULHQWDGR D FDUiFWHU E\WH.

3 6HULDO/LQN.3. 6LHOVHSDUDGRUDSDUHFHGHQWURGHOSDTXHWHVHVXVWLWX\HSRURWURSDWUyQ 1R WLHQH FRQWURO GH IOXMR VH XQ RUGHQDGRU HV PiV UiSLGR HQYLDQGR HO RWUR QR SRGUiSURFHVDUORVGDWRV\ORVSDTXHWHVVHSHUGHUiQ6HFRQItDHQTXHXQQLYHOVXSHULRU ORGHWHFWD\SRGHODUHWUDQVPLVLyQ 7DPSRFR KD\ FRQWURO GH HUURUHV VH GHMD SDUD QLYHOHV VXSHULRUHV 7DPSRFR VH KDFHQDGDVREUHODJHVWLyQGHHQODFH  6/.

3HQVDGR SDUD FRPXQLFDFLRQHV SXQWR D SXQWR HQWUH  PiTXLQDV 1R HV XQ SURWRFROROLJDGRDOQLYHOGHUHG VHSXHGHHPSOHDU.3RFXDOTXLHURWURHVLQGHSHQGLHQWH GHOQLYHOGHUHG.

 (VXQSURWRFRORRULHQWDGRDELWSXHVHOGHOLPLWDGRUGHFRPLHQ]R\ILQHV  '$726 )&6  )&6VRQELWVGHFRUUHFFLyQGHHUURUHV 6LVHUHSLWHHOSDWUyQHQORVGDWRVVHKDFHELWVWXIILQJ/RVGDWRVWLHQHQTXHVHU XQQ~PHURHQWHURGHE\WHV Q~PHURGHELWVP~OWLSORGH.

7LHQHGHWHFFLyQGHHUURUHV\ SXHGH SHGLU UHWUDQVPLVLyQ /R PiV LPSRUWDQWH HV TXH LQFOX\H JHVWLyQ GHO HQODFH /XLV%5DPtUH]GHO3LQR   333 3RLQWWR3RLQW3URWRFRO.

.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV &XDQGR  PiTXLQDV FRPLHQ]DQ D FRPXQLFDUVH FRQ 333 HPSOHDQ HO SURWRFROR /&3 /LQN &HQWUDO 3URWRFRO.

 FRQVLVWHQWH HQ XQ LQWHUFDPELR GH PHQVDMHV SDUD SRQHUVH GH DFXHUGRHQHOSURWRFRORGHOQLYHOGHUHGDHPSOHDU WLSRGHGDWRVDWUDQVSRUWDU.

TXpWLSR GHFRQWUROGHIOXMRYDQDKDFHUVLORVGDWRVVHYDQDFRPSULPLURQRHWF$ODFDEDUOD QHJRFLDFLyQVHSDVDDRWUDIDVHOODPDGD1&3 1HWZRUN&RQWURO3URWRFRO.

3 %DVWDQWH DQWLJXR SHUR PX\ LPSRUWDQWH SXHV GH pO VH KDQ GHULYDGR PXFKRV SURWRFRORV PiV TXH GHULYDUVH HV TXH +'/& WLHQH PXFKDV YDULDQWH X RSFLRQHV GH IXQFLRQDPLHQWR+D\PXFKRVSURWRFRORVTXHHQHOQLYHOGHHQODFHHPSOHDQ+'/&FRQ FLHUWDVRSFLRQHV (Q5'6.6'1.TXHGHSHQGH GHO SURWRFROR GH QLYHO GH UHG HVFRJLGR DQWHULRUPHQWH VH HQFDUJD GH TXH HO XVXDULR PDQGHXQORJLQ\XQSDVVZRUGDGHPiVGHDVLJQDUQRVXQDGLUHFFLyQ. .

VHHPSOHDQSURWRFRORVGHQLYHOGHHQODFH/$3 %\/$3' TXHVRQSDUWLFXODUL]DFLRQHV GH+'/& (QORV)UDPH5HOD\VHHPSOHD/$3)\HQORV/$1HV//& (VXQSURWRFRORRULHQWDGRDELW\VXIRUPDWRGHWUDPDHV  &21752/ '$726 &5&  (OFRQWUROOOHYD x 7LSRGHWUDPD'DWRVVLHVXQ555155(-65(- x 1žGHVHFXHQFLD GHWUDPD\GHDVHQWLPLHQWR.

x %LW3  D    +'/& +LJKOHYHO'DWD/LQN&RQWURO.

+'/& WDPELpQ WLHQH JHVWLyQ GHO HQODFH DO SULQFLSLR VH QHJRFLD HQ TXp QRGR IXQFLRQDUiHOHQODFH $54GHSDUDGD\HVSHUDUHFKD]RVLPSOHHWF.

  3UREOHPDV 5HDOLFHXQHVWXGLRFRPSDUWLGRGHOFDQDOHILFD] SRUODVWpFQLFDV$54GHSDUDGD\HVSHUD UHFKD]RVLPSOH\UHFKD]RVHOHFWLYRFRQVLGHUDQGRORVVLJXLHQWHVGDWRV x 1žGHELWVGHLQIRUPDFLyQHQWUDPDGHGDWRVELWV x 1žGHELWVGHFRQWUROHQWUDPDVGHGDWRVELWV x 1žGHELWVHQWUDPDV$&.ELWV x 9HORFLGDGGHWUDQVPLVLyQELWVVHJ x 3UREDELOLGDGGHHUURUGHELWÂ x 5HWDUGRGHSURSDJDFLyQPV $54FRQSDUDGD\HVSHUD /XLV%5DPtUH]GHO3LQR  .

VHJ 5 m 5pJLPHQELQDULR  ELWV VHJ 73523 GDGR HQHO HQXQFLDGR PV VHJ  /$&. ½ 7 ° ° 7352& 7352& | ¾ 6LQ HUURUHV 7$&. 73523 8 3UREDELOLGDGGHHUURUGHEORTXH 3HE     3 . 7$&.1R ORFRQVLGHUDPRV7$&. m /RQJLWXG GH WUDPD  ELWV 77.  ELW 7$&. |  ° 73523 ° ¿ 6XSRQHPRVTXHORVHUURUHVVHSURGXFHQHQODWUDPD /7. !)OXMRPiVSHTXHxRGHWUDQVPLVLyQVRQR 5 m 5pJLPHQELQDULR  ELW  VHJ ORGHVSUHFLDPRVWHQGUtDPRVTXHFRQWDUORVHUURUHVSURGXFLGRVHQHOHQYtRGH$&.  77.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 7 77.| 73523  D  77. m ORQJLWXG ELWV $&.

/7. (OUpJLPHQELQDULRRFDXGDOHILFD] &HI.  $54FRQSDUDGD\HVSHUD 8   3HE  8WLOL]DFLyQ GHO  GH ORV  ELWV HPSOHDGRV (O RWUR  VH   D SLHUGHHQUHWUDQVPLVLRQHVRHVSHUDVGH$&.

 GH OD SULPHUD WUDPD OD YHQWDQD QR VH KD DJRWDGR\QRQRVKHPRVWHQLGRTXHSDUDU 8   3HE  . ( 5 6H HPSOHDUtDQ HVWDV IRUPXODV VL QR H[LVWH HQYtR FRQWLQXR  (QYtR FRQWLQXR VL DO OOHJDU HO $&.HVÂ ELWVVHJ      $&.

  D3HE &HI  ELWV  VHJ   3HE   ELWV  VHJ (QHO$54GHUHFKD]RVHOHFWLYR VyORVHUHHQYtDODWUDPDHUUyQH D.

 8 &HI /XLV%5DPtUH]GHO3LQR  .

 7$&. 73523 6XSRQJDPRV  HVWDFLRQHV WHUUHVWUHV TXH VH FRPXQLFDQ YtD VDWpOLWH /D FDSDFLGDG GHO FDQDOGHOVDWpOLWHHVGH.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV /DXWLOL]DFLyQGH$54GHSDUDGD\HVSHUDHVPX\JUDQGHSRUTXHYLPRVTXHVL ODGXUDFLyQGHODWUDPDHVPXFKRPiVJUDQGHTXHHOUHWDUGRHVPHQRVPDOR &RQORVRWURVGRVPHFDQLVPRVVHREWLHQHQPHMRUHV UHVXOWDGRVTXHFRQSDUDGD\ HVSHUDVLHQGRPXFKRPiVFRPSOHMRV ¢3RUTXpQRKD\PXFKDGLIHUHQFLDHQWUHUHFKD]RVLPSOH\VHOHFWLYR"3RUTXHHO WDPDxRGHWUDPDHVPX\JUDQGH\HOHUURUGHELWHVPX\SHTXHxR 6LKXELpVHPRVHVFRJLGRODDSUR[LPDFLyQODIRUPXODGHDVHUtD D 352%/(0$ 77.ELWVVHJSHURVHGLYLGHHQ FDQDOHVGH.ELWVVHJ XQR SDUD FDGD VHQWLGR.

 6H GHFLGH XWLOL]DU FRQWURO GH IOXMR SRU YHQWDQD GHVOL]DQWH FRQ ³SLJJ\EDFNLQJ´ DSURYHFKDU HO DVHQWLPLHQWR SDUD HQYLDU LQIRUPDFLyQ DGLFLRQDO SRU HO RWURFDQDOVHHQYtDODWDUPD\HODVHQWLPLHQWRGHOD~OWLPDUHFLELGD.

 6XSRQHPRVTXHDPDVWHVWDFLRQHVVLHPSUHWLHQHQ WUDPDVTXHHQYLDU(OWLHPSRGH SURSDJDFLyQHQWUHWLHUUD\VDWpOLWHHVPV<TXHODORQJLWXGGHODWUDPDQHVGH E\WHV 6HSLGHFDOFXODUORVVLJXLHQWHSDUiPHWURV D.

 / Â ELWV PV 5  ELWV  VHJ E.77.

73523 7 77. 73523   PV F. 77 77.7LHPSRGHVGHODWUDQVPLVLyQGHOHU ELWGHXQD WUDPDKDVWDODUHFHSFLyQGHO~OWLPR 77.

73523 77. 73523  E\WHV SRU HO SLJJ\EDFNLQJ PDQGDWDPELpQLQIRUPDFLyQ.7LHPSRGHODWUDQVPLVLyQGHVGHHOHU ELWGHXQDWUDPDKDVWDHO~OWLPRELWGHODWUDPD GHDVHQWLPLHQWR 77 77.

7 77. PV G.

t PV :t  : !  o QHFHVLWDPRV  ELWV SRU HO Q~PHUR GH VHFXHQFLD 3RGHPRV HQYLDU  WUDPDV QXPHUDGDV FRQ FRGLILFDFLyQELQDULDGHELWV  /XLV%5DPtUH]GHO3LQR .WDPDxRGHYHQWDQDySWLPR    Q 77 :Â77.

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV  1LYHOGHHQODFH0HGLRFRPSDUWLGR (Q PHGLRV FRPSDUWLGRV KD\ TXH UHJXODU TXH QR WRGRV WUDQVPLWDQ DOD YH] 0HUHPRVTXpPHGLRVKD\SDUDUHJXODUHODFFHVRDOPHGLRFRPSDUWLGR  0XOWLSOH[DFLyQ &RQVLVWH HQ GLYLGLU HO XVR GHO PHGLR GH WUDQVPLVLyQ GH IRUPD HVWiWLFD HQWUHORV XVXDULRV (VDGLYLVLyQVHSXHGHKDFHUGHYDULDVIRUPDV x 0XOWLSOH[DFLyQSRUGLYLVLyQ HQHOWLHPSR7'0R7'0$ x 0XOWLSOH[DFLyQSRUGLYLVLyQHQIUHFXHQFLD)'0R)'0$ x 0XOWLSOH[DFLyQSRUGLYLVLyQHQORQJLWXGGHRQGD:'0R:'0$ x 0XOWLSOH[DFLyQSRUGLYLVLyQGHFyGLJR&'0R&'0$ (QHVHPHGLRFRPSDUWLGRVHYDDDVLJQDUDFDGDHVWDFLyQXQ LQWHUYDORGHWLHPSR SDUDWUDQVPLWLUGHWDOIRUPDTXHVHYDQSDVDQGRHOWXUQRVXFHVLYDPHQWH 3RUHOPHGLRFLUFXODXQDWUDPDSHULyGLFDTXHFRPLHQ]DHQXQLQVWDQWHW \YDXQD VXFHVLyQGHELWVHQYLDGRVSRUFDGDHVWDFLyQ $ YHFHV KD\ XQD FDEHFHUD TXH HV ODTXH FRPLHQ]D D JHQHUDU OD WUDPD 6L QR H[LVWH WRGDV ODV HVWDFLRQHV WLHQHQ TXH WHQHU XQ UHORM FRP~Q $~Q DVt FRQ FDEHFHUD WRGDVODVHVWDFLRQHVHVFXFKDQODWUDPDSDUDVLQFURQL]DUVH $O ILQDO HQ HO PHGLR HQ XQ LQVWDQWH [ VyOR SXHGH WUDQVPLWLU XQR \ VL SXHGH HQYLDUPiVGH[ELWVWLHQHTXHHVSHUDUDTXHOHOOHJXHGHQXHYRHOWXUQR 6L VH WUDQVPLWHQ 5 ELWVVHJ SRU HO PHGLR FDGD HVWDFLyQ SXHGH HQYLDU 51 ELWVVHJ DOJRPHQRVSRUTXHWDPELpQKD\FDEHFHUDV.

 6HHPSOHDQGHVGHKDFHPXFKRHQODUHGWHOHIyQLFD x (XURSDYR]D.ELWVVHJ x 86$YR]D.ELWVVHJ  7'0 8QVRORFDEOHSDUDWRGDV ODVFRPXQLFDFLRQHV (QHXURSDKD\XQVLVWHPD7'0 HO(GH0ELWVVHJ.

TXHFRQVLVWHHQXQD WUDPDGHFDQDOHVGHELWV      ELWV /XLV%5DPtUH]GHO3LQR  .

ELWVVHJGDQGROXJDUDORV 0ELWVVHJ (VWHGLYLGHHODQFKRGHEDQGDGHOPHGLRGHWUDQVPLVLyQ 6HDVLJQDXQDSRUFLyQDFDGDHVWDFLyQ$ODHVWDFLyQ SRU HMHPSOR OD REOLJDPRV D PRGXODU VX VHxDO SDUD TXH VX WUDQVPLVLyQ VH HQFXHQWUHMXVWR HQWUHOD EDQGDGH IUHFXHQFLDV TXHVHOHKDDVLJQDGR (O UpJLPHQ ELQDULR TXH SXHGH REWHQHU HVD HVWDFLyQ HV 51 SXHVWR TXH :1.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 6HUHSLWHFDGDPVHJ6HUHSLWHQFDQDOHVD .

 &RQ)'0WUDQVPLWHQWRGRVDODYH]SHURSRUEDQGDVGHIUHFXHQFLDGLVWLQWDV\DPHQRU YHORFLGDG 51ELWVVHJ.

 (Q)'0GDGDHVWDFLyQWUDQVPLWHDYHORFLGDG5SHURVyORGXUDQWHXQSHTXHxR WLHPSR(QPHGLDWUDQVPLWHD51SHURSXQWXDOPHQWHD5 6HXVDPHQRVHQUHGHVGLJLWDOHVDXQTXHVHXVDHQUHGHVGHWHOHIRQtD HVSUHYLRD 7'0\VHXQDPHQRVTXHpVWH.

 (VORPLVPRTXH)'0VyORTXHHVFXDQGRKDEOHPRVGHIUHFXHQFLDVPX\DOWDV HQHOHVSHFWURGHODOX].

/DLGHDHVODPLVPD6HXWLOL]DHQILEUDySWLFDPDQGDQGRSRU HVWDSXOVRVGHOX]GHGLIHUHQWHIUHFXHQFLD RORQJLWXGGHRQGD.

RVHDFRP RPDQGDUOX] GHGLIHUHQWHVFRORUHV (OUpJLPHQELQDULRHV: :ORJ0 :  )'0  :'0 6RQ WpFQLFDV GH HVSHFWURHQVDQFKDGR SHQVDGDV SDUD HQWRUQRV FRQ PXFKR UXLGR 3RUVXFRPSOHMLGDGQRORVYHUHPRV(QWHOHIRQtDPyYLOVHHPSOHDQ&'0FRQ)'0 9HQWDMDV GH OD PXOWLSOH[DFLyQ 6RQ PpWRGRV VHQFLOORV \ FDGD XVXDULR WLHQH XQ UDQJRRJDPDSRUHPLWLUSRUHOWHQLHQGRFDGDXVXDULRVXSRUFLyQGHDQFKRGHEDQGD  &'0 .QFRQYHQLHQWHV (V SRFD IOH[LEOH SXHV D FDGD XVXDULR VH OH DVLJQD SHUPDQHQWHPHQWH VX SRUFLyQ LQGHSHQGLHQWHPHQWH GH VL WUDQVPLWH R QR 3DUD DVLJQDFLRQHVGLQiPLFDVKD\RWURVPHFDQLVPRV  3URWRFROR$/2+$ (VWH VLVWHPD VH GLFH TXH HV XQ VLVWHPD GH FRQWLHQGD SRUTXH ORV XVXDULRV QR WLHQHQDVLJQDGDXQDSRUFLyQVLQRTXHWLHQHQTXHFRPSHWLUSRUHOXVRGHHVDUHG /XLV%5DPtUH]GHO3LQR   $/2+$SXUR .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV )XHGHVDUUROODGRHQORVHQOD XQLYHUVLGDGGH+DZDL\ FRQVLVWHHQVHVXHOH HPSOHDUHQUHGHVSDUDUDGLRRVDWpOLWH(QWHOHIRQtDPyYLOHOPyYLOHQYtDXQDSHWLFLyQGH OODPDGDSRUHOPpWRGR$/2+$FRPSLWLHQGRFRQHOUHVWRGHPyYLOHV &XDQGRXQDHVWDFLyQTXLHUHWUDQVPLWLUWUDQVPLWH3XHGHRFXUULUTXHRWUDHVWDFLyQ WUDQVPLWDDODYH]SURGXFLpQGRVHXQDFROLVLyQ 3RU FXHVWLRQHV GH UHWDUGR ODV HVWDFLRQHV QR HVFXFKDQ HO PHGLR D YHU VL HVWi RFXSDGR /R TXH VL KDFH GHVSXpV GH KDEHU WUDQVPLWLGR HV HVFXFKDU \ VL HVFXFKD XQD FROLVLyQ UHLQWHQWH HO HQYtR (O UHLQWHQWR VH SURGXFH WUDV XQ WLHPSR DOHDWRULR (VSHUD HVFXFKDQGR HO WLHPSR Pi[LPR GH UHWDUGR GH OD UHG SDUD DVHJXUDUVH TXH VX HQYtR QR SURGXMRFROLVLyQ (VWH WLSR GH UHGHV HVWi ELHQ SDUD SRFR WUDILFR SRUTXH VL QR KDEUtD PXFKDV FROLVLRQHVSURYRFDQGRUHWUDQVPLVLRQHV\PiVFROLVLRQHV  &iOFXORGHSUHVWDFLRQHV 6XSRQGUHPRVTXHODVWUDPDVWUDQVPLWLGDVVRQGHWDPDxRILMR /ELWV.

(OUpJLPHQ ELQDULRHV5ELWVVHJ /RTXHVHWDUGDHQWUDQVPLWLUXQDWUDPD WLHPSRGHWUDPDW.

 W / 5 7DPELpQVHVXSXVRTXHODSREODFLyQHUDPX\JUDQGH WLHQGHDLQILQLWR.

 6VHUiHOQ~PHURPHGLRGHWUDPDVQXHYDVTXHHVDSREODFLyQTXLHUHWUDQVPLWLUSRU HOWLHPSRGHWUDPD 1 ž WUDPDV QXHYDV 6 WLHPSR WUDPD 6WDPELpQVHOODPDWUiILFRQXHYRRIUHFLGR(OQ~PHURGHWUDPDVWRWDO QXHYDV  UHWUDQVPLVLRQHV WLHPSR GH WUDPD 6HOODPDWDPELpQWUiILFRWRWDORIUHFLGR * ¢&XiQWDVWUDPDVVHHQYLDUiQVLQFROLVLyQ" IDOWD 7UiILFR FXUVDGR  6 SRUTXH VH UHWUDQVPLWLUi OD WUDPD WDQWDV YHFHV FRPR KDJD 3 3UREDELOLGDGGHTXHXQDWUDPDQRFROLVLRQHV  W / / WW WW 1DGLHGHEHHPLWLUGXUDQWHHOLQWHUYDORGHGXUDFLyQW 6 !6 * *Â3 / / / 6PD[ H  /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 6XSRQGUHPRV TXH ODV WUDPDV VHUiQ JHQHUDGDV SRU ODV HVWDFLRQHV GH IRUPD DOHDWRULD 1 N H 1 VLJXLHQGR XQD GLVWULEXFLyQ GH SRLVRQ 3 >N @ FRQ N UHWUDQVPLVLRQHV.

 GRQGH 1 N W HVHOQžPHGLRGHWUDQVPLVLRQHVHQHOLQWHUYDORW HQWLHPSR.

ELWVVHJ UHWUDQVPLVLRQHV *PD[  * (O WUiILFR WRWDO QXHYR VHUi GHO  \ OD GLIHUHQFLD HQWUH  \  VHUiQ &DOFXODPRV HO Q~PHUR PHGLR GH LQWHQWRV KDVWD WUDQVPLWLU FRQ p[LWR XQD WUDPD $QWHVGHHVRWHQHPRVTXHYHUODSRVLELOLGDGGHTXHWUDQVPLWDPRVHQNLQWHQWRV 3URENLQWHQWRV  3. (QFDVRGHTXHQRTXHUDPRVFROLVLRQDUW W1 *\N  3 H* 6 *ÂH* /DUHSUHVHQWDFLyQJUiILFDHVODVLJXLHQWH (VWRV YDORUHVPi[LPRVQRV GLFHQ TXH SRGHPRV 6 6PD[ H  HQYLDUFRPRWUiILFRQXHYRHO6LHVXQDUHG GH.ELWVVHJFRQDORKD SRGUHPRVWUDQVPLWLU .

N Â3  H*.

N ÂH* f 3.

 N H *  7RGDVODVHVWDFLRQHVFRPSDUWHQXQUHORMQRWUDQVPLWLHQGRFXDQGRTXLHUDQVLQR TXH FXDQGR VH TXLHUH WUDQVPLWLU KD\ TXH HVSHUDUVH DO VLJXLHQWH LQVWDQWH GH WLHPSR P~OWLSORGHOWLHPSRGHWUDQVPLVLyQGHWUDPD / ELW ½ / ¾W 5 5 ELW  VHJ ¿ W W W W W  $/2+$UDQXUDGR ( H * (VSHURKDVWDW /  W /D YHQWDMD HV TXH VH UHGXFHQODVFROLVLRQHV /XLV%5DPtUH]GHO3LQR  .VLKD\FROLVLyQ3 QRFROLVLyQ 33UREDELOLGDGGHHQYLDUODDODSULPHUD3SUREDELOLGDGGHHQYLDUODDODVHJXQGD 1žPHGLRGHWUDQVPLVLRQHV ( Â3  Â3  Â3   ¦ N Â3 .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV WW WW W WW WW 6yORFROLVLRQDQFRQQRVRWURVODVWUDPDVTXHOOHJDQ HQWUH WW \ W VLHQGR XQ SHULRGR W QR W FRPR HQ $/2+$SXUR.

 ¢&RPRDIHFWDHVWRDODVSUHVWDFLRQHV" W W 1 * QRWFRPRDQWHV.

 3 H* !6 *ÂH* ( H* &RQ $/2+$ UDQXUDGR SRGHPRV OOHJDU KDVWD HO  HQ XQD UHG GH  .ELWVV SRGHPRV HQYLDU KDVWD WUDPDV QXHYDV D  .ELWVV VLHQGR HO UHVWR UHWUDQVPLVLRQHV (VSHUD (VSHUD FROLVLyQ (VSHUD 6XVWLWX\HQGRHQSRLVVRQ (HVHOQ~PHURPHGLRGHLQWHQWRV 6 *UiILFDPHQWH 6PD[ H  *PD[  *  &60$ &DUULHU6HQVH0XOWLSOH$FFHVV $FFHVRP~OWLSOHFRQGHWHFFLyQGHSRUWDGRUD.

 (VXQDYDULDQWHGH$/2+$SDUDUHGHVFRQXQUHWDUGRGHSURSDJDFLyQEDMR(Q $/2+$VHWROHUDQJUDQGHVGLVWDQFLDV\VHWUDQVPLWHFXDQGRVHTXLHUH QRVHHVFXFKD.

 /RVHQYtRVSXHGHQWDUGDUHQOOHJDU 6LODUHGHVPiVSHTXHxDODWUDQVPLVLyQWDUGDPHQRVHQOOHJDUDOUHFHSWRU$OVHU HOUHWDUGRPHQRUVHSXHGHQHYLWDUFROLVLRQHVVLDQWHVGHHPLWLUHVFXFKDDYHUVLDOJXLHQ HVWiWUDQVPLWLHQGRVHHVSHUDKDVWDTXHHOPHGLRTXHGDOLEUH +D\GLIHUHQWHVYDULDQWHGH&60$ &RQVLVWH HQ TXH VL DO HVFXFKDU HO PHGLR HVWi RFXSDGR VH HVSHUD D TXH TXHGH OLEUH SDUD WUDQVPLWLU 6L FROLVLRQD VH UHLQWHQWD XQ WLHPSR DOHDWRULR SRU TXH VL QR FROLVLRQDUtDVLHPSUH  &60$SHUVLVWHQWH  &60$QRSHUVLVWHQWH /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV 6LHOPHGLRHVWiRFXSDGRVHHVSHUDXQWLHPSRDOHDWRULRDQWHVGHYROYHUDLQWHQWDU HOHQYtR 3HVWiHQWUH\ HVXQDSUREDELOLGDG.

QWXLWLYDPHQWH&60$SHUVLVWHQWHFRQVLJXHWUDQVPLWLUDQWHVSHURHVPD\RUOD SUREDELOLGDG GH FROLVLyQ 1R HV UHFRPHQGDEOH FRQ WUiILFR DOWR GD OXJDU D PX FKDV FROLVLRQHV (Q HO &60$ QR SHUVLVWHQWH HO UHWDUGR HV PD\RU SXHV VL HVWi RFXSDGR QR WUDQVPLWRFXDQGRTXHGDOLEUHVLQRFXDQGRSXHGD\WUDVXQSHUtRGRDOHDWRULRGHWLHPSR 7LHQHPHQRVFROLVLRQHV  &60$&' &DUULHU 6HQVH 0XOWLSOH $FFHVV  &ROOLVLRQ 'HWHFWLRQ $FFHVR P~OWLSOH FRQ GHWHFFLyQGHSRUWDGRUDGHWHFFLyQGHFROLVLyQ.6HHVFXFKDHOPHGLR\VLHVWiRFXSDGR FRQ SUREDELOLGDG S SHUPDQH]FR D OD HVFXFKD KDVWD TXH HVWp OLEUH \ HQYtR \ FRQ SUREDELOLGDGSHVSHUDXQWLHPSRDOHDWRULR\UHLQWHQWRHOHQYtR  &60$SSHUVLVWHQWH .

P 6HSURGXFHFROLVLRQVLHQXQLQVWDQWHDQWHVGHWODRWUDHVWDFLyQWUDQVPLWH W 73 (OSHRUFDVRGHFROLVLyQVHSURGXFHWUDVPV&RPRWUDQVPLWRELWVPV YHU 5. 0HMRUDGH&60$SDUDFXDQGRHOUHWDUGRHVPHQRUD~Q 6L ODV GLVWDQFLDV VRQ PX\ SHTXHxDV VyOR SRGUi KDEHU FROLVLRQHV HQ OD SULPHUD SDUWHGHODWUDPD 73 HVHOWLHPSRGHSURSDJDFLyQ W  73 W 73  H W 73 H /D FROLVLyQ SURFHGH GH OD VXPD GH  VHxDOHVHOpFWLFDV SRU OR TXH KDVWD TXH QR SDVDXQWLHPSRWQRVHGHWHFWDUiODFROLVLyQ 'HVSXpV GH W  73 QR SXHGH KDEHU FROLVLyQ SXHV OD HVWDFLyQ GHVWLQR \D KD UHFLELGRODWUDQVPLVLyQ 6HVXHOHHPSOHDUHQHWKHUQHW .

GHVGHTXHHPSLH]RDWUDQVPLWLUKDVWD TXHUHFLERODFROLVLyQKHWUDQVPLWLGRELWV  E\WHV.

 (O WDPDxR Qi[LPR GH WUDPD HWKHUQHW HV  E\WHV 'HVSXHV GH KDEHU /XLV%5DPtUH]GHO3LQR  5 0ELWVVHJ (OUHWDUGRHVGHPV .

(((.E\WHV LJXDODORVE\WHVTXHVHSXHGHQSURSDJDUKDVWDTXH UHFLERODFROLVLyQHQHOSHRUFDVR(VWDLPSRVLFLyQHVSDUDVDEHUDOWUDQVPLWLUVLODWUDPD OOHJyFRQp[LWR (O LQFRQYHQLHQWH HV TXH HVH WDPDxRPtQLPR HVWi UHODFLRQDGR FRQ HO UHWDUGRHO UpJLPHQELQDULRHWF 6LVHTXLVLHUDGLVHxDUXQDHWHUQHWFRQ5 0ELWVVFRQORVPLVPRV.PGH FDEOH HO WDPDxR PtQLPR SDVD D VHU  E\WHV (Q OD SUDFWLFD VH KDQ FRQFHUYDGR HO WDPDxRPtQLPRGHE\WHVSRUORTXHODUHGSDUDTXHWHQJDXQUHWDUGRGHPVHQ YH]GHPVVHFRUWDHOFDEOHDP 3DUDFRQVHJXLU*ELWVHJFRPRPi[LPRHOFDEOHPHGLUiP 127$ 7DQWR $/2+$ SXUR FRPR HO UDQXUDGR \ WRGRV ORV &60$ VRQ WpFQLFDV GH FRQWLHQGD SRUTXH KD\ FROLVLyQ HQWUH HVWDFLRQHV +D\ RWUDV WHFQLFDV VLQ FROLVLyQ FRPR SXHGHVHUHO³SDVRGHWHVWLJR´  3DVRGHWHVWLJR 8QD HVWDFLyQ SDUD WUDQVPLWLU WLHQH TXH KDEHU UHFLELGR XQD WUDPD HVSHFLDO OODPDGD ³7HVWLJR´ (VD WUDPD OD WLHQH LQLFLDOPHQWH XQD HVWDFLyQ \ OR TXH KDFH HV WUDQVPLWLUODDODVLJXLHQWH7RGDVODVHVWDFLRQHVVDEHQFXDOHVODVLJXLHQWH 3DUDWUDQVPLWLUKD\ TXH HVSHUDUDWHQHUHOWHVWLJR $OUHFLELUHOWHVWLJRVH SXHGH WUDQVPLWLU$ODFDEDUSDVDHOWHVWLJRDODHVWDFLyQVLJXLHQWH 7HVWLJR 8QD HVWDFLyQ QR SXHGH WHQHU HO WHVWLJR GLHPSUH SXHGH WUDQVPLWLU GXUDQWH XQ WLHPSRPi[LPR6LWUDVHVHWLHPSRTXHUH VHJXLUWUDQVPLWLHQGRWLHQHTXHHVSHUDU\VROWDU HOWHVWLJR 2WUR SUREOHPD SXHGH OOHJDU VL OD HVWDFLyQ GHO WHVWLJR VH FDH 'HEH KDEHU XQD HVWDFLyQGHPDQWHQLPLHQWRTXHYLJLOHHOWHVWLJR\VLKDFHIDOWDSRQJDRWURHQFLUFXODFLyQ  /$1 /DVSULQFLSDOHVVRQ 7HFQRORJtDHQEXVFRQ&60$&' /XLV%5DPtUH]GHO3LQR  (WKHUQHW .6LVWHPDVGH&RPXQLFDFLyQGH'DWRV HQYLDGR  E\WHV HV LPSRVLEOH TXH KD\D FROLVLyQ \D &RQ HOOR FRQFOXtPRV TXH ODV FROLVLRQHVVHSURGXFHQHQORVSULPHURVE\WHV 6L FROLVLRQR WUDV HQYLDU  E\WHV HV WRQWHUtD VHJXLU WUDQVPLWLHQGR DVt TXH VH DERUWDODWUDQVPLVLyQ (Q ODV UHGHV &60$&' VH LPSRQHXQ WDPDxR PtQLPR GH WUDPDTXH HO HO FDVRGHHWKHUQHWHVGH.

 .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV +D\ YDULDQWHV D  0EV  0EV  *EV +D\ VREUH FRD[LDO GH GLIHUHQWHV WLSRVILEUDySWLFDSDUWUHQ]DGRHWF 9DULDQWHV OLGDG x %$6( \%$6( FRD[LDOD0ELWV EDVHFRD[LDOGHEDMDFD EDVHDOWDFDOLGDG.

(O\HO RVHDP\P.

P PV.GDQHOQžGHPHWURV TXHSXHGHPHGLUHOFDEOH6HSXHGHQDODUJDUFRQUHSHWLGRUHVVLHPSUH \FXDQGR QRVHVXSHUHQORV.

 x %$6(70ELWVFRQXQFDEOHGHWLSR7 SDUWUHQ]DGR.

P.3XHGHPHGLUKDVWD PVLQUHSHWLGRUHV x %$6())LEUDySWLFD KDVWD.

 x %$6(7 x %$6() x *LJDELW(WKHUQHW *ELWV 7RSRORJtD HQ DQLOOR HPSOHD HO SDVR GH WHVWLJR +D\  \ D 0ELWVHJ (PSOHD SDUWUHQ]DGR\ILEUD ySWLFD  7RNHQ5LQJ .(((.

(QDQLOORFRQSDVRGHWHVWLJR(VGH0ELWV'HILEUDySWLFD 7HFQRORJtD GH EXV FRQ SDVR GH WHVWLJR 6H HPSOHD HQ UHGHV LQWHUQDV SDUD FRPXQLFDUURERWVHQFDGHQDVGHPRQWDMH  7RNHQ%XV .  )''.(((.

 352%/(0$6 352%/(0$ 8QJUXSRGH1HVWDFLRQHVFRPSDUWHQXQFDQDO$/2+$SXURGH5 .ELWVV&DGD HVWDFLyQPDQGDFRPRPHGLDXQDWUDPDGH/ ELWVFDGDVHJXQGRVLQFOXVRVL ODDQWHULRUQRKDVLGRHQYLDGD ¢&XDOHVHOQžPi[LPRGHHVWDFLRQHVIXQFLRQDQGR" 6ROXFLyQ   ¢&XiQWRHVHOWLHPSRGHWUDPD" 60$. H  775$0$ /5 ELWELWV VHJ  /XLV%5DPtUH]GHO3LQR .

21  VHJ   75$0$6 &DGDHVWDFLyQJHQHUDHVWR.6LVWHPDVGH&RPXQLFDFLyQGH'DWRV ¢&XDQWDVWUDPDVQXHYDVWLHPSRWUDPDJHQHUDFDGDHVWDFLyQ" 775$0$775$0$(67$&.Ï1  718(9$6 WUDPD  VHJ Â WUDPD 775$0$ (67$&.

775$0$  ¢&XiQWDVWUDPDVQXHYDVVHJHQHUDQHQWRWDO" 6 1 0$.  HVWDFLRQHV 352%/(0$ 8QDJUDQSREODFLyQGHXVXDULRVGH$/2+$UDQXUDGRJHQHUDSHWLFLRQHVSRUVHJXQGR WUDPDVVHJ. Â   1 0$. Â  75$0$6 LJXDODPRV D  775$0$   ! 1 0$.

LQFOX\HQGRWUDPDVQXHYDV\UHWUDQVPLVLRQHV(OWDPDxRGHODUDQXUDGHO $/2+$HVGHPV ¢&XiOHVODSUREDELOLGDGGHp[LWRHQHOSULPHULQWHQWR" 6   * 6  W PV Â VHJWUDPD * WUDPDVVHJÂÂ VHJWUDPD 7UDPDV775$0$ (Q $ORKD UDQXUDGR WUDQVPLWLPRV HQ W FRQ OR FXDO HO WLHPSR GHWUDPDHVPV 6 *ÂH* ]RQDPDODPXFKDVFROLVLRQHV   * 3 SUREGHHQYtRVLQFROLVLRQHV.

 H*  VyORHO GHODVWUDPDVYDQDOD.

 ¢&XiOHVHOQXPHURPHGLRGHLQWHQWRVGHWUDQVPLWLUQHFHVDULRV" 352%/(0$ /DV PHGLGDV KHFKDV HQ XQ FDQDO $ORKD UDQXUDGR FRQ XQ Q~PHUR LQILQLWR GH XVXDULRV PXHVWUDQTXHVyORHOGHODVUDQXUDVHVWiQYDFtDV ¢&XiOHVHOWUiILFRRFDUJDWRWDO*HQHVWDUHG" 5DQXUD YDFtD HV HQ OD TXH QDGLH WUDQVPLWH YDFtD  W W W W W W W    QW ( H* LQWHQWRV /XLV%5DPtUH]GHO3LQR  .

6LVWHPDVGH&RPXQLFDFLyQGH'DWRV * N ÂH  * ELVVRQ.

N 3>@ 3 H* SUREDELOLGDGGHTXHQRWUDQVPLWHQDGLH.

3  H*  !*  ¢&XiQWRHVHOWUiILFRFXUVDGR 6.

GHODUHG" 6 *ÂH*  LQIUDXWLOL]DGR 6  VDWXUDGR 3>N @ ¢(QTXHFRQGLFLRQHVHVWiHVWH$/2+$VREUHFDUJDGRRLQIUDXWLOL]DGR" (VWiVDWXUDGR    * /XLV%5DPtUH]GHO3LQR  .

You're Reading a Free Preview

Descarga
scribd
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->